Page 1


índice O Desafio O Compromisso Perfil Organizacional O Grupo Cikel Governança, Compromissos e Engajamento Governança Estrutura de Governança Código de Conduta Representações da Alta Liderança em Iniciativas Externas Forma de Gestão e Indicadores de Desempenho Desempenho Ambiental Energia Áreas Protegidas Habitats protegidos ou restaurados

08 10 12 12 15 15 17 19 19 20 22 23 24 25


Impactos na biodiversidade Emissões de gases de efeito estufa e iniciativas para reduzir Desempenho Social Público Interno Perfil Funcional Responsabilidade pelo produto Desempenho Econômico DVA – Demonstrativo do Valor Adicionado Impacto de Mudanças Climáticas Balanço Social Anual 2010 Sumário GRI Informações corporativas

26 27 33 33 34 38 41 41 41 44 48 54


index The Challenge The commitment Organizational Profile The Cikel Group

08 10 12 12

Governance, Commitments and Engagement Governance Structure Governance Commitments Code of Conduct Representations of High Leadership in External Initiatives Form of Management and Performance Indicators Environmental Performance Energy Protected areas Protected or restored habitats

15 15 17 19 19 20 22 23 24 25


Impacts on biodiversity Greenhouse gases and initiatives for reducing emission Social Performance Internal staff Operational profile Responsibility for the product Economic performance VAS - Value Added Statement Climate Changing Impact Annual Social Accounting Summary GRI Corporate Information

26 27 33 33 34 38 41 41 41 44 48 54


8

O  desafio O recente crescimento, a taxas robustas, da economia mundial, vem exigindo da terra recursos naturais em escalas nunca vistas na história. Isso exige o desenvolvimento e adoção de práticas sustentáveis para o uso desses recursos a fim de garantir a evolução social, econômica e tecnológica sem prejudicar a sobrevivência das próximas gerações. Eis o grande desafio das empresas. No Grupo Cikel esta consciência é antiga. O conceito de sustentabilidade está presente há anos por meio das boas práticas no manejo de baixo impacto de florestas nativas. Na cadeia de suprimentos este desafio é ainda maior, pois precisamos fazer com que esta consciência evolua na mesma velocidade que a sociedade exige. Reforçando nosso direcionamento para negócios sustentáveis, é com muita satisfação que, além de abordar o setor de madeiras, incluímos no Relatório de Sustentabilidade da empresa o segmento de Prestação de Serviços.

The Challenge The recent growth of the world economy at high rates has been demanding natural resources from the land in proportions never seen in history. That requires sustainable practices to be developed and adopted in order to ensure social, economic and technological evolution without putting the survival of the next generations at risk. Here is the greatest challenge of enterprises. For Cikel Group this awareness goes back a long way. The concept of sustainability has been present for years in good practices for low-impact management of native forest. In the supply chain this challenge is even greater, because we need to make this awareness evolve at the same speed that society demands. Reinforcing our resolve towards sustainable business, it is with great satisfaction that we have included the section Rendering Of Services in the company’s Sustainability Report, in addition to the timber sector.


9

Reafirmamos também que nosso planejamento estratégico está focado na continuidade do empreendimento e, com esse intuito, em 2010 iniciamos a construção de uma nova forma de governança corporativa. Para assegurar o sucesso desse novo formato de gestão, a transição, que já começou, deve continuar de forma gradativa ao longo dos próximos anos com o Conselho de Administração do Grupo Cikel, formado pelos membros da família Pereira Dias e uma diretoria formada por executivos. Nossas decisões balizam nosso desejo de continuar construindo um empreendimento em que nossas partes interessadas possam reforçar a cada dia sua vontade de permanecer conosco. Queremos ampliar nossa atuação com sistemas produtivos sustentáveis, já que este é o caminho para garantir a sobrevivência e o crescimento dos negócios. Conselho de Administração Aparecida Calixto Pereira Denadai, Damião Pereira Dias, João Bosco Pereira, José Pereira Dias e Manoel Pereira Dias.

We also ensure that our strategic planning is focused on the continuity of the enterprise and with this goal we have begun to build a new way of corporate governance in 2010. In order to ensure the success of this new way of management, the transition, which has already begun, must continue gradually in the next years, with Cikel Group’s Administration Council, formed by members of the Pereira Dias family and a Board of Directors formed by executives. Our decisions direct our will to keep on building an enterprise whose stakeholders are able to constantly reinforce their wish of being with us. We want to broaden our operation with sustainable production systems, since this is the way to guarantee the survival and growth of business. Administration Council Aparecida Calixto Pereira Denadai, Damião Pereira Dias, João Bosco Pereira, José Pereira Dias e Manoel Pereira Dias.


10

O  compro Em 2010 assumimos com veemência nossos três pilares estratégicos; produtividade, crescimento e inovação, com a certeza que eles nos guiam para o âmbito da plena sustentabilidade dos negócios do Grupo Cikel. Mesmo com o árduo trabalho para superar o período de grandes desafios frente a uma retração de demandas a nível mundial, reflexo da crise dos anos anteriores, mantivemos o desenvolvimento sustentável como nossa prioridade absoluta. Como principais resultados dessa nova postura, em 2010, nossa dedicação ao cliente foi fortalecida e tornou possível ampliar nosso atendimento ao mercado interno, bem como dedicar esforços para desenvolvimento de tecnologia e inovação aos produtos e processos. Internamente a adoção de melhores práticas de governança corporativa também se destaca como fator relevante ao alinhamento estratégico dos negócios. Tivemos a formação do Conselho de Administração e a constituição da Direção Executiva, de forma a fortalecer a atuação estratégica do Grupo com vistas no crescimento sustentável dentro de um ambiente de compromisso com as gerações futuras. Esse novo formato de gestão, que está sendo implantado na empresa, é responsável por desenvolver o empreendimento com base nos valores que sempre nortearam as ações do Grupo Cikel. Pretendemos reforçar as iniciativas que valorizem o capital humano e o meio ambiente gerando vantagens competitivas aos nossos negócios.

The Commitment In 2010 we committed vehemently to our three strategic pillars: productivity, growth and innovation, confident that they would guide us towards the scope of total sustainability of the business of Cikel Group. Even with the hard work to overcome the period of great challenges due to demand recession at global level, consequence of the crisis of previous years, we maintained the sustainable development as our absolute priority. As main results of this new attitude, in 2010 our dedication to our customers was strengthened and we were able to extend our service to the internal market, as well as to increase efforts towards developing technology and innovation for our products and processes. Internally, the adoption of better practices of corporate governance is also featured as a relevant factor to the strategic alignment of business. The Administration Council was formed and the Board of Directors was created, reinforcing the Group’s strategic operation for sustainable growth within an environment of commitment to the future generations. This new form of management, which is being implanted in the company, is responsible for developing the enterprise based on values that always lead the actions of the Cikel Group. We intend to reinforce initiatives that value human capital and the environment, creating competitive advantages to our businesses.


11

misso De olho nas novas oportunidades globais de negócios sustentáveis, a Cikel iniciou a implementação de um projeto voluntário de Redução de Emissões pelo Desmatamento e Degradação (REDD), com objetivo de manter as florestas nativas em pé, evitando a emissão de gases de efeito estufa. Nesse sentido, a Cikel optou por atuar, também, com foco na mitigação da mudança climática, preservação da biodiversidade e geração de benefícios para as comunidades locais. O futuro nos mostra um horizonte promissor, por isso é momento de agradecer os acionistas, o staff executivo e, especialmente, os colaboradores pelos resultados conquistados em 2010. Afirmamos que estamos confiantes em dias cada vez melhores. Vamos manter uma gestão responsável, no sentido de garantir o crescimento dos negócios, aprimorar socialmente as áreas em que atuamos e aplicar os princípios da sustentabilidade em todos os nossos processos. Rosângela Thomaz Guimarães Diretora Executiva

With eyes set on new global opportunities for sustainable businesses, Cikel has started implementing a volunteer project of Reducing Emissions from Deforesting and Forest Degradation (REDD), aiming to maintain native forest, avoiding emission of greenhouse gases. To this effect, Cikel opted to act with focus on climate change mitigation, biodiversity preservation and benefit generation for local communities. The future shows us a promising horizon. Therefore it is now moment to thank the shareholders, the executive staff and, especially, the collaborators for the results achieved in 2010. We state that we are confident for better days. We shall keep up the responsible management, in order to guarantee business growth, to socially improve the fields in which we work and to apply the principles of sustainability in all our processes. Rosângela Thomaz Guimarães Executive Officer


12

Perfil Organizacional

Cerca de 210 mil hectares de florestas próprias.

228 mil hectares de florestas

O  Grupo  Cikel

arrendadas;

Cerca de 330 mil hectares de áreas manejadas possuem certificação florestal;

4.900 m³ de toras

beneficiadas por mês para a produção de serrados e aparelhados para exportação;

1.100 m³ de madeira serrada

processadas anualmente para produção de serrados e pisos para o mercado interno e externo.

About 210,000 hectatares of proprietary forest

228,000 hectares of leasehold forest;

About 330,000 hectares of managed areas have forest certification;

4,900 m³ in logs processed per

month to produce sawn timber and dressed lumber for exportation;

1,100 m³ in sawn timber

processed annually for production of sawn timber and flooring for the internal and external market.

Encontrar espaço no mercado, expandir os negócios, mantendo-se competitivo com excelência na prestação de serviços industriais, além de inovar em tecnologias e soluções sustentáveis para floresta, é o que move o Grupo Cikel. Desde sua fundação, em 1977, pelo Sr. Nelson Pereira Dias, a Cikel tem atuado no segmento florestal de forma visionária, pois se antecipa aos fatos socioeconômicos e políticos, assegurando sua permanência no mercado. A ampliação dos negócios, em 1984, na área de prestação de serviços industriais especializados de apoio industrial, foi mais uma das atitudes empreendedoras da família Pereira Dias. Atuar de forma estratégica nos segmentos florestal e serviços especializados de apoio industrial permite ao Grupo Cikel a constante melhoria de sua capacidade de inovação, gestão e produtividade. O modelo de gestão baseado no Balance Scorecard(BSC), possibilita a Cikel destacar suas diretrizes estratégicas, dentro das perspectivas de finanças, clientes e mercado, processos sustentáveis e aprendizado. Dessa forma, a empresa acredita que é possível melhorar sua atuação junto aos trabalhadores diretos, melhorar a qualidade dos produtos e serviços, bem como expandir sua atuação no mercado. A gestão corporativa da empresa tem sua sede em Curitiba, estado do Paraná, atendendo todas as unidades do Grupo nas áreas de gestão de pessoas, marketing, tecnologia da informação, jurídico, controladoria, exportação, suprimentos, qualidade e projetos, através do Centro de Serviços Compartilhados (CSC). Em Curitiba também está o departamento financeiro corporativo.

The Cikel Group Finding room in the market, expanding business, keeping itself competive with excellence in rendering of industrial services, in addition to innovating technology and sustainable solutions for the forest, that is what moves the Cikel Group. Since its fundation, in 1977, by Mr. Nelson Pereira Dias, Cikel has been woorking in the forest industry in a visionary way, because it forestalls to the socioeconomic and political facts, ensuring its permanence in the market. The expansion of business, in 1984, in the rendering of specialized industrial services for indutrial support was one more of the enterprising acts of the Pereira Dias family. Acting strategically in the forest and specialized services for industrial support fields allows the Cikel Group to constantly improve its innovation, management and productivity capability. The management model, based on the Balance Scorecard (BSC), enables Cikel to highlight its strategic guidelines, within financial, client and market perspectives, sustainable processes and learning. So being, the company believes that it is possible to improve its action to the direct workers, to improve the quality of products and services, as well as to expand its market share. The corporative management of the company has its headquarters in Curitiba, Paraná state. The Center of Shared Services (CSC) serves all units of the group in the fields of: people management, marketing, information technology, law department, controllership, quality, and projects. In Curitiba also is the corporative financial department.


Organizational Profile

As unidades que atuam com a prestação de serviços industriais especializados de apoio industrial estão localizadas em Minas Gerais e Rio de Janeiro, e contam com escritório comercial em São Paulo. Trabalham diretamente na planta industrial dos clientes, oferecendo soluções em logística interna e na manutenção e conservação industrial. As atividades que se destacam no conceito de logística interna estão vinculadas aos processos de recebimento de matéria-prima, transporte e movimentação de materiais e produtos acabados. A Cikel também se destaca pela qualidade dos serviços de embalagem, armazenagem e expedição, certificados pela ISO9001. A área de manutenção e conservação industrial contempla as atividades de manutenção de linhas férreas na planta industrial, montagem e manutenção de estruturas metálicas, jateamento e pintura industrial e construção civil para obras novas e reparos. O negócio florestal tem suas bases, de exploração e beneficiamento de madeira, localizadas no Estado do Pará, nas cidades de Ananindeua, Paragominas e Portel. Os produtos comercializados pela Cikel são toras para o mercado interno; madeira serrada, utilizadas em estruturas residenciais e comerciais no mercado interno e externo; e, também, os pisos de madeira para ambientes internos, com oferta de piso maciço e piso engenheirado, além de pisos de madeira para ambientes externos, como os Deckings e os Garden Tiles. O know-how na prestação de serviços e na oferta de produtos de madeira de alta qualidade revela que, além da postura ética e responsável da Cikel junto aos seus trabalhadores, promovendo sustentabilidade ambiental e desenvolvimento social, a empresa preza pela parceria sólida e transparente com seus clientes.

The units that render specialized industrial services for industrial support are located in Minas Gerais and Rio de Janeiro states and are supported by a commercial Office in São Paulo. They work directly on the industrial plants of customers, offering solutions in terms of internal logistics and industrial maintenance and conservation. The activities that stand out in the concept of internal logistics are bond to receiving processes of raw material, transport and moving of finished materials and products. Cikel also stands out for its quality in rendering services of packaging, storing and shipment, certified by ISO9001. The fields of industrial maintenance and conservation contemplate the activity of maintaining railroads in the industrial plant, assembling and maintaining metallic structures, blasting and industrial painting and civil construction for new projects and repair. The forest business has its basis, of timber exploration and processing, located in Pará state, in the cities of Ananindeua, Paragominas and Portel. The products traded by Cikel are logs for the internal market; sawn timber, used in residential or commercial structures for internal and external markets; and also wood flooring for internal areas, solid flooring and engineered flooring, in addition to wood flooring for external areas, such as deckings and garden tiles. The know-how in rendering services and the high quality wood products offered reveal that, in addition to its ethical and responsible attitude towards its employees, promoting ecological sustainability and social development, the company values the solid and transparent partnership with its customers.

13

O Grupo Cikel é reconhecido pelo:

Prêmio Excelência Ambiental 2010 da International Woods Products Association (IWPA)

Prêmio Proteção Brasil 2010 – Segurança do Trabalho

na categoria “Gerenciamento de Riscos”

Mérito Exportação pela

Revista da Madeira, desde 2005

The Cikel Group is acknowledged for:

Award for Environmental Excellence 2010 from International

Wood Products Association (IWPA) Award Protection Brazil 2010 – Occupational Safety and Health in the category “Risk Management”

Exportation Merit from Madeira magazine since 2005


14

Governança, Compromissos e Engajamento

Para estabelecer o diálogo com as partes interessadas, a Cikel levou em consideração a importância em ouvir o público interno e externo da organização.

To establish the dialog with the interested parties, Cikel has taken into consideration the importance of listening to internal and external public of the organization.


Governance, Commitments and Engagement

Governança O principal objetivo do Grupo Cikel em realizar o processo de engajamento com seus stakeholders é a possibilidade de fortalecer a interação entre as partes, bem como identificar os pontos comuns de interesse dos diferentes públicos sobre a atuação da empresa. Para estabelecer o diálogo com as partes interessadas, a Cikel levou em consideração a importância em ouvir o público interno e externo da organização. Na sequência atentou para as seguintes premissas: Quais interesses das partes afetam a empresa? Quais são os conflitos entre a necessidade da parte interessada da empresa? Como são gerenciados tais conflitos? Quem na empresa é responsável pelo relacionamento? Quais são as políticas que orientam este relacionamento?

15

Para  estabelecer  o  diálogo   com  as  partes   interessadas,  a   Cikel  levou  em   consideração  a   importância  em   ouvir  o  público   interno  e  externo  da  organização.

A consulta aos stakeholders teve seu início em 2009, e a cada ano tem sido ampliada no sentido de aproximar a Cikel às suas partes interessadas e melhorar o relacionamento com as mesmas. Assim, neste relatório está considerada a definição de aspectos materiais levantados nas consultas realizadas na Cikel Brasil Verde Madeiras e na Cikel Logística e Serviços.

Governança The main objective of Cikel Group in performing the engagement process with its stakeholders is the possibility of strengthening the interaction between the two parts, as well as identifying common threads of interest from different customers on the company’s operations. To establish the dialog with the interested parties, Cikel has taken into consideration the importance of listening to internal and external public of the organization. After that, it focused on the following premises: Which interests of the parties affect the company? Which are the conflicts between parties’ and company’s needs? How are those conflicts managed? Who in the company is responsible for the relationship? Which are policies that guide this relationship? The consultation with stakeholders started in 2009 and it has been enlarged each year in order to make Cikel closer to its interested parties and improve the relationship with them. Therefore, in this report, the definition of material aspects gathered in the consultations performed along with Cikel Brasil Verde Madeiras and Cikel Logistics and Services is considered.

To  establish   the  dialog  with   the  interested   parties,  Cikel   has  taken  into   consideration   the  importance   of  listening   to  internal   and  external   public  of  the   organization.


16

Governança, Compromissos e Engajamento

Perfil Organizacional Relação das principais partes interessadas identificadas pela Diretoria do Grupo Cikel.

GRUPO CIKEL | CIKEL GROUP

Relation of the main interested parties identified by the Board of Directors of Cikel Group. Governo e Sociedade Government and Society ONGs NGOs Público Interno Internal Public Fornecedores Suppliers Clientes Customers Consumidores Consumers Comunidade Community

Após a realização do engajamento, os dados foram analisados e os seguintes aspectos foram definidos como essenciais para serem contemplados neste Relatório de Sustentabilidade: After carrying out the engagement, the data were analyzed and the following aspects were defined as essential to be contemplated in this Sustainability Report: Desempenho ambiental Environmental Performance Biodiversidade Biodiversity Conformidade legal- investimento em proteção ambiental Saúde e segurança do trabalhador Law compliance - investiment in environmental protection Health and safety for workers Training and education

Na Cikel Brasil Verde Madeiras o engajamento foi realizado em novembro de 2009, nas unidades da empresa localizadas nos municípios de Paragominas (unidade Rio Capim) e Portel (unidade Pacajá), além de considerar as partes interessadas localizadas nos municípios de Goianésia do Pará, Baião e Belém. O processo contou com representantes do governo, sociedade, terceiro setor, meio ambiente, comuniGoverno e Sociedade dades do entorno das fazendas e público interno. Na Cikel Logística e Serviços o trabalho ocorreu em março de 2011 e foram envolvidos os seguintes públicos para a identificação dos aspectos: diretoria e alta administração da empresa, além de representantes dos trabalhadores. No total foram ouvidas 58 pessoas.

In Cikel Brasil Verde Madeiras the engagement was performed in november 2009 in the company’s units located in the municipalities of Paragominas (Rio Capim unit) and Portel (Pacajá unit), in addition to considering the interested parties located in the cities of Goianésia do Pará, Baião and Belém. The process was supported by representatives from the government, society, tertiary sector, environment, communities around the properties and the internal members. In Cikel Logistics and Services the consultation occurred in March 2011 and the following people were involved for identification of aspects: board of directors and high level administration, in addition to workers’ representatives. Altogether, 58 persons were listened.


Governance, Commitments and Engagement

Estrutura de Governança A nova estrutura de governança do Grupo Cikel manteve suas instâncias corporativas. O grande desafio assumido em 2010 foi o processo de transição da gestão, com início estabelecido para 2011. Nos próximos anos, os membros da família fundadora do grupo passarão a integrar o Conselho de Administração. Já a Diretoria será assumida por executivos. O Conselho de Administração tem como responsabilidades determinar estratégias visando proteger e valorizar o patrimônio da empresa, bem como maximizar o retorno do investimento, gerir o corpo diretivo do grupo e monitorar as ações dos gestores. Além disso, cabe ao Conselho assegurar uma visão compartilhada sobre o futuro, estabelecer modelo claro de sucessão, aumentar o valor da empresa, facilitar seu acesso ao capital e contribuir para sua perenidade. A Diretoria Executiva, por sua vez, é responsável pela relação entre o Conselho e os gestores. Executa e monitora o resultado das diretrizes do Conselho, por meio de metas estabelecidas e ações operacionais junto às gerências das unidades de negócios e as gerências das áreas corporativas. Este Relatório de Sustentabilidade além de retratar a atuação da Cikel no segmento florestal, aborda também o segmento de prestação de serviços especializados no sudeste do país. A área de serviços possui gerências próprias e, assim como o segmento de madeiras, tem sua administração vinculada às unidades corporativas de gestão como Centro de Serviços Compartilhados, Financeiro e Responsabilidade Socioambiental.

Governance Structure The new governance structure of Cikel Group kept its corporate instances. The great challenge taken in 2010 was the process of management transition, with its beginning set for 2011. In the following years, the members of the group’s founding family will integrate the Administration Council full time, whereas the Executive Office will be taken up by executives. The Administration Council is responsible for determining strategies that aim to protect and value the company’s assets, as well as maximizing the return on investment, managing the group’s directive board and monitoring the managers’ actions. Moreover, the Council is responsible for ensuring a shared vision about the future, establishing a clear model of succession, increasing the company’s value, facilitating its access to the capital and contributing to its continuity. The Executive Office, for its part, is responsible for the relation between the Council and the managers. It executes and monitors the results of actions defined by the Council, by means of goals established and operational actions together with the unit management offices and the corporate management offices. This Sustainability Report, in addition to depicting Cikel’s action in the forest field, also addresses the segment of rendering specialized services in Southwest Brazil. The services field has its own management offices and, as the timber industry, its administration is linked to the corporate management units, such as the Shared Services Center, Financial Center and Socio-envionmental Responsibility Center.

Compromissos da Governança

17

Governance Commitments

Grupo Cikel Visão

Ser referência mundial em produtos e serviços sustentáveis

Missão

Transformar recursos naturais e humanos em riquezas sustentáveis

CKBV

Missão

Valorizar o uso da floresta

CKLS

Missão

Construir elos para a geração de riqueza

Cikel Group Vision To be a world reference in sustainable services and products Mission Transforming natural and human resources and products

CKBV Mission Appraising the forest

CKLS Mission Building links for wealth generation


18

Governança, Compromissos e Engajamento

Visando contribuir para um mercado mais inclusivo e igualitário, o Grupo Cikel, desde 2009, é signatário do Pacto Global, fortalecendo a execução de negócios pautados em valores internacionalmente aceitos na área dos direitos humanos, relações de trabalho, meio ambiente e combate à corrupção.

Suas unidades de negócios e gestão estão assim distribuídas: Its business and management units are distributed as follows:

Unidade Pacajá (Manejo Florestal e Madeira Serrada) - Portel/PA Pacajá Unit - ( Forest Management and Sawn Timber) Portel/PA

Unidade Rio Capim (Manejo Florestal) Paragominas/PA Rio Capim Unit (Forest Management) - Paragominas/PA

Unidade de Pisos Sólidos e Engenheirados – Ananindeua/PA Plant of Solid and Engineered Flooring – Ananindeua/PA

Diretoria de Responsabilidade Socioambiental Social-Environmental Responsibility Management

Unidade Cikel Logística e Serviços – Ouro Branco/MG Cikel Logistics and Services Unit – Ouro Branco/MG

In order to contribute for a more including and egalitarian market, the Cikel Group is signatory to the Global Compact since 2009, strengthening business transactions guided by values internationally accepted in the fields of human rights, work relations, environment, and fight against corruption.

Unidade Cikel Logística e Serviços – Volta Redonda e Rio de Janeiro/RJ Cikel Logistics and Services Unit – Volta Redonda e Rio de Janeiro/RJ

Cikel Logística e Serviços – Escritório Comercial – São Paulo/SP Cikel Logistics and Services - Commercial Office – São Paulo/SP

Escritório Administrativo – Curitiba/PR Administrative Headquarters – Curitiba/PR

Centro de Serviços Compartilhados e Departamento Financeiro – Curitiba/PR Center of Shared Services and Financial Department – Curitiba/PR


Governance, Commitments and Engagement

Código de Conduta Em 2010 o Código de Conduta da Cikel passou por uma revisão, tornando-o mais abrangente em relação à postura da empresa quanto a práticas trabalhistas e relacionamento com os stakeholders. Foram implantados canais de ética para que os colaboradores possam interagir com a empresa em caso de dúvidas sobre o código e/ou denunciar práticas que desrespeitem a conduta estabelecida. Os colaboradores ainda recebem treinamentos sobre o conteúdo e uso do Código, prezando por práticas cidadãs e de anticorrupção.

Representações da Alta Liderança em Iniciativas Externas O Grupo Cikel é bastante influente em meios públicos, privados e não governamentais que envolvem discussões com foco no uso responsável de recursos florestais. A Cikel, através de seus profissionais, representa os interesses do segmento em diversas organizações: Vice-presidência da Associação das Indústrias Exportadoras de Madeiras - AIMEX Vice-presidência da Associação dos Produtores Florestais Certificados na Amazônia – PFCA Integra o Conselho Consultivo do Instituto do Homem e Meio Ambiente – IMAZON Integra o Conselho Consultivo do Instituto Floresta Tropical – IFT Integra o Conselho de Administração da Associação Nacional dos Produtores de Piso de Madeira – ANPM Integra a Comissão de Transparência do Fórum Amazônia Sustentável

Code of Conduct In 2010 Cikel’s Code of Conduct was reviewed, becoming more comprehensive in relation to the company’s attitude regarding labor practices and relationship with stakeholders. Ethics channels were implemented in order to enable collaborators to interact with the company in case of doubt about the code and/or to denounce any actions that disrespect the established conduct. Collaborators also receive training about the content and usage of the Code, emphasizing citizenship and anti-corruption practices.

Representations of High Leadership in External Initiatives Cikel Group is highly influential among public, private and non-governmental organs which are involved in discussions about the responsible usage of forest resources. Cikel, through its professionals, represents the sector in various organizations: Vice-presidency of Association of Timber Exporting Industries - AIMEX Vice-presidency of Association of Certified Amazon Forest Products – PFCA Integrates the Advisory Council of Man and Environment Institute – IMAZON Integrates the Advisory Council of Institute Tropical Forest – IFT Integrates the Administrative Council of the National Association of Timber Flooring Producers – ANPM Integrates the Commission of Transparency of Forum Sustainable Amazon

19

Criado pela Fundação Abrinq, o Programa Empresa Amiga da Criança mobiliza instituições para atuação social em benefício de crianças e adolescentes no Brasil. Em 2010, o Grupo Cikel recebeu o título “Empresa Amiga da Criança” pelo trabalho que desenvolve nas Escolas Nelson Pereira Dias, que mantém em parceria com as prefeituras de Portel e Goianésia do Pará, pelo Programa de Inclusão Digital e pelo Programa Igarité realizado em 2009 para jovens, junto ao Instituto Criança Vida. Created by Abrinq Foundation, the Program Child Friendly Company mobilizes institutions for social actions in benefit of children and teenagers in Brazil. In 2010, Cikel Group received the title “Child Friendly Company” due to the work developed in Nelson Pereira Dias schools that are maintained in partnership with Portel and Goianésia do Pará city halls; the Digital Inclusion program and Igarité program carried out in 2009 for youngsters along with Criança Vida Institute.


20

Governança, Compromissos e Engajamento

Política Integrada Integrated Policy “Buscar constante evolução social, econômica, ambiental, legal, e ética da organização, vivenciada pelos colaboradores e reconhecida pelos clientes e sociedade.” “To search for the constant social, economic, environmental, legal, and ethical evolution of the organization, with is experienced by collaborators and reconized by clients and the society.”

Forma de Gestão e Indicadores de Desempenho O Grupo Cikel está sempre atento às necessidades de evolução, melhorias de gestão e atendimento das demandas do mercado, buscando por meio do seu corpo diretivo, gerencial e operacional se antecipar a todas as exigências que possam impactar diretamente no dia a dia dos negócios, relacionamentos e interesses da empresa. O Grupo assegura que o equilíbrio econômico, social e ambiental deve sempre orientar a condução das atividades. Para concretizar as metas, a Cikel parte do Planejamento Estratégico que tem a função de direcionar todas as atividades do grupo para três macros objetivos: produtividade, crescimento e inovação. Estes objetivos são desdobrados para compor o plano de metas das áreas de gestão da empresa, o qual é mensalmente avaliado quanto ao seu cumprimento e alcance dos objetivos estratégicos.

Administrar os Recursos Naturais: Atuar de forma sustentável, privilegiando o uso de recursos naturais disponíveis e a prevenção da poluição. Administrate natural resources to act in a sustainable way, favoring the use of avaliable natural resources and prevention against pollution.

Promover a Cultura e a Capacitação: Promover continuamente a profissionalização, satisfação e bem-estar dos trabalhadores. Promote culture and training: To promote professionalization, satisfaction and well-being of employees on an ongoing basis.

Trabalhar de Forma Integrada com a Comunidade: Interagir com as comunidades locais buscando o desenvolvimento social, educacional e econômico da população. Work in integrated way with the community: To interact with local communities, aiming at social, educational and economic development of the population.

Form of Management and Performance Indicators Cikel Group is always attentive to evolution needs, management improvements and market demands. So being, through its directive, managing and operational board, the group seeks to forestall to all demands that may have direct impact on the company’s day-to-day business, relationships and interests. The group ensures that the economic, social and environmental balance shall always guide its activities. In order to achieve goals, Cikel performs Strategic Planning, which has the function of directing all the group’s activities to three macro-objectives: productivity, growth and innovation. These objectives are unfolded to compose the goal setting of the management areas of the company, which is monthly examined to check compliance and achievement of strategic goals.


Governance, Commitments and Engagement

A política integrada visa a constante evolução social, econômica, ambiental, legal e ética da organização. Em seus princípios estão ligados à administração de recursos naturais, promoção da cultura e capacitação, trabalho integrado com a comunidade, segurança e saúde do colaborador, respeito às normas, melhoria contínua, responsabilidade e dever. Esta forma de gestão integrada é constantemente verificada em sua eficiência e eficácia. Prova disso é a Certificação Florestal, FSC ® – Forest Stewardship council® , que avalia a empresa em relação à transparência e ética com que são cumpridas as exigências de manejo das florestas de forma ambientalmente correta, socialmente justa e economicamente viável. O Grupo também conta com a ISO 9001 que certifica as atividades de embalagem, armazenagem e expedição no segmento de Logística e Serviços. Seguindo essa orientação estratégica, o Grupo Cikel apresenta os indicadores de desempenho ambiental, social e econômico que corroboram para a integração das áreas de negócio e acompanhamento das metas.

The integrated policy aims at constant social, economic, environmental, legal, and ethical evolution of the organization. Its principles are connected to natural resources administration, promotion of culture and training, integrated work with the community, safety and health for collaborators, respect to rules, continuous improvement, responsibility and duty. This form of integrated management is constantly verified regarding its efficiency and effectiveness. Evidence of that is the Forest Certification from the FSC ® – Forest Stewardship council® , which evaluates the company regarding the transparency and ethics with which forest management demands are met: environmentally correct, socially fair and economically viable. The Group also counts with ISO 9001 certification for the activities of packaging, storing and expedition in the Logistics and Services segment. Following this strategic orientation, Cikel Group presents the indicators of environmental, social and economic performance which support the integration of areas of business and goal monitoring.

21

Melhoria Contínua: Planejar e monitorar as ações de melhoria continua do sistema de gestão integrada. Continuous improvement: To plan and monitor continuous improvements to the integrated management system.

Respeito às Normas: Atuar de forma responsável com respeito aos requisitos legais e outros requisitos aplicáveis às nossas atividades. Respect to standard: To act with responsibility regarding legal requirements and other requirements applied to the business.

Segurança e Saúde do Trabalhador: Prevenir e minimizar os riscos relacionados à saúde e segurança dos colaboradores, melhorando o desempenho do SESMT. Health and safety of collaborators: To prevent and minimize risks to health and safety of collaborators, improving SESMT performance.

Responsabilidade e Dever: É responsabilidade e dever da empresa divulgar e difundir todas as ações do sistema de gestão integrada a todas as partes interessadas. Responsability And Obligation: The company is responsable for and obliged to disclose and disseminate all actions of the integrated management system to all stakeholders.


22

Desempenho Ambiental

A empresa trabalha com o intuito de diminuir ao máximo o consumo, além de substituir combustíveis fósseis por renováveis.

The company works aiming to decrease the level of consumption to the lowest, in addition to replacing fossil fuels by renewable fuels.


Environmental Performance

Desempenho   Ambiental A sociedade, atualmente, tem uma consciência muito maior de desenvolvimento sustentável do que tinha há algumas décadas. Felizmente, o mundo está caminhando a passos largos para dar respostas cada vez mais rápidas a este enorme desafio. Porém o caminho é longo e cheio de desvios, fazendo com que muitas empresas desistam e voltem a conduzir seus negócios da maneira tradicional. O Grupo Cikel, empresa com elevado compromisso ambiental, a cada ano busca melhorar seus processos para o âmbito da sustentabilidade. A expectativa é que os negócios tenham resultados significativos oriundos de produtos e serviços ambientalmente corretos, não explorados até muito recentemente. As novas perspectivas globais permitem e incentivam o desenvolvimento de produtos e serviços novos, incorporando os conceitos de sustentabilidade.

Energia Utilizar recursos de forma consciente é presença constante no Grupo Cikel. A empresa trabalha com o intuito de diminuir ao máximo o consumo, além de substituir combustíveis fósseis por renováveis.

Em 2010, foram utilizadas as seguintes fontes de geração de energia: In 2010, the following sources of energy generation were used:

Fonte de energia Source of energy

Nowadays, society has higher awareness of sustainable development than it had some decades ago. Fortunately the world is becoming gradually able to answer even faster to this huge challenge. However, the pathway is long and tortuous, causing many companies to give up and resume doing business the traditional way. Cikel Group, company with high environmental commitment, tries each year to improve its processes to the scope of sustainability. The expectation is that businesses have significative results from products and services that are environmentally correct, not explored until quite recently. The new global perspectives allow and encourage the development of new products and services, incorporating the concepts of sustainability.

Energy Using resources consciously is common practice in Cikel Group. The company works aiming to decrease the level of consumption to the lowest, in addition to replacing fossil fuels by renewable fuels.

Grupo Cikel Cikel Group Volume

Diesel (litros) Diesel (liters)

251.825

Valor Value (R$) 450.020

Combustível fóssil Fossil fuel used by consumido por gera- generators for electric dores para a geração energy de energia elétrica. Biomassa consumida (m³)

Consumed biomass (m³)

Resíduos de madeiras como pó de serra, sobras e aparas geradas no processo de beneficiamento da madeira e que podem ser consumidas pela caldeira para a geração de energia elétrica. Biomassa vendida (m³) Sold biomass (m³)

Environmental Performance

23

Biomassa vendida para outras empresas que utilizam como fonte de geração de energia (pó para fabricação de briquete, lenha). Eletricidade (kWh)

Electricity (kWh)

-

-

Residues of timber, such as sawdust, leftovers and chips from timber processing that can be consumed by kilns for electric energy generation.

17.896

278.080

Biomass sold to other companies which use it as source of energy generation (sawdust for production of briquettes, logs)

4.638.176 1.501.733

Energy supplied by Energia fornecida pelas Centrais Elétri- Electrical Company of cas do Pará – REDE Pará – REDE CELPA CELPA


24

Desempenho Ambiental

Áreas protegidas Compromisso até 2012 Mensurar a biomassa utilizada nas operações da empresa na geração de energia renovável.

Commitment until 2012 Mesure biomass used in company operations for generation of renewable energy.

Em consulta realizada na base de dados do Micro Zoneamento Econômico Ecológico do Estado do Pará, verificou-se que as áreas manejadas pelo Grupo Cikel não estão localizadas em unidades de conservação, seja de uso sustentável ou proteção integral. Nas áreas de manejo, que possuem a certificação florestal, é realizado estudo de biomas e biodiversidade para que sejam identificados habitats com atributos de alto valor de conservação, conhecidos como Floresta de Alto Valor de Conservação (FAVC). Nas unidades de logística e serviços, as atividades são desenvolvidas nas plantas dos clientes que se localizam em centro urbanos. De acordo com os critérios da certificação para a classificação das áreas de alto valor de conservação, é possível identificar:

Protected areas After consulting the database of the Economic-Environemental Microzoning of Pará state, it was verified that the areas managed by the Cikel Group are not located in conservation units, neither for sustainable usage nor full protection. In the areas of management that have forest certification, studies of biomes and biodiversity are carried out to identify habitats with high conservation value, known as High Conservation Value Forest (HCVF). In the logistics and service units, the activities are developed at the customers’ plants, which are located in urban centers. In 2010 the discussion began about implementing a fixed basis for the development of some activities in a land to be leased from the city hall of Ouro Branco, Minas Gerais state.

Fazenda Rio Capim - FAVC 1 Área 750 (ha)

Apesar da área apresentar o mesmo tipo florestal do restante da unidade de manejo, Floresta Ombrófila Densa, parece ter ocorrido neste local um fenômeno denominado tempestade vertical. Este tipo de fenômeno é comum na Amazônia e provoca danos pontuais na floresta. A presença de árvores caídas antigas e mais recentes sugerem que possa ter ocorrido um fenômeno mais intenso no passado, que propiciou a abertura de várias clareiras e tornou a área mais susceptível à queda de outras árvores, num efeito em cascata. Rio Capim Estate - HCVF 1 - Area 750 (ha) Even though the area has the same type of forest than the rest of the management unit, Dense Ombrophile Forest, it seems that a phenomenon called vertical storm might have happened in this site. This kind of phenomenon is common in Amazon region and causes occasional damages in the forest. The presence of fallen trees, both old and new, suggests that a more intense phenomenon might have happened in the past and caused the formation of various glades, making other trees susceptible to falling in the area, in a domino effect.


Environmental Performance Fazenda Rio Capim - FAVC 2 e 3 Área 3.415,56 (ha)

Estas duas áreas de Alto Valor de Conservação serão tratadas em conjunto por se caracterizarem pelo mesmo tipo de ecossistema. Trata-se de lagos de várzea e habitats no qual a topografia e o solo de alguns pontos da margem do rio Capim propiciam o surgimento de lagoas marginais, conectados ao rio, aparentemente mesmo na época de seca. Estes ambientes possuem grande importância na ciclagem de nutrientes com alta produtividade primária. Rio Capim Estate- HCVF 2 and 3 - Area 3.415,56 (ha) These two High Conservation Value areas will be addressed together, because they have the same kind of ecosystem. They have floodplain lakes and habitats in which the topography and the soil of some points in the bank of the Capim river have resulted in secondary lagoons, connected to the river, apparently even during the drought. These environments have major importance in the cycle of nutrients, with high primary productivity.

Fazenda Jutaituba - FAVC 1 Área 1.20.20 (ha)

A área possui vegetação classificada como Floresta Ombrófila Densa periodicamente alagada. Este tipo de ambiente é conhecido pela literatura por abrigar a maior diversidade de anfíbios dentre os ambientes Amazônicos. Ou seja, a preservação desta área seria propícia a conservação de várias espécies de anfíbios anuros, além dos esperados, pois o ambiente continuará a oferecer abrigo e recursos para a permanência deste grupo faunístico.

Jutaituba Estate- HCVF 1 - Area 1.20.20 (ha) The vegetation in this area is classified as Dense Ombrophile Forest, periodically flooded. This kind of environment is known by literature to host the biggest diversity of amphibians among all amazon environments. This means that the preservation of this area would be helpful to the conservation of many species of Anuran amphibians, not only the expected ones, because the environment will continue to offer shelter and resources for the permanence of this fauna group.

Habitats protegidos ou restaurados Nas áreas de manejo da Cikel, as partes identificadas como Áreas de Preservação Permanente (APP) são mantidas em estado de conservação, atendendo às leis ambientais. Dessa forma, toda a malha hidrográfica é mapeada com a definição da área em torno dos cursos d´água, raio que depende da largura do curso. Além destas áreas, uma porcentagem de 5% é destinada para a preservação, não ocorrendo nenhuma atividade de manejo, obedecendo aos critérios da certificação florestal FSC, Forest Stewardship Council. Área de Preservação Permanente (ha)

Área 5% FSC (ha)

19.010,05

15.981,81

Protected or restored habitats In the management areas of Cikel, the land identified as Permanent Preservation Areas (PPA) is kept in conservation state, observing environmental laws. So being, all the drainage net is mapped with the definition of the area around the water courses; its radius depends on the width of the river course, where forest management activities are not executed. In addition to these management areas, 5% is preserved and there is no forest activity, in accordance to the directive of forest certification FSC, Forest Stewardship Council.

Permanent Preservation Area (ha)

Area 5% FSC (ha)

19.010,05

15.981,81

25


26

Desempenho Ambiental

Impactos na biodiversidade Compromisso até 2012

O manejo florestal com exploração de impacto reduzido adotado pela Cikel minimiza possíveis impactos ambientais. Todas as ações que causem impactos diretos e indiretos ao meio ambiente, nas atividades de manejo florestal, são monitoradas. As atividades identificadas como de maior impacto são tratadas por equipes treinadas, que empregam metodologias de gestão de recursos naturais de forma a minimizar os impactos e custos. Também são empregadas técnicas de exploração de impacto reduzido de forma a minimizar os danos causados às espécies remanescentes, ao solo, a hidrografia, o ar e a fauna.

Intensificar os estudos na área de florestas em prol da biodiversidade.

Desta forma, todas as atividades florestais possuem diferentes etapas denominadas de processos, que são avaliados em relação aos riscos e impactos. Medidas compensatórias são prontamente conduzidas a fim de minimizar ao máximo a presença da Cikel na floresta. As atividades desenvolvidas pela Cikel Logística e Serviços apresentam como principal aspecto ambiental a geração de resíduos sólidos, não evidenciando diretamente a geração de efluentes líquidos e possíveis impactos na biodiversidade. A gestão dos prováveis impactos na biodiversidade nas unidades de manejo florestal ocorrem por meio de um Programa de Monitoramento da Fauna e da Flora, com medições da flora e avistamento da fauna com um ano antes da exploração. Além disso, também são feitas medições com um, três e cinco anos após a exploração.

Estabelecer novas parcerias para estudos e monitoramentos em fauna e flora.

Commitment until 2012 Boost studies of forestry in favor of biodiversity. Establish new partnerships for studies and monitoring of flora and fauna.

Impacts on biodiversity The forest management with reduced impact logging adopted by Cikel lowers the potential environmental impacts. All actions that cause direct and indirect impacts on the environment, in forest managing activities, are monitored. The activities identified and monitored due to higher impact are treated by trained teams, which employ methodologies of natural resources management in order to lessen the impacts and costs. Techniques of reduced impact logging are also adopted in order to reduce the damage caused to the remaining species, soil, hydrography, air and fauna. This way, all forest activities have different stages called processes, which are evaluated concerning risks and impacts. Compensatory measures are immediately carried out so to lessen Cikel’s presence in the forest to a minimum. The main environmental aspect of the activities developed by Cikel Logistics and Services is the production of solid waste with no evidence of direct production of effluents and possible impacts on biodiversity. To manage possible impacts on biodiversity, the forest management units have Fauna and Flora Monitoring Programs, measuring the flora and sighting wildlife one year prior to exploration. Furthermore, measuring is also made after one, three and five years of exploration.


Environmental Performance

Emissões de gases de efeito estufa e iniciativas para reduzir

27

Compromisso 2012

Para realização do Inventário de Emissões do Grupo Cikel foi estabelecido uma parceira com a empresa 33 Asset Management para quantificar as emissões das atividades desenvolvidas e os estoques de carbono conservados na manutenção da floresta em pé. Os estudos estão sendo realizados e as quantificações serão feitas em 2011. O desenvolvimento de atividades que mantém a floresta, garantindo a sua permanência e evitando práticas de desmatamento, arquivam consideráveis estoques de carbono que deixam de ser emitidos para a atmosfera, além da absorção do gás carbônico pelo processo de crescimento e regeneração da floresta.

Inventariar as emissões de carbono no Complexo Rio Capim.

Greenhouse gases and initiatives for reducing emission To make the Emissions Inventory of Cikel Group, a partnership was established with the company 33 Asset Management to quantify emissions from activities and carbon storage conserved in maintaining the forest standing. Studies are being carried out and quantifications are going to be performed in 2011. The development of activities that maintain the forest, which guarantee its permanence and avoid deforesting, conserve considerable amounts of carbon storage that are not emitted into the atmosphere. Moreover, these activities promote the absorption of carbonic gas through the process of forest growth and regeneration.

Commitment 2012 Make an inventory of carbon emissions at Rio Capim Complex.

O manejo florestal sustentável desenvolvido pela Cikel, nas fazendas do complexo Rio Capim, mantém 199.168,83 ha de floresta preservados que contribuem para mitigação da mudança climática. The sustainable forest management developed by Cikel, in Rio Capim estate complex, maintain approximately 199,168.83 ha of preserved forest which contribute to mitigation in climate changing.


28

Desempenho Ambiental

Peso total de resíduos, por tipo e mÊtodo de disposição A Cikel possui um Programa de Gestão de Resíduos Sólidos (PGRS) visando o gerenciamento e destinação adequada dos resíduos gerados, aplicados aos setores produtivos. Para o bom desempenho do programa são desenvolvidas algumas açþes como: t4FOTJCJMJ[BÎ�P"NCJFOUBMSFBMJ[BEBBUSBW�TEFQBMFTUSBTFUSFJOBNFOUPT

Total residue weight, by type and method of disposal Cikel has a Solid Waste Management Program (SWMP), which aims at management and adequate destination of the waste produced. It also proposes organization improvement and cleaning of various environments, applied at first moment in the productive sectors. For a good program performance, some action are developed, as follows: t&OWJSPONFOUBMTFOTJUJ[BUJPOCZNFBOTPGMFDUVSFTBOEUSBJOJOHT

Temas trabalhados com colaboradores em 2010 Aspecto de segurança e saúde no gerenciamento de resíduos Aspectos e Impactos Ambientais Cuidados com solo no manuseio de tintas e solventes Educação ambiental no setor produtivo Empresa e meio ambiente (ar, ågua e consumo de energia) Gestão de resíduos sólidos industriais Impacto ambiental e açþes humanas Limpeza e organização Padrþes de meio ambiente Plano de resposta emergencial Política ambiental Respeito à fauna e à flora Tempo de degradação de materiais pelo meio ambiente

Topics covered with collaborators in 2010 Aspects of safety and health in waste managing Environmental aspects e impacts Soil care in managing paints and solvents Environmental education in productive sector Enterprise and environment (air, water and energy consumption) Industrial solid waster management Environmental impact and human actions Cleaning and organization Environmental patterns Emergency response plan Environmental policy Respect for fauna and flora Time of waste degradation by the environment


Environmental Performance

t4FHSFHBÎÍPEPTSFTÓEVPTFEFTUJOBÎÍPBUSBWÏTEFBÎÜFTGPDBEBTOBSFEVÎÍPEBHFSBÎÍPEFSFTÓEVPT TFQBSBÎÍP USBOTQPSUF USBUBmento e destinação final. Os resultados do gerenciamento estão evidenciados na tabela seguinte. t4FQBSBUJPOPGXBTUFBOEEFTUJOBUJPOCZNFBOTPGBDUJPOTGPDVTFEPOSFEVDUJPOPGXBTUFQSPEVDUJPO TFQBSBUJPO USBOTQPSUBUJPO USFBUNFOUBOEGJOBM destination. Management results are presented in the following chart.

Resíduos Gerados e Destinação

PRODUCED WASTE AND DESTINATION

Resíduos

Total (kg)

Destino Final

Waste

Total (kg)

Final Destination

Plástico Papel/Papelão Metais Perigosos Gerais

8.450 1.880 42.261 54.003 114.800

Plastic Paper/Cardboard Metal Hazardous General

8,450 1,880 42,261 54,003 114,800

221.394

Total

221,394

Recycling Recycling Recycling Treatment Disposal in Controlled Landfill

Total

Reciclagem Reciclagem Reciclagem Tratamento Disposição em Aterro Controlado

Os materiais possíveis de serem reciclados foram vendidos para empresas especializadas no devido tratamento. Já no caso dos resíduos perigosos e patogênicos, contratou-se uma empresa especializada e licenciada para a realização de tratamentos químicos e disposição final, conforme regulamentação ambiental. The recyclable materials were sold to specialized companies for due treatment. As for hazardous and pathogenic waste, a licensed specialized company was hired for chemical treatment and final disposal, according to environmental regulation.

29


30

Desempenho Ambiental

Iniciativas para mitigar os impactos de produtos e serviços Em 2010 as iniciativas para mitigar ou minimizar os impactos foram executadas conforme a viabilidade financeira e grau de prioridade na intervenção do aspecto ambiental.

Initiatives for decreasing the impacts of products and services In 2010, initiatives to decrease or lessen the impacts were executed according to financial viability and priority degree in intervention of the environmental aspect.

Ações

Descrição

Gerenciamento de resíduos

Todos os resíduos das unidades passaram a ser segregados e acondicionados adequadamente com a construção de abrigos de resíduos temporários e estabelecimentos de procedimentos operacionais. Essas iniciativas sanaram o impacto de contaminação do solo e possível lençol freático pelo chorume gerado no processo de decomposição e tóxicos de resíduos perigosos.

Waste Management

All residues from the units began to be properly separated and stored with the construction of shelters for temporary residues and buildings for operational procedures. These initiatives terminated the impacts of soil and possible water table contamination by leachate produced in the decomposition process and by toxic from hazardous waste.

Sensibilização Ambiental

O programa de educação ambiental, visando à sensibilização dos funcionários, segue como eixo orientador a perspectiva da sustentabilidade ambiental na construção social. As ações do programa destinam-se a assegurar, no âmbito educativo, a interação e a integração equilibrada das múltiplas dimensões da sustentabilidade ambiental atingindo 100% dos funcionários da Cikel Brasil Verde Madeiras.

Environmental Sensitization

The program of environmental education, which aims at sensitizing employees, follows the perspective of environmental sustainability in social construction as guideline. The actions of the program are destined to ensure, in the educational aspect, balanced interaction and integration of various dimensions of environmental sustainability covering 100% of Cikel Brasil Verde Madeiras employees.

Adequações Estruturais

Algumas estruturas foram adequadas com os sistemas de proteção ambiental pertinentes. As principais adequações foram:

Actions

Description

a) adequação do sistema de lavagem de máquinas e equipamentos; b) construção de sistema separador de água e óleo; c) construção de abrigos temporários de resíduos; d) construção de coletores de resíduos para reciclagem; e) troca de tanques de armazenamento de combustível; e f ) construção de bacias e contenção móveis (atividades de exploração). Structural Adjustments

Some structures were adjusted with pertinent environment protection systems. The main adjustments were: a) adjustment of machine and equipment washing; b) construction of a system for separation of water and oil; c) construction of temporary shelters for waste; d) construction of waste collectors for recycling; e) replacement of fuel storage tanks; and f) construction of mobile basins and contention (exploratory activities).


Environmental Performance

Multas ambientais O Grupo Cikel foi autuado em R$14.598,30 por supostamente transportar madeira em toras desacompanhada de licença ambiental. O fato foi contestado em defesa apresentada pela empresa, através de provas comprovando que a madeira transportada estava acompanhada da guia florestal e de notas fiscais.

Environmental fines Cikel Group has been charged R$14,598.30 for allegedly transporting timber without environmental license. The fact was replied in the defense presented by the company, with evidence proving that the transported timber had forest form and tax receipt. Acknowledgement that the notice of infraction was insubstantial has not yet been considered by the institution.

Os investimentos realizados pela Cikel para a gestão ambiental em 2010 foram: The investments made by Cikel for environmental management in 2010 were: Itens

Investimentos (R$)

Recursos Humanos Human Resources

180.798,07

Consultoria Ambiental Environmental Consulting

16.179,54

Educação ambiental Environmental Education

16.907,47

Gestão de Resíduos Waste Management

3.848,10

Adequações para Proteção Ambiental Adjustments for Environmental Protection

36.027,51

Viagens Trips

6.412,00

Materiais / Equipamentos Materials / Equipment

809,30

Outros Others

1.794,67

Total:

R$ 262.776,66

Items

Investiments (R$)

31


32

Desempenho Social

Harmonia, respeito, comprometimento, simplicidade, entusiasmo, empreendedorismo e integridade pautam o relacionamento da Cikel com seus colaboradores.

Harmony, respect, commitment, simplicity, enthusiasm, entrepreneurship, and integrity rule the relationship between Cikel and its collaborators


Social Performance

Desempenho  Social Ações desenvolvidas junto ao público interno, treinamentos técnicos, cursos de segurança e saúde do trabalho, qualidade do produto e de serviços, entre outras iniciativas educativas, refletem a preocupação do Grupo Cikel em capacitar e valorizar o capital humano de todos os seus segmentos de atuação. Os valores organizacionais da empresa: harmonia, respeito, comprometimento, simplicidade, entusiasmo, empreendedorismo e integridade pautam o relacionamento da Cikel com seus colaboradores, bem como com o mercado e o meio ambiente, contribuindo para a construção de um mundo mais equânime.

Social Performance Actions developed with the internal staff, technical training, occupational safety and health courses, quality of products and services, among other educational initiatives, all of them reflect Cikel Group’s concern for qualifying and valuing the human capital of all its segments. The company’s organizational values: harmony, respect, commitment, simplicity, enthusiasm, entrepreneurship, and integrity rule the relationship between Cikel and its collaborators, as well as with the market and the environment, contributing to the construction of a more equal world.

Público interno

Internal Staff

Todas as mudanças que ocorreram nos últimos anos no Grupo Cikel, em parte foram para melhor atender aos anseios dos colaboradores. Para uma maior transparência e confiança na gestão, todas as mudanças significativas que impactem no dia a dia dos colaboradores são comunicadas formalmente pela diretoria, através do endereço eletrônico e dos murais de aviso, com um prazo mínimo de três meses. Outra forma de comunicação utilizada é através da assessoria de imprensa ou ainda por jornais de grande circulação.

All changes that took place in the last few years in the Cikel Group were, in part, to better fulfill the aspirations of our collaborators. For more transparency and confidence in management, all the significant changes that may have impact on the day-to-day of collaborators are formally reported by the board of directors, by means of electronic mail and notice boards, with a minimum deadline of three months. Another means of communication used is the press office or newspapers of general circulation.

Cuidar das pessoas, do local onde elas trabalham, da forma como interagem, cumprindo com as obrigações legais e indo além, é compreender com profundidade a importância de ser sustentável. Na Cikel 100% dos colaboradores são abrangidos pelo acordo coletivo, que além de outras questões valida os benefícios oferecidos ao público interno. Merece destaque o plano de saúde que é parcialmente subsidiado pela empresa e opcional, porém oferecido a todos. O Grupo Cikel é uma empresa que valoriza seus talentos e fornece condições para que as pessoas cresçam e alcancem novos patamares dentro do grupo. Através do plano de cargos e salários e da avaliação de desempenho, as pessoas podem ascender para outros níveis hierárquicos.

To take care of people, the place where they work and the way they interact, obeying legal obligations and beyond, means to deeply understand the importance of being sustainable. In Cikel 100% of the collaborators are covered by collective labor agreement, which, in addition to other issues, validates the benefits offered to the internal staff. Noteworthily, health insurance is optional, but offered to everyone. Cikel Group is a company that appreciate its talents and offers conditions for people to grow and achieve new levels inside the group. By means of staffing and compensation plans and performance evaluation, people may achieve higher hierarchical levels. Operational profile

33


34

Desempenho Social

Perfil funcional Colaboradores por área - 2.232 em 2010 Collaborators by area – 2,232 in 2010 1000

989

800 612 600 400 209

200

85

199 111

27

Administrativo/ Administrative

Florestal/Foresting

Produção Industrial/ Industrial Production

Reflorestamento/ Reforesting

Telhado/Roofing

Pintura/Painting

Outros/Others

0

Colaboradores por tipo - 2.232 em 2010 Collaborators by kind – 2,232 in 2010 2500

2223

Rotatividade Em duas das unidades da CKBV, a empresa tem atividades sazonais de seis meses, em que os funcionários são contratados e, terminando a safra, são dispensados. Uma particularidade é que a Cikel não trabalha com contratos por prazo determinado, o que contribui para o aumento da rotatividade. Nas filiais da CKLS, o mercado de trabalho está bem aquecido, possibilitando ao funcionário a escolha ou a troca de emprego. Consequentemente não há, no mercado, expressiva disponibilidade de mão de obra. Para o cálculo da taxa de rotatividade, a Cikel utiliza a média das admissões e desligamentos e divide pelo número total de colaboradores.

Turnover In two units of CKBV, the company has seasonal activities six months long, during which employees are hired and at the end of logging they are dismissed. Particularly, Cikel doesn’t work with labor agreements of specified duration, which contribute to the increase of turnover rates. In CKLS branches, the labor market is strong, which enables workers to choose or change jobs. Consequently, workforce availability in the market is limited.

2000 1500 1000

For calculation of turnover rate, Cikel uses the average of admissions and dismissals and divide it by the total number of collaborators.

500 9

0

Terceiros/ Third parties

Celetistas/ CLT employees

Colaboradores por região - 2.232 em 2010 Collaborators by region – 2,232 in 2010 1345

1400 1200 1000 826 800 600 400 200

Sudeste/ Southeast

48 Sul/South

Norte/Norte

Nordeste/ Northeast

13

0


Social Performance

35

Saúde e Segurança “Para a Cikel segurança é o ato ou efeito de assegurar afastamento de todo o perigo, condição de estar seguro, garantia, confiança, tranquilidade de espírito por não haver perigo, certeza, convicção, amparo. É um conjunto de sistemas de um regime destinado a garantir proteção contra diversos riscos sociais, em especial ligados ao trabalho”.

Rotatividade por região - 16,9% em 2010 Turnover rate by region – 16.9% in 2010 8 6,86 5,45 3,96

4

Através de acordos coletivos, a empresa assegura que questões de saúde e segurança sejam discutidas e validadas. Fornecimento de água potável, material necessário a prestação de primeiros socorros, banheiros e sanitários com padrões mínimos de higiene e com separação por sexo, identificação de ambientes perigosos ou com risco de acidentes, além de treinamentos são alguns dos critérios apurados. Manter refeitório adequado para que os trabalhadores possam esquentar os seus lanches e refeições nos horários próprios também fazem parte do acordo coletivo.

2 0,63 Sul/South

Sudeste/ Southeast

0 North/Norte

A fim de permitir que todos os colaboradores conheçam e sigam às normas relacionadas à saúde e segurança. O SESMT (Serviços Especializados em Engenharia de Segurança e Medicina do Trabalho) é composto por 41 pessoas. Na CIPA (Comissão Interna de Prevenção de Acidentes) participam 106 colaboradores, representando 16% do quadro funcional. Para garantir a segurança das pessoas, nas unidades onde se faz necessário, a Cikel mantém equipes de brigada de incêndio, compostas por colabora- dores com potencial de liderança e outros atributos. Os brigadistas são selecionados e treinados em relação à teoria de prevenção, causas e controle de incêndio.

Nordeste/ Northeast

Este conceito é intensamente perseguido no intuito do Grupo Cikel diminuir ao máximo a possibilidade de um problema relacionado à saúde e a segurança do pessoal.

6

Rotatividade por faixa etária - 16,9% em 2010 Turnover rate by age – 16.9% in 2010 8

7,21

6

4,82

4

3,18 1,68

2

Health and safety

0,01

This goal is highly pursued so that the Cikel Group may lessen at most the possibility of problems related to health and safety of staff. In order to allow all collaborators to know and follow the rules related to health and safety. The Specialized Services in Safety Engineering and Occupational Health (SSSEOH) is composed by 41 people. One hundred-six collaborators take part in the Internal Commission for Accident Prevention (ICAP), accounting for 16% of the staff. In order to guarantee people’s safety, Cikel maintains fire brigades in the units that need them. They are composed by collaborators with leadership potential and other attributes and they are selected and trained in prevention theory, causes and fire control. Through collective deals, the company ensures that health and safety issues are discussed and validated. Potable water supply; first aid material; restrooms with minimal hygiene patterns and with gender separation; identification of hazardous environments are some of the criteria established, in addition to training. Maintaining an adequate refectory so that workers may heat their snacks and meals during due timetable is also part of the agreement.

51 a 60 anos/

51 to 60 years

41 a 50 anos/

41 to 50 years

31 to 40 years

31 a 40 anos/

21 a 30 anos/

“For Cikel safety is the act or effect of ensuring that danger is averted; condition of being safe; guarantee; trust; peace of mind for existing no danger; certainty; conviction; and support. It is a set of systems of a regime meant to guarantee protection against various social risks, especially the work related ones”.

21 to 30 years

Até 20 anos/

up to 20 years

0

Rotatividade por gênero - 16,9% em 2010 Turnover rate by gender – 16.9% in 2010 20 15,95 15

10

5 0,95 0 Feminino/ Female

Masculino/ Male


36

Desempenho Social

O setor de segurança tambÊm realiza cursos, treinamentos, palestras e programas, em que todos os colaboradores devem participar. Em 2010 a Cikel investiu R$ 1.391.676,50 com estas pråticas e para manter uma equipe de SESMT.

Compromisso 2011

The safety sector also promotes courses, training, lectures and programs in which all collaborators must take part. In 2010 Cikel invested R$ 1,391,676.50 in such programs and in maintaining a SSSEOH team. Cursos Courses

Reduzir em 70% o Ă­ndice de acidentes de trabalho.

Em 2010 com o intuito de garantir que a saúde e a segurança dos colaboradores estejam de acordo com os padrþes estabelecidos, a empresa realizou algumas açþes como:

t34o3FVOJĂ?PEF4FHVSBOĂŽBDPNPT encarregados, supervisores e gerĂŞncia t"35o"OĂˆMJTFEF3JTDPEF5BSFGB tCheck List de Inspeção de Segurança t3FMBUPFFTUBUĂ“TUJDBEF*ODJEFOUF

Tabagismo e alcoolismo

Imunização e controle vacinal

Autonomous Breathing

Respiratory and Auditive Protection

Smoking and Alcoholism

Immunization and Vaccine Control

Espaço confinado

Primeiros socorros

Primeiros socorros

Confined Spaces

First Aid

First Aid

Programa de Comportamento Seguro

Direção defensiva Defensive Driving

Equipamento de Proteção Individual e Coletiva

DST/AIDS

NR-10 – Norma que regulamenta Segurança em Instalaçþes e Serviços em Eletricidade

Machine Operator

t1$"o1SPHSBNBEF$POUSPMF"VEJUJWP t113o1SPHSBNBEF1SPUFĂŽĂ?P3FTQJratĂłria

Agentes agressivos e ambientais Aggressive and Environmental Agents

NR-10 (Standard for Safety in Installations and Electricity Services)

t/PSNBTF1SPDFEJNFOUPTEF4FHVSBOĂŽB

t$*1"o$PNJTTĂ?P*OUFSOBEF1SFWFOĂŽĂ?P de Acidente

STD/AIDS

Equipment for Collective and Individual Protection

Operador de mĂĄquinas

t1$.40o1SPHSBNB$POUSPMF.Ă?EJDPF SaĂşde Ocupacional

Programas Programs

Proteção respiratória e auditiva

t3FVOJĂ?PEP4&4.5

t113"o1SPHSBNBEF1SFWFOĂŽĂ?PEF Riscos Ambientais

Palestras Lectures

Respiração autônoma

t(JOĂˆTUJDB-BCPSBM t%44o%JĂˆMPHP4FNBOBMEF4FHVSBOĂŽB

Treinamentos Training

AnĂĄlise de riscos Risk Analysis

Operador de caldeiras

Prevenção e combate a incêndios

Boiler Operator

Fire Prevention and Fire Fighting

Operador de moto serra

Mapa de risco

Chainsaw Operator

Risk Map Rotas de fuga Escape Routes Ferramentas manuais Manual Tools

HipertensĂŁo Hypertension

Safe Behavior Program


Social Performance

37

Plano de Cargos e Salårios O gerenciamento de carreira na Cikel Ê feito atravÊs do Plano de Cargos, Salårios e Carreira, no qual estå contemplado o perfil completo para cada função, abrangendo o nível de experiência e escolaridade, os conhecimentos e competências necessårios, descrição das responsabilidades e o principal objetivo da função. Variando de acordo com o perfil da vaga disponível, a Cikel avalia em seus processos competências como: Cooperação e Trabalho em Equipe, Orientação para Resultados, Cultura da Qualidade, Qualidade e Organização, Pró-atividade e Iniciativa, Pensamento Analítico, Busca de Informação, Visão Integrada de Processos, Orientação EstratÊgica, Articulação de Relacionamentos, Comprometimento Organizacional, Mentalidade de Negócio, Liderança de Equipe, Desenvolvimento de outros, Flexibilidade, Autocontrole, Resistência ao Stress, Orientação cliente-fornecedor, Competências tÊcnica – Expertise, Inovação, Objetividade e Clareza.

Commitment 2011

Reduce work accident rate by 70%.

Nas promoçþes verticais o colaborador muda de função desde que atendidos os prÊrequisitos definidos.

Política de Treinamento Visando o desenvolvimento profissional dos colaboradores, o Grupo Cikel prepara seus profissionais com treinamentos de capacitação tÊcnica, saúde e segurança e aprimoramento profissional. Em 2010, a empresa manteve o mesmo índice registrado em 2009 que foi de oito horas de treinamento por colaborador.

In 2010 in order to guarantee that the health and safety of collaborators are in accordance with established patterns, the company carried out some actions like: t8PSLQMBDF&YFSDJTF t8%48FFLMZ%JBMPHPO4BGFUZ

Staffing and Compensation Plan Career management in Cikel is done through Staffing, Compensation and Career Plan, which defines a complete profile for each position, covering experience, education, specific knowhow and abilities needed, description of responsibilities and the main purpose of each position. According to the profile of the available position, Cikel evaluates in its processes competences such as: Cooperation and Team Work; Result Orientation; Quality Culture; Quality and Organization; Proactivity and Initiative; Analytical Thinking; Information Search; Integrated View of Processes; Strategic Orientation; Relationship Coordination; Organizational Commitment; Business Mentality; Team Leadership; Other People Development; Flexibility; Self-Control; Stress Resistance; CustomerSupplier Orientation; Technical Competences – Expertise, Innovation, Objectivity and Clearness. In case of vertical promotions, collaborators change positions provided that they meet all pre-defined requirements.

Training Policy Aiming at professional development of its collaborators, Cikel Group prepares its professionals with technical training, health and safety and professional improvement. In 2010 the company maintained the same rate registered in 2009, which was eight hours of training per collaborator.

t4.o4BGFUZ.FFUJOHXJUI supervisors and management officers t53"o5BTL3JTL"OBMZTJT t$IFDL-JTUPG4FDVSJUZ*OTQFDUJPO t3FQPSUBOETUBUJTUJDTPG*ODJEFOUT t444&0).FFUJOH t3VMFTBOE1SPDFEVSFTPG4BGFUZ t&311&OWJSPONFOUBM3JTLT Prevention Program t0)$10DDVQBUJPOBM)FBMUI Control Program t*$"1*OUFSOBM$PNNJTTJPOGPS Accident Prevention t"$1"VEJUJWF$POUSPM1SPHSBN t311o3FTQJSBUPSZ1SPUFDUJPO Program


38

Desempenho Social

Canais de Comunicação Interna

O Grupo Cikel se comunica com seu público interno através do uso de ferramentas como e-mail marketing periódico, jornal interno bimestral - o “Cikel em Ação”, clippings e uso do Canal da Ética Cikel.

A Cikel se preocupa em capacitar os profissionais levando em consideração as particularidades dos segmentos, seja para execução de serviços, processo fabril ou desenvolvimento de produto. Além de cursos variados, a empresa oferta cursos obrigatórios e assegurados em lei como é o caso do treinamento para operadores de empilhadeira.

Avaliação de Desempenho No Grupo Cikel estão implementados dois modelos de Avaliação de Desempenho, sendo um voltado a cargos gerenciais (PDG - Performance e Desenvolvimento Gerencial), num modelo 360 graus, e outro voltado a líderes e cargos-chave (PDLC - Programa de Desenvolvimento de Líderes Cikel), num modelo 180 graus.

Responsabilidade pelo produto Atento às demandas do mercado, o Grupo Cikel constantemente inova seu portfólio. Os estudos, as pesquisas e a elaboração de novos produtos e serviços são gerenciados pela área de Gestão da Qualidade & Projetos. As solicitações podem ser oriundas da diretoria e/ou do departamento de marketing e vendas.

Canais de Comunicação Externa

A comunicação externa do Grupo Cikel ocorre mediante uso de folders, website, distribuição do newsletter – “Cikel em Foco” e exposição de vídeos institucionais para as partes interessadas. O Grupo está constantemente presente em feiras e eventos, onde pode ser conhecido.

O desenvolvimento de novos produtos ou serviços na Cikel passa por diferentes etapas como planejamento, análise crítica dos requisitos do cliente, registro e documentação de todas as alterações feitas nos protótipos, verificação do produto ou serviço, conforme especificações técnicas e validação final.

Cikel provides training for the employees, taking into consideration the particularity of the segment, whether it be service execution, manufacturing process or product development. In addition to a variety of courses, the company offers mandatory and law ensured courses , such as training for fork-lift operators.

Performance Evaluation Two models of Performance Evaluation are implemented in Cikel Group. One of them refers to management positions (MPD - Management Performance and Development), a 360-degree model; and another one for leaders and key-positions (CLDP - Cikel Leader Development Program), a 180-degree model.

Responsibility for the product Attentive to market demands, Cikel Group is constantly innovating its portfolio. Studies, researches and new product and service elaboration are managed by the Quality and Projects Management area. Orders may come from the board of directors and/or from the sales and marketing department. In Cikel, development of new products and services goes through various stages such as planning, critical analysis of customer’s requirements, registration and documentation of all changes made on the prototypes, verification of product or service according to technical specifications and final validation.


Social Performance

Ainda no planejamento, etapa inicial do processo, são avaliados os impactos ambientais e possíveis impactos na saúde e segurança dos clientes, respaldando o compromisso do Grupo frente ao cliente, meio ambiente e sociedade. A Cikel garante em todos os serviços e produtos o cumprimento de leis nas esferas municipais, estaduais, federais e internacionais. Além disso, a qualidade dos produtos e serviços ainda é assegurada por padronizações, testes, auditorias periódicas e inspeções de processos. Alguns produtos da Cikel Madeiras necessitam de rotulagem específica como é o caso da madeira serrada, que utiliza o Sistema REACH, regulamento relativo ao registro, avaliação e à autorização de produtos químicos para exportação à União Européia. A linha de pisos engenheirados também utiliza esse Sistema na rotulagem e atende a exigência CARB (California Air Resources Board), norma americana para emissão de formaldeído em produtos químicos exportados aos Estados Unidos. Em 2010, o Grupo Cikel recebeu, no total, multa de R$ 515.292,73 referente a não conformidade de produtos como pisos (R$ 274.332,68) e madeira serrada (R$ 240.960,05). No entanto, a empresa não registrou nenhum Termo de Ajustamento de Conduta (TAC) relacionado a produtos. Ações corretivas e melhorias constantes fazem parte do dia a dia de todos os segmentos da Cikel.

During planning, which is the initial stage of the process, environmental impacts and possible impacts on customer’s safety and health are evaluated, confirming the commitment of Cikel with clients, environment and society. Cikel guarantees to observe municipal, state, federal and international law in all services and products. Moreover, the quality of products and services is ensured by standardizations, tests, periodic auditing and inspection of processes. Some products of Cikel Madeiras need specific labeling. An example is sawn timber, which uses REACH System, regulation regarding registration, evaluation and authorization of chemical products to be exported to the European Union. The engineered flooring line also uses this System in labeling and meets CARB (California Air Resources Board) requirement, American standard for emission of formoldehyde in chemical products exported to the United States. In 2010, Cikel Group was fined a sum of R$ 515,292.73, for noncompliance of products, such as flooring (R$ 263,332.68) and sawn timber (R$ 240,960.05). However, the company has no registered Term of Conduct Adjustment (TCA) related to products. Corrective actions and constant improvements are part of the routine in all segments of Cikel.

39

Internal Communication Channels

Cikel Group communicates with its internal staff by means of tools such as e-mail, periodic marketing, bimonthly internal journal called “Cikel in Action”, clippings and Cikel Ethics Channel.

External Communication Channels

External communication of Cikel Group is established through folders, the website and a newsletter - “Cikel in Focus”, and institutional videos presented to stakeholders. The Group is constantly present in fairs and events where it might be known.


40

Desempenho Econômico

De forma inovadora e voluntária, em 2010 o Grupo Cikel iniciou a implementação do Projeto de Redução de Emissões por Desmatamento e Degradação (REDD)

In 2010 Cikel Group, in an innovative and voluntary way, started implementing the project Reducing Emissions from Deforesting and Forest Degradation (REDD).


41

Economic Performance

Desempenho   Econômico Ao passar a relatar seus indicadores de forma a integrar seus negócios (madeira, logística e serviços), o Grupo Cikel demonstra evolução em seus números, principalmente quando comparado os exercícios de 2009 e 2010. O acréscimo no desempenho econômico se dá tanto em relação à receita quanto aos outros indicadores que compõem o DVA (Demonstrativo do Valor Adicionado). Comparativamente, a contribuição da Cikel para sociedade evoluiu significativamente, demonstrando o compromisso da empresa com as partes interessadas e com a perenidade dos negócios.

Impacto de Mudanças Climáticas A mudança climática é algo que vem interferindo cada vez mais na vida das pessoas. Por isso, de forma inovadora e voluntária, em 2010 o Grupo Cikel iniciou a implementação do Projeto de Redução de Emissões por Desmatamento e Degradação (REDD). A iniciativa objetiva manter a floresta em pé, a fim de reduzir a emissão de gases de efeito estufa e atuar em prol de melhorar as práticas de trabalho, beneficiar as comunidades locais e a biodiversidade, por meio da verificação e comercialização de créditos de carbono.

Economic Performance Since Cikel started to report its indicators in order to integrate its businesses(timber, logistics and services), the group has been showing increasing numbers, mainly when compared to the years of 2009 and 2010. The growth in economic performance is related to revenue as well as the other indicators that compose the VAS (Value Added Statement).

DVA Distribuição da riqueza Agentes Agents

2010 Part % (values in thousand R$ )

2009 Part % (values in thousand R$)

Governo Government

13,23%

8,04%

Colaboradores(as) Collaborators

64,28%

54,42%

Financiadores Backers

21,64%

23,41%

Retido Retained

0,85%

14,13%

Acionistas Shareholders

0,00%

0,00%

TOTAL

100%

100%

2010 0%

1,0%

13,0%

22,0%

64,0%

2009 0%

In comparison, Cikel’s contribution to society has evolved significantly, demonstrating the company’s commitment to the interested parties and business continuity.

14%

Climate Changing Impact

23%

Climate changing is something that has been interfering more and more in people’s lives. Therefore, in 2010 Cikel Group, in an innovative and voluntary way, started implementing the project Reducing Emissions from Deforesting and Forest Degradation (REDD). The initiative aims at maintaining the forest standing in order to reduce greenhouse gas emission and act in favor of improving work practices, benefiting local communities and biodiversity, by means of verification and trade of carbon credit.

8%

55%

Governo

Colaboradores(as)

Financiadores

Retido

Acionistas


42

Desempenho Econômico

Insumos 2010: mercado interno x mercado externo: Inputs 2010: External market x internal market: Suprimentos por valor Grupo Cikel

Para o Grupo Cikel é vital manter o equilíbrio climático. A empresa assegura que não há como oferecer serviços e produtos desvinculados do compromisso ambiental que, por sua vez, influencia as mudanças climáticas.

Menor salário pago O Grupo Cikel respeita e pratica o piso salarial estabelecido na Convenção Coletiva do Trabalho (CCT) de cada unidade onde atua. Dos estados onde o Grupo Cikel tem unidades, apenas o Rio de Janeiro não segue o mínimo nacional. Nesta localidade, o salário mínimo estabelecido é de R$ 581,88.

Supply by value - Cikel Group Mercado externo External market

R$ 108.249,37

Práticas com fornecedores

Mercado interno Internal market

R$ 62.217.208,43

Total

R$ 62.325.457,80

O Grupo Cikel não possui uma política de contratação de fornecedores e nem classificação por localidade. Em cada aquisição busca-se verificar a idoneidade da empresa a ser contratada. Em caso de fornecimento por um período determinado, e volumes constantes, é elaborado um contrato que estabelece critérios legais entre as partes. A empresa prioriza fornecedores mais próximos às unidades fabris, com intuito de minimizar os custos com frete, reduzir o tempo de entrega da mercadoria, além de incentivar o desenvolvimento econômico local.

Suprimentos por tipo Grupo Cikel Supply by kind - Cikel Group Grupo de estoque Stock Group

Em Reais In Real

Matéria-Prima Raw Material

1.306.020,89

Produto Acabado Finished Product

167.516,41

Madeira Serrada Sawn Timber

800.026,38

Lâmina Torneada Turning Stock

83.146,89

Produto em Elaboração Product in Development

6.652,49

For Cikel Group, it is vital to maintain climate balance. The company assures that there is no way of offering services and products detached from environmental commitment which, in turn, influences climate changing. In 2010 Cikel did not receive tax benefits.

Combustíveis e Lubrificantes Fuels and Lubricants

5.036.222,98

Lowest salary

Material Secundário / Embalagem Secondary Material / Packaging

653.340,13

Material de Almoxarifado Consumables

6.576.514,89

Material Débito Direto Direct Debit Material

47.696.016,54

Total

62.325.457,80

Para aquisição de bem imobilizado ou investimentos, a negociação é realizada pela diretoria com a participação dos gestores das áreas. A partir daí a negociação segue o fluxo normal de compra, assim como matérias-primas e insumos, para os quais é preciso abrir uma solicitação de compra no sistema gerencial. O setor de suprimentos efetua as cotações e gera o pedido, que deve ser aprovado, seguindo as escalas de aprovadores, por faixa de valores, em cada unidade fabril. Somente após as aprovações é efetuada a compra.

Cikel Group respects and maintains the wage floor established by the Collective Labor Convention (CLC) of each unit where it operates. Of all states where Cikel Group has units, only in Rio de Janeiro does not follow the national minimal wage. In that state the minimal wage established is R$ 581.88.

Practices with suppliers Cikel Group does not have a policy for hiring suppliers or classifying them according to place. In every acquisition the company to be hired is checked for good business standing. In case of supplying for a determined period of time and constant quantity, a contract is written, establishing legal criteria between the parties. The company prioritizes suppliers that are nearer the factory units, aiming at minimizing shipping costs, reducing time of delivery, in addition to promoting local economic development. For acquisition of fixed assets or investments, negotiation is conducted by the board of directors with participation of area managers. Then the negotiation follows regular business flow; this is also the case for raw material and inputs, for which it is necessary to submit a purchase request in the management system. The supplying sector provides price quotation and places the order, which must be approved according to approver scales, by value bracket in each factory unit. Only after approval does the purchase proceed.

Local high managements succession The Human Resources department is responsible for the recruiting and selection processes, either internal, external or in any hierarchical level.


Economic Performance

43

Sucessão da alta gerência local O departamento de Recursos Humanos é responsável pelos processos de recrutamento e seleção, internos e externos, em qualquer nível hierárquico. Embora não exista política de sucessão gerencial estabelecida, qualquer processo seletivo deve atender ao procedimento interno. Quando há vagas em aberto, a área responsável faz a divulgação, respeitando as diferenças regionais. Na maioria dos casos, a divulgação é realizada em jornais locais, no entanto existem situações específicas em que as vagas são divulgadas em locais de grande circulação, como nas comunidades vizinhas, empresas de recrutamento e seleção, sindicatos e instituições de interesse. Não há restrições para participação nos processos seletivos, todos os candidatos têm igualdade de acesso à vaga, desde que atendam aos pré-requisitos estabelecidos.

Investimentos com impacto público A área de Responsabilidade Social vem melhorando suas práticas a cada ano. Com orçamento anual estabelecido, a atuação social do Grupo Cikel foca o desenvolvimento por meio da educação, capacitação e qualidade de vida. No ano de 2010, o Grupo deu continuidade a sua atuação junto aos colaboradores e comunidades próximas às unidades, obtendo resultados sociais significativos. A Cikel reestruturou sua forma de relacionamento e consolidou, com a comunidade, técnicas de construção participativa para realização de programas focados no desenvolvimento socioeconômico.

Impactos econômicos indiretos Com a adoção de técnicas de construção participativa junto às comunidades e o fortalecimento das relações, o procedimento de análise de possíveis impactos causados pelas operações do Grupo Cikel será implantado em 2011 e nos anos subsequentes. Serão colocados em prática e monitorados os planos de mitigação e maximização de impactos.

Although there is no established policy for management succession, any selection process must follow internal procedures. When there are job openings, the responsible area discloses them, respecting local differences. In most cases, they are posted in local newspapers; however, there are specific situations in which job opening ads are posted in greater circulation places, such neighbor communities, companies of recruiting and selection, trade unions and interested institutions. There are no restrictions to take part in the selection process; all candidates are equal to compete for the job, once they comply with the established requirements.

Investments with public impact The Social Responsibility area has been improving its practices year by year. With the annual budget established, the social actions of Cikel Group focus on development by means of education, training and life quality. In 2010, the Group provided continuity to its actions along with the collaborators and communities near the units, obtaining significant social results. Cikel restructured its relationship and consolidated techniques of participative construction with the community, in order to carry out programs focused on socioeconomic development.

Investimentos sociais realizados em 2010 Social Investment made in 2010

Ação

Investimento

Beneficiários Região

Action

Investment ($)

Beneficiaries

Region

Doação de Produtos

131.696,46

-

Ananideua, Baião, Belém (Pará)

Educação Básica Basic Education

36.727,80

245

Portel (Pará)

Inclusão Digital Digital Inclusion

19.936,89

223

Ananindeua, Portel (Pará)

87

Ananindeua, Belém, Portel (Pará); Ouro Branco (Minas Gerais)

Products Donnated

Programas para Geração 19.036,49 de Renda Income Generation Programs Programas de Saúde Health Programs

28.907,99

1650

Ananindeua, Paragominas, Portel (Pará)

Divulgação Social Social Disclosure

27.469,42

-

-

Custos Administrativos Management Costs

76.248,71

-

-

Logística Logistics

26.508,22

-

-

Total de Investimentos 366.531,98

2205


44

Desempenho Econômico

Balanço Social Anual / 2010 Empresa: Grupo Cikel

1 -‐ Base de Cálculo Receita líquida (RL) Resultado operacional (RO) Folha de pagamento bruta (FPB)

2010 Valor (Mil reais) 128.933.615 685.867 62.814.241

2009 Valor (Mil reais) 90.922.125 5.784.922 25.500.838

2 -‐ Indicadores Sociais Internos Alimentação Encargos sociais compulsórios Previdência privada Saúde Segurança e saúde no trabalho Educação Cultura &DSDFLWDomRHGHVHQYROYLPHQWRSURÀVVLRQDO Creches ou auxílio-‐creche Participação nos lucros ou resultados Outros Total -‐ Indicadores sociais internos

Valor (mil) 3.111.463 22.602.440 0 956.916 986.830 31.293 0 56.834 0 0 1.366.493 29.112.270

% sobre FPB 4,95% 35,98 0,00% 1,52% 1,57% 0,05% 0,00% 0,09% 0,00% 0,00% 2,18% 46,35%

% sobre RL 2,41% 17,53% 0,00% 0,74% 0,77% 0,02% 0,00% 0,04% 0,00% 0,00% 1,06% 22,58%

Valor (mil) 1.559.983 9.412.685 0 359.564 118.334 40.857 0 44.701 0 0 702.073 12.238.198

% sobre FPB 6,12% 36,91% 0,00% 1,41% 0,46% 0,16% 0,00% 0,18% 0,00% 0,00% 2,75% 47,99%

% sobre RL 1,72% 10,35% 0,00% 0,40% 0,13% 0,04% 0,00% 0,05% 0,00% 0,00% 0,77% 13,46%

3 -‐ Indicadores Sociais Externos Educação Cultura Saúde e saneamento Esporte Combate à fome e segurança alimentar Outros (doação asilo e seleção APAE). Total das contribuições para a sociedade Tributos (excluídos encargos sociais) Total -‐ indicadores sociais externos

Valor (mil) 0 0 0 0 0 0 0 10.242.514 10.242.514

% sobre RO 0,00% 0,00% 0,00% 0,00% 0,00% 0,00% 0,00% 1493,37% 1493,37%

% sobre RL 0,00% 0,00% 0,00% 0,00% 0,00% 0,00% 0,00% 7,94% 7,94%

Valor (mil) 0 0 0 0 0 128.500 128.500 4.129.320 4.257.820

$ sobre RO 0,00% 0,00% 0,00% 0,00% 0,00% 2,22% 2,22% 71,38% 73,60%

% sobre RL 0,00% 0,00% 0,00% 0,00% 0,00% 0,14% 0,14% 4,54% 4,68%

4 -‐ Indicadores Ambientas Investimentos relacionados com a produção/operação da em-‐ presa Investimentos em programas e/ou projetos externos Total dos investimentos em meio ambiente

Valor (mil)

% sobre RO

% sobre RL

Valor (mil)

$ sobre RO

% sobre RL

Quanto ao estabelecimento de “metas anuais” para minimizar resíduos, o FRQVXPRHPJHUDOQDSURGXomRRSHUDomRHDXPHQWDUDHÀFiFLDQDXWLOL]DomR de recursos naturais, a empresa

11.344.469

1654,03%

8,80%

8.943.818

154,61%

9,84%

0 11.344.469

0,00% 1654,03%

0,00% 8,80%

0 8.943.818

0,00% 154,61%

0,00% 9,84%

(x) não possui metas ( ) cumpre de 0 a 50%

( ) cumpre de 51 a 75% ( ) cumpre de 76 a 100%

(x) não possui metas ( ) cumpre de 0 a 50%

( ) cumpre de 51 a 75% ( ) cumpre de 76 a 100%


Tributos (excluĂ­dos encargos sociais)

10.242.514

1493,37%

7,94%

4.129.320

71,38%

4,54%

Total -� indicadores sociais externos

10.242.514

1493,37%

7,94%

4.257.820

73,60%

4,68%

Economic Performance 4 -� Indicadores Ambientas

Valor (mil)

Investimentos relacionados com a produção/operação da empresa

Quanto ao estabelecimento de “metas anuaisâ€? para minimizar resĂ­duos, o consumo em geral na produção/operação e aumentar a HĂ€FiFLDQDXWLOL]DomRGHUHFXUVRVQDWXUDLVDHPSUHVD

% sobre RL

Valor (mil)

$ sobre RO

% sobre RL

11.344.469

1654,03%

8,80%

8.943.818

154,61%

0

0,00%

0,00%

0

0,00%

0,00%

11.344.469

1654,03%

8,80%

8.943.818

154,61%

9,84%

Investimentos em programas e/ou projetos externos Total dos investimentos em meio ambiente

% sobre RO

(x) nĂŁo possui metas ( ) cumpre de 0 a 50%

( ) cumpre de 51 a 75% ( ) cumpre de 76 a 100%

5 -�-�Indicadores Indicadores do Corpo Funcional 5 do Corpo Funcional

2010

1žGHHPSUHJDGRV DV DRÀQDOGRSHUtRGR 1žGHHPSUHJDGRV DV DRÀQDOGRSHUtRGR

2232

NÂş durante o perĂ­odo NÂş de deadmissĂľes admissĂľes durante o perĂ­odo

644

NÂş terceirizados(as) NÂş de deempregados(as) empregados(as) terceirizados(as)

77

NÂş de estagiĂĄrios(as)

1

NÂş de estagiĂĄrios(as) NÂş de empregados(as) acima de 45 anos NÂş de mulheres que trabalham na empresa NÂş de mulheres que trabalham na empresa GHFDUJRVGHFKHĂ€DRFXSDGRVSRUPXOKHUHV GHFDUJRVGHFKHĂ€DRFXSDGRVSRUPXOKHUHV NÂş de negros(as) que trabalham na empresa NÂş de negros(as) que trabalham na empresa GHFDUJRVGHFKHĂ€DRFXSDGRVSRUQHJURV DV

GHFDUJRVGHFKHĂ€DRFXSDGRVSRUQHJURV DV

1žGHSRUWDGRUHV DV GHGHÀFLrQFLDRXQHFHVVLGDGHVHVSHFLDLV 1žGHSRUWDGRUHV DV GHGHÀFLrQFLDRXQHFHVVLGDGHVHVSHFLDLV 6 -� Informaçþes relevantes quanto ao exercício da cidadania empresarial 6 -� Informaçþes relevantes quanto ao exercício da cidadania empresarial Relaçãoentre entre a maior e a menor remuneração Relação a maior e a menor remuneração na empresana empresa Nº de empregados(as) acima de 45 anos

471 111 1,05% 1308 1,05% 4

2010

(x) nĂŁo possui metas ( ) cumpre de 0 a 50%

2010 2232 644 77 1 471 111 1,05% 1308 1,05% 4

69

NĂşmero total de acidentes de trabalho

( ) cumpre de 51 a 75% ( ) cumpre de 76 a 100%

2009 2009 1015 1015 652652 116116 2

2 114 70 70 1,08% 1,08% 805 805 3,65% 63,65% 6 114

Metas 2011

2010

2009

0,0283 0,0283

NĂşmero total de acidentes de trabalho

0 0

69

0

0

( x ) direção e ( ) todos(as) ( x ) direção e 2VSURMHWRVVRFLDLVHDPELHQWDLVGHVHQYROYLGRVSHODHPSUHVDIRUDPGHÀQLGRV ( ) direção ( ) direção( x ) direção e Os projetos sociais e ambientais desenvolvidos pela ( x ) direção e gerências ( ) todos(as) SRU empregados(as) gerências ( ) direção ( ) direção

HPSUHVDIRUDPGHĂ€QLGRVSRU

gerĂŞncias

empregados(as)

( ) todos(as)

( ) todos(as) + Cipa

( x ) direção e 2VSUDGU}HVGHVHJXUDQoDHVDOXEULGDGHQRDPELHQWHGHWUDEDOKRIRUDPGHÀQL-� Os pradrþes de segurança e salubridade no ambiente ( x ) direção e gerências GRVSRU

gerĂŞncias

GHWUDEDOKRIRUDPGHĂ€QLGRVSRU

ciação coletiva e à representação interna dos(as) WUDEDOKDGRUHV DV DHPSUHVD $SUHYLGrQFLDSULYDGDFRQWHPSOD $SUHYLGrQFLDSULYDGDFRQWHPSOD $SDUWLFLSDomRGRVOXFURVRXUHVXOWDGRVFRQWHPSOD

( ) todos(as) empregados(as)

( ) nĂŁo se ( x ) segue as ( x ) segue as envolve normas da OIT

Quanto à liberdade sindical, ao direito de negociação coletiva e à represen-� Quanto à liberdade sindical, ao direito de nego-� WDomRLQWHUQDGRV DV WUDEDOKDGRUHV DV DHPSUHVD

9,84%

gerĂŞncias

( ) todos(as) + ( ) direção e e Cipa ( ) direção gerências

( x ) todos(as) + Cipa

empregados(as) ( ) todos(as) ( x ) todos(as) + Cipa

gerĂŞncias

( ) incentiva e

( ) todos(as)

( ) todos(as)

( ) empregados(as) todos(as) empregados(as)

( ) nĂŁo se

( x ) seguirĂĄ as

( ) incentivarĂĄ e

gerĂŞncias

empregados(as)

( x ) seguirå segue a OIT normas da OIT seguirå a OIT ( ) incentiva e ( ) nãoenvolverå se ( ) incentivarå e normas da as normas da segue a OIT envolverå seguirå a OIT ( ) direção e ( ) todos(as) ( ) direção e (x ) todos(as) OIT OIT ( ) direção ( ) direção gerências empregados(as) gerências empregados(as) ( ) direção e ( ) todos(as) ( ) direção e ( ) todos(as) ( ) direção ( ) direção gerências ( ) direção empregados(as) gerências empregados(as) e ( ) todos(as) ( ) direção e ( x) todos(as) ( ) não se envolve

( ) direção

gerĂŞncias

empregados(as)

( ) direção

( ) direção e ( ) todos(as) ( ) direção e ( ) todos(as) $SDUWLFLSDomRGRVOXFURVRXUHVXOWDGRVFRQWHPSOD ( ) direção ( ) não ( ) direção são ( x ) são sug( ) não serão gerências ( x ) serão sug- empregados(as) Na seleção dos fornecedores, os mesmos padrþes Êticos e de responsabilidade gerências empregados(as) ( ) são exigidos ( ) serão exigidos VRFLDOHDPELHQWDODGRWDGRVSHODHPSUHVD

Na seleção dos fornecedores, os mesmos padrþes Êti-�

considerados

eridos

considerados

( ) nĂŁo serĂŁo

x ) se são sug- ( ) apóia ) (não ( ) organiza e ( ) não se Quanto à participação de empregados(as) em programas de trabalho voluntårio, cos e de responsabilidade social e ambiental adotados ( ) não são ( xenvolve ( ) são exigidos consideraDHPSUHVD incentiva envolverå considerados eridos SHODHPSUHVD

1~PHURWRWDOGHUHFODPDo}HVHFUtWLFDVGHFRQVXPLGRUHV DV  Quanto à participação de empregados(as) em progra-�

PDVGHWUDEDOKRYROXQWiULRDHPSUHVD

GHUHFODPDo}HVHFUtWLFDVDWHQGLGDVRXVROXFLRQDGDV

Número total de reclamaçþes e críticas de

9DORUDGLFLRQDGRWRWDODGLVWULEXLU HPPLO5  FRQVXPLGRUHV DV 

% de reclamaçþes e críticas atendidas 'LVWULEXLomRGR9DORU$GLFLRQDGR '9$  VROXFLRQDGDV

7 -� Outras Informaçþes

ou

9DORUDGLFLRQDGRWRWDODGLVWULEXLU HPPLO5 

na empresa

( x ) nĂŁo se _______ ( ) apĂłia envolve na empresa _______

no Procon na Justiça ( ) organiza_______ e _______

incentiva

na empresa _______%

no Procon _______

___% governo

na Justiça _______

___% colaboradores(as)

na empresa

no Procon

( ) nĂŁo_______ se _______ ( x ) apoiarĂĄ envolverĂĄ na empresa

Em 2010: _______

na___% empresa e na justiça _______% acionistas ___ % terceiros ___% retido Em 2010: 81.121.722

dos

eridos

( x ) serão ( x ) organizarå e ( x ) apoiarå ( ) serão exigidos incentivarå sugeridos na Justiça _______ ( ) organizarå e incentivarå

no Procon _______%

no Procon _______

na Justiça _______Em 2009:

___% governo ___% colaboradores(as) Procon ___ e na% justiça_______% ___% no acionistas terceiros ___% retido

Em 2009: 40.953.631

Grupo Cikel Ltda, CNPJ 03.501.232/0001-�11. Atua globalmente atendendo aos mercados Nacional, Europeu e Norte Americano. A empresa respeita o ser humano e preza pelo seu pleno 13,23%assegura governo 64,28% colaboradores governo 54,42escrava % colaboradores desenvolvimento, por meio de capacitaçþes e programaçþes sociais; tambÊm o não envolvimento com atos corruptos; não8,04% utilização de mão-�de-�obra e/ou infantil. Para 'LVWULEXLomRGR9DORU$GLFLRQDGR '9$  DFLRQLVWDVÀQDQFLDPHQWRV esclarecimentos sobre as informaçþes declaradas favor contatar KarenDFLRQLVWDVÀQDQFLDPHQWRV Anjos, por meio do e-�mail karen@cikel.coom.br ou pelo telefone (091) 4005-�9955

0,85% retido 14,13% retido 7 -� Outras Informaçþes As empresas Cikel Brasil Verde Madeiras Ltda, CNPJ 03.501.232/0001-�11 e Cikel Logística e Serviços Ltda, CNPJ 03.542.670/0001-�28 pertencem ao Grupo Cikel. O grupo atua globalmente atendendo aos mercados Nacional, Europeu e Norte Americano. A empresa respeita o ser humano e preza pelo seu pleno desenvolvimento, por meio de capacitaçþes e programaçþes sociais; tambÊm assegura o não envolvimento com atos corruptos; não utilização de mão de obra escrava e/ou infantil. Para esclarecimentos sobre as informaçþes declaradas favor contatar Karen Anjos, por meio do e-�mail karen@cikel. coom.br ou pelo telefone (091) 4005-�9955

Devida à inclusão da Cikel Logística e Serviços Ltda na apuração dos indicadores, os valores de 2010 foram superiores aos de 2009.

45


46

Desempenho Econômico

Annual Social Accounting / 2010 Company: Cikel Group

1 -‐ Calculation Basis Net Revenue (NR) Operating Income (OI) Gross Payroll (GP)

2010 Value (Thousand reais) 128.933.615 685.867 62.814.231 % over GP

Food Compulsory Social Security Charges Private Pension Found Health Work Safety and Health Education Cuture Training and Professional Development Day-‐care Centers 3URÀWDQG5HVXOW6KDULQJ Others Total -‐ Social Internal Indicators

Value (Thousand) 3.111.463 22.602.440 0 956.916 986.830 31.293 0 56.834 0 0 1.366.493 29.112.270

3 -‐ External Social Indicators

Value (Thousand)

% over GP

2 -‐ Internal Social Indicators

Education Culture Health and Sanitation Sports Fight against hunger and food safety Others (donation to shelter and APAE) All contributions to the society Charges (excluding social security charges) Total -‐ External Social Indicators 4 -‐ Environmental Indicators Investments related to production / operation of the com-‐ pany Investments external programs and/or projects Total Investments in yhe Environment

As forstablishing annual goals to minimize residues, general consumption LQSURGXFWLRQDQGRSHUDWLRQDQGLQFUHDVLQJHIÀFLHQF\LQWKHXVHRIQDWXUDO resources, the company:

0 0 0 0 0 0 0 10.242.514 10.242.514 Value (Thousand)

4,95% 35,98% 0,00% 1,52% 1,57% 0,05% 0,00% 0,09% 0,00% 0,00% 2,18% 46,35%

0,00% 0,00% 0,00% 0,00% 0,00% 0,00% 0,00% 1493,37% 1493,37% % over GP

% over NR 2,41% 17,53% 0,00% 0,74% 0,77% 0,02% 0,00% 0,04% 0,00% 0,00% 1,06% 22,58% % over NR 0,00% 0,00% 0,00% 0,00% 0,00% 0,00% 0,00% 7,94% 7,94% % over NR

2009 Value (Thousand reais) 90.922.125 5.784.922 25.500.838 Value (Thousand) 1.559.983 9.412.685 0 359.564 118.334 40.857 0 44.701 0 0 702.073 12.238.198

% over GP

Value (Thousand)

% over GP

0 0 0 0 0 128.500 128.500 4.129.320 4.257.820 Value (Thousand)

6,12% 36,91% 0,00% 1,41% 0,46% 0,16% 0,00% 0,18% 0,00% 0,00% 2,75% 47,99%

0,00% 0,00% 0,00% 0,00% 0,00% 2,22% 2,22% 71,38% 73,60% % over GP

% over NR 1,72% 10,35% 0,00% 0,40% 0,13% 0,04% 0,00% 0,05% 0,00% 0,00% 0,77% 13,46% % over NR 0,00% 0,00% 0,00% 0,00% 0,00% 0,14% 0,14% 4,54% 4,68% % over NR

11.344.469

1654,03%

8,80%

8.943.818

154,61%

9,84%

0

0,00%

0,00%

0

0,00%

0,00%

11.344.469

1654,03%

8,80%

8.943.818

154,61%

9,84%

( X ) não possui metas ( ) cumpre de 51 a 75% ( ) cumpre de 0 a 50% ( ) cumpre de 76 a 100%

( X ) não possui metas ( ) cumpre de 51 a 75% ( ) cumpre de 0 a 50% ( ) cumpre de 76 a 100%


Economic Performance

5 - Employees' Indicators

2010

2009

Number of employees in the end of the period

2232

1015

Number of admissions in the period

644

652

Number of outsourced employees

77

116

Number of trainees

1

2

471

114

Number of employees with more than 45 years of age Number of women that work in the company % management-level positions occupied by women

111

70

1,05%

1,08%

Number of African-american working in the company

1308

805

% management-level positions occupied by African-americans

1,05%

3,65%

4

6

Number of employees with disability or special needs 6 - Important Information Regarding Bussiness Citizenship Practice Proportion between higest and lowest salary in the company Total number of workplace accidents

2010

Goals 2011

0,0283

0

69

0

The social and environmental projects developed by the companies were defined by:

( ) directors

( x ) directors and managers ( ) all employees

( ) directors

( x ) directors and managers

( ) all employees

The safety and salubrity standards of the workplace heve been defined by:

( x ) directors and managers

( ) all employees

( ) all + CIPA

( ) directors and managers

( ) all employees

( x ) all + CIPA

As for unior liberty, the right to collective negotiation and internal representation of employees, the company:

( ) does not get involved

( x ) follows OIT standards

( ) encourages and follows OIT

( ) does not get involved

( x ) follows OIT standards

( ) encourages and follows OIT

Private pension found is for:

( ) directors

( ) directors and managers ( ) all employees

( ) directors

( ) directors and managers

( ) all employees

Profite and results sharing is for:

( ) directors

( ) directors and managers ( ) all employees

( ) directors

( ) directors and managers

( ) all employees

When selecting suppliers, the same ethical, social respnsibility and environmental standards adopted by the company:

( ) are not considered

( x ) are suggested

( ) are required

( ) are not considered

( x ) will be suggested

( ) will be required

As for the participation of employees in volunteer work programs, the company:

( x ) does not get involved

( ) supports

( ) organizes and encourages

( ) will not get involved

( x ) will support

( ) will organize and encourage

in the company _______

at Procon _______

in Court ________

in the company _______

at Procon _______

in Court ________

Total mumber of complaints and criticism from consumers: % of complaints or criticism attended or solved Addes value to be distributed (in thousand reais) Added Value Distribution (AVD)

in the company _______%

at Procon _______%

in Court ________%

In 2010: 81.121.722 13,23% government 64,28% collaborators 0% shareholders 21,64% withheld

in the company _______%

at Procon _______%

in Court ________%

In 2009: 40.953.631 8,04% government 0% shareholders 14,13%

54,42 % collaborators 23,41% withheld

7 - Other Information The companies Cikel Brasil Verde Madeiras Ltda, CNPJ 03.501.232/0001-11 and Cikel Logística e Serviços Ltda, CNPJ 03.542.670/0001-28 belong to Cikel Group. The group acts globally in the National, European and American North markets. The company respects human beings and Works for their full development, bt means of trainings and social programs, the company also guarantees not to be involved in corruption, slave work or child work. For more information regarding the data reported, please contact Karen Anjos: karen@cikel.com.br, or telefone (091) 4005-9955. %HFDXVHWKHLQFOXVLRQRIWKH&LNHO/RJtVWLFDH6HUYLoRV/WGDLQWKHLQGLFDWRUVYHULÀFDWLRQWKHYDOXHVRIKDGEHHQVXSHULRUWKDQ

47


48

Desempenho Econômico

Sumário GRI 1. Estratégia e Análise

08 e 09

1.1. Declaração da Presidência

10

1.2. Principais impactos, riscos e oportunidades

11

2. Perfil Organizacional

12

2.1. Nome da organização

12

2.2. Principais marcas, produtos e/ou serviços

12 e 13

2.3. Estrutura operacional

12 e 17

2.4. Localização da sede da organização

12 e 54

2.5. Atuação geográfica

45

2.6. Natureza jurídica

45

2.7. Mercados atendidos

45

2.8. Porte da organização

45

2.9. Principais mudanças no ano

08

2.10. Prêmios

13

3. Parâmetros para o Relatório

17

3.1. Período coberto pelo relatório

1° de janeiro a 31 de dezembro de 2010

3.2. Relatório anterior

2009

3.3. Periodicidade

Anual

3.4. Dados para contato

45 e 54

3.5. Definição do conteúdo

16

3.6. Limite do relatório

17

3.7. Escopo e limite do relatório

17

3.8. Base para a elaboração do relatório

17

3.9. Técnicas de medição e bases de cálculos

20

3.10. Consequências de reformulações de informações

17

3.11. Mudanças significativas

08 e 17

3.12. Localização das informações

48, 50 e 52

3.13. Verificação externa

Nível de aplicação do GRI

4. Governança, Compromissos e Engajamento

17

4.1. Estrutura de governança

17

4.2. Identificação dos principais executivos

09 e 11

4.3. Conselheiros independentes

Não disponível

4.4. Canais de comunicação com o Conselho

38

4.5. Remuneração por sustentabilidade

Não disponível

4.6. Conflitos de interesse

19

4.7. Qualificações de conselheiros

Não disponível


Economic Performance

Summary GRI 1. Strategy and Analysis

08 e 09

1.1. Administration Council and Executive Officer Message

10

1.2. Main Impacts, Risks and Opportunities

11

2. Organizational Profile

12

2.1. Name of the Organization

12

2.2. Main brands, products and/or services

12 e 13

2.3. Operational Structure

12 e 17

2.4. Localization of Organization’s Headquarters

12 e 54

2.5. Geographic Performance

45

2.6. Legal Nature

45

2.7. Markets Seved

45

2.8. Size of Organization

45

2.9. Main Changes in the Year

08

2.10. Awards Received

13

3. Parameters for the Report

17

3.1. Reporting Period

Period between January 1 and December 31

3.2. Previous Report

2009

3.3. Regularity

Annual

3.4. Contact Point

45 e 54

3.5. Definition of Content

16

3.6. Limit of the Report

17

3.7. Scope and Limit of the Report

17

3.8. Basis for Elaboration of the Report

17

3.9. Measurement Techniques and Calculation Basis

20

3.10. Consequences of any Restatement of Information

17

3.11. Significant Changes

08 e 17

3.12. Localization of Information

48, 50 e 52

3.13. External Verification

GRI application level

4. Governance, Commitments and Engagement

17

4.1. Governance Structure

17

4.2. Identification of Main Executive Officers

09 e 11

4.3. Independent Council Members

Not Avaliable

4.4. Communication Channels with the Council

38

4.5. Yield for Sustainability

Not Avaliable

4.6. Conflicts of Interests

19

4.7. Council Members Qualifications

Not Avaliable

49


50

Desempenho Econômico

4.8. Valores, códigos e princípios internos

17

4.9. Atuação do Conselho na avaliação do desempenho de sustentabilidade

17

4.10. Autoavaliação do Conselho na avaliação do desempenho de sustentabilidade

Não disponível

4.11. Princípio da precaução

20

4.12. Cartas, princípios e iniciativas

17

4.13. Participação em associações

19

4.14. Relação dos stakeholders

16

4.15. Identificação dos stakeholders

16

4.16. Engajamento dos stakeholders

16

4.17. Demandas dos stakeholders

16

Forma de Gestão

20

Desempenho Ambiental

23

EN3. Energia direta

23

EN11. Áreas Protegidas

24

EN12. Impactos na Biodiversidade

26

EN13. Habitat protegido ou restaurado

25

EN14. Gestão do impacto na biodiversidade

26

EN16. Emissões diretas e indiretas de gases do efeito estufa

27

EN18. Iniciativa para redução de emissões

27

EN22. Peso total de resíduos

29

EN26. Mitigação de impactos ambientais de produtos e serviços

30

EN28. Multas Ambientais

31

EN30. Investimento em proteção ambiental

31

Desempenho Social

33

LA1. Perfil dos trabalhadores

34

LA2. Taxa de rotatividade

34

LA3. Benefícios

33

LA4. Negociação coletiva

33

LA5. Prazo mínimo para notificação com antecedência de mudanças operacionais

33

LA6. Percentual de empregados representados por comitês

35

LA8. Assistência aos empregados em casos de doenças graves

35

LA9. Temas cobertos por acordos com sindicato

35

LA10. Horas de treinamento

37

LA12. Análise de desempenho e desenvolvimento de carreira

38

HR4. Casos de discriminação e medidas tomadas

Sem registro em 2010

HR6. Operações com risco de ocorrência de trabalho infantil

19


Economic Performance 4.8. Values, Codes and Internal Principles

17

4.9. Participation of the Council in Evaluation of Sustainability Performance

17

4.10. Self-Evaluation of the Council in Evaluation of Sustainability Performance

Not Avaliable

4.11. Precaution Principle

20

4.12. Letters, Principles and Initiatives

17

4.13. Participation in Associations

19

4.14. Relationship of the stakeholders

16

4.15. Identification of the stakeholders

16

4.16. Engagement of the stakeholders

16

4.17. Demands of the stakeholders

16

Form of Management

20

Environmental Performance

23

EN3. Direct Energy

23

EN11. Protected Areas

24

EN12. Impacts on Biodiversity

26

EN13. Protected or Restored Habitat

25

EN14. Impact Management on Biodiversity

26

EN16.Direct and Indirect Emissions of Greenhouse Gases

27

EN18. Initiative for Emission Reduction

27

EN22. Total Weight of Waste

29

EN26. Mitigation of Environmental Impacts of Products and Services

30

EN28. Environmental Fines

31

EN30. Investment on Environmental Protection

31

Social Performance

33

LA1. Workers’ Profile

34

LA2. Turnover Rate

34

LA3. Benefits

33

LA4. Collective Bargaining

33

LA5. Minimal Deadline for Advance Notice of Operational Changes

33

LA6. Percentage of Employees represented by Committees

35

LA8. Assistance to Employees in case of Critical Illnesses

35

LA9. Issues covered by Agreements with the Union

35

LA10. Hours of Training

37

LA12. Analysis of Performance and Career Development

38

HR4. Cases of Discrimination and Measures Taken

No register in 2010

HR6. Operations with risk for incidents of child labor

19

51


52

Desempenho Econômico

HR7. Operações com risco de trabalho forçado

18

SO1. Gestão de impactos

38

SO3. Treinamento anticorrupção

19

SO4. Medidas tomadas em casos de corrupção

Nenhum caso de corrupção identificado no período.

SO8. Multas e sanções

Nenhuma multa no período.

PR1. Avaliação de impactos

38 e 39

PR3. Rótulos de produtos

39

PR6. Adesão às normas

39

PR9. Multas

39

Desempenho econômico

41

EC1. DVA

41

EC2. Mudanças climáticas

41 e 42

EC4. Subsídios

Em 2010, a Cikel não recebeu benefícios fiscais.

EC5. Relação salário mínimo interno/local

42

EC6. Gastos com fornecedores locais

42

EC7. Contratação local

43

EC8. Investimentos em infraestrutura

43

EC9. Impactos econômicos indiretos

43


Economic Performance

HR7. Risky Operations

18

SO1. Impacts Management

38

SO3. Anti-Corruption Training

19

SO4. Measures Taken in cases of Corruption

None case corruption identifield in the period.

SO8. Fines and Sanctions

No fine in the period.

PR1. Impact Evaluation

38 and 39

PR3. Label of Products

39

PR6. Adhesion to Rules

39

PR9. Fines

39

Economic Performance

41

EC1. VAS

41

EC2. Climate Changes

41 and 42

EC4. Subsidy

In 2010 Cikel did not receive tax benefits.

EC5. Internal / Local Minimal Wage Relation

42

EC6. Expenditure with Local Suppliers

42

EC7. Local Recruitment

43

EC8. Investments in Infrastructure

43

EC9. Indirect Economic Impacts

43

53


54

Informações Corporativas

Corporate Information:

Grupo Cikel – Sede Administrativa Rua Desembargador Westphalen, 2779 – Rebouças Curitiba – PR – Brasil Cep: 80.220-030 Tel: +55 41 2169-8200 www.cikel.com.br

Cikel Group – Head Office Rua Desembargador Westphalen, 2779 – Rebouças Curitiba – PR – Brazil Zip Code: 80.220-030 Phone: +55 41 2169-8200 www.cikel.com.br

Grupo Cikel – Responsabilidade Socioambiental Estrada 40 horas, 17, - km 04 Ananindeua – PA – Brasil CEP: 67.120-370 Tel: +55 91 4005-9955 www.cikel.com.br

Cikel Group – Social and Environmental Responsability Estrada 40 horas, 17, - km 04 Ananindeua – PA – Brazil Zip Code: 67.120-370 Phone: +55 91 4005-9955 www.cikel.com.br

Contato

Contact

O Grupo Cikel está disponível para oferecer mais informações ou receber comentários sobre este Relatório, através do contato:

Cikel Group is available to provide further information and to receive comments about this report. Please contact:

Karen Anjos Gerente de Responsabilidade Social E-mail: karen@cikel.com.br Fone: +55 91 4005-9935 Fax: +55 91 3273-1808

Karen Anjos Social Responsability Manager E-mail: karen@cikel.com.br Phone: +55 91 4005-9935 Fax: +55 91 3273-1808

Créditos

Credits

Coordenação: Departamento de Responsabilidade Socioambiental – Grupo Cikel. Consultoria GRI: SESI/PA e SESI/SC Fotos: Banco de imagens do Grupo Cikel Projeto Gráfico: Consultoria em Responsabilidade Corporativa SESI/SC Tradução: Sheime Denadai Impressão: Gráfica Exklusiva Tiragem: 1000 exemplares

Coordination: Social and Environmental Responsability Department – Cikel Group GRI Consulting: SESI/PA e SESI/SC Photos: Company’s files Graphic Design: SESI/SC – Corporate Responsability Consulting Translation: Sheime Denadai Printing: Gráfica Exklusiva Print Run: 1000 issues

O Grupo Cikel agradece a todos colaboradores envolvidos no levantamento das informações constantes nesta edição do Relatório de Sustentabilidade.

Cikel Group is thankful to all collaborators invoved in gathering information for this edition of the Sustainability Report.


Cikel 2010 Sustainability Report  

Cikel 2010 Sustainability Report

Advertisement
Read more
Read more
Similar to
Popular now
Just for you