Issuu on Google+

Page 1

94

L’ I M M O B I L I E R D E P R E S T I G E S U I S S E

AO Û T- S E P T E M B R E 2 015 - C H F 15 . -

16:12

SCHWEIZER LUXUS IMMOBILIEN

IMMOBILIER VAUD FORCE D’ATTRACTION WAADT - STARKE ANZIEHUNGSKRAFT

SCHWEIZER LUXUS IMMOBILIEN

29.7.2015

L’ I M M O B I L I E R D E P R E S T I G E S U I S S E

Projet1

DÉCORATION SALLES DE BAINS - SPAS N°94 - CHF 15.-

BADEZIMMER - SPAS


Projet1

29.7.2015

16:13

Page 3

Accès direct à notre magazine exclusif.

VENTE IMMEUBLE, VILLA, APPARTEMENT, TERRAIN

www.brolliet.ch

PRESTIGE | GÉRANCE | COPROPRIÉTÉS | VENTES IMMEUBLES | IMMOBILIER COMMERCIAL | PROMOTION IMMOBILIÈRE | VENTES & LOCATIONS RÉSIDENTIELLES


h94-001-016.qxd

31.7.2015

10:42

Page 1

94

EDIT O

UN SECTEUR SAIN ET RÉGULÉ EIN GESUNDER UND REGULIERTER SEKTOR Permettez-moi d’oser un rêve… Et si nous vivions dans un monde qui ne délivrait pas chaque semaine son lot de crises économiques et financières? Car enfin, soyons sérieux ; alors que l’Europe est aujourd’hui parvenue, semble-t-il, à une certaine maturité politique, voilà qu’elle s’étripe sur des questions de dette publique et de monnaie commune, dont la Confédération est heureusement à l’écart. N’y aurait-il pas moyen d’unir les efforts de tous les pays riches pour venir en aide à ceux qui en réellement besoin? Ne sommes-nous pas en train de gâcher ce qui devrait être une période de prospérité? Je ne m’étendrai pas plus sur cette question, qui relève d’autres magazines que celui que vous tenez entre vos mains… Nous devons ici parler d’immobilier et cette crise, pour importante qu’elle soit en termes de milliards de dollars, ne doit pas nous faire oublier que le marché suisse est un secteur sain, régulé et en hausse générale constante. Le très haut de gamme, avec la part de rêve qu’il véhicule, semble plus solide que jamais. Nos pages vont une fois de plus le prouver. Ce numéro 94 d’Helvetissimmo lance un coup de projecteur sur les merveilles cachées du canton de Vaud. Mais de Genève au Tessin, chaque canton recèle son lot d’objets exceptionnels, qui n’attendent qu’une chose, leur futur propriétaire. Et si c’était vous?

Gestatten Sie mir zu träumen… Wenn wir in einer Welt lebten, die nicht jede Woche ihren Anteil an Wirtschafts- und Finanzkrisen offenbarte? Denn, seien wir seriös; während Europa heute zu einer gewissen politischen Maturität gekommen zu sein scheint, zerreist es sich in Fragen der Staatsschuld und gemeinsamen Währung, von denen die Eidgenossenschaft zum Glück nicht betroffen ist. Gäbe es keine Möglichkeit, dass in vereinten Bemühungen die reichen Länder denen, die wirklich in Not sind, zu Hilfe kommen? Sind wir nicht dabei das, was eine Wohlstandsperiode sein sollte, zu verderben? Ich werde mich über diese Frage nicht weiter verbreiten, sie betrifft andere Magazine als dieses, was sie in Händen halten... Wir sollen über Immobilien sprechen, und dass wir trotz dieser Krise, gleich auf wie viele Milliarden Dollars sie sich beläuft, nicht vergessen dürfen, dass der Schweizer Markt ein gesunder Sektor ist, reguliert und in allgemeiner ständiger Erhöhung. Die Spitzenklasse, mit ihrem Anteil Traum, den sie verbreitet, scheint solider denn je zuvor. Unsere Seiten werden es einmal wieder beweisen. Diese Ausgabe 94 von Helvetissimmo richtet ihre Scheinwerfer auf die verborgenen Wunder des Kantons Waadt. Aber von Genf bis zum Tessin, verbirgt jeder Kanton sein Los an außergewöhnlichen Objekten, die nur eins erwarten, ihren zukünftigen Besitzer. Und wenn Sie das wären?

Laurent Caillaud,

Rédacteur en chef / Chefredakteur

LUX-RESIDENCE.COM

1


h94-001-016.qxd

31.7.2015

10:42

Page 2

GROUP

ALTAVISTA Vista Alegre, Ibiza

At the heart of an exceptionnal and secure private area, Vista Alegre located in 15 minutes to Eivissa , to the airport and near to the most famous beaches The Prestige Properties is building a high-end Estate with luxurious unexpected finishes and an extraordinary view on the Mediterranean sea. ALTAVISTA is a 2250-square meters prestigious property composed by a main Villa and a guest house, 9 suites-rooms, 5 pools, 2 jacuzzi, a home-cinema, 1 lift car garage, a disco, and an access to a private Beach. Being an owner with The Prestige Properties is having the luxury to be at home in one of the most beautiful place on earth. Delivery Summer 2016

Your personal contact : The Prestige Properties Ibiza by Martin Chedler Paseo Juan Carlos I 39, 07800 Ibiza ( Islas Baleares ) + 34 871 718 060 wwww.theprestigeproperties.com I info@theprestigeproperties.com

Creating Exception mauritius


h94-001-016.qxd

31.7.2015

10:42

Page 3

Août-Septembre 2015

94

SOMMAIRE INHALT

Photo de couverture Bien mis en vente en p. 100 BARNES International Luxury Real Estate Groupe Gérofinance-Dunand | Régie de la Couronne Grand-Rue 14 - 1095 Lutry Tél.: +41 (0)21 796 35 35 www.barnes-suisse.com

Concept Multimédia (Switzerland) SA Route des Jeunes 5D - CH-1227 Carouge Tél.: +41 (0)22 307 12 23 - Fax: +41 (0)22 307 12 22 info@helvetissimmo.ch - www.lux-residence.com

Direction / Direktion Directeur de la publication / Publication Direktor Cyril Janin Directeur / Direktor Franck Paignon +41 (0)79 364 28 62 franck.paignon@helvetissimmo.ch

Rédaction / Redaktion Laurent Caillaud Communication laurent.caillaud@helvetissimmo.ch Directeur Artistique / Artdirekteur Alexandre Perrelet-Carrera a.perreletcarrera@gmail.com Assistante de production / Produktionsassistent Maria Agramunt Ont collaboré à ce numéro / Mitarbeiter dieser Ausgabe L.C., Marie Rizk, Thinkstockphotos.fr Traduction / Übersetzung Louise Blasi, Lawtank, Monika Gierse, Agad Traductions

006

ACTUALITÉS

TEETIME BEI F.P.JOURNE

016

SHOPPING

DES GOÛTS ET DES COULEURS FÜR JEDEN GESCHMACK

018

FOCUS

GEROFINANCE-DUNAND | RÉGIE DE LA COURONNE

PARTENAIRE DE L’OMEGA EUROPEAN MASTERS

PARTNER DES OMEGA EUROPEAN MASTERS

020

HORLOGERIE

HEURE D’ÉTÉ SOMMERZEIT

022

VIP ROOM

VALÉRIE MESSIKA CÉLÉBRER L’AUDACE WER WAGT, GEWINNT

024

AUTO

VOLVO XC90 ELOGE DE LA SOBRIÉTÉ BEWÄHRTE FACHKUNDIGKEIT

030

DÉCORATION

Impression Swissprinters www.swissprinters.ch

SALLES DE BAINS/SPAS UN AIR DE RENOUVEAU BADEZIMMER/SPAS - EIN NEUER FRÜHLING

038 Abonnements / Abonnement Dynapresse +41 (0)22 308 08 08 abonnements@dynapresse.ch

F.P. JOURNE À L’HEURE DU TEE

FOCUS

ELITE UN INVESTISSEMENT DURABLE POUR VOTRE BIEN-ÊTRE EINE NACHHALTIGE INVESTITION FÜR IHR WOHLBEFINDEN

040

FOCUS

DÔME ART ET DÉCORATION KUNST UND DEKORATION

...... LUX-RESIDENCE.COM

3


h94-001-016.qxd

31.7.2015

10:42

Page 4

Août-Septembre 2015

SOMMAIRE

94

INHALT

044

FOCUS

VAUD FORCE D’ATTRACTION WAADT - STARKE ANZIEHUNGSKRAFT

050

FOCUS

GRANGE & CIE SA L’IMPLANTATION À NYON

20

p.

NIEDERLASSUNG IN NYON

052

FOCUS

NAEF IMMOBILIER UNE NOUVELLE AGENCE À VEVEY EINE NEUE AGENTUR IN VEVEY

056

FOCUS

BERNARD NICOD UNE RELATION DE CONFIANCE EINE VERTRAUENSSACHE

058

SUISSE

122

MONTAGNE

130

ÉTRANGER

144 30

p.

SCHWEIZ

BERG

AUSLAND

Publicité commerciale / Anzeigenwerbung Valérie Sergent +41 (0)79 555 99 63 v.sergent@helvetissimmo.ch

Publicité immobilière / Immobilien-Werbung Genève - Neuchâtel - Fribourg / Genf - Neuenburg - Freiburg Yamine Aissaoui +41 (0)79 840 51 28 yaissaoui@helvetissimmo.ch Vaud / Waadt Corinne Vibert +41 (0)78 907 22 20 c.vibert@helvetissimmo.ch Tessin - Valais - Suisse alémanique / Ticino - Wallis - Deutschschweiz Valérie Sergent +41 (0)79 555 99 63 v.sergent@helvetissimmo.ch

Marketing, Communication / Marketing, Kommunikation Pauline Spriet, Julie Garnier

INDEX Diffusion Responsable Diffusion Frédéric Chossis Suisse alémanique / Deutschschweiz Valora AG Suisse romande / Welsche Schweiz Naville SA

Tirage: 12’000 exemplaires Tirage certifié ∑ REMP Reproduction même partielle interdite. Jegliche, selbst teilweise Reproduktion ist untersagt. Copyright CONCEPT MULTIMEDIA (SWITZERLAND) SA 2004. Le magazine n’est pas responsable des textes, documents, photos qui lui sont envoyés. Für eingesandte Texte, Dokumente, Fotos wird keine Haftung übernommen.

Une publication du groupe Spir communication / Eine Publikation der Gruppe Spir communication. Edité par Concept multimédia (SWITZERLAND) SA 2004. Herausgegeben von Concept multimédia (SWITZERLAND) SA 2004.

4

HELVETISSIMMO


h94-001-016.qxd

31.7.2015

10:42

Page 5


h94-001-016.qxd

31.7.2015

10:43

Page 6

ACTUALITÉS

Par L.C.

F.P. JOURNE

À L’HEURE DU TEE

La compétition de golf organisée chaque été par F.P. Journe à Cologny est désormais une tradition !

TEETIME BEI F.P.JOURNE Der jeden Sommer von F.P. Journe in Cologny organisierte Golf-Wettbewerb ist von nun ab eine Tradition! Le samedi 13 juin dernier, F.P. Journe a organisé pour la troisième année consécutive au Golf Club de Genève (Cologny) une compétition qui, en clin d’œil à ses montres à complication, adoptait la formule compliquée du «Greensome, Stabelford». L’occasion pour l’horloger de prestige de présenter deux modèles de la lineSport en Titane, le Centigraphe Sport, chronographe à remontage manuel mesurant le 100e de seconde et l’Octa Sport automatique avec grande date, réserve de marche et indication jour nuit. F.P. Journe a récompensé les gagnants en brut, M. et Mme Rodrigo Lacerdo Suarez, qui ont chacun reçu un bon pour un dîner au restaurant Tse Fung de la Réserve Hôtel & Spa Genève. Le classement net a récompensé les premiers, MM. Serge Nordmann et Marc Girard, qui ont reçu un Jéroboam de champagne Laurent Perrier, et les seconds, Mme Caroline Barbier-Mueller et M. Maxime de Raemy qui ont reçu un bon cadeau du décorateur Ars Vivendi. Les gagnants de la catégorie invités MM. William Newmann et Richard Sheiner ont reçu un stylo Caran d’Ache en argent. Les gagnants de la catégorie Junior, Riccardo Fiammingo et Victor Bouvier, ont reçu un sac de golf F.P. Journe. Le tirage au sort a récompensé Mme Cécile Gagnebin qui a remporté une magnifique horloge de bureau F.P. Journe «Octa Sport», et Mme Elizabeth Couson a reçu un bon pour une visite de la Manufacture F.P. Journe!

Am letzten Samstag, dem 13. Juni, organisierte F.P. Journe im dritten aufeinanderfolgenden Jahr im Golf Club de Genève (Cologny) einen Wettbewerb der mit einem Wink auf seine Komplikationen die komplizierte Formel des „Greensome, Stabelford“ übernommen hatte. Für den Uhrmacher war es die Gelegenheit, zwei Modelle der LineSport aus Titan vorzustellen, den Centigraphe Sport, Chronograph mit Handaufzug, der die Hundertstelsekunde anzeigt und die Octa Sport mit Automatikaufzug mit Datum in Großformat, Gangreserve und Tag-/Nachtanzeige. F.P. Journe hat die Gewinner im Bruttopreis, M. und Mme Rodrigo Lacerdo Suarez prämiert, sie haben jeweils einen Gutschein für ein Diner im Restaurant Tse Fung der Réserve Hôtel & Spa Genève erhalten. Die Netto-Klassifizierung hat die ersten, MM. Serge Nordmann und Marc Girard prämiert, sie haben eine 3l-Flasche Champagner Laurent Perrier erhalten, und die zweiten, Mme Caroline Barbier-Mueller und M. Maxime de Raemy, erhielten einen Geschenkgutschein des Dekorateurs Ars Vivendi. Die Gewinner der Kategorie Gäste, MM. William Newmann und Richard Sheiner, haben einen Füllfederhalter Caran d’Ache aus Silber erhalten. Die Gewinner der Kategorie Junior, Riccardo Fiammingo und Victor Bouvier, haben eine Golftasche F.P. Journe erhalten. Bei der Verlosung gewann Mme Cécile Gagnebin eine prächtige Schreibtischuhr F.P.Journe „Octa Sport“, und Mme Elizabeth Couson erhielt einen Gutschein für einen Besuch der Manufacture F.P. Journe!

www.fpjourne.com 6

HELVETISSIMMO


h94-001-016.qxd

31.7.2015

10:43

Page 7

AND ZERL T I W S

TION I B I EXH ART

FREE ENTRY ARTWORKS FOR SALE

OCTOBER, 17 | DECEMBER, 18 | 2015 EVERYDAY FROM 10 A.M. TO 6 P.M.

Zürich

IN ART WE TRUST

Lugano Airport

SHARING | EDUCATION | TRADE CAMENISCH, MÜLLER

LE CORBUSIER

AGAM

MODIGLIANI

GIACOMETTI

SEGANTINI

BASQUIAT

PICASSO

HERMANN HESSE

VALENTI

FONTANA

WEREFKIN & MORE...

VIA PEDEMONTE DI SOPRA, 1 - TEL. +41 91 649 33 36 6818 MELANO | TICINO | SWITZERLAND

www.artrust.ch info@artrust.ch

Lugano

Maroggia-Melano Mendrisio

Milan -Italy

Behind Maroggia-Melano train station


h94-001-016.qxd

31.7.2015

10:43

Page 8

ACTUALITÉS

Par L.C./ Photos D.R.

L’AIRBUS A310 ZERO-G

S’ENVOLE POUR LA SUISSE ! DER AIRBUS A310 ZERO-G FLIEGT IN DIE SCHWEIZ ! Dans le cadre d’un partenariat entre l’Université de Zürich et Novespace, l’Airbus A310 ZERO-G effectuera les 21 et 22 septembre prochains, deux vols en apesanteur à partir de l’aéroport de Zürich-Dübendorf. C’est la première fois que cet avion sera opéré depuis un autre pays que la France! Depuis une dizaine d’années des chercheurs zurichois participaient aux vols paraboliques organisés par Novespace. Ils ont ainsi eu l’occasion d’y développer un savoir-faire ainsi que de nombreuses expériences en apesanteur au point, aujourd’hui, qu’une forte demande de vols paraboliques existe au sein des laboratoires de l’UZH. Les vols du ZERO-G se dérouleront à partir de la base aérienne de Dübendorf, au nord-est de Zürich, qui est considérée comme le berceau de l’aviation civile et militaire suisse depuis 1910. Des vols de découverte de l’apesanteur vont être vendus à un public non-professionnel. Les bénéfices récoltés permettront aux scientifiques de l’université zurichoise de voler, à leur tour, à bord du ZERO-G afin d’y conduire leurs expériences. Ce «fundraising» particulier peut aussi être renforcé par des dons et legs effectués par les mécènes suisses. Im Rahmen einer Partnerschaft zwischen der Universität Zürich und Novespace, führt der Airbus A310 ZERO-G am 21. und 22. September zwei Flüge in die Schwerelosigkeit durch, ab dem Flugplatz Zu_rich-Du_bendorf. Es ist das erste Mal, dass dieses Flugzeug von einem anderen Land als Frankreich aus startet! Seit cirka zehn Jahren nehmen Wissenschaftler aus Zürich an von Novespace organisierten Parabel-Flügen teil. Sie hatten so die Gelegenheit ihr Wissen in zahlreichen Experimenten in Schwerelosigkeit auszuweiten, so dass heute eine starke Nachfrage nach Parabel-Flügen in den Versuchslaboren der UZH besteht. Die Flüge der ZERO-G finden auf dem Luftstützpunkt von Dübendorf im Nord-Osten von Zürich statt, der als die Wiege der Schweizer Zivil- und Militärluftfahrt seit 1910 betrachtet wird. Entdeckungsflüge in Schwerelosigkeit werden einem nicht professionellen Publikum verkauft werden. Der Erlös wird den Wissenschaftlern der Universität Zürich gestatten, selbst an Bord der ZERO-G zu fliegen um ihre Experimente zu machen. Dieses besondere „fundraising“ kann auch durch Spenden und Vermächtnisse durch Schweizer Mäzene unterstützt werden. www.microgravity.ch

«ONLY WATCH»

À GENÈVE BOTSCHAFTERIN DES LUXUS Soutenant les recherches sur la Myopathie de Duchenne, la sixième édition de Only Watch se tiendra pour 2015 le 7 novembre à Genève, en avant-première de la semaine des ventes horlogères qui réunit de nombreux collectionneurs et amateurs d’horlogerie. La vente aux enchères sera orchestrée par le nouveau département montres de la maison Phillips, en collaboration avec Aurel Bacs, commissaire-priseur et expert de renom. Les fonds recueillis seront versés à 15 partenaires scientifiques totalisant 90 chercheurs et cliniciens basés dans cinq pays différents. Les plus grands horlogers ont répondu présent pour ces enchères caritatives, à l’image de Van Cleef & Arpels qui a créé pour l’occasion une pièce unique, née de l’excellence de son savoir-faire et de sa conception du «Temps Poétique» (ci-contre). Zur Unterstützung der Forschung der Duchenne- Muskeldystrophie findet die sechste Ausgabe der Only Watch 2015 am 7. November in Genf statt, in Vorpremiere der Uhren-Auktion, die zahlreiche Sammler und Uhren-Amateure vereint. Die Auktion wird von der neuen Uhrenabteilung des Hauses Phillips organisiert, in Zusammenarbeit mit Aurel Bacs, dem renommierten Versteigerer und Experten. Der Erlös wird an 15 wissenschaftliche Partner insgesamt 90 Forscher und Kliniker in f��nf verschiedenen Ländern überwiesen. Die renommiertesten Uhrenmarken werden bei dieser karitativen Auktion anwesend sein, so wie Van Cleef & Arpels, der für diesen Anlass ein einmaliges Stück geschaffen hat, mit Exzellenz und Know-how konzipiert, die „Temps Poétique“ (nebenstehend). www.onlywatch.com

8

HELVETISSIMMO


h94-001-016.qxd

31.7.2015

10:43

Page 9


h94-001-016.qxd

31.7.2015

10:43

Page 10


h94-001-016.qxd

31.7.2015

10:43

Page 11


h94-001-016.qxd

31.7.2015

10:43

Page 12


h94-001-016.qxd

31.7.2015

10:43

Page 13


h94-001-016.qxd

31.7.2015

10:43

Page 14


h94-001-016.qxd

31.7.2015

10:43

Page 15

TENDANCE TENDENZEN


h94-001-016.qxd

31.7.2015

10:43

Page 16

SHOPPING

DES GOÛTS ET DES COULEURS L’été 2015 se veut flamboyant, à l’image de ces nouveautés version tout feu tout flamme!

FÜR JEDEN GESCHMACK Der Sommer 2015 kündigt sich funkelnd an, so wie diese Neuheiten, ganz Feuer und Flamme!

DIOR AU SOLEIL Les lunettes de soleil Dior So Real adoptent des verres inédits à double miroir bleu et argent. Die Sonnenbrillen Dior So Real haben ganz neue doppelt verspiegelte Gläser blau und silbern. www.dior.com

HERMÈS ET SES GARDÉNIAS Hermès Parfumeur présente Jour d’Hermès Gardénia, une nouvelle nuance du Jour, intense et contrastée, solaire et végétale… Hermès Parfumeur stellt Jour d’Hermès Gardénia vor, eine neue Nuance, solar und pflanzlich… www.hermes.com

16

HELVETISSIMMO

VIKING ET L’INDUCTION Viking propose une nouvelle plaque à induction, la MagneQuick TM, dont chacun des éléments produit jusqu’à 3'700 watts! Viking bietet ein neues Induktionskochfeld an, MagneQuick TM, in dem jedes Element bis zu 3'700 Watt produziert! www.cuisine-viking.com


h94-017-032.qxd

30.7.2015

15:51

Page 17

Genève - Mies - Rolle - Morges - Yverdon - Bussigny - Lausanne - Lutry - Vevey - Montreux - Sion - Crans-Montana

Paris - Monaco - London - Brussels - Lisbon - Moscow - Los Angeles - New York - Miami - St. Barts - Mauritius

www.barnes-suisse.com


h94-017-032.qxd

30.7.2015

15:51

Page 18

FOCUS

GEROFINANCE-DUNAND | RÉGIE DE LA COURONNE

PARTENAIRE DE L’OMEGA EUROPEAN MASTERS Pour la 7e année consécutive Gerofinance-Dunand | Régie de la Couronne a participé comme sponsor officiel à l’Omega European Masters de Crans-Montana.

PARTNER DES OMEGA EUROPEAN MASTERS Im 7. aufeinanderfolgenden Jahr hat Gerofinance-Dunand | Régie de la Couronne als offizieller Sponsor an dem Omega European Masters von Crans-Montana teilgenommen. BARNES Suisse, la division de luxe du groupe GerofinanceDunand | Régie de la Couronne, a accueilli ses invités du 23 au 26 juillet derniers lors de cette prestigieuse compétition, sur le golf de Crans-Montana. L’occasion pour Jérôme Félicité, président du groupe, Jean-Christophe Delacrétaz, directeur général et Marc d’Andiran, responsable des deux agences du Valais, accompagnés d’une dizaine de collaborateurs, de recevoir dans une magnifique loge avec terrasse plus de 350 invités VIP, clients, prospects et relations d’affaires. BARNES Suisse a pu compter sur une météo idéale pour offrir aux amateurs de golf de se rencontrer dans une atmosphère conviviale et chaleureuse sur le parcours et autour d’un buffet d’une qualité saluée par tous les participants.

18

HELVETISSIMMO

BARNES Suisse, die Luxusabteilung der Gruppe GerofinanceDunand | Régie de la Couronne, hat ihre Gäste vom 23. bis 26. Juli anlässlich dieses renommierten Turniers auf dem Golf von Crans-Montana empfangen. Für Jérôme Félicité, Präsident der Gruppe, Jean-Christophe Delacrétaz, Generaldirektor und Marc d’Andiran, verantwortlich für die zwei Agenturen im Wallis, begleitet von etwa zehn Mitarbeitern, bot sich hier die Gelegenheit, in einer prächtigen Loge mit Terrasse mehr als 350 VIP-Gäste, Kunden, Interessenten und Geschäftsbeziehungen zu empfangen. BARNES Suisse konnte auf ein ideales Wetter zählen zum Treffen der Golfamateure in einer gastfreundlichen und gemütlichen Stimmung auf dem Parcours und versammelt um ein von allen Teilnehmern gelobten Buffet!


h94-017-032.qxd

30.7.2015

15:51

Page 19

L’agence BARNES à Crans-Montana a été ouverte avec un horaire spécialement adapté pour recevoir la clientèle sur place durant les 4 jours de cet événement. Par ailleurs, un cocktail organisé pour les clients et propriétaires de la région a eu lieu le vendredi 24 juillet dans ses propres locaux.

Die Agentur BARNES in Crans-Montana hatte besondere Öffnungszeiten, um die anwesende Kundschaft während der 4 Tage dieses Events zu empfangen. Für die Kunden und Besitzer der Region wurde am Freitag, dem 24. Juli in den eigenen Räumen ein Cocktail organisiert.

ELITE DES JOUEURS EUROPÉENS

ELITE DER EUROPÄISCHEN SPIELER

Côté sportif, ce 69e Omega European Masters, qui a réuni l’élite des joueurs européen, aura été marqué par un suspense ayant duré jusqu’au dernier trou: l’Anglais Danny Willet s’est en effet imposé avec un score final de -17 sur l’ensemble de l’épreuve, devant ses compatriotes Matthew Fitzpatrick et Tyrell Hatton, qui finissent respectivement à -16 et -15. Au palmarès, Danny Willet succède à des champions de légende comme Severiano Ballesteros, José Maria Olazabal, Sergio Garcia, Colin Montgomerie ou Ernie Els! Cette compétition est en effet l'une des plus prestigieuses du continent européen, le GolfClub de Crans-sur-Sierre étant le site le plus spectaculaire du calendrier de l'European Tour!

Was den Sport anbetrifft, hat dieses 69. Omega European Masters die Elite der europäischen Spieler vereint, mit einer Spannung, die bis zum letzten Loch anhielt: der Engländer Danny Willet setzte sich mit einem Final Score von -17 insgesamt durch vor seinen Landsleuten Matthew Fitzpatrick und Tyrell Hatton, die jeweils mit -16 et -15 abschließen. Auf der Preisträgerliste folgt Danny Willet den legendären Champions, wie Severiano Ballesteros, José Maria Olazabal, Sergio Garcia, Colin Montgomerie oder Ernie Els!

INFORMATIONS: BARNES – Crans-Montana Rue Centrale 15 CH-3963 Crans-Montana Tél.: +41 (0)27 485 42 00 www.barnes-suisse.com www.gerofinance-dunand.ch

Dieses Turnier ist in der Tat das renommierteste des europäischen Kontinents, der Golf-Club von Crans-sur-Sierre ist der prestigereichste Ort des European Tour- Kalenders!

LUX-RESIDENCE.COM

19


h94-017-032.qxd

30.7.2015

15:51

Page 20

HORLOGERIE

HEURE D’ÉTÉ

L’arrivée des beaux jours est l’occasion rêvée de goûter sans modération aux nouveautés présentées par la planète horlogère.

SOMMERZEIT Das Eintreffen der schönen Tage ist die erträumte Gelegenheit ohne Einschränkung die Neuheiten der Uhrenwelt zu erforschen.

LA CRÉATIVITÉ DE MB&F Le laboratoire horloger genevois MB&F présente, en collaboration avec L'Epée 1839, Melchior: un robot cinétique impressionnant mais aussi une horloge de table mécanique composée de 480 composants aux finitions parfaites! Das Genfer Uhren-Laboratorium MB&F stellt in Zusammenarbeit mit L'Epée 1839, Melchior vor: einen eindrucksvollen kinetischen Roboter, aber auch eine mechanische Tischuhr bestehend aus 480 Teilen mit feinsten Verarbeitungen! www.mbandf.com LANGE RAJEUNIT LA SAXONIA Les trois nouveau-nés de la collection Saxonia d’A. Lange & Söhne sont désormais disponibles! La marque fait souffler un vent de jeunesse sur sa collection mythique lancée en 1994 en présentant, 21 ans plus tard, ces trois garde-temps aux cadrans dynamiques et vigoureux. Die drei Neugeborenen der Kollektion Saxonia von A. Lange & Söhne sind von nun an verfügbar! Die Marke lässt eine Verjüngungswelle über ihre mythische, 1994 lancierte Kollektion wehen und präsentiert 21 Jahre später diese drei Zeitmesser mit dynamischen und kräftigen Zifferblättern. www.alange-soehne.com

20

HELVETISSIMMO


h94-017-032.qxd

30.7.2015

15:51

Page 21

Par Marie Rizk

PEQUIGNET AU SEPTIÈME CIEL La manufacture Pequignet présente cette montre aviateur, dont l’allure militaire reprend un cadran à l’apparence classique associé à une fonctionnalité et une fiabilité remarquables. Die Manufaktur Pequignet stellt diese Fliegeruhr vor, deren militärisches Aussehen ein Zifferblatt von klassischer Art übernimmt verbunden mit einer beachtlichen Funktionalität und Verlässlichkeit. www.pequignet.com

DE BETHUNE AU GRÉ DU TEMPS Issu d’une tradition séculaire de métiers d’art et de gravure, le cadran en or massif de la DB25 Quetzalcoatl, façonné par la graveuse Michèle Rothen d’après les dessins de David Zanetta poursuit les nombreux travaux et explorations des fondateurs de la marque De Bethune. Entstanden aus Jahrhunderte langer Tradition von Kunsthandwerk und Grafik, das Zifferblatt aus Massivgold der DB25 Quetzalcoatl, von der Graveurin Michèle Rothen nach dem Entwurf von David Zanetta geformt, setzt die zahlreichen Arbeiten und Erkundungen der Gründer der Marke De Bethune fort. www.debethune.ch

HYT COMME VOUS NE L’AVEZ JAMAIS VU HYT révèle le lancement d’une collection complète de trois montres en édition limitée. Les trois pièces de la collection H1 Air explorent des terrains inédits avec leurs designs maritime, camouflage ou art déco. HYT präsentiert die Lancierung einer kompletten Kollektion von drei Uhren in limitierter Ausgabe. Die drei Teile der Kollektion H1 Air begeben sich in unerforschte Gebiete mit ihrem maritimen Design, Camouflage oder Art déco. www.hytwatches.com

LUX-RESIDENCE.COM

21


h94-017-032.qxd

30.7.2015

15:52

Page 22

VIP-ROOM

VALÉRIE MESSIKA

CÉLÉBRER L’AUDACE WER WAGT, GEWINNT 22

HELVETISSIMMO


h94-017-032.qxd

30.7.2015

15:52

Page 23

Par L.C.

En dix ans, la créatrice de Messika a réussi à imposer son nom dans l’univers très fermé de la haute joaillerie. In zehn Jahren ist es der Gestalterin von Messika gelungen, ihren Namen in dem geschlossenen Universum der hohen Juwelierkunst durchzusetzen.

Valérie Messika n’a pas choisi le diamant par hasard. Depuis son enfance, elle écoute les histoires racontées par son père André, acteur majeur du négoce du diamant. Valérie a choisi de s’y consacrer elle aussi, tout en suivant sa propre voie. Elle fonde Messika en 2005, initiant une nouvelle écriture joaillière qui porte en elle la personnalité de sa créatrice, sa jeunesse, sa gaité et sa façon de vivre à 100 à l’heure. Elle place la passion qu’elle porte en elle au centre de toutes les créations. Instinctivement, chaque diamant lui inspire un porté ou un dessin, l’émotion tient à la monture qu’elle imagine en voyant la pierre. Les formes, les motifs et les techniques prévalent, ils ne sont choisis que pour mettre en valeur le caractère unique du diamant, sa qualité, sa taille, sa brillance et ses nuances. Pour ses créations joaillerie et haute joaillerie Valérie Messika porte une extrême attention au serti, taille de pierre, légèreté qui sont à la base de ses recherches esthétiques. Chaque bijou est un concentré de technicité, source inépuisable d’idées et de formes.

Valérie Messika hat nicht per Zufall den Diamanten ausgewählt. Seit ihrer Kindheit hört sie den Geschichten ihres Vaters André zu, bedeutender Marktakteur des Diamantenhandels. Valérie hat beschlossen, sich diesem Handel ebenfalls zu widmen und dennoch ihren eigenen Weg zu verfolgen. Sie gründet 2005 Messika und bringt einen neuen Schriftzug in die Juwelierkunst, der die Persönlichkeit seiner Schöpferin, ihre Jugend ihre Fröhlichkeit und ihre Art in einem hundert StundenkilometerTempo zu leben widerspiegelt. Sie bringt ihre eigene Begeisterung in all ihre Kreationen. Instinktiv inspiriert ihr jeder Diamant eine Haltung oder ein Bild, die Fassung wird von ihrer Emotion beim Anblick des Steins bestimmt. Die Formen, Motive und Techniken sind vorherrschend, sie sind nur ausgesucht, um den einmaligen Charkakter des Diamanten zur Geltung zu bringen, seine Qualität, seine Größe, seine Brillanz und seine Nuancen. Bei ihren Schmuck- und Juwelierkreationen achtet Valérie Messika ganz besonders auf die Fassung, den Schnitt des Steins, Leichtigkeit als Basis für die Suche nach Ästhetik. Jedes Schmuckstück ist ein Konzentrat an Fachwissen, eine unerschöpfliche Quelle an Ideen und Formen.

VISION CONTEMPORAINE

ZEITGENÖSSISCHE VISION

Pour célébrer cette première décennie de créativité, la Maison Messika a inauguré son propre atelier de haute joaillerie au sein de ses bureaux parisiens. Le défi est là: jongler entre modernité et tradition pour créer un univers à part, dans le cercle très fermé des grands noms de la place Vendôme et de la rue Saint-Honoré. Une dizaine d’artisans se penchent chaque jour sur les établis: une dessinatrice, un spécialiste de la conception assistée par ordinateur, un maquettiste, trois joailliers, un sertisseur et une polisseuse y façonnent des pièces uniques. Un savoirfaire ancestral où chaque pièce est une œuvre d’art, fruit d’une chaîne de talents. Chaque moule est classé et précieusement gardé. Dans ce temple discret du sur-mesure, les bijoux prennent la lumière pour la première fois grâce aux mains habiles qui s’activent en coulisse.

Zur Feier dieses ersten Jahrzehnts an Kreativität, hat die Firma Messika ihre eigene Werkstatt hoher Juwelierkunst innerhalb ihrer Pariser Büros eingeweiht. Die Herausforderung: zwischen Modernität und Tradition jonglieren, um ein besonderes Universum zu schaffen, in dem sehr geschlossenen Kreis der großen Namen der Place Vendôme und der Rue Saint-Honoré. Zirka zehn Künstler beugen sich täglich über die Werktische: eine Zeichnerin, ein Konzeptionsspezialist computergestützt, ein Modellbauer, drei Juweliere, ein Edelsteinfasser und eine Poliererin formen hier einmalige Stücke. Ein altüberliefertes Knowhow, bei dem jedes Stück ein Kunstwerk ist, Ergebnis einer Kette von Talenten. Jeder Abdruck wird klassiert und sorgfältig aufbewahrt. In diesem diskreten Tempel für Maßarbeit kommen die Schmuckstücke zum ersten Mal ans Licht dank der geschickten Hände, die hinter den Kulissen arbeiten.

Jusque dans les moindres détails, Valérie Messika a mis sa touche personnelle dans cet espace à la décoration épurée très éloignée des ateliers traditionnels. Un antre à la fois moderne et audacieux, à l’image de cette marque promise à n’en pas douter à un grand destin!

Bis ins kleinste Detail hat Valérie Messika ihre persönliche Note in diesem Raum mit klarer Dekoration angebracht, weit entfernt von den traditionellen Werkstätten. Eine sowohl moderne als auch wagemutige Höhle, so wie diese Marke, der zweifellos eine große Zukunft verheißen ist!

INFORMATIONS: www.messika.com

LUX-RESIDENCE.COM

23


h94-017-032.qxd

30.7.2015

15:52

Page 24

AUTO

VOLVO XC90

ELOGE DE LA SOBRIÉTÉ BEWÄHRTE FACHKUNDIGKEIT

24

HELVETISSIMMO


h94-017-032.qxd

30.7.2015

15:52

Page 25

Par L.C.

Sans renier ses racines, le nouveau Volvo XC90 revendique son statut de SUV premium sept places, doté d’un design affirmé et moins vorace en carburant que son prédécesseur. Ohne seine Wurzeln zu verleugnen, beansprucht der neue Volvo XC90 den Premium-Status eines SUV-Siebensitzers mit überzeugendem Design und weniger gefräßig an Kraftstoff wie seine Vorgänger. Le XC90 marque pour Volvo le début d’un nouveau chapitre, avec l’apparition d’un logo redessiné, dont la flèche s’aligne plus élégamment avec la barre diagonale à travers la grille. Le grand capot avant arbore lui aussi un nouveau style, la ceinture de caisse, les épaules affûtées et les feux arrière repensés étant autant de signatures du futur design de la marque suédoise. L’intérieur est, selon la marque, le plus luxueux jamais conçu pour une Volvo. La caractéristique la plus saisissante réside dans l’écran tactile type tablette qui forme le cœur du tout nouveau système de contrôle intégré. Mais l’habitacle aligne les matériaux nobles, tels que le plus fin des cuirs Nappa, le bois ciselé à la main, et même un levier de vitesses en cristal signé par le verrier suédois Orrefors!

Der XC90 öffnet für Volvo ein neues Kapitel, mit einem neu gezeichneten Logo, der Pfeil passt sich eleganter der Diagonale über dem Kühlergrill an. Die große Motorhaube bekommt ebenfalls einen neuen verlängerten Stil, die Schulterpartien sind verfeinert und die Rücklichter neu gestaltet und bestätigen das zukünftige Design der schwedischen Marke. Das Interieur ist nach Angaben der Firma die luxuriöseste Ausführung die je für einen Volvo geschaffen wurde. Das bedeutendste Merkmal ist das Touchscreen in Form eines Tablet-Bildschirms, was das ganz neue integrierte Kontrollsystem darstellt. Der Innenraum zeigt noble Materialien, feinste Nappa-Leder, Holzapplikationen und sogar einen Schalthebel aus Kristallglas von dem schwedischen Glashersteller Orrefors! Volvo ist bereits dafür bekannt, mit die bequemsten Sitze der Automobilindustrie herzustellen. Der neue XC90 geht noch eine Stufe höher und bietet Sitze in innovativem Design an, die Platz für die Passagiere der zweiten und dritten Reihe schaffen und den XC90 zu einem echten Siebensitzer machen. Jeder Sitz nimmt die ergonomische Form der menschlichen Wirbelsäule an. Die zahlreichen Einstellmöglichkeiten gestatten die ideale Sitzposition zu finden, die neuen Sitze sind mit regulierbaren Seitenlehnen sowie ausdehnbaren Sitzflächen und Massagefunktion erhältlich. Die zweite Reihe ist mit drei individuellen verstellbaren und verschiebbaren Sitzen ausgestattet, um den Passagieren der dritten Reihe mehr Platz zu lassen oder den Laderaum zu vergrößern. Die Sitze der dritten Sitzreihe bieten nach Angaben des Herstellers den Personen bis zu einer Größe von 1,70 m einen Komfort erster Klasse …

LUX-RESIDENCE.COM

25


h94-017-032.qxd

30.7.2015

15:52

Page 26

AUTO

INFORMATIONS: www.volvocars.ch

26

HELVETISSIMMO

Volvo est déjà réputé pour produire des sièges parmi les plus confortables de l’industrie automobile. Le nouveau XC90 monte encore la barre en proposant des sièges au design innovant, qui libèrent de l’espace pour les passagers des deuxième et troisième rangs, faisant du XC90 un véritable 7 places. Chaque siège possède, en effet, une forme ergonomique similaire à la colonne vertébrale humaine. La multitude d’ajustements permet à l’utilisateur de trouver sa position assise idéale, les nouveaux sièges étant disponibles avec des appuis latéraux ajustables, une assise extensible et la fonction massage. Le deuxième rang est équipé de trois sièges individuels inclinables et coulissants afin de laisser plus de place aux passagers du troisième rang, ou pour accroître la capacité de chargement. Les sièges du troisième rang offrent, selon le constructeur un confort de première classe aux passagers mesurant jusqu’à 1,70 m…

POIDS CONTENU Sécurités active et passive sont évidemment de très haut niveau, Volvo Oblige, avec un châssis entièrement nouveau lui aussi, dont les premiers essayeurs ne cessent de chanter les louanges. Le XC90 propose pour son lancement en Suisse une gamme de motorisations 2 litres quatre cylindres essence, diesel et hybride dont les puissances s’échelonnent entre 225 et 400 ch. Tous les moteurs sont couplés à une boîte automatique 8 rapports en série, avec des consommations et des rejets polluants en nette baisse (5,8 l/100 km et 152 g/km de CO2 pour le D5 de 225 ch). Long de 4,95 m pour un poids contenu à 2’005 kg, le XC90 est bardé d’aides à la conduite dès sa version d’entrée de gamme, proposée à CHF 62'200.-. Il ne serait pas surprenant que Volvo tienne là un best-seller capable de tenir la dragée haute à ses concurrents allemands et britanniques!


h94-017-032.qxd

30.7.2015

15:52

Page 27

GEZÄHMTES GEWICHT Die aktiven und passiven Sicherheitstechniken sind selbstverständlich von höchstem Niveau, Volvo verpflichtet, mit einem völlig neuen Chassis, das von den ersten Probefahrern nur gelobt wird. Der XC90 bietet zu seiner Lancierung in der Schweiz eine Motorisierungspalette von Zweiliter Vierzylindermotoren an als Benziner, Diesel und Hybrid mit Leistungen zwischen 225 und 400 PS. Alle Motoren sind serienmäßig mit einer Achtgangautomatik ausgestattet, mit geringerem Kraftstoffverbrauch und CO2-Ausstoss (5,8 l/100 km und 152 g/km an CO2 für den D5 mit 225 PS). Mit einer Länge von 4,95 m bei einem auf 2’005 kg bezähmten Gewicht, der XC90 ist ab dem ersten Modell der Reihe mit vielen Fahrhilfen ausgestattet und wird zu CHF 62'200.- angeboten. Es wäre nicht erstaunlich, wenn Volvo hier einen Bestseller besitzt, der in der Lage ist, die deutschen und britischen Konkurrenten weit hinter sich zu lassen!

LUX-RESIDENCE.COM

27


h94-017-032.qxd

30.7.2015

15:52

Page 28

www.moinat.net Succursale Av. Juste-Olivier 9 CH - 1006 Lausanne Tél. +41 (0)21 320 46 00 Fax +41 (0)21 320 46 04

La Tête-Noire Grand-rue 94 CH - 1180 Rolle Tél. +41 (0)21 825 48 00 Fax +41 (0)21 825 48 04


h94-017-032.qxd

30.7.2015

15:52

Page 29

DÉCORATION DEKORATION


h94-017-032.qxd

30.7.2015

15:52

Page 30

DÉCORATION

SALLES DE BAINS/SPAS

UN AIR DE RENOUVEAU BADEZIMMER/SPAS - EIN NEUER FRÜHLING 30

HELVETISSIMMO


h94-017-032.qxd

30.7.2015

15:52

Page 31

Par L.C.

Chaque saison amène son lot de nouveautés dans cette pièce essentielle qu’est la salle de bains. Jede Saison bringt Neuigkeiten für das Badezimmer, diesen wichtigen Raum.

L’univers de la salle de bains est en perpétuel bouillonnement! Le 11 juin dernier, Bette, le spécialiste de la baignoire en acier vitrifié, a remporté le MIAW 2015 dans la catégorie «Salle de bains» pour sa baignoire BetteLux Shape. Les Muuuz International Awards (MIAW) sont organisés chaque année par l’ArchiDesignClub, en partenariat avec Muuuz, le magazine des professionnels de l’architecture et du design. Durant cette édition 2015, 22’000 professionnels ont récompensé les nouveautés les plus remarquables de l’architecture, de l’agencement et de la décoration, dans les cinq catégories retenues (revêtement, mobilier, éclairage, cuisine & bain et outdoor). Le prix reçu par Bette a été remis à Diane Poteaux, responsable commercial pour l’Europe de l’Ouest, qui a salué la dynamique du fabricant au-delà de ses frontières allemandes: «Pour Bette, c’est un honneur de recevoir cette distinction internationale. Ce prix nous encourage dans notre démarche de promotion du made in Germany dans d’autres pays européens». Conçue par Tesseraux et Partenaires, la baignoire BetteLux Shape en îlot en acier vitrifié dispose d’un corps intérieur doux et fluide, ainsi que d’un rebord presque plat. Elle est insérée dans un cadre en acier ouvert disponible en six coloris: noir, blanc, taupe, sky (bleu), rosé et mint (vert menthe). Le cadre ouvert rend visible de tous les côtés la forme de la baignoire émaillée à l’intérieur comme à l’extérieur.

Die Badezimmerwelt ist in einer ständigen Wallung! Am vergangenen 11. Juni hat Bette, Spezialist für Badewannen aus versiegeltem Stahl, den MIAW 2015 in der Kategorie „Badezimmer“ für seine Badewanne BetteLux Shape gewonnen. Die Muuuz International Awards (MIAW) werden jedes Jahr von dem ArchiDesignClub in Partnerschaft mit Muuuz, dem Fachmagazin für Architektur und Design, organisiert. Während der Edition 2015 haben 22’000 Fachspezialisten die bedeutendsten Neuigkeiten in Architektur, Raumaufteilung und Dekoration belohnt, in den fünf in Betracht gezogenen Kategorien (Auskleidung, Mobiliar, Beleuchtung, Küche & Bad und Outdoor). Der von Bette gewonnene Preis wurde Diane Poteaux, Verkaufsleiterin für Westeuropa, überreicht, die die Dynamik des Fabrikanten weit über die deutschen Grenzen hinaus lobte: „Für Bette ist es eine Ehre, diese internationale Auszeichnung zu erhalten. Dieser Preis ermutigt uns in unserer Promotion des Made in Germany in weiteren europäischen Ländern“. Von Tesseraux + Partner geschaffen, die freistehende Badewanne BetteLux Shape aus Stahl/Email hat einen weich fließenden Innenkörper und flach auslaufenden Wannenrand. Sie wird in ein offenes Stahlgestell gesetzt, was in sechs verschiedenen Farben verfügbar ist: schwarz, weiß, taupe, sky (himmelblau) rosé und mint (minzgrün). Der offene Rahmen zeigt die Form der Badewanne von allen Seiten, sowohl von innen als auch von außen.

Dans un style diamétralement opposé, la marque Victoria + Albert, reconnue pour ses créations originales de baignoires et vasques en îlot, a lancé cette année sa première gamme de meubles, marquant ainsi son entrée dans le

In einem diametral gegensätzlichen Stil hat die Marke Victoria + Albert, die für ihre originellen Kreationen an Badewannen und freistehenden Waschtischen bekannt ist, dieses Jahr zum ersten Mal eine Möbelserie herausgebracht

LÉGENDES: Photos Carré Bleu / Schmidt / Bradstone / Bette

LUX-RESIDENCE.COM

31


h94-017-032.qxd

30.7.2015

15:52

Page 32

DÉCORATION

LÉGENDES: Photo Victoria+Albert

32

HELVETISSIMMO

monde des accessoires pour salles de bains. A la fois élégants et pratiques, ces meubles accompagnent harmonieusement les baignoires en îlot pour rendre la pièce aussi stylée que fonctionnelle. Fabriqués avec les meilleurs matériaux et tout en bois de hêtre massif et de merisier, ils disposent de rangements intégrés avec séparateurs et d’un mécanisme d’ouverture «push to open» (ouverture par simple pression, sans poignée). Leurs deux pieds ajustables permettent quant à eux un positionnement parfait au sol. Résistants dans le temps et pratiques, Mandello 114 et Lario 100 se veulent également majestueux et s’insèrent en totale harmonie avec les baignoires existantes Victoria+Albert, qu’elles soient traditionnelles ou plus contemporaines.

und so ihren Eintritt in die Welt der Badaccessoires markiert. Sowohl elegant als auch praktisch, diese Möbel begleiten harmonisch die freistehenden Badewannen um den Raum stilvoll und funktional zu machen. Aus besten Materialien hergestellt und alles aus massivem Eichen- und Kirschholz, die Waschtische verfügen über integrierte Schubladen und einem mechanischen Öffnungssytem „push to open“ (Öffnung durch einfachen Druck ohne Griff). Die beiden verstellbaren Füße erlauben einen perfekten Stand auf dem Boden. Solide und praktisch, die Modelle Mandello 114 und Lario 100 passen sich majestätisch in totaler Harmonie den bereits vorhandenen Badewannen von Victoria+Albert an, sowohl den traditionellen als auch den mehr zeitgemäßen.

Autre innovation marquante de cette saison, Arcos, présentée par Schmidt, veut être bien plus qu’une salle de bains, «un vaste espace dédié à la détente». Design et lignes sobres jouent les contrastes avec la force du bois sombre Maverick. Les éléments se positionnent à l’envie pour créer des volumes de rangements modulables. Faciles d’accès, les meubles hauts offrent un rangement à portée de main et visible en un seul regard. Le banc équipé de blocs de rangement délimite l’espace et se révèle très utile pour se préparer et se pomponner! Sobre et élégant, le mur d’armoires offre un espace de rangement maximal, avec des portes sans poignées qui se font oublier...

Eine weitere markante Neuigkeit dieser Saison, Arcos, von Schmidt vorgestellt, will mehr sein als ein Badezimmer, „einen weiten Raum zur Entspannung“. Design und pure Linien kontrastieren mit der Kraft des dunklen Holzes Maverick. Die Teile positionieren sich nach Wunsch um modulierbaren Raum zu schaffen. Mit leichtem Zugriff, die hohen Möbel bieten einen greifbaren und sichtbaren Zugang. Die Bank mit Ablagen dient zur Raumabtrennung und ist sehr nützlich um sich herzurichten und zu verschönern! Schlicht und elegant, die Schrankwand bietet einen maximalen Verstauraum, mit Türen ohne Griffe…


h94-033-048.qxd

30.7.2015

15:54

Page 33

UN HABILLAGE EN PIERRE NATURELLE POUR UN STYLE ÉPURÉ ET UNIQUE.

Photo : Thierry Genand

Comme un tableau minéral, le marbre sur mesure Monterrey Gold sublime votre salle de bain de maître. Une exclusivité Capri.

PIERRES NATURELLES INDOOR & OUTDOOR : MARBRE, GRANIT, QUARTZITE, ONYX, CALCAIRE, SEMI-PRECIEUX Showroom Capri, 74800 St Pierre en Faucigny, France - Tél. +33(0)4 50 03 50 86 - info.geneve@capri.fr


h94-033-048.qxd

30.7.2015

15:54

Page 34

DÉCORATION

LÉGENDES: Photo Victoria+Albert

34

HELVETISSIMMO

BIEN-ÊTRE ET VALEURS FAMILIALES

WOHLBEFINDEN UND FAMILIENGLÜCK

Longtemps réservé aux centres de thalassothérapie et aux espaces de remise en forme, le spa investit lui aussi nos intérieurs et nos extérieurs. Avec des améliorations considérables en matière d’esthétisme et l’intégration de nouveaux équipements sportifs. Autrefois disgracieux, il s’impose désormais comme un objet décoratif, voire design. À l’extérieur, il prolonge une piscine ou trône seul sur une terrasse près du jardin ou à l’étage. À l’intérieur, il occupe un espace dédié, mais peut tout aussi bien habiter une chambre ou un salon. Le marché du spa se développe et répond à la tendance actuelle, celle du retour aux sources où l’on privilégie le bien-être et les valeurs familiales. Et ses vertus relaxantes, ainsi que thérapeutiques ne sont pas à négliger. Dans une eau entre 34 et 40°C, le corps se détend et les tensions se dénouent. Stress, insomnie, douleurs dorsales et articulaires, migraines, etc. peuvent ainsi être soulagés. Pour les sportifs, les spas de nage sont idéaux et gagnent du terrain: de nombreux équipements peuvent être ajoutés pour ramer, s’étirer, courir, nager, faire de l’aquagym, de l’aquabiking. Certains spas intègrent même un home cinéma, des enceintes sonores, des Leds, de l’aromathérapie, etc.; d’autres peuvent être gérés à distance via une application sur smartphone ou tablette.

Lange Zeit den Thalassotherapiezentren und Fitnesszentren vorbehalten, das Spa investiert jetzt auch unsere Innen- und Außenbereiche. Mit beträchtlichen Verbesserungen betreffend Ästhetik und Eingliederung von neuen Sportausstattungen. Früher unschön, setzt es sich jetzt als ein dekoratives Objekt durch, sogar mit Design. Im Außenbereich wird es zu einer Verlängerung des Schwimmbads, oder es steht allein auf einer Terrasse nahe dem Garten oder im Stockwerk. Im Innenbereich füllt es einen ihm bestimmten Raum kann aber ebenso in einem Zimmer oder Salon untergebracht werden. Der Markt des Spa entwickelt sich und entspricht einem aktuellen Trend, von Wohlbefinden und Familienwerten. Seine entspannenden sowie therapeutischen Eigenschaften sind nicht zu verachten. In einem Wasser zwischen 34 und 40°C entspannt der Körper und Spannungen werden gelöst. Stress, Schlaflosigkeit, Rücken- und Gelenkschmerzen, Migräne usw. können auf diese Art gelindert werden. Für Sportler sind Swim Spas ideal und gewinnen an Bedeutung: zahlreiche Ausstattungen können hinzugefügt werden, zum Rudern, Strecken, Laufen, Schwimmen, Aquagym, Aquabiking. Einige Spas integrieren sogar ein Heimkino, Lautsprecher, Leds, Aromatherapie usw.; andere können ferngesteuert werden über eine Applikation auf Smartphon oder Tablet.

DESIGN UNIVERSEL

UNIVERSALES DESIGN

L’événement en la matière sera sans conteste le premier Mondial du Bâtiment, qui se tiendra du 2 au 6 novembre 2015 à Paris (infos sur www.batimat.com). Ce salon, qui s’adresse à tous les professionnels du bâtiment et de l’architecture, attend en effet plus de 2’600 exposants et plus de 350’000 visiteurs! Quelles sont les tendances et perspectives 2015? Pour les organisateurs du salon, les trois principaux axes sont le confort, l’accessibilité pour tous et le design universel: «La salle de bains est de plus

Der Event in diesem Bereich wird zweifellos die weltgrößte Baumesse, Mondial du Bâtiment sein, die in Paris vom 2. bis 6. November 2015 stattfindet (Infos auf www.batimat.com). Diese Messe wendet sich an alle Fachspezialisten aus dem Baugewerbe und der Architektur und rechnet mit mehr als 2’600 Ausstellern für mehr als 350’000 Besuchern! Was sind die Tendenzen und Perspektiven für 2015? Für die Organisatoren der Messe zeichnen sich drei Hauptachsen ab, das sind Komfort, Barrierefreiheit für alle und das universale


h94-033-048.qxd

30.7.2015

15:54

Page 35


h94-033-048.qxd

30.7.2015

15:54

Page 36

DÉCORATION

LÉGENDES: Photos Carré Bleu / Schmidt / Victoria+Albert

36

HELVETISSIMMO

en plus mature, intégrant tous les matériaux jusqu’alors dédiés aux autres pièces de la maison (bois, carrelage…) pour devenir une pièce à vivre à part entière». Si les espaces de bains restent toujours petits, le confort y est prioritaire. Tous les fabricants intervenants s’accordent et rivalisent de créativité et d’offres pour affiner, alléger et agrandir cette pièce, toujours au service du décor et de l’esthétisme avec des meubles moins profonds, des douches ouvertes ou plus transparentes, l’intégration de «walk’in», l’augmentation des «2 en 1» (par exemple les baignoires/douches)…

Design: „Das Badezimmer wird immer ausgereifter, es übernimmt Materialien, die sonst nur für andere Räume des Hauses bestimmt waren (Holz, Kacheln…) um zu einem vollwertigen Lebensraum zu werden“. Wenn der dem Bad zugestandene Raum immer noch gering bleibt, so ist der Komfort vorderrangig. Alle betroffenen Fabrikanten sind sich einig und rivalisieren an Kreativität und Angeboten um diesen Raum zu verschönern, zu vergrößern für eine bessere Dekoration und Ästhetik mit weniger tiefen Möbeln, offenen oder transparenteren Duschen, Einführung des „Walk’in“ und mehr „2 in 1“ (zum Beispiel Badewannen/Duschen)…

Le «design universel» de la salle de bains participe pour sa part à une circulation en toute fluidité avec comme tendance forte, le suspendu quand les supports le permettent: le lavabo, la cuvette, et/ou les meubles sont mis en hauteur pour un visuel allégé de la pièce et une praticité d’entretien et d’utilisation. On note également un nouveau courant pour une forme asymétrique des meubles, s’inscrivant toujours dans l’optimisation d’une meilleure circulation dans la salle de bains, notamment via des baignoires galbées. Dans cette recherche d’esthétisme et de confort, l’éclairage a lui aussi sa carte à jouer. Lumière et led fusent au cœur de la salle de bains: la lumière au naturelle et les leds reviennent en force et participent activement à l’évolution de la salle de bains comme véritable pièce de bien-être avec une lumière douce, colorée et qui change selon la température en toute sécurité.

Das „universale Design“ des Badezimmers trägt zu einem flüssigeren Verkehr bei, mit der neuen Tendenz der hängenden Geräte und Möbel, wenn der Support dies erlaubt: Waschbecken, das WC-Becken, und/oder die Möbel, was den Raum erleichtert und eine praktischere Pflege und Nutzung erlaubt. Ebenfalls zu bemerken eine neue Richtung zu asymmetrischen Formen der Möbel, immer für eine Optimierung eines besseren Verkehrs im Badezimmer, insbesondere durch geschwungene Badewannen. Bei dieser Suche nach Ästhetik und Komfort spielt auch die Beleuchtung eine Rolle. Licht und Led leuchten inmitten des Badezimmers: das natürliche Licht und Leds kommen stark wieder und nehmen an der Umwandlung des Badezimmers in einen echten Lebensraum teil, mit einem milden Licht, farbig, was je nach der Temperatur in völliger Sicherheit changiert.


h94-033-048.qxd

30.7.2015

15:54

Page 37

Interior Design

ARCHITECTURE INTÉRIEURE DÉCORATION MOBILIER

Chemin du Triangle 5 1295 Mies ‒Suisse

www.dome.ch contact@dome.ch

T +41 (0)22 362 74 70 F +41 (0)22 362 74 71


h94-033-048.qxd

30.7.2015

15:55

Page 38

FOCUS

ELITE

UN INVESTISSEMENT DURABLE POUR VOTRE BIEN-ÊTRE Vous dormez mal et vous cherchez un nouveau matelas? Vous avez pu tester un lit avec un vrai sommier tapissier et vous avez adoré?

EINE NACHHALTIGE INVESTITION FÜR IHR WOHLBEFINDEN Schlafen Sie schlecht und sind auf der Suche nach einer neuen Matratze? Durften Sie einmal auf einem Boxspring Bett übernachten und haben dies sehr genossen?

LÉGENDE: Les matelas et lits Elite sont produits à la main et avec soin au bord du lac Léman. Elite Matratzen und Betten werden in liebevoller Handarbeit am Genfersee hergestellt.

38

HELVETISSIMMO

UN PRODUIT SUISSE POUR UN CONFORT MAXIMAL Il n'y a probablement rien de meilleur qu'une bonne nuit de sommeil. Au réveil, nous regorgeons généralement d'énergie, de pensées créatives, d'humour et d'envie d'entreprendre. Les matelas et lits Elite sont fabriqués pour permettre une relaxation profonde et totale assortie d'un confort moelleux comme on ne le connait que des hôtels 5-étoiles. Nés il y a plus de 100 ans, les lits Elite font partie de ces produits helvétiques qui font la réputation du pays.

EIN SCHWEIZER PRODUKT FÜR EINEN SPITZENKOMFORT Es gibt eigentlich kaum etwas Schöneres als eine gute Nacht. Am Tag danach ist der Mensch voller Tatendrang, kreativem Denken, Humor und Unternehmungslust. Elite Matratzen und Betten werden so hergestellt, dass sie dem Schläfer eine totale Entspannung ermöglichen und ihn einbetten in einen Komfort, den man nur von Fünf-Sterne-Hotels kennt. Seit mehr als 100 Jahren zählen Elitebetten zu den Spitzenprodukten, welche den Ruf der Schweiz begründen.

UN MATELAS NATUREL POUR UN SOMMEIL SAIN Sous leur look élégant, les matelas Elite cachent un assemblage à la fois écologique et respectueux de la santé du dormeur. Certifiés par l'Ecolabel européen, les matelas Elite ont été fabriqués de manière douce et écologique, avec des matières premières nobles, naturelles et renouvelables telles que la soie Tussah, le coton biologique et la laine de mouton suisse.

EIN NATURBETT FÜR DEN GESUNDEN SCHLAF Hinter dem eleganten Look der Elitematratze versteckt sich ein umwelt- und menschenfreundliches Produkt. Alle Elitematratzen sind mit dem EU Ecolabel zertifiziert. Dieses Gütesiegel steht für einen schonungsvollen Fabrikationsprozess und den Gebrauch von hauptsächlich natürlichen und erneuerbaren Rohstoffen, wie Tussahseide, biologische Baumwolle und Schweizer Schafwolle.


h94-033-048.qxd

30.7.2015

15:55

Page 39

UN MATELAS SUR MESURE, UN LIT AU GOÛT DU CLIENT Un matelas adapté doit accueillir le dormeur en douceur et lui procurer un soutien ergonomique du corps dans toutes les positions du sommeil. Elite prend soin de créer un matelas pour chaque personne, en tenant compte de la corpulence et des habitudes de couchage. L'appréciation du confort est une donne individuelle. Un lit constitue un achat conséquent dont les bénéfices se mesurent sur le long terme. Il est primordial d'y consacrer du temps et de l'attention. La maison vaudoise met beaucoup de soin dans le conseil et l'accompagnement du client.

EINE MATRATZE AUF MASS, EIN BETT NACH IHREM GESCHMACK Eine gute Matratze soll den Körper mit einem weichen und ergonomischen Komfort umgeben, um jegliche Druckstellen zu vermeiden, aber dennoch hart genug sein, um den Rücken sowie die Lenden und Halswirbel zu stützen.

«LE LUXE VÉRITABLE: UNE BONNE NUIT QUI RÉGÉNÈRE» „DER ECHTE LUXUS: EINE SCHÖNE UND ERHOLSAME NACHT“

Elitematratzen gibt es in vielen verschiedenen Ausführungen und Dimensionen für jede Korpulenz und alle Schlafgewohnheiten. Die Beurteilung des Schlafkomforts ist eine individuelle Angelegenheit. Daher ist es wichtig sich bei der Bettauswahl genug Zeit zu lassen. Bei Elite ist die Kundenbetreuung gross geschrieben.

Acheter un lit Elite équivaut à acquérir un produit d'excellence suisse et à prendre soin de soi durant de nombreuses années.

LA CHAMBRE À COUCHER D'AUJOURD'HUI: UN ENDROIT PAISIBLE À SOI L'agitation, le stress, la communication permanente ont fini par bannir le sommeil. Il est d'autant plus essentiel de faire de sa chambre à coucher une oasis de détente: un lit confortable, de jolies parures, une ambiance calme et paisible, de la lumière douce, un pyjama agréable, une brise d'air frais. Le lit est en passe de devenir ce refuge de bien-être où il est encore possible de rêver en paix.

INFORMATIONS:

www.elitebeds.ch

DAS SCHLAFZIMMER VON HEUTE: EIN STILLER PLATZ FÜR SICH SELBST Wilde Hektik und permanente Kommunikation verdrängen den Schlaf. Es ist umso notwendiger das Schlafzimmer wie eine Oase der Erholung zu gestalten: ein komfortables Bett, schöne Bettwäsche, ein beruhigendes Ambiente, sanftes Licht, ein angenehmer Schlafanzug, ein Hauch frischer Luft. Das Bett wird zum Refugium der Geborgenheit wo man ungestört träumen darf.

LUX-RESIDENCE.COM

39


h94-033-048.qxd

30.7.2015

15:55

Page 40

FOCUS

DÔME

ART ET DÉCORATION Fondé en 2005 par Cécile Demole, Dôme est né d’une passion pour l’architecture intérieure, le mobilier et l’art sous toutes ses formes

KUNST UND DEKORATION Im Jahre 2005 von Cécile Demole gegründet, Dôme wurde aus einer Passion für Innenausstattung, Mobiliar und Kunst in all ihren Formen geboren. Guidée par ses valeurs de haute tradition, de savoir-faire et de qualité, l’équipe de Dôme vise l’excellence, l’élégance et le raffinement dans tous les travaux de décoration qu’elle réalise. C’est avec un réel souci du détail que la société s’occupe de toutes les étapes d’un projet, de la conception à la réalisation. Ses architectes d’intérieur et décorateurs sont à même de proposer des créations de mobilier sur-mesure et une collaboration exclusive avec certaines des plus grandes marques de design telles que Amboan, Arketipo, Chelini, Colleccion Alexandra, Philippe Hurel, Visionnaire, XVL ainsi qu’une grande sélection de luminaires de marques de renom comme Peter Adam, Porta Romana, Stéphane Davidts ou encore Sigmal 2.

40

HELVETISSIMMO

Geleitet von den Werten hoher Tradition, Know-how und Qualität, das Team von Dôme strebt Exzellenz, Eleganz und Verfeinerung in allen Dekorationsarbeiten, die es ausführt, an. Mit dem Bestreben ins Detail zu gehen, kümmert sich die Firma um alle Etappen eines Projektes, von der Konzeption bis zur Realisierung. Ihre Innenarchitekten und Dekorateure sind in der Lage Möbelkreationen nach Maß anzubieten und eine exklusive Zusammenarbeit mit einigen der größten Marken für Design, wie Amboan, Arketipo, Chelini, Colleccion Alexandra, Philippe Hurel, Visionnaire, XVL sowie eine große Auswahl an Beleuchtungskörper-Marken wie Peter Adam, Porta Romana, Stéphane Davidts oder auch Sigmal 2.


h94-033-048.qxd

30.7.2015

15:55

Page 41

Cécile Demole et son équipe se démarquent aussi par leur passion pour l’art contemporain: les œuvres sont choisies avec détail et peuvent être créées sur-mesure pour les intérieurs que la société conçoit. Dans certains cas, ce sont même les œuvres qui guident le processus décisionnel de l’intérieur et du style! Le choix des artistes est infini et éclectique, certains artistes établis fortement, d’autres en devenir. Ainsi une collaboration forte avec les galeries d’art les plus prestigieuses en Europe et aux Etats-Unis s’est établie depuis de longues années.

Cécile Demole und ihr Team zeichnen sich ebenfalls durch ihre Passion für zeitgenössische Kunst aus: die Werke werden sorgfältig ausgesucht und können nach Maß für die Interieurs, die die Firma plant, geschaffen werden. In gewissen Fällen sind es sogar die Werke, die den Entscheidungsprozess für das Interieur und den Stil lenken! Die Auswahl an Künstlern ist unendlich und eklektisch, gewisse Künstler sind schon fest etabliert, andere im Werden. So hat sich eine starke Zusammenarbeit mit den berühmtesten Kunstgalerien in Europa und in den Vereinigten Staaten seit vielen Jahren aufgebaut.

Le showroom, situé aux portes de Genève met en scène différentes pièces de la maison, telle une véritable demeure, créant une atmosphère des plus chaleureuses tout en restant dans l’air du temps.

Der an den Toren von Genf gelegene Showroom zeigt verschiedene Räume des Hauses, so wie eine echte Wohnung, schafft die wärmste Atmosphäre und bleibt dennoch zeitgenössisch.

QUELLES TENDANCES SE DÉGAGENT EN 2015 EN MATIÈRE DE DÉCORATION INTÉRIEURE? Cécile Demole: Après le minimalisme des années 2000 à 2010, nous sommes passés à des intérieurs plus chaleureux. Notamment par l’utilisation de matériaux comme le bronze, pour les poignées, les serrures et de nombreux accessoires. De même, les tissus et papiers peints sont davantage texturés et moirés, dans des tonalités chaudes comme le taupe.

WELCHE TENDENZEN ZEICHNEN SICH FÜR 2015 BEZÜGLICH INNENDEKORATION AB? Cécile Demole: Nach dem Minimalismus der Jahre 2000 bis 2010, sind wir zu wärmeren Interieurs übergegangen. Insbesondere durch die Verwertung von Materialien wie Bronze für die Türgriffe, Schlösser und zahlreiches Zubehör. Ebenso sind die Stoffe und Tapeten mehr strukturiert und moiriert, in warmen Farbtönen wie taupe.

LUX-RESIDENCE.COM

41


h94-033-048.qxd

30.7.2015

15:55

Page 42

FOCUS

LÉGENDE PHOTO: De gauche à droite: Justine Lavoine architecte d’intérieur, Cécile Demole managing director, Alice Cajka décoratrice d’intérieur et responsable du showroom, Charlotte Gosselke communication et administration (manquent Céline Jacquinet architecte d’intérieur et Christine Zurfluh courtepointière).

INFORMATIONS: Dôme Chemin du Triangle 5 1295 Mies Tél.: +41 (0)22 362 74 70 www.dome.ch

42

HELVETISSIMMO

VOS CLIENTS ONT-ILS UNE IDÉE PRÉCISE DU STYLE QU’ILS RECHERCHENT? Quand ils viennent nous voir, nos clients savent parfaitement ce qu’ils ne veulent pas, à nous de les aider à déterminer ce qu’ils veulent! Il s’agit des les guider, de les accompagner, l’aspect humain et la qualité de l’écoute passant toujours en premier. Nous suggérons mais nous n’imposons jamais nos propres goûts. Ensuite, notre force est de mener le projet de A à Z, avec une livraison clé en main. Ce qui signifie que nos clients entrent dans une maison ou un appartement dont les lits sont faits, le linge et les couverts achetés et rangés! VOUS PROPOSEZ UN SERVICE ORIGINAL CONCERNANT L’ART CONTEMPORAIN… La plupart de nos chantiers se situent en Suisse et en France, puis à Londres et Dubaï. Nous accompagnons nos clients en amont dans le processus d’achat d’œuvres d’art contemporain, en partenariat avec une dizaine de galeries de référence à Paris, Genève et New York. L’idée est de concevoir dès l’origine l’intérieur qui sera à même de mettre en valeur ces œuvres, qu’il s’agisse de peintures ou de sculptures.

HABEN IHRE KUNDEN EINE FESTE VORSTELLUNG VON DEM STIL, DEN SIE SUCHEN? Wenn sie zu uns kommen wissen unsere Kunden ganz genau, was sie nicht wollen, es ist uns überlassen zu bestimmen, was sie wollen! Es geht darum, sie zu leiten und zu begleiten, der menschliche Faktor und die Qualität des Zuhörens stehen an erster Stelle. Wir empfehlen, aber wir zwingen nie unseren persönlichen Geschmack auf. Sodann liegt unsere Stärke darin, das Projekt von A bis Z zu führen, mit einer schlüsselfertigen Lieferung. Was bedeutet, dass unsere Kunden in ein Haus oder eine Wohnung mit gemachten Betten einziehen, die Wäsche und Bestecke sind gekauft und eingeräumt! SIE BIETEN EINEN ORIGINELLEN SERVICE BEZÜGLICH ZEITGENÖSSISCHER KUNST AN… Die meisten unserer Baustellen sind in der Schweiz und auch in Frankreich, dann in London und Dubai. Wir begleiten unsere Kunden vorab in dem Kaufprozess von zeitgenössischen Kunstwerken, in Partnerschaft mit etwa zehn Referenzgalerien in Paris, Genf und New York. Ziel ist von Anfang an das Interieur zu schaffen, was diese Werke, seien es Gemälde oder Skulpturen, zur Geltung bringen kann.


h94-033-048.qxd

30.7.2015

15:55

Page 43

IMMOBILIER IMMOBILIEN


h94-033-048.qxd

30.7.2015

15:55

Page 44

FOCUS

VAUD

FORCE D’ATTRACTION WAADT - STARKE ANZIEHUNGSKRAFT

44

HELVETISSIMMO


h94-033-048.qxd

30.7.2015

15:56

Page 45

Par L.C. - Photos Thinkstockphotos.fr

Entre lacs et montagnes, le plus grand et le plus peuplé canton de Suisse romande bénéficie d’une situation géographique privilégiée, gage d’un un marché immobilier toujours aussi recherché. Zwischen Seen und Bergen, erfreut sich der größte und bevölkerungsreichste Kanton der französischen Schweiz einer bevorzugten geographischen Lage, Garantie eines nach wie vor sehr gefragten Immobilienmarktes. Ils sont venus, ils ont vu, ils sont restés! Gustave Courbet, Oskar Kokoschka, Charlie Chaplin et bien d'autres avant eux et après eux. C'est bien naturel, tant la Riviera vaudoise réunit harmonieusement une vue magnifique sur les Alpes et une végétation messagère de douceur méridionale… C'est dans le canton de Vaud que l'on trouve les plus anciens sites néolithiques de Suisse, datant de quelque 5'000 ans avant J.-C., au bord du lac Léman. Les Romains fondèrent en effet sur les rives du lac la petite ville de Lousonna, qui deviendra Lausanne, aujourd'hui capitale du canton de Vaud. Le respect de l'environnement et le développement durable sont aujourd’hui les priorités du canton de Vaud et de la ville de Lausanne, sa capitale. Depuis 2000, Lausanne adhère en effet au programme de développement durable Agenda 21 dans tous les domaines de l'action communale, avec pour objectif l'amélioration de la qualité de vie des habitants de la ville et de ses hôtes.

Sie kamen, sie sahen und blieben! Gustave Courbet, Oskar Kokoschka, Charlie Chaplin und viele andere vor und nach ihnen. Das ist ganz natürlich, denn die waadtländische Riviera vereint harmonisch einen herrlichen Blick auf die Alpen und eine Pflanzenwelt, die meridionale Milde ankündigt… Es ist der Kanton Waadt, in dem sich die ältesten neolithischen Sehenswürdigkeiten der Schweiz befinden, sie stammen von vor ca. 5'000 Jahren v. Chr., am Ufer des Genfer Sees. Denn die Römer gründeten an den Ufern des Sees die kleine Stadt Lousonna, die Lausanne wurde und heute die Hauptstadt des Kantons Waadt ist. Schutz der Umwelt und nachhaltige Entwicklung sind heute Prioritäten des Kantons Waadt und der Stadt Lausanne, seiner Hauptstadt. Seit 2000 ist Lausanne Mitglied des nachhaltigen Entwicklungsprogramms der Agenda 21 in allen Bereichen kommunaler Maßnahmen mit dem Ziel, die Lebensqualität der Bewohner der Stadt und seiner Gäste zu verbessern.

Le canton de Vaud offre en effet un cadre de vie exceptionnel: des paysages spectaculaires et un environnement préservé, invitant aux activités sportives et aux loisirs; des agglomérations à taille humaine où règne la sécurité; des infrastructures efficaces et une riche activité culturelle. Les distances sont courtes et les moyens de communication bien développés, ce qui permet aisément de vivre en pleine campagne et travailler en ville. La diversité de l'habitat est extrêmement variée, entre ville, campagne, lac et montagne. Le marché immobilier vaudois reste attractif, les taux hypothécaires pour la construction étant avantageux. Mais la demande toujours soutenue implique des prix au

Der Kanton Waadt bietet in der Tat einen außergewöhnlichen Lebensraum: sagenhafte Landschaften und eine bewahrte Umwelt laden zu Sport- und Freizeitaktivitäten ein, Ansiedlungen von menschlichem Ausmaß, wo Sicherheit herrscht, effiziente Infrastrukturen und ein reiches Kulturleben. Die Entfernungen sind gering und die Transportmittel gut entwickelt, so dass es einfach ist, auf dem Lande zu leben und in der Stadt zu arbeiten. Die Wohnmöglichkeiten sind ausgesprochen vielseitig, zwischen Stadt, Land, See und Gebirge. Der waadtländische Immobilienmarkt bleibt attraktiv, die Hypothekensätze im Bausektor sind günstig. Aber die ständig starke Nachfrage

LUX-RESIDENCE.COM

45


h94-033-048.qxd

30.7.2015

15:56

Page 46

FOCUS

mètre-carré élevés: il sera difficile de trouver un appartement à moins CHF 6’000.-/m2, avec des sommets atteignant, voire dépassant, la barre symbolique des CHF 20’000.-/m2!

bewirkt hohe Quadratmeterpreise: es wird schwierig sein, eine Wohnung für weniger als CHF 6’000.-/m2 zu finden, mit Gipfeln, die die symbolische Grenze von CHF 20’000.-/m2 erreichen oder übersteigen!

POLITIQUE INNOVANTE

INNOVATIVE POLITIK

Cette multiplicité d’atouts n’empêche pas l’Office cantonal statistique de se pencher régulièrement sur la distorsion entre offre et demande et sur le nombre de logements vacants présents sur le marché. Le Bureau d'information et de communication de l'Etat de Vaud a publié le 1er juin 2015 une étude rapportant que «quelque 2’600 logements sont annoncés vacants dans le canton, soit 20 de plus que l'année dernière (+0,8%). Plus de 40% des logements vacants sont destinés exclusivement à la vente (1’100). Le taux de vacance demeure à 0,7%, tant sur l'ensemble du parc de logements que sur le marché locatif». Les logements disponibles se partagent entre 1’100 objets destinés exclusivement à la vente et 1’500 offerts à la location ou sur les deux marchés. Les objets offerts à la vente augmentent légèrement (+5,5%) alors que ceux offerts à la location diminuent (-2,5%). Le taux global de vacance n'évolue pas: comme l'année dernière, il se situe à 0,7%. Ce taux (encore provisoire) mesure le rapport mathématique entre l'effectif des logements offerts à la vente ou à la location et l'ensemble du parc de logements.

Diese Vielzahl von Pluspunkten hindert das Kantonale Statistikamt nicht daran, sich regelmäßig mit der Verzerrung zwischen Angebot und Nachfrage und der Anzahl leerer Wohnungen auf dem Markt zu beschäftigen. Das Informations- und Kommunikationsbüro des Kantons Waadt hat am 1. Juni 2015 eine Studie veröffentlicht, die „einige 2’600 leerstehende Wohnungen im Kanton angab, das heißt 20 mehr als im letzten Jahr (+0,8%). Mehr als 40% der leeren Wohnungen sind ausschließlich zum Verkauf bestimmt (1’100). Der Leerwohnungsbestand bleibt bei 0,7%, sowohl für den gesamten Bestand als auch den Mietwohnungsmarkt“. Die verfügbaren Wohnungen bestehen aus 1’100 nur zum Verkauf angebotenen Objekten und 1’500 zur Vermietung oder auf beiden Märkten angebotenen Objekten. Die zum Verkauf angebotenen Objekte sind leicht im Steigen (+5,5%) während die zur Vermietung angebotenen sich vermindern (-2,5%). Der gesamte Leerbestand bewegt sich nicht: wie letztes Jahr liegt er bei 0,7%. Dieser (noch provisorische) Prozentsatz misst das mathematische Verhältnis zwischen dem Bestand an den zum Verkauf oder zur Vermietung angebotenen Wohnungen und dem gesamten Wohnbestand. Es ist üblich, den Markt als ausgeglichen zu betrachten, wenn er einen Leerbestand von 1,5% aufweist, was seit 1999 nicht mehr der Fall ist. Auf dem Mietmarkt bleibt der Prozentsatz an Leerbestand ebenfalls bei 0,7%.

Il est d'usage de considérer le marché comme équilibré lorsqu'il affiche un taux de vacance de 1,5%, ce qui n'est plus le cas depuis 1999. Sur le marché de la location, le taux de vacance reste également à 0,7%.

46

HELVETISSIMMO


h94-033-048.qxd

30.7.2015

15:56

Page 47

LES YEUX DANS LE BLEU DU PLUS BLEU DES LAGONS

CARRÉ BLEU, CRÉATEUR DE BLEU

CARRÉ BLEU SUISSE Nicollier Paysages & Piscines SA *OK\9OUL‹ -\SS` 9\LKL)VZZL`‹;YVPUL_ ;LS‹-H_ PUMV'JHYYLISL\JO‹^^^JHYYLISL\JO

www.carrebleu.ch


h94-033-048.qxd

30.7.2015

15:56

Page 48

FOCUS

48

HELVETISSIMMO

A noter, le taux global de vacance est particulièrement bas pour les logements de une à trois pièces (entre 0,4% et 0,5%) et maximal pour les logements de six pièces ou plus (1,2%). En termes d'effectifs, ce sont les logements vacants de quatre pièces qui sont les plus nombreux (710), puis les trois pièces (600). Suivent les logements de 6 pièces et plus avec 440 unités dont plus de 70% sont uniquement proposés à la vente (source: Vd.ch).

Es ist zu bemerken, dass der Gesamtprozentsatz an Leerwohnungen besonders niedrig bei Wohnungen von einem bis drei Zimmern liegt (zwischen 0,4% und 0,5%) und maximal bei Wohnungen von sechs Zimmern oder mehr (1,2%). Tatsächlich sind die Leerwohnungen mit vier Zimmern am zahlreichsten (710), dann die drei Zimmer-Wohnungen (600). Es folgen die Wohnungen mit 6 Zimmern und mehr mit 440 Einheiten, wovon 70% nur zum Verkauf angeboten werden (Vd.ch).

Autre indicateur important du marché immobilier vaudois, le préavis favorable donné au projet du Conseil d'État par la majorité de la Commission du Grand Conseil en charge de l'examen du «paquet logement». Ceci concerne d’abord une incitation faite communes et aux investisseurs pour la construction de logements à loyers abordables destinés à la classe moyenne, en proposant des outils d'intervention efficients tels qu'un droit de préemption restreint, la possibilité de fixer des quotas de logements d'utilité publique ou celle d'octroyer des bonus de surface brute de plancher habitable. Ensuite, le projet de loi sur la préservation du parc locatif (LPPL) fusionne la loi sur les démolitions, les transformations et les rénovations (LDTR) et celle sur l'aliénation d'appartements loués (LAAL). Elle simplifie ainsi un arsenal législatif complexe et introduit une mise en œuvre différenciée par district subissant la pénurie. La majorité de la Commission, présidée par le député Marc-Olivier Buffat, a relevé «l'aspect innovant de cette politique répondant aux besoins avérés de la population vaudoise, qui introduit des outils à la fois fonciers et juridiques pour améliorer l'adéquation de l'offre de logement par rapport à la demande, ainsi que la cohérence de l'ensemble du projet».

Ein weiterer bedeutender Indikator des waadtländischen Immobilienmarktes ist der positive Vorentscheid zum Projekt des Staatsrates durch die Mehrheit der Kommission des Grossen Rates zur Prüfung des „Wohnungsausbaupaketes“. Dies betrifft insbesondere eine Anregung für die Gemeinden und Investoren zum Bau von Wohnungen mit erschwinglichen Mieten bestimmt für die Mittelklasse, mit begrenztem Vorkaufsrecht, Festlegung von Quoten für gemeinnützige Wohnungen oder Bewilligung von einem Bonus auf die Ausnützung der Bruttowohnfläche. Schließlich der Gesetzentwurf zum Erhalt des Mietparks (LPPL) fusioniert mit dem Gesetz über Demolierungen, Transformationen und Renovierungen (LDTR) und das Gesetz bezüglich Übertragung von Mietwohnungen (LAAL). Es vereinfacht ein komplexes legislatives Arsenal und führt eine differenzierte Umsetzung durch je nach dem Bezirk, in dem ein Mangel besteht. Die Mehrheit der Kommission, die von dem Abgeordneten Marc-Olivier Buffat geleitet wurde, hat festgestellt, „Der innovative Aspekt dieser Politik entspricht den Erfordernissen der waadtländischen Bevölkerung, und führt sowohl bodenrechtliche als auch juristische Instrumente ein, um die Anpassung des Wohnungsangebotes im Verhältnis zur Anfrage auszugleichen sowie die Kohärenz des gesamten Projektes zu verbessern“.


h94-049-064.qxd

30.7.2015

15:58

Page 49

Quand le meilleur de l’immobilier s’associe au golf professionnel, aux portes de Barcelone A deux pas de Gérone et des plages de la Costa Brava se trouve un luxueux domaine de golf qui n’a pas son pareil. Mêlant design éblouissant et architecture d’avant-garde, les villas et appartements de luxe font face au plus prestigieux parcours de golf en Espagne. Une destination idoine pour les meilleurs joueurs du monde. Avec en toile de fond la palpitante Barcelone. À partir de 385.000 €

Residents Club

PGA Catalunya Resort soutient la Fédération royale espagnole de golf afin d’amener la Ryder Cup 2022 en Catalunya. Pour plus d’informations ou prendre rendez-vous, téléphonez au +41 22 518 31 70, ou visitez le site www.pgacatalunya.com

realestate@pgacatalunya.com

+41 22 518 31 70

www.pgacatalunya.com


h94-049-064.qxd

30.7.2015

15:58

Page 50

FOCUS

GRANGE & CIE SA

L’IMPLANTATION À NYON L’une des plus anciennes régies immobilières genevoises s’implante à Nyon.

NIEDERLASSUNG IN NYON Eines der ältesten Genfer Immobilien-Unternehmen lässt sich in Nyon nieder.

LÉGENDE: Immeuble l’Amphithéatre, futur emplacement de l’agence de Nyon

50

HELVETISSIMMO

Vaudois d’origine, François-Louis Grange fonde la régie Grange & Carey en 1869 à Genève. Depuis lors, cinq générations se sont succédé à la direction de cette entreprise familiale, qui a été l’initiatrice, en 1879, de la Société des Régisseurs de Genève, devenue depuis lors USPI Genève.

Waadtländer seiner Herkunft nach, François-Louis Grange gründet die Regie Grange & Carey im Jahre 1869 in Genf. Seitdem folgten sich fünf Generationen an der Direktion dieses Familienunternehmens, was 1879 zum Initiator der Société des Régisseurs de Genève wurde, und von dann ab USPI Genève

En 1937, la régie Grange rachète la régie Sautter à Nyon, alors située à la rue Juste-Olivier 16. Elle était alors spécialisée dans la gestion de grands domaines agricoles et équestres et avait développé un portefeuille de gérance d’immeubles et de lots résidentiels. Elle quitte cette ville en 1954, afin d’y recentrer son activité immobilière au cœur de Genève et développer de manière importante ses activités de gérance, courtage et promotions.

Im Jahre 1937 kauft die Regie Grange die Regie Sautter in Nyon zurück, damals in der Rue Juste-Olivier 16 gelegen. Sie war spezialisiert in der Verwaltung großer Landwirtschafts- und Reiterei-Domänen und hatte ein Portefeuille für Verwaltung von Gebäuden und Wohnanteilen ausgebaut. Sie verlässt diese Stadt im Jahre 1954 um ihre Immobilienaktivität auf Genf zu konzentrieren und in großem Stil ihre Verwaltungs-, Vermittlungs- und Promotionsaktivitäten zu entwickeln.

Grange & Cie SA, dont le capital-actions est entièrement détenu par la famille, occupe aujourd’hui 80 collaborateurs. Dirigée conjointement par quatre associés, la société a su se développer tout en maintenant sa taille humaine, son

Grange & Cie SA, deren Gesellschaftskapital voll im Besitz der Familie ist, beschäftigt heute 80 Mitarbeiter. Gemeinsam von vier Teilhabern geleitet, konnte sich das Unternehmen entwickeln und dennoch sein menschliches Ausmaß, seinen


h94-049-064.qxd

30.7.2015

15:58

Page 51

Nyonnais

esprit familial et dynamique, en cultivant des valeurs comme le respect du client, la transparence, un professionnalisme rigoureux et de solides compétences.

Familiensinn und seine Dynamik beibehalten und seine Werte, wie Achtung des Kunden, Transparenz, rigorose Professionalität und solide Kompetenzen pflegen.

La proximité fait également partie des valeurs fondamentales de la société, c’est la raison pour laquelle, après avoir ouvert une agence et récemment une arcade à Carouge, elle a choisi de revenir à Nyon en ouvrant une agence à la rue de la Gare 7 pour y développer la gérance et le courtage en terre vaudoise. Dans un second temps, un service de gérance sera implanté dans de tout nouveaux bureaux, sur une surface de 350 m2, dans un immeuble en construction situé à l’entrée de Nyon, dont les caractéristiques architecturales en feront un bâtiment de référence. La nouvelle activité de courtage à Nyon est dirigée par Fabien Risse qui est au bénéfice d’une grande expérience de la région.

Die Kundennähe gehört ebenfalls zu den Grundwerten des Unternehmens, aus diesem Grund, nachdem eine Agentur und kürzlich eine Arkade in Carouge eröffnet wurde, hat das Unternehmen beschlossen, wieder nach Nyon zurückzukehren und eine Agentur in der Rue de la Gare 7 zu eröffnen, um hier die Verwaltung und Courtage auf waadtländischem Boden zu entwickeln. Anschließend wird eine Verwaltungsabteilung in ganz neuen Büros auf einer Fläche von 350 m2 in einem im Bau befindlichen Gebäude am Eingang von Nyon mit architektonischen Merkmalen, die es zu einem Referenzgebäude machen werden, eingerichtet. Die neue Courtage in Nyon wird von Fabien Risse geleitet, der über eine große Erfahrung in dieser Gegend verfügt.

De par son ancienneté, la régie Grange & Cie SA bénéficie d’un important réseau. En effet, elle fait notamment partie des régies fondatrices du réseau Courtiers Partenaires, dont l’un des concepts de base est la mise en place d’une étroite collaboration en matière de vente entre les agences membres. Aujourd’hui, ce partenariat fonctionne très bien et offre un gain de temps, un plus vaste choix pour les clients, et une transparence accrue.

Durch ihr langjähriges Bestehen profitiert die Regie Grange & Cie SA von einem bedeutenden Netz. Sie gehört in der Tat zu der Gründer-Regie des Netzes Courtiers Partenaires, eines der Basiskonzepte dieses Netzes ist die enge Zusammenarbeit zwischen den zugehörigen Agenturen bei Verkaufsangelegenheiten. Heute funktioniert diese Partnerschaft sehr gut und gewährt einen Zeitgewinn, eine größere Auswahl für den Kunden und eine gesteigerte Transparenz.

«LA VOIE ROMAINE», UN PROJET D’ENVERGURE

„LA VOIE ROMAINE“, EIN GROßANGELEGTES PROJEKT

La régie Grange est l’initiatrice, avec un groupe d’investisseurs, d’un projet d’envergure à Nyon, dont elle s’est vue confier la vente d’appartements en PPE et la gérance de nombreux immeubles locatifs. Une partie des immeubles est sortie de terre et, d’ores et déjà, 85 appartements sur 90 ont été vendus à un prix attractif d’environ CHF 7’750.- le m2. Au total, plus de 550 logements en PPE et en location sont prévus dans ce nouveau quartier bénéficiant d’une situation exceptionnelle entouré de vignes et de champs, à proximité du Parc du Reposoir et à trois tours de roue de l’autoroute. L’ensemble accueillera également une école primaire et une zone sportive. 20’000 m2 de surfaces seront dévolues à des activités administratives et commerciales. Au terme de la construction, quelques 2’000 personnes vivront dans ce nouveau quartier qui deviendra une référence dans l’important développement de la ville et de ses alentours.

Die Regie Grange ist zusammen mit einer Gruppe von Investoren der Initiator eines aufwändigen Projektes in Nyon, sie wurde mit dem Verkauf von Wohnungen in Etageneigentum PPE und der Verwaltung zahlreicher Miethäuser beauftragt. Ein Teil der Gebäude ragt bereits aus dem Boden und schon jetzt wurden 90 Wohnungen zu einem attraktiven Preis von ungefähr CHF 7’750.- pro m2 verkauft. Insgesamt sind mehr als 550 Wohnungen in PPE und zur Vermietung in diesem neuen Viertel in außergewöhnlicher Lage, umgeben von Weinbergen und Feldern, in der Nähe des Parc du Reposoir und drei Autorunden von der Autobahn entfernt, vorgesehen. Der Gebäudekomplex wird ebenfalls eine Grundschule und ein Sportterrain enthalten. 20’000 m2 Fläche sind für Verwaltungsund kommerzielle Aktivitäten vorgesehen. Am Ende der Bauarbeiten werden einige 2’000 Personen in diesem neuen Viertel leben, was zu einer Referenz für die bedeutende Entwicklung der Stadt und ihrer Umgebung werden wird.

LÉGENDE: Ci-dessus à droite: Rue de la Gare 7 à Nyon

INFORMATIONS: Grange & Cie SA Agence de Nyon Rue de la Gare 7 CH-1260 Nyon Tél.: +41(0) 22 365 92 00 nyon@grange.ch www.grange.ch

LUX-RESIDENCE.COM

51


h94-049-064.qxd

30.7.2015

15:58

Page 52

FOCUS

NAEF IMMOBILIER

UNE NOUVELLE AGENCE À VEVEY Leader du marché immobilier romand, Naef Immobilier poursuit son expansion régionale en ouvrant une nouvelle agence en plein cœur de Vevey, une démarche qui confirme la solide implantation géographique du groupe et sa participation active au tissu économique local.

EINE NEUE AGENTUR IN VEVEY Marktführer auf dem Immobilienmarkt der französischen Schweiz, Naef Immobilier setzt seine regionale Expansion fort und eröffnet eine neue Agentur im Herzen von Vevey, ein Vorhaben was die solide geographische Ansiedlung der Gruppe und ihre aktive Teilnahme am lokalen wirtschaftlichen Netz bestätigt.

LÉGENDE: De gauche à droite: Sébastien Rota, responsable des ventes Vevey - Nathalie Del Mastro, assistante des ventes Vevey - Michel Maillard directeur des agences de Lausanne et Vevey

52

HELVETISSIMMO

QUELLES SONT LES SPÉCIFICITÉS DE NAEF IMMOBILIER? Michel Maillard directeur des agences de Lausanne et Vevey: Fondé en 1881, Naef Immobilier est l'un des principaux acteurs sur le marché de l'immobilier en Suisse romande, participant activement à son essor. Fort de sa solide implantation géographique, avec 45 points de vente grâce à l'affiliation au réseau Courtiers Partenaires, et de son réseau national et international, notamment par ses partenariats avec Delta Plus et KM&P en Suisse, Knight Frank pour l’immobilier de prestige et BNP Paribas Real Estate pour l’immobilier commercial, le groupe réunit tous les domaines d'expertise sous un

WAS SIND DIE BESONDERHEITEN VON NAEF IMMOBILIER? Michel Maillard Direktor der Agenturen von Lausanne und Vevey: Im Jahre 1881 gegründet, Naef Immobilier ist einer der Hauptakteure auf dem Immobilienmarkt der französischen Schweiz, und nimmt aktiv an ihrem wirtschaftlichen Aufschwung teil. Bestärkt durch die solide geographische Ansiedlung der Gruppe, mit 45 Verkaufspunkten dank der Zugehörigkeit zu dem Netz Courtiers Partenaires, und ihrem nationalen und internationalen Netz, insbesondere durch die Partnerschaften mit Delta Plus und KM&P in der Schweiz, Knight Frank für das Prestige-Immobiliengeschäft und BNP Paribas Real Estate für die gewerbsmäßigen Immobilien, die Gruppe


h94-049-064.qxd

30.7.2015

15:58

Page 53

même toit ! Du pilotage de promotions immobilières à la gérance, en passant par le courtage, l’administration de PPE, les prestations spécifiques comme le conseil fiscal et juridique, l’expertise immobilière, la réalisation et le suivi de projets architecturaux ou encore la création de logiciels de gestion en ligne high-tech.

vereint alle Sachverständigenbereiche unter einem Dach! Angefangen bei der Leitung von Immobilienpromotionen bis zur Geschäftsführung, über Vermittlung, Verwaltung von Etageneigentum, besondere Dienstleistungen wie steuerliche und juristische Beratung, Immobilienexpertise, Aufstellung und Weiterverfolgung von architektonischen Projekten oder auch die Schaffung von Verwaltungs-Software online Hightech.

QUELLES SONT LES PRINCIPALES VALEURS ÉTHIQUES DU GROUPE? Première régie certifiée ISO 9001 en 1996, Naef Immobilier évolue dans une démarche de développement durable afin d’assurer la pérennité du parc immobilier pour les générations futures. Esprit pionnier, éthique, proximité et écoute constituent à ce titre les valeurs clé de sa culture d'entreprise. Naef Immobilier a pour volonté de rester un groupe indépendant à taille humaine, transmis de génération en génération au sein de la famille Naef et ouvert à quelques actionnaires privés et dirigeants membres de la direction générale.

WAS SIND DIE ETHISCHEN HAUPTWERTE DER GRUPPE? Erste ISO 9001 beglaubigte Regie im Jahre 1996, Naef Immobilier entwickelt sich im Sinne der nachhaltigen Entwicklung um den Fortbestand des Immobilienparks für die zukünftigen Generationen zu sichern. Pioniergeist, Ethik, Nähe zum Kunden und Anhören stellen die Hauptwerte seiner Unternehmenskultur dar. Naef Immobilier hat die Absicht eine unabhängige Gruppe von menschlichem Ausmaß zu bleiben, übertragen von Generation zu Generation innerhalb der Familie Naef und mit Öffnung für einige private Aktionäre und leitende Mitglieder der Generaldirektion.

CONCERNANT LE MARCHÉ DES BORDS DE LACS, Y A-T-IL UNE DEMANDE PARTICULIÈRE POUR LES PROPRIÉTÉS SITUÉES À PROXIMITÉ IMMÉDIATE DE L’EAU? Il existe une forte demande pour ce type de propriété. Avec une situation aussi magnifique que les rives du lac Léman, qui ne rêve pas de posséder une propriété pied dans l’eau avec ponton et plage privée? De plus, ces propriétés offrent un style de vie exceptionnel tout en étant à proximité des commodités. La demande concerne aussi bien les grands domaines que les villas de dimensions plus familiales. Plusieurs résidences de standing se sont développées ces dernières années sur les rives du Léman. Ces appartements d’exception séduisent une clientèle exigeante qui profite ainsi de cette ambiance lacustre en milieu urbain ou péri-urbain.

WAS DEN MARKT AN DEN SEEUFERN BETRIFFT, GIBT ES EINE BESONDERE NACHFRAGE NACH BESITZTÜMERN DIREKT AM WASSER GELEGEN? Es gibt eine starke Nachfrage nach dieser Art Besitztum. Bei einer so herrlichen Lage wie die Ufer des Genfer Sees, wer träumt nicht davon ein Besitztum am Wasser mit Ponton und Privatstrand zu besitzen? Außerdem bieten diese Besitztümer einen außergewöhnlichen Lebensstil und befinden sich dennoch in der Nähe von Annehmlichkeiten. Die Nachfrage bezieht sich sowohl auf große Domänen als auch auf Villen von familiäreren Ausmaßen. Mehrere Residenzen von hohem Niveau sind in den letzten Jahren an den Ufern des Genfer Sees entstanden. Diese außergewöhnlichen Wohnungen finden bei einer anspruchsvollen Kundschaft Anklang, die so von einer Seeatmosphäre in einem städtischen oder stadtnahen Milieu profitieren.

DE LA PART DE QUEL TYPE DE CLIENTÈLE? Ces situations exceptionnelles intéressent aussi bien la clientèle Suisse qu’internationale. Lorsqu’un client étranger découvre la Riviera et vient nous trouver pour un premier entretien, il est fréquent que l’idée qu’il se fait de sa future acquisition concerne un attique en première ligne du lac. Par ailleurs, notre partenariat avec Knight Frank nous permet d’intervenir sur tous les marchés internationaux avec la pertinence du numéro 1 de l’immobilier résidentiel de prestige dans le monde. La demande étant soutenue pour des propriétés pied dans l’eau et l’offre très limitée, il s’agit donc d’un marché de niche qui ne réagit pas de la même manière que les autres segments composant l’ensemble du marché immobilier. A bien et situation exceptionnels, prix exceptionnel!

VON WELCHER KUNDSCHAFT? Diese besondere Lage interessiert sowohl die Schweizer Kundschaft als auch die internationale. Wenn en ausländischer Kunde die Riviera entdeckt, kommt er zu uns zu einer ersten Unterhaltung, es kommt oft vor, dass die Vorstellung die er von seinem zukünftigen Erwerb hat eine Attikawohnung in erster Reihe am See betrifft. Außerdem gestattet uns unsere Partnerschaft mit Knight Frank auf allen internationalen Märkten mit der Relevanz der Nummer 1 des PrestigeImmobilienmarktes einzugreifen. Die Nachfrage für Besitztümer direkt am Wasser ist anhaltend und das Angebot sehr begrenzt, es handelt sich infolgedessen um eine Marktlücke, auf die eine andere Reaktion erfolgt als auf die weiteren Segmente des gesamten Immobilienmarktes. Ein besonderes Besitztum in außergewöhnlicher Lage bedingt einen außergewöhnlichen Preis!

CÔTÉ INVESTISSEMENT, EST-CE UN BON CALCUL POUR UNE RENTABILITÉ À MOYEN/LONG TERME? Du fait des prix de ce type d’objets il est rare que des biens offrant une telle situation intéressent des investisseurs dans un but de rentabilité. Nous pouvons parler ici de

WAS DIE INVESTITION BETRIFFT, IST ES EINE GUTE KALKULATION FÜR EINE MITTEL/LANGFRISTIGE RENTABILITÄT? In anbetracht der Preise dieser Objekte ist es selten, dass die Besitztümer in dieser Lage Investoren mit einem Rentabilitätsziel interessieren. Man kann hier von einer mittel- und langfristigen

LUX-RESIDENCE.COM

53


h94-049-064.qxd

30.7.2015

15:58

Page 54

FOCUS

NAEF VEVEY Rue du Lac 23 1800 Vevey Tél.: +41 (0)21 318 77 18 vevey@naef.ch prestige.riviera@naef.ch www.naef.ch www.naef-prestige.ch

54

HELVETISSIMMO

placement à moyen et long terme et donc de protection d’investissement. Une situation de bords de lac pour un bien immobilier de luxe permettra de maintenir un certain niveau de valeur.

Anlage sprechen und somit von einem Investitionsschutz. Die Lage am Seeufer gewährt einem Luxus-Immobiliengut einen gewissen Wert beizubehalten.

QUEL EST L’OBJECTIF DE LA NOUVELLE AGENCE DE VEVEY? Nous sommes des gens de métier et de terrain, au contact des biens qui nous sont confiés. Pour certaines prestations, nos clients apprécient de pouvoir nous rencontrer dans notre environnement professionnel avec une certaine visibilité. En plus de la marque Naef pour les objets résidentiels, nous renforçons avec Naef Prestige Knight Frank nos activités de courtage pour les biens d'exception très recherchés par une clientèle internationale.

WAS IST DIE ZIELSETZUNG DER NEUEN AGENTUR VON VEVEY? Wir sind Fachleute und kennen die Besitztümer, die uns anvertraut sind. Wenn es um bestimmte Dienstleistungen geht, schätzen es unsere Kunden, wenn sie uns in unserer professionellen Umgebung mit einer gewissen Sichtbarkeit treffen können. Außer der Marke Naef, verstärken wir unsere Makleraktivitäten für Wohnobjekte und, mit Naef Prestige Knight Frank, für außergewöhnliche Objekte, die bei einer internationalen Kundschaft sehr gefragt sind.

SON ADRESSE EST-ELLE SON PREMIER ATOUT? Nous devons être là où sont nos clients. Le cœur de la veille ville de Vevey est très accueillant et animé. La Rue du Lac est une superbe rue piétonne, trait d’union du quartier historique.

IST IHRE ADRESSE IHR GRÖßTER PLUSPUNKT? Wir müssen dort sein wo unsere Kunden sind. Das Herz der Altstadt von Vevey ist sehr einladend und belebt. Die Rue du Lac ist eine herrliche Fußgängerzone, mit Verbindung zum historischen Viertel.

QUEL EST SON RAYON D’ACTION D’ACTIVITÉ? L’agence de Vevey couvre l’ensemble de la Riviera, du Lavaux au Chablais en passant par la Veveyse soit le sud du canton de Fribourg. Dans un premier temps, nous déployons des activités de courtage, d’estimation et de promotion. Les prestations de gérance et d’administration de PPE suivront.

WAS IST IHR AKTIONSRADIUS? Die Agentur von Vevey deckt die gesamte Riviera, von Lavaux zum Chablais über die Veveyse das heißt den Süden des Kantons Fribourg. Zunächst breiten wir unsere Tätigkeit an Courtage, Wertschätzung und Promotion aus. Die Dienstleistungen für Geschäftsführung und Verwaltung von Etageneigentum folgen.


h94-049-064.qxd

30.7.2015

15:58

Page 55

Le Bonheur est dans la Cuisine Rue Eugène-Marziano 23

Route du Bois-Genoud 1B

Du lundi au vendredi

CH -1227 GENÈVE ACACIAS

CH - 1023 CRISSIER

8h - 12h / 14h - 18h

T. +41 (0)22 308 45 10

T. +41 (0)21 637 07 87

le samedi sur RDV

www.tekcuisines.ch


h94-049-064.qxd

30.7.2015

15:58

Page 56

FOCUS

BERNARD NICOD

UNE RELATION DE CONFIANCE Avec onze agences, le Groupe Bernard Nicod, qui existe depuis près de 40 ans, s’étend sur tout l’arc Lémanique, de Genève à Montreux pour le bord du Lac Léman, jusqu’en Valais et Yverdon en bord de lac de Neuchâtel.

EINE VERTRAUENSSACHE Mit elf Agenturen dehnt sich die Gruppe Bernard Nicod, die seit fast 40 Jahren existiert, auf dem ganzen Genfer Seebogen aus, von Genf bis Montreux am Ufer des Genfer Sees, bis ins Wallis und nach Yverdon am Ufer des Neuenburgersee. Plusieurs aspects font la force du Groupe Bernard Nicod. «Par le biais de nos 11 agences, explique Peter Oscarsson, courtier de Bernard Nicod Morges, nous restons proches de nos clients. Nous offrons tous les services de l’immobilier, la vente de biens évidemment, mais aussi la location, la gérance, l’achat, l’entreprise générale, etc. D’autre part, nous construisons pour près de 300 M par an. Cela nous permet de parfaitement connaître et comprendre le marché local, ce qui est impératif pour être performants». Ci-dessus: Le projet «Terrasses des Mémises»

56

HELVETISSIMMO

Mehrere Aspekte machen die Stärke der Gruppe Bernard Nicod aus. „Durch unsere 11 Agenturen, erklärt Peter Oscarsson, Makler und Verkaufsleiter von Bernard Nicod Morges, bleiben wir in der Nähe unserer Kunden. Wie bieten alle Immobiliendienstleistungen an, natürlich den Verkauf von Besitzungen, aber ebenfalls die Vermietung, die Verwaltung, den Ankauf, die Betriebsführung, usw. Das gestattet uns, den lokalen Markt genau zu kennen und zu verstehen, was eine Bedingung ist, um leistungsstark zu sein“.

Le Groupe Bernard Nicod a d’autre part su s’implanter et «grandir» depuis sa création, pour représenter une telle image de stabilité, de performance et de professionnalisme, et apporter la confiance et l’efficacité dont ses clients ont besoin.

Die Gruppe Bernard Nicod konnte sich andrerseits seit ihrer Gründung einbürgern und „wachsen“ um ein Produktimage der Solidität, der Leistung und Professionalität darzustellen und das erforderliche Vertrauen und die Effektivität aufzubringen, die ihre Kunden benötigen.

LE MARCHÉ RESTE POSITIF

DER MARKT BLEIBT POSITIV

«J’ai repris le service des ventes de l’agence de Morges fin 2012, poursuit Peter Oscarsson. Entre 2013 et 2015, notre chiffre d’affaires a augmenté de plus de 90%! Nous nous chargeons de la commercialisation de toutes les catégories de biens immobiliers, objets de luxe, immeubles,

„Ich habe die Verkaufsabteilung der Agentur von Morges Ende 2012 übernommen, setzt Peter Oscarsson fort. Zwischen 2013 und 2015, stieg unser Umsatz um mehr als 90%! Wir übernehmen die Kommerzialisierung aller Kategorien von Besitztümern, Luxusobjekte, Gebäude, Investment-Güter,


h94-049-064.qxd

30.7.2015

15:58

Page 57

biens d’investissement, promotions et objets communs. Nous pouvons observer que le marché a une croissance annuelle de 2% avec des taux hypothécaires toujours très bas. Le marché reste donc très positif. Nous constatons de plus un intérêt très marqué de la part des particuliers, ainsi que des institutions, pour l’investissement dans la pierre. Les taux négatifs des banques et autres tourments encouragent en effet les investisseurs à se tourner vers des valeurs refuges, ce que l'immobilier a toujours été».

Promotionen und Gemeinschaftseigentum. Wir können beobachten, dass der Markt ein jährliches Wachstum von 2% zu verzeichnen hat mit einem immer noch sehr niedrigen Hypothekenzinssatz. Der Markt bleibt infolgedessen sehr positiv. Wir stellen außerdem ein immer stärkeres Interesse von Privatpersonen sowie von Institutionen an Immobilieninvestitionen fest. Die negativen Zinsfüsse der Banken und anderes Kopfzerbrechen ermutigen in der Tat die Investoren zu sicheren Werten zu flüchten, was die Immobilie seit jeher war“.

L'immobilier ne «baisse» donc pas mais se corrige. L'escalade des prix observée depuis la fin des années 2000 jusqu’au début 2010 ne pouvait en effet continuer... «Nous n'avons pas eu besoin de l'aide des politiques et de la FINMA pour cela, qui sont plutôt en train d'empêcher l'accès à la propriété d'une grosse tranche de la population!», tempère Peter Oscarsson.

Der Immobilienmarkt „fällt“ nicht, sondern er korrigiert sich. Die seit Ende der Jahre 2000 bis Anfang 2010 beobachtete Preis-Eskalation konnte in der Tat nicht anhalten… „Wir brauchten hierzu nicht die Hilfe der Politiker und der FINMA (Eidgenössische Finanzmarktaufsicht), die vielmehr dabei sind, den Zugang zum Besitztum für einen großen Teil der Bevölkerung zu verhindern!“ temperiert Peter Oscarsson.

La demande reste donc soutenue et le marché positif. Malgré cela, les affaires sont plus difficiles et le délai de concrétisation plus long. Ceci est notamment dû aux problèmes rencontrés par les acquéreurs lors de l’obtention de leur financement.

Die Nachfrage bleibt anhaltend und der Markt positiv. Dennoch sind die Geschäfte schwieriger und die Zeitspanne bis zur Konkretisierung ist länger. Dies ist vor allem auf die Probleme zurückzuführen, die die Kunden bei der Beschaffung ihrer Finanzierung antreffen.

Certaines questions se posent suite à la constatation observée ci-dessus: - «Est-il normal que le pays le plus/ou un des plus riches ne compte que 40% de propriétaires?» - «Est-il normal qu’avec les diverses régularisations opérées par les politiques et la FINMA, inutilement puisque le marché se régularise déjà seul, de voir des cas ou des clients avec 65% d’apport ne puissent acheter des biens très bien placés? Quels sont les risques pour les banques?».

Zu obiger Feststellung stellen sich gewisse Fragen: - „Ist es normal, dass das reichste/oder eines der reichsten Länder der Erde nur 40% Besitzer zählt?“ - „Ist es normal, dass durch die verschiedenen von den Politikern und der FINMA vorgenommenen unnötigen Regulierungen, da der Markt sich alleine reguliert, Fälle existieren, in denen Kunden mit einer Einlage von 65% keine sehr gut gelegenen Güter kaufen können? Was sind die Risiken für die Banken?“.

INFORMATIONS: Bernard Nicod Rue de la Gare 11 CH-1110 Morges Tél.: +41 (0)21 804 79 79 www.bernard-nicod.ch

NOUVELLE CONSTRUCTION À PRÉVERENGES – LES TERRASSES DES MÉMISES A 5 minutes du centre de Lausanne, dans un environnement exceptionnel à proximité immédiate de la réserve naturelle de la Venoge, de l’Ile aux Oiseaux ainsi que de la plus belle plage du Lac Léman, cette résidence qui enchante par la pureté de ses lignes architecturales s’ouvre sur le lac et les Alpes de Savoie. Cet immeuble Minergie comporte 16 appartements de 2,5 à 4,5 pièces, proposés à des prix extrêmement bien placés pour du neuf d’excellent standing. NEUES BAUPROJEKT IN PRÉVERENGES – LES TERRASSES DES MÉMISES In einer außergewöhnlichen Umgebung, 5 Minuten vom Zentrum von Lausanne entfernt, in direkter Nähe des Naturschutzgebietes von Venoge, der Vogelinsel sowie dem schönsten Strand des Genfer Sees, diese Residenz, die durch die Klarheit ihrer architektonischen Linien entzückt mit Blick auf den See und die savoyischen Alpen. Das Gebäude im MinergieStandard enthält 16 Wohnungen mit 2,5 bis 4,5 Zimmern, zu ausgesprochen günstigen Preisen für Neubau von exzellentem Rang.

LUX-RESIDENCE.COM

57


h94-049-064.qxd

30.7.2015

15:58

Page 58


h94-049-064.qxd

30.7.2015

15:58

Page 59

SUISSE FRIBOURG • GENÈVE • NEUCHÂTEL • NIDELWALD • TESSIN • TURGOVIE • VALAIS • VAUD • ZURICH


h94-049-064.qxd

30.7.2015

15:58

Page 60

CHARMEY EN GRUYERE – A 2 KM DES BAINS THERMAUX

FRIBOURG

Magnifique ferme authentique rénovée

Décor et emplacement exceptionnels pour cette magnifique propriété de charme située dans un cadre naturel et paisible aux alentours de Charmey. Entourée d’une parcelle de 5’113 m2, elle se compose d'une splendide ferme gruérienne traditionnelle avec sa grange et ses écuries, d'une bâtisse anciennement un four à pain, et d’un chemin d’accès privatif arborisé. Rénovées avec finesse et goût en mêlant les charmes rustique et moderne, les nombreuses pièces de la ferme sont très lumineuses et spacieuses. Cette propriété est bercée par les seuls bruits de la rivière de la Jogne voisine et des cloches des vaches.

Exceptional setting, property of charm located in a peaceful, natural setting near Charmey. Set in grounds of 5’113 m2, it consists of a splendid traditional Gruérienne farm with its barn and stables, a former bread oven, and a private tree-lined path. Renovated with skill and taste combining rustic and modern features, the numerous rooms of the farm are very bright and spacious. This property is rocked by the sounds of the nearby Jogne river and cows with their bells. Price on request

Prix sur demande

Philippe Ansermot - CF Immobilier Compagnie Foncière SA Rue St-Denis, 40 - CH-1630 Bulle Tél.: +41 (0)26 921 05 05 - Fax: +41 (0)26 925 10 05 info@cfimmobilier.ch - www.cfimmobilier.ch

60

HELVETISSIMMO


h94-049-064.qxd

30.7.2015

15:58

Page 61

FRIBOURG

A 5 MN D’ESTAVAYER-LE-LAC

A Bollion - Propriété de 5 pièces avec 2 boxes à chevaux

Cette demeure de charme est implantée sur une parcelle de 6’815 m2 aux aménagements bucoliques agrémentée de deux boxes à chevaux. Avec sa distribution actuelle qui comprend: séjour avec cheminée, cuisine agencée ouverte sur la salle à manger, deux chambres à coucher, deux salles d’eau et un studio indépendant avec salle d’eau et kitchenette, elle s’adresse à un couple avec un ou sans enfants, il est néanmoins possible de créer 3 chambres dans les combles, dans ce cas, elle pourrait également s’adresser à une famille plus nombreuse. Non soumis à la LDFR.

This charming residence is set in grounds of 6'815 m2 with bucolic amenities and embellished by two horse boxes. Its present layout comprises: a living room with fireplace, fitted kitchen open to the dining room, two bedrooms, two shower rooms and a separate studio with shower room and kitchenette, it is suitable for a couple with one or no children, however 3 bedrooms can be added in the attic, in this case, it could also apply to a larger family. Not subject to LDFR. Ref. Internet N° 4967. Price: CHF 1’695’000.-

Réf. Internet N° 4967. Prix: CHF 1’695’000.-

Leduc SA Rue de Lausanne 37 - CH-1700 Fribourg Tel.: +41 (26) 422 32 06 - Fax: +41 (26) 422 32 09 vente@leduc.ch - www.leduc.ch

LUX-RESIDENCE.COM

61


h94-049-064.qxd

30.7.2015

15:59

Page 62

GENÈVE

ONEX

Allure contemporaine

Cette magnifique maison contemporaine de plain-pied se situe dans un agréable jardin paysagé, agrémenté d'une piscine, de belles terrasses et patios. Profitant d’une généreuse luminosité, elle offre une surface utile d'environ 400 m2. Elle propose de belles réceptions, salon avec cheminée, salle à manger et une cuisine équipée. Elle dispose d'une suite parentale avec dressing et sdb, de 3 cc et 2 sdb, d'un bureau et salon TV. Prestations haut de gamme.

This wonderful contemporary style single storey residence is situated in a pleasant landscaped garden enhanced by a pool, beautiful terraces and patios. Enjoying lavish luminosity, it offers a floor space of approx. 400 m2. Comprising beautiful reception rooms, a lounge with fireplace, dining room, fitted kitchen, parental suite with dressing room and bathroom, 3 beds and 2 baths, a study and TV lounge. High-end amenities. Ref. N° 25284. Price: CHF 4'600'000.-

Réf. N° 25284. Prix: CHF 4'600'000.-

ANIERES

Imaginez votre maison au bord du lac

Rare opportunité. Ce magnifique terrain d’une surface de 3'746 m2 (peut être vendu en 2 parties: 1’500 m2 + 2’246 m2) offre l’une des plus belles vues sur le lac de Genève. Il se situe en plein cœur du très calme village d’Anières. Située en zone 5, la parcelle permettrait la construction d'une ou deux propriétés totalisant 750 m2 hab. hors sous-sol et annexes. Une place d'amarrage située dans un port privé est accessible par un petit chemin depuis le jardin.

Rare opportunity. These beautiful 3'746 m2 grounds (can be sold in 2 parts: 1’500 m2 + 2’246 m2), situated in the heart of the quiet village of Anières, enjoy one of the finest views of the lake. Located in zone 5, the plot would allow the construction of one or two properties for a total of 750 m2 excluding basement and annexes. A docking site located in a private port is accessible through a small path from the garden. Ref. N° 23170. Price on request.

Réf. N° 23170. Prix sur demande.

Brolliet SA Genève et Vaud - Avenue du Cardinal-Mermillod 36 - CP 1076 - CH-1227 Carouge Tel.: +41 (0)22 908 24 00 - Fax: +41 (0)22 908 24 01 ventes@brolliet.ch - www.brolliet.ch

62

HELVETISSIMMO


h94-049-064.qxd

30.7.2015

15:59

Page 63

GENÈVE

VESENAZ

Prenez le temps de rêver

Située dans le hameau de La Capite, cette maison villageoise de 670 m2 offre une très belle vue sur le lac Léman et le Jura. Elle a été construite sur une belle parcelle de 1’483 m2 et dispose de deux petits chalets annexe, belles réceptions, cuisine familiale, quatre chambres (poss. six), quatre salles de bains et un parking privé de six places. Charme et élégance sont les maîtresmots pour qualifier cette propriété. Réf. N° 24675. Prix: CHF 8'500'000.-

Situated in the hamlet of La Capite, this 670 m2 village house enjoys a very beautiful view over Lake Geneva and the Jura. It was built on a beautiful 1’483 m2 plot and includes two small annexed chalets, reception rooms, family kitchen, four bedrooms (poss. six), four bathrooms and a private six spaces parking. Charm and elegance are the key words to describe this superb property. Ref. N° 24675. Price: CHF 8’500’000.-

VIEILLE VILLE

L’élégance investie

Elégant et lumineux appartement de 115 m2 en parfait état. Il est composé d'un spacieux séjour avec cheminée, d'une cuisine entièrement équipée avec espace repas, d'une chambre à coucher avec deux dressings et d'une salle d'eau. Une cave à vin et une cave en sous-sol complètent ce bien. Réf. N° 25416. Prix: CHF 3'200'000.-

Elegant and sunny 115 m2 apartment in perfect condition. It consists of a spacious living room with fireplace, a fully fitted kitchen with dining area, bedroom with two dressing rooms and a bathroom. A wine cellar and basement cellar complete this property. Ref. N° 25416. Price: CHF 3'200'000.-

Brolliet SA Genève et Vaud - Avenue du Cardinal-Mermillod 36 - CP 1076 - CH-1227 Carouge Tel.: +41 (0)22 908 24 00 - Fax: +41 (0)22 908 24 01 ventes@brolliet.ch - www.brolliet.ch

LUX-RESIDENCE.COM

63


h94-049-064.qxd

30.7.2015

15:59

Page 64

GENÈVE

ANIERES

Un balcon sur le lac

Splendide maison contemporaine dominant le lac, offrant de très belles surfaces, la pièce de réception d’environ 87 m2 s’ouvre sur une immense terrasse intimiste face au lac. 4 chambres dont une en suite avec salle de bain privée. Terrain d’environ 1’500 m2 avec piscine. Espace nuit pour les invités, salle de cinéma 60 m2, garage 4 voitures. Prix: CHF 7'500'000.-

Splendid modern house overlooking the lake, very beautiful surface areas, a reception room of approx. 87 m2 opens onto a vast convivial terrace facing the lake. 4 bedrooms including an en suite with bathroom. Grounds of around 1’500 m2 with a pool. Sleeping area for guests, cinema room 60 m2, 4 cars garage. Price: CHF 7'500'000.-

Le Pilier de l'Immobilier Tél.: +41 (0)22 301 17 20 vente@le-pilier.ch www.le-pilier.ch

64

HELVETISSIMMO


h94-065-080.qxd

30.7.2015

16:01

Page 65

Collonge-Bellerive Magnifique propriété de Maître ^ŝƚƵĠĞĂƵƐĞŝŶĚ͛ƵŶƐƵƉĞƌďĞƉĂƌĐ͕ĐĞƩĞƌĂƌĞƉƌŽƉƌŝĠƚĠƉƌŽĮƚĞĚ͛ƵŶĐĂĚƌĞĞdžĐůƵƐŝĨĞƚ ƉƌŝǀĂƟĨ͕ ă ů͛Ăďƌŝ ĚĞ ƚŽƵƚĞƐ ŶƵŝƐĂŶĐĞƐ͕ ă ƐĞƵůĞŵĞŶƚ ƋƵĞůƋƵĞƐ ŵŝŶƵƚĞƐ ĚƵ ĐĞŶƚƌĞ ĚĞ 'ĞŶğǀĞ͘ >Ă ĚĞŵĞƵƌĞ Ă ĠƚĠ ĞŶƟğƌĞŵĞŶƚ ƌĠŶŽǀĠĞ Ğƚ ĚĠĐŽƌĠĞ ĞŶ ϮϬϭϯ͘ ůůĞ ƐĞ ƐŝƚƵĞ ƐƵƌƵŶĞŵĂŐŶŝĮƋƵĞƉĂƌĐĞůůĞĚĞϱ͛ϱϬϳŵϮĞƚƉƌŽƉŽƐĞƵŶĞƐƵƌĨĂĐĞƵƟůĞĚĞϰϲϬŵϮ. La ŵĂŝƐŽŶĚŝƐƉŽƐĞĚĞϱĐŚĂŵďƌĞƐĞƚϰƐĂůůĞƐĚ͛ĞĂƵ͘>ĂƉƌŽƉƌŝĠƚĠĞƐƚĂĐƚƵĞůůĞŵĞŶƚĚŽƚĠĞ Ě͛ƵŶĞƐĂůůĞĚĞƚƌĂĚŝŶŐƉĂƌĨĂŝƚĞŵĞŶƚĠƋƵŝƉĠĞ͕ŝĚĠĂůĞƉŽƵƌƵŶĞdžĠĐƵƟǀĞĚ͛ƵŶŚĞĚŐĞͲ ĨƵŶĚŽƵĚ͛ƵŶĞŽŵŵŽĚŝƚLJdƌĂĚŝŶŐ,ŽƵƐĞ͘ >ŽĐĂƚĞĚĂĨĞǁŵŝŶƵƚĞƐĨƌŽŵƚŚĞĐĞŶƚĞƌŽĨ'ĞŶĞǀĂ͕ŽŶĂďĞĂƵƟĨƵůƉůŽƚŽĨůĂŶĚ͕ƚŚŝƐƌĂƌĞ ƉƌŽƉĞƌƚLJĞŶũŽLJƐĂŶĞdžĐůƵƐŝǀĞ͕ƉƌŝǀĂƚĞƐĞƫ ŶŐƐĞĐůƵĚĞĚĨƌŽŵĂŶLJĚŝƐƚƵƌďĂŶĐĞ͘dŚŝƐŚŽŵĞ ǁĂƐĨƵůůLJƌĞŶŽǀĂƚĞĚĂŶĚĚĞĐŽƌĂƚĞĚŝŶϮϬϭϯ͘/ƚƐŝƚƐŽŶĂϱ͕ϱϬϳƐƋ͘ŵƉůŽƚŽĨůĂŶĚĂŶĚŚĂƐ ĂϰϲϬƐƋ͘ŵŇŽŽƌĂƌĞĂ͕ŽīĞƌŝŶŐϱďĞĚƌŽŽŵƐĂŶĚϰďĂƚŚƌŽŽŵƐ͘,ĞĂƚĞĚƐǁŝŵŵŝŶŐƉŽŽů͕ ƉŽŽůŚŽƵƐĞ͕ďĂƐŬĞƚďĂůůĐŽƵƌƚ͕ƉůĂLJŐƌŽƵŶĚĨŽƌĐŚŝůĚƌĞŶĂŶĚŐĂƌĂŐĞ͘džĐĞƉƟŽŶĂůŚŽŵĞ ĂƵƚŽŵĂƟŽŶƐLJƐƚĞŵĂŶĚĂĚǀĂŶĐĞĚƐĞĐƵƌŝƚLJƐLJƐƚĞŵƚŚĂƚŵĞĞƚƐƚŚĞŚŝŐŚĞƐƚƐƚĂŶĚĂƌĚƐ͘

ZĠĨ͘ϱϯϬϰϬϳ

Chemin du Château-Bloch 11 | CP 172 | 1211 Genève 8 | 022 809 06 48 'ĂŵŵĞĚĞƉƌŝdž;ĞŶ,&Ϳര͗ 3 à 6 mios

6 à 10 mios

10 à 15 mios

+15 mios

GROUPE GEROFINANCE-DUNAND | RÉGIE DE LA COURONNE Genève | Mies | Rolle | Morges | Yverdon | Bussigny | Lausanne | Lutry | Vevey | Montreux | Sion | Crans-Montana

www.barnes-suisse.com

LUX-RESIDENCE.COM

65


h94-065-080.qxd

30.7.2015

16:01

Page 66

Hermance Superbe propriété ĞƩĞ ƐƵďůŝŵĞ ƉƌŽƉƌŝĠƚĠ ĐŽŶƚĞŵƉŽƌĂŝŶĞ ĞƐƚ ƐŝƚƵĠĞ ƐƵƌ ƵŶĞ ƉĂƌĐĞůůĞ Ě͛ĞŶǀŝƌŽŶϭ͛ϵϬϬŵ2͕ĨĂĐĞăƵŶƉĂŶŽƌĂŵĂĚĞƚŽƵƚĞďĞĂƵƚĠƐƵƌůĞůĂĐĞƚůĞ :ƵƌĂ͕ĂƵĐĂůŵĞĂďƐŽůƵ͘ŽŶƐƚƌƵŝƚĞĞŶϮϬϬϳ͕ƌĠƐŽůƵŵĞŶƚĂǀĂŶƚͲŐĂƌĚŝƐƚĞ͕ ĞůůĞ ũŽƵŝƚ ĚĞ ŵĂƚĠƌŝĂƵdž ŚĂƵƚ ĚĞ ŐĂŵŵĞ͘ ͛ƵŶĞ ƐƵƌĨĂĐĞ ŚĂďŝƚĂďůĞ ĚĞ ƉƌğƐĚĞϰϬϬŵ2͕ůĂǀŝůůĂƉƌŽƉŽƐĞƋƵĂƚƌĞƐƉůĞŶĚŝĚĞƐĐŚĂŵďƌĞƐăĐŽƵĐŚĞƌ ĞƚϰƐĂůůĞƐĚĞďĂŝŶƐ͘ dŚŝƐŵĂŐŶŝĮĐŝĞŶƚƉƌŽƉĞƌƚLJŝƐůŽĐĂƚĞĚŽŶĂďĞĂƵƟĨƵůƉůŽƚŽĨĂďŽƵƚϭ͛ϵϬϬ m2ĨĂĐŝŶŐƚŚĞůĂŬĞĂŶĚƚŚĞ:ƵƌĂ͕ŝŶĂƋƵŝĞƚĂŶĚƌĞƐŝĚĞŶƟĂůĂƌĞĂ͘Ƶŝůƚ ŝŶ ϮϬϬϳ ǁŝƚŚ ŚŝŐŚ ƐƚĂŶĚŝŶŐ ŵĂƚĞƌŝĂůƐ͕ ƚŚĞ ǀŝůůĂ ŽīĞƌƐ Ă ůŝǀŝŶŐ ƐƉĂĐĞ ŽĨĂďŽƵƚϰϬϬŵ2ŽŶĨŽƵƌĚŝīĞƌĞŶƚŇŽŽƌƐ͘/ƚƉƌŽƉŽƐĞƐϰďĞĚƌŽŽŵƐĂŶĚ ϰďĂƚŚƌŽŽŵƐ͘dŚŝƐƉƌŽƉĞƌƚLJŝƐƌĂƌĞŽŶƚŚĞŵĂƌŬĞƚ͘

CHF 11’000’000.-

ZĠĨ͘ϳϵϯϴϭϵ

Eaux-Vives Magnifique duplex en attique ŝĞŶĚ͛ĞdžĐĞƉƟŽŶ͊ĞŵĂŐŶŝĮƋƵĞĂƫ ƋƵĞĚĞϯϯϰŵ2нϭϯϬŵ2ĚĞƚĞƌͲ ƌĂƐƐĞ ĞƐƚ ƐŝƚƵĠ ă ϱ ŵŝŶƵƚĞƐ ĚƵ ĐĞŶƚƌĞͲǀŝůůĞ͘ /ů ďĠŶĠĮĐŝĞ Ě͛ƵŶĞ ĐƵŝƐŝŶĞ ĠƋƵŝƉĠĞ͕Ě͛ƵŶĞƐĂůůĞăŵĂŶŐĞƌ͕Ě͛ƵŶƐĠũŽƵƌ͕Ě͛ƵŶĞďŝďůŝŽƚŚğƋƵĞ͕ĚĞϰ ĐŚĂŵďƌĞƐĞƚĚĞϮƐĂůůĞƐĚĞďĂŝŶƐ͘ŶƟğƌĞŵĞŶƚƌĠŶŽǀĠ͕ů͛ĠƚĂŐĞƐĞĐŽŵͲ ƉŽƐĞ Ě͛ƵŶĞ ƐƵŝƚĞ ƉĂƌĞŶƚĂůĞ ĂŝŶƐŝ ƋƵĞ Ě͛ƵŶĞ ĐŚĂŵďƌĞ Ě͛ĂŵŝƐ͘ >Ă ƚĞƌͲ ƌĂƐƐĞ͕ĚĞϭϯϬŵ2͕ƉƌŽĮƚĞĚ͛ƵŶĞǀƵĞŝŵƉƌĞŶĂďůĞƐƵƌůĂƌĂĚĞĚĞ'ĞŶğǀĞ͘ džĐĞƉƟŽŶĂůĚƵƉůĞdžͲĂƉĂƌƚŵĞŶƚ͊dŚŝƐƚŽƉŇŽŽƌĂƉĂƌƚŵĞŶƚŽīĞƌƐĂůŝǀŝŶŐ ƐƉĂĐĞŽĨϯϯϰŵ2ĂŶĚĞŶũŽLJƐĂďĞĂƵƟĨƵůƚĞƌƌĂĐĞŽĨϭϯϬŵ2͘ŝƚLJĐĞŶƚĞƌŝƐ ŽŶůLJϱŵŝŶƵƚĞƐĂǁĂLJ͘/ƚƉƌŽƉŽƐĞƐĂŶĞƋƵŝƉƉĞĚŬŝƚĐŚĞŶ͕ĂĚŝŶŝŶŐƌŽŽŵ͕Ă ůƵŵŝŶŽƵƐůŝǀŝŶŐƌŽŽŵ͕ϰďĞĚƌŽŽŵƐĂŶĚϮďĂƚŚƌŽŽŵƐ͘ŽŵƉůĞƚĞůLJƌĞŶŽͲ ǀĂƚĞĚ͕ƚŚĞĂƫ ĐƉƌŽƉŽƐĞƐĂƉĂƌĞŶƚĂůƐƵŝƚĞĂŶĚĂŐƵĞƐƚƌŽŽŵ͘dŚĞĂƉĂƌƚͲ ŵĞŶƚĞŶũŽLJƐĂŵĂŐŶŝĮĐŝĞŶƚǀŝĞǁŽŶ'ĞŶĞǀĂ͘

CHF 4’500’000.-

ZĠĨ͘ϳϳϯϯϳϱ

Chemin du Château-Bloch 11 | CP 172 | 1211 Genève 8 | 022 809 06 48 'ĂŵŵĞĚĞƉƌŝdž;ĞŶ,&Ϳര͗ ϯăϲŵŝŽƐ

ϲăϭϬŵŝŽƐ

ϭϬăϭϱŵŝŽƐ

нϭϱŵŝŽƐ

GROUPE GEROFINANCE-DUNAND | RÉGIE DE LA COURONNE 'ĞŶğǀĞͮDŝĞƐͮZŽůůĞͮDŽƌŐĞƐͮzǀĞƌĚŽŶͮƵƐƐŝŐŶLJͮ>ĂƵƐĂŶŶĞͮ>ƵƚƌLJͮsĞǀĞLJͮDŽŶƚƌĞƵdžͮ^ŝŽŶͮƌĂŶƐͲDŽŶƚĂŶĂ

www.barnes-suisse.com

66

HELVETISSIMMO


h94-065-080.qxd

30.7.2015

16:01

Page 67

Thônex Très belle propriété rénovée Située dans un écrin de verdure, sur une belle parcelle arborée de 1’300 m2͕ĐĞƩĞďĞůůĞŵĂŝƐŽŶĚŝƐƉŽƐĞĚ͛ƵŶĞƐƵƌĨĂĐĞŚĂďŝƚĂďůĞĚ͛ĞŶǀŝͲ ron 260 m2ĞƚĚ͛ƵŶĞƐƵƌĨĂĐĞƵƟůĞĚĞϯϳϬŵ2͘ZĠƉĂƌƟĞƐƵƌϮŶŝǀĞĂƵdžн ƐŽƵƐͲƐŽů͕ĐĞƩĞĚĞƌŶŝğƌĞĂĠƚĠƌĠŶŽǀĠĞĞƚŽīƌĞĚĞďĞĂƵdžĞƚůƵŵŝŶĞƵdž ǀŽůƵŵĞƐ͘>ĂǀŝůůĂũŽƵŝƚĚĞϰĐŚĂŵďƌĞƐăĐŽƵĐŚĞƌĞƚĚĞϰƐĂůůĞƐĚ͛ĞĂƵ͘ 'ĂƌĂŐĞĚŽƵďůĞĞƚϮƉůĂĐĞƐĚĞƉĂƌĐĞdžƚĠƌŝĞƵƌĞƐ͘ >ŽĐĂƚĞĚŝŶĂŐƌĞĞŶĂŶĚƌĞƐŝĚĞŶƟĂůĂƌĞĂ͕ŽŶĂďĞĂƵƟĨƵůƉůŽƚŽĨĂďŽƵƚ 1’300 m2͕ƚŚŝƐĨĂŵŝůLJŚŽƵƐĞŽīĞƌƐĂůŝǀŝŶŐƐƉĂĐĞŽĨϮϲϬŵ2ĂŶĚĞŶũŽLJƐĂ ůĂƌŐĞďĂƐĞŵĞŶƚŽĨϭϭϬŵ2͘KŶƚǁŽŇŽŽƌƐ͕ƚŚĞƉƌŽƉĞƌƚLJŚĂƐďĞĞŶĐŽŵͲ ƉůĞƚĞůLJƌĞŶŽǀĂƚĞĚĂŶĚĞŶũŽLJƐϰďĞĚƌŽŽŵƐĂŶĚϰďĂƚŚƌŽŽŵƐ͘'ĂƌĂŐĞĨŽƌ ƚǁŽĐĂƌƐĂŶĚϮŽƵƚĚŽŽƌƉĂƌŬŝŶŐƐƉĂĐĞƐ͘

CHF 3’300’000.-

ZĠĨ͘ϴϭϮϮϯϯ

Chêne-Bougeries Villa individuelle avec piscine ĞƩĞ ďĞůůĞ ǀŝůůĂ ĨĂŵŝůŝĂůĞ ĞŶƟğƌĞŵĞŶƚ ƌĠŶŽǀĠĞ ĞŶ ϮϬϭϱ͕ ƐĞ ƐŝƚƵĞ ƐƵƌ ůĂ ĐŽŵŵƵŶĞ ƉƌŝƐĠĞ ĚĞ ŚġŶĞͲŽƵŐĞƌŝĞƐ͘ ƌŝŐĠĞ ƐƵƌ ƵŶĞ ƉĂƌĐĞůůĞ ĚĞ plus de 1’000 m2͕ ĞůůĞ ŽīƌĞ ƵŶ ďĞĂƵ ũĂƌĚŝŶ ĂƌďŽƌĠ͕ ĐůƀƚƵƌĠ ĂǀĞĐ ƉŝƐͲ ĐŝŶĞĐŚĂƵīĠĞ͕ƵŶŐĂƌĂŐĞƉŽƵƌĚĞƵdžǀŽŝƚƵƌĞƐĞƚϮƉůĂĐĞƐĞdžƚĠƌŝĞƵƌĞƐ͘>Ă ŵĂŝƐŽŶƉƌŽĮƚĞĞŶŽƵƚƌĞĚĞϱĐŚĂŵďƌĞƐăĐŽƵĐŚĞƌĞƚĚĞϯƐĂůůĞƐĚ͛ĞĂƵ͘ ^ƵƌĨĂĐĞŚĂďŝƚĂďůĞĚĞϮϬϬŵ2нƐŽƵƐͲƐŽů͘ ŶƟƌĞůLJƌĞŶŽǀĂƚĞĚŝŶϮϬϭϱ͕ƚŚŝƐďĞĂƵƟĨƵůĂŶĚĨĂŵŝůŝĂůƉƌŽƉĞƌƚLJŝƐůŽĐĂͲ ƚĞĚŽŶƚŚĞĐŚĂƌŵŝŶŐĐŽŵŵƵŶĞŽĨŚġŶĞͲŽƵŐĞƌŝĞƐ͘>ŽĐĂƚĞĚŽŶĂƉůŽƚ ŽĨϭ͛ϬϬϬŵ2͕ŝƚŽīĞƌƐĂŶĞŶũŽLJĂďůĞŐĂƌĚĞŶǁŝƚŚĂŚĞĂůŝŶŐƐǁŝŵŵŝŶŐͲ ƉŽŽů͕ĂŐĂƌĂŐĞĨŽƌƚǁŽĐĂƌƐĂŶĚƚǁŽŽƵƚĚŽŽƌƉĂƌŬŝŶŐƐƉĂĐĞƐ͘dŚĞŚŽƵƐĞ ƉƌŽƉŽƐĞƐ ϱ ďĞĚƌŽŽŵƐ ĂŶĚ ϯ ďĂƚŚƌŽŽŵƐ͘ dŽƚĂů ůŝǀŝŶŐ ƐƉĂĐĞ ϮϬϬ ŵ2 + ďĂƐĞŵĞŶƚ͘

CHF 4’290’0000.-

ZĠĨ͘ϴϮϭϳϳϱ

Chemin du Château-Bloch 11 | CP 172 | 1211 Genève 8 | 022 809 06 48 'ĂŵŵĞĚĞƉƌŝdž;ĞŶ,&Ϳര͗ ϯăϲŵŝŽƐ

ϲăϭϬŵŝŽƐ

ϭϬăϭϱŵŝŽƐ

нϭϱŵŝŽƐ

GROUPE GEROFINANCE-DUNAND | RÉGIE DE LA COURONNE 'ĞŶğǀĞͮDŝĞƐͮZŽůůĞͮDŽƌŐĞƐͮzǀĞƌĚŽŶͮƵƐƐŝŐŶLJͮ>ĂƵƐĂŶŶĞͮ>ƵƚƌLJͮsĞǀĞLJͮDŽŶƚƌĞƵdžͮ^ŝŽŶͮƌĂŶƐͲDŽŶƚĂŶĂ

www.barnes-suisse.com

LUX-RESIDENCE.COM

67


h94-065-080.qxd

30.7.2015

16:01

Page 68

GENEVE - CENTRE

GENÈVE

Appartement d’exception avec vue panoramique sur la Rade

M

D AN

AT

E

LU XC

SIF

Situé dans les étages supérieurs d’un immeuble de très haut standing, cet objet rare offre une surface PPE de 301 m2 composée de quatre magnifiques pièces de réception en enfilade, avec cheminée, toutes avec balcon face au Lac, de trois chambres, d’une cuisine et de trois salles d’eau. Possibilité de séparer une pièce pour bénéficier d’un studio indépendant. Buanderie avec sanitaires. Annexes: une chambre de service avec sanitaires, un grenier, une cave de 17 m2 et un parking. Prix sur demande

ROSSET IMMOBILIER Renseignements: Service vente Tél.: +41 (0)22 339 39 13 vente@rosset.ch

68

HELVETISSIMMO

Situated on the upper floors of a prestigious building, this rare property offers 301 m2 of a co-owned surface composed of four magnificent through reception rooms with a fireplace, all with a balcony facing the lake, three bedrooms, a kitchen and three shower rooms. Possibility of separating a room to create a self-containing studio. Utility room. Utility room with bathroom. Annexes: a staff bedroom with bathrooms, an attic, 17 m2 cellar and a parking space. Price on request


h94-065-080.qxd

30.7.2015

16:01

Page 69

Bory & Cie - Agence Immobilière SA - Avenue de Rosemont 8 - 1208 Genève

LUX-RESIDENCE.COM

69


h94-065-080.qxd

30.7.2015

16:01

Jussy

Page 70

Prix / Price

Au cœur de la campagne genevoise, propriété de douze pièces en excellent état d’entretien avec jardin arboré et belle piscine, offrant toutes les commodités pour les passionnés de chevaux. Le bâtiment d’habitation de 475 m2 comprend trois pièces en enfilade, cinq chambres à coucher, quatre salles d’eau et un studio indépendant. Couvert pour trois voitures. Ecurie avec quatre boxes, abri de pansage, grainerie et sellerie. Carrière de 20 m x 60 m, piste de 300 m et parcs de détente complètent ce bien. Réf. 10972

In the heart of the Geneva countryside, twelve-room property in excellent state of maintenance with a wooded garden and a nice swimming pool offering all amenities for horse enthusiasts. The dwelling offers 475 m2 and notably consists of three adjoining rooms, five bedrooms, and four bathrooms. Self-contained studio apartment - fully independent. Cover for three cars. Stable with four box stalls, a grooming shelter, a granary and a tack room. Complete with a 20 m x 60 m riding ring, 300 m of track, and relaxation areas. Réf. 10972

4 à 8 Mio 8 à 15 Mio 15 à 25 Mio + de 25 Mio

Bory & Cie - Agence Immobilière SA - Avenue de Rosemont 8 - 1208 Genève - t. +41 (0)22 708 12 30 - f. +41 (0)22 321 78 55

70

HELVETISSIMMO


h94-065-080.qxd

30.7.2015

16:01

Page 71

Jussy

Prix / Price

Magnifique propriété campagnarde aux portes de Genève, rénovée en 2007. La bâtisse principale d’environ 470 m2 habitables, lumineuse avec des beaux volumes, dispose de 11 pièces réparties en de généreuses réceptions et un espace familial dans les étages. Le jardin, agrémenté d’un barbecue d’été et d’un étang, offre une vue imprenable sur les champs et le Jura. Un appartement et un bureau aménagés dans la dépendance complètent cet objet. Le calme et le charme de ce lieu en font un bien rare à Genève. Réf. 22401

Magnificent country estate renovated in 2007, on the outskirts of Geneva. The main building with approx. 470 m2 of living space, bright and spacious interiors, comprising 11 rooms split into large reception rooms and a family area on the upper floors. The garden featuring a summer barbecue and a lake enjoys stunning views over the fields and the Jura. An apartment and an office in the outbuilding complete this property. The calm and charm of this site make it a scarce commodity in Geneva. Ref. 22401

4 à 8 Mio 8 à 15 Mio 15 à 25 Mio + de 25 Mio

Bory & Cie - Agence Immobilière SA - Avenue de Rosemont 8 - 1208 Genève - t. +41 (0)22 708 12 30 - f. +41 (0)22 321 78 55

LUX-RESIDENCE.COM

71


h94-065-080.qxd

30.7.2015

16:01

Page 72

MEINIER MAISON DE CARACTĂˆRE

CHARMING HOUSE OF CHARACTER

Au cœur d’un charmant hameau de la commune de Meinier, cette SURSULWHVWVLWXHDXFDOPHDEVROX(OOHEQƂFLHGŒXQSDUFGHSOXVGH ŒbP2, en partie en zone agricole. La demeure offre des espaces de vie JQUHX[DLQVLTXŒXQHVXUIDFHKDELWDEOHGHSOXVGHbP2.

In the heart of a charming hamlet of the commune of Meinier, this property sits in a quiet and disturbance free area. It offers a park of over bP2, in a partly agricultural zone. The house offers generous living VSDFHRQDVXUIDFHRIRYHUbP2.

Le rez-de-chaussÊe est distribuÊ par de belles pièces de rÊception avec cheminÊe. Aux Êtages, 8 spacieuses chambres à coucher et 6 salles d’eau. /HMDUGLQMROLPHQWDUERUSURƂWHQRWDPPHQWGŒXQFRXUWGHWHQQLV

7KH JURXQG ĆƒRRU FRPSULVHV EHDXWLIXO UHFHSWLRQ URRPV ZLWK D Ć‚UHSODFH 8SVWDLUV  ODUJH EHGURRPV DQG  EDWKURRPV7KH YHU\ QLFHO\ ZRRGHG garden comprises a tennis court.

Une belle cour avec garages complète ce bien.

$EHDXWLIXOFRXUW\DUGZLWKJDUDJHVFRPSOHWHVWKLVSURSHUW\

Des travaux de mise au goĂťt du jour sont Ă  prĂŠvoir. RĂŠf. 17466

0RGHUQLVDWLRQZRUNVDUHWREHSODQQHG5HI

Prix sur demande / Price on demand 5 – 7,5 /

7,5 – 10 /

GRANGE & CIE SA SERVICE VENTE 21-23, CHEMIN DE GRANGE-CANAL | 1208 GENĂˆVE

72

HELVETISSIMMO

10 – 12,5 /

12,5 – 15 /

15 + (mio CHF)

TÉL : +41 22 707 10 50 | FAX : +41 22 707 10 03 VENTE@GRANGE.CH | WWW.GRANGE.CH


h94-065-080.qxd

30.7.2015

16:01

Page 73

COLOGNY VUE IMPRENABLE SUR LE LAC

STUNNING VIEW ON THE LAKE

8QLTXH HW PDJQLĆ‚TXH SDUFHOOH GH SOXV GH Ĺ’ P2 offrant une vue panoramique et imprenable sur le lac et la rade.

Unique and beautiful plot of over 2,600 m2, offering a panoramic and FOHDUYLHZRQWKHODNHDQGWKHKDUERU

Situation exceptionnelle et tranquillitĂŠ absolue sont les principales caractĂŠristiques de ce terrain surplombant le lac.

Exceptional location and absolute tranquility are the main characteristics of this land overlooking the lake.

Sis en zone Rive du Lac, il permettra la construction d’une villa de plus de 520 m2 habitables. RÊf. 25501

/RFDWHGLQDĹ”/DNH6LGHĹ•]RQHLWZLOODOORZWKHFRQVWUXFWLRQRIDYLOODRI over 520 m2. Ref. 25501

Prix sur demande / Price on demand 5 – 7,5 /

7,5 – 10 /

GRANGE & CIE SA SERVICE VENTE 21-23, CHEMIN DE GRANGE-CANAL | 1208 GENĂˆVE

10 – 12,5 /

12,5 – 15 /

15 + (mio CHF)

TÉL : +41 22 707 10 50 | FAX : +41 22 707 10 03 VENTE@GRANGE.CH | WWW.GRANGE.CH

LUX-RESIDENCE.COM

73


h94-065-080.qxd

30.7.2015

16:01

Page 74

VANDŒUVRES MAISON D’ARCHITECTE

ARCHITECT HOUSE

,PSODQW«H VXU XQH PDJQLƂTXH SDUFHOOH GH SOXV GH Œb P2 GH OD FRPPXQHGH9DQGĐXYUHVFHWWHOXPLQHXVHPDLVRQGŒDUFKLWHFWHUHVWDXU«HHWDJUDQGLHHQRIIUHGHJUDQGVHVSDFHVGHYLHFRQWHPSRUDLQV

/RFDWHGRQDEHDXWLIXOSORWRIbP2LQWKHFRPPXQHRI9DQGĐXYUHV WKLVEULJKWDUFKLWHFWKRXVHUHVWRUHGDQGH[WHQGHGLQRIIHUVODUJH FRQWHPSRUDU\OLYLQJVSDFH

/HUH]GHFKDXVV«HGŒXQHVXUIDFHGHYLHGHbP2FRPSUHQGOHV«MRXU SULQFLSDOHWODFXLVLQHXQGHX[LªPHVDORQDLQVLTXŒXQHFKDPEUHGŒDPLV DYHFVDOOHGHGRXFKH/Her«WDJHHWOHVFRPEOHVVHU«SDUWLVVHQWHQWUH FKDPEUHV¢FRXFKHUXQHFKDPEUHWWHXQHVDOOHGHEDLQVHWVDOOHVGH GRXFKHDYHFWRLOHWWHV

7KHJURXQGƃRRUFRPSULVHVDbP2OLYLQJDUHDZKLFKLQFOXGHVWKHPDLQ OLYLQJURRPDQGWKHNLWFKHQDVHFRQGOLYLQJURRPDQGDJXHVWEHGURRP ZLWKSULYDWHVKRZHU7KHƂUVWƃRRUDQGWKHDWWLFRIIHUEHGURRPVD VPDOOEHGURRPDEDWKURRPDQGVKRZHUVZLWKWRLOHWV

8QJDUDJHSRXUYRLWXUHVHWXQFRXYHUWFRPSOªWHQWFHELHQGŒH[FHSWLRQ 5«I

$FDUJDUDJHDQGDFRYHUHGDUHDFRPSOHWHWKLVH[FHSWLRQDOSURSHUW\ 5HI

Prix sur demande / Price on demand 2à4/

GRANGE & CIE SA SERVICE VENTE 21-23, CHEMIN DE GRANGE-CANAL | 1208 GENÈVE

74

HELVETISSIMMO

4à6/

6à8/

8 à 10 (mio CHF)

TÉL : +41 22 707 10 50 | FAX : +41 22 707 10 03 VENTE@GRANGE.CH | WWW.GRANGE.CH


h94-065-080.qxd

30.7.2015

16:01

Page 75

PETIT-SACONNEX ATTIQUE TRIPLEX AVEC VUE SUR LE LAC

TRIPLEX ATTIC WITH VIEW ON THE LAKE

$ SUR[LPLW« GHV 2UJDQLVDWLRQV ,QWHUQDWLRQDOHV FH PDJQLƂTXH DSSDUWHPHQWDWWLTXHWULSOH[RIIUHXQHVXUIDFHKDELWDEOHGHbP2DLQVLTXH bP2GHWHUUDVVHVEDOFRQVDYHFYXHVXUOHODF

&ORVHWR,QWHUQDWLRQDO2UJDQL]DWLRQVWKLVVWXQQLQJWULSOH[DWWLFDSDUWPHQW RIIHUV D OLYLQJ DUHD RI  b P2 DQG b P2 RI EDOFRQLHVWHUUDFHV RYHUORRNLQJWKHODNH

Au 8ªPH «WDJH SLªFHV GH U«FHSWLRQ J«Q«UHXVHV VDORQ FXLVLQH VDOOH ¢ PDQJHU VDORQELEOLRWKªTXH FKDPEUH DYHF GUHVVLQJ HW VDOOH GH EDLQV EXDQGHULH HW ZF YLVLWHXUV $ OŒ«WDJH LQI«ULHXU  FKDPEUHV HW  VDOOHV GŒHDX(QDWWLTXHJUDQGHSLªFHDYHFVDOOHGHEDLQVVŒRXYUDQWVXUXQH WHUUDVVHGHbP28QDFFªVGLUHFWHWLQG«SHQGDQWGRQQHVXUODSLVFLQH GHODFRSURSUL«W«VLWX«HVXUOHWRLWGHOŒLPPHXEOH

2QWKHWKƃRRUODUJHUHFHSWLRQURRPVORXQJHNLWFKHQGLQLQJURRP OLYLQJOLEUDU\EHGURRPZLWKGUHVVLQJDQGEDWKURRPODXQGU\URRPDQG JXHVWWRLOHWV2QWKHORZHUƃRRUEHGURRPVDQGEDWKURRPV7KHDWWLF RIIHUVDODUJHURRPZLWKEDWKURRPZKLFKRSHQVRQWRDbP2 WHUUDFH 'LUHFWDQGLQGHSHQGHQWDFFHVVWRWKHFRQGRPLQLXPŒVSRROORFDWHGRQ WKHURRIRIWKHEXLOGLQJ

8QER[XQSDUNLQJDLQVLTXHFDYHVFRPSOªWHQWFHELHQ5«I

/RFNXSJDUDJHSDUNLQJDQGFHOODUV5HI

Prix sur demande / Price on demand 2à4/

GRANGE & CIE SA SERVICE VENTE 21-23, CHEMIN DE GRANGE-CANAL | 1208 GENÈVE

4à6/

6à8/

8 à 10 (mio CHF)

TÉL : +41 22 707 10 50 | FAX : +41 22 707 10 03 VENTE@GRANGE.CH | WWW.GRANGE.CH

LUX-RESIDENCE.COM

75


h94-065-080.qxd

30.7.2015

16:01

Page 76

MAGNIFIQUE APPARTEMENT CHAMPEL Situé au 3e étage d’un immeuble de standing construit en 2010, dans le quartier prisé et recherché de Champel, proche du Parc Bertrand et à deux pas de la Vieille-Ville, ce magnifique appartement bénéficie de grandes baies vitrées et d’une surface PPE de 211 m2 et 18 m2 de loggia. Il se compose d’un long hall d’entrée avec armoires, d’une cuisine entièrement équipée ouverte sur l’espace salon/salle à manger d’une surface de plus de 60 m2, de 2 spacieuses chambres, d’un dressing et de 2 salles de bains. Annexes : une cave et un box simple. CHF 3 600 000.–

Tél. 022 839 09 47

ventes@mvvi.ch • www.mvvi.ch

76

HELVETISSIMMO


h94-065-080.qxd

30.7.2015

16:01

Page 77

SOMPTUEUSE MAISON COLOGNY Entièrement rénovée en 2011 avec un soin particulier dans un style contemporain, splendide maison bénéficiant d’une surface habitable de 300 m2 et plus de 500 m2 de surface utile, offrant un cadre de vie luxueux sur une belle parcelle plate avec une vue imprenable sur le lac et le Jura. Orientée ouest, elle comprend 2 niveaux + sous-sol et se compose d’une cuisine entièrement équipée avec îlot central, d’un office, d’une salle à manger, d’un grand séjour avec cheminée, d’un bureau d’angle, de 4 chambres, de 4 salles d’eau et d’un sous-sol entièrement excavé. Annexes : une piscine extérieure, une piscine intérieure, une véranda chauffée, un garage pour 2 voitures. CHF 16 000 000.–

Tél. 022 839 09 47

ventes@mvvi.ch • www.mvvi.ch

LUX-RESIDENCE.COM

77


h94-065-080.qxd

30.7.2015

16:01

Page 78

naef

Prestige

VANDOEUVRES - GENÈVE - DOMAINE DE MAÎTRE Au cœur du village de Vandoeuvres, cette belle demeure de style Genevois dispose d’une surface OHIP[HISL KL WS\Z KL  Tõ L[ ItUtÄJPL K»\UL vue panoramique sur le Mont-Blanc. La propriété se distribue sur deux niveaux plus un sous-sol et VɈYL KL ILH\_ ]VS\TLZ 3L YLaKLJOH\ZZtL ZL compose d’un vaste hall d’entrée, de deux salons en LUÄSHKLH]LJJOLTPUtLK»\ULZHSSLnTHUNLYK»\UL cuisine, d’une bibliothèque avec cheminée, de deux chambrettes, de toilettes visiteurs et d’un vestiaire.

This stylish mansion property in the typical Genevois style, located in the heart of the village of Vandoeuvres, provides more than 300 m² of living space and enjoys a panoramic ]PL^VM4VU[)SHUJ;OLWYVWLY[`VɈLYZNLULYV\ZYVVTZ V]LY [^V ÅVVYZ WS\Z H IHZLTLU[ ;OL NYV\UK ÅVVY includes a large entrance hall, two adjoining living rooms ^P[OÄYLWSHJLKPUPUNYVVTRP[JOLUSPIYHY`^P[OÄYLWSHJL two small bedrooms, a WC for guests and a cloakroom. ;OL \WWLY ÅVVY HJJVTTVKH[LZ Ä]L ILKYVVTZ [^V bathrooms and a separate WC.

Naef Prestige Mail: prestige.ge@naef.ch Téléphone: 022 839 38 77 www.naef-prestige.ch

Réf.: 24836 Prix sur demande ** / Price on request ** Naef Prestige is a member of the Knight Frank network

78

HELVETISSIMMO

*/-KLnTPV*/-KLnTPV*/-KLnTPV*/-WS\ZKLTPV


h94-065-080.qxd

30.7.2015

16:01

Page 79

naef

Prestige

CONCHES - GENĂˆVE - CACHET UNIQUE *LZTHNUPĂ„X\LZ[LYYHPUZKÂť\ULZ\YMHJL[V[HSLKLWS\Z KLÂťTĂľZVU[ZP[\tZH\JÂľ\YKÂť\UKLZX\HY[PLYZ SLZWS\ZYLJOLYJOtZ!n*VUJOLZ;V\[LUItUtĂ„JPHU[ K\ JHSTL KL JL SPL\ THNUPĂ„X\L ]V\Z YLQVPUKYLa SL JLU[YL]PSSL HPUZP X\L SLZ JVTTVKP[tZ LU X\LSX\LZ TPU\[LZ 3LZ KL\_ WHYJLSSLZ ZVU[ LU aVUL ]PSSH n SÂťHIYPKL[V\[LZU\PZHUJLZ,SSLZZVU[VYPLU[tLZ:\K ,Z[ QV\PZZLU[ KÂť\U QVSP KtNHNLTLU[ L[ KPZWVZLU[ KL THNUPĂ„X\LZ HYIYLZ JLU[LUHPYLZ ,SSLZ ZVU[ ]LUK\LZ SPIYLZKLTHUKH[KÂťHYJOP[LJ[L

;OPZZ\WLYIWYVWLY[`^P[OH[V[HSZ\YMHJLHYLHVMTVYL [OHUÂťTĂľPZSVJH[LKPUVULVM[OLTVZ[ZV\NO[ HM[LYKPZ[YPJ[ZPU*VUJOLZ(S[OV\NO[OL`ILULĂ„[MYVT [OL [YHUX\PSP[` VM [OPZ THY]LSV\Z ZP[L [OL` HYL VUS` H few minutes away from all the city centre amenities. )V[OWSV[ZHYLPUaVULYLZPKLU[PHSaVUPUN^LSSH^H` MYVT HU` KPZ[\YIHUJLZ ;OL` MHJL :V\[O,HZ[ PU H WYL[[` JSLHYPUN ^P[O THNUPĂ„JLU[ TH[\YL [YLLZ ;OL` are sold with no commitment to a particular architect.

Naef Prestige Mail: prestige.ge@naef.ch TĂŠlĂŠphone: 022 839 38 77 www.naef-prestige.ch

RĂŠf.: 24937 Prix sur demande ** / Price on request ** Naef Prestige is a member of the Knight Frank network

* CHF de 2 Ă  5 mio ** CHF de 5 Ă  15 mio *** CHF de 15 Ă  30 mio **** CHF plus de 30 mio

LUX-RESIDENCE.COM

79


h94-065-080.qxd

30.7.2015

16:01

Page 80

UNION SUISSE DES GRANDS DOMAINES GENEVE

IMMEUBLE ADMINISTRATIF OU GALERIE COMMERCIALE DE PREMIER ORDRE

Réf. N° 72662

• • • • • •

Edifice de premier ordre Quartier des banques privées au centre ville Locaux administratifs à louer entièrement équipés Surface de 1’719 m2 répartis sur 7 niveaux Rue de la Corraterie 6, Genève Informations sur demande

• • • • • •

Prestigious building Private city centre banks district Fully equipped administrative premises for rent Surface of 1’719 m2 spread over 7 floors Rue de la Corraterie 6, Genève Information on request

«OFFRES D’ACHAT FACULTATIVES ÉTUDIÉES»

I NVESTISSEMENTS F ONCIERS P ATRIMONIAUX

DOMAINE DU CHÂTAIGNIER – CHEMIN DE LA PETITE VOIE 1A – CH-1294 GENTHOD/GENÈVE TEL +41 (0) 79 204 15 24 - UNIONSUISSE@GRANDSDOMAINES.CH

80

HELVETISSIMMO


h94-081-096.qxd

30.7.2015

16:03

Page 81

UNION SUISSE DES GRANDS DOMAINES GENEVE

IMMEUBLE ADMINISTRATIF OU GALERIE COMMERCIALE DE PREMIER ORDRE

Réf. N° 72684

• • • • • •

Edifice de premier ordre Quartier des banques privées au centre ville Locaux administratifs à louer entièrement équipés Surface de 1’040 m2 répartis sur 7 niveaux Rue de Diday 2, Genève Informations sur demande

• • • • • •

Prestigious building Private city centre banks district Fully equipped administrative premises for rent Surface of 1’040 m2 spread over 7 floors Rue de Diday 2, Geneva Information on request

«OFFRES D’ACHAT FACULTATIVES ÉTUDIÉES»

I NVESTISSEMENTS F ONCIERS P ATRIMONIAUX

DOMAINE DU CHÂTAIGNIER – CHEMIN DE LA PETITE VOIE 1A – CH-1294 GENTHOD/GENÈVE TEL +41 (0) 79 204 15 24 - UNIONSUISSE@GRANDSDOMAINES.CH

LUX-RESIDENCE.COM

81


h94-081-096.qxd

30.7.2015

16:03

Page 82

UNION SUISSE DES GRANDS DOMAINES GENEVE

HÔTEL PARTICULIER RÉSIDENTIEL 4 APPARTEMENTS D’ÉPOQUE 1873 - LIBRES ET À RÉNOVER

Réf. N° 72672

Cet hôtel particulier d’exception se situe au 8, rue Saint-Victor dans le prestigieux quartier des ambassades à Genève. Erigé au XIX siècle e

par le célèbre architecte John Camoletti, la bâtisse résidentielle de style Louis XIII offre une surface utile de plus de 850 m comprenant 4 appartements d’un caractère d’époque. L’espace intérieur privilégie de vastes pièces de réception en enfilade agrémentées de leurs cheminées, de hauteur sous plafond imposante et d’une luminosité généreuse. Actuellement libre de tout occupant, l’édifice bénéficie d’une autorisation en force permettant des transformations telles que la réalisation d’un ascenseur ou l’embellissement de sa façade en pierre de taille. Destiné à un connaisseur, cet objet rare constitue un investissement de premier ordre. Prix sur demande. 2

I NVESTISSEMENTS F ONCIERS P ATRIMONIAUX

DOMAINE DU CHÂTAIGNIER – CHEMIN DE LA PETITE VOIE 1A – CH-1294 GENTHOD/GENÈVE TEL +41 (0) 79 204 15 24 - UNIONSUISSE@GRANDSDOMAINES.CH

82

HELVETISSIMMO


h94-081-096.qxd

30.7.2015

16:03

Page 83

UNION SUISSE DES GRANDS DOMAINES GENEVE

RESIDENTIAL MANSION 4 APARTMENTS WITH PERIOD CHARACTER FROM 1873 - AVAILABLE AND READY TO RENOVATE

Ref. N° 72672

This exceptional mansion house situated at 8. rue Saint-Victor in the prestigious embassies sector of Geneva was built in the 19

century by the famous architect John Camoletti, this Louis XIII style residential building has a floor space of over 850 m composed of 4 apartments with period character. The interior favours large through reception rooms decorated with fireplaces, lofty ceilings and plentiful light. Currently free of any occupant, the building holds permission for transformations such as a lift or embellishment of its dressed stone facade. Suitable for a connoisseur, this rare item is a premier property investment. Price on request. th

2

I NVESTISSEMENTS F ONCIERS P ATRIMONIAUX

DOMAINE DU CHÂTAIGNIER – CHEMIN DE LA PETITE VOIE 1A – CH-1294 GENTHOD/GENÈVE TEL +41 (0) 79 204 15 24 - UNIONSUISSE@GRANDSDOMAINES.CH

LUX-RESIDENCE.COM

83


h94-081-096.qxd

30.7.2015

16:03

Page 84

10 years

Superior Living In Switzerland G E N E V A

•

V A U D

•

V A L A I S

•

N E U C H Ă‚ T E L

•

G S T A A D

www.spgfinestproperties.ch

9,(,//(9,//(ĹŠ*(1u9(

Prix 2

Somptueux appartement de 175 m habitables, entièrement rÊnovÊ en 2014 en plein cœur de la Vieille-Ville. Cuisine ouverte sur salle à manger, 3 chambres à coucher dont une avec grande salle de douche, une salle de bains et coin bureau.

SPG FINEST PROPERTIES, Genève, T 058 810 30 30

)/25,66$17ĹŠ*(1u9(

Prix

0DJQLŰTXHGXSOH[HQDWWLTXHSRVVGDQWXQHVSOHQGLGHWHUUDVVHGHP amÊnagÊe avec cuisine, barbecue et jacuzzi. Entièrement rÊnovÊ en 2013. Vaste sÊjour, cuisine contemporaine, suite parentale et 2 chambres avec salle de bains. 2 boxes. 2

SPG FINEST PROPERTIES, Genève, T 058 810 30 30 A vendre – Gamme de prix en CHF :

GENĂˆVE Rte de Frontenex 41 A • 1207 Genève T. +41 ( 0 ) 58 810 30 30 geneva@spgfinestproperties.ch

84

HELVETISSIMMO

4 -8 millions

8 -12 m.

12 -15 m.

NYON Av. Alfred-Cortot 7 • 1260 Nyon T. +41 ( 0 ) 58 810 36 50 nyon@spgfinestproperties.ch

15 - 20 m.

+ 20 m.

LAUSANNE-OUCHY Pl. de la Navigation 14 • 1006 Lausanne-Ouchy T. +41 ( 0 ) 58 810 35 50 lausanne@spgfinestproperties.ch


h94-081-096.qxd

30.7.2015

16:03

Page 85

naef

Prestige

CHEZ-LE-BART - NEUCHÂTEL - PIEDS DANS L’EAU Cette charmante villa se situe à Chez-le-Bart, sur deux parcelles totalisant 2’395 m² avec accès direct au lac. *VUZ[Y\P[L LU  JL[[L ]PSSH VɈYL KLZ WPuJLZ généreuses et lumineuses, un design moderne et des ÄUP[PVUZKLJOVP_ La parcelle est arborée avec soin et comprend une ombrée sous les pins, un vrai coin de paradis d’une grande tranquillité.

This charming villa is located in Chez-le-Bart, on two parcels totalizing 2’395 sqm with a private direct access to the lake. Built in 2002, this villa VɈLYZ NLULYV\Z HUK IYPNO[ YVVTZ ^P[O H TVKLYU design. The plot was wooded with care and includes a gorgeous shaded place under pines. A real paradise of tranquility !

Naef Prestige Mail: prestige.ne@naef.ch Téléphone: 032 737 27 65 www.naef-prestige.ch

Réf.: 22921 Prix sur demande * / Price on request * Naef Prestige is a member of the Knight Frank network

* CHF de 2 à 5 mio ** CHF de 5 à 15 mio *** CHF de 15 à 30 mio **** CHF plus de 30 mio

LUX-RESIDENCE.COM

85


h94-081-096.qxd

30.7.2015

16:03

Page 86

NEUCHÂTEL

PROXIMITÉ DU CENTRE-VILLE DE NEUCHÂTEL

Maison de Maître avec vue imprenable sur le Lac et les Alpes

Cette magnifique maison de Maître, construite sur 4 niveaux dont 3 habitables et un vaste sous-sol, se situe à proximité du centre-ville de Neuchâtel. Elle bénéficie d’une vue imprenable sur le lac et les Alpes. Les pièces ont des dimensions généreuses et sont extrêmement lumineuses grâce à la position dominante de la propriété. Cette propriété offre: salon avec belle cheminée en marbre, salle à manger, bureau, cuisine avec véranda donnant accès à la terrasse et à la piscine chauffée, vastes halls avec escalier monumental, 5 chambres à coucher dont 2 avec balcon/terrasse, 3 salles d'eau, 1 WC séparé, cave à vins, grande buanderie, 1 pièce annexe, cascade extérieure, jardin en terrasses richement arboré et fleuri, garage triple accessible depuis l’habitation et comportant une rampe.

This magnificent 3-storey mansion located near Neuchâtel includes a large basement. It boasts stunning views of the lake and the Alps. This property has superior quality facilities, amenities and materials. The rooms are spacious and extremely bright thanks to the commanding situation of the property. This property comprises: a living room with marble fireplace, dining room, study, kitchen with veranda giving access to the terrace and heated pool, vast halls with monumental staircase, 5 bedrooms including 2 with balcony/terrace, 3 shower rooms, separate WC, wine cellar, large utility room, additional room, exterior waterfall, terraced garden rich with trees and flowers and 3-car garage with access from the house and a ramp. Sale price and information on request

Prix de vente et renseignements sur demande

Thorens - Les métiers de l'Immobilier Route de Soleure 12 - CH-2072 St-Blaise Tél.: +41 (0)32 756 00 56 - Fax: +41 (0)32 756 00 59 info@thorenssa.ch - www.thorenssa.ch

86

HELVETISSIMMO


h94-081-096.qxd

30.7.2015

16:03

Page 87

NEUCHÂTEL

COUVET

L’une des plus belles maisons du Val-de-Travers

Cette belle maison du XVIIIe siècle située à Couvet, construite sur deux niveaux habitables plus combles aménageables, contient un vaste logement de 9 pièces ainsi qu'un plus petit appartement de 3 pièces avec mezzanine, actuellement loué. Cette demeure est implantée sur une parcelle de plus de 1'500 m2 et bénéficie d’un ensoleillement optimal. La construction du type quasi monumental a fait l'objet d'une rénovation fondamentale voire une restructuration principalement en 2000, quelques équipements ayant encore été changés en 2005.

Situated in Couvet, beautiful 18th C two storey house with attic suitable for conversion, spacious 9-room accommodation as well as a smaller 3 room apartment with mezzanine, currently rented. This residence is set in grounds of over 1’500 m2 and boasts a sunny climate. The almost monument type of construction was the subject of a fundamental renovation or restructuring mainly in 2000, some equipment was changed in 2005. Sale price and information on request

Prix de vente et renseignements sur demande

Thorens - Les métiers de l'Immobilier Route de Soleure 12 - CH-2072 St-Blaise Tél.: +41 (0)32 756 00 56 - Fax: +41 (0)32 756 00 59 info@thorenssa.ch - www.thorenssa.ch

LUX-RESIDENCE.COM

87


h94-081-096.qxd

30.7.2015

16:04

Page 88

NIDWALDEN

HERGISWIL

Peninsula, sensational living

Das Projekt PENINSULA wurde auf einem der schönsten Seegrundstücke in Hergiswil NW realisiert. Die eindrucksvolle Anlage wird durch eine klare, gradlinige Architektur geprägt. Die durchdachte Konzeption und Lichtführung garantieren ein maximales, exklusives Wohnerlebnis. Lassen Sie sich begeistern von einer atemberaubenden Sicht auf See und Berge. Springen Sie vom privaten Badeplatz in die sanften Wogen und erleben Sie die Elemente hautnah. 5,5-Zimmer-Wohnung im Obergeschoss, direkt am Seeufer gelegen, 220 m2 BGF, 18 m2 Loggia, 83 m2 Terrasse (321 m2 Gesamtfläche), 2 grosszügige Tiefgaragenplätze inklusive.

The PENINSULA project has been realised on one of the finest lakeshore locations in Hergiswil (NW). The impressive property features clear, straight-line architecture. Thought-through design and use of natural lighting ensure an optimum and exclusive living experience. Let the breath-taking view of lake and mountains entrance you! Dive from your private shore into the softly lapping waves and feel the elements on your skin! 5,5-room apartment on the upper floor, right by the lakeside, 220 m2 gross area, 18 m2 loggia, 83 m2 terrace (321 m2 total area), 2 generous basement garage spaces. Price: CHF 4’700’000.-

Preis: CHF 4’700’000.-

Andreas Grebhan - F & R Asset Management AG Dorfstrasse 27, Postfach 165 - CH-6375 Beckenried Tel.: +41 (0)41 620 07 73 - Fax: +41 (0)41 620 07 43 andreas.grebhan@realest.ch - www.realest.ch/peninsula

88

HELVETISSIMMO


h94-081-096.qxd

30.7.2015

16:04

Page 89

THURGAU

UTTWIL

Einzigartige Perle direkt am Bodenseeufer

Auf dem grosszügigen Grundstück präsentiert sich eine freistehende Villa in absolut einmaliger Lage. Das Hauptgebäude wird eingerahmt durch eine Grünfläche mit einer mediterranen Gartenanlage, Aussen-Whirlpool und romantischem Sitzplatz. Alle Zimmer verfügen über einen Balkon mit Seesicht. Uttwil im Thurgau ist eine äusserst attraktive Steuergemeinde. Uttwil liegt direkt am Bodensee zwischen Romanshorn und Konstanz. Highlight der Villa ist der grandiose, freie Blick auf den Bodensee. Wir freuen uns, Ihnen dieses wunderschöne Objekt vorzustellen und stehen Ihnen gerne für weitere Fragen zur Verfügung. Silvan Zürcher, +41 (0)78 824 00 09. Preis auf Anfrage

A detached villa standing in the spacious grounds of this unique location. The main building is surrounded by a green area consisting of a Mediterranean garden, outdoor whirlpool and a romantic seating area. All rooms feature a balcony with lake view. Uttwil im Thurgau is an exceptionally beautiful municipality. Uttwil is located directly on the shores of Lake Constance, between Romanshorn and Konstanz. One of the highlights of the villa is its magnificent, unobstructed view of Lake Constance. We are pleased to be able to present this beautiful property to the market. Please feel free to contact us if you have any questions or require further information. Silvan Zürcher, +41 (0)78 824 00 09. Price on request

RE/MAX Immobrokers - Wil Untere Bahnhofstrasse 10 - CH-9500 Wil SG Tel.: +41 (0)71 911 91 91 - Fax: +41 (0)71 911 91 21 silvan.zuercher@remax.ch - www.remax-wil.ch

LUX-RESIDENCE.COM

89


h94-081-096.qxd

30.7.2015

16:04

Page 90

TICINO

ASCONA

Central Park Ascona – Your place to be

Leben im Garten mit Stil und Sinnlichkeit im Herzen von Ascona. Ein individueller Mix für Singles, Paare oder Familien. Die Wohnflächen betragen ca. 68-180 m2 brutto, plus separat ausgewiesene Terrassen und private Gärten mit mediterranen Pflanzen. Von dieser einzigartigen Zentrumsoase, erreicht man die Piazza, den See und die Einkaufsmöglichkeiten in wenigen Geh-Minuten. Ob als 1. Wohnsitz oder Ferienwohnung, wir machen es möglich. Preis auf Anfrage

Live in a lovely and stylish garden in the heart of Ascona. An individual mix for singles, couples and families. The living areas are approx. 68-180 m2 plus terrace and private garden with Mediterranean plants.The apartments are very centrally located and you can easily reach the Piazza, the lake and the shopping areas in a just a few minutes. We can make your wishes come true be it as your primary or holiday residence. Price on request

ASCONA

V.I.P Very important place

Dieses Penthouse in einer 2 stöckigen Villa kann schon morgen Ihnen gehören (Ferienresidenz). Auf ca. 207 m2 BWFL ist eine moderne mit edlen Materialien ausgestattete Attika entstanden, die keine Wünsche offen lässt. Der Masterbedroom-Suite (ca. 27 m2) mit Ankleide ist eine anspruchsvolle Wellness-Oase angegliedert. Vom grosszügigen Wohn- Esszimmer mit Bulthaup Küche und „Attika“ Kamin erreicht man die zum Teil gedeckte Sommer- und Winterterrasse. Preis auf Anfrage

Bea Huwiler 90

HELVETISSIMMO

This penthouse apartment in a 2-floor villa can be yours Tomorrow (secondary residence). A modern attic apartment of approx. 207 m2 living area with élégant materials leaving no wishes open can be yours whenever you wish. The large master bedroom-suite with wardrobe of approx. 27 m2 is adjoining to a wonderful wellness oasis. From the spacious living-dining area with Bulthaup kitchen and „attic“ chimney you can reach the partly covered summer and winter terrace. Price on request

Bea Huwiler Promotion Via Lido 1 - CH-6612 Ascona Tel.: +41 (0)91 792 37 05 - Fax: +41 (0)91 792 37 04 info@beahuwiler.ch - www.beahuwiler.ch


h94-081-096.qxd

30.7.2015

16:04

Page 91

TICINO

RONCO SOPRA ASCONA

„Sunrise & Sunset” in Ronco

Es war einmal ein Rustico namens „Cascatella“ in Ronco, das schlief zwischen hohen Bäumen und einem Wasserfall... im Wald. Zum Glück küsste es ein Käufer und eine Innenarchitektin wach, um ein sehr persönliches DesignMärchen zu erzählen. Dieser „Gipfelstürmer“ ist ein einmaliges Holzhaus und liegt an der via Gottardo Madonna und wurde in der Zeitschrift „schöner Wohnen“ zum Haus des Jahres gekürt. Von der Terrasse geniesst man den einmaligen unverbaubaren Panoramablick auf den Lago Maggiore. Von Ascona bis weit nach Italien.

Once upon a time there was a Rustico called „Cascatella“ in Ronco, tucked away in a forest between tall trees and a waterfall. Luckily a buyer and an interior decorator discovered this fairy tale house and brought it back to splendour. It is a unique wood house and is located on the via Gottardo Madonna and received the title of „House of the year” in the magazine “Better Living”. From the terrace you can enjoy the absolutely unique panoramic views on Lake Maggiore right from Ascona up to Italy. Price on request

Preis auf Anfrage

MURALTO

Stadt nah mit Panorama-Aussicht

Diese 5,5 Zimmer Attikawohnung zeichnet sich durch ihre ideale Lage aus. In wenigen Gehminuten erreicht man die Seepromenade, die einladenden Restaurants und elegante Boutiquen. Auf der ca. 160 m2 Bruttowohnfläche entstand eine optimale Raumaufteilung. Man geniesst eine fantastische Panorama-Aussicht auf den Lago Maggiore, das Gambarogno und den Hafen von Locarno. Diese Attika ist eine perfekte Alternative zum Einfamilienhaus. Preis auf Anfrage

Bea Huwiler

This 5,5 room attic-apartment is located in a convenient position; you can reach the lakeside, the nice restaurants and the elegant boutiques in just a few minutes. The room division in the approx. 160 m2 living area has been well planned. Enjoy the fantastic panoramic views on lovely Lake Maggiore, the Gambarogno region and the harbour of Locarno. This beautiful attic apartment is the perfect alternative to a single family house. Price on request

Bea Huwiler Promotion Via Lido 1 - CH-6612 Ascona Tel.: +41 (0)91 792 37 05 - Fax: +41 (0)91 792 37 04 info@beahuwiler.ch - www.beahuwiler.ch

LUX-RESIDENCE.COM

91


h94-081-096.qxd

30.7.2015

16:04

Page 92

TICINO

ASCONA

Residenz in Ascona

Dieses 3,5 Zi.-App. liegt an unverbaubarer Lage und bietet einen wunderschönen Seeblick. Die Wohnung verfügt über einen Wohnbereich mit Gäste-WC sowie zwei Schlafräumen mit Badezimmer. Der Wohnbereich besteht aus einem grosszügigen Wohn- Esszimmer mit offener Küche. Die schöne Terrasse ist teilweise gedeckt und verfügt über eine Pergola. Der gepflegte Innenpool mit Liegewiese der Residenz sorgt für Ihre Fitness und Erholung. Wohnfläche: ca. 100 m2. Terrasse: ca. 33 m2. Ref. N° W-021F2Z. Preis: CHF 990’000.-

This 3,5-room apartment is in a location which cannot be built round and offers a superb lake view. The accommodation has a living area with a guest WC and two bedrooms with a bathroom. The living area comprises a generous living-dining room with an open-plan kitchen. The fine terrace is partly covered and features a pergola. The well-cared for indoor pool with sunbathing lawn, belonging to the Residence apartments, helps you stay fit and relaxed. Area: approx. 100 m2. Terrace: approx. 33 m2. Ref. N° W-021F2Z. Price: CHF 990’000.-

LOCARNO-MONTI

Exklusive luxuriöse Wohnung

Diese exklusive, luxuriöse Wohnung befindet sich in Locarno-Monti, an privilegierter und sonniger Lage mit einer atemberaubenden Aussicht. Das absolute Highlight ist die ca. 110 m2 grosse, teils gedeckte Terrasse. Ob zum Entspannen, Grillieren, Sonnen oder Baden – durch die Anschlüsse für ein Jacuzzi und die vielen Sonnenstunden im Tessin, lädt die fantastische Terrasse das ganze Jahr zum Verweilen und Geniessen ein. Zur Wohnung gehört ein kleiner Garten. Wohnfläche: ca. 175 m2. Terrasse: ca. 110 m2. Anzahl Räume: 2. Ref. N° W-022UGD. Preis: CHF 1'680'000.-

This exclusive, luxury apartment is situated in Locarno-Monti, in a well-favoured and sunny spot with a breath-taking view. The absolute highlight is the approx. 110 m2 partly covered terrace. Whether it's for relaxation, barbecues, sunbathing or sitting in the jacuzzi - the connections are in place – it’s a wonderful place to spend your time enjoying Ticino's many hours of sunshine. The apartment also has its own small garden. Living area: approx. 175 m2. Terrace: approx. 110 m2. Number of rooms: 2. Ref. N° W-022UGD. Price: CHF 1'680'000.-

Engel & Völkers - Büro Ascona - EV Ascona Top Real Estates AG Piazza G. Motta 57 - CH-6612 Ascona Tel.: +41 (0)91 785 14 80 - Fax: +41 (0)91 785 14 85 ascona@engelvoelkers.com - www.engelvoelkers.ch/ascona

92

HELVETISSIMMO


h94-081-096.qxd

30.7.2015

16:04

Page 93

TICINO

BRISSAGO

Villa direkt am See mit privatem Bootsplatz

Eine Rarität am Lago Maggiore, absolut ruhig und exklusiv gelegen, nur wenige Schritte vom Zentrum Brissago und etwa 10 Autominuten von Ascona und Locarno entfernt. Das Grundstück von 690 m2 liegt direkt am See und umfasst eine 4,5 Zimmervilla (ca. 150 m2, erweiterbar) die von einem parkähnlichem, hochwassersicherem Grundstück umrandet wird. Der private Bootsplatz vervollständigt diese einzigartige Immobilie. Preis auf Anfrage

A rarity on Lake Maggiore, completely quiet and in an exclusive setting, just a short walk from the centre of Brissago and about ten minutes by car from Ascona and Locarno. The 690 m2 plot is right by the lake and encompasses a 4,5 room villa (approx. 150 m2, extendable) set amid park-like grounds that are safe from flooding. The private mooring is just one more advantage enjoyed by this unique property. Price on request

Immobiliare Fideconto SA Piazza Muraccio - Via Ciseri 23 - CH-6600 Locarno Tel.: +41 (0)91 756 02 70 - Fax: +41 (0)91 756 02 71 immo.locarno@fideconto.com - www.fideconto.com

LUX-RESIDENCE.COM

93


h94-081-096.qxd

30.7.2015

16:04

Page 94

TICINO

2,5 KM FROM LUGANO CITY CENTER

Design villa with lake view

Die Design-Villa (Wohnfläche ca. 300 m2 – Gelände ca. 640 m2 Terrasse/Veranda ca. 80 m2) liegt in einer traumhaften Lage und erstreckt sich über 3 Stockwerke, die sich in 7,5 geräumige, helle Räume aufteilen. Jeder Winkel im Innen- und Außenbereich der Villa profitiert von einem atemberauenden Seeblick von 180 Grad vom Golf von Lugano bis nach Porlezza. Das Anwesen verfügt über gut gepflegten Ausbau, sein stillvolles Cheminée verbreitet Wärme im Wohnzimmer, das einen direkten Zugang zu Terrasse, Veranda und Garten hat. Das ideale Anwesen, um sich von einem bewegten Bild mit einem bezaubernden Panorama umarmt zu fühlen, welches den Blick Tag und Nacht fesselt.

The design villa (living space of approx. 300 m2 – land area of approx. 640 m2 - terrace/patio approx. 80 m2) located in a fabulous position, is laid out on 3 levels, divided into 7,5 spacious, bright rooms, every indoor and outdoor angle of the villa benefits of a breathtaking lake view of 180 degree from the Lugano Gulf to Porlezza. The property enjoys well-groomed finishes, its charming fireplace provides warmth to the living room, that has direct access to the terrace, patio and garden. Ideal property to feel embraced by an image on the move with an enchanting panorama that catches the eye day and night. Price on request

Preis auf Anfrage

Interfida SA Via Cantonale 19 - CH-6901 Lugano Tel.: +41 (0)91 923 90 47 - Fax: +41 (0)91 923 90 46 interfida.lugano@interfida.ch - www.interfida.ch

94

HELVETISSIMMO


h94-081-096.qxd

30.7.2015

16:05

Page 95

TICINO

PORTO-RONCO

„Living in a dream” - Residenza Mimosa

In der Sonnenstube der Schweiz, eingebettet in der idyllischen Berg- und Seelandschaft, liegt in direkter Seenähe dis Residenza Mimosa mit vier Luxus Wohnungen. Nur wenige Kilometer vom Zentrum Ascona befinden sich die Wohnflächen von 134 bis 175 m2 brutto mit mediterran bepflanzten Terrassen und Privatgärten. Das Besondere an der Residenza Mimose ist der exklusive Privatstrand mit Lounge. Für Bootsliebhaber besteht ausserdem die Möglichkeit direkt vor der Haustüre eine Boje zu mieten. Die luxeriöse Ausstattung der Wohnbereiche, Gartenanlagen, Tiefgarage und des Privatstrands wird höchsten Ansprüchen gerecht. Preis auf Anfrage.

In the suntrap of Switzerland, set in an idyllic lake and mountain landscape, the five luxury apartments of Residenza Mimosa are right on the lakeside. The apartments, with gross habitable areas of between 134 and 175 m2 and terraces and private gardens graced by Mediterranean plants, are just a few kilometres from the centre of Ascona. A special feature of Residenza Mimose is its exclusive private beach and lounge. Boat-lovers, moreover, can hire a mooring right on their doorstep. The luxurious finish of the accommodation, the gardens, the underground garage and the private beach will meet the highest expectations. Price on request.

Poroli Real Estate - Kontakt: Katharina Poroli Viale B. Papio 3 - CH-6612 Ascona Tel.: +41(0)91 785 80 30 - GSM: +41 (0)79 620 34 38 katharina@poroli.ch - www.poroli.ch/residenza_mimosa

LUX-RESIDENCE.COM

95


h94-081-096.qxd

30.7.2015

16:05

Page 96

VALAIS

BOUVERET

Votre villa «pieds dans l’eau» avec ponton privé

A dix min de Montreux, villa d'architecte de 6,5 pièces, neuve, moderne, les pieds dans le Léman. Un ponton privé est à disposition. A 150 mètres de la gare du Bouveret. Ascenseur privé, solarium et jacuzzi sur le toit. Finitions haut de gamme. Disponible de suite. Prix sur demande.

Just ten minutes from Montreux, new, modern, architect designed lake Geneva waterfront villa with 6,5 rooms. A private dock is available. Just 150 m from Gare du Bouveret station. Private lift, rooftop solarium and jacuzzi. High-end finishing's. Available immediately. Price on request.

Fimmob Riviera Chablais Sàrl - Agence Immobilière Avenue de Chillon 90 - CH-1820 Territet Tél.: +41 (0)21 963 08 74 - GSM: +41 (0)79 953 69 09 - Fax: +41 (0)21 963 08 73 vente@fimmobriviera.ch - www.fimmobriviera.ch

96

HELVETISSIMMO


h94-097-112.qxd

30.7.2015

16:10

Page 97

VAUD

BURSINS

Belle maison d’époque de 500 m2 avec vue sur le lac et les vignes

Rare à la vente. Cette belle maison d’époque de 500 m2 sur une parcelle de 1’468 m2 se situe à Bursins, dans un environnement calme avec de belles vues sur les vignes et le lac. Elle se trouve à proximité du centre du village et bénéficie d’un vaste jardin, de vignes, d’une grande terrasse et d’une piscine. Cette ancienne bâtisse a récemment été rénovée tout en gardant son charme d’origine et se compose comme suit: grand séjour de 62 m2 avec cheminée, salle à manger, cuisine, 5 chambres dont une suite parentale avec 2 salles de bains attenantes et dressing, et 3 autres salles d’eau. Un Spa et un magnifique carnotzet avec cave à vin complètent ce bien. Prix sur demande

Rare sale. This beautiful ancient house of 500 sq.m on a land of 1’468 sq.m is located in Bursins, in a quiet environment with nice views over the vines and the lake. It is situated close to the centre of the village and benefits from a vast garden, vines, a large terrace and a pool. This old building has been recently renovated, while keeping its original charm and is composed as follows: large living room of 62 sq.m with fireplace, dining room, kitchen, 5 bedrooms including a master bedroom with 2 en suite bathrooms and dressing room, and 3 other bathrooms. A Spa and a beautiful carnotzet with wine cellar complete this property. Price on request

Ax Properties SA Avenue Krieg, 7 - CH-1208 Genève Tél.: +41 (0)22 300 62 62 info@ax-properties.com - www.ax-properties.com

LUX-RESIDENCE.COM

97


h94-097-112.qxd

30.7.2015

16:10

Page 98

VAUD

A 15 MINUTES DU CENTRE DE VEVEY

Splendide propriété avec un charme irrésistible !

Véritable have de paix et de verdure – deux corps de bâtiments et un pavillon de chasse – matériaux nobles – parcelle de 3'500 m2 magnifiquement arborée – situation d’exception – ensoleillement optimal. Prix: CHF 3'290'000.-

Splendid property with an irresistible charm! An authentic haven of peace and greenery - two buildings and a hunting lodge - fine materials - beautifully planted grounds of 3'500 m2 - Exceptional setting - maximum sunshine. Price: CHF 3'290'000.-

BAOUR IMMOBILIER Chemin de Villette 12 - CH-1096 Villette / Lavaux Tél.: +41 (0)21 799 30 30 info@baour-immo.ch - www.baour-immo.ch

98

HELVETISSIMMO


h94-097-112.qxd

30.7.2015

16:10

Page 99

Paudex Propriété contemporaine /ĚĠĂůĞŵĞŶƚ ƐŝƚƵĠĞ ĞŶƚƌĞ ůĞƐ ƉƌĞƐƟŐŝĞƵƐĞƐ ǀŝŐŶĞƐ ĚĞ >ĂǀĂƵdž Ğƚ ůĞ ĐŚĂƌŵĂŶƚ ďŽƵƌŐ ĚĞ >ƵƚƌLJ͕ ĐĞƩĞ ŵĂŐŶŝĮƋƵĞ ƉƌŽƉƌŝĠƚĠ ĐŽŶƚĞŵͲ ƉŽƌĂŝŶĞĞŶĐŚĂŶƚĞƌĂůĞǀŝƐŝƚĞƵƌăůĂƌĞĐŚĞƌĐŚĞĚ͛ƵŶďŝĞŶĞdžĐĞƉƟŽŶͲ ŶĞů͘ŝƐƚƌŝďƵĠĞĞŶƚƌŽŝƐĐŽƌƉƐĚĞďąƟŵĞŶƚ͕ĚŽŶƚĐĞƌƚĂŝŶƐƐƵƌĚĞƵdž ĠƚĂŐĞƐ͕ůĂǀŝůůĂŽīƌĞĚ͛ŝŶŶŽŵďƌĂďůĞƐƉŽƐƐŝďŝůŝƚĠƐƉƵƌƵŶĞƋƵĂůŝƚĠĚĞ ǀŝĞƐĂŶƐĠŐĂů͘ /ĚĞĂůůLJ ůŽĐĂƚĞĚ ďĞƚǁĞĞŶ ƚŚĞ ƉƌĞƐƟŐŝŽƵƐ ǀŝŶĞLJĂƌĚƐ ŽĨ >ĂǀĂƵdž ĂŶĚ ƚŚĞĐŚĂƌŵŝŶŐǀŝůůĂŐĞŽĨ>ƵƚƌLJ͕ƚŚŝƐŵĂŐŶŝĮĐĞŶƚŚŽŵĞŝŶƌĞƐŽůƵƚĞůLJ ĐŽŶƚĞŵƉŽƌĂƌLJĂƌĐŚŝƚĞĐƚƵƌĞǁŝůůĚĞůŝŐŚƚƚŚŽƐĞŝŶƐĞĂƌĐŚŽĨĂŶĞdžĐĞƉͲ ƟŽŶĂů ƉƌŽƉĞƌƚLJ͘ ŝƐƚƌŝďƵƚĞĚ ŝŶ ƚŚƌĞĞďƵŝůĚŝŶŐƐ͕ ŝŶĐůƵĚŝŶŐ ƐŽŵĞ ŽŶ ƚǁŽŇŽŽƌƐ͕ƚŚŝƐƐƉĂĐŝŽƵƐǀŝůůĂŽīĞƌƐĞŶĚůĞƐƐƉŽƐƐŝďŝůŝƚĞƐĨŽƌĂƋƵĂůŝƚLJ ŽĨůŝŬĞƐĞĐŽŶĚƚŽŶŽŶĞ͘ ZĠĨ͘ϰϴϬϵϲϴ

Grand-Rue 14 | 1095 Lutry | 021 796 35 35

Lutry Appartement de standing Ğ ƐƉůĞŶĚŝĚĞ ĂƉƉĂƌƚĞŵĞŶƚ ĚĞ ϰ͘ϱ ƉŝğĐĞƐ ŽĐĐƵƉĞ ůĞ ƌĞnjͲĚĞͲ ĐŚĂƵƐƐĠĞĚ͛ƵŶĞWWůƵdžƵĞƵƐĞĐŽŵƉŽƐĠĞĚĞϰďŝĞŶƐ͘ŝƐƚƌŝďƵĠƐĚĞ ŵĂŶŝğƌĞŚĂƌŵŽŶŝĞƵƐĞ ĞƚůŽŐŝƋƵĞ͕ ůĞƐǀŽůƵŵĞƐ ĚĞĐĞďŝĞŶ ŽīƌĞŶƚ ĚĞ ƚƌğƐ ďĞůůĞƐ ƉŽƐƐŝďŝůŝƚĠƐ ƋƵĂŶƚ ă ůĂ ĐƌĠĂƟŽŶ Ě͛ƵŶĞ ĂƚŵŽƐƉŚğƌĞ ĨĂŵŝůŝĂůĞ Ğƚ ĐŚĂůĞƵƌĞƵƐĞ͘ sƵĞ ƐƉĞĐƚĂĐƵůĂŝƌĞ ƐƵƌ ůĞ >ĠŵĂŶ Ğƚ ůĞƐ ůƉĞƐ͕ĐĂůŵĞ͕ǀĞƌĚƵƌĞ͕ƐŽŶƚůĞƐŵĂŠƚƌĞƐŵŽƚƐĚĞĐĞďŝĞŶĚŝƐƉŽŶŝďůĞ ĚğƐŶŽǀĞŵďƌĞϮϬϭϱ͘ dŚŝƐ ŵĂŐŶŝĮĐŝĞŶƚ ϰ͘ϱ ƌŽŽŵ ĂƉĂƌƚŵĞŶƚ ƚĂŬĞƐ ƵƉ ƚŚĞ ŐƌŽƵŶĚ ŇŽŽƌ ŽĨ Ă ĐŽͲŽǁŶĞĚ ƉƌŽƉĞƌƚLJ ĐŽŵƉŽƐĞĚ ŽĨ ϰ ƌĞƐŝĚĞŶĐĞƐ͘ >ĂŝĚ ŽƵƚ ŝŶ Ă ŚĂƌŵŽŶŝŽƵƐ ĂŶĚ ůŽŐŝĐĂů ŵĂŶŶĞƌ͕ ƚŚŝƐ ƐƉĂĐŝŽƵƐ ƉƌŽƉĞƌƚLJ ŽīĞƌƐ ǁŽŶĚĞƌĨƵůƉŽƐƐŝďŝůŝƟĞƐĨŽƌĐƌĞĂƟŶŐĂĐŽƐLJĨĂŵŝůLJĂƚŵŽƐƉŚĞƌĞ͘^ƉĞĐͲ ƚĂĐƵůĂƌƉƌŽƉĞƌƚLJ͕ǁŚŝĐŚŝƐĂǀĂŝůĂďůĞĨƌŽŵEŽǀĞŵďĞƌϮϬϭϱ͘

CHF 2’920’000.-

ZĠĨ͘ϴϭϲϵϮϳ

Grand-Rue 14 | 1095 Lutry | 021 796 35 35 'ĂŵŵĞĚĞƉƌŝdž;ĞŶ,&Ϳര͗ ϯăϲŵŝŽƐ

ϲăϭϬŵŝŽƐ

ϭϬăϭϱŵŝŽƐ

нϭϱŵŝŽƐ

GROUPE GEROFINANCE-DUNAND | RÉGIE DE LA COURONNE 'ĞŶğǀĞͮDŝĞƐͮZŽůůĞͮDŽƌŐĞƐͮzǀĞƌĚŽŶͮƵƐƐŝŐŶLJͮ>ĂƵƐĂŶŶĞͮ>ƵƚƌLJͮsĞǀĞLJͮDŽŶƚƌĞƵdžͮ^ŝŽŶͮƌĂŶƐͲDŽŶƚĂŶĂ

www.barnes-suisse.com

LUX-RESIDENCE.COM

99


h94-097-112.qxd

30.7.2015

16:10

Page 100

Terre-Sainte Magnifique villa de standing ĞƩĞŵĂŐŶŝĮƋƵĞǀŝůůĂĚĞƐƚĂŶĚŝŶŐĂǀĞĐǀƵĞƐƵƌůĞƐůƉĞƐĞƐƚĐŽŶƐƚƌƵŝƚĞ ĚĂŶƐƵŶƉĂƌĐĂƌďŽƌĠĚĞƉůƵƐĚĞϲ͛ϬϬϬŵ2͕ůƵŝƉƌĠƐĞƌǀĂŶƚƵŶĞŐƌĂŶĚĞ ŝŶƟŵŝƚĠ͘ŽŶƐƚƌƵŝƚĞĂǀĞĐĚĞƐŵĂƚĠƌŝĂƵdžĚĞŚĂƵƚƐƚĂŶĚŝŶŐ͕ĞůůĞĚŝƐƉŽƐĞ ĚĞ ϰϯϬ ŵ2 ŚĂďŝƚĂďůĞƐ͕ ƉůƵƐ ƵŶ ƐŽƵƐͲƐŽů ĚĞ ϮϬϬ ŵ2 ĂŵĠŶĂŐĠ͘ ůůĞ ƐĞ ĐŽŵƉŽƐĞĚĞǀĂƐƚĞƐƉŝğĐĞƐ͕ĚŽŶƚƵŶƐĂůŽŶĂƵƉůĂĨŽŶĚĐĂƚŚĠĚƌĂůĞ͕ƵŶĞ ƉƌĞƐƟŐŝĞƵƐĞ ĐƵŝƐŝŶĞ ŽƵǀĞƌƚĞ͕ ϰ ĐŚĂŵďƌĞƐ ă ĐŽƵĐŚĞƌ Ğƚ Ϯ ƐƵŝƚĞƐ͘ hŶĞ ƉŝƐĐŝŶĞĞƚƵŶũĂĐƵnjnjŝĂŐƌĠŵĞŶƚĞŶƚůĞƉĂƌĐ͘ dŚŝƐďĞĂƵƟĨƵůƉƌĞƐƟŐŝŽƵƐǀŝůůĂǁŝƚŚǀŝĞǁƐŽĨƚŚĞůƉƐŝƐƐĞƚŝŶĂŵĂƚƵƌĞ ƉĂƌŬŽĨŽǀĞƌϲ͛ϬϬϬŵ2͕ƉƌĞƐĞǀŝŶŐŝƚƐŐƌĞĂƚƉƌŝǀĂĐLJ͘ƵŝůƚǁŝƚŚŚŝŐŚƋƵĂůŝͲ ƚLJŵĂƚĞƌŝĂůƐ͕ŝƚŚĂƐϰϯϬŵ2ŽĨůŝǀŝŶŐƐƉĂĐĞĂƐǁĞůůĂƐĂϮϬϬŵ2ďĂƐĞŵĞŶƚ͘ /ƚĐŽŶƐŝƐƚƐŽĨƐƉĂĐŝŽƵƐƌŽŽŵƐ͕ŝŶĐůƵĚŝŶŐĂůŝǀŝŶŐƌŽŽŵǁŝƚŚŝƚƐĐĂƚŚĞĚƌĂů ĐĞŝůŝŶŐ͕ĂƉƌĞƐƟŐŝŽƵƐŽƉĞŶͲƉůĂŶŬŝƚĐŚĞŶ͕ϰďĞĚƌŽŽŵƐĂŶĚϮĞŶͲƐƵŝƚĞƐ͘ ƉŽŽůĂŶĚũĂĐƵnjnjŝĞŵďĞůůŝƐŚƚŚĞƉĂƌŬ͘ ZĠĨ͘ϰϮϭϲϵϮ

Mies Belle parcelle plane ƵĐŽĞƵƌĚ͛ƵŶƋƵĂƌƟĞƌƌĠƐŝĚĞŶƟĞůƚƌğƐĐĂůŵĞĚĞůĂĐŽŵŵƵŶĞĚĞDŝĞƐ͕ ĐĞƩĞƉĂƌĐĞůůĞĚĞƉůƵƐĚĞϮ͛ϰϴϬŵ2ŽīƌĞƵŶĐĂĚƌĞĚĞǀŝĞƚƌğƐƌĞĐŚĞƌĐŚĠ ĞƚƌĂƌĞ͘^ĂƐŝƚƵĂƟŽŶ͕ƐĂƉƌŽdžŝŵŝƚĠĚĞ'ĞŶğǀĞ͕ĚĞƐĠĐŽůĞƐƉƌŝǀĠĞƐƌĠƉƵͲ ƚĠĞƐ͕ĂŝŶƐŝƋƵĞĚĞů͛ĂĠƌŽƉŽƌƚĞŶĨŽŶƚƵŶůŝĞƵƚƌğƐĂƉƉƌĠĐŝĠ͘hŶh^ĚĞ Ϭ͘ϮϱƉĞƌŵĞƩƌĂŝƚĚĞĐŽŶƐƚƌƵŝƌĞƵŶĞŚĂďŝƚĂƟŽŶŝŶĚŝǀŝĚƵĞůůĞĚĞϲϮϭŵ2 ŚĂďŝƚĂďůĞƐƌĠƉĂƌƟƐƐƵƌϮŶŝǀĞĂƵdžƉůƵƐĐŽŵďůĞƐŽƵĚĞϮǀŝůůĂƐũƵŵĞůůĞƐ͘ /ŶƚŚĞŚĞĂƌƚŽĨĂƋƵŝĞƚƌĞƐŝĚĞŶƟĂůĂƌĞĂŽĨƚŚĞǀŝůůĂŐĞŽĨDŝĞƐ͕ƚŚŝƐƉůŽƚ ŽĨŽǀĞƌϭ͕ϲϬϬƐƋ͘ŵŽīĞƌƐĂŚŝŐŚůLJƐŽƵŐŚƚĂŌĞƌĂŶĚƌĂƌĞůŝǀŝŶŐĞŶǀŝƌŽŶͲ ŵĞŶƚ͘/ƚƐƐĞƫ ŶŐ͕ƉƌŽdžŝŵŝƚLJƚŽ'ĞŶĞǀĂĂŶĚŝƚƐĞƐƚĞĞŵĞĚƉƌŝǀĂƚĞƐĐŚŽŽůƐ ĂƐ ǁĞůů ĂƐ ƚŚĞ ĂŝƌƉŽƌƚ ŵĂŬĞ ŝƚ Ă ǀĞƌLJ ƉŽƉƵůĂƌ ůŽĐĂƟŽŶ͘ dŚĞ ůĂŶĚ ƵƐĞ ĐŽĞĸ ĐŝĞŶƚŽĨϬ͘ϮϱĂůůŽǁƐĐŽŶƐƚƌƵĐƟŽŶŽĨĂƐŝŶŐůĞĨĂŵŝůLJĚǁĞůůŝŶŐǁŝƚŚ Đ͕ŽƌŽĨƚǁŽƐĞŵŝͲĚĞƚĂĐŚĞĚ ĂϲϮϭŵ2ůŝǀŝŶŐĂƌĞĂĂĐƌŽƐƐϮůĞǀĞůƐĂŶƚĂƫ ǀŝůůĂƐ͘

CHF 2’980’000.-

ZĠĨ͘ϳϯϲϱϲϴ

Chemin du Triangle 5 | 1295 Mies | 022 950 97 95 'ĂŵŵĞĚĞƉƌŝdž;ĞŶ,&Ϳര͗ ϯăϲŵŝŽƐ

ϲăϭϬŵŝŽƐ

ϭϬăϭϱŵŝŽƐ

нϭϱŵŝŽƐ

GROUPE GEROFINANCE-DUNAND | RÉGIE DE LA COURONNE 'ĞŶğǀĞͮDŝĞƐͮZŽůůĞͮDŽƌŐĞƐͮzǀĞƌĚŽŶͮƵƐƐŝŐŶLJͮ>ĂƵƐĂŶŶĞͮ>ƵƚƌLJͮsĞǀĞLJͮDŽŶƚƌĞƵdžͮ^ŝŽŶͮƌĂŶƐͲDŽŶƚĂŶĂ

www.barnes-suisse.com

100

HELVETISSIMMO


h94-097-112.qxd

30.7.2015

16:10

Page 101

Montreux Sublime appartement de 600 m2 Ğ ƐƚLJůĞ ůŽŌ͕ ŝů ĞƐƚ ĐŽŵƉŽƐĠ ĚĞ ϳ͘ϱ ƉŝğĐĞƐ ƐƵƌ ĚĞƵdž ŶŝǀĞĂƵdž͘ /ů ĚŝƐͲ ƉŽƐĞ Ě͛ƵŶĞ ƐƵƌĨĂĐĞ Ě͛ĞŶǀ͘ ϱϵϬ ŵϸ Ğƚ Ě͛ƵŶĞ ďĞůůĞ ƚĞƌƌĂƐƐĞ ĚĞ ϱϮ ŵϸ ĚŽŵŝŶĂŶƚůĂĐĞƚŵŽŶƚĂŐŶĞƐ͘^ŝƚƵĠĂƵdžϰeĞƚϱeĠƚĂŐĞƐĚ͛ƵŶĞƐƉůĞŶĚŝĚĞ ƌĠƐŝĚĞŶĐĞƋƵŝƐĞƚƌŽƵǀĞĞŶĂŵŽŶƚĚƵĞŶƚƌĞĚĞƐŽŶŐƌğƐĚĞDŽŶƚƌĞƵdž͘ Ğ ĐŽŶƐƚƌƵĐƟŽŶ ƌĠĐĞŶƚĞ Ğƚ ƌĠƐŽůƵŵĞŶƚ ĐŽŶƚĞŵƉŽƌĂŝŶĞ͕ ůĞƐ ƉŝğĐĞƐ ă ǀŝǀƌĞƐŽŶƚăůĂĨŽŝƐŵĂũĞƐƚƵĞƵƐĞƐĞƚĠƉƵƌĠĞƐ͘ĞƐŚĂƵƚĞƵƌƐĚĞƉůĂĨŽŶĚ ĂůůĂŶƚũƵƐƋƵ͛ăϰ͘ϱŵğƚƌĞƐ͕ĚŽŶŶĞŶƚƵŶǀŽůƵŵĞŝŶĠŐĂůĂďůĞ͘

CHF 6’700’000.-

ZĠĨ͘ϱϱϬϰϳϱ

dŚŝƐůŽŌͲƐƚLJůĞĂƉĂƌƚŵĞŶƚŚĂƐϳ͘ϱƌŽŽŵƐĂĐƌŽƐƐƚǁŽůĞǀĞůƐ͕ǁŝƚŚĂďŽƵƚ ϱϵϬƐƋ͘ŵŽĨůŝǀŝŶŐƐƉĂĐĞĂŶĚĂϱϮƐƋ͘ŵƚĞƌƌĂĐĞŽǀĞƌůŽŽŬŝŶŐ>ĂŬĞ'ĞŶĞǀĂ ĂŶĚƚŚĞŵŽƵŶƚĂŝŶƐ͘KŶƚŚĞϰƚŚĂŶĚϱƚŚŇŽŽƌƐŽĨĂďĞĂƵƟĨƵůƌĞƐŝĚĞŶĐĞ ĂďŽǀĞ ƚŚĞ DŽŶƚƌĞƵdž ŽŶǀĞŶƟŽŶ ĞŶƚƌĞ͕ ƚŚŝƐ ŝƐ Ă ŚŝŐŚůLJ ƐŽƵŐŚƚͲĂŌĞƌ ůŽĐĂƟŽŶ͘ZĞĐĞŶƚůLJďƵŝůƚŝŶďŽůĚĐŽŶƚĞŵƉŽƌĂƌLJƐƚLJůĞ͕ƚŚĞůŝǀŝŶŐĂƌĞĂƐĂƌĞ ďŽƚŚŵĂũĞƐƟĐĂŶĚĐůĞĂŶͲůŝŶĞĚ͕ǁŝƚŚĐĞŝůŝŶŐŚĞŝŐŚƚƐŽĨƵƉƚŽϰ͘ϱŵĞƚƌĞƐ ƉƌŽǀŝĚŝŶŐ ŽƵƚƐƚĂŶĚŝŶŐ ǀŽůƵŵĞƐ͘ ,ŝŐŚͲĞŶĚ͕ ŶŽďůĞ ĂŶĚ ƐƚLJůŝƐŚ ĮŶŝƐŚŝŶŐ ŵĂƚĞƌŝĂůƐ͘

Grand-Rue 54 | 1820 Montreux | 021 962 80 80

Suchy Splendide rural rénové ĞƐƉůĞŶĚŝĚĞƌƵƌĂůĚĞϭϬ͘ϱƉŝğĐĞƐĞƐƚƌĠƉĂƌƟƐƵƌϰĠƚĂŐĞƐĞŶĚĞŵŝͲŶŝͲ ǀĞĂƵdžĞƚďĠŶĠĮĐŝĞĚ͛ƵŶĞƐƵƌĨĂĐĞŚĂďŝƚĂďůĞĚ͛ĞŶǀŝƌŽŶϲϬϬŵϸ͘/ŵƉůĂŶƚĠ ƐƵƌƵŶĞƉĂƌĐĞůůĞĚĞϱϰϮŵϸ͕ŝůĂĠƚĠĞŶƟğƌĞŵĞŶƚƌĠŶŽǀĠĞŶϮϬϬϵĂǀĞĐ ĚĞƐŵĂƚĠƌŝĂƵdžĚĞŚĂƵƚƐƚĂŶĚŝŶŐ͘sŽůƵŵĞ͕ĐŽŶĨŽƌƚĞƚůƵŵŝŶŽƐŝƚĠƌĠƐƵͲ ŵĞŶƚůĞĐĂƌĂĐƚğƌĞƵŶŝƋƵĞĚĞĐĞďŝĞŶƚŽƵƚăĨĂŝƚŚŽƌƐĚƵĐŽŵŵƵŶ͘ĞƩĞ ŵĂŝƐŽŶƐĞƐŝƚƵĞĚĂŶƐůĞĐŚĂƌŵĂŶƚǀŝůůĂŐĞĚĞ^ƵĐŚLJ͕ƋƵŝĞƐƚăϱŵŝŶƵƚĞƐ ĚĞƐĂdžĞƐĂƵƚŽƌŽƵƟĞƌƐĚ͛zǀĞƌĚŽŶĞƚĚĞŚĂǀŽƌŶĂLJĐĞƋƵŝƉĞƌŵĞƚĚĞƌĂůͲ ůŝĞƌ>ĂƵƐĂŶŶĞĞŶů͛ĞƐƉĂĐĞĚĞϮϬŵŝŶƵƚĞƐŽƵEĞƵĐŚąƚĞůĞŶϯϬŵŝŶƵƚĞƐ͘ dŚŝƐ ƐƉůĞŶĚŝĚ ϭϬ͘ϱ ƌŽŽŵ ϰͲƐƚŽƌĞLJ ƌƵƌĂů ƉƌŽƉĞƌƚLJ ŝŶ ŚĂůĨ ůĞǀĞůƐ ďŽĂƐƚƐ Ă ůŝǀŝŶŐ ƐƉĂĐĞ ŽĨ ĂƉƉƌŽdž͘ ϲϬϬ ŵϸ͘ ^ŝƚƵĂƚĞĚ ŝŶ ϱϰϮ ŵϸ ŐƌŽƵŶĚƐ ŝƚ ǁĂƐ ĨƵůůLJƌĞŶŽǀĂƚĞĚŝŶϮϬϬϵǁŝƚŚƉƌĞƐƟŐŝŽƵƐŵĂƚĞƌŝĂůƐ͘^ƉĂĐĞ͕ĐůĂƌŝƚLJĂŶĚ ĐŽŵĨŽƌƚƐƵŵƵƉƚŚĞƵŶŝƋƵĞĐŚĂƌĂĐƚĞƌŽĨƚŚŝƐƋƵŝƚĞƵŶƵƐƵĂůƉƌŽƉĞƌƚLJ͘ dŚŝƐŚŽƵƐĞŝƐůŽĐĂƚĞĚŝŶƚŚĞĐŚĂƌŵŝŶŐǀŝůůĂŐĞŽĨ^ƵĐŚLJ͕ŽŶůLJϱŵŝŶĨƌŽŵ ZĠĨ͘ϳϴϭϰϲϬ ƚŚĞ ŚĂǀŽƌŶĂLJ zǀĞƌĚŽŶ ŵŽƚŽƌǁĂLJ ĂdžŝƐ ŵĂŬŝŶŐ ŝƚ ƉŽƐƐŝďůĞ ƚŽ ƌĞĂĐŚ >ĂƵƐĂŶŶĞŝŶϮϬŵŝŶƵƚĞƐŽƌEĞƵĐŚąƚĞůŝŶϯϬŵŝŶƵƚĞƐ͘

CHF 3’400’000.-

Rue de la Plaine 37 | 1400 Yverdon-les-Bains | 024 425 44 44 'ĂŵŵĞĚĞƉƌŝdž;ĞŶ,&Ϳര͗ ϯăϲŵŝŽƐ

ϲăϭϬŵŝŽƐ

ϭϬăϭϱŵŝŽƐ

нϭϱŵŝŽƐ

GROUPE GEROFINANCE-DUNAND | RÉGIE DE LA COURONNE 'ĞŶğǀĞͮDŝĞƐͮZŽůůĞͮDŽƌŐĞƐͮzǀĞƌĚŽŶͮƵƐƐŝŐŶLJͮ>ĂƵƐĂŶŶĞͮ>ƵƚƌLJͮsĞǀĞLJͮDŽŶƚƌĞƵdžͮ^ŝŽŶͮƌĂŶƐͲDŽŶƚĂŶĂ

www.barnes-suisse.com

LUX-RESIDENCE.COM

101


h94-097-112.qxd

30.7.2015

16:10

Page 102

VAUD

PRÉVERENGES

Individuelle unique et familiale au calme absolu

Avec une situation idéale, à 100 m du lac et de la plus belle plage du canton de Vaud, très belle maison exceptionnelle et familiale. Elle est distribuée sur une surface de 360 m2 + sous-sol avec des espaces lumineux, des volumes généreux (séjour: hauteur sous plafond 9 m!), et une disposition des pièces judicieuse permettant à chacun d’y trouver son espace. Belle parcelle plate clôturée et arborée avec piscine. Rafraichissements à prévoir. Réf. N° V15-312-27. Prix sur demande

Ideally located, 100 m from the lake and the most beautiful beach in the Vaud canton, beautiful and exceptional family residence. With a light-filled surface area of 360 m2 + basement, spacious interiors (living room: 9 m high ceiling), and a judicious arrangement of rooms enabling everyone to find their space. Beautiful enclosed and mature flat grounds with pool. Refreshing restores to be foreseen. Ref. N° V15-312-27. Price on request

Bernard Nicod Rue de la Gare 11 - CH-1110 Morges Tél.: +41 (0)21 804 79 79 - Fax: +41 (0)21 804 79 70 www.bernard-nicod.ch

102

HELVETISSIMMO


h94-097-112.qxd

30.7.2015

16:10

Page 103

GROHE IMMOBILIER SA – Rue Louis de Savoie 78 1110 Morges - 021 811 32 20 - www.groheimmobilier.ch

BIENVENUE DANS L’UNIVERS DU GROUPE GROHE

UNE MAISON, UN APPARTEMENT À REMETTRE ? CONTACTEZ UN AS

À PEINE CONFIÉ

DÉJÀ VENDU L’AGENCE QUI VEND PLUS VITE QUE SON OMBRE

LUX-RESIDENCE.COM

103


h94-097-112.qxd

30.7.2015

16:11

Page 104

VAUD

BLONAY

Magnifique villa avec piscine et vue panoramique sur le lac et les montagnes

Magnifique villa individuelle de 7,5 pièces, d’une surface habitable de 260 m2, située dans un quartier résidentiel des bas de la commune de Blonay, au bénéfice d'une très jolie vue sur le lac et les montagnes. Construite sur une belle parcelle de 1'648 m2, cette propriété dispose également d’une piscine chauffée, d'un grand garage double avec porte automatique ainsi qu’un joli cabanon de jardin.

Magnificent 7,5 room detached villa, with 260 m2 of living space in a residential sector at the bottom of Blonay town, enjoying a beautiful view of the lake and mountains. Built on beautiful grounds of 1'648 m2, this property also boasts a heated pool, a large 2-car garage with automatic door as well as a lovely garden shed. Ref. N° 71851. Price: CHF 2’290’000.-

Réf. N° 71851. Prix: CHF 2’290’000.-

MONTREUX/CHERNEX

Attique de rêve avec panorama grandiose

Cet attique de rêve de 6,5 pièces, situé sur les hauts de Montreux, dispose d'une surface habitable de 173 m2 + 100 m2 de terrasse, au bénéfice d'une vue panoramique grandiose sur la Riviera et les Alpes. Ce bien d'exception, aux finitions de haut standing et de bon goût, est vendu avec une grande cave ainsi que 2 places de parc intérieures, comprises dans le prix de vente. Cet objet peut-être acheté comme résidence principale ou secondaire; il est également ouvert à la vente aux étrangers non résidents.

This dream penthouse with 6,5 rooms is situated on the hills above Montreux, living space of 173 m2 and 100 m2 of terrace, enjoying a grandiose panoramic view of the Riviera and the Alps. This exceptional property, with luxury finishes of good taste, is sold with a large cellar as well as 2 interior parking spaces, included in the sale price. This property can be purchased as a main or secondary residence; it is also open for sale to non-residents. Ref. N° 70375 Price on request

Réf. N° 70375. Prix sur demande

CGS Global Immobilier SA CH-1820 Montreux Tel.: +41 (0)21 962 70 50 www.cgs-immobilier.ch

104

HELVETISSIMMO


h94-097-112.qxd

30.7.2015

16:11

Page 105

¼ LAUSANNE 1010 Les résidences de Crousaz Notre nouvelle promotion offrira en été 2016 —

Une situation idéale par sa proximité de l’entrée " Vennes " de l’A9 (5 minutes) et de la station  )RXUPL  du métro M2 (200m.) : le centre-ville, la gare, les Hôpitaux et le biopôle sont à portée de main…

Un site résidentiel remarquablement calme

Deux immeubles dans un cadre verdoyant, orientés plein sud et dotés de terrasses généreuses

Construction aux normes Minergie

Appartements à vendre en PPE (Prix forfaitaire clés en mains)

2 4 appartements 4 ½ pièces - 128 m2 Terrasse et jardin privatif ....................................................... 1’070’000 F 2 4 appartements 3 ½ pièces - 108m2 Grande terrasse ................................................................................... 890’000 F 0 4 appartements en attique 2 ½ pièces - 71 m2 Grande terrasse ..................................................................................... 640’000 F

¼ MORGES 2 5 vi l l as co n ti guë s à v e n d r e sur p l a n s En plein cœur du village de Lully-sur-Morges, il ne reste que 2 villas offrant de grandes pièces à vivre, 3 à 4 chambres, deux balcons, un jardin individuel et un garage double. L’autoroute est à 2 km et le centre de Morges à 3 km. Bus pour la gare de Morges. 1RPEUHXVHVFRQÀJXUDWLRQVSRVVLEOHV

3UL[jSDUWLUGH··)

Information et réservation : Téléphone : 021 807 17 65 E-mail : immolac@immolac.ch | Site internet : www.immolac.ch

LUX-RESIDENCE.COM

105


h94-097-112.qxd

30.7.2015

16:11

Page 106

VAUD

ST-LÉGIER LA CHIESAZ

«Domaine Les coteaux du Village»

D

10 ÉJÀ

V

AS ILL

V

D EN

UE

S

Réservé

Domaine privatisé de 15'600 m2 situé sur les hauteurs de Vevey comprenant 16 villas. Cette construction de belle qualité se situe dans un lieu calme et proche de toutes les commodités (Ecole Internationale Haut-Lac à 3 min). A saisir dernières Villas individuelles de 200 m2 hab (4 chambres) + sous-sols + parcelle de 1'012 m2 dès CHF 1'895'000.- Finitions au gré du preneur. Livraison printemps 2016. Laissez-vous séduire par son design exceptionnel, sa luminosité, ses matériaux et aménagements haut standing qui vous assureront le confort et la douceur de vivre que vous recherchez! Prix: dès CHF 1’895’000.www.lescoteauxduvillage.ch

Privatised estate of 15'600 m2 on the heights of Vevey cwith 16 villas. This beautiful quality building is situated in a calm setting close to all amenities (Only 3 min from the Ecole Internationale Haut-Lac). Excellent opportunity the last detached 200 m2 Villas (4 bedrooms) + basement + 1'012 m2 grounds from CHF 1'895'000.-. Finishes at the discretion of the buyer. Delivery Spring 2016. Be captivated with its unique design, its luminosity, luxury materials and amenities that will ensure you the comfort and easy life you are looking for! Prices: from CHF 1’895’000.www.lescoteauxduvillage.ch

Jean Wicki Management SA Route de Champ Colin 11 - Case Postale 2373 - CH-1260 Nyon 2 Tél.: +41 (0)22 354 01 01 infovd@jeanwicki.ch - www.jeanwicki.ch

106

HELVETISSIMMO


h94-097-112.qxd

30.7.2015

16:11

Page 107

CHARDONNE

RÊVER IMAGINER ET VIVRE L’EXCEPTIONNEL

ISON

LIVRA

2016 EMPS

PRINT

Appartements à vendre de 3.5 à 6,5 pièces dès

CHF 895’000.Visites et rdv :

021.921.08.33 info@parc-de-baumaroche.ch

Jean Wicki Management SA mise en valeur + pilotage + promotion + courtage

16 appartements en PPE dans 3 résidences distinctes situées au cœur d’un domaine privé de 8 425 m2 à Chardonne. Appartements de standing de 3.5 à 6.5 pièces avec vue imprenable sur le lac et les montagnes.

www.parc-de-baumaroche.ch

Route de Champ Colin 11 Case postale 2373 1260 Nyon 2

022 354 01 01

LUX-RESIDENCE.COM

107


h94-097-112.qxd

30.7.2015

16:11

Page 108

VAUD

CORSEAUX

Magnifique appartement à vendre en viager occupé

Magnifique appartement avec vue lac et montagnes imprenable! Grand salon-salle à manger avec un grand balcon de 20 m2, véranda de 20 m2, 2 ch., sdb/wc, douche/wc, cuis. éq. ind.. Au 2e étage d'une PPE avec ascenseur. Place de bateau par la PPE dans le port privé de la résidence. Capitainerie, cabine de bains, jardin sans droit de passage. Accès direct au lac. Très calme. Garage fermé, une cave, buanderie... Valeur vénale: CHF 1’500’000.-. Prix: Bouquet de CHF 750’000.-, pas de rente Droit d’occupation à vie par femme de 70 ans

Beautiful apartment with stunning lake and mountain views! Spacious livingdining room, large 20 m2 balcony, 20 m2 veranda, 2 bedrooms, bathroom/toilet, shower room/toilet and fitted kitchen. 2nd floor of a condominium with lift. Mooring space in the residence's private harbour. Harbour master's office, bathroom and garden without right of way. Direct access to the lake. Very peaceful. Lock-up garage, cellar and utility room... Market value: CHF 1’500’000.Price: Bouquet of CHF 750’000.-, no pension Life occupancy tenant 70 year old woman

LAUSANNE A

A appartement à vendre en viager occupé Bel

Bel appartement traversant de 77 m2 dans une PPE de 1937 à Lausanne, quartier Béthusy. Au 3e étage avec ascenseur neuf. 3,5 pièces avec grand hall, 2 chambres, un salon, une cuisine indépendante équipée, salle de bains, wc séparés, 3 grands balcons, belle échappée lac. Cave, buanderie commune. Valeur vénale: CHF 660’000.-. Prix: Bouquet de CHF 400’000.-, pas de rente Droit d’occupation à vie par homme de 72 ans

LE SPÉCIALISTE DE LA VENTE EN VIAGER EN SUISSE

108

HELVETISSIMMO

Beautiful double oriented apartment of 77 m2 in a condominium dating from 1937 in Lausanne, Béthusy neighbourhood. On the 3rd floor with a new lift. 3,5 rooms with a large hall, 2 bedrooms, lounge, fitted open plan kitchen, bathroom, separate toilet, 3 large balconies and beautiful lake glimpse. Cellar, and shared utility room. Market value: CHF 660’000.Price: Bouquet of CHF 400’000.-, no pension Life occupancy tenant 72 year old man

Immo-Vie-Agée Sàrl S.Reynier - CH-Rolle GSM: +41 (0)78 635 58 57 contact@immo-vie-agee.ch - www.immo-vie-agee.ch


h94-097-112.qxd

30.7.2015

16:11

Page 109

naef

Prestige

ST-SULPICE - VAUD - MAISON CONTEMPORAINE Située sur les bords du lac Léman, à proximité immédiate de Lausanne, cette propriété d’exception WYVÄ[LK»\ULWHYJLSSLKLWYuZKL» T2 en front de lac, avec son propre ponton d’amarrage. Vue panoramique sur le lac et les Alpes, calme absolu et privacité caractérisent cette propriété de charme. Rénovée dans sa totalité en 2014, cette KLTL\YL JVU[LTWVYHPUL [V[HSPZL  WPuJL :H situation et son orientation en font un objet rare.

This outstanding waterfront property stands on a plot VMHSTVZ[» T2, with its own mooring pontoon, on the banks of Lake Geneva, very near Lausanne. ;OL LUJOHU[PUN WYVWLY[` ILULÄ[Z MYVT WHUVYHTPJ views of the lake and Alps combined with absolute WLHJL HUK ZLJS\ZPVU ;OL JVU[LTWVYHY` YVVT house was totally renovated in 2014. It provides more than 600 m2 of living space with impressive reception rooms and a separate apartment.

Naef Prestige Mail: prestige.la@naef.ch Téléphone: 021 318 77 21 www.naef-prestige.ch

9tM!  7YP_7YPJL!*/-»» Naef Prestige is a member of the Knight Frank network

LUX-RESIDENCE.COM

109


h94-097-112.qxd

30.7.2015

16:11

Page 110

VAUD

LUTRY

Attique avec vue panoramique

Sur un coteau résidentiel calme, cet appartement de 276 m2 bénéficie d’un accès direct par ascenseur. Un généreux espace de réception comprenant un séjour avec cheminée, une grande salle à manger et une cuisine agencée accède à un grand balcon et un jardin d’hiver, ainsi qu'un bureau ou chambre. La partie nuit comprend quatre chambres et trois salles d’eau. Ce bien dispose également d’une annexe de 39 m2.

Situated on a quiet hillside, this 276 m2 property benefits from direct lift access. The spacious reception area, comprising a living room with fireplace, large dining room and a fully fitted kitchen, leads through to a large balcony and a conservatory as well as an office/spare bedroom. There are four bedrooms and three bathrooms as well as a 39 m2 annex. Ref. N° 55889. Price: CHF 2,300,000 + 3 indoor parking spaces

Réf. N° 55889. Prix: CHF 2’300'000.- + 3 places intérieures

PULLY-LA-ROSIAZ

Appartement en attique

Au cœur d’un quartier résidentiel très calme, cet attique de 5 pièces de 192 m2 + mezzanine de 106 m2 profite d’un environnement verdoyant et d'une vue sur le lac. Occupant l’entier du dernier étage, il comprend 3 chambres, 3 salles d’eau, deux grands balcons sud et ouest, un petit bureau. La pièce à vivre dispose d'une double hauteur avec cheminée se prolongeant sur la salle à manger puis la cuisine.

Located in the heart of a quiet and leafy residential area, this 5-room property boasts 192 m2 plus a 106 m2 mezzanine floor and lake views. It occupies the whole of the top floor and includes 3 bedrooms, all with ensuites, 2 large balconies facing south and west and a small office. The double height living room has a fireplace and leads through to the dining room and kitchen. Ref. N° 39283. Price: CHF 2,490,000 + 2 indoor parking spaces

Réf. N° 39283. Prix: CHF 2’490’000.- + deux parkings intérieurs

POLI REAL ESTATE SA Rue du Centre 9 - CH-1009 Pully Tél.: +41 (0)21 711 10 09 - GSM: +41 (0)79 409 22 67 info@poli-real-estate.ch - www.poli-real-estate.ch

110

HELVETISSIMMO


h94-097-112.qxd

30.7.2015

16:11

Page 111

VAUD

BREMBLENS

Superbe environnement - Permis pour villa avec piscine

Située entre deux zones agricoles, cette parcelle de 2'500 m2 se trouve dans un environnement de belles propriétés. Magnifiquement agrémentée d'arbres centenaires, elle offre une très belle vue sud-ouest sur la campagne et le Jura. La parcelle est d'ores et déjà au bénéfice d'un permis de construire en force pour une villa avec piscine extérieure et garage. Dernière opportunité d'acquérir un terrain dans cet endroit privilégié!

This 2’500 m2 plot is in a sought-after residential area situated between two agricultural zones. The plot boasts magnificent 100-year old trees and stunning, south-westerly views of the surrounding countryside and Jura mountains. Planning permission has been granted to build a detached house with outdoor pool and garage. Last chance to purchase a plot in this exceptional area! Ref. N° 63073. Price: CHF 1,980,000

Réf. N° 63073. Prix: CHF 1'980'000.-

LUTRY-SUD

Superbe propriété avec vue

Sur les bords du Léman, cette propriété de caractère est idéalement située sur la promenade longeant le vieux port de Lutry, soit à quelques mètres du rivage. Elle jouit d'une excellente intimité grâce à son jardin superbement aménagé et arborisé. Cette ancienne maison de maître (1850) soigneusement rénovée avec goût allie charme d'antan et confort contemporain et offre des espaces à vivre très conviviaux et luxueux.

On the shores of Lake Geneva, this character property is ideally located only a few meters from the shore, on the promenade along the old port. It combines great privacy and beautifully landscaped. This former mansion (1850) has been carefully and tastefully renovated in order to preserve its character and add contemporary comfort and offers friendly and luxurious living spaces. Price on request

Prix sur demande

POLI REAL ESTATE SA Rue du Centre 9 - CH-1009 Pully Tél.: +41 (0)21 711 10 09 - GSM: +41 (0)79 409 22 67 info@poli-real-estate.ch - www.poli-real-estate.ch

LUX-RESIDENCE.COM

111


h94-097-112.qxd

30.7.2015

16:11

Page 112

Rue Froide 5 - 1296 COPPET T 022 960 03 63 - info@nicolemichel.ch www.nicolemichel.ch

CHAVANNES-DES-BOIS (VD) Propriété campagnarde sur 3’000 m2 au calme à 15 minutes de Genève Environnement rural et dégagé pour cette imposante propriété sise dans un havre de paix aux portes de Genève. Cette demeure de style classique possède une surface habitable de plus de 600 m2 répartis sur 2 niveaux.

112

CHF 4’700’000.Large country house on 3’000 m2 15 minutes from Geneva Peaceful rural setting for this classic family home located in a small village close to Geneva and quality international schools. Lovely views of the Mont Blanc, the Jura and the surrounding countryside. The house has more than 600 m2 of living space on the two

Intérieurs chaleureux au style « farmhouse » avec poutres appa-

main levels; a pretty garden with south facing terraces, a large

rentes et vastes cheminées. Beau jardin, piscine et parking

swimming pool plus generous inside and outside parking for

intérieur et extérieur pour plusieurs véhicules. Bonus : vues sur

several cars make this property a special and comfortable

le Mont Blanc, le Jura et la campagne.

home for the growing family.

HELVETISSIMMO


h94-113-128.qxd

30.7.2015

16:30

Page 113

Rue Froide 5 - 1296 COPPET T 022 960 03 63 - info@nicolemichel.ch www.nicolemichel.ch

TANNAY

CHF 4’450’000.-

Propriété exceptionnelle sise dans un cadre calme et résidentiel

Magnificent Huf House 20 minutes from Geneva

Situé à 20 minutes de l’aéroport de Genève, proche des écoles

This unique Huf-Haus, built on 1’800 m2 almost entirely of wood

publiques et privées. Cette maison lumineuse et ensoleillée dotée

and glass with top-quality finishings is in the perfect quiet and

de finitions soignées est en excellent état d’entretien.

residential location with close access on foot to the village and

Elle possède un grand jardin fleuri et soigné, une piscine avec

the station.

guest / pool-house indépendant ; en plus des belles pièces de

It has a splendid private garden carefully planted and tended with

réception en enfilade, 5 chambres, 4 bains et deux bureaux se

a swimming pool and a charming independant pool/guest house.

répartissent sur les 3 niveaux de la maison.

Large “plantation style” covered decks surround the main house

Parcelle intime de près de 1’800 m2. Un bien exceptionnel à visiter absolument.

which has 5 bedrooms and 4 bathrooms, with a sumptuous extra large bathroom for the master suite. This lovely family home with its open plan space, generous volumes and unique natural light must be viewed.

LUX-RESIDENCE.COM

113


h94-113-128.qxd

30.7.2015

16:30

Page 114

VAUD

AUBONNE

Ferme traditionnelle vaudoise de 900 m2 rénovée

Originalité et anticonformisme traduisent l’esprit de cette traditionnelle ferme vaudoise rénovée de 900 m2 sise sur une parcelle d’environ 2’500 m2. Le mariage des poutres vieillies et des bétons polis, associé à des volumes hors normes assigne à cette propriété une facture singulière. La demeure offre 6 chambres, 2 cuisines, une piscine intérieure annexée à un espace de détente et de loisir et d’un patio, lequel accueille une cuisine d’été et un authentique four à pizza. Le niveau supérieur se décline en un loft de 225 m2 avec cheminée centrale. Surface habitable 900 m2 Surface terrain 2’500 m2.

Originality and unconventionality reflect the spirit of this traditional farmhouse. It features 900 m2 on a parcel of approximately 2’500 m2. The marriage of aged beams and polished concrete, combined with outsized volumes assigned to this property a unique invoice. The house offers 6 bedrooms, 2 kitchens, indoor pool attached to a recreational and leisure and a patio, which hosts a summer kitchen and an authentic pizza oven. The upper comes in a loft of 225 m2 with fireplace. Living space 900 m2 2’500 m2 land. Price on request

Prix sur demande

Quintessentially Estates Rue de Lausanne 69 - CH-1201 Genève GSM: +41 (0)78 655 90 91 karim.b@quintessentiallyestates.com - www.quintessentiallyestates.ch

114

HELVETISSIMMO


h94-113-128.qxd

30.7.2015

16:30

Page 115

Magnifique propriété de 11 pièces Magnificent 11-room property

SUISSE - Jouxtens-Mézery (Vaud) A L L E M AGN E F RANC E

SUISSE

AU T R I C HE

Jouxtens-Mézery (VD) I TA L I E

Idéalement située à 10 minutes de Lausanne et 15 minutes de Morges, dans une commune résidentielle et recherchée, cette magnifique propriété bénéficie d'un environnement de premier ordre. Elle est érigée sur une belle parcelle de plus de 5’000 m2 aménagée avec goût et offrant une intimité de rigueur. Volumes et luminosité caractérisent ce bien doté de finitions supérieures. Son orientation lui offre un ensoleillement optimal et un dégagement sur le lac. Toutes les pièces du rez-de-chaussée ont un accès direct à la terrasse et au jardin, celles de l'étage disposent d'un balcon. Le vaste hall d'entrée au rez-dechaussée distribue des pièces de réception avec cheminée, un salon d'été avec accès à la piscine, une salle à manger, une cuisine agencée offrant un espace repas et un office, un bureau avec cheminée et un WC visiteurs. L'étage comprend quatre chambres à coucher en suite avec rangements, ainsi que la chambre principale dotée d'un dressing double et d'une cheminée. Ideally situated 10 minutes from Lausanne and 15 minutes from Morges, in a much sought-after residential municipality, this magnificent property enjoys a first-class environment. It is built on a beautiful, tastefully landscaped parcel of more than 5’000 sq. m., providing complete privacy. Space and light are the main features of this residence, which is finished to an extremely high standard. Its orientation enables it to take full advantage of maximum sunshine and a partial view of the lake. The vast entrance hall on the ground floor leads to the various reception rooms with open fireplaces, a summer lounge leading to the swimming pool, a dining room, a fully-fitted kitchen with meal’s area and a butler’s pantry, a study with open fireplace and a guests’ WC. The first floor comprises four en suite bedrooms with built-in wardrobes and the master bedroom with a double dressing room and open fireplace.

Prix / Price : CHF

CHF 4 - 8 millions

MEMBRE DU GROUPE SPG-RYTZ

8 -12 m.

12 -15 m.

15 -20 m.

20 m.

SPG Finest Properties Place de la Navigation 14 CH-1006 Lausanne-Ouchy T. + 41 ( 0 ) 58 810 35 50 lausanne@spgfinestproperties.ch www.spgfinestproperties.ch SPG Finest Properties

LUX-RESIDENCE.COM

115


h94-113-128.qxd

30.7.2015

16:30

Page 116

VAUD

PULLY CENTRE

Exceptionnel appartement neuf dans une résidence classée

Ce duplex de 212 m2, dont les finitions sont encore à choix, occupe les combles et surcombles d’une maison patrimoniale de caractère en cours de réhabilitation totale. La vue spectaculaire sur le Léman et le charme d’antan offrent son exclusivité à ce logement desservi par un ascenseur. Sa situation privilégiée au cœur de Pully, à quelques minutes de St-François, est un atout non négligeable. Une excellente opportunité à ne surtout pas manquer! Réf. N° 799157. Prix: CHF 2'950’000.-

This 212 m2 duplex, whose finishes have yet to be selected, can be found in the attic of a patrimonial character house currently undergoing full rehabilitation. The spectacular view of Lake Geneva with its old world charm offers its exclusiveness to this residence with lift. Its privileged location in the heart of Pully, just minutes from St. François, is a considerable asset. An excellent not to be missed opportunity! Ref. N° 799157. Price: CHF 2'950'000.-

PULLY

Superbe habitation avec terrasse et jardin privés

Lumineux appartement de standing, 192 m2 pondérés (155 m2 nets), entièrement rénové comprenant une terrasse de 120 m2 et un jardin d’env. 76 m2. Bord du lac à 5 min, très calme. Centre de Pully avec ses commerces et la gare ainsi que Lausanne à 5 min. 2 places de parc intérieures en sus. Réf. N° 533507. Prix: CHF 1'810’000.-

Light-filled penthouse, 192 m2 weighted (155 m2 net), fully renovated with a terrace of 120 m2 and a garden of approx. 76 m2. Peaceful and only 5 min from the lakeside. Only 5 min from Pully centre with its shops and train station as well as Lausanne. 2 interior parking spaces are included. Ref. N° 533507. Price: CHF 1'810’000.-

Galland & Cie Quartier du Rôtillon - Flon 1 - CH-1003 Lausanne Tél.: +41 (0)21 310 25 15 - Fax: +41 (0)21 310 25 09 ventes@regiegalland.ch - www.regiegalland.ch

116

HELVETISSIMMO


h94-113-128.qxd

30.7.2015

16:30

Page 117

VAUD

MORGES

Ferme d’exception

A 15 minutes de Morges cette demeure du XIXe siècle a été entièrement rénovée en 2009. Répartis sur trois niveaux et totalisant une surface de plancher d’environ 900 m2. Elle dispose d’un sauna et d’une piscine intérieure idéal pour se détendre. Dans son parc d’environ 5’000 m2 cette propriété est garante du calme et d’une grande tranquillité.

Only 15 min from morgesthis 19th C. residence was fully renovated in 2009 Three floors with a total surface area of approx. 900 m2. Comprising a sauna and an interior pool for relaxation. Set in a park of 5’000 m2 guaranteeing peace and tranquillity. Price on request

Prix sur demande

CHAILLY-MONTREUX

Maison d’architecte

Maison d’architecte, lumineuse et spacieuse au milieu d’un parc joliment arboré. Vue sur le lac Léman et les vignes. Ce havre de paix offre la possibilité depuis la terrasse couverte plongeante sur la piscine de profiter pleinement du calme et de la sérénité du lieu. Viager occupé: H86/F73 Valeur vénale: CHF 4’995'000.Bouquet: CHF 3'965'000.Rente mensuelle: Pas de rente !

Light-filled and spacious in its mature park. View of lake Geneva and the vineyards. Covered terrace overlooking the pool a haven of tranquility and serenity. Occupants: M86/F73 Market value: CHF 4’995'000.Bouquet: CHF 3'965'000.Rent: none !

SAVINTER SA Boulevard Georges-Favon 3 - CH-1204 Genève Tél.: +41 (0)22 319 06 25 info@savinter.ch - www.savinter.ch

LUX-RESIDENCE.COM

117


h94-113-128.qxd

30.7.2015

16:30

Page 118

ZURICH

ZÜRCHER OBERLAND

Repräsentatives Wohnhaus mit Swimming-Pool

Traumhaftes 6,5-Zimmer-Landhaus mit Swimmingpool im Zürcher Oberland, angrenzend an die Landwirtschaftszone. Repräsentatives Wohnhaus von 1989 mit Swimming-Pool; Grundstückfläche ca. 1'500 m2; Wohnfläche ca. 227 m2; eine angrenzende. Landwirtschaftsparzelle mit über 3'600 m2 Fläche kann dazu erworben werden. Gebäudevolumen GVZ knapp 1'300 m2. Grosse offene Küche (24 m2), Essen (14 m2), Gästezimmer/Büro im EG (20 m2), grosszügiges Wohnzimmer (43 m2) mit Cheminée, ein grosses Badezimmer und zweimal Dusche/WC sowie eine Ankleide. Die vier Zimmer im Obergeschoss bzw. Dachgeschoss sind zwischen 14 und 26 m2 gross. Ein wunderschönes Anwesen, gelegen am süd-östlichen Dorfrand von Bertschikon, Gemeinde Gossau ZH, sucht einen neuen Nutzer! Preis: CHF 2’190’000.-

Elliscasis Immobilien GmbH www.elliscasis.ch

118

HELVETISSIMMO

ELLISCASIS IMMOBILIEN GMBH Schlossbachstrasse 2 - CH-8620 Wetzikon Tél.: +41 (0)44 995 18 81 info@elliscasis.ch - www.elliscasis.ch

Wonderful 6,5-room country house, with swimming pool, in the Zurich Oberland, bordering on the agricultural zone. Prestigious residence of 1989 built with swimming pool; approx. 1’500 m2 plot; habitable area 227 m2; adjoining 3’600 m2 of agricultural land, also for sale. The GVZ building volume is 1’300 m2. Large open-plan kitchen (24 m2), dining room (14 m2), guest room/study on ground floor (20 m2), generous living room (43 m2) with fireplace, large bathroom, two shower/WCs, and a dressing room. The four bedrooms on the upper floor are between 14 and 26 m2 in area. This very fine home, situated on the south-eastern edge of the village of Bertschikon in the municipality of Gossau ZH, is only in need of new owner! Price: CHF 2’190’000.-


h94-113-128.qxd

30.7.2015

16:30

Page 119

h c . k c e h ec

hom

SCHAUEN SIE AUCH HINTER DIE FASSADE? Eigenheim kaufen ohne Überraschung. Ferienimmobilie erwerben ohne schlaflose Nächte. Kein Ärger mehr mit Planer und Handwerker. Ich prüfe, begutachte, bewerte und analysiere Ihre Traumimmobilie in der Schweiz, Deutschland, Österreich, Frankreich, Spanien, Italien und Florida. Wissenschaftlich, korrekt und immer persönlich. Beat Michael Wälty dipl. Ing. dipl. Arch. SIA STV VBI VDA freier Sachverständiger und akkreditierter Gerichtsgutachter im Bau- und Immobilienrecht

DR E I ST E I N Immobilien. Gutachten. Schlichtung.

DREISTEIN AG Picardiestrasse 5 CH - 5040 Schöftland Schweiz carrer de les estepes 12 E - 07680 Porto Cristo Novo Illes Balears Espana T +41 62 726 26 00 F +41 62 726 26 01 www.homecheck.ch

LUX-RESIDENCE.COM

119


h94-113-128.qxd

30.7.2015

16:30

Page 120

ZÜRICH

HIRSLANDEN QUARTIER ZÜRICH

Hier will ich leben!

In der Stadt und doch mitten in der Natur verkaufen wir auf Herbst 2015 noch eine 3,5-Zimmer-Maisonett-Wohnung in einem Mehrfamilienhaus mit 4 Eigentumswohnungen. Das Wohnhaus befindet sich an ruhiger Lage und in unmittelbarer Nähe zur Natur. Die angrenzende Wiese und der Wald sind Teil des grosszügigen Naherholungsgebietes am Adlisberg. Die schmale, leicht konische Form fügt sich optimal in die Umgebung ein. Im kompakten Gebäude sind drei grosszügige Maisonette-Wohnungen sowie eine Einheit im Gartengeschoss mit unterschiedlichen Aussichts- und Aussenraumbezügen angeordnet. Ein Projekt der RSH Bau und Immobilien AG. Preis: CHF 1’910’000.-

Set in greenery we are selling a duplex apartment with 3,5 bedrooms in a building with 4 freehold apartments. The property is in a quiet location with direct access to an area of unspoilt nature. The adjacent forest and meadow form part of the spacious, green area at the foot of the Adlisberg. The sleek profile in a conical shape fits and integrates perfectly with the surroundings. The compact buildings accommodate 3 spacious duplex apartments and a residential unit on the ground floor with a garden, which has different panoramic viewpoints and outdoor spaces. A RSH Bau and Immobilien AG project. Price: CHF 1’910’000.-

SIV Suter Immobilien und Verwaltungen - Andreas Jordi Weinbergstrasse 100 - CH-8802 Kilchberg Tel.: +41 (0)43 377 31 21 - Fax: +41 (0)43 377 31 01 andreas.jordi@s-i-v.ch - www.s-i-v.ch/hirslanden

120

HELVETISSIMMO


h94-113-128.qxd

30.7.2015

16:30

Page 121

Haus «Désirée» 8735 Rüeterswil

Das Haus «Désirée» gehört zu den Toplagen im Quartier. Traumhafte Panoramasicht auf den Zürichsee und die Berge. Knapp 800 M.ü.M, meist nebelfrei, sehr sonnig und absolut ruhig. Verkaufspreis schlüsselfertig CHF 1.98 Mio. Ausbau-Details können noch mitbestimmt werden.

Landhaus-Bau AG, Obermatten 13, 8735 Rüeterswil SG 055 284 50 70 / landhaus-bau@bluewin.ch

LUX-RESIDENCE.COM

121


h94-113-128.qxd

30.7.2015

16:30

Page 122


h94-113-128.qxd

30.7.2015

16:30

Page 123

MONTAGNE VAUD • ALPES FR ANÇAISES


h94-113-128.qxd

30.7.2015

16:30

Page 124

VAUD

PAYS D’ENHAUT – GSTAAD

Magnifique chalet de 300 m2 habitables

Juché sur un terrain de 1'446 m2, à 2 kilomètres du centre du village de Château d'Oex et à seulement 12 minutes de la célèbre station de Gstaad, ce magnifique chalet de haut standing, construit en 2008, a été conçu pour privilégier l'espace et la lumière dans chacune de ses pièces. Ce chalet se compose de 5 chambres à coucher avec dressing, 4 salles de bains, un salon TV, une belle cuisine ouverte sur la salle à manger et le très grand séjour. Chaque étage possède des accès directs sur les larges balcons et les terrasses, permettant de jouir à chaque instant de son ensoleillement optimal et de la vue exceptionnelle sur les montagnes et la vallée.

Perched on grounds of 1'446 m2, only 2 km from Château d'Oex village centre and only 12 min from the famous ski resort of Gstaad, this beautiful luxury chalet, built in 2008, was designed to favour space and light in each of its rooms. This chalet consists of 5 bedrooms with dressing rooms, 4 bathrooms, a TV lounge, beautiful kitchen open to the dining room and a spacious living room. Each floor has direct access to wide balconies and terraces to enjoy every moment of its sunny climate and the exceptional views of the mountains and the valley. Price: CHF 4'200'000.-

Prix: CHF 4'200'000.-

Louis Martin - CF Immobilier Compagnie Foncière SA Au Village - CH-1659 Rougemont Tel.: +41 (0)26 925 10 00 - Fax: +41 (0)26 925 10 05 info@cfimmobilier.ch - www.cfimmobilier.ch

124

HELVETISSIMMO


h94-113-128.qxd

30.7.2015

16:30

Page 125

CHAMONIX Chalet de Prestige ŚĂůĞƚ ĚĞ ƉƌĞƐƟŐĞ ƐŝƚƵĠ ĚĂŶƐ ůĞ ƐĞĐƚĞƵƌ ƚƌğƐ ƉƌŝƐĠ ĚĞƐ ŚĂǀĂŶƚƐ͕ ĂƵdž ,ŽƵĐŚĞƐ͕ ƉƌŽĐŚĞ ĚĞƐ ƌĞŵŽŶƚĠĞƐ ŵĠĐĂŶŝƋƵĞƐĞƚĚĞƚŽƵƚĞƐůĞƐĐŽŵŵŽĚŝƚĠƐ͘ĞĐŚĂůĞƚ͕ĨĂĐĞ ĂƵDŽŶƚͲůĂŶĐ͕ĐŽŵƉƚĞƵŶĞŵĂŐŶŝĮƋƵĞƉŝğĐĞĚĞǀŝĞĂǀĞĐ ŐƌĂŶĚƐĂůŽŶĞƚƐĂůůĞăŵĂŶŐĞƌ͕ƵŶĞĐƵŝƐŝŶĞƐƉĂĐŝĞƵƐĞĞƚ ůƵŵŝŶĞƵƐĞ͕ƵŶƐĂůŽŶds͕ƵŶŐƌĂŶĚďƵƌĞĂƵĞƚϱƐƵŝƚĞƐ͘^ĂůůĞ ĚĞƐƉŽƌƚƐ͕ƐĂƵŶĂĞƚũĂĐƵnjnjŝĞdžƚĠƌŝĞƵƌ͘dĞƌƌĂŝŶƉĂLJƐĂŐĠĚĞ ϭϲϳϯŵ2͘

Prix / Price : 3 280 000 € FAI WͬŶĞƌŐLJĐĞƌƟĮĐĂƟŽŶ͗

ZĠĨ͘ϰϵϮ

>ƵdžƵƌLJ ĐŚĂůĞƚ ƐŝƚƵĂƚĞĚ ŝŶ ƚŚĞ ƐŽƵŐŚƚ ĂŌĞƌ ƐĞĐƚŽƌ ŽĨ ŚĂǀĂŶƚƐ͕ ,ŽƵĐŚĞƐ͕ ŶĞĂƌ ƚŚĞ ƐŬŝ ůŝŌƐ ĂŶĚ Ăůů ĂŵĞŶŝƟĞƐ͘ dŚŝƐĐŚĂůĞƚ͕ ĨĂĐŝŶŐƚŚĞDŽŶƚͲůĂŶĐ͕ŚĂƐĂďĞĂƵƟĨƵůůŝǀŝŶŐ ĂƌĞĂǁŝƚŚƐƉĂĐŝŽƵƐůŝǀŝŶŐĂŶĚĚŝŶŝŶŐƌŽŽŵ͕ĂƐƉĂĐŝŽƵƐĂŶĚ ďƌŝŐŚƚŬŝƚĐŚĞŶ͕ĂdsůŽƵŶŐĞĂŶĚĂůĂƌŐĞŽĸĐĞĂŶĚϱƐƵŝƚĞ ďĞĚƌŽŽŵƐ͘'LJŵ͕ƐĂƵŶĂĂŶĚĂŶŽƵƚƐŝĚĞ:ĂĐƵnjnjŝ͘ϭϲϳϯƐƋ͘ŵ ƉůŽƚ͘

CHAMONIX Propriété Exceptionnelle ĠŶĠĮĐŝĂŶƚ Ě͛ƵŶĞ ƐŝƚƵĂƟŽŶ ĞdžĐĞƉƟŽŶŶĞůůĞ͕ ĨĂĐĞ ĂƵdž ĂŝŐƵŝůůĞƐ ĚĞƐ  ƌƵƐ Ğƚ ă ůĂ ĐŚĂŠŶĞ ĚƵ DŽŶƚͲůĂŶĐ͕ ĐĞƩĞ ŵĂŐŶŝĮƋƵĞ ƉƌŽƉƌŝĠƚĠ Ě͛ĞŶǀŝƌŽŶ ϲϬϬ ŵ2͕ ĂǀĞĐ ĂŶŶĞdžĞƐ͕ ĂůůŝĞ ĂƌĐŚŝƚĞĐƚƵƌĞ ĂůƉŝŶĞ͕ ĐŽŶƚĞŵƉŽƌĂŝŶĞ Ğƚ ĚĞƐŝŐŶ͘ Ğů ĞƐƉĂĐĞ ĚĞ ǀŝĞ Ğƚ ŶĞƵĨ ĐŚĂŵďƌĞƐ͘ ƐƉĂĐĞ ĚĠƚĞŶƚĞ Ě͛ĞdžĐĞƉƟŽŶ ĂǀĞĐ ƉŝƐĐŝŶĞ ĐŽƵǀĞƌƚĞ͕ ƐĂůůĞĚĞŵĂƐƐĂŐĞ͕ŚĂŵŵĂŵ͕ũĂĐƵnjnjŝĞdžƚĠƌŝĞƵƌĞƚƐĂůůĞĚĞĐŝŶĠŵĂ͘ WƌĞƐƚĂƟŽŶƐůƵdžƵĞƵƐĞƐ͘dĞƌƌĂŝŶƉĂLJƐĂŐĠĞƚĐůŽƐĚĞϯϳϵϰŵ2͘

Prix sur demande / Price upon request WͬŶĞƌŐLJĐĞƌƟĮĐĂƟŽŶ͗ĞŶĐŽƵƌƐͬŝŶƉƌŽŐƌĞƐƐ

ŶũŽLJŝŶŐ ĂŶ ĞdžĐĞƉƟŽŶĂů ůŽĐĂƟŽŶ͕ ĨĂĐŝŶŐ ƚŚĞ ĂŝŐƵŝůůĞƐ ĚĞƐ ƌƵƐ ĂŶĚ DŽŶƚͲůĂŶĐ͕ ŵĂŐŶŝĮĐĞŶƚ ƉƌŽƉĞƌƚLJ ŽĨ ĂƉƉƌŽdž͘ ϲϬϬ ƐƋ͘ŵ ǁŝƚŚ ĂŶŶĞdžĞƐ͕ ĐŽŵďŝŶŝŶŐ ĐŽŶƚĞŵƉŽƌĂƌLJ ĂŶĚ ĚĞƐŝŐŶĞƌ ůƉŝŶĞĂƌĐŚŝƚĞĐƚƵƌĞ͘ĞĂƵƟĨƵůůŝǀŝŶŐƐƉĂĐĞĂŶĚŶŝŶĞďĞĚƌŽŽŵƐ͘ džĐĞƉƟŽŶĂůƌĞůĂdžĂƟŽŶĂƌĞĂǁŝƚŚĐŽǀĞƌĞĚƉŽŽů͕ŵĂƐƐĂŐĞƌŽŽŵ͕ ƐƚĞĂŵ ƌŽŽŵ͕ ŽƵƚƐŝĚĞ ũĂĐƵnjnjŝ ĂŶĚ ŚŽŵĞ ĐŝŶĞŵĂ͘ >ƵdžƵƌŝŽƵƐ ƐĞƌǀŝĐĞƐ͘ϯϳϵϰƐƋ͘ŵƉůŽƚ͘ ZĠĨ͘ϯϯϳ

BARNES CHAMONIX 96 Route Edmond de Rothschild | F 74120 MEGEVE | +33 (0)4 50 21 21 00 ŵĞŐĞǀĞΛďĂƌŶĞƐͲŝŶƚĞƌŶĂƟŽŶĂů͘ĐŽŵ ǁǁǁ͘ďĂƌŶĞƐͲŵĞŐĞǀĞ͘ĐŽŵ

LUX-RESIDENCE.COM

125


h94-113-128.qxd

30.7.2015

16:30

Page 126

COMBLOUX Chalet Vue Mont-Blanc Niché dans un véritable havre de paix avec une vue ĞdžĐĞƉƟŽŶŶĞůůĞ ƐƵƌ ůĞ DŽŶƚͲůĂŶĐ͕ ĐŚĂůĞƚ ĚĞ ϮϮϬ ŵϮ sur un ƚĞƌƌĂŝŶĚĞϮϮϬϬŵϮĂǀĞĐƉŝƐĐŝŶĞĞdžƚĠƌŝĞƵƌĞ͘/ůƐĞĐŽŵƉŽƐĞĚ͛ƵŶ ƐĠũŽƵƌͬƐĂůŽŶĂǀĞĐĐŚĞŵŝŶĠĞĚŽŶŶĂŶƚƐƵƌƵŶĞůĂƌŐĞƚĞƌƌĂƐƐĞ͕ Ě͛ƵŶĞƐƵŝƚĞĂǀĞĐƐĂůůĞĚĞďĂŝŶƐĞƚďĂůĐŽŶĞƚĚĞϱĐŚĂŵďƌĞƐ ĐŽŵƉůĠŵĞŶƚĂŝƌĞƐĂǀĞĐϯƐĂůůĞƐĚĞĚŽƵĐŚĞ͘ĂǀĞ͕ďƵĂŶĚĞƌŝĞ͕ ƐŬŝƌŽŽŵĞƚŐĂƌĂŐĞ͘

Chalet of about 220 sq.m located on a 2 200 sq.m plot with an ŽƵƚĚŽŽƌƉŽŽů͕ƐĞƚŝŶĂŚĂǀĞŶŽĨƉĞĂĐĞǁŝƚŚĞdžĐĞƉƟŽŶĂůǀŝĞǁƐŽĨ DŽŶƚůĂŶĐ͘/ƚŚĂƐĂůŝǀŝŶŐƌŽŽŵǁŝƚŚĮƌĞƉůĂĐĞŽƉĞŶŝŶŐŽŶƚŽĂ large terrace, a master suite with bathroom and balcony and ĮǀĞŵŽƌĞďĞĚƌŽŽŵƐǁŝƚŚƚŚƌĞĞƐŚŽǁĞƌƌŽŽŵƐ͘ĞůůĂƌ͕ůĂƵŶĚƌLJ room, ski room and parking.

Prix / Price : 2 200 000 € FAI WͬŶĞƌŐLJĐĞƌƟĮĐĂƟŽŶ͗ĞŶĐŽƵƌƐͬŝŶƉƌŽŐƌĞƐƐ

Réf. 500

Prix / Price : 2 880 000 € FAI WͬŶĞƌŐLJĐĞƌƟĮĐĂƟŽŶ͗ĞŶĐŽƵƌƐͬŝŶƉƌŽŐƌĞƐƐ

Réf. 414

SAINT-GERVAIS Ferme Renovée ^ƵƌůĞƐŚĂƵƚĞƵƌƐĚĞ^ĂŝŶƚͲ'ĞƌǀĂŝƐ͕ƚƌğƐďĞůůĞĨĞƌŵĞƌĠŶŽǀĠĞ ĂǀĞĐƉƌĞƐƚĂƟŽŶƐŚĂƵƚĚĞŐĂŵŵĞ͘DĠůĂŶŐĞŚĂƌŵŽŶŝĞƵdžĚĞ ĐĂƌĂĐƚğƌĞĞƚĚĞŵŽĚĞƌŶŝƚĠ͘>ĂƉŝğĐĞĚĞǀŝĞĂǀĞĐĐŚĞŵŝŶĠĞ ĐĞŶƚƌĂůĞŽīƌĞĚĞŵĂŐŶŝĮƋƵĞƐǀŽůƵŵĞƐĞƚƐĞƉƌŽůŽŶŐĞƐƵƌ ůĂ ƚĞƌƌĂƐƐĞ Ğƚ ůĂ ƉŝƐĐŝŶĞ͘ ŝŶƋ  ƐƵŝƚĞƐ͕ Ğƚ ĞƐƉĂĐĞ ĚĠƚĞŶƚĞ ĂǀĞĐƐĂƵŶĂ͕ŚĂŵŵĂŵĞƚũĂĐƵnjnjŝƐƵƌůĂƚĞƌƌĂƐƐĞĞdžƚĠƌŝĞƵƌĞ͘ dĞƌƌĂŝŶĚĞϮϲϴϴŵϮ͕ĂǀĞĐǀƵĞƐƵƌůĞDŽŶƚͲůĂŶĐ͘

KŶ ^ĂŝŶƚͲ'ĞƌǀĂŝƐ ŚĞŝŐŚƚƐ͕ ďĞĂƵƟĨƵů ƌĞŶŽǀĂƚĞĚ ĨĂƌŵŚŽƵƐĞ ǁŝƚŚ ŚŝŐŚͲĞŶĚ ĮdžƚƵƌĞƐ͘  ƐŵŽŽƚŚ ďůĞŶĚ ŽĨ ĐŚĂƌĂĐƚĞƌ ĂŶĚ ŵŽĚĞƌŶŝƚLJ͘ dŚĞ ůŝǀŝŶŐ ƌŽŽŵ ǁŝƚŚ Ă ĐĞŶƚƌĂů ĮƌĞƉůĂĐĞ ŽīĞƌƐ ďĞĂƵƟĨƵůǀŽůƵŵĞƐĂŶĚŽƉĞŶƐŽŶƚŽƚŚĞƚĞƌƌĂĐĞĂŶĚƉŽŽů͘&ŝǀĞ ƐƵŝƚĞ ďĞĚƌŽŽŵƐ ĂŶĚ Ă ƌĞůĂdžĂƟŽŶ ĂƌĞĂ ǁŝƚŚ ƐĂƵŶĂ͕ ƐƚĞĂŵ room and jaccuzi on the outdoor terrace. 2 688 sq.m plot with Mont-Blanc view.

BARNES MEGEVE ϵϲZŽƵƚĞĚŵŽŶĚĚĞZŽƚŚƐĐŚŝůĚͮ&ϳϰϭϮϬD'sͮнϯϯ;ϬͿϰϱϬϮϭϮϭϬϬ ŵĞŐĞǀĞΛďĂƌŶĞƐͲŝŶƚĞƌŶĂƟŽŶĂů͘ĐŽŵ ǁǁǁ͘ďĂƌŶĞƐͲŵĞŐĞǀĞ͘ĐŽŵ

126

HELVETISSIMMO


h94-113-128.qxd

30.7.2015

16:30

Page 127

MEGÈVE ŚĂůĞƚ ŶĞƵĨ ĚĞ ƉƌĞƐƟŐĞ͕ ƌĠĂůŝƐĠ ĚĂŶƐ ƵŶ ƐƵďƟů ŵĠůĂŶŐĞ ĚĞ ďŽŝƐ ĂŶĐŝĞŶ Ğƚ ĚĞ ƉŝĞƌƌĞƐ͘ sĂƐƚĞ ĞƐƉĂĐĞ ĚĞ ǀŝĞ ĂǀĞĐ ĐŚĞŵŝŶĠĞ͕ ŐƌĂŶĚĞ ĐƵŝƐŝŶĞ ĠƋƵŝƉĠĞ ŽƵǀĞƌƚĞ Ğƚ ϰ ƐƵŝƚĞƐ ĚŽŶƚ ƵŶĞ ŵĂƐƚĞƌ͘ /ů ďĠŶĠĮĐŝĞ Ě͛ƵŶ ĞŶƐŽůĞŝůůĞŵĞŶƚ ŵĂdžŝŵƵŵŐƌąĐĞĂƵdžŐƌĂŶĚĞƐďĂŝĞƐǀŝƚƌĠĞƐŽƵǀƌĂŶƚƐƵƌĚĞ ůĂƌŐĞƐ ďĂůĐŽŶƐ Ğƚ ƚĞƌƌĂƐƐĞƐ͘ ƐƉĂĐĞ ĚĠƚĞŶƚĞ ĂǀĞĐ ƉŝƐĐŝŶĞ ŝŶƚĠƌŝĞƵƌĞ͕ƐĂƵŶĂĞƚŚĂŵŵĂŵ͘

Brand new chalet, made of subtle blend of old wood and ƐƚŽŶĞƐ͘>ĂƌŐĞůŝǀŝŶŐĂƌĞĂǁŝƚŚĮƌĞƉůĂĐĞ͕ůĂƌŐĞŽƉĞŶŬŝƚĐŚĞŶ and 4 suite bedrooms including master. Maximum sunlight ƚŚĂŶŬƐƚŽůĂƌŐĞǁŝŶĚŽǁƐŽƉĞŶŝŶŐŽŶƚŽůĂƌŐĞďĂůĐŽŶŝĞƐĂŶĚ ƚĞƌƌĂĐĞƐ͘EŝĐĞƌĞůĂdžŝŶŐƐƉĂĐĞǁŝƚŚŝŶĚŽŽƌƐǁŝŵŵŝŶŐƉŽŽů͕ sauna and steam room.

Prix / Price : 4 700 000 € FAI WͬŶĞƌŐLJĐĞƌƟĮĐĂƟŽŶ͗ĞŶĐŽƵƌƐͬŝŶƉƌŽŐƌĞƐƐ

Réf. 402

MEGÈVE Ğ ĐŚĂůĞƚ ƐƵƌ ƚĞƌƌĂŝŶ ƉůĂƚ ĞŶ ĐŽƵƌƐ ĚĞ ĐŽŶƐƚƌƵĐƟŽŶ ŽīƌĞ ƵŶĞƐƵƉĞƌďĞĞdžƉŽƐŝƟŽŶƐƵĚͬĞƐƚ͘sĂƐƚĞĞƐƉĂĐĞĚĞǀŝĞĂǀĞĐ ĐƵŝƐŝŶĞ ŽƵǀĞƌƚĞ ĚŽŶŶĂŶƚ ƐƵƌ ƚĞƌƌĂƐƐĞ Ğƚ ũĂƌĚŝŶ͘ YƵĂƚƌĞ ƐƵŝƚĞƐ ĚŽŶƚ ƵŶĞ ŵĂƐƚĞƌ ĂǀĞĐ ĚƌĞƐƐŝŶŐ Ğƚ ƐĂůůĞ ĚĞ ďĂŝŶƐͬ ĚŽƵĐŚĞ͘ 'ƌĂŶĚ ƐŽƵƐͲƐŽů ĚĞ ϭϲϬ ŵϸ ĐŽŵƉŽƐĠ Ě͛ƵŶ ŚŽŵĞ ŝŶĠŵĂ Ğƚ ƉŽƐƐŝďŝůŝƚĠ Ě͛ĂŵĠŶĂŐĞƌ ƵŶ ĞƐƉĂĐĞ ĚĠƚĞŶƚĞ͘ ŽƵďůĞ ŐĂƌĂŐĞ͘ ĐƋƵŝƐŝƟŽŶ ƉŽƐƐŝďůĞ ĂǀĞĐ ƌĠĐƵƉĠƌĂƟŽŶ ĚĞds͘WŽƐƐŝďŝůŝƚĠĚĞĚĠĮŶŝƌǀŽƐƉƌĞƐƚĂƟŽŶƐĚĞĮŶŝƟŽŶƐ͘ ZĞŶƐĞŝŐŶĞŵĞŶƚƐƐƵƌĚĞŵĂŶĚĞ͘

ƌĂŶĚ ŶĞǁ ĐŚĂůĞƚ ĨĂĐŝŶŐ ^ŽƵƚŚ ͬ Ɛƚ͘ >ĂƌŐĞ ůŝǀŝŶŐ ƐƉĂĐĞ ǁŝƚŚ ĂŶ ŽƉĞŶ ŬŝƚĐŚĞŶ ŽǀĞƌůŽŽŬŝŶŐ ƚĞƌƌĂĐĞ ĂŶĚ ŐĂƌĚĞŶ͘ Four bedrooms suites including a master bedroom with dressing room and bathroom. 160 sq.m basement, with a home cinema and a relaxing area. Double garage. Possible ĂĐƋƵŝƐŝƟŽŶǁŝƚŚsdƌĞĨƵŶĚ͘DŽƌĞŝŶĨŽƌŵĂƟŽŶƵƉŽŶƌĞƋƵĞƐƚ͘ WŽƐƐŝďŝůŝƚLJƚŽĚĞĮŶĞLJŽƵƌŽǁŶĮŶŝƐŚĞƐ͘

Prix / Price : 2 490 000 € FAI WͬŶĞƌŐLJĐĞƌƟĮĐĂƟŽŶ͗ĞŶĐŽƵƌƐͬŝŶƉƌŽŐƌĞƐƐ

Réf. 434

BARNES MEGEVE 96 Route Edmond de Rothschild | F 74120 MEGEVE | +33 (0)4 50 21 21 00 ŵĞŐĞǀĞΛďĂƌŶĞƐͲŝŶƚĞƌŶĂƟŽŶĂů͘ĐŽŵ ǁǁǁ͘ďĂƌŶĞƐͲŵĞŐĞǀĞ͘ĐŽŵ

LUX-RESIDENCE.COM

127


h94-113-128.qxd

30.7.2015

16:30

Page 128

ALPES

COMBLOUX

Vue panoramique

Rare, propriété située dans un environnement calme et champêtre, à environ 4 km de Megève et 1,5 km des remontées mécaniques, constituée de trois corps de bâtiments: une ferme datant de 1748 rénovée subtilement afin de lui conserver son authenticité, avec beaucoup de volume, trois chambres, mezzanine, partie à terminer, un grenier ancien transformé en chalet annexe avec salon cheminée, kitchenette, salle de bains et chambre mansardée, un bâtiment garage plus récent, accessible par un tunnel souterrain partant de la ferme, permettant de stationner quatre véhicules et complété par une vaste salle de jeux/sport en sous-sol. Surface: 370 m2. Classe Energie: D. Prix: EUR 1’800’000.-

Rare property situated in a peaceful and rural environment, approx. 4 km from Megève and 1,5 from the ski lifts, consisting of three main buildings: farmhouse dating from 1748, subtly renovated in order to preserve its authenticity, lots of space, three bedrooms, and a mezzanine area to be completed, former granary converted into an annexed chalet comprising a lounge with fireplace, kitchenette, bathroom and attic room, recent garage accessible from the farm via an underground tunnel, making it possible to park four vehicles and completed by an extensive playroom/gym basement. Surface: 370 m2. Energy rating: D. Price: EUR 1’800’000.-

Agence Boan-Panisset Rue Ambroise Martin 40 - F-74120 Megève Tél.: +33 (0)4 50 91 09 97 transactions@agenceboan.com - www.agenceboan.com

128

HELVETISSIMMO


h94-129-144.qxd

30.7.2015

16:13

Page 129

ALPES

MEGÈVE

Chalet contemporain

Chalet d'architecture contemporaine aux lignes pures, sa situation lui permet de bénéficier d'une vue panoramique et imprenable sur le village, le Mont-Blanc et les montagnes. Baigné de lumière grâce à de grandes baies vitrées et de nombreuses ouvertures, il distribue sur quatre niveaux reliés par un ascenseur: un séjour avec cheminée centrale, salon, bar, salle à manger, cuisine indépendante équipée et salon TV, le tout donnant sur des terrasses, six chambres avec douches ou bains et un garage pour sept voitures. Classe Energie: en cours.

Contemporary style chalet with clean lines, its location enables it to benefit from a panoramic and breath-taking view of the village, Mont Blanc and the mountains. Bathed in light thanks to large windows and numerous openings, on four floors with a lift: living room with central fireplace, lounge, bar, dining room, fitted kitchen and TV lounge, all leading onto terraces, six bedrooms with shower or bathrooms and a 7-car garage. Energy rating: In progress. Price on request

Prix sur demande

Agence Boan-Panisset Rue Ambroise Martin 40 - F-74120 Megève Tél.: +33 (0)4 50 91 09 97 transactions@agenceboan.com - www.agenceboan.com

LUX-RESIDENCE.COM

129


h94-129-144.qxd

30.7.2015

16:13

Page 130


h94-129-144.qxd

30.7.2015

16:13

Page 131

ÉTRANGER FR ANCE VOISINE • FR ANCE SUD-EST


h94-129-144.qxd

30.7.2015

16:13

Page 132

AUX PORTES D’ANNECY Propriété d’Exception Aux portes d’Annecy dans une commune des plus recherchées, sur la rive Est avec une vue imprenable sur le lac, somptueuse propriété avec piscine à débordement. Elle comprend 5 suites dont une master avec dressing, un vaste salon/séjour avec ĐŚĞŵŝŶĠĞ Ğƚ ƵŶĞ ĐƵŝƐŝŶĞ ŝŶĚĠƉĞŶĚĂŶƚĞ ĞŶƟğƌĞŵĞŶƚ ĠƋƵŝƉĠĞ͘ >͛ĞŶƐĞŵďůĞ ŽƵǀƌĞ ƐƵƌ ĚĞůĂƌŐĞƐƚĞƌƌĂƐƐĞƐĂǀĞĐƵŶĂĐĐğƐĂƵƉĂƟŽ͘^ĂůůĞĚĞƌĠĐĞƉƟŽŶĂǀĞĐďĂƌĚŽŶŶĂŶƚƐƵƌůĞ jardin. Terrain paysagé de 2 980 m2.

In the most sought municipality near Annecy, on the eastern bank of the lake with ƐƚƵŶŶŝŶŐůĂŬĞǀŝĞǁ͕ůƵdžƵƌŝŽƵƐƉƌŽƉĞƌƚLJǁŝƚŚŝŶĮŶŝƚLJƉŽŽů͘/ƚŚĂƐϱďĞĚƌŽŽŵƐŝŶĐůƵĚŝŶŐĂ ŵĂƐƚĞƌƐƵŝƚĞǁŝƚŚĚƌĞƐƐŝŶŐƌŽŽŵ͕ĂůĂƌŐĞůŝǀŝŶŐƌŽŽŵǁŝƚŚĮƌĞƉůĂĐĞ͕ĂŶĚĂŶŝŶĚĞƉĞŶĚĞŶƚ ĂŶĚĨƵůůLJĞƋƵŝƉƉĞĚŬŝƚĐŚĞŶ͘dŚĞŚŽƵƐĞŽƉĞŶƐŽŶƚŽůĂƌŐĞƚĞƌƌĂĐĞƐǁŝƚŚĂĐĐĞƐƐƚŽĂƉĂƟŽ͕ ƌĞĐĞƉƟŽŶƌŽŽŵǁŝƚŚĂďĂƌŽǀĞƌůŽŽŬŝŶŐƚŚĞŐĂƌĚĞŶ͘ϮϵϴϬƐƋ͘ŵƉůŽƚ͘

Prix sur demande / Price upon request WͬŶĞƌŐLJĐĞƌƟĮĐĂƟŽŶ͗ĞŶĐŽƵƌƐͬŝŶƉƌŽŐƌĞƐƐ



BARNES ANNECY 96 Route Edmond de Rothschild | F 74120 MEGEVE | +33 (0)4 50 21 21 00 ŵĞŐĞǀĞΛďĂƌŶĞƐͲŝŶƚĞƌŶĂƟŽŶĂů͘ĐŽŵ ǁǁǁ͘ďĂƌŶĞƐͲŵĞŐĞǀĞ͘ĐŽŵ

132

HELVETISSIMMO

ZĠĨ͘ϰϵϬ


h94-129-144.qxd

30.7.2015

16:13

Page 133

AU BORD DU LÉMAN Propriété d’Exception Construite sur un terrain de 3 200 m2, propriété contemporaine de grand standing d’environ 480 m2 ŽīƌĂŶƚ ƵŶĞ ǀƵĞ ƉĂŶŽƌĂŵŝƋƵĞ ƐƵƌ ůĞ ůĂĐ >ĠŵĂŶ͘ ƵŝƐŝŶĞ ĂǀĞĐ ĠƋƵŝƉĞŵĞŶƚƵůƚƌĂŵŽĚĞƌŶĞŽƵǀƌĂŶƚƐƵƌůĂƐĂůůĞăŵĂŶŐĞƌ͕ůĞƐĠũŽƵƌĂǀĞĐĐŚĞŵŝŶĠĞĞƚůĞ ƐĂůŽŶds͘YƵĂƚƌĞƐƵŝƚĞƐĞƚƵŶďƵƌĞĂƵ͘'ƌĂŶĚĞƐŽƵǀĞƌƚƵƌĞƐĚŽŶŶĂŶƚƐƵƌůĂƚĞƌƌĂƐƐĞĞƚůĂ ƉŝƐĐŝŶĞĞdžƚĠƌŝĞƵƌĞĐŚĂƵīĠĞ͘^ƉĂĞƚƐĂůůĞĚĞƐƉŽƌƚ͘

Set in 3200 m2 grounds, contemporary style luxury property of approx. 480 m2, enjoying panoramic views over Lake Geneva. Kitchen with state of the art equipment opening onto ƚŚĞĚŝŶŝŶŐƌŽŽŵ͕ůŝǀŝŶŐƌŽŽŵǁŝƚŚĮƌĞƉůĂĐĞĂŶĚdsůŽƵŶŐĞ͕ĨŽƵƌĞŶͲƐƵŝƚĞďĞĚƌŽŽŵƐĂŶĚĂ study. Large windows lead to the terrace and heated outdoor pool. Spa and gym.



Prix sur demande / Price upon request WͬŶĞƌŐLJĐĞƌƟĮĐĂƟŽŶ͗ĞŶĐŽƵƌƐͬŝŶƉƌŽŐƌĞƐƐ

Réf. 513

BARNES LÉMAN 96 Route Edmond de Rothschild | F 74120 MEGEVE | +33 (0)4 50 21 21 00 ŵĞŐĞǀĞΛďĂƌŶĞƐͲŝŶƚĞƌŶĂƟŽŶĂů͘ĐŽŵ ǁǁǁ͘ďĂƌŶĞƐͲŵĞŐĞǀĞ͘ĐŽŵ

LUX-RESIDENCE.COM

133


h94-129-144.qxd

30.7.2015

16:13

Page 134

LAC DU BOURGET – PROCHE AIX-LES-BAINS/CHAMBÉRY

FRANCE VOISINE

Authentique château restauré avec domaine

A 1 heure de Genève et à 25 minutes d'Aix les Bains, ce splendide château du XIXe siècle a été entièrement rénové avec de luxueuses prestations. Magnifique panorama lac et montagnes. 550 m2 habitables environ. Au calme, 7 chambres, multiples salons, sous-sol complet, vaste dépendances, piscine chauffée. Domaine d’1,2 hectare environ avec allée privée. Proche aéroport de Chambéry. Réf. N°2362. Prix: EUR 1'900'000.-

One hour from Geneva and 25 mins from Aix-les-Bains, this splendid 19th century castle has been entirely renovated with luxurious finishings. Stunning panorama upon lake and mountains. Approx 550 sq. m living space, quiet area, 7 bedrooms, multiple lounges, full basement, vast outbuildings, heated swimming pool. Approx 1,2 hectare domain with private alley. Close to Chambery’s airport. Ref. N°2362. Price: EUR 1'900'000.-

Stephan De Meyer Immobilier Rue Paul Guiton, 5 - F-74000 Annecy Tél.: +33 (0)4 50 230 230 contact@demeyer-immobilier.com - www.demeyer-immobilier.com

134

HELVETISSIMMO


h94-129-144.qxd

30.7.2015

16:13

Page 135

FRANCE VOISINE

35 MINUTES DE GENÈVE ET 15 MINUTES D’ANNECY

Propriété d’exception avec splendide parc

A 35 minutes de Genève et 15 minutes d’Annecy, cette propriété unique offre un havre de paix au milieu d’un environnement bucolique. Panorama à 360°. Surface habitables d’environ 250 m. Parc clos 12’000 m. environ. Jacuzzi. Piscine chauffée à débordement 25 mètres x 7 mètres. 4 chambres, 3 salles de bains. Véritable salle de cinéma. Salon de lecture. Prestations grand standing. Equipement high-tech. Allée privée. 3 garages. Héliport. Dépendance. Réf N°2621. Prix: EUR 2'500’000.-

35 minutes from Geneva and 15 mins from Annecy, this unique property offers a safe haven surrounded by greenery. Unobstructed panorama. Approx 250 sq. m living space. Approx 12000sqm closed park. Jacuzzi. Heated overflowing swimming pool 25x7 meters. 4 bedrooms, 3 bathrooms. Home-cinema. Reading lounge. High-end finishings. High-tech specs. Private alley. 3 garages. Heliport. Outbuilding. Ref N°2621. Price: EUR 2'500’000.-

Stephan De Meyer Immobilier Rue Paul Guiton, 5 - F-74000 Annecy Tél.: +33 (0)4 50 230 230 contact@demeyer-immobilier.com - www.demeyer-immobilier.com

LUX-RESIDENCE.COM

135


h94-129-144.qxd

30.7.2015

16:14

Page 136

ANNECY, SECTEUR SAINT MICHEL

FRANCE VOISINE

Magnifique maison bourgeoise

Edifiée en 1900, superbe maison bourgeoise de construction traditionnelle en très bon état sur deux niveaux: Rez-de-chaussée: cuisine, hall, salle à manger, bibliothèque, office de cuisine, toilettes, salon. A l'étage: quatre chambres, salle de bains, débarras, grenier au dessus dont une partie aménagée en deux chambres et salle d'eau. Au sous-sol: quatre caves. Annexe: garage pour trois voitures, remise et grenier au dessus non aménagé. Parcelle d'environ 2’397 m2 de terrain clos avec bâtiment à usage de remise dans le jardin. Classe énergie: E. Prix: EUR 1’560’000.-

Built in 1900, superb traditionally built 2-storey town house in very good condition: Ground floor: kitchen, hall, dining room, library, kitchen pantry, WC, living room. Upstairs: four bedrooms, bathroom, storage room, attic above with part converted into two bedrooms and shower room. Basement: four cellars. Annexe: three-car garage, shed and attic above for conversion. Set in a a plot of approx. 2’397 m2 of enclosed land with garden shed. Energy rating: E. Price: EUR 1’560’000.-

LAC D’ANNECY RIVE EST

Superbe villa d’architecte

Superbe villa d'architecte, contemporaine, aux beaux volumes. Surface d'environ 200 m2: Au rez-de-chaussée: entrée, chambre 1 avec placard et salle d'eau, chambre 2 avec placard et salle d'eau, toilettes avec lave-mains, buanderie, séjour et cuisine équipée. A l'étage: mezzanine, bureau, chambre 3 avec dressing et accès douche, chambre 4 avec dressing, salle de bains et douche, wc, terrasse. Annexes: Garage double attenant à la maison. Piscine 10 m x 4 m - pool house. Terrain: 2’500 m2. Classe énergie: C. Prix: EUR 1’690’000.-

VALLAT Premium Rue Sommeiller 49 - F-74000 Annecy Tél.: +33 (0)4 50 66 82 00 premium@vallat.fr - www.vallat-premium.com

136

HELVETISSIMMO

Superb contemporary style architect designed villa with spacious interiors. Surface area of 200 m2: Ground floor: entrance hall, bedroom 1 with closet and shower room, bedroom 2 with closet and shower room, toilet with WHB, utility room, living room and fitted kitchen. Upstairs: mezzanine, study, bedroom 3 with dressing room and shower access, bedroom 4 with dressing room, bathroom and shower, toilet and terrace. Annexes: 2-car garage adjoining the house. 10x4 m pool - pool house. Plot: 2’500 m2. Price: EUR 1’690’000.-


h94-129-144.qxd

30.7.2015

16:14

Page 137

STÉPHANE PAILLARD ŒNOLOGUE

Piémont méditerranéen

“ Le Cloître des Rois de Majorque ”

L

e Spécialiste de la « Résidence du Vin » depuis 1991, en toute confidentialité. Bastide XVIIIe de grand caractère d’inspiration romantique à restaurer en position dominante au coeur d’un territoire vallonné d’un seul tenant sur plus de 200 ha - Haut lieu historique - Sources - Bassins - Platanes centenaires - Dépendances - Chasse privée - Vignoble AOP et sa cave - Affaire rare Dossier sur demande. Réf. : 03217.

The "Wine Residence" specialist since 1991, in complete confidentiality. Bastide Dating from the 18th C, of a highly romantic character, suitable for restoration, in an elevated setting in the heart of a gently rolling area of over 200ha in one piece – A prestigious historic site - Springs - Ponds - Centenarian plane trees - Outbuildings - Private hunting grounds - AOP vineyard and its cellar - A rare opportunity - Details on request . Ref.: 03217.

EXPERTISE ET NÉGOCIATION DE PROPRIÉTÉS VITICOLES Bordeaux - Bourgogne - Provence - Champagne - Val de Loire - Beaujolais - Cognac - Méditerranée Internet : www.bureauviticole.com - E-mail : bv@bureauviticole.fr - Tél.: 33 (0)4 90 92 48 74 LUX-RESIDENCE.COM

137


h94-129-144.qxd

30.7.2015

16:14

Page 138

FRANCE SUD-EST

AIX-EN-PROVENCE

Propriété d’exception

A 5 mn du centre ville, 1’000 m2 de bâti pour cette propriété équestre d'exception comprenant une ferme en pierres du XVIIIe de 700 m2 environ entièrement restaurée avec beaucoup de goût et de raffinement, un bâtiment annexe, des écuries (18 boxes), un marcheur, un centre de soin hydrothérapie, une carrière et une piste de galop sur 8 ha 3 paddocks et dépendances. Possibilité 7 ha supplémentaires. Une piscine chauffée 5x17 et son pool house de 241 m2. Une orangerie. La magnifique restauration du bâti ancien, la qualité des installations équestres et sa situation géographique à 15 mn du TGV font de cette propriété un bien exceptionnel et unique qui saura séduire un amateur éclairé.

Exceptional 1’000 m2 equestrian property composed of a fully restored 18th C. stone farmhouse of approx. 700 m2, an outbuilding, stables (18 stalls) a walker, hydrotherapy treatment centre, training arena and a gallop track on 8 ha 3 of paddocks and outbuildings. 7 hectares additional option. 5x17 heated pool and 241 m2 pool house. An orangery. The quality of the restoration of the old buildings and its equestrian facilities as well as its location only 15 min from the TGV station make it an exceptional and unique property that will appeal to connoisseurs. Price on request

Prix sur demande

L’immobilier de caractère Les Hauts de Maruège - 200 Ancienne Route des Alpes - F-13100 Aix-en-Provence Tél.: +33 (0)6 62 15 06 41 danielle@coteaix.com - www.cote-aix.com

138

HELVETISSIMMO


h94-129-144.qxd

30.7.2015

16:14

Page 139

FRANCE SUD-EST

AIX EN PROVENCE

Propriété exceptionnelle

Bastide Aixoise de 750 m2 et maison de gardien. Sur un parc de 7 hectares. A 10 minutes du centre-ville. Cette propriété de prestige offre un cadre de vie exceptionnel à 10 mn à peine du centre historique et du Cours Mirabeau, au cœur d’un magnifique parc de 7 ha avec oliveraie, tennis éclairé et somptueuse piscine de 22 m. Au RdC: superbes pièces de réception ouvrant sur une magnifique terrasse et le parc 2 très belles suites, cuisine et office. A l’étage: 2 suites 7 chs 4 sdb 1 lingerie. A seulement 15 mn de la gare TGV et de l’aéroport de Marseille. Ce véritable havre de paix saura séduire des amateurs éclairés et exigeants.

Country House 750 m2 and caretaker's house. On a 7-hectare park. 10 minutes from the town center. This prestigious property offers an exceptional setting 10 minutes from the historic centre of Aix en Provence and the Cours Mirabeau in the heart of a magnificent park with olive grove, tennis court and pool. For the “Bastide”: magnificent reception rooms, 4 suites, 7 bedrooms, 4 bathrooms, kitchen, pantry, wine cellar, and laundry. The caretaker’s house includes 3 bedrooms. Only 15 minutes from the TGV station and Marseille airport. This haven of peace will seduce the true connoisseurs. Price on request

Prix sur demande

L’immobilier de caractère Les Hauts de Maruège - 200 Ancienne Route des Alpes - F-13100 Aix-en-Provence Tél.: +33 (0)6 62 15 06 41 danielle@coteaix.com - www.cote-aix.com

LUX-RESIDENCE.COM

139


h94-129-144.qxd

30.7.2015

16:14

Page 140

20 min from Nice Airport Ref. MZICA2423

CANNES - FRENCH RIVIERA

MICHAËL ZINGRAF REAL ESTATE 34 LA CROISETTE - 06400 CANNES

Tel. +33 (0)4 93 39 29 29 - niki@michaelzingraf.com www.michaelzingraf.com CANNES MOUGINS OPIO SAINT-PAUL DE VENCE SAINT-JEAN CAP FERRAT CAP D’ANTIBES SAINT-TROPEZ GORDES LOURMARIN SAINT-REMY DE PROVENCE

140

HELVETISSIMMO


h94-129-144.qxd

30.7.2015

16:14

Page 141

LES PLUS BEAUX HÔTELS DE SUISSE DIE SCHÖNSTEN HOTELS DER SCHWEIZ SWITZERLAND’S MOST BEAUTIFUL HOTELS BÂLE

BERNE

SWISSÔTEL LE PLAZA BASEL ***** Messeplatz 25 - 4021 Basel Tel.: +41 (0)61 690 33 33 Fax: +41 (0)61 690 39 70 emailus.basel@swissotel.com www.swissotel.com

HOTEL HILTON BASEL * * * * * Aeschengraben 31 - 4001 Basel Tel.: +41 (0)61 275 66 00 Fax: +41 (0)61 275 66 50 basel@hilton.ch www.hilton.ch

LENKERHOF ALPINE RESORT ***** Postfach 241 - 3775 Lenk im Simmental Tel.: +41 (0)33 736 36 36 Fax: +41 (0)33 736 36 37 welcome@lenkerhof.ch

VICTORIA-JUNGFRAU GRAND HOTEL & SPA * * * * * Höheweg 41 - 3800 Interlaken Tel.: +41 (0)33 828 28 28 Fax: +41 (0)33 828 28 80 Interlaken@victoria-jungfrau.ch www.victoria-jungfrau.ch

GRAND HOTEL BELLEVUE * * * * * Haupstrasse - 3780 Gstaad Tel.: +41 (0)33 748 00 00 Fax: +41 (0)33 748 00 01 info@bellevue-gstaad.ch www.bellevue-gstaad.ch

LINDNER GRAND HOTEL BEAU RIVAGE * * * * * Höheweg 211 - 3800 Interlaken Tel.: +41 (0)33 826 70 07 Fax: +41 (0)33 826 70 08 beaurivage@email.ch www.linderhotels.ch

GRAND HOTEL PARK * * * * * Wispilestrasse - 3780 Gstaad Tel.: +41 (0)33 748 98 00 Fax: +41 (0)33 748 98 08 info@grandhotelpark.ch www.linderhotels.ch

WELLNESS & SPA HÔTEL ERMITAGE-GOLF * * * * * 3778 Gstaad-Schönried Tel.: +41 (0)33 748 60 60 ermitagegolf@gstaad.ch

PALACE HOTEL GSTAAD * * * * * 3780 Gstaad Tel.: +41 (0)33 748 50 00 Fax: +41 (0)33 748 50 01 info@palace.ch www.palace.ch

ROYAL PARK HOTEL * * * * * B. RIKLI 3718 Kandersteg Tel.: +41 (0)33 675 88 88 Fax: +41 (0)33 675 88 80 royal@rikli.com www.royalkandersteg.com

STARLING GENEVA HOTEL * * * * Route François-Peyrot 34 1218 Le Grand-Saconnex Tel.: +41 (0)22 747 02 02 contact@shgeneva.ch www.shgeneva.ch

HOTEL DE LA PAIX * * * * * Quai du Mont-Blanc 11 1211 Genève 1 Tél.: +41 (0)22 909 60 00 Fax: +41 (0)22 909 60 01 www.hoteldelapaix.ch

HOTEL DES BERGUES * * * * * Quai des Bergues 33 - 1201 Genève Tél.: +41 (0)22 908 70 00 Fax: +41 (0)22 908 70 90 info@hoteldesbergues.com www.hoteldesbergues.com

MANDARIN ORIENTAL HOTEL DU RHÔNE * * * * * Quai Turrettini - 1201 Genève Tel.: +41 (0)22 909 00 00 Fax: +41 (0)22 909 00 10 mogva-reservations@mohg.com www.mandarinoriental.com

HOTEL BRISTOL * * * * Rue du Mont-Blanc 10 - 1201 Genève Tel.: +41 (0)22 716 57 00 Fax: +41 (0)22 716 57 70 bristol@bristol.ch www.bristol.ch

RICHEMOND GENÈVE * * * * * Jardin Brunswick - 1201 Genève Tel.: +41 (0)22 715 70 00 Fax: +41 (0)22 715 70 01 reservation@richemond.ch www.richemond.ch

HOTEL LES ARMURES * * * * * Rue Puits-Saint-Pierre 1 - 1204 Genève Tel.: +41 (0)22 310 91 72 Fax: +41 (0)22 310 98 46 armures@span.ch www.hotel-les-armures.ch

SWISSÔTEL GENÈVE MÉTROPOLE * * * * * Quai Guisan 34 - 1204 Genève Tel.: +41 (0)22 318 32 00 Fax: +41 (0)22 318 33 00 emailus.geneva@swissotel.com www.swissotel-geneva.com

MÖVENPICK HÔTEL GENEVA * * * * * Rte de Pré-Bois 20 - 1215 Genève 15 Tel.: +41 (0)22 717 16 11 Fax: +41 (0)22 791 02 84 hotel.geneva@moevenpick.com www.movenpick.com

INTERCONTINENTAL GENÈVE HOTEL & SPA * * * * * Chemin du Petit-Saconnex 7-9 1211 Genève 19 Tel.: +41 (0)22 919 39 39 Fax: +41 (0)22 919 38 38 geneva@interconti.com www.intercontinental.com/geneva

GENÈVE

LUX-RESIDENCE.COM

141


h94-129-144.qxd

30.7.2015

16:14

Page 142

HÔTELS GRISONS

HOTEL PRESIDENT WILSON * * * * * Quai Wilson 47 - 1201 Genève Tel.: +41 (0)22 906 66 66 Fax: +41 (0)22 906 66 67 resa@hotelpwilson.com www.hotelpwilson.com

BEAU-RIVAGE * * * * * Quai du Mont-Blanc 13 - 1201 Genève Tel.: +41 (0)22 716 66 66 Fax: +41 (0)22 716 60 60 info@beau-rivage.ch www.beau-rivage.ch

KULM HOTEL ST. MORITZ * * * * * 7500 St. Moritz Tel.: +41 (0)81 836 80 00 Fax: +41 (0)81 836 80 01 info@kulmhotel-stmoritz.ch www.kulmhotel-stmoritz.ch

KEMPINSKI GRAND HÔTEL DES BAINS * * * * * Via Mezdi 27 - 7500 St. Moritz Tel.: +41 (0)81 838 38 38 Fax: +41 (0)81 838 30 00

HÔTEL WALDHAUS * * * * * 7514 Sils-Maria Tel.: +41 (0)81 838 51 00 Fax: +41 (0)81 838 51 98 mail@waldhaus-sils.ch www.waldhaus-sils.ch

ANGLETERRE * * * * * Quai du Mont-Blanc 17 - 1201 Genève Tel.: +41 (0)22 906 55 55 Fax: +41 (0)22 906 55 56 angleterre@rchmail.com www.hoteldangleterre.ch

LA RÉSERVE GENÈVE HOTEL & SPA * * * * * Route de Lausanne 301 1293 Genève-Bellevue Tel.: +41 (0)22 959 59 59 Fax: +41 (0)22 959 59 60 reservation@lareserve.ch www.lareserve.ch

BADRUTT’S PALACE * * * * * Via Serlas 27 - 7500 St. Moritz Tel.: +41 (0)81 837 10 00 Fax: +41 (0)81 837 29 99 Réservations: +41 (0)81 837 11 00 reservations.palace@rosewoodhotels.com www.badruttspalace.com

PARK HOTEL WALDHAUS * * * * * Via dil Parc 3 - 7018 Flims Waldhaus Tel.: +41 (0)81 928 48 48 Fax: +41 (0)81 928 48 58 info@parkhotel-waldhaus.ch reservations.grandhoteldesbains@kempinski.com www.parkhotel-waldhaus.ch www.kempinski-stmoritz.com

AROSA KULM & ALPIN SPA * * * * * 7050 Arosa Tel.: +41 (0)81 378 88 88 Fax: +41 (0)81 378 88 89 info@arosakulm.ch www.arosakulm.ch

GRAND HOTEL KRONENHOF * * * * * Via Maistra - 7504 Pontresina Tel.: +41 (0)81 830 30 30 Fax: +41 (0)81 830 30 31 info@kronenhof.com www.kronenhof.com

TSCHUGGEN GRAND HOTEL * * * * * Sonnenbergstrasse - 7050 Arosa Tel.: +41 (0)81 378 99 99 Fax: +41 (0)81 378 99 90 reservations@tschuggen.ch www.tschuggen.ch

SUVRETTA HOUSE * * * * * Via Chasellas 1 - 7500 St. Moritz Tel.: +41 (0)81 836 36 36 Fax: +41 (0)81 836 37 37 info@suvrettahouse.ch www.suvrettahouse.ch

FLÜELA HOTEL * * * * * Bahnhofstrasse 5 - 7260 Davos Dorf Tel.: +41 (0)81 410 17 17 Fax: +41 (0)81 410 17 18 hotel@fluela.ch www.fluela.ch

STEIGENBERGER BELVÉDÈRE ***** Promenade 89 - 7270 Davos-Platz Tel.: +41 (0)81 415 60 00 Fax: +41 (0)81 415 60 01 davos@steigenberger.ch www.davos.steigenberger.ch

PARK HOTEL VITZNAU * * * * * 6354 Vitznau/Luzern Tel.: +41 (0)41 399 60 60 Fax: +41 (0)41 399 60 70 info@parkhotel-vitznau.ch www.parkhotel-vitznau.ch

PALACE LUZERN * * * * * Haldenstrasse 10 - 6002 Luzern Tel.: +41 (0)41 416 16 16 Fax: +41 (0)41 416 10 01 info@palace-luzern.ch www.palace-luzern.ch

PARK HOTEL WEGGIS * * * * * Hertensteinstrasse 34 - 6353 Weggis Tel.: +41 (0)41 392 05 05 Fax: +41 (0)41 392 05 28 info@phw.ch www.phw.ch

GRAND HOTEL NATIONAL THP LTD. * * * * * Haldenstrasse 4 - 6006 Luzern Tel.: +41 (0)41 419 09 09 Fax: +41 (0)41 419 09 10 info@national-luzern.ch www.national-luzern.ch

SCHWEIZERHOF LUZERN * * * * * Schweizerhofquai 3a - 6004 Luzern Tel.: +41 (0)41 410 04 10 Fax: +41 (0)41 410 29 71 info@schweizerhof-luzern.ch www.schweizerhof-luzern.ch

NEUCHÂTEL

SAINT GALL

GRAND HOTEL EDEN * * * * * Riva Paradiso 1 - 6900 Lugano-Paradiso Tel.: +41 (0)91 985 92 00 Fax: +41 (0)91 985 92 50 welcome@edenlugano.ch www.edenlugano.ch

GRAND HOTEL VILLA CASTAGNOLA * * * * * Viale Castagnola 31 - 6906 Lugano Tel.: +41 (0)91 973 25 55 Fax: +41 (0)91 973 25 50 info@villacastagnola.com www.villacastagnola.com

LUCERNE

HOTEL PALAFITTE * * * * * Route des Gouttes d’Or 2 2000 Neuchâtel Tel.: +41 (0)32 723 02 02 Fax: +41 (0)32 723 02 03 reservation@palafitte.ch www.palafitte.ch

142

HELVETISSIMMO

GRAND HOTEL QUELLENHOF ***** 7310 Bad Ragaz Tel.: +41 (0)81 303 30 30 Fax: +41 (0)81 303 30 33 reservation@resortragaz.ch www.resortragaz.ch

TESSIN

PARKHOTEL DELTA * * * * * Via Delta 137-141 - 6612 Ascona Tel.: +41 (0)91 785 77 85 Fax: +41 (0)91 785 77 35 info@parkhoteldelta.ch www.parkhoteldelta.ch


h94-129-144.qxd

30.7.2015

16:14

VILLA PRINCIPE LEOPOLDO & RESIDENCE * * * * * Via Montalbano 5 - 6900 Lugano Tel.: +41 (0)91 985 88 55 Fax: +41 (0)91 985 88 25 info@leopoldohotel.com www.leopoldohotel.com

Page 143

CASTELLO DEL SOLE * * * * * Via Muraccio 142 - 6612 Ascona Tel.: +41 (0)91 791 02 02 Fax: +41 (0)91 792 11 18 info@castellodelsole.ch www.castellodelsole.com

EDEN ROC * * * * * Via Albarelle 16 - 6612 Ascona Tel.: +41 (0)91 785 71 71 Fax: +41 (0)91 785 71 43 info@edenroc.ch www.edenroc.ch

SWISS DIAMOND HOTEL OLIVELLA * * * * * Via Cantonale 18 - 6921 Vico Morcote Tel.: +41 (0)91 735 00 00 Fax: +41 (0)91 735 00 99 info@swissdiamondhotel.com www.swissdiamondhotel.com

HOTEL SPLENDIDE ROYAL * * * * * Riva Caccia 7 - 6900 Lugano Tel.: +41 (0)91 985 77 11 Fax: +41 (0)91 985 77 22 info@splendide.ch www.splendide.ch

CHALET D'ADRIEN * * * * * Chemin des Creux - 1936 Verbier Tel.: +41 (0)27 771 62 00 Fax: +41 (0)27 771 62 24 info@chalet-adrien.com www.chalet-adrien.com

FERIENART RESORT & SPA * * * * * 3906 Saas Fee Tel.: +41 (0)27 958 19 00 Fax: +41 (0)27 958 19 05 info@ferienart.ch www.ferienart.ch

HOTEL DU GOLF * * * ** 1884 Villars Tel.: +41 (0)24 496 38 38 Fax: +41 (0)24 495 39 78 info@hotel-golf.ch www.hotel-golf.ch

RIFFELALP RESORT * * * * * 3920 Zermatt Tel.: +41 (0)27 966 05 55 Fax: +41 (0)27 966 05 50 reservation@riffelalp.com www.zermatt.ch/riffelalp

LE MIRADOR RESORT & SPA * * * * * 1801 Mont-Pelerin Tel.: +41 (0)21 925 11 11 Fax: +41 (0)21 925 11 12 mirador@attglobal.net www.mirador.ch

HÔTEL ROYAL PLAZA * * * * * Grand Rue 97 - 1820 Montreux Tel.: +41 (0)21 962 50 50 Fax: +41 (0)21 962 51 51 info@royalplaza.ch www.royalplaza.ch

LAUSANNE PALACE & SPA * * * * * Grand-Chêne 7-9 - 1002 Lausanne Tel.: +41 (0)21 331 31 31 Fax: +41 (0)21 323 25 71 reservations@lausanne-palace.ch www.lausanne-palace.com

PARK HYATT * * * * * Beethoven Strasse 21 - 8002 Zürich Tel: +41 (0)43 883 12 34 Fax: +41 (0)43 883 12 35 zurich.park@hyattintl.com www.zurich.park.hyatt.com

WIDDER HOTEL * * * * * Rennweg 7 - 8001 Zürich Tel.: +41 (0)44 224 25 26 Fax: +41 (0)44 224 28 24 management@widderhotel.ch www.widderhotel.ch

VALAIS

SEILER HOTEL MONT CERVIN ***** 3920 Zermatt Tel.: +41 (0)27 966 88 88 Fax: +41 (0)27 967 28 78 montcervin@zermatt.ch www.zermatt.ch/montcervin

VAUD

GRAND HOTEL ZERMATTERHOF * * * * * Bahnhofstrasse 55 - 3920 Zermatt Tel.: +41 (0)27 966 66 00 Fax: +41 (0)27 966 66 99 zermatterhof@zermatt.ch www.zermatt.ch/zermatterhof

CRANS AMBASSADOR * * * * * 3, Rte du Petit-Signal 3963 Crans-Montana Tel.: +41 (0)27 485 48 48 Fax: +41 (0)27 485 48 49 info@cransambassador.ch www.cransambassador.ch

ZURICH

BEAU-RIVAGE PALACE * * * * * Place du Port 17-19 - 1006 Lausanne Tel.: +41 (0)21 613 33 33 Fax: +41 (0)21 613 33 34 info@brp.ch www.brp.ch

SAVOY HOTEL BAUR EN VILLE ***** Am Paradeplatz - 8022 Zürich Tel.: +41 (0)44 215 25 25 Fax: +41 (0)44 215 25 00 welcome@savoy-zurich.ch www.savoy-zurich.com

MARRIOTT HOTEL * * * * * Neumühlequai 42 - 8001 Zürich Tel: +41 (0)44 360 70 70 Fax: +41 (0)44 360 77 77 marriott.zurich@marriotthotels.com www.marriotthotels.com

HOTEL BAUR AU LAC * * * * * Talstrasse 1 - 8022 Zürich Tel.: +41 (0)44 220 50 20 Fax: +41 (0)44 220 50 44 info@bauraulac.ch www.bauraulac.ch

HILTON ZURICH AIRPORT HOTEL * * * * * Hohenbühlstrasse 10 - Opfikon-Glattbrugg 8152 Zürich-Glattbrugg Tel.: +41 (0)44 828 50 50 Fax: +41 (0)44 828 51 51 zurich@hilton.com www.hilton.de/zuerich

THE DOLDER GRAND * * * * * Kurhausstrasse 65 - 8032 Zürich Tel.: +41 (0)44 456 60 00 Fax: +41 (0)44 456 60 01 info@thedoldergrand.com www.doldergrand.ch

LUX-RESIDENCE.COM

143


Projet1

29.7.2015

16:13

Page 3

Accès direct à notre magazine exclusif.

VENTE IMMEUBLE, VILLA, APPARTEMENT, TERRAIN

www.brolliet.ch

PRESTIGE | GÉRANCE | COPROPRIÉTÉS | VENTES IMMEUBLES | IMMOBILIER COMMERCIAL | PROMOTION IMMOBILIÈRE | VENTES & LOCATIONS RÉSIDENTIELLES


Page 1

94

L’ I M M O B I L I E R D E P R E S T I G E S U I S S E

AO Û T- S E P T E M B R E 2 015 - C H F 15 . -

16:12

SCHWEIZER LUXUS IMMOBILIEN

IMMOBILIER VAUD FORCE D’ATTRACTION WAADT - STARKE ANZIEHUNGSKRAFT

SCHWEIZER LUXUS IMMOBILIEN

29.7.2015

L’ I M M O B I L I E R D E P R E S T I G E S U I S S E

Projet1

DÉCORATION SALLES DE BAINS - SPAS N°94 - CHF 15.-

BADEZIMMER - SPAS


h94-129-144.qxd

30.7.2015

16:14

Page 144

INDEX

M O N TA G N E / B E R G

SUISSE / SCHWEIZ FRIBOURG / FREIBURG

60 61

Barnes Suisse Bory & Cie Brolliet SA Grange & Cie SA Le Pilier de l’Immobilier Moser Vernet & Cie Naef Prestige Knight Frank Rosset Immobilier SPG Finest Properties Union Suisse des Grands Domaines

65-67 69-71 62-63 72-75 64 76-77 78-79 68 84 80-83

NEUCHÂTEL / NEUENBURG

Naef Prestige Knight Frank Thorens – Les Métiers de l’Immobilier

85 86-87

NIDELWALD / NIDWALDEN

F&R - Finance Real Estate

88

Re/max Immobrokers

89

GENÈVE / GENF

THURGOVIE / THURGAU

TESSIN / TICINO

Bea Huwiler Promotion Engel & Völkers Ascona Immobiliare Fideconto SA Interfida SA Poroli Real Estate

VALAIS / WALLIS

C2C - Fimmob

VAUD / WAADT

ZURICH / ZÜRICH

144

CF Immobilier Compagnie Foncière SA Leduc SA

HELVETISSIMMO

Ax Properties Barnes Suisse Baour Immobilier Bernard Nicod Morges CGS Global Immobilier SA Galland & Cie Grohe Immobilier SA Immolac Invest Immo-Vie Agée Sàrl Jean Wicky Management SA Naef Prestige Knight Frank Nicole F. Michel Poli Real Estate SA Quintessentially Estates SPG Finest Properties Savinter SA Dreistein Ag Elliscasis Immobilien GmbH Landhaus-Bau Ag SIV Suter Immobilien und Verwaltungen

Barnes Megève Boan Immobilier Knight Frank CF Immobilier Compagnie Foncière SA

125-127 128-129 124

ETRANGER / AUSLAND FRANCE VOISINE / FRANKREICH Barnes Megève Stephan De Meyer Immobilier Vallat Premium FRANCE SUD-EST / SUDÖSTFRANKREICH Bureau Viticole Côté Aix-en-Provence Michaël Zingraf Real Estate

132-133 134-135 136 137 138-139 140

90-91 92 93 94 95 96 97 99-101 98 102 104 116 103 105 108 106-107 109 112-113 110-111 114 115 117 119 118 121 120

RETROUVEZ PLUS D’ANNONCES SUR :


Helvetissimmo H94 (Août-Septembre 2015)