Issuu on Google+

/#4¬

+($57/ !¬7AY¬OF¬,IFE $1'

#/6%2È34/29

SEBRING CENTENNIAL: !È',!.#%È).4/È4(%È(%!24,!.$È#)493È()34/29


È

/CTOBERÈÈ

Heartland InTheFieldMagazine




Well Rounded Nutrition Comes in a Block 20% Protein Plus Mag Bio-Mos® Fortified with all natural sources of protein, extra magnesium and other essential minerals and vitamins. This convenient, 33.3-lb pressed block requires no bunks or feeders and contains the ingredient, Bio-Mos® to help maintain gut health and stability. With no additional sources of salt or minerals required, it’s just that easy to make a well rounded investment in your operation.

Available at: Central States Enterprises. LLC 668 NW Waldo Street, Lake City, FL 32055 800-275-4429 l www.csefeeds.com

Heartland InTheFieldMagazine

Performs. Promise.

BioMos® is a registered trademark of Alltech

È/CTOBERÈ


È

/CTOBERÈÈ

Heartland InTheFieldMagazine




/#4¬







+($57/ !¬7AY¬OF¬,IFE $1' ¬

(UNTING¬3POTLIGHT¬!SHLEY¬3HAW

¬ 

(EARTLANDS¬&ISHING¬2EPORT %\&DSW0DUN.LQJ

¬ 

#ITRUS¬5PDATE¬-ECHANICAL¬(ARVESTING %\-XVWLQ6PLWK

¬ 

'OING¬'REEN¬#ALLAWAY¬&ARMS¬'REEN¬3HAVINGS %\5XVW\+DUWOLQH

¬ 

&LORIDA¬&ARMING¬2OAD¬4RIP %\5RQ/DPEHUW

¬ 

5TILIZATION¬OF¬#ULL¬6EGETABLES¬AS¬&EEDSTUFFS¬FOR¬#ATTLE %\&RXUWQH\'DYLV/LQGVH\:LJJLQVDQG0DWW+HUVRP

¬

&EATURED¬!RTIST¬*AMES¬2¬(AHN

¬¬ 7OMAN¬)N¬!G¬'ENIE¬4ILLMAN  %\5REEL6XPQHU ¬¬ $INING¬)N¬THE¬(EARTLAND¬¬(ENDRY¬#OUNTY¬#ATTLEMENS¬ !SSOCIATION  ³7KH*UHDWHVW&KHIVRIWKH6RXWK´%\/LQGVH\:LJJLQV ¬¬ &LORIDA¬#ATTLEWOMEN¬2ECIPE¬¬4ENDERLOIN¬AND¬'ARLIC¬2OASTED¬ 6EGETABLES ¬¬ &&6!S¬)N¬3EASON¬.OW¬&LORIDA¬3QUASH ¬¬ 2USS¬,EONARDS¬(ANDCRAFTED¬.OVELTY¬4RUCKS  %\%ULDQ1RUULV ¬¬ #REEL¬4RACTOR  %\&LQG\&XWULJKW ¬¬ ,ABOR¬$AY¬2ANCH¬2ODEO  %\5REELH6XPQHU

 

¬¬ #ATTLE¬3ENSE  %\'U&DWK\%DQG\N4XDOLW\/LTXLG)HHGV ¬¬ /KEECHOBEE¬"RAHMAN¬3R¬&&!  %\5REEL6XPQHU ¬¬ !G¬#ALENDAR

 /.¬4(%¬#/6%2

¬ 6(%5,1*&(17(11,$/$*ODQFHLQWRWKH+HDUWODQG&LW\¶V+LVWRU\ %\0RUJDQ7D\ORU1RUULVDQG/LQGVH\6HEULQJ

È

Heartland InTheFieldMagazine

È/CTOBERÈ


È

/CTOBERÈÈ

Heartland InTheFieldMagazine




+($57/$1' !ÂŹ7AYÂŹOFÂŹ,IFEÂŹ

0HONEÂŹ ÂŹ  &AXÂŹ ÂŹ  0UBLISHER 2HONDAÂŹ'LISSON 2HONDA HEARTLANDITFCOM +ARENÂŹ"ERRY KDBERRY INTHElELDMAGAZINECOM %XECUTIVEÂŹ%DITOR -ORGANÂŹ4AYLORÂŹ.ORRIS -ORGAN HEARTLANDITFCOM "USINESSÂŹ-ANAGER ,IZZETTEÂŹ3ARRIA !RTÂŹ$IRECTORS #ARRIEÂŹ%VANS /LIVIAÂŹ"ONE -ARKETINGÂŹ#ONSULTANT +ATHRYNÂŹ'LADWELL 3TAFFÂŹ7RITERS 2ONÂŹ,AMBERT -ORGANÂŹ4AYLORÂŹ.ORRIS *USTINÂŹ3MITH 2OBBIÂŹ3UMNER #ONTRIBUTINGÂŹ7RITERS #HASSÂŹ"RONSON 2USSELLÂŹ(ANCOCK "RENDAÂŹ6ALENTINE ,INDSEYÂŹ7IGGINS 2USTYÂŹ(ARTLINEÂŹ "RIANÂŹ.ORRIS ,INDSEYÂŹ3EBRING 0HOTOGRAPHY +ELLEYÂŹ"AKERÂŹÂŹ *IMÂŹ$AVISÂŹ0HOTOGRAPHY 3HARONÂŹ'LISSON 2USSELLÂŹ(ANCOCK -ORGANÂŹ4AYLORÂŹ.ORRIS ,AURENÂŹ4AYLOR

%DITORS.OTE 2FWREHULVDVSHFLDOPRQWKIRUDVPDOOWRZQLQWKH+HDUWODQGLWœV6HEULQJœVWK %LUWKGD\7KHUHZLOOEHDQHQWLUHZHHNRI&HQWHQQLDO&HOHEUDWLRQVIURPDEHGUDFHWR DSDUDGHDQGWKH0D\RUœV6WUHHW'DQFH%HLQJDWKLUGJHQHUDWLRQ6HEULQJUHVLGHQW, DPSUHWW\H[FLWHGDERXWFHOHEUDWLQJWKLVPLOHVWRQHZLWKP\KRPHWRZQ,KDYHPDQ\ ZRQGHUIXOPHPRULHVRI&KULVWPDVOLJKWVRQWKH&LUFOHHDWLQJDWWKH&DWKRXVHZLWKP\ JUDQGIDWKHUDQGZHHYHQWRRNZHGGLQJSLFWXUHVGRZQWRZQ 2QDKD\ULGHZLWKWKH ZHGGLQJSDUW\RIFRXUVH 6HEULQJZLOODOZD\VEHKRPH *HRUJH(6HEULQJSODQWHGVRPHRIWKHDJULFXOWXUDOURRWVWKDWZHZULWHDERXWLQWKHSDJHV RI+HDUWODQG,QWKH)LHOGHYHU\PRQWKZKHQKHEXLOWWKHWRZQLQ<RXFDQWDNH DEULHIJODQFHLQWRWKLV+HDUWODQGFLW\œVKLVWRU\RQSDJHDQGEHVXUHWRQRWHDOOWKH KDSSHQLQJVIRUWKH&HQWHQQLDO&HOHEUDWLRQRQ7KHFHOHEUDWLRQVEHJLQ2FWREHU $ORQJZLWKWKH&HQWHQQLDO&HOHEUDWLRQWKHUHZLOOEHDQHZPXUDODGGHGWRGRZQWRZQ 6HEULQJ-DPHV5+DKQLVRXUIHDWXUHGDUWLVWWKLVPRQWKDQGWKHPXUDOLVWWKDWZLOOVKDUH KLVSDVVLRQIRUDUWDQGKLVLQFUHGLEOHWDOHQWZLWKWKH&LW\RI6HEULQJDQGWKH+HDUWODQG 7KHPXUDOIRFXVLQJRQVHYHUDOYLJQHWWHVUHSUHVHQWLQJWKHWRZQZLOOEHRQWKHFRUQHU RI0DJQROLD$YHQXHDQG6RXWK5LGJHZRRG'ULYH+HZLOOEHGRLQJVRPHOLYHSDLQWLQJ GXULQJWKHFHOHEUDWLRQZHHNVREHVXUHWRVWRSE\ 7KLVPRQWKZHDUHVSRWOLJKWLQJDFRPSDQ\ZLWKDJUHDWEHGGLQJSURGXFWIRUDOORXUUHDGHUV ZLWKKRUVHV&DOODZD\)DUPVLVJRLQJJUHHQZLWK*UHHQ6KDYLQJV7KHVHVKDYLQJVDUH JUHDWIRUKRUVHKHDOWKDQGPRUH5HDGWKHLUVWRU\RQSDJH 7KH$J&DOHQGDUIRU2FWREHULVSDFNHGIXOORI)DOO)HVWLYDOVSXPSNLQSDWFKHVDQGH[FLWLQJ KDSSHQLQJVLQWKH+HDUWODQG2QHVSHFLDOHYHQWLVWKH¿UVWHYHU+HDUWODQG0D]HDKXJH FRUQPD]HORFDWHGLQ%RZOLQJ*UHHQ7KLVHYHQWLVGHHPHG³$JULWDLQPHQW´DQG,FDQœW ZDLWWRJRWKURXJKP\¿UVW0D]HH[SHULHQFH0D\EH,œOOVHH\RXWKHUH" /LNHXVRQ)DFHERRNDQG\RXFDQVHHHYHQWSKRWRVMRLQLQRQ$J)DFW)ULGD\WHOOXVKRZ ZHœUHGRLQJUHDGWKHPDJD]LQHRQOLQHDQGPXFKPRUH $VDOZD\V,œGORYHWRKHDUIURP\RX3OHDVH VHQGDQ\FRPPHQWVRUTXHVWLRQVWRPRUJDQ# KHDUWODQGLWIFRP :HœOOVHH\œDOO,QWKH)LHOG

0RUJDQ7D\ORU1RUULV ,ÂśGORYHWRKHDUIURP\RX 3OHDVHVHQGDQ\FRPPHQWVRUTXHVWLRQVWR PRUJDQ#KHDUWODQGLWIFRP

Heartland in the Field Magazine is published monthly and is available through local businesses, restaurants and other local venues within Hardee, Highlands, DeSoto, Charlotte, Glades, Hendry and Okeechobee Counties. It is also distributed by U.S. mail to a target market, which includes members of the Farm Bureau and those with ag classification on their land. Letters, comments and questions can be sent to Heartland In the Field Magazine, P.O. Box 3183 Plant City, FL. 33563 or you are welcome to e-mail them to Rhonda@heartlanditf.com or call 813-708-3661. Advertisers warrant & represent the description of their products advertised are true in all respects. Heartland In the Field Magazine assumes no responsibility for claims made by their advertisers. All views expressed in all articles are those of the authors and not necessarily those of G Five Publications, Inc. Any use or duplication of material used in Heartland In the Field Magazine is prohibited without written consent from Berry Publications and G Five. All contents Copyright 2012. No part of this work may be copied, transmitted, reproduced or reprinted without the express written consent of the publisher. Annual subscriptions to receive Heartland A Way of Life at your home or business is $25 annually. For advertising, subscriptions or editorial questions please call 813-708-3661 or email morgan@heartlanditf.com. HeartlandÂŽ A Way Of Life In The Field publication has been in print since 2009.

Ă&#x2C6;

Heartland InTheFieldMagazine

Ă&#x2C6;/CTOBERĂ&#x2C6;


HARD CLAMS are caught wild in Florida’s central and east coast waters. They are also farmed-raised in Florida by farmers who lease coastal water bottoms and plant seed clams under nets or in mesh bags. Farmers monitor the clams until they reach market size in 12 to 18 months. Clam farming requires good water quality, which makes Florida an excellent setting for this enterprise. Currently there are 365 certified clam growers working on 1,200 acres of state-owned submerged lands dedicated to aquaculture leases in Florida. The total economic impact exceeds $62.9 million and 606 jobs for the state of Florida, resulting in a happy clamming industry for us all.

For more information about Florida’s seafood and aquaculture industries, visit FL-Seafood.com.

È

/CTOBERÈÈ

Heartland InTheFieldMagazine




/#4¬

+($57/ !¬7AY¬OF¬,IFE $1' )NDEX¬OF¬!DVERTISERS ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬ ¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬¬ ¬

!DAMS¬2ANCH¬¬ ¬ ¬ ¬ !GRI¬3ERVICES¬ ¬ ¬ ¬¬ !GRO¬#ULTURE¬ ¬ ¬ ¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ !RCADIA¬3TOCKYARD¬ ¬ ¬ ¬¬¬ !RCADIA¬3TOCKYARD¬"ULL¬3ALE¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ "IG¬4¬4IRE¬¬ ¬ ¬ ¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ "URNS¬#ITRUS¬¬ ¬ ¬ ¬ ¬ #ALLAWAY¬&ARMS #ARY¬0IGMAN¬ #ATTLEMENS¬,IVESTOCK¬-ARKET¬ ¬ ¬¬ #ENTER¬3TATE¬"ANK¬ ¬ ¬ ¬¬¬¬ #ENTRAL¬3TATES¬%NTERPRISES #RYSTAL¬$RAKE¬ ¬ ¬ ¬ ¬¬ #&¬)NDUSTRIES¬ ¬ ¬ ¬ #HEM¬#ONTAINERS¬ ¬ ¬ ¬¬¬¬ #REEL¬4RACTOR¬ ¬ ¬ ¬¬¬¬ $ANIELS¬$ECEIVERS¬ ¬ ¬ ¬¬¬¬ $ENISE¬'RIMSLEY $ESOTO¬#OUNTY¬!G¬&EST¬ $ESOTO#HARLOTTE¬&ARM¬"UREAU¬ ¬ $E3OTO¬-ACHINE¬3HOP¬ ¬ ¬ ¬¬ $E3OTO¬-EMORIAL¬(OSPITAL¬¬ ¬ ¬¬¬¬¬¬ ¬ &IELDS¬%QUIPMENT¬ ¬ ¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ &LORIDA¬&ENCE¬0OST¬ ¬ &LORIDA¬$EPARTMENT¬OF¬!G¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ &RONTO¬2ECYCLING¬¬ ¬ ¬ ¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ 'LARNER¬&ARMERS¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ ¬¬¬¬¬¬ 'LADE¬AND¬'ROVE¬ ¬ ¬ ¬ 'LISSONS¬!NIMAL¬3UPPLY¬ ¬ ¬¬¬¬¬¬¬¬¬¬ 'OIN¬0OSTAL¬ ¬ ¬ ¬ 'RIFlNS¬#ARPET¬-ART (ARDEE¬#OUNTY¬&ARM¬"UREAU¬¬ ¬ ¬ (ARBOR¬.ISSAN¬ ¬ ¬ ¬¬¬¬¬¬¬ (ELENA¬#HEMICAL¬ ¬ ¬ ¬¬¬¬¬¬¬ (ICKS¬/IL¬ ¬ ¬ ¬ ¬ ¬¬ (IGHLANDS¬#OUNTY¬&ARM¬"UREAU¬ ¬

¬¬ (IGHLANDS¬3OIL¬ ¬ ¬ ¬¬¬¬¬¬¬ ¬¬ +EY0LEX¬ ¬¬ ,ABELLE¬&EED¬ ¬ ¬ ¬¬¬¬¬¬¬ ¬¬ ,AYES¬4IRE¬3ERVICE¬ ¬ ¬ ¬ ¬¬ ¬¬ -ARLIN¬-ARBLE¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ ¬¬ -ICHAEL¬'¬+IRSCH¬¬ ¬ ¬ ¬ ¬¬ ¬¬ -ILLERS¬!IR¬¬ ¬ ¬ ¬¬¬¬¬¬¬¬ ¬¬ -OSAIC¬ ¬ ¬ ¬ ¬ ¬¬ .EWTON¬#ROUCH¬ ¬ ¬ ¬¬¬¬¬¬¬¬ ¬¬ /KEECHOBEE¬$ODGE¬ ¬ ¬ ¬¬ /KEECHOBEE¬,IVESTOCK¬-ARKET¬¬ ¬ ¬¬ ¬¬ 0ATHWAY¬ ¬ ¬ ¬ ¬¬¬¬¬¬¬ ¬¬ 0EACE¬2IVER¬#ITRUS¬ ¬ ¬ ¬¬¬¬¬¬¬¬ ¬ ¬¬ 0LANTED¬0INES¬ ¬ ¬ ¬ ¬¬ ¬¬ 2EPAIR¬3OLUTIONS¬¬¬¬¬¬ ¬ ¬¬¬¬¬¬¬¬ ¬¬ 2IVER¬0ASTURE-ETAL¬!RT¬ ¬ ¬ ¬¬ 3ABLE¬2IDGE¬ ¬¬ 3EACOAST¬"ANK¬ ¬ ¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ ¬¬ 3EEDWAY¬ ¬¬ 3MITH¬&ARMS¬ ¬ ¬ ¬¬¬¬¬¬¬¬¬ ¬¬ 3MITHS¬2ANCH¬¬'ARDEN¬ ¬ ¬¬¬¬¬¬¬¬¬ ¬¬ 3PRING¬,AKE¬(ARDWARE¬ ¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ ¬¬ 3PURLOWS¬/UTDOOR¬¬¬¬ ¬ ¬ ¬¬ 3UNSHINE¬&AMILY¬$ENTISTRY¬ ¬ ¬¬¬¬¬¬¬¬¬¬ ¬¬ 3UPERIOR¬-UFmER¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ ¬¬ 4AYLOR¬/IL¬#OMPANY¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬ ¬¬ 4HE¬!NDERSONS¬ ¬ ¬ ¬ ¬¬ ¬ 4RIANGE¬(ARDWARE¬ ¬ ¬ ¬ ¬¬ 4RINKLE¬2EDMAN¬#OTON¬ ¬ ¬¬¬¬¬¬¬¬¬¬¬ ¬ ¬¬ 7ALPOLE¬&EED¬ ¬ ¬ ¬ ¬¬ ¬¬ 7ARNER¬3OUTHERN¬#OLLEGE¬ ¬¬ 7ATERING¬(OLE¬ ¬ ¬ ¬ ¬7AUCHULA¬3TATE¬"ANK¬ ¬ ¬ ¬7ICKS¬"ROWN¬#0!¬ ¬ ¬ ¬ ¬7INlELD¬3OLUTIONS¬¬ ¬ ¬ ¬ ¬

3ALES¬4EAM (IGHLANDS -ORGAN¬.ORRIS ¬MORGAN HEARTLANDITFCOM 7YATT¬(OLMES ¬WYATT HEARTLANDITFCOM

(ARDEE¬AND¬$ESOTO 2OBBI¬3UMNER ¬ROBBI HEARTLANDITFCOM 2ON¬"ROWN ¬RON INTHElELDMAGAZINECOM

-ANATEE¬ -ORGAN¬.ORRIS ¬MORGAN HEARTLANDITFCOM

#INDY¬#UTRIGHT ¬CINDY HEARTLANDITFCOM

,EE¬AND¬(ENDRY

#HARLOTTE

/KEECHOBEE ¬'LADES¬AND¬3T¬,UCIE

-ORGAN¬.ORRIS ¬MORGAN HEARTLANDITFCOM 2ON¬BROWN ¬RON INTHElELDMAGAZINECOM

2OBBI¬3UMNER ¬ROBBI HEARTLANDITFCOM

#ORPORATE ¬0OLK¬AND¬(ILLSBOROUGH $ANNY¬#RAMPTON ¬DANNY INTHElELDMAGAZINECOM -ORGAN¬.ORRIS ¬MORGAN HEARTLANDITFCO 2HONDA¬'LISSON ¬RHONDA HEARTLANDITFCOM

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;


È

/CTOBERÈÈ

Heartland InTheFieldMagazine




&2817<)$50%85($8

+$5'((&2817< )$50%85($8

+,*+/$1'6&2817< )$50%85($8

6(86+LJKZD\ $UFDGLD)/

86+LJKZD\1 :DXFKXOD)/

86+LJKZD\6 6HEULQJ)/

2I¿FH+RXUV 0RQGD\±)ULGD\ DPWRSP

2I¿FH+RXUV 0RQGD\±)ULGD\ DPWRSP

2I¿FH+RXUV 0RQGD\±)ULGD\ DPWRSP

3KRQH

3KRQH  )D[ 

3KRQH  )D[ 

&+$5/277('(6272

 &KDUORWWH/LQH  )D[ 

:HEVLWH ZZZKLJKODQGVIDUPEXUHDXFRP

2)),&(56$1' (;(&87,9(&200,77((

2)),&(56$1'

2)),&(56$1'

(;(&87,9(&200,77((

(;(&87,9(&200,77((

3UHVLGHQW««««-LP6HOSK

3UHVLGHQW««'DYLG%5R\DO

3UHVLGHQW«««6FRWW.LURXDF

9LFH3UHVLGHQW«««-HIIUH\$GDPV

9LFH3UHVLGHQW«*UHJ/6KDFNHOIRUG

9LFH3UHVLGHQW«'RXJ0LOOHU

6HF7UHDVXUHU%U\DQ.%HVZLFN

6HF7UHDVXUHU««%R5LFK

6HFUHWDU\«««&DUH\+RZHUWRQ 7UHDVXUHU««0LNH:DOGURQ

',5(&7256)25

',5(&7256)25

',5(&7256)25

-LP%UHZHU-RKQ%XUWVFKHU

-RVHSK%&KHUU\-RKQ3ODWW

6DP%URQVRQ6WHYH)DUU

0LNH&DUWHU6WHYH)XVVHOO

&RUH\/DPEHUW'DQLHO+6PLWK

'UHZ3K\SHUV&KDUOHV/DQ¿HU

/LQGVD\+DUULQJWRQ

6WHYH$-RKQVRQ%LOO+RGJH

0LNH0LOLFHYLF-HII:LOOLDPV

5LFKDUG(+DUYLQ$QQ+5\DOV

'DYLG%5R\DO*UHJ/6KDFNHOIRUG

)UDQN<RXQJPDQ0DUW\:RKO

0DF7XUQHU0DWW+DUULVRQ

%R5LFK

-LP:RRG/LQGVH\6HEULQJ

&RXQW\6HFUHWDU\ 6XVDQ&KDSPDQ

&RXQW\6HFUHWDU\ -DQHW0HQJHV

.HQ+DUULVRQ &RXQW\6HFUHWDU\ .DWKHULQH5\DOV

)DUP%XUHDX ,QVXUDQFH 6SHFLDO$JHQWV

)DUP%XUHDX ,QVXUDQFH 6SHFLDO$JHQWV

)DUP%XUHDX ,QVXUDQFH 6SHFLDO$JHQWV

$JHQF\0DQDJHU &DPHURQ1-ROO\

$JHQF\0DQDJHU 1-D\%U\DQ

$JHQF\0DQDJHU &KDG'0F:DWHUV

$JHQWV 'DZQ$+LQHV &OLQW%URZQ

$JHQWV *HRUJH/:DGVZRUWK-U

$JHQWV -RVHSK:%XOOLQJWRQ

86+Z\1 :DXFKXOD)/  

86+LJKZD\6 6HEULQJ)/  

6(86+LJKZD\ $UFDGLD)/  

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;


$ISTRICTÃ&#x2C6;Ã&#x2C6;5PDATE &ROM¬THE¬$ESK¬OF¬!NDY¬.EUHOFER 'ENEÃ&#x2C6; -C!VOYÃ&#x2C6; ISÃ&#x2C6; THEÃ&#x2C6; %XTENSIONÃ&#x2C6; $IRECTORLQ+HQGU\&RXQW\DQGKHLV WKHPXOWLFRXQW\YHJHWDEOHDJHQWDV ZHOO*HQHVHQGVRXWDSOHWKRUDRI LQIRUPDWLRQHDFKGD\YLDHPDLO +LV LQIRUPDWLRQ FRPHV IURP YDULRXV VRXUFHV  2QH LWHP RI LQWHUHVWDQGSRVVLEO\VRPHFRQFHUQLVWKDW&KLQDLVWKH IRXUWKODUJHVWLPSRUWHURIIUHVKYHJHWDEOHVWRWKH8QLWHG 6WDWHV7KHWUHQGKDVEHHQDVKDUSLQFUHDVHLQLPSRUWHG YHJHWDEOHVRYHUWKHODVWWHQ\HDUV$OPRVWKDOIRIWKH IUHVKIUXLWVDQGYHJHWDEOHVFXUUHQWO\FRQVXPHGLQWKH 86 ZHUH LPSRUWHG  7KH VRXUFH RI WKLV LQIRUPDWLRQ FDPHIURP7H[DV$JUL/LIH:HVWHUQ)DUP3UHVV 0HDQZKLOH WZR LPSRUWDQW QDWLRQDO LVVXHV DUH WKH )DUP %LOO DQG ZDWHU UHJXODWLRQ  7KH +RXVH RI 5HSUHVHQWDWLYHV· $JULFXOWXUH &RPPLWWHH DQG WKH IXOO 6HQDWH KDYH WKHLU YHUVLRQV RI WKH )DUP %LOO ZKLFK LV UHTXLUHGE\ODZWRUHQHZHYHU\Ã&#x20AC;YH\HDUV7KH+RXVH KDV\HWWRYRWHRQWKHELOODVRIWKLVZULWLQJ%RWKELOOV FRQWDLQGHÃ&#x20AC;FLWUHGXFWLRQDVDIHW\QHWIRUIDUPHUVDQG URRPWRQHJRWLDWH 7KH ZDWHU LVVXH LV DQ HIIRUW E\ WKH (QYLURQPHQWDO 3URWHFWLRQ $JHQF\ DQG WKH $UP\ &RUS RI (QJLQHHUV WR FLUFXPYHQW WKH ODZ E\ GUDIWLQJ D ´*XLGDQFH 'RFXPHQWµ  7KLV GRFXPHQW FLUFXPYHQWV WKH &OHDQ :DWHU$FWD6XSUHPH&RXUWUXOLQJDQGWKHUXOHPDNLQJ SURFHVVZKLFKUHTXLUHVSXEOLFLQSXW7KHLQWHQWLVWR LQFOXGH $// ZDWHUV DV ZDWHUV RI WKH 86 DQG WKXV VXEMHFWWRUHJXODWLRQ,WLVLPSRUWDQWWRVWRSWKLVHIIRUW 2Q DQRWKHU QRWH WKH )ORULGD )DUP %XUHDX $QQXDO 0HHWLQJZLOOEHWDNLQJSODFHRQ2FWREHU²DWWKH 3RQWH9HGUD6DZJUDVV0DUULRWW7KLVLVWKHWLPHZKHQ \RXU ORFDO FRXQW\ )DUP %XUHDXV VHQG WKHLU GHOHJDWHV WRWKHFRQYHQWLRQWRGLVFXVV)DUP%XUHDXUHVROXWLRQV SROLFLHVDQGEXVLQHVV,WLVDWLPHZKHQDQQXDOUHSRUWV DUH JLYHQ DQG D WLPH WR FKDUW QH[W \HDU·V FRXUVH &RXQW\)DUP%XUHDXVDUHDZDUGHGIRUWKHLUHIIRUWVWKLV SDVW\HDU<RXQJ)DUPHUVDQG5DQFKHUVFRPSHWH7KH \RXWK FRPSHWH LQ WKH DQQXDO VSHHFK FRQWHVW <RXQJ FKLOGUHQGUDZSRVWHUVDERXW)ORULGDDJULFXOWXUH,WLV DQLPSRUWDQWPHHWLQJDQGLVUHTXLUHGDVSHUWKH)ORULGD )DUP%XUHDX)HGHUDWLRQ%\/DZV$VD)DUP%XUHDX PHPEHU UHVW DVVXUHG ZH VWD\ VWURQJ EHFDXVH WKH YROXQWHHUVRIWKLVRUJDQL]DWLRQDUHGHGLFDWHGWR)DUP %XUHDXDQG)ORULGDDJULFXOWXUH !NDY¬.EUHOFER¬¬¬¬¬ &LORIDA¬&ARM¬"UREAU¬$ISTRICT¬  !NDYNEUHOFER FFBFORG ¬WWWmORIDAFARMBUREAUORG Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

Heartland InTheFieldMagazine




Okeechobee Hosts FCA & FCW Quarterly Meetings

T

KH )ORULGD &DWWOHPHQ¶V DQG &DWWOHZRPHQ¶V $VVRFLDWLRQV HDFK KHOG WKHLUTXDUWHUO\PHHWLQJVLQ2NHHFKREHH 6HSWHPEHUWK±WK )&$3UHVLGHQW:RRG\/DUVRQZDV RQ KDQG WR ZHOFRPH JXHVWV DQG OHDG PHHWLQJVRIWKH%RDUGDQGWKH*HQHUDO VHVVLRQ 9DULRXV FRPPLWWHHV DOVR PHW WR GLVFXVV LVVXHV UDQJLQJ IURP $J 5HVHDUFKDQG(GXFDWLRQWR0DUNHWLQJ DQG3XEOLF5HODWLRQV )&: 3UHVLGHQW 0HOLVVD 0RQWHV GH 2FD SUHVLGHG RYHU WKDW JURXS¶V PHHWLQJV ZKLFK FRYHUHG WRSLFV IURP $JLQWKH&ODVVURRPDQGWKH%HHIIRU WKH+ROLGD\VSURJUDPWRWKHXSFRPLQJ %HHI 6KRUW &RXUVH WR EH KHOG LQ *DLQHVYLOOH 'HFHPEHU WK 7KHLU DQQXDO &OD\ 6KRRW IXQGUDLVLQJ HYHQW ZLOOEHKHOG-DQXDU\WKDW4XDLO&UHHN 3ODQWDWLRQ

FHQWHUHG DURXQG SULPH ULE WKDW KDG EHHQH[SHUWO\&#7Ã&#x2C6;"OARD  FRRNHG E\ 2NHHFKREHH &DWWOHPHQ¶V 3UHVLGHQW 'DYLG +D]HOOLHI DQG KLV WUXVW\FUHZRIJULOOKHOS0HPEHUVRI WKH 2NHHFKREHH -XQLRU &DWWOHPHQ¶V $VVRFLDWLRQVHUYHGXSWKHVLGHGLVKHV DQGKRPHPDGHGHVVHUWVZHUHSURYLGHG E\ PHPEHUV RI WKH 2NHHFKREHH &DWWOHZRPHQ¶V$VVRFLDWLRQ 7KH\HDUHQG4XDUWHUO\PHHWLQJLV VFKHGXOHGIRU1RYHPEHUWK WK LQ/DNH&LW\

$W 7KXUVGD\ HYHQLQJ¶V ³6WHDN 2XW´ GLQQHU KHOG DW WKH :LOOLDPVRQ 5DQFK&DPS+RXVHDWWHQGHHVHQMR\HG IHOORZVKLS DQG D GHOLFLRXV PHDO

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;




#%!! "$       "!" %$ &#$$%$%"     





+ ).(-1"))&,$)#(0#-" (.,-+#,#(-)+#/-" 3 )''#,,#)(+5, .,#(,,)!(#-#)( 0+4*+,(-#(&+-#)()  ,.,, .&&&#(,-0(-".,#(,,)''.(#-1(&)&,"))&, -)( #-&)+#5,,-.(-,#-.+-)+#%-2+,  (#(+# ,"++ ).(-1.&#"))&,#"+  "(- (&)+#5, )''#,,#)(+)  .-#)( + +#'#-" -.(-,,+" )+ ),,#&,)( *+)*+-1





.%4231*&2*201/4%3/0"13.&16*3)"1%&&&.*/1*()$)//, *$341&%"#/5&3/"1&3)&  2$)/,"12)*06*..&12 *$+1*##,&".*&,&1.".%&8&/.3&5".2"5".."),#1*33/. ".%1&.%"!"-/1"0*$341&%6*3)&..7*,,&1/'.%4231*&2"$)/' 3)&2&(1"%4"3*.(2&.*/121&$&*5&% 3/2400/133)&*1'4341&&%4$"3*/.



((1#&&+*+,(-, /# .+,-(#0#-" )(-+#.-#)( )+#&--#.'.*%*

 Ă&#x2C6;

    /CTOBERĂ&#x2C6;Ă&#x2C6;



  #!$  $ $ 





/4.37/"%

9 "4$)4,"  

Heartland InTheFieldMagazine




2FWREHU·V+XQWLQJ6SRWOLJKW EURXJKWWR\RXE\ 6SXUORZ·V2XWGRRU2XWILWWHUV (DVW:DOO6WUHHW)URVWSURRI)/VSXUORZVRXWGRRUV#KRWPDLOFRP ZZZVSXUORZVFRP

$VKOH\LVVL[\HDUVROGWKHGDXJKWHURI%DUU\ DQG&U\VWDO6KDZDQGELJVLVWHUWREDE\ EURWKHU(YHUHWW$VKOH\DWWHQGV6DOOLH-RQHV (OHPHQWDU\6FKRROLQ3XQWD*RUGD+HU KREELHVDUHGDQFLQJVSRUWVKXQWLQJDQG ÀVKLQJ$VKOH\KDVEHHQLQWKHZRRGVDQG RQEXJJLHVVLQFHVKHZDVDQHZERUQEXWVKH UHDOO\OLNHVWKHEXJJLHV $VKOH\DQGKHU'DGJRVKRRWLQJDORWDQGKHU IDYRULWHJXQWRVKRRWLVD6KHVKRWD ODVWZHHNHQGIRUWKHÀUVWWLPHVKRWLWWZLFHDQG ZDQWHGKHUEDFN 

6RPHWLPHVWKH\MXVWJRULGLQJLQWKH:HEE 0DQDJHPHQW$UHDDQGVKHORYHVWRDWFK GHHUVKHOLNHVDOOWKHDQLPDOVEXWHVSHFLDOO\ WKHGHHU7KH\KDYHEHHQWDNLQJ$VKOH\RXW WKHUHVLQFHVKHZDVDERXWWZR\HDUVROG 1RZ%DUU\NHHSVDSDLURIELQRFXODUVLQWKH WUXFNMXVWIRUKHU $VKOH\DOVRORYHVÀVKLQJZLWKKHU'DGDQG VKHLVSUHWW\JRRGVRPHNHHSHUWURXWDQG VQDSSHURQWKHLUODVWWULS+HUIDYRULWHÀVKWR HDWLVÁRXQGHUDQGLWKDVWREHIULHG %DUU\VD\V´7KHEHVWPHPRULHV,KDYHRI $VKOH\DUHRIKHUDQG,HQMR\LQJ*RG·V FUHDWLRQWRJHWKHUµ

6XEPLW\RXUFKLOGUHQ¶VKXQWLQJSLFWXUHVIRUWKH0RQWKO\+XQWLQJ6SRWOLJKW WRPRUJDQ#KHDUWODQGLWIFRP È Heartland InTheFieldMagazine

È/CTOBERÈ


GLISSON’S ANIMAL SUPPLY

È

/CTOBERÈÈ

Heartland InTheFieldMagazine




HEARTLANDâ&#x20AC;&#x2122;S

&)3().' 2%0/24

&DSWLDQ0DUN.LQJ

7

H QRZ KDYH SOHQW\ RI ZDWHU LQ /DNH 2NHHFKREHH WKDQNV WR +XUULFDQH ,VDDF DQG WKH EDVVKDYHPRYHGEDFNLQWRWKHJUDVV LQDELJZD\7KHODNHOHYHOLVXSRYHU ¿IWHHQIHHWDQGDFWXDOO\KLJKHUWKDQ ZHQHHGLWEXW,DPQRWFRPSODLQLQJ DVZHFRXOGVWLOOKDYHORZZDWHUDQG LWFRXOGEHJHWWLQJORZHU7KH\DUH VWDUWLQJ WR UHOHDVH VRPH ZDWHU RXW RI WKH ODNH EXW ZLWK ZKDW UDLQ ZH DUH UHFHLYLQJ WKH ZDWHU OHYHO VKRXOG EH SHUIHFW IRU WKH IDOO DQG ZLQWHU VHDVRQ KHUH RQ 2NHHFKREHH 7KH EDVV KDYH PDGH D PRYH WR WKH JUDVV LQ D ELJZD\DQGHYHQWKRXJKWKH\DUHLQ FHUWDLQ DUHDV ULJKW QRZ DOO ZH QHHG LVDIHZPRUHZHHNVDQGWKH\VKRXOG EHHYHU\ZKHUHRQWKHODNH7KLVIDOO ZLQWHUDQGVSULQJRQWKHODNHLVJRLQJ WR EH RQH RI WKH EHVW LQ PDQ\ \HDUV DQGWKHUHVKRXOGEHDORWRIUHDOO\ELJ EDVV FDXJKW DORQJ ZLWK VRPH JUHDW QXPEHUVDOVR ,KDYHEHHQ¿VKLQJPRVWO\RQWKHVRXWK HQGRIWKHODNHEXWWKHUHLVDORWRI¿VK EHLQJFDXJKWXSQRUWKDOVRDQGDVWKH ZDWHU VKRXOG VWDUW WR FRRO RII D OLWWOH QH[W PRQWK WKH EDVV ZLOO EH LQ WKH JUDVVELJWLPHZKHUHWKHEDLWLVDOUHDG\ PRYLQJWR,KDYHEHHQFDWFKLQJEDVV SLWFKLQJ *DPEOHU ZRUPV DQG 6XSHU 6WXGVLQWKHVFDWWHUHGJUDVVDQGUHHG KHDGVIURP&OHZLVWRQWR3HOLFDQ%D\ ZLWKVRPHUHDOO\JUHDWVXFFHVV,KDYH

#APTAINÃ&#x2C6; -ARKÃ&#x2C6; +ING

Ã&#x2C6; ISÃ&#x2C6; AÃ&#x2C6; FULLÃ&#x2C6; TIMEÃ&#x2C6; GUIDEÃ&#x2C6; ANDÃ&#x2C6; TOURNAMENTÃ&#x2C6; ANGLERÃ&#x2C6; GUIDINGÃ&#x2C6; OUTÃ&#x2C6; OFÃ&#x2C6; THEÃ&#x2C6; WORLDÃ&#x2C6; FAMOUSÃ&#x2C6; 2OLANDÃ&#x2C6; -ARTINSÃ&#x2C6; -ARINAÃ&#x2C6; ANDÃ&#x2C6; 2ESORTÃ&#x2C6; INÃ&#x2C6; #LEWISTONÃ&#x2C6; &LORIDAÃ&#x2C6; ANDÃ&#x2C6; ALSOÃ&#x2C6; INÃ&#x2C6; THEÃ&#x2C6; &LORIDAÃ&#x2C6; +EYSÃ&#x2C6; OUTÃ&#x2C6; OFÃ&#x2C6; -ARATHONÃ&#x2C6; AREAÃ&#x2C6;-ARKÃ&#x2C6;ISÃ&#x2C6;ANÃ&#x2C6;)'&!Ã&#x2C6;#ERTIlEDÃ&#x2C6;#APTAIN Ã&#x2C6;ACTIVEÃ&#x2C6; MEMBERÃ&#x2C6; OFÃ&#x2C6; THEÃ&#x2C6; &LORIDAÃ&#x2C6; 'UIDEÃ&#x2C6; !SSOCIATIONÃ&#x2C6; ANDÃ&#x2C6;THEÃ&#x2C6;&LORIDAÃ&#x2C6;/UTDOORÃ&#x2C6;7RITERSÃ&#x2C6;!SSOCIATIONÃ&#x2C6; #APTAINÃ&#x2C6;-ARKÃ&#x2C6;ISÃ&#x2C6;SPONSOREDÃ&#x2C6;BYÃ&#x2C6;2ANGERÃ&#x2C6;"OATS Ã&#x2C6; %VINRUDEÃ&#x2C6;/UTBOARDS Ã&#x2C6;2OLANDÃ&#x2C6;-ARTINSÃ&#x2C6;-ARINEÃ&#x2C6; #ENTER Ã&#x2C6; 0OWER 0OLE Ã&#x2C6; -INNÃ&#x2C6; +OTAÃ&#x2C6; TROLLINGÃ&#x2C6; MOTORS Ã&#x2C6; #HARLIESÃ&#x2C6; 7ORMS Ã&#x2C6; /KUMAÃ&#x2C6; &ISHING Ã&#x2C6; !&4#/Ã&#x2C6; CLOTHING Ã&#x2C6; 3MARTSHIELDÃ&#x2C6; 3UNÃ&#x2C6; 0ROTECTIONÃ&#x2C6; 0RODUCTS Ã&#x2C6;2-2Ã&#x2C6;)NDUSTRIES Ã&#x2C6;&UELÃ&#x2C6;-EDICÃ&#x2C6;%THANOLÃ&#x2C6; 4REATMENT Ã&#x2C6;ANDÃ&#x2C6;9ETIÃ&#x2C6;COOLERS -ARKÃ&#x2C6;CANÃ&#x2C6;BEÃ&#x2C6;CONTACTEDÃ&#x2C6;TOÃ&#x2C6;BOOKÃ&#x2C6;AÃ&#x2C6;GUIDEÃ&#x2C6;TRIP Ã&#x2C6; SEMINARS Ã&#x2C6; PERSONALÃ&#x2C6; APPEARANCES Ã&#x2C6; TESTÃ&#x2C6; RIDESÃ&#x2C6; INÃ&#x2C6; HISÃ&#x2C6; %VINRUDEÃ&#x2C6; POWEREDÃ&#x2C6; 2ANGERÃ&#x2C6; ORÃ&#x2C6; TOÃ&#x2C6; lSHÃ&#x2C6; AÃ&#x2C6; TOURNAMENTÃ&#x2C6; WITHÃ&#x2C6; HIMÃ&#x2C6; ATÃ&#x2C6;   Ã&#x2C6; ORÃ&#x2C6; ATWWWMARKKINGlSHINGCOMÃ&#x2C6; ANDWWW TARPONINTHEKEYSCOM

DOVR EHHQ FDWFKLQJ D ORW RI EDVV RXW IURP XQGHU PDWWHG YHJHWDWLRQ RQ D *DPEOHU:K\1RWZLWKDRQHRXQFH ZHLJKW WKLV LV RQH RI P\ IDYRULWH ZD\V WR FDWFK ELJ 2NHHFKREHH EDVV :LWK WKH EDVV EDFN LQ WKH JUDVV \RX ZLOOZDQWWRJREDFNWRKHDY\EUDLGHG OLQH DW OHDVW ¿IW\SRXQG WHVW DQG D JRRG KHDY\ DFWLRQ URG OLNH WKH +DOR URGV WKDW , DP XVLQJ , DP KDSS\ WR QRZ EH ¿VKLQJ D JUHDW URG IURP D ORFDO FRPSDQ\ KHUH RQ 2NHHFKREHH \RXZLOOEHVHHLQJDORWPRUHRIWKHVH URGV IURP WKH SURV RQ WKH FLUFXLW WR ORFDO JXLGHV DQG ¿VKHUPHQ DOO RYHU WKH867KHOLYHEDLW¿VKLQJZLWKZLOG VKLQHUV KDV UHDOO\ SLFNHG XS WKH SDVW ZHHN RU VR ZLWK ¿YH GR]HQ VKLQHUV RQO\ODVWLQJWLOODERXWWHQR¶FORFNDQG ZHDUHDOUHDG\VHHLQJVRPHELJEDVV IURPVL[WRQLQHSRXQGVEHLQJFDXJKW

6RPH DUHDV WR WU\ KHUH RQ WKH VRXWK HQGRI/DNH2NHHFKREHHDUH3HOLFDQ %D\/RQJ3RLQW*UDVV\5LWWD,VODQG (DVW:DOODQGWKH:HVW:DOO$V\RX FDQVHHWKHUHDUHDORWRIDUHDVWR¿VK

2OLANDÃ&#x2C6;-ARTINÃ&#x2C6;-ARINEÃ&#x2C6;#ENTERÃ&#x2C6;ISÃ&#x2C6;AÃ&#x2C6;FULLÃ&#x2C6;SERVICEÃ&#x2C6;MARINAÃ&#x2C6;INCLUDINGÃ&#x2C6;BOAT Ã&#x2C6;MOTOR Ã&#x2C6;ANDÃ&#x2C6;TACKLEÃ&#x2C6;SALESÃ&#x2C6;ANDÃ&#x2C6;BOATÃ&#x2C6;ANDÃ&#x2C6;MOTORÃ&#x2C6;SERVICEÃ&#x2C6;BYÃ&#x2C6;ONEÃ&#x2C6;OFÃ&#x2C6;THEÃ&#x2C6;TOPÃ&#x2C6; SERVICEÃ&#x2C6;CREWSÃ&#x2C6;INÃ&#x2C6;3OUTHÃ&#x2C6;&LORIDAÃ&#x2C6;!REÃ&#x2C6;YOUÃ&#x2C6;LOOKINGÃ&#x2C6;FORÃ&#x2C6;AÃ&#x2C6;NEWÃ&#x2C6;ORÃ&#x2C6;USEDÃ&#x2C6;2ANGERÃ&#x2C6;BOATÃ&#x2C6;ORÃ&#x2C6;MAYBEÃ&#x2C6;YOUÃ&#x2C6;JUSTÃ&#x2C6;NEEDÃ&#x2C6;AÃ&#x2C6;NEWÃ&#x2C6;OUTBOARDÃ&#x2C6;TOÃ&#x2C6;PUTÃ&#x2C6;ONÃ&#x2C6;AÃ&#x2C6;BOATÃ&#x2C6;YOUÃ&#x2C6; ALREADYÃ&#x2C6;HAVEÃ&#x2C6;WELLÃ&#x2C6;THANÃ&#x2C6;AÃ&#x2C6;NEWÃ&#x2C6;%VINRUDEÃ&#x2C6;% 4ECÃ&#x2C6;WOULDÃ&#x2C6;PUTÃ&#x2C6;YOUÃ&#x2C6;RIGHTÃ&#x2C6;BACKÃ&#x2C6;OUTÃ&#x2C6;ONÃ&#x2C6;THEÃ&#x2C6;WATERÃ&#x2C6;4HEYÃ&#x2C6;HAVEÃ&#x2C6;THEÃ&#x2C6;HOTTESTÃ&#x2C6;TACKLEÃ&#x2C6;ONÃ&#x2C6;THEÃ&#x2C6;MARKETÃ&#x2C6;INÃ&#x2C6;THEÃ&#x2C6; STORYÃ&#x2C6;WITHÃ&#x2C6;NAMESÃ&#x2C6;LIKEÃ&#x2C6;'AMBLER Ã&#x2C6;2EACTIONÃ&#x2C6;)NNOVATION Ã&#x2C6;#HARLIESÃ&#x2C6;7ORMS Ã&#x2C6;$UCKETTÃ&#x2C6;RODS Ã&#x2C6;,EWSÃ&#x2C6;2EELS Ã&#x2C6;ANDÃ&#x2C6;,IVEÃ&#x2C6;4ARGETÃ&#x2C6;+OPPERÃ&#x2C6;4HEYÃ&#x2C6;ALSOÃ&#x2C6;HAVEÃ&#x2C6;ALLÃ&#x2C6;YOURÃ&#x2C6; BOATINGÃ&#x2C6;NEEDSÃ&#x2C6;FROMÃ&#x2C6;OILSÃ&#x2C6;TOÃ&#x2C6;ANCHORSÃ&#x2C6;ANDÃ&#x2C6;EVERYTHINGÃ&#x2C6;INÃ&#x2C6;BETWEENÃ&#x2C6;7ITHÃ&#x2C6;TWOÃ&#x2C6;FULLÃ&#x2C6;TIMEÃ&#x2C6;MECHANICSÃ&#x2C6;ANDÃ&#x2C6;AÃ&#x2C6;FULLYÃ&#x2C6;STOCKEDÃ&#x2C6;PARTSÃ&#x2C6;ROOMÃ&#x2C6;GETTINGÃ&#x2C6;YOURÃ&#x2C6;BOATÃ&#x2C6; BACKÃ&#x2C6;OUTÃ&#x2C6;ONÃ&#x2C6;THEÃ&#x2C6;WATERÃ&#x2C6;WILLÃ&#x2C6;BEÃ&#x2C6;NOÃ&#x2C6;PROBLEMÃ&#x2C6;4HEYÃ&#x2C6;ALSOÃ&#x2C6;HAVEÃ&#x2C6;MINNOWS Ã&#x2C6;WORMS Ã&#x2C6;CRICKETS Ã&#x2C6;SODAS Ã&#x2C6;BEER Ã&#x2C6;ANDÃ&#x2C6;ICEÃ&#x2C6;ATÃ&#x2C6;ALLÃ&#x2C6;TIMESÃ&#x2C6;)FÃ&#x2C6;YOUÃ&#x2C6;AREÃ&#x2C6;LOOKINGÃ&#x2C6;FORÃ&#x2C6;AÃ&#x2C6; ONEÃ&#x2C6;STOPÃ&#x2C6;MARINAÃ&#x2C6;THANÃ&#x2C6;2OLANDÃ&#x2C6;-ARTINÃ&#x2C6;-ARINEÃ&#x2C6;#ENTERÃ&#x2C6;ISÃ&#x2C6;THEÃ&#x2C6;PLACEÃ&#x2C6;TOÃ&#x2C6;GOÃ&#x2C6;4HEYÃ&#x2C6;AREÃ&#x2C6;CONVENIENTLYÃ&#x2C6;LOCATEDÃ&#x2C6;JUSTÃ&#x2C6;BEFOREÃ&#x2C6;THEÃ&#x2C6;RAMPÃ&#x2C6;INÃ&#x2C6;#LEWISTONÃ&#x2C6;ONÃ&#x2C6;WORLDÃ&#x2C6; FAMOUSÃ&#x2C6;,AKEÃ&#x2C6;/KEECHOBEEÃ&#x2C6;3TOPÃ&#x2C6;INÃ&#x2C6;ANDÃ&#x2C6;SEEÃ&#x2C6;MYÃ&#x2C6;WIFEÃ&#x2C6;$IANEÃ&#x2C6;INÃ&#x2C6;THEÃ&#x2C6;PARTSÃ&#x2C6;DEPARTMENTÃ&#x2C6;ANDÃ&#x2C6;SHEÃ&#x2C6;JUSTÃ&#x2C6;MIGHTÃ&#x2C6;GIVEÃ&#x2C6;AWAYÃ&#x2C6;AÃ&#x2C6;FEWÃ&#x2C6;OFÃ&#x2C6;MYÃ&#x2C6;lSHINGÃ&#x2C6;SPOTS

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;


VR HYHU\RQH LV QRW ÂżVKLQJ LQ WKH VDPH DUHD DQG RQ WRS RI HDFK RWKHU 0\IRUHFDVWIRUWKLVVHDVRQLVDEXV\ RQH DV , DP DOUHDG\ ERRNLQJ D ORW RI WULSVIRUWKHVHDVRQ,I\RXKDYH HYHU WKRXJKW DERXW D ÂżVKLQJ WULS WR 2NHHFKREHH QRZ LV WKH WLPH WR SODQ WKDWZLQWHURUVSULQJWULSRIDOLIHWLPH IRU \RX DQG WKH IDPLO\ *RRG OXFN WLJKWOLQHVDQG,KRSHWRVHHHYHU\RQH RQWKHZDWHUVRRQ

I am now fishing Halo rods and I am proud to be promoting a great rod from a local company right here on world famous Lake Okeechobee. The Twilite series rods will be a great addition to the already top of the line equipment that I have on my boat. I love the extreme sensitivity, unparalleled strength and weight, advanced micro guide technology that are braided line resistant, unmatched casting distance, and precisely engineered rod actions that these rods offer. I will also be using the Daylite series on Okeechobee and the all new Inshore series for my saltwater trips. All the equipment they make at HALO Fishing is made with the idea that they are making the very best products to get the job done. We work very closely and listen to our pro staff in the design process to ensure we offer them the best equipment to get their job done on the water. If you are thinking about a new fishing rod you owe it to yourself to check out Halo Rods. www.halofishing.com

Economical way to obtain and maintain agricultural tax exemption HAVE VACANT LAND: Excellent way to restore land to original features Possible government cost share assistance PLANT PINES THIS WINTER BENEFITS: â&#x20AC;˘ Low maintenance & liability â&#x20AC;˘ Income in the future with low money input â&#x20AC;˘ Adds value to vacant land by having trees â&#x20AC;˘ Improves wildlife value and provides other land options

â&#x20AC;˘ Machine and hand planting tree available â&#x20AC;˘ Commercial or restoration tree plantings â&#x20AC;˘ Longleaf or Slash pine trees available

Call for free information and evaluation: Sam Van Hook, Kissimmee Valley Forester â&#x20AC;˘ 863.678.5199

Ă&#x2C6;

/CTOBERĂ&#x2C6;Ă&#x2C6;

Heartland InTheFieldMagazine




0RVDLF &RQWULEXWLRQ )XQGV 0LQL*UDQWV IRU 6FKRRO *DUGHQV  )ORULGD $JULFXOWXUH LQ WKH &ODVVURRP LV D QRQSUR¿W LQ'H6RWR+DUGHH+LOOVERURXJK0DQDWHHDQG3RON&RXQWLHV RUJDQL]DWLRQEDVHGLQ*DLQHVYLOOHWKDWHGXFDWHVVWXGHQWVDERXW )ORULGDDJULFXOWXUHE\SURYLGLQJSUHNLQGHUJDUWHQWKURXJKWK *$,1(69,//( ± )ORULGD$JULFXOWXUH LQ WKH &ODVVURRP ,QF JUDGHWHDFKHUVZLWKFXUULFXODPDWHULDOVJUDQWPRQH\DQGRWKHU LVRIIHULQJVFKRROJDUGHQPLQLJUDQWVWRWHDFKHUVLQ¿YH SURJUDPV,WVSULPDU\VRXUFHRIIXQGLQJFRPHVIURPVDOHVRI &HQWUDO )ORULGD FRXQWLHV EHJLQQLQJ 6HSW  WKDQNV WR D JUDQW WKHDJULFXOWXUHVSHFLDOW\OLFHQVHSODWHFDOOHGWKH³$J7DJ´ IURP7KH0RVDLF&RPSDQ\)RXQGDWLRQ 7KH 0RVDLF &RPSDQ\ LV WKH ZRUOG¶V OHDGLQJ SURGXFHU DQG *HQHUDOHGXFDWLRQDQGDJULVFLHQFHWHDFKHUVLQSUHNLQGHUJDUWHQ PDUNHWHURIFRQFHQWUDWHGSKRVSKDWHDQGSRWDVKWZRHVVHQWLDO WKURXJKWKJUDGHLQ'H6RWR+DUGHH+LOOVERURXJK0DQDWHH FURS QXWULHQWV 'ULYHQ E\ LWV PLVVLRQ WR KHOS WKH ZRUOG JURZ DQG 3RON FRXQWLHV DUH HOLJLEOH WR DSSO\ XVLQJ DQ RQOLQH WKHIRRGLWQHHGV0RVDLFLVFRPPLWWHGWRVWUHQJWKHQLQJJOREDO DSSOLFDWLRQV\VWHPRQ)ORULGD$JULFXOWXUHLQWKH&ODVVURRP¶V IRRG VHFXULW\ DQG SURWHFWLQJ FULWLFDO ZDWHU UHVRXUFHV 7KH ZHEVLWHDWZZZÃ&#x20AC;DJLQWKHFODVVURRPFRP 0RVDLF&RPSDQ\DQG7KH0RVDLF&RPSDQ\)RXQGDWLRQPDNH LQYHVWPHQWV LQ DQG SDUWQHU ZLWK EHVWRIFODVV OHDGHUV LQ WKH 7KHIXQGVFDQEHXVHGIRUQHZRUH[LVWLQJVFKRROJDUGHQVWR IRFXVDUHDVRIIRRGZDWHUDQGORFDOFRPPXQLW\LQYHVWPHQWV SD\IRULWHPVQHHGHGWRSODQWDQGPDLQWDLQIUXLWYHJHWDEOHDQG 0RUHLQIRUPDWLRQDERXW0RVDLFLVDYDLODEOHDWZZZPRVDLFFR RUQDPHQWDOSODQWJDUGHQV0RVDLF¶VJUDQWWR)ORULGD$JULFXOWXUH FRP LQWKH&ODVVURRPLVSDUWRIPLOOLRQUHFHQWO\GRQDWHGWR  QRQSUR¿W FRPPXQLW\ RUJDQL]DWLRQV VHUYLQJ FRXQWLHV LQ WKH FRPSDQ\¶V &HQWUDO )ORULGD RSHUDWLQJ DUHD *UDQWV ZHUH DZDUGHGWRRUJDQL]DWLRQVLPSOHPHQWLQJLQLWLDWLYHVIRFXVHGRQ KXQJHU UHOLHI DJULFXOWXUDO UHVHDUFK DQG GHYHORSPHQW ZDWHU FRQVHUYDWLRQDQGVWHZDUGVKLSDQGFRPPXQLW\HQULFKPHQW  ³:H DUH SOHDVHG WR VXSSRUW WKLV KDQGVRQ SURJUDP WKDW HQDEOHVVWXGHQWVWRSHUVRQDOO\H[SHULHQFHDQGOHDUQDERXWWKH LPSRUWDQFHRIIDUPLQJDQGRXUIRRGVXSSO\´VDLG*DU\1³%R´ 'DYLV0RVDLF¶VVHQLRUYLFHSUHVLGHQWRI3KRVSKDWH2SHUDWLRQV DQGDERDUGPHPEHURI7KH0RVDLF&RPSDQ\)RXQGDWLRQ´ 0RVDLF LV FRPPLWWHG WR LQYHVWLQJ DW OHDVW RQH SHUFHQW RI LWV DQQXDOSUR¿WVLQWRLWVFRPPXQLWLHVJOREDOO\PDNLQJFRPPXQLW\ LQYHVWPHQWV LQ VHYHUDO JUDQW URXQGV HDFK \HDU 'DYLV VDLG 2YHU WKH SDVW \HDU 0RVDLF DQG LWV )RXQGDWLRQ KDYH GRQDWHG PRUHWKDQPLOOLRQWRFRPPXQLW\RUJDQL]DWLRQVIRFXVHGRQ &HQWUDO)ORULGD7RUHDGPRUHDERXW0RVDLF¶VIRFXVRQIRRG ZDWHU DQG ORFDO FRPPXQLW\ LQYHVWPHQWV DQG LWV RQOLQH JUDQW V\VWHPYLVLWZZZPRVDLFFRFRPFRPPXQLW\FRPPXQLW\KWP ³)ORULGD$JULFXOWXUHLQWKH&ODVVURRPDSSUHFLDWHVWKHFKDQFH WR ZRUN ZLWK D SDUWQHU OLNH 0RVDLF WR SURYLGH WHDFKHUV ZLWK UHVRXUFHVWKH\QHHGWRHGXFDWHVWXGHQWVDERXWZKHUHWKHLUIRRG ¿EHUDQGIXHOFRPHVIURP´VDLG-HQQLIHU6LOOVFKDLUZRPDQRI )$,7&

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;


%HWWHU<LHOGV%HWWHU4XDOLW\ 6DIHUIRUWKH(QYLURQPHQW $YDLODEOHWKURXJK-LP'RUPDQRI&KDUOLHªV3ODQW)DUP,QF  

ZZZDJUROLTXLGFRP

Agro-Culture

BYÃ&#x2C6;'ALYNNÃ&#x2C6;"EER

FL-Ad.indd 1

9/18/2012 10:54:40 AM

,IQUIDÃ&#x2C6;&ERTILIZERSÃ&#x2C6;0ICKSÃ&#x2C6;5PÃ&#x2C6;THEÃ&#x2C6;0ACE $JUR&XOWXUH /LTXLG KDV GHPRQVWUDWHG WKHDGYDQWDJHRIEDODQFHGFURSQXWULWLRQ LQ WKH FKDOOHQJLQJ FRQGLWLRQV RI WKH VRXWKHDVWHUQ 86$V DQ LQGXVWU\ OHDGHU LQ VXSSO\LQJ D IXOO UDQJH RI SODQW QXWULHQWV WR LWV FXVWRPHUV $JUR/LTXLG KDV HDUQHG D UHSXWDWLRQ IRU EHLQJ DEOH WR DGGUHVV QXWULHQW OLPLWDWLRQV RI FURSV E\ GUDZLQJ IURP H[SHULHQFHV RQ WKHLU H[WHQVLYHQXWULHQWUHVHDUFKIDUPWRKHOS JURZHUVPD[LPL]H\LHOGDQGTXDOLW\$Q LPSRUWDQW DVSHFW WKDW VHWV$JUR&XOWXUH /LTXLG )HUWLOL]HUV DSDUW IURP RWKHU IHUWLOL]HU FRPSDQLHV LV D FRPPLWPHQW WR QRW RQO\ VXSSO\LQJ D IXOO UDQJH RI QXWULHQWV EXW DOVR DGGLQJ LQ FRPSDQ\ VXSSRUWWRHQVXUHPD[LPXPEHQH¿WIURP WKHQXWULHQWDSSOLFDWLRQV 6XSSRUW IURP $JUR/LTXLG FRQWLQXHV WR JURZ LQ WKH 6( 7KH UHFHQW DGGLWLRQ RI 3DXOLQR *XWLHUUH] LV D VWHS WRZDUG EXLOGLQJRQPRPHQWXPWKDWKDVDOUHDG\ Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

EHHQHVWDEOLVKHG3DXOLQRKDVVSHQWPRVW RIKLVFDUHHULQWKHDJLQGXVWU\DQGFDQ TXLFNO\LGHQWLI\RSSRUWXQLWLHVDVZHOODV FKDOOHQJHV LQ DQ DUHD +LV ³KDQGVRQ´ DSSURDFKWRVXSSRUWLQJSURGXFWVZLWKDQ DFWLYHSUHVHQFHLQWKH¿HOGLVDQDWWULEXWH WKDW ZLOO LQFUHDVH WKH YDOXH RI $JUR /LTXLG LQ KLV DUHD 3DXOLQR UHVLGHV LQ 6DUDVRWD)/DQGDVDUHVXOWLVDFFHVVLEOH WRPDQ\NH\FURSVDQGDUHDVRIWKH6( +LVVXSSRUWRI$JUR/LTXLG¶VDUHDVHOOHUV ZLOOHQVXUHWKDWJURZHUVFDQFRXQWRQWKH FRPSDQ\ WR VXSSO\ WKHLU FURS QXWULWLRQ QHHGV $QRWKHUDGGLWLRQWRWKHVWDIILQWKH6(LV 'U0LNH5HDG+HZLOOSURYLGHDJURQRP\ VXSSRUW IRU IUXLWV DQG YHJHWDEOHV 0LNH KDV ZRUNHG ZLWK $JUR&XOWXUH /LTXLG SURGXFWVLQYDULRXVFDSDFLWLHVIRUVHYHUDO \HDUV 2YHU KLV FDUHHU KH KDV OLYHG DQG ZRUNHG LQ VHYHUDO FRXQWULHV ZLWK GLYHUVH FOLPDWHV DQG FXOWXUDO KDELWV

7KLV H[SHULHQFH KDV HTXLSSHG KLP WR EHDEOHWRDGDSWWKHÃ&#x20AC;H[LELOLW\RI$JUR /LTXLGSURGXFWVWRWKHPDQDJHPHQWDQG DYDLODEOH UHVRXUFHV RI WKH JURZHU +H UHVLGHV LQ9HQLFH )/ DQG OLNH 3DXOLQR LVDTXLFNFRPPXWHWRPDQ\DUHDFURSV $JUR&XOWXUH /LTXLG )HUWLOL]HUV LV FRPPLWWHG WR DQ LQFUHDVLQJ SUHVHQFH LQ WKH VRXWKHDVW7KH FRPSDQ\ SKLORVRSK\ RI PD[LPL]LQJ SURGXFWLRQ IURP DSSOLHG QXWULHQWVLVDJRRG¿WZLWKWKHFKDOOHQJHV LQWKHDUHD7KHFOLPDWHDQGVRLOVRIWKH 6(FUHDWHVRPHREVWDFOHVIRUJURZHUVWKDW $JUR/LTXLG LV HTXLSSHG WR PHHW KHDG RQ 7KH GHGLFDWLRQ WR NQRZOHGJHDEOH ¿HOG VXSSRUW DQG D FRPSOHWH PHQX RI SODQW QXWULWLRQ SODFHV $JUR&XOWXUH /LTXLG LQ D SRVLWLRQ RI JURZWK LQ WKH DUHD%HVXUHWRYLVLWWKHZHEVLWHDWZZZ DJUROLTXLGFRP LQ RUGHU WR YHULI\ WKHLU YDOXHWR\RXURSHUDWLRQ Heartland InTheFieldMagazine




#)4253ä50$!4% "YÃ&#x2C6;*USTINÃ&#x2C6;3MITH

E\-XVWLQ6PLWK

Mechanical (!26%34).'

4

KH¿UVWVLJQVRI)DOOKDYHEHHQVKRZLQJXSWKHODVW IHZGD\V7KHDLUKDVMXVWDVOLJKWO\FULVSHUIHHODQG WKH  KXPLGLW\ RI WKH VXPPHU GRJ GD\V KDYH DOPRVW FRPSOHWHO\ YDQLVKHG  7KH JURYHV DUH DOVR JLYLQJ WKH XVXDO LQGLFDWRUV RI WKH IDOO VHDVRQ  7KH GDUNJUHHQVSKHUHVDUHVORZO\PHWDPRUSKRVLQJWRDOLJKWHUSDOH JUHHQZKLFKZLOOVRRQEHWKHKDUYHVWVHDVRQ¶VEULJKWRUDQJHZH DOOORRNIRUZDUGWRR ,QWKHJURYHWKHODVWRIWKHQXWULWLRQDOVSUD\VDUHEHLQJSXWRQ WKH OHDYHV DQG WKH ¿QDO IHUWLOL]HU DSSOLFDWLRQV DUH VSUHDGLQJ $VDOORIWKLVLVWDNLQJSODFHJURZHUVDUHPRQLWRULQJWKH¿QDO VWDJHV RI WKHLU SURGXFWLRQ HQGHDYRUV DQG EHJLQQLQJ WR WKLQN DERXW KDUYHVWLQJ  6RRQ PDWXULW\ WHVWLQJ ZLOO VWDUW DQG WKHQ

WKHSLFNLQJZLOOEHJLQ$VZLWKHYHU\WKLQJHOVHLQWKHJURYH KDUYHVWLQJFRPHVZLWKLWVRZQVHWRIFKDOOHQJHV2QHRIWKH WRSFRQFHUQVIRUKDUYHVWLQJWKHVHGD\VLVODERU %\QRPHDQVLVODERUDQHZSUREOHPIRUFLWUXVJURZHUVEXWLWLV RQHZKLFKEHFRPHVPRUHFKDOOHQJLQJDQGPRUHFRPSOH[\HDU DIWHU\HDU7KHGUHDGHGHYHULI\SURJUDPLVDFRQVWDQWWKUHDW OLQJHULQJ RYHU WKH KHDGV RI KDUYHVWHUV  7KH +$ SURJUDP ZKLOHWRXJKZLWKLWVVWUHQXRXVFRPSOLDQFHLVVXHVKDVEHHQD VDYLQJJUDFHIRUNHHSLQJWKHPXFKQHHGHGODERUDYDLODEOH7KH LQGXVWU\LVDOVRJRLQJEDFNZDUGVVRWRVSHDNRQLWVUHOLDQFHRI PDQXDOODERUDVPHFKDQLFDOKDUYHVWLQJLVGHFOLQLQJ 7KH SHDN RI WKH PHFKDQLFDO KDUYHVWLQJ PRYHPHQW KLW EDFN LQ  DQG FDPH LQ VRPHZKHUH DURXQG  DFUHV  ,W VHHPHG IRU D WLPH DV WKRXJK WKLV PD\ KDYH EHHQ WKH ORQJ ORRNHG IRU DQVZHU WR DOOHYLDWH GHSHQGHQFH RQ PLJUDQW ODERU (DFK \HDU LPSURYHPHQWV ZHUH EHLQJ PDGH DQG WKH UHVXOWV ZHUH VKRZLQJ DV PRUH JURZHUV ZHUH JHWWLQJ RQ ERDUG  %XW WKHUHKDVEHHQDVWHDG\GHFOLQHHDFK\HDUVLQFHWKDWSRLQW/DVW \HDU WKH  SLFNLQJ VHDVRQ RQO\ VDZ DURXQG  DFUHVPHFKDQLFDOO\KDUYHVWHG6RLQDWLPHWKDWPDQXDOODERU LV EHFRPLQJ KDUGHU DQG KDUGHU WR ¿QG ZK\ LV PHFKDQLFDO KDUYHVWLQJ VHHPLQJ WR VKULQN DW OHDVW LQ VKHHU QXPEHUV RI DFUHV":K\DUHZHJRLQJEDFNZDUGVLQDWLPHWKDWLWLVYLWDOO\ LPSRUWDQWWRPRYHIRUZDUG" 5HFHQWO\ 'U )ULW] 5RND ZDV QDPHG WR WDNH RYHU WKH OHDG RQ PHFKDQLFDO KDUYHVWLQJ ZLWK 8)¶V &LWUXV 5HVHDUFK DQG (GXFDWLRQ &HQWHU  +H KDV JLYHQ KLV LQVLJKW WR WKH GHFOLQH RIWKHPHFKDQLFDOKDUYHVWHUV¶SURJUHVV'U5RNDEHOLHYHVLW FDQ DOO EH VXPPHG XS LQ RQH ZRUG JUHHQLQJ  +H VWDWHV WKH PDMRULW\ RI WKH PHFKDQLFDOO\ KDUYHVWHG DFUHV ZHUH LQ 6RXWK )ORULGDZKLFKZDVKLW¿UVWDQGKDUGHVWE\JUHHQLQJ+HDOVR EHOLHYHVWKHORVVRIPDWXUHWUHHVORZHUHGWKHHI¿FLHQF\RIWKH KDUYHVWHUVDQGEHJDQWRLPSDFWWKHHFRQRPLFEHQH¿WRIXVLQJ WKHPDFKLQHV 6LQFH WKH GUHDGHG JUHHQLQJ GLVHDVH WRRN URRW LQ )ORULGD LW KDV VHHPLQJO\ RYHUVKDGRZHG PRVW RWKHU LVVXHV DQG ULJKWO\ VR  +RZHYHU ZH KDYH OHDUQHG WHFKQLTXHV WR KHOS OLYH ZLWK JUHHQLQJDQGDOWKRXJKLWLVVWLOODKXJHWKUHDWLWLVDOVRWLPHWR JHWEDFNWRRWKHULQGXVWU\LVVXHVDWWKHVDPHWLPH0HFKDQLFDO KDUYHVWLQJLVGH¿QLWHO\RQHRIWKRVH

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;


$V ZH KDYH VHHQ WUHH KHDOWK LQFUHDVH GXH WR WKH SURGXFWLRQ V\VWHPV QRZ EHLQJXWLOL]HGLQWKHHUDRIJUHHQLQJWKH FRQFHUQVRIWUHHVWUHVVIURPPHFKDQLFDO KDUYHVWLQJ DUH DFWXDOO\ PXFK OHVV RI D IDFWRU WKDQ WKH\ ZHUH RULJLQDOO\  7KLV LV RQH RI WKH EHQH¿WV QRZ LQ SODFH WKDW FRXOG PDNH PHFKDQLFDO KDUYHVWLQJ WKDW PXFKPRUHRIDSRVVLELOLW\ 7KHUH LV D QHZ DEVFLVVLRQ SURGXFW ZKLFK ZLOO VRRQ EH ODEHOHG IRU FLWUXV 5HVHDUFKHUV DUH YHU\ RSWLPLVWLF WKLV SURGXFW FRXOG EH D NH\ FRPSRQHQW LQ DLGLQJPHFKDQLFDOKDUYHVWLQJ2QHRIWKH FRQFHUQVKDVDOZD\VEHHQWKH³EHDWLQJ´ WKH WUHHV JHW IURP WKH PDFKLQHV  7KH DEVFLVVLRQ SURGXFW ZLOO DOORZ WKH IUXLW WREHUHPRYHGPXFKHDVLHUDQGZLOOQRW UHTXLUHVXFKDYLROHQWVKDNLQJRIWKHWUHH FDQRS\

Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

$V ZLWK HYHU\ FKDOOHQJH WKH )ORULGD FLWUXV LQGXVWU\ IDFHV WKH ODERU DQG KDUYHVWLQJ RQH LV YHU\ OLNHO\ WR EH RYHUFRPH  +RZHYHU WKDW ZLOO QRW EH ZLWKRXW PXFK WULDO DQG HUURU DQG GH¿QLWHO\ QRW ZLWKRXW JURZHUV VWHSSLQJ XS DQG WDNLQJ WKH OHDG  ,Q WKH ZRUOG HFRQRP\ZHPXVWGREXVLQHVVLQWRGD\ VWD\LQJHFRQRPLFDOO\FRPSHWLWLYHLVQRW RQO\YLWDOEXWLWLVDOVRYHU\IDVWSDFHG 7KHPRYHPHQWRIDVPDOOHUODERUIRUFHLV ZHOOXQGHUZD\DQGJURZHUVHYHU\ZKHUH ZLOOQHHGWREHLQYROYHGDQGVXSSRUWLYH LQ\HWDQRWKHUSKDVHRILQGXVWU\FKDQJH -XVW DV WKH VHDVRQV FKDQJH VR GR WKH SUDFWLFHV RI SURGXFLQJ FLWUXV  /RRN DURXQGDQGQRWLFHWKH¿UVWVLJQVRIWKRVH FKDQJHVDQGWKHQJRZLWKWKHP1RRQH FDQVWRSWKHFRRODLURI)DOOIURPUROOLQJ LQ DQG QR RQH ZLOO EH DEOH WR VWRS WKH FKDQJHVRIKDUYHVWLQJZKLFKDUHFRPLQJ LQWKHGLUHFWLRQRIWKHFLWUXVLQGXVWU\

Heartland InTheFieldMagazine




'/).' 'REEN #!,,!7!9¬ &!2-3¬'2%%.¬ 3(!6).'3¬ "YÃ&#x2C6;2USTYÃ&#x2C6;(ARTLINE

W

KHWKHU \RX DUH ZDONLQJ WURWWLQJ ORSLQJ RU JDOORSLQJ WKH KRRI DQG OHJ KHDOWK RI \RXU KRUVH LV RQH RI WKH PRVW LPSRUWDQW DVSHFWV RI VRXQGQHVV LQ \RXU DQLPDO:KLOHGLHWDQGH[HUFLVHUHPDLQVWDSOHVLQWKH FDUHRIHTXLQHHQVXULQJSURSHUEHGGLQJDQGVWDEOH FRQGLWLRQVVKRXOGEHDWRSSULRULW\WRKRUVHRZQHUV  $FFRUGLQJ WR 'U .\OHH 'XEHUVWHLQ $VVLVWDQW 3URIHVVRU RI (TXLQH 6FLHQFH DW WKH 8QLYHUVLW\ RI *HRUJLD WKH WKUHH PRVW LPSRUWDQW LVVXHV WR DGGUHVV ZKHQ LW FRPHV WR WKH VRXQGQHVV RI \RXU DQLPDOV DUH SUHYHQWLQJ KRRI SUREOHPV 7KUXVK  SURYLGLQJ DGHTXDWH FXVKLRQLQJ DQG SUHYHQWLQJ DPPRQLD ZLWKLQ VWDOOV 7KUXVK LV D EDFWHULDOLQIHFWLRQRIWKHKRRIRIDKRUVH7KHPDLQ FDXVHV RI WKLV SUREOHP DUH LQDGHTXDWH EHGGLQJ PRLVWXUHDQGEDFWHULDZLWKLQVWDOOV3URSHUFOHDQLQJ DQGPDLQWHQDQFHRIVWDEOHVLVLPSRUWDQWLQSUHYHQWLQJ WKLVLVVXH

Ã&#x2C6; Heartland InTheFieldMagazine

 :KHQVWDOOVDUHQ¶WPDQDJHGSURSHUO\DVLGH IURP7KUXVKWKHEXLOGXSRIDPPRQLDIURPDQLPDO XULQHDQGZDVWHFDQOHDGWRUHVSLUDWRU\SUREOHPVDQG RWKHUPDMRULVVXHV%HGGLQJVXFKDVZRRGVKDYLQJV KD\ DQG GLUW FDQ HDVLO\ EHFRPH D EUHHGLQJ JURXQG IRU EDFWHULD IXQJXV DQG RWKHU PLFURELDO GLVHDVHV LI QRW SURSHUO\ PDLQWDLQHG :KHQ EX\LQJ EHGGLQJ SURGXFWV RZQHUV VKRXOG ORRN IRU TXDOLWLHV VXFK DV DEVRUEHQF\ ORZ WR QR GXVW SDUWLFOHV DV ZHOO DV YDOXHFRQVLGHULQJWKLVLVDSURGXFWGHVLJQHGWREH GLVSRVDEOHDQGUHJXODUO\FKDQJHG  &DOODZD\ )DUPV 0DQXIDFWXULQJ LV D SUHPLXP ZRRG VKDYLQJV FRPSDQ\ RXW RI :DVKLQJWRQ *$ WKDW KDV UHFHQWO\ SDWHQWHG D EHGGLQJSURGXFWGHVLJQHGWRQRWRQO\DGGUHVVLVVXHV RIDEVRUEHQF\EXWDOVRFRPEDWEDFWHULDOIXQJDODQG RWKHUPLFURELDOLVVXHVZLWKLQVWDOOV*UHHQ6KDYLQJV DV WKHLU QDPH VXJJHVWV LV D YLVXDOO\ VWULNLQJ QHZ SURGXFW WKDW WXUQV D IHZ KHDGV MXVW RQ WKHLU FRORU DORQH7KLVQHZSURGXFWIURPDOLQHRIH[FHSWLRQDO DQLPDOEHGGLQJRSWLRQV&DOODZD\)DUPVKDVWRRIIHU LV FXUUHQWO\ WKH RQO\ SDWHQWHG DQWLEDFWHULDO DQWL IXQJDODQGDQWLPLFURELDOSURGXFWRQWKHPDUNHW  :LWK WKH XVH RI D FRPPRQ RUJDQLF IRRG DGGLWLYHSRWDVVLXPVRUEDWHIRXQGLQPDQ\SURGXFWV WKDW ZH XVH RQ D GDLO\ EDVLV &DOODZD\ )DUPV KDV GHYHORSHG *UHHQ 6KDYLQJV D EHGGLQJ SURGXFW WKDWJRHVEH\RQGWKHHYHU\GD\LVVXHVRISURYLGLQJ FXVKLRQLQJDQGDEVRUEHQF\ZLWKLQVWDOOV7KHQDPH RI WKH JDPH LV DOO DERXW SUHYHQWLRQ :KHQ \RX FDQ SUHYHQW WKH VWDUW RI EDFWHULDO IXQJDO DQG RWKHU PLFURELDOJURZWKWKHEDWWOHRIKRRIDQGOHJKHDOWKLV KDOIZD\RYHU Ã&#x2C6;/CTOBERÃ&#x2C6;


 $QG\%RZHUV*HQHUDO0DQDJHUDQG&(2RI &DOODZD\)DUPV0DQXIDFWXULQJKDGWKLVWRVD\³WKH LGHDRIKDYLQJDWUHDWHGEHGGLQJSURGXFWLVDOODERXW SUHYHQWLRQLWV VDIH FRQYHQLHQWDQG DQ HFRQRPLFDO ZD\WRDGGUHVVDQROGLVVXHZKLFKLVVDQLWDU\DQGGU\ VWDOO FRQGLWLRQV´ ³:H ZDQWHG WR GHYHORS D SURGXFW WRLQKLELWWKHJURZWKRIZKDWZHDW&DOODZD\)DUPV FRLQHG )XQN\ 6WXII´ 7KH µIXQN\ VWXII¶ %RZHUV UHIHUVWRLVWKHEDFWHULDDQGIXQJXVWKDWJURZLQGDPS DQGGDUNHQYLURQPHQWVOLNHWKRVHSUHVHQWLQVWDEOHV DQGKRUVHVWDOOV  7KHUH DUH VRPH FRQFHUQV ZLWK XVLQJ D SURGXFWWKDWLVWUHDWHGDURXQGDQLPDOVEXWDV%RZHUV VWDWHG ³WKH DGGLWLYH LV VDIH RGRUOHVV WDVWHOHVV DQG LVIRXQGLQIRRGSURGXFWVOLNHFKHHVHVGULQNVZLQHV DQG SKDUPDFHXWLFDOV WR SUHYHQW PROG \HDVW DQG RWKHUIXQN\VWXII´7KHJUHHQFRORUDWLRQRIWKHZRRG VKDYLQJV LV ¿[HG WR WKH SURGXFW DIWHU LW LV WUHDWHG DQGGRHVQRWUXERIIZKHQWKH\DUHZHW3UHYHQWLQJ D SUREOHP EHIRUH LW RFFXUV VDYHV WLPH PRQH\ DQG HQVXUHVWKHKHDOWKRI\RXUDQLPDOV

DOO DERXW SUHYHQWLRQ 0DNH VXUH \RXU VWDOOV DUH FOHDQHG GU\ DQG ZKHQWKHEHGGLQJKDVGRQHLWVMRE PDNH VXUH WR UHSODFH LW UHJXODUO\ 7KHUHDUHPDQ\SURGXFWVRXWWKHUH EXWQH[WWLPH\RXJRWR\RXUORFDO IHHGVWRUHRUIDUPVXSSO\FRPSDQ\ WKLQN DERXW SXUFKDVLQJ D EHGGLQJ SURGXFW WKDW LV SDWHQWHG WR LQKLELW WKH JURZWK RI IXQN\ VWXII ZLWKLQ \RXUDQLPDOV¶VWDOOV*R*UHHQDQG ORRN LQWR *UHHQ 6KDYLQJV IURP &DOODZD\ )DUPV 0DQXIDFWXULQJ 3URWHFW \RXU DQLPDO LQYHVWPHQW DQG HQMR\ WKH WLPH \RX KDYH ZLWK WKHP E\ NHHSLQJ WKHP KHDOWK\ )RU PRUH LQIRUPDWLRQ YLVLW KWWS ZZZFDOODZD\IDUPVXV

 7KHFRVWRIVXFKDQDPD]LQJSURGXFWPD\EH DQRWKHUFRQFHUQIRUWKRVHORRNLQJWRYHQWXUHRXWDQG WU\DSURGXFWGHVLJQHGWRSUHYHQWKHDOWKSUREOHPVLQ \RXU DQLPDOV :KLOH WKHUH LV D VOLJKW GLIIHUHQFH LQ SULFH IURP RWKHU ZRRG VKDYLQJ SURGXFWV WKDW GRQ¶W KDYH EDFWHULDO DQG PLFURELDO UHVLVWDQFH WKH FRVW RI SUHYHQWLQJWKHLVVXHVEHIRUHWKH\RFFXULVPXFKPRUH HFRQRPLFDOWKDQSD\LQJIRUPHGLFDOWUHDWPHQWVIURP YHWHULQDULDQVDQGFRQVWDQWYLVLWVIURP\RXUIDUULHU  7KH KHDOWK RI \RXU DQLPDOV LV RQH RI WKH PRVWLPSRUWDQWWKLQJVRZQHUVVKRXOGDGGUHVV3URSHU KHDOWK FRQWULEXWHV WR WKH VRXQGQHVV DQG DWWLWXGH RI DQLPDOV DQG , DP QRW VXUH DERXW \RX EXW , ZRXOG UDWKHU QRW ULGH D KRUVH ZLWK VRUH KRRYHV 7KH EHVW ZD\ WR HQVXUH \RXU DQLPDO LV KHDOWK\ DQG KDSS\ LV

Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

Heartland InTheFieldMagazine




By Ron Lambert

ROAD TRIP

New Orleans, Louisiana

Greetings to each and every one of you good folks out in the Heartland; a great place to live and a wonderful place to return to. I am going to share my accounts of a recent trip to the region surrounding New Orleans, Louisiana. È Heartland InTheFieldMagazine

È/CTOBERÈ


$ &UHROH SODQWHU QDPHG -DFTXH 7HOHVSKRUH 5RPDQ EXLOW WKH KRPH LQ  ,Q LWV KH\GD\ LW ZDV RQH RI WKH ODUJHU VXJDU SODQWDWLRQV LQ WKDW UHJLRQ 7RGD\ LW LV D 1DWLRQDO +LVWRULF /DQGPDUNDQGDWUXO\LPSUHVVLYHVLJKW WR EHKROG  $OO LQ DOO \RX ZLOO YLHZ D IDLUO\ GLYHUVH DJULFXOWXUH SDODWH LQ DQG DURXQG6W-DPHV3DULVK

,Q$XJXVW,WRRNDURDGWULSRXWWKHUH 2IFRXUVH\RXDUHQHYHUPRUHWKDQD DQGZKLOHYLVLWLQJ,ZDVDEOHWRVHHDORW IHZKXQGUHG\DUGVIURPWKH0LVVLVVLSSL RILQWHUHVWLQJDJULFXOWXUHUHODWHGDUHDV 5LYHU  7KH OHYHH LV RZQHG DQG PDLQWDLQHGE\YDULRXV/HYHHERDUGVDQG :H¿UVWYLVLWHG/DXUD3ODQWDWLRQQHDU WKH86$UP\&RUSRI(QJLQHHUV,QRWHG 9DFKHULH/D9DFKHULHLVD)UHQFKZRUG WKDWKLNLQJDQGELNHWUDLOVDUHEHLQJEXLOW PHDQLQJDFDWWOHUDQFK/DXUD3ODQWDWLRQ IRUUHFUHDWLRQDOXVHLQPDQ\DUHDV ZDV RZQHG E\ &UHROH IDPLOLHV QDPHG 'X3DUFDQG/RFRXO7KLVSODQWDWLRQZDV :KHQ WKH /DXUD 3ODQWDWLRQ¶V KRPH KHOG E\ WKHVH IDPLOLHV IURP  XQWLO DQGJDUGHQVZHUHUHVWRUHGLQWKH¶V   2QH WKLQJ WKDW VWDQGV RXW LQ WKH , KDG D KDQG LQ KHOSLQJ ORFDWH 3KRHQL[ ZULWWHQ KLVWRU\ RI WKLV SODQWDWLRQ ZDV &DQDULHQVLV3DOPVWKDWZHUHWUDQVSRUWHG WKDWLWZDVRSHUDWHGE\WKHZRPHQRIWKH IURP )ORULGD DQG LQVWDOOHG LQ D IRUPDO IDPLO\WKHHQWLUHWLPHWKDWLWZDVRZQHG JDUGHQRQWKHJURXQGV E\WKHVHIDPLOLHV 2Q RQH ¿QDO QRWH UHJDUGLQJ /DXUD 7RGD\ /DXUD 3ODQWDWLRQ LV RSHQ WR 3ODQWDWLRQ LQ WKH HDUO\ \HDUV WKH VODYHV YLVLWRUV DV DQ H[DPSOH RI D ZRUNLQJ WROGVWRULHVZKLFKFORVHO\UHVHPEOHGWKH SODQWDWLRQ KRPH  ,W UHPDLQV PXFK DV -RHO&KDQGOHU+DUULVERRN³8QFOH5HPXV LW DSSHDUHG LQ WKH \HDUV EHIRUH WKH FLYLO DQG%UHU5DEELW´,Q$OFHH)RUWLHU ZDU,WZDVEXLOWZLWKQDWLYHF\SUHVVFXW FRPSLOHG DQG SXEOLVKHG D ERRN WLWOHG DQG PLOOHG RQ VLWH  7KH EULFN WKDW ZDV ³&RPSDLU /DSLQ´ ZKLFK ZDV SULQWHG LQ XVHGZDVPDGHRQWKHSURSHUW\DVZHOO )UHQFK WKDW LV VLPLODU WR ³8QFOH 5HPXV 7KH /DXUD 3ODQWDWLRQ LV OLVWHG RQ WKH DQG%UHU5DEELW´7KRXJKQRRQHNQRZV 1DWLRQDOUHJLVWHURI+LVWRULFSODFHVDQG IRUVXUHMXVWKRZWKLVVLPLODULW\RFFXUUHG LVWRGD\DYHU\LQWHUHVWLQJVLWHWRYLVLWLI EXW LW LV DQRWKHU LQWHUHVWLQJ SDUW RI WKH \RXVKRXOGKDYHWKHRSSRUWXQLW\ $IULFDQ$PHULFDQKHULWDJH $GULYHXSRQWKHJUHDWULYHUURDGIURP WKH :HVW EDQN RI WKH 0LVVLVVLSSL ZLOO FDUU\\RXSDVWYDVW¿HOGVRIVXJDUFDQH PRVWRIZKLFKDUHRZQHGE\PHPEHUVRI WKH 6W -DPHV 6XJDU &RRSHUDWLYH  <RX ZLOO DOVR VHH D IDLU DPRXQW RI VR\EHDQV JURZQLQWKLVDUHD Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

, DOVR KDG D YLVLW WR /DXUHO 9DOOH\ 3ODQWDWLRQ ZKLFK LV ORFDWHG LQ /D)RXUFKH 3DULVK QHDU 7KLERGDX[ /DXUHO9DOOH\LVPDLQWDLQHGDVDPXVHXP ZLWK ROG PDFKLQHU\ VODYH FDELQV DQG D FRPSDQ\ VWRUHPXVHXP PXFK DV LW DSSHDUHGLQLWVSULPH7KHFXUDWRURI WKHPXVHXPVKRZHGPHDQH[DPSOHRI FRPSDQ\ VFULSW RU PRQH\ SULQWHG DQG XVHGDVSD\PHQWWRWKHZRUNHUVDIWHUWKH FLYLOZDU<RXZHUHSDLGZLWKFRPSDQ\ LVVXHGVFULSWWRSXUFKDVHVXSSOLHVDWWKH FRPSDQ\ VWRUH SLFWXUHG KHUH  /DXUHO 9DOOH\3ODQWDWLRQFXUUHQWO\SODQWVPDQ\ KXQGUHGVRIDFUHVRIVXJDUFDQH,WZDV YHU\ SUHWW\ RQ ERWK VLGHV RI WKH URDGV VWUHWFKLQJXQWLOLWVHHPHGRXWRIVLJKW :KLOHWKHUH,VSRNHWRDPDQQDPHG -RH /D%RHXI ZKR H[SODLQHG WR PH LQ GHWDLO WKH SURFHVV ZKHUHE\ \RX FRXOG EXLOGDZRRGHQERDWDVLVSLFWXUHGKHUH 7KLV LV DQ H[DPSOH RI D 3LHUUH 3DUW VNLII $W WKLV PXVHXP HYHU\ 6DWXUGD\

9HU\ QHDU WR /DXUD 3ODQWDWLRQ \RX ZLOO FRPH XSRQ WKH VWXQQLQJ YLHZ RI D GRXEOH URZ RI OLYH RDNV  LQ DOO DQG VSDFHG  IHHW DSDUW  7KHVH WUHHV DUH DURXQG  \HDUV ROG  7KH\ IUDPH WKH HQWUDQFH IURP WKH 0LVVLVVLSSL ULYHU WR 2DN$OOH\3ODQWDWLRQ Heartland InTheFieldMagazine




DFODVVRQERDWEXLOGLQJLVKHOG ,QWHUHVWHG SHRSOH FDQ WDNH SDUW LQ D VHULHV RI FODVVHV DQG DFWXDOO\EXLOGWKHLURZQERDWRU SLURJXH /DXUHO9DOOH\LVPDLQWDLQHG E\ D QRQSUR¿W JURXS )ULHQGV RI /DXUHO 9DOOH\  9ROXQWHHU JURXSV DUH KDUG DW ZRUN SUHVHUYLQJ WKHVH ROG EXLOGLQJV DQG PDFKLQHU\ IRU WKH EHQH¿W RI IXWXUH JHQHUDWLRQV ZKR DOO WRR VRRQ ZLOO NQRZ QRWKLQJ RI WKLVSDUWRIWKHLUKHULWDJH :H DOVR YLVLWHG WKH KRPH RI WKH :HVWZHJR +LVWRULFDO 6RFLHW\  7KLV LV D PXVHXP ORFDWHGLQWKHIRUPHUKRPHDQG VWRUHRI'XUDF7HUUHERQQH7KLV VWRUH ZDV D RQH VWRS VKRS IRU WKH SHRSOH RI WKLV FRPPXQLW\ 7KH\ZHUH¿VKHUPHQWUDSSHUV IDUPHUV OXPEHUPHQ VKLS EXLOGHUV DQG ZKDW LW WRRN WR PDNH D FRPSOHWH DQG YLEUDQWSRSXODWLRQFHQWHU ,KDYHUHDGDQXPEHURIROGERRNVRI DFFRXQWV RI DJULFXOWXUH LQ /RXLVLDQD  , KDYHDOZD\VIRXQGVRPHWKLQJRILQWHUHVW LQWKHVHKLVWRULFDOSDJHV,RQFHPHWDQ ROGODG\QDPHG0UV4XLQHWWH,GRQRW UHFDOOKHU¿UVWQDPHKRZHYHUKHUIDWKHU ZDV UHFRJQL]HG DV WKH ¿UVW WR JURZ

VWUDZEHUULHV LQ /RXLVLDQD  6KH DOVR WROG PH RI WKH ORVV RI WKH IDPLO\ FLWUXV WUHHV WR FDQNHU LQ WKH HDUO\ SDUW RI WKH FHQWXU\ DURXQG   7KLV IDPLO\ KDV OLYHGRQWKHVDPHSLHFHRIODQGIURQWLQJ WKH0LVVLVVLSSL5LYHUDW1LQH0LOH3RLQW VLQFH   7KHLU RULJLQDO KRPH ZDV ORFDWHG QHDU WKH VLWH RI WKH &KDOPHWWH %DWWOH¿HOG  (YHQ WRGD\ WKLV LV FDOOHG (QJOLVK7XUQ

<RX KDYH DOO KHDUG WKH VRQJ 7KH %DWWOH RI 1HZ 2UOHDQV  7KHVH IRONV OLYHG ULJKW ZKHUH WKH EDWWOH WRRN SODFH DQGWKHLUKRPHZDVGHVWUR\HGE\FDQQRQ ¿UHVRWKH\PRYHGXSULYHUWR0DJQROLD /DQH 3ODQWDWLRQ  7KLV LV DQRWKHU SODQWDWLRQ KRPH EXLOW LQ  ORFDWHG RQ WKH 2OG 6SDQLVK 7UDLO DW RQH WLPH WKHRQO\ZDJRQURDGIURPWKH:HVWLQWR 1HZ2UOHDQV 2QWKH:HVWEDQNRIWKH0LVVLVVLSSL ULYHUEHORZ1HZ2UOHDQVLV3ODTXHPLQH DQG 6W %HUQDUG 3DULVK  ,Q WKLV UHJLRQ OLYHVDIDPLO\QDPHG%HFQHOZKRKDYH EHHQ JURZLQJ 6DWVXPD &LWUXV WKHUH IRU  \HDUV  , ZDV WKHUH QRW PXFK PRUH WKDQ RQH ZHHN EHIRUH 6RXWK (DVW /RXLVLDQD ZDV KLW E\ KXUULFDQH ,VDDF -XGJLQJ E\ QHZV UHSRUWV WKHVH DUHDV VXIIHUHGDJUHDWGHDORIGDPDJH , ZDQW WR VD\ WKDW , UHDOL]H WKDW QRW DOORIZKDW,KDYHZULWWHQGHDOVGLUHFWO\ ZLWK DJULFXOWXUH  , ZLOO VWDWH KRZHYHU WKDWZLWKRXWDJULFXOWXUHRIYDULRXVIRUPV QRQHRIWKHVHSODQWDWLRQVZRXOGKDYH EHHQEXLOW7KURXJKRXWP\OLIH,IHHO, KDYHEHQH¿WHGJUHDWO\E\WDNLQJWKHWLPH WRKHDUZKDWRWKHUVKDGWRVD\DQGVKDUH ZLWK PH DERXW WKHLU KHULWDJH  , WKDQN \RXDOOIRUJLYLQJPHWKHRSSRUWXQLW\WR VKDUHVRPHGHWDLOVDQGSLFWXUHVRIDYHU\ UHZDUGLQJWULS

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;


È

/CTOBERÈÈ

Heartland InTheFieldMagazine




È Heartland InTheFieldMagazine

È/CTOBERÈ


È

/CTOBERÈÈ

Heartland InTheFieldMagazine




Monica Anuez

Jamie Brammeier

Faveola Carrillo

Personal Banker

Customer Service Specialist

Sr. Personal Banker

Shannon Conrad

Kristy Crawford

Sr. Customer Service Specialist Commercial Loan Officer/VP

Sherri Enfinger Consumer Loan Officer

Heather Hancock

Jennifer Lafferty

Cecilia Rodriguez

Executive Assistant

Residential Lender/AVP

Sr. Personal Banker

Tabitha Trent

John Williams

Branch Manager/VP

Community President/SVP

CenterState Bank’s Core Values: Local Market Driven • A Long Term Horizon • World Class Service Relationship Banking • Faith and Family

863.763.5573 2100 South Parrott Ave. • Okeechobee, FL 34974 w w w. c e n t e r s t a t e b a n k . c o m

È Heartland InTheFieldMagazine

È/CTOBERÈ


SEBRING HAS BEEN IN BUSINESS 100 YEARS! HAPPY BIRTHDAY, SEBRING!

È

/CTOBERÈÈ

Heartland InTheFieldMagazine




&%!452%$ää!24)34

*!-%3Ã&#x2C6;2Ã&#x2C6;(!(. 7nBdg\VcIVnadgCdgg^h

:KDWEHJDQDVDQLQVSLUHG\HDU ROG SUHDFKHU¶V NLG YLVLWLQJ %DQII &DQDGD EHFDPH RQH RI WKH FUHDWRUV RI WKH &DEEDJH 3DWFK .LGV WKH PXUDOLVW IRU 3DWURQ 7HTXLOD DQG WKH DUWLVW FRPPLVVLRQHG WR 6HEULQJ IRU WKH &HQWHQQLDO 0XUDO  -DPHV 5 +DKQ 3URGXFWLRQVZLOOEHSDLQWLQJDIWZLGH E\IWWDOOPXUDOLQ'RZQWRZQ6HEULQJ RQ WKH FRUQHU RI 0DJQROLD $YH DQG 6RXWK5LGJHZRRG'ULYH -DPHV LV ERWK WDOHQWHG LQ DUW DQG PXVLF DV KH DQG KLV ZLIH RI DOPRVW  \HDUVKDYHZULWWHQRYHUVRQJV+H VD\VKLVZRUNLVYDULHGLWLVPRUHWKDQ MXVW WKURZLQJ D SDLQWLQJ RQ D ZDOO DQG VHOOLQJ LW  +H HQMR\V EHLQJ GLIIHUHQW DQG NHHSLQJ KLV PLQG RSHQ WR SURMHFWV WR KHOS VFKRROV EXVLQHVVHV FDPSV DQG XOWLPDWHO\ EULQJLQJ SHRSOH WRJHWKHU  ,I \RXWDNHDORRNDWKLVZRUN\RXZLOOVHH WKDWDQGLI\RXHYHUKDYHWKHFKDQFHWR VLW GRZQ DQG WDON ZLWK -DPHV \RX FDQ KHDU WKH SDVVLRQ IRU KLV ZRUN LQ KLV YRLFH +LV FDUHHU UHDOO\ VWDUWHG ZKHQ KH ZDV LQ FROOHJH DQG ;DYLHU 5REHUWV

Ã&#x2C6; Heartland InTheFieldMagazine

UHFUXLWHG -DPHV DQG  RWKHUV WR EHJLQ WKH&DEEDJH3DWFK.LGV-DPHVZDVWKH RULJLQDO PXUDOLVW WR SDLQW WKH FDEEDJH SDWFK+HVDLGWKDWIURPWKDWH[SHULHQFH KH UHDOL]HG ³(YHQ FUD]\ DUWLVWLF LGHDV FDQEHOLIHFKDQJLQJWKLQJVLI\RXWUHDWLW OLNHDEXVLQHVVDQGDUHSDVVLRQDWHDERXW LW´  7KH +DKQ¶V KDG D JDOOHU\ LQ 9HUR %HDFKIRU\HDUVDQG-DPHV¶ZRUNLV IHDWXUHGLQPDQ\KLJKHQGKRPHVRQWKH (DVW&RDVWIURP9HUR%HDFKWR0LDPL 6LQFH WKHQ WKH\ KDYH PRYHG WKHLU EXVLQHVVWR6HEULQJDQGZLOOEHRSHQLQJ D WRS RI WKH OLQH JDOOHU\ RQ /DNHYLHZ 'ULYH  7KH ORFDWLRQ ZLOO KRVW PDQ\ JDOOHU\ HYHQWV DQG ZLOO IHDWXUH D 9,3 &RQIHUHQFH5RRPDQHYHQWURRPDQGD PHGLDURRP7KH+DKQ¶VDUHQRWQHZWR WKHZRUOGRIKLJKHQGJDOOHU\HYHQWVDV WKHLU JDOOHU\ ZDV KRQRUHG WR GHEXW WKH 3DQDVRQLF'0RWLRQ)LOP&DPHUD 7KH &HQWHQQLDO PXUDO WKDW +DKQ ZLOO EH EULQJLQJ WR OLIH LQ 6HEULQJ ZLOO LQFRUSRUDWH PDQ\ SLFWXUHV RI WKLV \HDU WRZQ DQG VKRXOG EULQJ EDFN PHPRULHVWRPDQ\,WZLOOGHSLFWVFHQHV LQFOXGLQJ D VHDSODQH RYHU WKH ODNH

UDFLQJ YLJQHWWHV LPDJHV RI WKH FLWUXV DQG FDWWOH LQGXVWU\ DUFKLWHFWXUDO LFRQV DQGSKRWRVERWKROGDQGPRGHUQ-DPHV VDLG³,WZLOOORRNOLNHDQROGSRVWFDUG WKDW¶V VWDQGLQJ ULJKW RQ WKH VLGH RI WKH URDG,WZLOOPDNH\RXVPLOHDV\RXDUH ZDONLQJE\´ 6SRQVRUV DUH VWHSSLQJ XS WR PDNH WKLV SRVWFDUG SODQ D UHDOLW\ RQ WKH FXUUHQW EODQN FDQYDV RI D ZDOO 7KH &HQWHQQLDO0XUDOVSRQVRUVDUH(VVHQWLDO 'HSRW 6HEULQJ 86 6SRUW $YLDWLRQ ([SR DQG $HURPHG  ,W LV EHFDXVH RI WKHVH FRPSDQLHV VXSSRUWLQJ WKH DUWV DQGWKHFLW\WKDWWKHPXUDOZLOOEHPDGH SRVVLEOH ,I \RX ZRXOG OLNH WR EHFRPH D VSRQVRURIWKLVWLPHOHVVSLHFHRIDUWLQ WKH +HDUWODQG DQG FHOHEUDWH 6HEULQJ¶V &HQWHQQLDO FRQWDFW -DPHV 5 +DKQ 3URGXFWLRQVDWRU\RXFDQ YLVLWWKHLUZHEVLWHDWZZZMDPHVUKDKQ FRP  -DPHV ZLOO EH SDLQWLQJ OLYH GXULQJ FHOHEUDWLRQ ZHHN VR LI \RX DUH DURXQG EH VXUH WR VWRS LQ DQG VHH KLV PDVWHUSLHFHFRPHWROLIH

Ã&#x2C6;/CTOBERÃ&#x2C6;


I keep our land productive.

I am Mosaic. Before we begin any mining for phosphate — an essential crop nutrient for growing food — Mosaic develops a government-approved plan for restoring the land to productive use after mining. As reclamation supervisor, I oversee the creation of wetlands, parks, wildlife habitats, and other areas for both people and wildlife to enjoy. Knowing I’m helping to preserve nature makes my work more than a job. Actually, it’s nothing short of a mission.

®

www.mosaicfla.com

È

/CTOBERÈÈ

Heartland InTheFieldMagazine




7/-!.ä).ä!'2)#5,452%

Genie

4),,-!.

By Robbie Sumner

“In my opinion, farming, whether it be exotic bulbs or animals for exotic leather, is the truest from of conservation.” – Genie Tillman

/NEÈPHONEÈCALLÈCANÈCHANGEÈTHEÈ COURSEÈOFÈTHEÈWHOLEÈDAY

VD\V *HQLH 7LOOPDQ ZKR DORQJ ZLWK KXVEDQG-RHRZQVDQGRSHUDWHV3DUNHU ,VODQG *DWRU )DUP  3URFHVVLQJ LQ /DNH 3ODFLG *HQLH KDQGOHV WKH ERRN NHHSLQJVDOHVDQGPDUNHWLQJDVSHFWVRI WKHEXVLQHVVZKLOH-RHWDNHVFDUHRIWKH RXWVLGH UHVSRQVLELOLWLHV OLNH IDFLOLWLHV PDLQWHQDQFH LQFXEDWLRQ DQG JDWRU FRXQWV :LWKHLJKWSHUPLWWHGIDUPVRQDFUHV RI ODQG 3DUNHU ,VODQG LV RQH RI WKH ROGHVWDQGODUJHVWRSHUDWLRQVRILWVW\SH LQ )ORULGD $FFRUGLQJ WR *HQLH WKH EXVLQHVV ZDV LQLWLDOO\ IRXQGHG EDVHG RQ -RH¶V SDVVLRQ IRU JDWRU KXQWLQJ ³:H VWDUWHG LQ WKH HDUO\ V DIWHU JDWRU IDUPLQJ EHFDPH OHJDO -RH EXLOW WKH IDFLOLWLHV ZH SXUFKDVHG RXU LQLWLDO VWRFN DQG MXVW NHSW JURZLQJ IURP WKHUH´

È Heartland InTheFieldMagazine

,Q WKH V *HQLH SDUWLFLSDWHG LQ D QXPEHU RI UHVWDXUDQW VKRZV DFURVV WKH 8QLWHG 6WDWHV LQ RUGHU WR SURPRWH DOOLJDWRU PHDW FRPPHUFLDOO\ 6KH H[SODLQV WKDW JDWRUV DUH IDUPHG IRU GLIIHUHQW UHDVRQV LQFOXGLQJ IRU WKHLU KLGHV PHDW DQG WKHVH GD\V HYHQ HQWHUWDLQPHQW³7KHPHDWPDUNHWQRZ LVDZHVRPHLW¶VDOOZHFDQGRWRNHHS RXU ORFDO UHVWDXUDQWV VXSSOLHG :H JHW WZR RU WKUHH FDOOV D GD\ IURP SHRSOH DFURVV WKH 86 ZKR ZDQW JDWRU PHDW ,W¶V JURZLQJ LQ SRSXODULW\ IURP 6WDWH )DLUVLQ0LQQHVRWDDQG1HZ<RUNWRWKH )URJ/HJ)HVWLYDOKHOGLQ)HOOVPHUH´ 7KHSRSXODULW\RIWHOHYLVLRQVKRZVOLNH 6ZDPS 3HRSOH DQG *DWRU %R\V KDVQ¶W KXUW HLWKHU 2Q WKH GD\ RI P\ YLVLW 7LOOPDQZDVVKLSSLQJWZRODUJHUJDWRUV RXW WR WKH 0LGZHVW WR EH XVHG E\ WKH

³6ZDPSPDVWHU´ -HII 4XDWWURFFKL LQ IDLU H[KLELWV DQG GHPRQVWUDWLRQV 7KH VDPHWZRJDWRUVZHUH¿OPHGZLWK-HII DQG/DUU\WKH&DEOH*X\IRUDVHJPHQW RI³2QO\LQ$PHULFD´GXHWREHDLUHGLQ )HEUXDU\7KH\DUHDOVRH[SHFWLQJ DYLVLWIURPWKHFUHZRI$ (FKDQQHO¶V 6KLSSLQJ:DUVIRUDSRWHQWLDOVHJPHQW KLJKOLJKWLQJWKHFKDOOHQJHVLQYROYHGLQ WKHWUDQVSRUWDWLRQRIDOOLJDWRUV ³7KLV LV D KLJKO\ UHJXODWHG LQGXVWU\ ± ZH OLYH D ¿VK ERZO OLIH´ *HQLH VD\V 7KH3DUNHU,VODQG)DUPLVOLFHQVHGDQG LQVSHFWHG E\ WKH )ORULGD 'HSDUWPHQW RI$JULFXOWXUH DQG LV +D]DUG$QDO\VLV &ULWLFDO &RQWURO 3RLQW &HUWL¿HG +$&&3 LV D 86 )RRG DQG 'UXJ $GPLQLVWUDWLRQ PDQDJHPHQW V\VWHP WKDW DGGUHVVHV IRRG VDIHW\ IURP UDZ SURGXFWLRQWRFRQVXPSWLRQ :KLOHPRVWRIWKHDOOLJDWRUVSURFHVVHG DW3DUNHU,VODQGDUHUDLVHGRQWKHIDUP WKH\DOVRJHWQXLVDQFHJDWRUVWKDWKDYH EHHQFDXJKWE\OLFHQVHGWUDSSHUVDQGWKH )ORULGD)LVKDQG:LOGOLIH&RQVHUYDWLRQ &RPPLVVLRQ RQHV KDUYHVWHG GXULQJ WKHDQQXDOSXEOLFKXQWDQGJDWRUVIURP SURSHUW\RZQHUVZKRSDUWLFLSDWHLQWKH 3ULYDWH /DQGV $OOLJDWRU 0DQDJHPHQW 3URJUDP DGPLQLVWHUHG E\ WKH ):& ³7KHUH GRHVQ¶W VHHP WR EH DV PXFK È/CTOBERÈ


SDUWLFLSDWLRQ LQ WKDW SURJUDP DV WKHUH XVHG WR EH EHFDXVH WKH YDOXH RI KLGHV KDVGURSSHG´DGGV*HQLH +DWFKLQJVHDVRQIRUDOOLJDWRUVW\SLFDOO\ VWDUWV LQ PLG$XJXVW DQG , IRXQG WKH LQFXEDWLRQ KRXVH IXOO RI QHVWLQJ ER[HV HDFK¿OOHGZLWKVWHULOL]HGVWDJQXPPRVV DQG FRQWDLQLQJ DQ DYHUDJH RI  HJJV 1HZERUQ JDWRUV DUH DERXW VL[ LQFKHV ORQJ DQG -RH PRYHV WKHP WR D ZDWHU WURXJK ZLWK DGGHG DQWLELRWLFV IRU WKHLU ¿UVW  KRXUV RI OLIH EHIRUH WKH\ DUH UHORFDWHGWRRQHRIWKHODUJHUKRWKRXVHV 7KH JURZWK RI DOOLJDWRUV LQ FDSWLYLW\ LV PXFK IDVWHU WKDQ IRU WKRVH LQ WKH ZLOG VLQFH WKHLU OLYLQJ FRQGLWLRQV DUH FRQWUROOHG $FFRUGLQJ WR *HQLH WKHLU JDWRUV DYHUDJH  PRQWKV WR UHDFK D OHQJWK RI  LQFKHV7KH ³VNLQQHUV´ DUH W\SLFDOO\ KDUYHVWHG EHWZHHQ  DQG  LQFKHVSURGXFLQJWRSRXQGVRIPHDW DQG FRPPHUFLDO KLGHV WKDW FDQ EH XVHG IRUHYHU\WKLQJIURPZDWFKEDQGVSXUVHV DQGVKRHV(YHU\SDUWRIDQDOOLJDWRUFDQ EH XVHG LQFOXGLQJ WKHLU EORRG ZKLFK LV RIWHQ XVHG IRU WHVWLQJ PHGLFDO EORRG FDOLEUDWLRQPDFKLQHV

QRWKLQJ OLNH WUDGLWLRQDO URVHV´ H[SODLQV *HQLH ³7KH\ DUH DFWXDOO\ PRUH OLNH FDODGLXPV EHLQJ D WURSLFDO EXOE ± WKH\ VKDUHJURZLQJVHDVRQVDQGKDYHVLPLODU FDUHUHTXLUHPHQWV´7KLVZRUNVRXWZHOO VLQFHWKH7LOOPDQVKDGJURZQFDODGLXPV SULRU WR JDWRU IDUPLQJ 7KH WXEHURVH¶V ZKLWH Ã&#x20AC;RZHU KHDG JURZV DW WKH HQG RI D JUDVVOLNH VWDON DQG LV RIWHQ XVHG LQ +DZDLLDQOHLV

*HQLH LV D PHPEHU RI WKH +LJKODQGV &RXQW\ )DUP %XUHDX DQG WKH )ORULGD $OOLJDWRU 0DUNHWLQJ DQG (GXFDWLRQ $GYLVRU\ &RPPLWWHH 6KH KDV DOVR YROXQWHHUHGZLWKDOOLJDWRUH[KLELWVDWWKH +LJKODQGV DQG 2NHHFKREHH &RXQW\¶V $J9HQWXUHSURJUDPV6KHDQG-RHKDYH FKLOGUHQJUDQGFKLOGUHQDQGJUHDW JUDQGFKLOGUHQ ,Q  -RH KDG KHDUW WUDQVSODQW VXUJHU\$FFRUGLQJ WR *HQLH ³+HKDVUXQWKHVKRHVRIIWKHUHVWRIXV ,QDGGLWLRQWRWKHDOOLJDWRUVWKH7LOOPDQV VLQFH WKHQ :H¶UH YHU\ WKDQNIXO WR EH DOVRJURZWXEHURVHVRQVL[DFUHVRIWKHLU DEOHWRFRQWLQXHZRUNLQJWRJHWKHUGRLQJ ODQGDQGDUHWKHRQO\86JURZHUVRIWKH ZKDWZHORYH´ ³GRXEOH SHDUO´ YDULHW\ ³7XEHURVHV DUH Ã&#x2C6; /CTOBERÃ&#x2C6;Ã&#x2C6;

Heartland InTheFieldMagazine




HEARTLAND MAZE SOME A-MAIZE-ING FACTS It takes the average visitor more than one hour to discover the puzzle’s exit, while those who make all the correct decisions can complete the task in 15-30 minutes. The origin of the maze is lost in prehistory - some five millenia ago. The first cornfield maze, however, was created in Pennsylvania in 1993. Sparking a new “agritainment” industry, there are now hundreds worldwide.

Agritainment comes to Hardee County 7KH+HDUWODQG0D]HLQ%RZOLQJ*UHHQ LVDKXPDQODE\ULQWKFDUYHGLQWRDDFUH ¿HOG2ZQHGE\+HDUWODQG(YHQWV//& DQG RSHUDWHG E\ $* 2XWGRRU :RUOG ,QF DQG +HQGHUVRQ )DPLO\ )DUPV LW ZDV GHVLJQHG E\ %UHWW +HUEVW ± QRZ WKHZRUOG¶VOHDGLQJGHVLJQHURI FRUQ PD]HV 'HVLJQHG WR FKDOOHQJH WKH ZLWVRIWKRVHDWWHPSWLQJWR¿QGWKHRQH H[LW IURP PLOHV RI WZLVWV WXUQV DQG GHDGHQGVWKHSX]]OHSURYLGHVDXQLTXH VRXUFH RI JRRG IDUPLQ¶ IXQ IRU DGXOWV DQGFKLOGUHQDOLNH 7KH ¿UVW RI WKH LQFUHDVLQJO\SRSXODU ³0$L=( FUD]H´ WR UHDFK WKH +DUGHH &RXQW\WKHODE\ULQWKLVGHVLJQHGLQWKH VKDSHRIWKH+DUGHH&RXQW\/RJRDORQJ ZLWK WKH ORJR RI WKH +DUGHH :LOGFDWV DQG $* 2XWGRRU :RUOG  2Q DYHUDJH PD]HJRHUV ZLOO ZDQGHU IRU PRUH WKDQ DQKRXUVHHNLQJWKHODE\ULQWK¶VRQHDQG RQO\H[LW 7KHUH ZLOO EH D NLGV VHFWLRQ RI WKH PD]H D KD\ EDOH PD]H FRZ WUDLQ KD\ULGHFRUQFDQQRQGXFNUDFHVSOD\ DUHDKDXQWHGKRXVHPHUFKDQWDQGIRRG YHQGRUVSXPSNLQVIRUVDOHDQGPRUH

È Heartland InTheFieldMagazine

7+( 0$L=( ZLOO RSHQ 2FWREHU  WKURXJK1RYHPEHU+RXUVDUH )ULGD\ SP ± SP 6DWXUGD\ DP ± SP6XQGD\SP±SP7XHVGD\ ±)ULGD\±)LHOGWULSV RWKHUHYHQWVE\ UHVHUYDWLRQ  ,W LV ORFDWHG DW  86 +LJKZD\  1RUWK %RZOLQJ *UHHQ $GPLVVLRQLVDVIROORZV$JHVDQGXS DGPLVVLRQSOXVWD[$JHVDQGXS WLFNHW SDFNDJHV   XS LQFOXGHV DGPLVVLRQ  $JHV  DQG XQGHU DUH )5((  *URXS GLVFRXQWV DUH DYDLODEOH IRUDQGXSLVRIIDQGJURXSVRI RUPRUHZLOOUHFHLYHRII  7KH 0$L=( KDV ³VSURXWHG´ LQWR WKH ZRUOG¶VODUJHVWFRUQ¿HOGPD]HFRPSDQ\ DQG ZLOO RSHUDWH PRUH WKDQ  VLWHV DFURVVWKH8QLWHG6WDWHV&DQDGD3RODQG DQG (XURSH WKLV \HDU 7KH FUHDWLRQ RI 8WDKQ %UHWW +HUEVW WKH FUD]H EHJDQ ZKHQ WKH HQWUHSUHQHXU LQWURGXFHG WKH ODUJHVWFRUQPD]HFUHDWHGLQWKHZHVWHUQ 8QLWHG 6WDWHV WR $PHULFDQ )RUN 8WDK LQ:LWKWKDW¿UVWDWWHPSWGUDZLQJ PRUH WKDQ  YLVLWRUV LQ RQO\ WKUHH ZHHNV WKH VXFFHVVIXO ZRUOGZLGH YHQWXUHKDVQRZFKDOOHQJHGPLOOLRQVRI FXULRXVPD]HJRHUV

7KLV \HDU WKH 0$L=(¶V  VLWHV DUH VFDWWHUHG WKURXJKRXW ¿YH FRXQWULHV $ FRPSOHWHOLVWLQJRIDOOORFDWLRQVFDQEH IRXQGDWZZZWKHPDL]HFRP ,Q VXSSRUW RI DJULFXOWXUDO HGXFDWLRQ 7KH0$L=(KDVFUHDWHGDQHOHPHQWDU\ HGXFDWLRQ FDPSDLJQ WKDW LQFOXGHV FXVWRPL]HG ³FODVVURRP LQ WKH FRUQ´ OHVVRQ SODQV DQG DFWLYLW\ VKHHWV IRU WHDFKHUV RQVLWH GLVSOD\V DQG WRXUV LQ VRPH ORFDWLRQV GLVFRXQWHG ¿HOG WULS RSSRUWXQLWLHV DQG D ³SDVVSRUW´ WKDW LQWHJUDWHV HGXFDWLRQ LQWR WKH PD]H H[SHULHQFH DQG KHOSV JXLGH FKLOGUHQ DQGIDPLOLHVDORQJWKHFRUUHFWSDWKZD\ $OVRDYDLODEOHWRWKHSXEOLFDUHSDVVSRUW VXEMHFWV LQFOXGLQJ LQWHUDFWLYH + $PHULFDQKLVWRU\+DOORZHHQWLQ\WRWV DQGVFULSWXUDO )RUPRUHLQIRUPDWLRQFDOOWKHLUKRWOLQH DW0$=(RUFKHFNRXWWKHZHE VLWHDWZZZWKHKHDUWODQGPD]HFRP

DQG +HQGHUVRQ)DPLO\ )DUPV//& È/CTOBERÈ


YOUTH

2/$%/Ã&#x2C6;2%35,43Ã&#x2C6;

%\5REEL6XPQHU

7KH )ORULGD +LJK 6FKRRO 5RGHR $VVRFLDWLRQ KHOGLWV¿UVWDQGVHFRQGURGHRVRIWKH \HDU DW WKH )UHG 6PLWK 5RGHR$UHQD %ULJKWRQ 6HPLQROH5HVHUYDWLRQRQ6DWXUGD\DQG6XQGD\ 6HSWHPEHUQGDQGUG 2I¿FLDO UHVXOWV ZHUH QRW DYDLODEOH DW SUHVV WLPH EXW GDLO\ ZLQQHUV RI HDFK HYHQW ZHUH UHSRUWHG DV IROORZV 6DWXUGD\ %DUHEDFN5LGLQJ±-XVWLQ0LOOV*RDW7\LQJ±-HVVLFD*UD\ 6WHHU:UHVWOLQJ±-RVHSK&ROOLQV7LH'RZQ5RSLQJ ±-RVHSK&ROOLQV%UHDNDZD\5RSLQJ±+ROO\*ULPDOGL 6DGGOH%URQF5LGLQJ±7XFNHU(YDQV%DUUHO5DFLQJ ±'DNRWD5DQGROSK7HDP5RSLQJ±&RG\&RQUR\  $DURQ %DUEHU  3ROH %HQGLQJ ± -DFH\ -RKQVRQ  %XOO 5LGLQJ ± =DFKDU\ +HLPDQQ  %R\V &XWWLQJ ± &DGH &RZDUW*LUOV&XWWLQJ±0DWWLH%DVV6XQGD\%DUHEDFN5LGLQJ ± -XVWLQ 0LOOV  *RDW 7\LQJ ±$VKWRQ /HDWKHUZRRG  6WHHU :UHVWOLQJ ± /XFDV %UDV¿HOG  7LH 'RZQ 5RSLQJ ± &RG\ &RQUR\  %UHDNDZD\ 5RSLQJ ± &DG\ &RRSHU  6DGGOH %URQF 5LGLQJ ± /DQH +\GHU  %DUUHO 5DFLQJ ± 'DNRWD 5DQGROSK 7HDP 5RSLQJ ± %UDQGRQ &DOOHQ  &ROW 0DWKHZV  3ROH %HQGLQJ ± &DUO\ 6WULFNODQG %XOO5LGLQJ±=DFKDU\+HLPDQQ%R\V&XWWLQJ± &DGH&RZDUW*LUOV&XWWLQJ±0DWWLH%DVV 7KH QH[W )+65$ HYHQW LV VFKHGXOHG IRU 2FWREHU WK DQG WK LQ )HOOVPHUH 9LVLW ZZZIKVUDKRPHVWHDGFRP IRU PRUH LQIRUPDWLRQDQGWKHFRPSOHWHOLVWRIRI¿FLDOUHVXOWV 7KH $OO )ORULGD -XQLRU 5RGHR $VVRFLDWLRQ KHOG LWV WKLUG DQG IRXUWK URGHRV RI WKH  VHDVRQ DW WKH 2NHHFKREHH $JUL &LYLF &HQWHU RQ 6DWXUGD\ DQG 6XQGD\ 6HSWHPEHU QG DQGUG7KH$VVRFLDWLRQLVIRUER\VDQGJLUOVDJHVWR ZKRDUHQRW\HWROGHQRXJKWRFRPSHWHDWWKHKLJKVFKRROOHYHO %HOW EXFNOHV ZHUH DZDUGHG WR WKH ZHHNHQG DYHUDJH ZLQQHUV DVIROORZV6WHHU5LGLQJ&KDVH'L[RQ%XOO5LGLQJ7DQQHU 0DUWLQ7LH'RZQ5RSLQJ$EGLHO=DPRUD %DUUHO 5DFLQJ  0DWWL 0R\HU %UHDNDZD\ 5RSLQJ  $QG\ $OEULWWRQ*RDW7\LQJ0DWWLH0R\HU7HDP5RSLQJ5DOIDHO 'RPHQLJR DQG $QG\ $OEULWWRQ 3ROH %HQGLQJ  9DQHVVD 6DIHULJKWDQG&KXWH'RJJLQJ$EGLHO=DPRUD7KH*LUOV$OO $URXQGEXFNOHZDVZRQE\0DWWL0R\HUDQG$EGLHO=DPRUD WRRNKRPHWKH%R\V$OO$URXQGEXFNOH 7KHQH[W$)-5$HYHQWLVVFKHGXOHGIRU2FWREHUWKDQGVW DWWKH.LVVLPPHH6SRUWV$UHQD7KH\DUHDOVRKROGLQJDJROI WRXUQDPHQW IXQGUDLVHU DW WKH 2NHHFKREHH *ROI DQG &RXQWU\ &OXE1RYHPEHUUG9LVLWZZZDIMUDFRPRUFDOO5HQH)ORZHUV IRUPRUHLQIRUPDWLRQ Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

Heartland InTheFieldMagazine




È Heartland InTheFieldMagazine

È/CTOBERÈ


È

/CTOBERÈÈ

Heartland InTheFieldMagazine




#/6%2Ã&#x2C6;34/29

SEBRING CENTENNIAL: !Ã&#x2C6;',!.#%Ã&#x2C6;).4/Ã&#x2C6;4(%Ã&#x2C6;(%!24,!.$Ã&#x2C6;#)493Ã&#x2C6;()34/29 %\ 0RUJDQ7D\ORU1RUULV /LQGVH\6HEULQJ

*

HRUJH (XJHQH 6HEULQJ ZDV TXLWH IDPLOLDUZLWKWKHZD\RIOLIHZHRIWHQ UHIHU WR LQ WKH +HDUWODQG ,Q IDFW KH FKRVHWKH6HEULQJDUHDWRVHWWOHDIWHUD¿VKLQJWULS WR/DNH-DFNVRQLQ3DUWRIWKHUHDVRQWKDW KHFODLPHGZLQWHUUHVLGHQFHLQ)ORULGDIURP2KLR EHVLGHVWKHFOLPDWHRIFRXUVHZDVIRUWKHKXQWLQJ DQG ¿VKLQJ $V ZH WDNH D EULHI JODQFH LQWR WKH KLVWRU\RIWKLV\HDUROGFLW\LQWKH+HDUWODQG ZHZLOOVHHWKDWRXUDJULFXOWXUDOURRWVUHDFKEDFN WRZKHQWKLVWRZQ¿UVWEHJDQ *HRUJH¶V RULJLQDO SODQ ZDV WR DFTXLUH ODQG LQ WKHFHQWUDOKLJKODQGVDUHDRIWKHVWDWHWRFUHDWHD FRPPXQLW\EXLOWDURXQGFLWUXVSURGXFWLRQ7KDW YHQWXUH LQ  VWDUWHG ZLWK D SORW RI ODQG QHDU $XEXUQGDOH DQG RQH LQ WKH /DNH $OIUHG DUHD $IWHUWKHVHDWWHPSWVZLWKEXVLQHVVSDUWQHUVZHUH XQVXFFHVVIXO *HRUJH GHFLGHG WR ORRN HOVHZKHUH DQGRQO\SDUWQHUZLWKKLVVRQ2UYHO

Ã&#x2C6; Heartland InTheFieldMagazine

*HRUJHDQGKLVEURWKHUVVWDUWHGPDQ\EXVLQHVV YHQWXUHV WRJHWKHU LQ 2KLR LQFOXGLQJ HVWDEOLVKLQJ WKH WRZQ RI 6HEULQJ 2KLR DQG D VXFFHVVIXO SRWWHU\ EXVLQHVV :KHQ LW FDPH WR EXVLQHVV UHODWLRQVKLSV*HRUJHIRXQGWKDWSDUWQHULQJZLWK IDPLO\LQVWHDGRIRWKHUSDUWQHUVPLJKWEHWKHZD\ WRJR$ZULWHUZKRNQHZERWKRIWKH6HEULQJPHQ GHVFULEHG *HRUJH DV ³LPDJLQDWLYH UHVRXUFHIXO DQG LQFOLQHG WR EH FRQVHUYDWLYH´ ZKLOH KLV VRQ 2UYHOZDV³YLVLRQDU\«DQGZLOOLQJWRWDNHPRUH WKDQFDOFXODWHGULVNV´7KRVHTXDOLWLHVRIIDWKHU DQGVRQFRPSOLPHQWHGHDFKRWKHUZHOODQGPDGH WKHPDJUHDWWHDP :LWKWKHKHOSRIUHDOWRU$*6PLWKRI:DXFKXOD WKDWVHDUFKIRUWKHULJKWODQGWRVHWWOHRQZDVRYHU 6PLWK EURXJKW *HRUJH RQ D ¿VKLQJ WULS WR /DNH -DFNVRQDQGLWZDVWKHQKHGHFLGHGWKDWWKHEDQNV RIWKRVHFU\VWDOFOHDUZDWHUVZRXOGEHZKHUHWKH\ ZRXOGEXLOGWKHLUWRZQ+HUHFRJQL]HGWKH Ã&#x2C6;/CTOBERÃ&#x2C6;


7KH 6HEULQJV ZHUH VR H[FLWHG DERXW VWDUWLQJ WKH ORFDO FLWUXV LQGXVWU\ WKDW WKH\ SODQWHG D ³1XUVHU\ *DUGHQ´ GRZQWRZQ ,Q WKH JDUGHQ WKH\ ZRXOG KROG GHPRQVWUDWLRQV IRU SRWHQWLDO EX\HUV  7KH GHPRQVWUDWLRQ ZRXOGWHDFKEX\HUVKRZWRSODQW WKH FLWUXV WUHHV DV ZHOO DV KRZ WR SODQW DGGLWLRQDO FDVK FURSV DPRQJ WKH WUHHV ZKLOH ZDLWLQJ IRUWKHWUHHVWREHDUIUXLW  SRWHQWLDO IRU FLWUXV SURGXFWLRQ DV ZHOO DV WKH QDWXUDO EHDXW\ DQG GHFLGHG WKDW WKHHDVWHUQVKRUHRI/DNH-DFNVRQZRXOG EH WKH LGHDO ORFDWLRQ IRU WKH WRZQ VLWH 7KXV D WUDFW RI ODQG DSSUR[LPDWHO\  DFUHV ZDV SXUFKDVHG IURP 6PLWK DQGWKHSODQQLQJEHJDQ 7KH 6HEULQJ PHQ HQOLVWHG WKH DLG RI FLYLOHQJLQHHU$&1\GHJJDURI:LQWHU +DYHQ WR SORW WKH XQXVXDO UDGLDO WRZQ SODQ WKDW JLYHV 6HEULQJ LWV QDPH RI ³&LW\ RQ WKH &LUFOH´ WRGD\  $ VHFRQG VXUYH\RU - : 7XUQHU RI /DNHODQG FDPH LQ WR ¿QLVK WKH SODQV DQG WKH\ EHJDQWKHFOHDULQJRI&LUFOH3DUN7KH ¿UVW VWUXFWXUH WR EH EXLOW RQ WKH FLUFOH ZDV WKH 6HEULQJ 5HDO (VWDWH &RPSDQ\ RI¿FH%\7KH6HEULQJ5HDO(VWDWH &RPSDQ\KDGDOLVWRISURSHUWLHVUHDG\ WREHVROG7KHEORFNVDORQJ5LGJHZRRG $YHQXHZHUHGLYLGHGLQWRWKUHHORWVSHU EORFNDQGRIIHUHGDWSHUSDUFHO $ORQJZLWKWKHSXUFKDVHRIDSDUFHORI ODQG FDPH DQ DGGLWLRQDO ORW SODQWHG ZLWKJUDSHIUXLWDQGRUDQJHWUHHV Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

7KHUHZHUHDQXPEHURIHDUO\VHWWOHUV WKDW ZHUH LQWHUHVWHG LQ WKH SURVSHFW RI FLWUXV SURGXFWLRQ LQ WKH DUHDV DURXQG WRZQ  2QH VHWWOHU VDLG ³2QH GLG QRW WKHQ KHDU RI DQ\ VXEGLYLVLRQV IRU 6HEULQJ«¶*URYHV¶ ZDV WKH FU\ DQG µVHFWLRQ QXPEHUV¶ D IDPLOLDU WHUP´ *HRUJH SODQQHG RQ WKH FLWUXV LQGXVWU\ IXHOLQJ WKH HFRQRP\ RI WKH FLW\ DORQJ ZLWKWRXULVPDQGDIWHU\HDUVFLWUXV LV VWLOO D VWURQJ KROG WKDW IXHOV WKH HFRQRP\ IRU WKH DUHD  7KLV LQGXVWU\ ZDVHYHQXVHGLQSDPSKOHWVWROXUHQHZ UHVLGHQWV WR WKH FLW\  2QH SDPSKOHW IURPUHDG³,I\RXZDQWWRVHHDQ RUDQJHDQGJUDSHIUXLWJURYHRI WUHHVFRPHWR6HEULQJ´ %HVLGHV VHHLQJ WKH RSSRUWXQLW\ WR LQFUHDVH FLWUXV SURGXFWLRQ DQG FDWWOH LQ WKH DUHD *HRUJH ZDV DOVR D PDQ GHHSO\ URRWHG LQ KLV IDLWK DQG JDYH SURSHUW\ LQ WKLV QHZO\ IRXQGHG FLW\ WR YDULRXV GHQRPLQDWLRQV ZDQWLQJ WR EXLOG D FKXUFK RU D V\QDJRJXH 7KLV KHOSHG EHJLQ PDQ\ FKXUFKHV WKDW DUH VWLOODURXQGDQGWKULYLQJWRGD\7KH¿UVW

FKXUFK VHUYLFHV EHIRUH FRQVWUXFWLRQ RI WKH EXLOGLQJV ZDV FRPSOHWH ZHUH KHOG RQ WKH FLUFOH DGMDFHQW WR WKH 6HEULQJ 5HDO (VWDWH &RPSDQ\  0DNHVKLIW FRYHULQJVZHUHDWWDFKHGWRWKHWUHHVDQG LWZDVGHHPHG³&KXUFKRIWKH7UHHV´ 7RGD\ DQ HQWLUH FHQWXU\ ODWHU PDQ\ RIWKHVDPHLGHDOVWKDWEURXJKW*HRUJH (XJHQH 6HEULQJ DQG KLV VRQ 2UYHO WR WKLVDUHDVWLOOH[LVW$ORWKDVKDSSHQHG VLQFHWKHIRXQGLQJLQDQGDOWKRXJK EXVLQHVVHV KDYH PRYHG DQG EXLOGLQJV XSGDWHG6HEULQJZLOODOZD\VEHWKH&LW\ RQ WKH &LUFOH MXVW DV *HRUJH HQYLVLRQ +LV ¿VKLQJ VSRW RQ /DNH -DFNVRQ LV VWLOO D GHVWLQDWLRQ VSRW IRU DQJOHUV DQG KXQWLQJ ZLOO DOZD\V EH D IDYRULWH SDVWLPH IRU PDQ\  7KH DJULFXOWXUDO URRWV WKDW ZHUH SODQWHG DUH VWURQJ DQG ZHRZHDSSUHFLDWLRQWRWKH6HEULQJVIRU WKH KRSHV WKH\ KDG IRU WKH LQGXVWU\ VR PDQ\GHFDGHVDJR 7RFHOHEUDWHWKLVZRQGHUIXOPLOHVWRQH IRUWKHFLW\RI6HEULQJWKHUHZLOOEHDQ HQWLUHZHHNRIFHQWHQQLDOHYHQWV)URP EHGUDFHVWRSDUDGHVWRD0D\RU¶V6WUHHW 'DQFH\RXFDQ¿QGDOLVWRIHYHU\WKLQJ RQSDJH7KHUHLVDOVRWKH&HQWHQQLDO 2GHZULWWHQE\&LW\0D\RU0U*HRUJH +HQVOH\ 'XULQJ WKH VWUHHW GDQFH WKH SODQ LV IRU WKH HQWLUH WRZQ WR VLQJ WKLV 2GHWRJHWKHUVRVWXG\XSRUMXVWEULQJ \RXU PDJD]LQH DQG IROORZ DORQJ  )RU PRUH LQIRUPDWLRQ DERXW WKH &HQWHQQLDO &HOHEUDWLRQ DQG (YHQWV YLVLW WKHLU ZHEVLWHDWZZZ6HEULQJFRP

(APPYÃ&#x2C6;"IRTHDAYÃ&#x2C6;3EBRING Heartland InTheFieldMagazine




CENTENNIAL ODE Written by City Mayor, Mr. George Hensley â&#x20AC;&#x2DC;Twas a warm and sunny day, when George Sebring came to play, the good hunting and the fishing were his game. And so then he looked around, Said, â&#x20AC;&#x153;I think Iâ&#x20AC;&#x2122;ll build a townâ&#x20AC;?, And he built the town that brought him lots of fame. Refrain: George E. Sebring, the town that bears his name, People came to know it far and wide. The descendents of the clan, Still pay tribute to the man, And the people of the town still share his pride.

6HEULQJ&HQWHQQLDO &HOHEUDWLRQ(YHQWV 2FWREHU  

'HVWLQDWLRQ'RZQWRZQ6HEULQJ+DOORZHHQ%DVK 30

2FWREHU

6HEULQJ+LJK6FKRRO+RPHFRPLQJ)RRWEDOO*DPH

2FWREHU  

6HEULQJ&HQWHQQLDO%HG5DFH $0

2FWREHU  

&LUFOHRI7UXWK&RQFHUW 30

2FWREHU

/LYLQJWKH/HJDF\&HQWHQQLDO3DUDGH

2FWREHU  

3DUW\RQWKH&LUFOHDQG(QWHUWKH 3HULRG&RVWXPH&RQWHVW30

2FWREHU

6SHFLDO&LW\&RXQFLO5HFHSWLRQ&LW\+DOO30

2FWREHU  

&RPPXQLW\&KXUFK6HUYLFH &LW\3LHU%HDFK30

2FWREHU    

'RZQWRZQ6HEULQJ&KDPEHU0L[HU 0D\RUÂśV6WUHHW'DQFHDQG7LPH&DSVXOH&HOHEUDWLRQ 30

2FWREHU  

%OHVVLQJRIWKH%XVLQHVV/XQFKHRQ .HQLOZRUWK/RGJH$0

2FWREHU  

&HQWHQQLDO%RDW3DUDGH&DU6KRZDQG3DUW\ &LW\3LHU%HDFK5RWDU\3DUN30

2FWREHU  

6HEULQJ&KDPEHU0DMRU7KRPDV0F*XLUH. +LJKODQGV+DPPRFN6WDWH3DUN$0

2FWREHU  

7KH*UDQG)LQDO%LUWKGD\%DVK /DNHVKRUH0DOO30

Ă&#x2C6; Heartland InTheFieldMagazine

Soon the word went out all, â&#x20AC;&#x153;Thereâ&#x20AC;&#x2122;s free land to hear Godâ&#x20AC;&#x2122;s callâ&#x20AC;?. And the people chose their place to hear his word. Then the church built in a day, started others on their way, just to sing and share the gospel of the Lord. Refrain Oh the shores of Jackson Lake, they call all around to take, a nice swim or a boat ride upon the blue. And so when the day is done, youâ&#x20AC;&#x2122;ll be thankful for the fun, and the town that George E. Sebring made for you. Refrain The good people of the snow, know just where they need to go, when the winter snow descends upon their street. Then they head to Sebring town, join the people all around, glad to find a place like home to warm their feet. Refrain Oh itâ&#x20AC;&#x2122;s been a hundred years, and the townâ&#x20AC;&#x2122;s still filled with cheers, and the people still are coming by the score. The good folks you will meet, still say â&#x20AC;&#x2DC;Howdyâ&#x20AC;? on the street, and weâ&#x20AC;&#x2122;re planning for at least a hundred more. Refrain

Ă&#x2C6;/CTOBERĂ&#x2C6;


)RUTXLFNFURSHVWDEOLVKPHQW EHWWHUVWDQGV

`

ĞĨŽƌĞ ƉůĂƐƚŝĐ

`

,QWHJUDWH PLFUREHV ZLWK IHUWLOL]HU DWRU EHIRUH SODQWLQJ

ĨƚĞƌ ƉůĂƐƚŝĐ

$YDLODEOH )URP tŚĂƚWĂƚŚǁĂLJ/^

tŚĂƚWĂƚŚǁĂLJ/^EKd

‡ ƉƌĞƐĐƌŝďĞĚŵŝĐƌŽďŝĂůďůĞŶĚŽĨƌŽŽƚĐŽůŽŶŝnjŝŶŐ ŵŝĐƌŽďĞƐͲĂĚǀĂŶĐĞĚƉƵƌĞĐƵůƚƵƌĞƐĐŝĞŶĐĞ

‡ EKdĂĐŽŵƉŽƐƚĞĚŵŝĐƌŽďŝĂůƉƌŽĚƵĐƚǁŝƚŚ ŝŶĐŽŶƐŝƐƚĞŶƚŝŶŐƌĞĚŝĞŶƚƐΘƉĞƌĨŽƌŵĂŶĐĞ

‡ ĨĞƌƚŝůŝnjĞƌĞŶŚĂŶĐĞŵĞŶƚƚŽŝŵƉƌŽǀĞŶƵƚƌŝĞŶƚĞĨĨŝĐŝĞŶĐLJ ‡ EKdĂĨĞƌƚŝůŝnjĞƌ͕ďƵƚĂƐŽŝůŝnjĞƌ ʹŵŝŶĞƌĂůŝnjĂƚŝŽŶĂŶĚƵƉƚĂŬĞ  ‡ ŚĞĂůƚŚLJƌŽŽƚͬŚĞĂůƚŚLJƉůĂŶƚĐĂƚĂůLJƐƚƚŚĂƚŵĂdžŝŵŝnjĞƐ ƉůĂŶƚƌĞƐŝƐƚĂŶĐĞƚŽĚŝƐĞĂƐĞΘƐƚƌĞƐƐ

‡ EKdĂĨƵŶŐŝĐŝĚĞŽƌŶĞŵĂƚŝĐŝĚĞ͕ďƵƚĂ ƉĞƌĨŽƌŵŝŶŐŝŶƉƵƚ

‡ ƉĞƌĨŽƌŵŝŶŐŵŝĐƌŽďŝĂůƐŽůƵƚŝŽŶǁŝƚŚƐƉĞĐŝĨŝĐƌŽůĞƐŝŶ LJŽƵƌĐƌŽƉĨĞƌƚŝůŝƚLJŵĂŶĂŐĞŵĞŶƚƉƌŽŐƌĂŵ

‡ EKdĂŶŽƚŚĞƌƵŶĚĞƌͲƉĞƌĨŽƌŵŝŶŐŝŶŐƌĞĚŝĞŶƚ

YYY2CVJYC[$KQ.QIKEEQO

È

/CTOBERÈÈ

Heartland InTheFieldMagazine




30%#)!,ä&%!452%

$).).'Ã&#x2C6;).Ã&#x2C6;4(%Ã&#x2C6;Ã&#x2C6;(%!24,!.$ The Hendry County Cattlemenâ&#x20AC;&#x2122;s Association

The Greatest Chefs of the South "YÃ&#x2C6;,INDSEYÃ&#x2C6;7IGGINS

3

URPRWLQJWKH%(()LQGXVWU\RQHULEH\HDWDWLPHPXVWEHWKH+HQGU\&RXQW\ &DWWOHPHQ¶V$VVRFLDWLRQ¶V +&&$ PRWWR$ERXWWLPHVSHU\HDU+&&$ %RDUG RI 'LUHFWRUV DQG PHPEHUV ¿UH XS WKHLU DPD]LQJ FXVWRP JULOOV DQG SUHSDUHDGHOLFLRXVIHDVW¿WIRUDNLQJ,QDGGLWLRQWRWKHLURZQDQQXDOHYHQWV DIXQGUDLVHUIDUPWRXUVDQGWKHPHPEHUVKLSPHHWLQJ+&&$KDVDOVRFRRNHGDWWKH ORFDO)DUP%XUHDXPHPEHUVKLSGLQQHUWKH\RXWKOLYHVWRFNEX\HU¶VGLQQHU*XOI&LWUXV HYHQWVDQGRWKHUFLYLFJURXSIXQFWLRQV±MXVWWRQDPHDIHZ7KH\DUHHTXLSSHGWR FRRNIRUWKHPDVVHVZLWKDODUJHRSHQÃ&#x20AC;DPHJULOODKXJHVPRNHUWZRJDOORQSRWV DQGXWLOLW\WUDLOHUVWRKDXOWKHUHVW2QHRIWKHODUJHVWFURZGV+&&$KDVHYHUVHUYHG ZDVH[WHQVLRQDJHQWVDQGWKHLUIDPLOLHVDWWKH1DWLRQDO$VVRFLDWLRQRI&RXQW\ $JULFXOWXUDO$JHQWVFRQIHUHQFH %HLQJVRPHRIWKHJUHDWHVWSURPRWHUVRIWKHDJULFXOWXUHLQGXVWU\WKH+&&$JULOOV DQGWUDLOHUVDUHDGRUQHGZLWKWKHSKUDVH³3URXGVWHZDUGVRI)ORULGDDJULFXOWXUH´)RU WKHSDVW\HDUVWKH$VVRFLDWLRQLQFRQMXQFWLRQZLWKWKH+HQGU\&RXQW\([WHQVLRQ 6HUYLFHSXWWRJHWKHUDIHZIDUPWRXUVHYHU\\HDUWRSURPRWH+HQGU\&RXQW\DJULFXOWXUH DQGDV\RXPD\KDYHJXHVVHGWKHSDUWLFLSDQWVDUHVHUYHGWKH&DWWOHPHQ¶VIDUHIRU OXQFK±VRPHKDYHEHHQDWWHQGLQJWKHVDPHWRXUIRUWKHSDVW\HDUVMXVWIRUWKHPHDO 7KH JURXSV WKDW +&&$ FRRN IRU DFWXDOO\ HQWLFH WKHLU SRWHQWLDO DXGLHQFH E\ SULQWLQJ RQ WLFNHWV DQG Ã&#x20AC;\HUV ³+HQGU\ &RXQW\ &DWWOHPHQ FRRNLQJ´ ± WKH PHDO LV WKDW SKHQRPHQDO 7KH\RQO\FRRNWKLFNFXW86'$&KRLFHULEH\HVVHDVRQHGWR SHUIHFWLRQZLWK(YHUJODGHV6HDVRQLQJFRRNHGWRRUGHURYHUD KRW FKDUFRDO Ã&#x20AC;DPH DQG VHUYHG JULOO VLGH  )L[LQ¶V LQFOXGH DQ HDURIVFUXPSWLRXVVZHHWFRUQIURPD6RXWK)ORULGD¿HOGDQGD EDNHGµWDWHU±VZHHWRU,ULVK +&&$¶VFRRNLQJWHFKQLTXHVKDYHEHHQSXWWRWKHWHVWDWWKH )ORULGD &DWWOHPHQ¶V$VVRFLDWLRQ¶V )&$  %HHI %ULVNHW &RRN 2IIZKLFKLVDVWDWHZLGHFRQWHVWKHOGLQ.LVVLPPHHGXULQJWKH 5DQFK5RGHR)LQDOVDQG+HULWDJH)HVWLYDO)RONVDWWHQGLQJWKH )HVWLYDOYRWHGDQGDZDUGHG+&&$ZLWKWKHQGSODFH³3HRSOH¶V &KRLFH´ DZDUG IRU WKHLU WDVW\ EULVNHW  6HUYHG DORQJVLGH WKH EULVNHW VDPSOH ZDV DQ +&&$ OHJHQGDU\ VZDPS FDEEDJH IULWWHU ZKLFK LV GHHS IULHG VZDPS FDEEDJH ± SUHWW\ PXFK D KRWFULVS\EDOORIKHDYHQ7KRVHIULWWHUVHDUQHG+&&$VRPH

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;


UHFRJQLWLRQDQGWKH\ZHUHDVNHGWRFRRNWKHPDWWKH )&$ /HJLVODWLYH 4XDUWHUO\ LQ 7DOODKDVVHH WKLV SDVW -DQXDU\7KHOREE\LVWVOHJLVODWRUVDQGWKHLUDLGVDWH WKHPE\WKHKDQGIXOV±GHVSLWHWKHLU1HZ<HDU¶VGLHW UHVROXWLRQ +&&$FHUWDLQO\KDVDORWWREUDJDERXWEXWWKH\ DUHYHU\KXPEOHDQGGRDOORIWKLVFRRNLQJIRUDJUHDW FDXVH±WKH\RXWKRI+HQGU\&RXQW\-XVWWKLV\HDU DORQHWKH&DWWOHPHQDZDUGHGLQVFKRODUVKLSV WR WKUHH VWXGHQWV SXUVXLQJ DQ DJULFXOWXUH GHJUHH $GGLWLRQDOO\ +&&$ KRVWV D \RXWK ³6WHDN &RRN 2II´GXULQJWKHLUDQQXDOPHPEHUVKLSPHHWLQJZLWK DFDVKSXUVHXSIRUJUDEV7KH+HQGU\&RXQW\ &DWWOHPHQ¶V$VVRFLDWLRQVXSSRUWVWKH\RXWKLQRWKHU YDULRXV ZD\V DV ZHOO VXFK DV SURYLGLQJ ¿QDQFLDO LQFHQWLYHV WR \RXWK EHHI H[KLELWRUV ZKR VKRZ FRXQW\ EUHG VWHHUV DQG WKH\ SXW RQ D \RXWK UDQFK URGHR 'HF WK  )HE UG  LQ FRQMXQFWLRQ ZLWK WKHLU TXDOLI\LQJ UDQFK URGHR )HE QG  UG  $OO LQ DOO«WKH +HQGU\ &RXQW\ &DWWOHPHQ¶V $VVRFLDWLRQ LV D JUHDW DVVHW WR +HQGU\ &RXQW\ DQG LWGRHVQ¶WKXUWWKDWWKH\PDNHWKHEHVWVWHDNDURXQG ,I\RXKDYHDQ\TXHVWLRQVDERXWDQ\RIWKH+HQGU\ &RXQW\&DWWOHPHQ¶VHYHQWVRULI\RXZRXOGOLNHWR SDUWLFLSDWH LQ WKH URGHR RU IDUP WRXUV SOHDVH FDOO  

Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

Heartland InTheFieldMagazine




2%#)0%ä/&ä4(%ä-/.4(

Tenderloin & Garlic-Roasted Vegetables Ingredients: ZKROHEHHIWHQGHUORLQURDVW WR SRXQGV

ODUJHKHDGJDUOLF WDEOHVSRRQVSOXVWHDVSRRQ ROLYHRLO SRXQGVSRWDWRHV VXFKDV ¿QJHUOLQJUXVVHWRUUHGSRWDWRHV  TXDUWHUHGLIODUJH VPDOORQLRQVKDOYHG VPDOOSOXPWRPDWRHVKDOYHG PHGLXP]XFFKLQLVOLFHG

Total recipe time: 1-1/2 to 2 hours Makes 15 to 20

Instructions:

3UHKHDWRYHQWRƒ)&XWDERXWLQFKRIIWRS RIJDUOLFKHDGH[SRVLQJFORYHV5HPRYHRXWHU SDSHU\VNLQOHDYLQJKHDGLQWDFW3ODFHLQFHQWHU RI LQFK VTXDUH KHDY\GXW\ DOXPLQXP IRLO GUL]]OHZLWKWHDVSRRQRLO%ULQJWZRRSSRVLWH VLGHVRIIRLORYHUJDUOLFVHDOZLWKGRXEOHIROG )ROGLQRSHQHQGVWRVHDO&RPELQHUHPDLQLQJ YHJHWDEOHV UHPDLQLQJ  WDEOHVSRRQV RLO  WHDVSRRQ ,WDOLDQ VHDVRQLQJ DQG  WHDVSRRQ EODFNSHSSHULQODUJHERZOWRVVWRFRDW &RPELQHUHPDLQLQJWHDVSRRQ,WDOLDQVHDVRQLQJ DQGWHDVSRRQSHSSHUSUHVVHYHQO\RQWRDOO VXUIDFHV RI EHHI URDVW 3ODFH URDVW RQ UDFN LQ VKDOORZ URDVWLQJ SDQ ,QVHUW RYHQSURRI PHDW WKHUPRPHWHU VR WLS LV FHQWHUHG LQ WKLFNHVW SDUWRIEHHI'RQRWDGGZDWHURUFRYHU3ODFH JDUOLFSRWDWRHVDQGRQLRQVRQULPPHGEDNLQJ VKHHW5RDVWWHQGHUORLQLQƒ)RYHQWR PLQXWHVIRUPHGLXPUDUHWRPLQXWHVIRU PHGLXP GRQHQHVV 5RDVW JDUOLF SRWDWRHV DQG RQLRQVPLQXWHV$GGWRPDWRHVDQG]XFFKLQL WR SDQ FRQWLQXH WR URDVW  PLQXWHV RU XQWLO YHJHWDEOHVDUHWHQGHU

WHDVSRRQVGULHG,WDOLDQ VHDVRQLQJGLYLGHG WHDVSRRQFUDFNHGEODFNSHSSHU GLYLGHG FXSSOXVWDEOHVSRRQVJUDWHG 3DUPHVDQFKHHVHGLYLGHG 6DOW

5HPRYH URDVW ZKHQ PHDW WKHUPRPHWHU UHJLVWHUV ƒ) IRU PHGLXP UDUH ƒ) IRU PHGLXP7HQWZLWKIRLO/HWVWDQGPLQXWHV 7HPSHUDWXUH ZLOO FRQWLQXH WR ULVH DERXW  GHJUHHV ) WR UHDFK ƒ) IRU PHGLXP UDUH ƒ)IRUPHGLXP

6TXHH]H JDUOLF SXOS RYHU YHJHWDEOHV VWLU WR FRPELQH 6SULQNOH ZLWK  FXS FKHHVH DQG VDOW DV GHVLUHG &DUYH URDVW VSULQNOH ZLWK UHPDLQLQJ  WDEOHVSRRQV FKHHVH 6HDVRQ ZLWK VDOWDVGHVLUHG6HUYHZLWKYHJHWDEOHV

Southern Womens Show • October 11-14, Orlando Convention Center December Quarterly Meeting • November 29-30, Lake City, Holiday Inn & Suites Florida Cattlewomen Beef Short Course • December 8, Gainesville Florida Cattlewomen Skeet Shoot • January 5, 2013, Quail Creek Plantation È Heartland InTheFieldMagazine

È/CTOBERÈ


5(*8/$56$/('$<6$1'7,0(6

021'$<·66$/(Â&#x2021;1221 %ULQJ\RXU&DWWOH6XQGD\DPWRSPRURQ6DOH'D\ 

:('1(6'$<·66$/(Â&#x2021;1221 %ULQJ\RXU&DWWOH7XHVGD\DPWRSPRURQ6DOH'D\ 

ZZZDUFDGLDVWRFN\DUGFRP /RFDWHGRQ+Z\ PLOHVQRUWKRI$UFDGLD)/

Â&#x2021;Â&#x2021;)D[

2ZQHGDQG2SHUDWHGE\&DUO0F.HWWULFNDQG-RH+LOOLDUG,,

Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

Heartland InTheFieldMagazine




&LORIDA Squash )NÈ3EASONÈ.OW

WWWFFVACOMÈÈÈÈÈÈÈÈÈÈTWITTERÈ&LA&RUITAND6EGÈÈÈÈÈÈÈÈ&ACEBOOKÈ&LORIDAÈ&RUITÈÈ6EGETABLEÈ!SSOCIATION

)FÈ YOUÈ THINKÈ ABOUTÈ IT È hSQUASHvÈ ISÈ KINDÈ OFÈ AÈ FUNNYÈ WORDÈ )TÈ SOUNDSÈLIKEÈSOMETHINGÈTHATÈSOMEONEÈSTEPPEDÈONÈORÈSOMETHINGÈ THATSÈDEmATEDÈLIKEÈANÈOLDÈBASKETBALLÈ4HEÈWORDÈACTUALLYÈCAMEÈ FROMÈ .ATIVEÈ !MERICANSÈ WHOÈ USEDÈ SEVERALÈ TERMSÈ TOÈ DESCRIBEÈ hSOMETHINGÈEATENÈRAWvÈ4HEÈ!MERICANÈCOLONISTSÈCOMBINEDÈTHEÈ TERMSÈTOÈCOMEÈUPÈWITHÈhSQUASHv 7KH FRORQLVWV VHQW VTXDVK VHHGV EDFN WR WKHLUFRXQWULHVRIELUWKZKHUHWKH\ZHUH GHYHORSHG  RYHU WKH \HDUV LQWR PDQ\ GLIIHUHQW YDULHWLHV$V \RX PLJKW H[SHFW IURPWKHVRXQGRIWKHZRUG³]XFFKLQL´ LWKDV,WDOLDQURRWV7KHVDPHVTXDVKKDV RWKHUQDPHVGHSHQGLQJRQZKHUHLWZDV JURZQ,WZDVEURXJKWEDFNWRWKH86 LQWKHHDUO\VDQGKDVEHHQSRSXODU KHUHHYHUVLQFH 7ZR FDWHJRULHV RI VTXDVK DUH JURZQ LQ WKH 8QLWHG 6WDWHV ± ZLQWHU VTXDVK DQG VXPPHU VTXDVK:LQWHU VTXDVK LQFOXGHV VSDJKHWWLDFRUQDQGEXWWHUQXW7KRVHDUH WKH W\SHV RI VTXDVK IRXQG LQ IDOO WDEOH GHFRUDWLRQV7KH\DUHWKLFNVNLQQHGDQG NHHSIRUXSWRVHYHUDOPRQWKV 6XPPHU VTXDVK LQFOXGHV ]XFFKLQL FURRNQHFN DQG VWUDLJKWQHFN W\SHV 6XPPHUVTXDVKLVKDUYHVWHGHDUOLHUWKDQ ZLQWHU VTXDVK DQG PXVW EH UHIULJHUDWHG XSWR¿YHGD\V LIQRWXVHGLPPHGLDWHO\ ,WKDVDKLJKZDWHUFRQWHQW

È Heartland InTheFieldMagazine

6TXDVKSODQWVKDYHERWKPDOHDQGIHPDOH ÀRZHUV %HHV DUH QHFHVVDU\ WR WUDQVIHU WKH SROOHQ IURP PDOH ÀRZHUV WR IHPDOH ÀRZHUV ,Q )ORULGD VXPPHU VTXDVK LQ KDUYHVWHG LQ WKH VSULQJ DQG IDOO 1HDUO\ DOO WKH )ORULGD FURS LV SURGXFHG IRU WKH IUHVK PDUNHW 0XFK RI LW LV JURZQ LQ 0LDPL 'DGH &RXQW\ ZLWK DGGLWLRQDO FURSV JURZQ LQ /HH +HQGU\ DQG &ROOLHU FRXQWLHVDVZHOODVVRPHDVIDUQRUWKDV +LOOVERURXJK &RXQW\ )ORULGD SURGXFHV PDLQO\VXPPHUVTXDVK 6TXDVK LV ORZ LQ FDORULHV DQG KLJK LQ YLWDPLQ $ DQG SRWDVVLXP  2QH FXS RI OLJKWO\ FRRNHG VXPPHU VTXDVK GHOLYHUV  FDORULHV J SURWHLQ  PJ FDUERK\GUDWHVQRIDWJGLHWDU\¿EHU ,8YLWDPLQ$DQGPJSRWDVVLXP VRXUFH-HDQ0HDGRZV([WHQVLRQ$JHQW ,9 &RRSHUDWLYH ([WHQVLRQ 6HUYLFH IRU 6DUDVRWD&RXQW\ 

$FFRUGLQJ WR 0DU\ .LQJ 8QLYHUVLW\ RI )ORULGD ,)$6 6DUDVRWD &RXQW\ ([WHQVLRQZLQWHUVTXDVK\LHOGVDERXWJ ¿EHUPJFDOFLXPPJSRWDVVLXP  PJ YLWDPLQ &  FDORULHV  ,8 YLWDPLQ$PFJIRODWHPJLURQ DQGPJQLDFLQ7KRVHVFRUHVDUHIRU EDNHGDFRUQVTXDVK 6XPPHUVTXDVKDUHLQWKHLUSULPHZKHQ VOLJKWO\ VPDOO DQG ¿UP ZLWK VPRRWK JORVV\VNLQDQGIUHHRIVSRWVRUEUXLVHV &KRRVHZLQWHUVTXDVKWKDWDUHVRPHZKDW KHDY\ DQG KDYH D KDUG GHHSFRORUHG ULQG6WRUHLQDFRROGU\DQGGDUNSODFH IRUDPRQWKRUORQJHUGHSHQGLQJRQWKH YDULHW\ 6XPPHU VTXDVK PD\ EH HDWHQ UDZ RU FRRNHG:LQWHUVTXDVKLVXVXDOO\EDNHG EXWFDQEHVWHDPHGVLPPHUHGRUPDVKHG +HUHDUHDFRXSOHRIZD\VWRHQMR\\RXU VTXDVKWKLVVHDVRQ

È/CTOBERÈ


3UMMER¬3QUASH¬ ¬'RILLED¬3UMMER¬3QUASH ¬ ¬ ¬ ¬ ¬ ¬ ¬ ¬

#UT¬SQUASH¬INTO¬¬TO¬ž¬INCH¬THICK¬SLICES¬AND¬PLACE¬ON¬BAMBOO¬SKEWERS¬¬ THAT¬HAVE¬BEEN¬SOAKED¬IN¬WATER¬FOR¬AT¬LEAST¬¬MINUTES "RUSH¬SQUASH¬WITH¬MELTED¬BUTTER¬OR¬COOKING¬OIL¬ON¬BOTH¬SIDES¬BEFORE¬PLACING¬¬ ON¬THE¬GRILL 0LACE¬SQUASH¬ON¬THE¬GRILL¬OVER¬DIRECT¬MEDIUM¬HEAT #OOK¬FOR¬¬TO¬¬MINUTES¬ON¬EACH¬SIDE¬4URN¬WHEN¬lRST¬SIDE¬IS¬BROWNED 4HE¬SQUASH¬IS¬DONE¬WHEN¬IT¬IS¬NICELY¬BROWNED¬ON¬EACH¬SIDE¬AND¬IS¬TENDER¬¬ WHEN¬POKED¬WITH¬A¬FORK¬¬3ERVE¬HOT

2ECIPE¬FROM¬0AULA¬3AYER ¬-ASTER¬'ARDENER ¬5NIVERSITY¬OF¬#ALIFORNIA¬#OOPERATIVE¬%XTENSION

7INTER¬SQUASH¬ ¬2OASTED¬!CORN¬3QUASH s¬ ¬SMALL¬ACORN¬SQUASH s¬ 6EGETABLE¬COOKING¬SPRAY s¬ ¬TABLESPOONS¬BUTTER ¬MELTED s¬ ¬TABLESPOONS¬LIGHT¬BROWN¬SUGAR s¬ —¬TEASPOON¬SALT s¬ ¬TEASPOON¬GROUND¬GINGER s¬ —¬TEASPOON¬GROUND¬CINNAMON #UT¬EACH¬SQUASH¬IN¬HALF¬CROSSWISE¬2EMOVE¬AND¬DISCARD¬SEEDS¬#UT¬SQUASH¬ HALVES¬INTO¬QUARTERS¬¬0LACE¬SQUASH ¬SKIN¬DOWN ¬ON¬LARGE¬BAKING¬SHEET¬COATED¬ WITH¬COOKING¬SPRAY¬#OMBINE¬BUTTER¬WITH¬REMAINING¬INGREDIENTS¬AND¬BRUSH¬EVENLY¬ OVER¬CUT¬SIDES¬OF¬SQUAH¬#OVER¬LOOSELY¬WITH¬FOIL¬AND¬BAKE¬AT¬¬DEGREES¬FOR¬¬ MINUTES¬¬5SE¬A¬TYPE¬OF¬PAN¬THAT¬WILL¬KEEP¬THE¬SQUASH¬UPRIGHT¬AND¬LEVEL¬TO¬HOLD¬ THE¬SPICED¬BUTTER 2ECIPE¬FROM¬-ARY¬+IND ¬&AMILY¬¬#ONSUMER¬3CIENCES ¬5NIVERSITY¬OF¬&LORIDA)&!3 ¬3ARASOTA¬#OUNTY¬%XTENSION



  



    74(538< ;4.9*;< <7*<<"'<+*



764/<<8*99:1<)5:1<276(<-6;;3 .9496%< 97<+6920.;8<7<8:693-<+473: :9<80++96:<;764/</5;428,<!!<27/8,<

  <8:693-<.195.;<&96<;764/<8;7893< +6920.5:/<732<<0745:/<:1690-190: ;:;32;2<+5.(8,<5-1<0745:/<276( -6;;3%<8*99:1<&605:%<)5:1<:1;<7 545:/<:9 *753:753<4;3-:1<:1690-190:<*04+4; +5.(8,<!!<27/8,<

 

9* 53;8<:1;< ;3;:<9&<5608< 6;858:73.;<)5:1<8:693-</5;428<9& 80+;6<8;4;.:<&605:,<9428<4;3-:1 032;6<8:6;88,<<27/8,<    ;;2)7/<;-;:7 4;<;;28< '$< 673;<5;42< 972%<35:<' 7(;4732%<<''$   <))),8;;2)7/,.9*<<<$'"$""

È

/CTOBERÈÈ

Heartland InTheFieldMagazine




Russ Leonardâ&#x20AC;&#x2122;s

"YÃ&#x2C6;"RIANÃ&#x2C6;.ORRIS

(ANDCRAFTEDÃ&#x2C6;.OVELTYÃ&#x2C6;4RUCKS 7KLQNEDFNWRZKHQ\RXZHUHDFKLOGDQG UHPHPEHUVRPHRIWKHWR\VWKDW\RXKDG WR SOD\ ZLWK &KDQFHV DUH RQH RI WKRVH WR\VZDVPDGHRIZRRG)RUXVER\VLW ZDV SUREDEO\ D WUXFN RI VRPH VRUW DQG IRUWKHODGLHVLWFRXOGKDYHEHHQDGROO <HDUV DJR WKHUH ZDV D JRRG FKDQFH WKLV ZRRGHQ WR\ ZDV KDQG FUDIWHG E\ VRPHRQHPXFKGLIIHUHQWWKDQWKHSODVWLF PDVV JHQHUDWHG RQHV RI WRGD\ 0D\EH SXUFKDVHGDWWKHWRZQIDLURUPDGHE\D IDPLO\PHPEHURUIULHQG 1RZ WKDW \RX¶UH ROGHU \RX FDQ DSSUHFLDWH WKH FUDIWVPDQVKLS DQG GHWDLO RIVRPHWKLQJKDQGFUDIWHGRXWRIZRRG 7KHVH GD\V WKH DUW RI ZRRGZRUNLQJ LV IDGLQJ DQG VRPHWKLQJ WUXO\ KDQGPDGH FDQ EH GLI¿FXOW WR ¿QG %XW ZKHQ ZH DUHDEOHWR¿QGWKDWKDQGFUDIWHGSLHFHRI IXUQLWXUH WR\ RU GHFRUDWLRQ ZH WHQG WR WUHDWLWZLWKPXFKPRUHUHVSHFWWKDQZH GLGDVNLGV:HDUHRIWHQYHU\SURXGWR RZQLWDQGZDQWWRVKRZLWRII :KDW LI \RX FRXOG KDYH \RX YHU\ RZQ WR\ VL]HG YHUVLRQ RI WKH WUXFNV DQG HTXLSPHQW WKDW \RX RU \RXU FRPSDQ\

Ã&#x2C6; Heartland InTheFieldMagazine

XVHVHYHU\VLQJOHGD\":KDWLI\RXFRXOG GLVSOD\ WKDW VHPL RU WUDFWRU ZLWK \RXU FRPSDQ\QDPHZULWWHQRQWKHVLGHULJKW LQ\RXUKRPHRURI¿FH"7KHUHLVDPDQLQ 6HEULQJZKRFDQPDNHWKDWKDSSHQ+LV QDPHLV5XVV/HRQDUG

FRQWLQXHG ZLWK KLV SDLQWLQJ EXVLQHVV ,Q  5XVV ZDV ORRNLQJ WKURXJK KLV ERRNVKHOIDQGIRXQGWKDWERRNKLVIULHQG OHW KLP ERUURZ \HDUV DJR $V KH ZDV ORRNLQJ WKURXJK WKH ERRN KH QRWLFHG D WUDFWRU WUDLOHU DQG GHFLGHG WKDW LW ZRXOG

5XVV LV D SDLQWHU E\ RFFXSDWLRQ EXW KDV DOZD\V HQMR\HG ZRUNLQJ ZLWK ZRRG *RLQJ EDFN WR WKH PLG ¶V LQ :DXFKXOD 5XVV DQG D IHZ RI KLV IULHQGV LQ WKH QHLJKERUKRRG HQMR\HG ZRRGZRUNLQJ 5XVV¶V VSHFLDOW\ DW WKH WLPH ZDV 6KDNHU VW\OH IXUQLWXUH +H ZRXOG EXLOG FKDLUV VRID WDEOHV DQG KHDGERDUGVIRUIULHQGVDQGIDPLO\2QH GD\RQHRI5XVV¶VJRRGIULHQGVOHWKLP ERUURZ D ERRN DERXW ZRRGHQ WR\V ,Q WKHERRNWKHUHZDVDWUDLQVHWWKDWFDXJKW 5XVV¶VDWWHQWLRQ+HGHFLGHGWREXLOGWKH WUDLQVHWIRUKLVJUDQGVRQDQGIRUJHWWLQJ WKDW KH QHHGHG WR UHWXUQ WKH ERUURZHG ERRNSXWLWRQWKHVKHOIZLWKWKHUHVWRI KLVZRRGZRUNLQJERRNV 7LPHSDVVHGDQGKLVIULHQGSDVVHGDZD\ EXW5XVVQHYHUUHPHPEHUHGWRUHWXUQWKH ERRNWRKLP7KHERRNVDWRQWKHVKHOI IRU PDQ\ \HDUV XQWRXFKHG DQG 5XVV Ã&#x2C6;/CTOBERÃ&#x2C6;


DFFXUDWHGRZQWRWKHKDQGFDUYHGWUHDGLQ WKHWLUHVDQGWKHOXJQXWVSODFHGRQWRWKH ZKHHOV5XVVWDNHVSULGHLQHYHU\SLHFH WKDWKHPDNHVDQGVSHQGVDVPXFKWLPH DV LW WDNHV WR PDNH WKDW ZRRGHQ WUXFN MXVWULJKW7KRXJKKHKDVDJRRGSURFHVV ¿JXUHGRXWLWWDNHVDERXWWZRGD\VWLPH IRUKLPWRFRPSOHWHHDFKWUXFN

EHVRPHWKLQJIXQWREXLOG$VKHVWDUWHG WREXLOGWKHWUXFNKHUHDOL]HGKHGLGQRW OLNH WKH WUDLOHU WKDW ZDV GHSLFWHG LQ WKH ERRN+HKDSSHQHGWREHGULYLQJDURXQG WKDW GD\ GXULQJ WKH SHDN RI KDUYHVWLQJ VHDVRQQRWLFHGDFLWUXVKDXOHUDQGGHFLGHG WKDW¶V H[DFWO\ ZKDW KH FRXOG EXLOG IRU D WUDLOHU6R5XVVVDWGRZQLQKLVVKRSZLWK VRPHSKRWRJUDSKVDQGEXLOWDFLWUXVKDXOHU FRPSOHWHZLWKRUDQJHVDQGDOO $IWHUKLVNLGVVDZWKHWUXFNDQGWUDLOHU WKH\ HQFRXUDJHG KLP WR VHH LI DQ\RQH ZRXOG EH LQWHUHVWHG LQ EX\LQJ KLV ZRRGHQ FUHDWLRQ /LYLQJ LQ :DXFKXOD KH NQHZ PDQ\ RI WKH FLWUXV JURZHUV VR ¿JXUHG WKDW ZRXOG EH D JRRG SODFH WR VWDUW:HOODIWHUDIHZYLVLWVKHUHDOL]HG KLV WUXFNV ZHUH D KLW 2QH SHUVRQ ZKR ZDQWHG D IUXLW KDXOHU DVNHG 5XVV LI KH FRXOGEXLOGD³JRDW´IRUKLP)RUWKRVH RI \RX QRW IDPLOLDU ZLWK ZKDW D ³JRDW´

Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

LVLW¶VDVSHFLDOWUXFNXVHGLQWKHRUDQJH JURYHVHTXLSSHGZLWKDK\GUDXOLFERRP WKDWSLFNVXSWKHIXOOWXEVRIRUDQJHVDQG WUDQVSRUWV WKH IUXLW WR WKH ZDLWLQJ VHPL WUDLOHUV 5XVV LQIRUPHG WKH JHQWOHPDQ WKDW KH ZRXOG EXW GLGQ¶W KDYH DQ\ SODQV LQ ZKLFK WR IROORZ 7KH JHQWOHPDQ WKHQ UHSOLHG ³, KDYH DERXW IRUW\ JRDWV LQ WKH EDFN JR WDNH VRPH SLFWXUHV´ 6R 5XVV GLGDQGFUHDWHGDWR\VL]HGYHUVLRQRIWKH JRDWIRUKLP6LQFHWKHQ5XVVKDVEXLOW DOONLQGVRIHTXLSPHQWIURP-RKQ'HHUH WUDFWRUV WR EDW ZLQJ PRZHUV DQG HYHQ IHUWLOL]HU VSUHDGHUV DOO E\ KDQG IURP SKRWRJUDSKV  $OO RI KLV FUHDWLRQV DUH PDGH IURP :DOQXW DQG 3RSODU ZRRG $IWHU VHHLQJ KLV ZRUN , KDYH WR VD\ KLV DWWHQWLRQ WR GHWDLO LV WUHPHQGRXV 7KH WUXFNV DUH

,QDGD\DQGDJHZKHQDOPRVWHYHU\WKLQJ LVPDGHIURPSODVWLFLQDQRWKHUFRXQWU\ LW¶V QLFH WR NQRZ WKDW WKHUH DUH VWLOO VNLOOHG FUDIWVPDQ KHUH LQ WKH +HDUWODQG PDNLQJTXDOLW\LWHPVWKDWHYHU\RQHFDQ DSSUHFLDWH:LWK5XVV¶VWUXFNV\RXFDQ DJDLQKDYHWKDWVSHFLDO³WR\´WKRXJKLWLV PXFK PRUH WKDQ D WR\7KHUH LV D VWRU\ EHKLQG HDFK WUXFN WUDFWRU RU JRDW WKDW KH FUHDWHV 2QH JHQWOHPDQ WROG 5XVV WKDWKHKDGEHHQVHDUFKLQJIRUWZR\HDUV ORRNLQJIRUWKHH[DFWWUXFNWKDW5XVVMXVW KDSSHQHGWRZDONLQZLWKRQHGD\ 5XVV¶V FUHDWLRQV DUH WKH SHUIHFW JLIW IRU WKDWSHUVRQZKRDOUHDG\KDVHYHU\WKLQJ RU WR SURXGO\ GLVSOD\ LQ WKH RI¿FH7KH WUXFNVFDQEHFXVWRPL]HGWRLQFOXGH\RXU FRPSDQ\ORJRMXVWDVLWLVRQWKHIXOOVL]H YHKLFOHV GULYLQJ GRZQ WKH URDG ,I \RX KDYHDFHUWDLQWUXFNRUSLHFHRIHTXLSPHQW WKDW\RXZDQWWRKDYHEXLOWGRQ¶WKHVLWDWH WR JLYH 5XVV D FDOO +LV ZRUN GRHV QRW HQG ZLWK VHPLWUXFNV +H FDQ UHFUHDWH MXVWDERXWDQ\WKLQJ$OO\RXKDYHWRGR LV JLYH KLP D FDOO DQG VKRZ KLP VRPH SLFWXUHV-XVWLQWLPHIRU&KULVWPDVFDOO 5XVVDW

Heartland InTheFieldMagazine




Cary Pigman #ANDIDATEÃ&#x2C6;FORÃ&#x2C6;&LORIDAÃ&#x2C6;3TATEÃ&#x2C6; 2EPRESENTATIVEÃ&#x2C6;$ISTRICTÃ&#x2C6; &DU\ 3LJPDQ LV D UHVLGHQF\WUDLQHG DQG ERDUG FHUWL¿HG (PHUJHQF\ 0HGLFLQH SK\VLFLDQ SUDFWLFLQJ DW )ORULGD +RVSLWDO +HDUWODQG0HGLFDO&HQWHULQ6HEULQJ+HZDV ERUQDQGUDLVHGLQUXUDO2KLREXWKDVOLYHGLQ +LJKODQGV&RXQW\VLQFH ³7ZRWKLQJVOHGPHWRUXQIRURI¿FH7KH ¿UVW LV WHUP OLPLWV , DJUHH ZLWK WKH PDMRULW\ RI )ORULGLDQV WKDW RXU UHSUHVHQWDWLYH VKRXOG EHVRPHRQHIURPEXVLQHVVDJULFXOWXUHRUWKH SURIHVVLRQVZKRDJUHHVWRFRQWULEXWHDSRUWLRQ RIKLVRUKHUSURIHVVLRQDOOLIHDVDVHUYDQWWRWKHLU FRPPXQLW\:KHQ WKLV VHUYLFH LV FRPSOHWHG KH VKRXOG UHWXUQ WR KLV RULJLQDO SURIHVVLRQ LQ KLV KRPH FRPPXQLW\ , DP EOHVVHG ZLWK KHDOWKDQGDSURIHVVLRQWKDWJLYHVPHIDQWDVWLF Ã&#x20AC;H[LELOLW\WRVHUYHLQWKH)ORULGD+RXVH7KH VHFRQGIDFWRUWKDWFRPSHOVPHWRVHUYHLVP\ H[SRVXUH WR FXUUHQW UHSUHVHQWDWLYHV PDQ\ RI ZKRP GHPRQVWUDWH D FDUHIXO FRQVLGHUHG DQG ZHOO LQIRUPHG DSSURDFK WR RXU VWDWH¶V LPSRUWDQWLVVXHVOLNH5HSUHVHQWDWLYHV'HQLVH *ULPVOH\DQG%HQ$OEULWWRQ,KRSHWRHPXODWH WKHVHKRQRUDEOHSXEOLFVHUYDQWV´&DU\VKDUHV +HVHHV(FRQRPLF'HYHORSPHQW$JULFXOWXUH 3URSHUW\ ,QVXUDQFH DQG +HDOWK &DUH DV WKH WRSLVVXHVIDFLQJ)ORULGD &DU\EHOLHYHVWKDWSXUVXLQJRSSRUWXQLWLHV IRUMREFUHDWLRQVKRXOGEHRQHRIWKHKLJKHVW SULRULWLHV RI WKH /HJLVODWXUH DQG ZRXOG VXSSRUWWD[LQFHQWLYHVWRHQFRXUDJHEXVLQHVVHV WR FUHDWH QHZ MREV LQ LQGXVWULHV WKDW ZRXOG KHOS GLYHUVLI\ )ORULGD¶V HFRQRP\$FFRUGLQJ WR &DU\ ³FRPSOH[ UHJXODWLRQV RYHUODSSLQJ DJHQF\ MXULVGLFWLRQV DQG OHQJWK\ SHUPLWWLQJ RU UHJXODWRU\ DSSURYDO SURFHVVHV DUH KLGGHQ

Ã&#x2C6; Heartland InTheFieldMagazine

WD[HV RQ ERWK EXVLQHVVHV DQG FRQVXPHUV DQG PXVW EH HOLPLQDWHG RU UHIRUPHG´ +H DOVR VXSSRUWV WRUW UHIRUP UHFRJQL]LQJIULYRORXVODZVXLWV DV DQRWKHU EXUGHQ RQ WKH )ORULGDHFRQRP\ +H UHFRJQL]HV WKH FULWLFDO QHHGRIFRQWLQXHGDFFHVVWRD VNLOOHG DJULFXOWXUDO ZRUNIRUFH DQG YRZV WR ZRUN ZLWK WKH IDUPHUV JURYH RZQHUV GDLU\PHQ DQG FDWWOHPHQ WR HQVXUH WKH VXUYLYDO DQG JURZWK RI WKHLU LQGXVWULHV&DU\VXSSRUWVWKHUHVWRUDWLRQRIWKH (YHUJODGHV DQG EHOLHYHV %HVW 0DQDJHPHQW 3UDFWLFHV SURWHFW RU LPSURYH ZDWHU TXDOLW\ ZKLOH PDLQWDLQLQJ RU HYHQ HQKDQFLQJ DJULFXOWXUDOSURGXFWLRQ &DU\ VXSSRUWV WKH GHSRSXODWLRQ RI WKH VWDWHUXQ &LWL]HQV 3URSHUW\ ,QVXUDQFH E\ UHPRYLQJ WKH PLOOLRQ GROODU PDQVLRQV DQG H[SHQVLYH EHDFKIURQW KRPHV IURP WKH SRRO +HEHOLHYHVWKDWLQRUGHUWRKHOSORZHUWKHFRVW RI SURSHUW\ LQVXUDQFH ZH PXVW FRQWLQXH WR HPSKDVL]HWKHLQFHQWLYHVRIVWRUPKDUGHQLQJ VWUXFWXUHV DQG H[SDQG WKH ULVN SRRO EH\RQG SULYDWHLQVXUHUV 'U3LJPDQVWURQJO\EHOLHYHVWKDWZHPXVW VROYH WKH FKDOOHQJHV IDFLQJ KHDOWK FDUH LQ $PHULFDZLWKRXWORVLQJWKHTXDOLW\RIFDUHRU GDPDJLQJWKHGRFWRUSDWLHQWUHODWLRQVKLS +HGRHVQRWZDQWWRWXUQKHDOWKFDUHRYHU WRJRYHUQPHQWEXUHDXFUDF\EXWZRXOGUDWKHU KHOS VPDOO EXVLQHVVHV WR RIIHU DIIRUGDEOH

KHDOWK FDUH WR WKHLU HPSOR\HHV DQG SURYLGH DQLQVXUDQFHGHGXFWLRQIRUWKHVHOIHPSOR\HG &DU\ UHFHQWO\ FRPSOHWHG D WRXU RI GXW\ LQ 1RUWKHUQ ,UDT DV D /W &RORQHO DQG SK\VLFLDQ LQ WKH 86 $UP\ 5HVHUYHV +LV ZLIH 'DUOHQH LV D UHWLUHG $HURPHG Ã&#x20AC;LJKW QXUVH DQG LV FXUUHQWO\ DQ (PHUJHQF\ 5RRP 51 DW +LJKODQGV 5HJLRQDO 0HGLFDO &HQWHU 7RJHWKHU WKH\ UDLVH VKHHS DQG FKLFNHQV DQG PDLQWDLQDYLQH\DUGRQWKHLUVPDOOIDUP&DU\ DOVRVHUYHVRQDQXPEHURIFRPPXQLW\ERDUGV DQG HQMR\V ELF\FOLQJ FOD\ VKRRWLQJ DQG FDU UDFLQJ &DU\VDLG³$V\RXU6WDWH5HSUHVHQWDWLYH , SURPLVH \RX DQ XQFRPSURPLVLQJ ZRUN HWKLF ¿VFDO UHVSRQVLELOLW\ DQG DQ KRQHVW FRQVWLWXHQWGULYHQ DSSURDFK WR JRYHUQLQJ ,¶YH SURXGO\ VHUYHG P\ FRXQWU\ DQG QRZ , ZRXOG OLNH WR VHUYH RXU FRPPXQLW\ LQ 7DOODKDVVHH´ )RU PRUH LQIRUPDWLRQ RQ KLV HOHFWLRQ ELG YLVLW ZZZFDU\SLJPDQIRUKRXVH FRPRUZZZIDFHERRNFRPFDU\SLJPDQ

Ã&#x2C6;/CTOBERÃ&#x2C6;


 ”‡•Šˆ”‘–Š‡ ‡ƒ”–Žƒ†

ƒ”›‹‰ƒ ˆ‘”–ƒ–‡‡’”‡•‡–ƒ–‹˜‡

3100 North Bonnett Creek Road | Avon Park, FL 33825

863-452-5347tcary@carypigman.com Political advertisement paid for and approved by Cary Pigman, Republican for State Representative

È

/CTOBERÈÈ

Heartland InTheFieldMagazine




Crystal Drake #ANDIDATEÃ&#x2C6;FORÃ&#x2C6;&LORIDAÃ&#x2C6;3TATEÃ&#x2C6; 2EPRESENTATIVEÃ&#x2C6;$ISTRICTÃ&#x2C6; ³,¶PFRQFHUQHGDERXWWKHSRODUL]DWLRQLQ JRYHUQPHQWEHWZHHQSROLWLFDOSDUWLHV1HLWKHU VLGHLVFRUUHFWEXW,¶GOLNHWREHSDUWRI WKHVROXWLRQWREULQJWKHVLGHVWRJHWKHU´VD\V &U\VWDO'UDNHZKHQDVNHGZK\VKHFKRVHWR UXQIRU6WDWHRI¿FH &XUUHQWO\DPLGGOHVFKRRO/DQJXDJH$UWV WHDFKHUDWWKH%ULJKWRQ6HPLQROH5HVHUYDWLRQ 3H\PD\HWY(PDKDNY&KDUWHU6FKRRO&U\VWDO WDXJKW $PHULFDQ *RYHUQPHQW DW 0RRUH +DYHQ -XQLRU6HQLRU +LJK 6FKRRO IRU RYHU WHQ \HDUV DQG WKDW ZDV ZKHUH KHU LQWHUHVW LQ SROLWLFVEHJDQ 7KH *ODGHV &RXQW\ UHVLGHQW VHHV $JULFXOWXUH %XVLQHVV DQG (GXFDWLRQ DV WKH PRVW SUHVVLQJ LVVXHV IDFLQJ WKH FLWL]HQV RI 'LVWULFW  ZKLFK LV PDGH XS RI *ODGHV +LJKODQGV 2NHHFKREHH DQG SDUW RI ZHVWHUQ 6W/XFLHFRXQWLHV ,Q UHJDUGV WR DJULFXOWXUH &U\VWDO UHFRJQL]HV WKDW ZDWHU LV D SULPDU\ DUHD RI FRQFHUQ ³,W LV WKH OLIHEORRG RI IDUPLQJ DQG UDQFKLQJDQGZLWKRXWWKHDELOLW\WRPDQLSXODWH LWWKHFRQWLQXHGVXFFHVVRIDJULFXOWXUHLQRXU VWDWH ZLOO EH WKUHDWHQHG´ 6KH DOVR VHHV WKH QHHG WR HGXFDWH WKRVH LQ XUEDQ DUHDV DERXW ZKHUHIRRGFRPHVIURP±EH\RQGWKHJURFHU\ VWRUH ± DQG WKH LPSRUWDQFH RI DJULFXOWXUH LQ RXUVWDWH

Ã&#x2C6; Heartland InTheFieldMagazine

$ GHVLUH WR ¿QG D ZD\ WR FUHDWH DQG DWWUDFW PRUH MREV WR )ORULGD LV DQRWKHU UHDVRQ &U\VWDO LV UXQQLQJ IRU RI¿FH ³7KH %39HUFLSLD ELRIXHOV SURMHFW LQ +LJKODQGV &RXQW\ DQGWKHSURSRVHG6RXWK)ORULGD ,QWHUQDWLRQDO /RJLVWLFV &HQWHU SDUWQHUVKLSSURMHFWEHWZHHQ/\NHV%URVDQG $ 'XGD  6RQV DUH WKH NLQGV RI SURMHFWV WKDW FDQ KHOS SURYLGH MREV WR RXU UHJLRQ ,W LV WKH MRE RI WKH OHJLVODWXUH WR GR ZKDW WKH\ FDQRQWKHVWDWHOHYHOWRPDNHWKHSHUPLWWLQJ SURFHVVHV DQG RWKHU OHJDO UHTXLUHPHQWV DV VWUHDPOLQHGDQGHI¿FLHQWDVQHFHVVDU\7LPH LV RI WKH HVVHQFH RQ SURMHFWV OLNH WKHVH DQG JRYHUQPHQWEXUHDXFUDF\VKRXOGQRWVWDQGLQ WKHZD\RUEHWKHUHDVRQLQYHVWRUVEDFNDZD\ IURP SURMHFWV RI WKLV QDWXUH  , ZLOO ZRUN WR PDNHVXUHJRYHUQPHQWGRHVQ¶WJHWLQWKHZD\ RIMREFUHDWLRQ´ :KLOH VXSSRUWLQJ WKH FRQFHSW RI WHDFKHU DFFRXQWDELOLW\ 'UDNH VHHV WKH )&$7 DV D GHWULPHQW QRW RQO\ WR VWXGHQWV DQG WHDFKHUV EXW HQWLUH FRPPXQLWLHV ³6FKRRO JUDGHV FDQ XQGHUPLQH HFRQRPLF GHYHORSPHQW LQ DUHDV WKDWQHHGLWWKHPRVW´VKHH[SODLQV³)ORULGD JRHVWRRIDUE\LQFOXGLQJGURSRXWUDWHVDQG RWKHUFULWHULDQRWUHTXLUHGE\WKH)HGHUDO1R &KLOG /HIW %HKLQG $FW´ 6WXGHQWV PXVW EH SUHSDUHG IRU D IXO¿OOLQJ IXWXUH EXW WHDFKHUV DQG DGPLQLVWUDWRUV VKRXOG EH DOORZHG WR

DFFRPSOLVKWKDWJRDOZLWKH[LVWLQJWRROVDQG VWUDWHJLHV&U\VWDOEHOLHYHVWKDWPRUHWHDFKHUV VKRXOGEHLQYROYHGLQPDNLQJGHFLVLRQVDERXW RXUHGXFDWLRQDOSROLFLHV &U\VWDO LV PDUULHG WR KHU KXVEDQG RI  \HDUV -: DQG WKH\ UXQ D VPDOO FRZ FDOI RSHUDWLRQ LQ DGGLWLRQ WR WKHLU IXOOWLPH MREV 7KH\ KDYH WZR FKLOGUHQ DQG IRXU JUDQGFKLOGUHQ &U\VWDO LV D  JUDGXDWH RI /HDGHUVKLS +HQGU\*ODGHV &RXQWLHV LV FXUUHQWO\ ZRUNLQJ RQ FRPSOHWLRQ RI KHU 0DVWHU¶V GHJUHH LQ 3XEOLF $GPLQLVWUDWLRQ IURP )ORULGD *XOI &RDVW 8QLYHUVLW\ DQG LV LQYROYHG LQ D QXPEHU RI FRPPXQLW\ DQG SURIHVVLRQDORUJDQL]DWLRQV ³, FRQVLGHU P\VHOI WR EH D FRQVHUYDWLYH 'HPRFUDW ERWK ¿VFDOO\ DQG VRFLDOO\ DQG HQFRXUDJH YRWHUV WR YRWH IRU WKH SHUVRQ QRW WKHSDUW\0\DOOHJLDQFHZLOOEHWRWKHYRWHUV  QRW D SROLWLFDO SDUW\´ &U\VWDO VWDWHV )RU PRUH LQIRUPDWLRQ RQ KHU HOHFWLRQ ELG YLVLW ZZZYRWHFU\VWDOFRP RU ZZZIDFHERRN FRP9RWH&U\VWDO

Ã&#x2C6;/CTOBERÃ&#x2C6;


! :HI EG:H:CIH

-X QLR U :LOOL H (G ZDUG V



$PNF&OKPZ"'VMM%BZ 0G'BNJMZ'VO

7XUQHU$JUL&LYLF&HQWHU 1(5RDQ6W$UFDGLD)/



ZZZWXUQHUFHQWHUFRP Ã&#x2C6;

/PWFNCFS  (BUFT0QFOBUBN

/CTOBERÃ&#x2C6;Ã&#x2C6;

Â&#x2021;(QWHUWDLQPHQW Â&#x2021;<RXWK%HHI 6KRZÂ&#x2021;(TXLSPHQW Â&#x2021;:RUNLQJ&RZ'RJV'HPR Â&#x2021;.LGV$UHDÂ&#x2021;(TXHVWULDQ'HPR  $QG0XFK0RUH Heartland InTheFieldMagazine




Denise Grimsley "RINGINGÃ&#x2C6;2EAL ,IFEÃ&#x2C6;0ERSPECTIVEÃ&#x2C6;Ã&#x2C6; TOÃ&#x2C6;,AWMAKING $V D UHJLVWHUHG QXUVH FLWUXV JURZHU DQG JUDQGPRWKHU 'HQLVH *ULPVOH\ ZHDUV D QXPEHU RI KDWV DQG GUDZV RQ HDFK RI WKHP WR UHSUHVHQW )ORULGD¶V +HDUWODQG LQ WKH VWDWH FDSLWRO 5XQQLQJ IRU DQ RSHQ VHDW LQ WKH )ORULGD+RXVHRI5HSUHVHQWDWLYHVLQVKH UHVROYHGWRPDNHFXWWLQJUHGWDSHDQGWD[HVD WRSSULRULW\ ³:KHQ , GHFLGHG WR UXQ IRU RI¿FH LW ZDV DIWHU VHHLQJ JRYHUQPHQW XS FORVH DQG SHUVRQDO´ VDLG *ULPVOH\ ZKR OHIW QXUVLQJ WR UXQ KHU IDPLO\¶V UHWDLO EXVLQHVV IRU WHQ \HDUV ZKHQKHUIDWKHU&KDUOHVWRRNLOO³(YHU\GD\LW VHHPHGOLNH,ZDVKDYLQJWREDWWOHJRYHUQPHQW UHJXODWRUVMXVWWRNHHSWKHGRRUVRSHQ´ :LWK RQH GDXJKWHU 1LFROH DQG WZR JUDQGFKLOGUHQ 7\VRQ DQG -LOOLDQ *ULPVOH\ LV HVSHFLDOO\ FRQFHUQHG DERXW PDNLQJ RSSRUWXQLWLHVDYDLODEOHIRUWKHQH[WJHQHUDWLRQ ³0RVW SHRSOH LQ WKH +HDUWODQG DUH HLWKHU UXQQLQJVPDOOEXVLQHVVHVRUWKH\¶UHHPSOR\HG E\ RQH´ VDLG *ULPVOH\ ³, MXVW ZDQW WR JLYH WKHVHIRONVD¿JKWLQJFKDQFHDWWKH$PHULFDQ 'UHDP:H¶UHQRWSURPLVHGKDSSLQHVVEXWZH DUH JXDUDQWHHG WKH IUHHGRP WR SXUVXH LW DQG JRYHUQPHQWUHJXODWLRQVWRRRIWHQVWUDQJOHWKDW IUHHGRP´ 7KDWSDVVLRQIRUVPDOOEXVLQHVVHVH[WHQGV WRKHUFRQFHUQIRUFLWUXVDQGDJULFXOWXUH:KHQ

Ã&#x2C6; Heartland InTheFieldMagazine

WKHQ6SHDNHURIWKH+RXVH0DUFR5XELRDVNHG KHUWRVHUYHDV&KDLURIWKH+RXVH&RPPLWWHH RQ$JULEXVLQHVVLQKHUXQGHUVWDQGLQJRI WKHFKDOOHQJHVIDFLQJIDUPHUVDQGUDQFKHUVLQ )ORULGD¶V+HDUWODQGPDGH*ULPVOH\DJRRG¿W IRUWKHUROH ³:KHQ LW FRPHV WR HGXFDWLQJ WKH /HJLVODWXUH DERXW )ORULGD¶V DJULFXOWXUH FRPPXQLW\ WKH OHDUQLQJ FXUYH LV VWHHS´ VDLG *ULPVOH\ ³0RVW OHJLVODWRUV KDYH QR EDFNJURXQG LQ DJULFXOWXUH DQG WXUQRYHU LQ WKH PHPEHUVKLS PHDQV WKDW WKH DZDUHQHVV FDPSDLJQLVQHYHUHQGLQJ´ 3HUKDSV*ULPVOH\¶VELJJHVWFKDOOHQJHKDV EHHQ WDFNOLQJ WKH VWDWH¶V ELOOLRQ EXGJHW LQDWRXJKHFRQRP\,QKHUOHJLVODWLYHFDUHHU *ULPVOH\LVWKH¿UVWZRPDQWRVHUYHDVFKDLU RIWKH+RXVH$SSURSULDWLRQV&RPPLWWHH ³:H PDGH WRXJK GHFLVLRQV EHFDXVH RI UHYHQXH VKRUWIDOOV EXW ZH GLG LW ZLWKRXW UDLVLQJ WD[HV´ VDLG *ULPVOH\  ³, WKLQN PRVW )ORULGLDQV SUHIHU WKDW ZH FXW VSHQGLQJ DQG EDODQFHRXUEXGJHWZLWKRXWUDLVLQJWD[HVDQG WKDW¶VZKDWZHKDYHGRQH´ 6N\URFNHWLQJ FRVWV LQ WKH 0HGLFDLG SURJUDP UHSUHVHQW WKH VLQJOHODUJHVW H[SHQVH XQGHUZULWWHQ E\ WD[SD\HUV  *ULPVOH\ VKHSKHUGHG )ORULGD¶V QDWLRQDOO\ UHFRJQL]HG 0HGLFDLGUHIRUPVWKURXJKWKH/HJLVODWXUH

³7KH ROG 0HGLFDLG V\VWHP KDV EHHQ D GLVVHUYLFH WR SDWLHQWV DQG WKH WD[SD\HUV XQGHUZULWLQJ LW´ VDLG *ULPVOH\ ZKR KDV ZRUNHG LQ KRVSLWDOV LQ +DUGHH +LJKODQGV DQG3RONFRXQWLHV³:H¶UHKRSLQJWRJHWFRVWV XQGHUFRQWURODQGSXWSDWLHQWVLQWKHGULYHU¶V VHDW *RYHUQPHQW VLPSO\ KDV D SRRU WUDFN UHFRUG ZKHQ LW JHWV LQYROYHG LQ KHDOWK FDUH GHOLYHU\´ *ULPVOH\ KDV VHUYHG WKH PD[LPXP HLJKW \HDUVDOORZHGLQWKH)ORULGD+RXVHDQGLVD FDQGLGDWHIRUWKH)ORULGD6HQDWH ³7KH EHVW ODZPDNLQJ GHSHQGV RQ JRRG SHUVSHFWLYH´ VDLG *ULPVOH\ UHÃ&#x20AC;HFWLQJ RQ KHU OHJLVODWLYH H[SHULHQFHV  ³$QG WKHUH¶V D ORW RI UHDOOLIH SHUVSHFWLYH LQ WKH +HDUWODQG WKDWQHHGVWREHKHDUGLQWKHKDOOVRIWKHVWDWH FDSLWRO´ 3HUKDSVWKRVHPDQ\KDWV*ULPVOH\ZHDUV DUH KHOSLQJ EULQJ WKDW IUHVK SHUVSHFWLYH WR 7DOODKDVVHH

Ã&#x2C6;/CTOBERÃ&#x2C6;


*33*("5*0/16.14&37*$&4 XXXBHTFSWJDFTJOUMDPN

'PSU1JFSDF "SDBEJB

/FXMZBDRVJSFE

(SPXFS4FSWJDFT $PNQBOZ *OD

%PVH.BSJOF 1SFTJEFOU



0VSTFSWJDFTJODMVEF

6OJWFSTJUZPG$FOUSBM'MPSJEB

.JLF,POE[JPMB

.BOBHFS8JOUFS)BWFO 5VSOLFZ$POUSBDUT "VCVSO6OJWFSTJUZ#VTJOFTT 5VSCJOF1VNQ*OTUBMMBUJPOT3FQBJS *OรถFME3FQBJS4FSWJDFT 8IPMFTBMF*SSJHBUJPO "VUPNBUJPO $VMWFSUT%SBJO5JMF 1FSSZ)PMMJOHTXPSUI $BMJCSBUJPOT .BOBHFS"SDBEJB 4QSBZFS&RVJQNFOU 6OJWFSTJUZPG(FPSHJBo"H&DPO รˆ

/CTOBERรˆรˆ

$IBE.BSJOF .BOBHFS'PSU1JFSDF "VCVSO6OJWFSTJUZ4DJFODF

Heartland InTheFieldMagazine




"YÃ&#x2C6;#INDYÃ&#x2C6;#UTRIGHT

RULJLQDO ORFDWLRQ RQ 3DOP %HDFK %RXOHYDUG WRSV WKHOLVWRIWKLVHOLWHJURXS

$ VWDPS SXUFKDVHG DW WKH )RUW 0\HUV 3RVW 2I¿FHLQZRXOGKDYHUXQ\RXZKLOHD SRXQGRIEDFRQDW3XEOL[ZDVMXVW$WLFNHWWR D WKHDWHU WR VHH WKH PXFK DQWLFLSDWHG PRYLH7KH *RGIDWKHUZRXOGKDYHVHW\RXEDFNRULI\RX SUHIHUUHGWRMXVWUROOGRZQWKHZLQGRZVDQGFUXLVH WKHEHDFK\RXFRXOG¶YH¿OOHGXSWKHFDUIRUDPHUH DJDOORQ %XWLI\RX RU\RXUSDUHQWV ZHUHLQWKHPDUNHWIRU IDUPHTXLSPHQWDWULSWRWKH)RUGWUDFWRUGHDOHUVKLS LQ)RUW0\HUVUHFHQWO\SXUFKDVHGLQ0DUFKRIWKDW \HDU E\ 5D\ DQG 3K\OOLV &UHHO ZRXOG KDYH EHHQ HVVHQWLDO    DQG IRU JRRG UHDVRQ )RUG ZDV RQH RIWKHEHVWNQRZQHTXLSPHQWPDQXIDFWXUHUVLQWKH FRXQWU\DWWKHWLPHZKLOHWKH&UHHOVIRUPHURZQHUV RI1DSOHV7RPDWR)DUPVZHUHZHOOUHVSHFWHGIRU WKHLUH[SHULHQFHDQGLQWHJULW\ )HZEXVLQHVVHVLQWKLVSDUWRIWKHVWDWHFDQERDVW FRQWLQXRXV VHUYLFH WR WKH DJULFXOWXUDO FRPPXQLW\ VSDQQLQJIRXUGHFDGHVRQHWKDWKDVEHHQIDPLO\ RZQHG LV HYHQ PRUH UDUH %XW &UHHO 7UDFWRU &RPSDQ\ ZKLFK LV VWLOO KRXVHG DW WKH ¿UP¶V

Ã&#x2C6; Heartland InTheFieldMagazine

$ORWKDVFKDQJHGVLQFH0DUFKRIDQG\HW EDVLF VWHDGIDVW EXVLQHVV SULQFLSOHV WKDW IDUPHUV DQG UDQFKHUV DGKHUHG WR WKHQ DSSO\ \HW WRGD\ &HUWDLQO\ WKH SXUFKDVLQJ DQG HI¿FLHQW VHUYLFLQJ RI IDUP HTXLSPHQW LV VWLOO SDUDPRXQW WR NHHSLQJ IDUPLQJDQGUDQFKLQJRSHUDWLRQVSUR¿WDEOH *URZWKLQWKH6RXWKZHVW)ORULGDDUHDVSXUUHG 5D\ LQWR H[SDQGLQJ WKH EXVLQHVV E\ DGGLQJ DGGLWLRQDO W\SHV RI HTXLSPHQW WR PHHW WKH QHHGV RI WKH DUHD¶V UDSLGO\ JURZLQJ FRQVWUXFWLRQ DQG KRXVLQJPDUNHWV)HZSHRSOHFRXOGKDYHSUHGLFWHG WKH H[SORVLRQ WKDW ZDV WR IROORZ %XW 5D\ D ELW RI D YLVLRQDU\ KDG LQNOLQJ RI ZKDW ZDV WR FRPH ,Q  KH EHJDQ VHOOLQJ DQG VHUYLFLQJ D OLQH RI %XVK +RJ UHFRJQL]HG DV RQH RI WKH LQGXVWU\ OHDGHUV RI PRZLQJ DQG WLOOLQJ HTXLSPHQW 2WKHU PDQXIDFWXUHU¶VSURGXFWVZHUHWRIROORZ 0DUN &UHHO DVVXPHG PDQDJHPHQW RI WKH EXVLQHVVIROORZLQJWKHSDVVLQJRIKLVIDWKHU5D\ LQ+HFRQWLQXHGWRH[SDQGEH\RQGWKHQHHGV RI WKH FRPSDQ\¶V DJ FXVWRPHUV E\ SURYLGLQJ WKH VDOHVDQGVHUYLFHRIHTXLSPHQWJHDUHGWRWKRVHRI FRQWUDFWRUV&RPSDQLHVFKDUJHGZLWKWKHEXLOGLQJ DQG PDLQWDLQLQJ RI JROI FRXUVHV RU RWKHUV WKDW SURYLGHG VLWH SUHSDUDWLRQ IRU UHVLGHQWLDO DQG FRPPHUFLDOFRQVWUXFWLRQVRRQFDPHWRUHO\RQWKH &UHHOQDPH Ã&#x2C6;/CTOBERÃ&#x2C6;


0DUN DQG KLV VRQ %ULDQ UHFHQWO\ VDW GRZQ IRU DQ LQWHUYLHZ ZLWK +HDUWODQG 0DJD]LQH :KHQ DVNHG ZKDW KDV FKDQJHG WKH PRVW GXULQJ WKH HQVXLQJ \HDUV 0DUN LQVWDQWO\ UHSOLHG ³2XU FXVWRPHUV:HVDZRXUGHPRJUDSKLFVFKDQJH:H XVHGWREHVROHO\DJRULHQWHGEXWZHVWDUWHGORVLQJ VRPHRIWKDWVHFWRUZKHQIDUPODQGZDVWXUQHGLQWR JROIFRXUVHVDQGJDWHGFRPPXQLWLHV´ 7R VWD\ UHOHYDQW 0DUN VDLG &UHHO7UDFWRU KDG WRGLYHUVLI\³7KHPDUNHWVZHUHFKDQJLQJDQGZH KDGWRFKDQJHZLWKWKHPVR\HDUVDJRZHDGGHG DPXQLFLSDOLW\DQGJROIFRXUVHVDOHVPDQ:HZHUH WKH¿UVWWRVHHLWQRERG\KDGKHDUGRIGRLQJWKDW :HVDZWKDWQLWFKRXWWKHUHDQGWRWKLVGD\,VWLOO Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

KDYH D VDOHVPDQ ZKR GRHV QRWKLQJ EXW FDOO RQ PXQLFLSDOLWLHV ,W LV D PDUNHW WKDW LV JURZLQJ DQG ZHKDYHJURZQZLWKLW´ $V QHZ GHYHORSPHQW VORZHG WKH &UHHOV QRWLFHGWKHLUEXVLQHVVKDGEHJXQWRVZLQJEDFNWR DJULFXOWXUHDWUHQGWKHFRPSDQ\ZDVZHOOSUHSDUHG WR KDQGOH 7KH ¿UP DOVR VHUYLFHV WKH FRQVXPHU PDUNHW ZKLFK LV FRPSULVHG RI SURSHUW\ RZQHUV 0DUN UHIHUV WR WKHP DV µZHHNHQG ZDUULRUV¶  ZKR RZQ EHWZHHQ  WR  DFUHV 7KLV SDUWLFXODU GHPRJUDSKLF ZKLFK ZDV DOVR EDGO\ KXUW GXULQJ WKHUHFHQWHFRQRPLFGRZQWXUQKDVVWDUWHGWRPDNH DFRPHEDFN 0DUNVD\VKHLVPRVWDGDPDQWDERXW Heartland InTheFieldMagazine




RQO\$QG,ZDVKDQGOLQJVDOHVZKHQ,ZDVVWLOO LQFROOHJHDW)ORULGD*XOI&RDVW8QLYHUVLW\:KHQ ,JRWRXWRIFROOHJHRXUVDOHVPDQDJHUUHWLUHGDQG, WRRNRYHUKLVVSRW´ 7KH DUHD WKH FRPSDQ\ FRYHUV LV WUXO\ LPSUHVVLYH³:HVHUYHVHYHQFRXQWLHV´%ULDQDGGV &XVWRPHUV IURP /HH &ROOLHU *ODGHV +HQGU\ &KDUORWWH 'H6RWR DQG +DUGHH &RXQWLHV KDYH DOO FRPHWRGHSHQGRQ&UHHO7UDFWRU&RPSDQ\GXULQJ WKH SDVW  \HDUV %RWK &UHHOV ZLOO WHOO \RX WKH\ KDYHDOOZRUNHGKDUGWRIRUJHODVWLQJUHODWLRQVKLSV ZLWK DUHD IDUPHUV DQG UDQFKHUV ORFDO EXVLQHVVHV JRYHUQPHQW DJHQFLHV DQG HYHQ DFDGHPLF LQVWLWXWLRQV%ULDQSRLQWVWRKLVDOPDPDWHU)ORULGD *XOI &RDVW 8QLYHUVLW\ DV D FDVH LQ SRLQW &UHHO 7UDFWRUZDVRQHRIWKHXQLYHUVLW\¶V¿UVWYHQGRUVD UHODWLRQVKLSWKDWHQGXUHVWRGD\

PDLQWDLQLQJWKHEHVWGLDORJXHSRVVLEOHZLWKKLV FXVWRPHUV³:HRIWHQDVNWKHPZRXOG\RXOLNHWR NQRZ ZKDW WKDW LV PDGH RI RU ZRXOG \RX OLNH WR NQRZKRZWKDWSURGXFWFDQKHOS\RX:HVWLOOGR WKDW 2XU VDOHVPHQ ZLOO DVN FXVWRPHUV VKRSSLQJ IRUDWUDFWRU ZKDWWKHLUQHHGVDUH7KHODVWWKLQJZH ZDQWWRGRLVVHOOWKHPVRPHWKLQJWKH\GRQ¶WQHHG :HWU\WRHGXFDWHWKHP´ 6HUYLFH LV WKH KDOOPDUN RI &UHHO 7UDFWRU &RPSDQ\ ³:H DUH YHU\ FRQVXPHURULHQWHG YHU\ KDQGV RQ´ VWDWHV 0DUN ³, DP LQYROYHG LQ HYHU\WKLQJ DV LV %ULDQ )RU LQVWDQFH , NQRZ ZKR LV KDYLQJ LVVXHV LQ WKH ¿HOG´ (YHQ ORJLVWLFV SOD\ DQ LPSRUWDQW UROH LQ SURYLGLQJ VXSHULRU VHUYLFH ³:H DUH FHQWUDOO\ ORFDWHG DQG RXU URDG JX\V DUH SRVLWLRQHG GLIIHUHQW SODFHV´ %XW 0DUN VD\V SHUVRQQHOPDNHDOOWKHGLIIHUHQFH³:HKDYHURDG WUXFNVDQGGHGLFDWHG¿HOGVHUYLFHWHFKVWKDWZRUN 7KH\DUHRQFDOODOOWKHWLPH2QHRIRXUWHFKV PD\ZRUNRQDWUDFWRUDWR¶FORFN6DWXUGD\QLJKW DQGEHVRPHSODFHHOVH6XQGD\PRUQLQJ´ 7KLVRXWVWDQGLQJOHYHORIVHUYLFHLVDVRXUFHRI SULGHIRUERWK&UHHOV,QIDFWKRPHSKRQHQXPEHUV DUHHYHQSULQWHGRQWKHFRPSDQ\¶VEXVLQHVVFDUGV LQFOXGLQJ0DUN¶VDQG%ULDQ¶VVRDPHPEHURIWKH &UHHOWHDPFDQEHUHDFKHGYLUWXDOO\DQ\WLPH $V WKH FRPSDQ\¶V VDOHV PDQDJHU %ULDQ KHDGV WKH&UHHOVDOHVGHSDUWPHQW+HVKDUHVKLVIDWKHU¶V GHGLFDWLRQ WR SURYLGLQJ RXWVWDQGLQJ FXVWRPHU VHUYLFHDQGWKRURXJKSURGXFWNQRZOHGJHDWSRLQW RIVDOHVRPHWKLQJ%ULDQVD\VKHOHDUQHGDWDQHDUO\ DJH³,VWDUWHGZRUNLQJKHUHSDUWWLPHZKHQ,ZDV

Ã&#x2C6; Heartland InTheFieldMagazine

3HUKDSV QRZKHUH LV WKH IRFXV RQ FXVWRPHU VHUYLFHPRUHSUHYDOHQWWKDWLQWKHEXVLQHVVRI¿FH ZKHUH0DUN%ULDQDQGWKHUHVWRIWKHEXV\WHDP DUHDLGHGE\\HWDWKLUG&UHHO%HWK 0DUN¶VZLIH DQG %ULDQ¶V PRWKHU  %HWK &UHHO DORQJ ZLWK WKH RI¿FHPDQDJHU%HWK0XUSK\KDQGOHVWKHWUXHQXWV DQGEROWVRIWKHRSHUDWLRQ7KH\ERWKDJUHHLWFDQ JHWKHFWLFDWWLPHVEXWZRXOGQ¶WKDYHLWDQ\RWKHU ZD\ ,WLVWUXHWKDW&UHHO7UDFWRU&RPSDQ\KDVEHHQ FRQVLGHUHGDVWDSOHRIGRZQWRZQ)RUW0\HUVGXULQJ WKH ODVW  GHFDGHV +RZHYHU WKH ¿UP UHSUHVHQWV VR PXFK PRUH WKDQ MXVW D VWRUHIURQW WKDW GLGQ¶W VKXWWHUDQGFORVHGXULQJRQHRIVHYHUDOUHFHVVLRQV H[SHULHQFHGLQWHUPLWWHQWO\WKURXJKRXWWKHSDVW \HDUV 5DWKHU LW LV PRUH LPSRUWDQW WR UHFRJQL]H WKDW WKH HTXLSPHQW VROG DQG VHUYLFHG E\ WKH ¿UP KDVEHHQXVHGWRSODQWWKRXVDQGVRIDFUHVRI¿HOGV EXLOG URDGV KRPHV EXVLQHVVHV DQG UHFUHDWLRQDO IDFLOLWLHV&UHHO7UDFWRUKDVEHHQDQLQWHJUDOSDUWRI 6RXWKZHVW)ORULGD¶VSDVWDQGZLOOFRQWLQXHWREHD UHOHYDQWSDUWRILWVIXWXUH &KHFNRXWWKHFRPSDQ\¶VZHEVLWH DWZZZFUHHOWUDFWRUFRPIRUPRUH LQIRUPDWLRQ RQ WKH EUDQGV RI HTXLSPHQW &UHHO 7UDFWRU &RPSDQ\ KDQGOHV VXFK DV 1HZ +ROODQG .XERWD DQG0DKLQGUDRUYLVLW WKHLU WLPHKRQRUHG IDFLOLW\ DW  3DOP %HDFK %RXOHYDUG LQ )RUW 0\HUV

Ã&#x2C6;/CTOBERÃ&#x2C6;


0/ÂŹ"/8ÂŹÂŹ0,!.4ÂŹ#)49 ÂŹ&,ÂŹÂŹÂŹÂŹÂŹ0(ÂŹ ÂŹ/2ÂŹ ÂŹÂŹÂŹÂŹÂŹÂŹ&!8ÂŹ ÂŹ 

+($57/ !ÂŹ7AYÂŹOFÂŹ,IFE $1' ORDER YOUR SUBSCRIPTION TODAY! 8DBEA:I:6C9B6>AI=>H86G9 Subscriberâ&#x20AC;&#x2122;s Agreement

YES! Send me Heartland 12 Months/12 Issues for only $25.00

First Issue to Begin in Jan Jul

Feb Aug

Mar Sep

Apr Oct

May Nov

Jun Dec

Subscriber Information Name _________________________________________________________ Phone (________) _______________________________________________ Company ______________________________________________________ Shipping Address _______________________________________________ _______________________________________________________________ City ___________________________________________________________ ST _________ Zip ____________________ Billing Address (If different than above) _______________________________________________________________ _______________________________________________________________ City ___________________________________________________________ ST _________ Zip ____________________ Billing Address (If different than above)

Payment Information Check One: Check Enclosed Credit Card Type: Mastercard

Credit Card Visa

Credit Card Number ____________________________________________ Expiration Date (MM/YY) _________ /_________ Security Code ___________ Signature _____________________________________________________

Mail to us at Heartland In the Field Magazine P.O. Box 3183 Plant City, FL 33563 Ă&#x2C6;

/CTOBERĂ&#x2C6;Ă&#x2C6;

Heartland InTheFieldMagazine




"YÃ&#x2C6;2OBBIÃ&#x2C6;3UMNER

/+%%#(/"%% #!44,%-%.3¬!33/#)!4)/.

2!.#(¬2/$%/

Labor Day

¬¬¬

S

SHFWDWRUV ¿OOHG WKH VWDQGV RI WKH 2NHHFKREHH $JUL &HQWHU WR HQMR\ WKH H[FLWHPHQWRIWKH&DWWOHPHQ¶V/DERU'D\ 5DQFK 5RGHR KHOG 6DWXUGD\ 6XQGD\ DQG 0RQGD\ 6HSWHPEHUVW±UG 7ZHQW\IRXU ¿YHPHPEHU WHDPV FDPH IURP DFURVV )ORULGD HDFK SD\LQJ D  HQWU\ IHH IRU WKHLU VKRW DW WDNLQJ KRPH EUDJJLQ¶ ULJKWV DQG SDUW RIWKHWRWDOSXUVH7ZHOYHWHDPVFRPSHWHG RQ 6DWXUGD\ DQG WKH VHFRQG WZHOYH FRPSHWHG RQ 6XQGD\ LQ ¿YH HYHQWV LQFOXGLQJ 7HDP %UDQGLQJ 7HDP 7\LQJ &RZ 'HFRUDWLQJ 7HDP 6RUWLQJ DQG 5DQFK%URQF5LGLQJ7KHWRS¿YHWHDPVIURPHDFK GD\WKHQZHQWKHDGWRKHDGLQWKH¿QDOVRQ0RQGD\ <RXQJVWHUV DOVR JRW GRZQ DQG GLUW\ LQ WKH 0XWWRQ %XVWLQ¶DQG&DOI6FUDPEOHFRPSHWLWLRQVHDFKGD\ 7KRVHIDPLOLDUZLWKWKH2NHHFKREHH/DERU'D\ 5RGHRWUDGLWLRQPD\KDYHQRWLFHGWKHQHZIRUPDW DVWKHDQQXDOHYHQWKDGEHHQD3URIHVVLRQDO5RGHR &RZER\V$VVRFLDWLRQVDQFWLRQHGURGHRIRUVHYHUDO GHFDGHV$FFRUGLQJWR'DYLG+D]HOOLHI2NHHFKREHH &RXQW\ &DWWOHPHQ¶V $VVRFLDWLRQ 3UHVLGHQW WKH FKDQJH FDPH DERXW IRU D QXPEHU RI UHDVRQV ³7KH UDQFKURGHRIRUPDWDOORZHGPRUHORFDOFRQWHVWDQWV

Ã&#x2C6; Heartland InTheFieldMagazine

WR FRPSHWH ZKLFK OHG WR PRUH SHRSOH ZKR ZHUH IDPLO\DQGIULHQGVRIWKHFRPSHWLWRUVFRPLQJRXWWR ZDWFK%HFDXVHRIWKHORZHUFRVWWRSXWRQDUDQFK URGHR ZH ZHUH DEOH WR UHGXFH WLFNHW SULFHV DQG SURYLGH PRUH DIIRUGDEOH IDPLO\ HQWHUWDLQPHQW WKDW EHQH¿WWHGWKHVSHFWDWRUVDQGVSRQVRUVDOLNH´/DUJH RYHUKHDGIDQVWKDWZHUHLQVWDOOHGLQVLGHWKHIDFLOLW\ LQ-XQHSURYLGHGDJUHDWO\ZHOFRPHGFRROHUPRUH SOHDVDQW DWPRVSKHUH WKDQ KDG EHHQ H[SHULHQFHG DW SUHYLRXVHYHQWVKHOGDWWKHYHQXH ,Q WKH 6DWXUGD\ DQG 6XQGD\ JRURXQGV  ZDV DZDUGHG WR WKH WRS WHDP LQ HDFK HYHQW DV IROORZV 7HDP %UDQGLQJ  )LUVW $PHULFDQ &DWWOH &RZ 'HFRUDWLQJ  5RFNLQJ 8 &DWWOH &R 5DQFK %URQF5LGLQJ6SXU67HDP6RUWLQJ-7)&DWWOH  3HUIRUPDQFHDQG7HDP7\LQJ./%DU

Ã&#x2C6;/CTOBERÃ&#x2C6;


7KH 6XQGD\ VKRUWJR HYHQW ZLQQHUV DOVR ZRQ  DQG LQFOXGHG 7HDP %UDQGLQJ  -7) &DWWOH  3HUIRUPDQFH &RZ 'HFRUDWLQJ $ %DU / &DWWOH &R 5DQFK %URQF 5LGLQJ  /RXWKDQ 5DQFK 7HDP 6RUWLQJ6SXU6DQG7HDP7\LQJ6\IUHWW5DQFK $W WKH HQG RI WKH ZHHNHQG WKH )LUVW$PHULFDQ &DWWOH&RWHDPRI$OH[-RKQV6KDQH3HUNLQV0DWW $ULHWWD &KDQFH :ULJKW DQG .DW\ 7KRPDV FDPH LQ IRXUWK WDNLQJ KRPH DQ DGGLWLRQDO   7KLUG SODFHSDLGWRWKH6SXU6WHDPRI%ULDQ6WUHHW 7RPP\ 6WRNHV 'DOWRQ %RQH\ +HLWK &UXP DQG 'DQQD-R0F)DUODQG7KH/RXWKDQ5DQFKWHDPRI 6HWK /RXWKDQ -LP %XUQHWWH 5DIH 'XUUDQFH :LOO &URQFLFK DQG 3DLJH 6KHUPDQ HQMR\HG  IRU WKHLUVHFRQGSODFH¿QLVK7KHRYHUDOOFKDPSLRQWLWOH ZDVHDUQHGE\-7)&DWWOH 3HUIRUPDQFHPHPEHUV -LPP\ )XVVHOO /XNH &DQWX %UDQGRQ 'LHWHU 0DWW 0DUWHOO DQG 7DPPH )XVVHOO ZKR SRFNHWHG DQ DGGLWLRQDOIRUWKHLUHIIRUWV ³7KH &DWWOHPHQ KDG D JUHDW WLPH DQG ZH ORRN IRUZDUG WR LPSURYLQJ RQ WKLV HYHQW LQ WKH IXWXUH 7KDQN \RX WR DOO RXU VSRQVRUV YROXQWHHUV DQG WHDPV´VDLG+HDWKHU5XFNV2&&$6HFUHWDU\

Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

Heartland InTheFieldMagazine




&$77/(6(16(

)NFORMATION¬THAT¬MAKES¬SENSE¬HELPING¬YOU¬MAKE¬CENTS¬ "Y¬$R¬#ATHY¬"ANDYK ¬1UALITY¬,IQUID¬&EEDS

7HATSÃ&#x2C6;(OLDINGÃ&#x2C6; 9OUÃ&#x2C6;"ACK "

DFN LQ EDVLF QXWULWLRQ FODVV ZH ZHUH LQWURGXFHG WR WKH FRQFHSW RI´Ã&#x20AC;UVWOLPLWLQJQXWULHQWµ7DNH D VLPSOLÃ&#x20AC;HG H[DPSOH LI VRPH FDOYHV ZHUH HDWLQJ HQRXJK SURWHLQ PLQHUDOV DQGYLWDPLQVWRVXSSRUWSRXQGVRIGDLO\ JDLQEXWRQO\HQRXJKHQHUJ\WRVXSSRUW ôWKH\ZRXOGJDLQôOEDGD\,QWKLV FDVHHQHUJ\LVWKHÃ&#x20AC;UVWOLPLWLQJQXWULHQW 0\ SURIHVVRUV LOOXVWUDWHG WKLV ZLWK WKH LPDJHRIDEDUUHOZLWKRQHVWDYHVKRUWHU WKDQ WKH RWKHUV ² LW FRXOG RQO\ EH Ã&#x20AC;OOHG WRWKHWRSRIWKHVKRUWVWDYHOLPLWLQJWKH EDUUHO·VHIIHFWLYHYROXPH%XWDV,WKLQN DERXW LW EDUUHOV DUHQ·W VRPHWKLQJ PRVW RI XV URXWLQHO\ HQFRXQWHU  $ PRUH XS WRGDWH H[DPSOH PLJKW EH KDYLQJ D FHOO SKRQH ZLWK * FDSDELOLWLHV SD\LQJ IRU D SODQ WKDW VXSSRUWV * DFFHVV EXW EHLQJ VRPHZKHUH ZLWK RQO\ * VHUYLFH DYDLODEOH6RWKHORFDOVHUYLFHEHFRPHV WKH ´Ã&#x20AC;UVW OLPLWLQJµ IDFWRUDQG VRPHRQH ZKRXVHVWKHLUSKRQHIRUPRUHGHPDQGLQJ DSSOLFDWLRQV WKDQ , GR GRHVQ·W JHW WKH VSHHGWKH\ZHUHKRSLQJIRU

Ã&#x2C6; Heartland InTheFieldMagazine

$FRQYHUVDWLRQDWDFRQIHUHQFHDIHZ ZHHNVDJRJRWPHWKLQNLQJDERXWORRNLQJ DW WKLV FRQFHSW LQ D EURDGHU FRQWH[W  , ZDV WDONLQJ ZLWK IULHQGV ZKR OLNH PH DUH SURIHVVLRQDOO\ IRFXVHG RQ KHOSLQJ FDWWOH SURGXFHUV PDNH WKHLU RSHUDWLRQV DVSURÃ&#x20AC;WDEOHDQGVXVWDLQDEOHDVSRVVLEOH :H HDFK ZRUN IRU FRPSDQLHV WKDW FDQ SURYLGH SURGXFWV RU SURJUDPV WKDW DGGUHVVVSHFLÃ&#x20AC;FQHHGVRUFKDOOHQJHVDQG ZH DUH DOO FRQÃ&#x20AC;GHQW WKDW ZH UHSUHVHQW YDOLG RSSRUWXQLWLHV WR HQKDQFH  RXU FXVWRPHUV· EXVLQHVVHV   %XW ZH·YH DOO IRXQG RXUVHOYHV LQ VLWXDWLRQV ZKHUH ZH GLGQ·W ² RU ZKHUH ZH NQHZ ZH FRXOGQ·W ² SURYLGH WKH NLQG RI ¶EDQJ IRU WKH EXFN· EHLQJ ORRNHG IRU  7KDW·V EHFDXVH WKHUHZDVD´Ã&#x20AC;UVWOLPLWLQJµPDQDJHPHQW SUDFWLFHRQWKHIDUPRUUDQFKWKDWQHHGHG WREHDGGUHVVHGÃ&#x20AC;UVW , JXHVV WKLV IROORZV WKH VDPH OLQH RI WKLQNLQJ DV ¶KROLVWLF PDQDJHPHQW· EXW ZLWKRXW WKH IDQF\ QDPH  :KDW LW ERLOV GRZQWRLVUHFRJQL]LQJWKDWQRWRQO\DUH DOO DUHDV RI FDWWOH SURGXFWLRQ LPSRUWDQW WKH\ DUH VR LQWHUGHSHQGHQW WKDW ZH FDQ·W PDQDJH RU LJQRUH  RQH ZLWKRXW FRQVLGHULQJ WKH UHODWLRQVKLSV WR DOO WKH RWKHUV

(%2$Ã&#x2C6;(%!,4( When cattle are sick, it probably doesnâ&#x20AC;&#x2122;t matter which efficiency enhancer we add to the diet, or how great their sireâ&#x20AC;&#x2122;s EPDs were; they still arenâ&#x20AC;&#x2122;t going to perform at a high level. Infections can place multiple roadblocks in the way of growth and reproduction: â&#x20AC;¢ Energy and other resources are re-directed towards fighting disease organisms and mounting a multi-pronged immune response; â&#x20AC;¢ Some diseases lead to specific losses such as abortions; â&#x20AC;¢ Sick animals often reduce their feed intake; â&#x20AC;¢ Absorption of nutrients from the feed that is eaten may be impaired. Itâ&#x20AC;&#x2122;s easy to see that an inadequate preventive health program can stand in the way of expected performance. A veterinarian who is familiar with the operation and local conditions is the best resource for developing a vaccination and biosecurity protocol that helps ensure that overall productivity isnâ&#x20AC;&#x2122;t limited by disease challenges.

0!2!3)4%3 Like infectious diseases, both internal and external parasites can sap valuable nutrients away from productive purposes. Heavily infested cattle eat less, absorb fewer nutrients, must fuel stress-related and immune responses, and have to repair damaged tissues and replace lost blood. If all that is going on, it is unlikely that adoption of any unrelated management practice is going to completely overcome the limits placed by the presence of high numbers of flies, worms, or other damaging pests.

Ã&#x2C6;/CTOBERÃ&#x2C6;


%.6)2/.-%.4

'ENETICS

This summer’s drought has brought the potential impact of environmental conditions home to many of the nation’s cattle producers. Heat, cold, mud, wind, and limited water quality and quantity can all add stress, increase maintenance requirements, and discourage feed consumption. Man-made components of the animals’ surroundings can both relieve or compound these problems. While much harder to control than diseases and parasites, environment can certainly become the factor that places the ceiling on potential performance. When that is the case, focusing on options like mounds, shade, misters, improved access to water, or windbreaks will be the best investment the operation can make.

When everything comes together, and cattle are healthy, parasite-free, and receiving a balanced diet in a low-stress environment, they can still only perform to their genetic potential. If the goal is for even faster gains, heavier weights, or more efficiency (and the resources are there to support this level of production), the right cattle need to be in place to accomplish that. On the flip side, large rapidly-growing animals need more inputs than their more moderate counterparts, and unless those can be provided economically, that genetic base is a poor fit. Unless the cattle fit the environment and the performance goals of the operation, the herd’s genetic makeup is going to be the major limitation towards desired progress.

.542)4)/. I began this discussion with a review of the ‘first limiting nutrient’ within a nutritional program. But the overall diet being offered to cattle can also be the definitive constraint on potential herd improvements. Cattle receiving inadequate nutrition can exhibit reduced response to vaccines, be unable to mount adequate immune responses, will not exhibit their full genetic potential for growth or reproduction, are unlikely to fully benefit from products like ionophores, and cannot effectively combat environmental stress. A balanced diet, potentially enhanced with any of a range of effective feed additives, is the foundation of a successful and profitable cattle enterprise.

$OO WKHVH DUHDV DUH FULWLFDOO\ LPSRU WDQWLQUDLVLQJFDWWOH$QGDGRSWLQJWRROV DQG SUDFWLFHV WKDW HQKDQFH DQ\ RI WKHP FDQEHDJRRGLQYHVWPHQW%XWWRJHWWKH EHVWUHWXUQRQWKDWLQYHVWPHQW²DQGWRVHH WKHIXOOH[SHFWHGUHVSRQVHWRWKDWFKDQJH ² ZH QHHG WR EH VXUH WKHUH LVQ·W DQRWKHU ´ÀUVWOLPLWLQJµPDQDJHPHQWSUDFWLFHWKDW QHHGVWREHDGGUHVVHGÀUVW

È

/CTOBERÈÈ

Heartland InTheFieldMagazine




Okeechobee Brahman Sr. FFA Chapter "YÃ&#x2C6;2OBBIÃ&#x2C6;3UMNER

W

ith over 32 combined years of FFA experience between them, the Okeechobee Brahman Sr. FFA Chapter officers are looking forward to another fantastic year! 7KH RI¿FHU WHDP IRU  FRQVLVWV RI 3UHVLGHQW 6KLORK $QXH] 9LFH 3UHVLGHQW %UDQGRQ 0F.HH 6HFUHWDU\ 0DU\ %DNHU 7UHDVXUHU -XOLH 6KDUSH 5HSRUWHU $OO\VRQ 7ULPEOH DQG 6HQWLQHO &XUWLV (YDQV 7KH &KDSWHU DGYLVRUV DUH 5RJHU 0F:DWHUV 0DUVKDOO *HUELW] DQG %ULDQ 'U\GHQ HDFK RI ZKLFK VKDUH D ZHDOWK RI NQRZOHGJH DQG WDOHQWVZLWKWKHRUJDQL]DWLRQ :KLOHWKHRI¿FHUWHDPKDVTXLWHDQLPSUHVVLYH UHVXPH WKH\ DUH TXLFN WR SRLQW RXW WKDW HYHU\ PHPEHU RI DQ ))$ &KDSWHU LV DQ LPSRUWDQW DVVHW RIWKHRUJDQL]DWLRQ7KHLUPHPEHUV¿HOGWHDPVIRU $J0HFKDQLFVDQG(QYLURQPHQWDO6FLHQFHDVZHOO DV/LYHVWRFN'DLU\/DQG0HDW&LWUXV9HJHWDEOH DQG +RUVH -XGJLQJ FRQWHVWV ,Q IDFW WKH\ SODFHG VHFRQGLQWKHVWDWHODVW\HDULQ/LYHVWRFN-XGJLQJ DQG IRXUWK LQ /DQG -XGJLQJ 7KH 0HDW -XGJLQJ WHDP RI &RG\ &DVSHUVRQ -HVVLFD +XPSKUH\ %UDQGRQ 0F.HH DQG -XOLH 6KDUSH ZRQ WKH VWDWH FRPSHWLWLRQDQGZLOOEHUHSUHVHQWLQJ)ORULGDDWWKH

Ã&#x2C6; Heartland InTheFieldMagazine

1DWLRQDO))$&RQYHQWLRQ  ([SR WR EH KHOG LQ ,QGLDQDSROLVWKLV2FWREHU

$FFRUGLQJ WR 6KLORK VSHFL¿F JRDOV IRU WKH FKDSWHU WKLV \HDU LQFOXGH EHFRPLQJ PRUH LQYROYHG LQ WKH FRPPXQLW\ PDNLQJWKHSXEOLFPRUHDZDUHRIWKHLPSRUWDQFHRI DJULFXOWXUHDQGREWDLQLQJPRUHDFWLYHPHPEHUV 7KLV VXPPHU FKDSWHU PHPEHUV RUJDQL]HG D FDU ZDVK IXQGUDLVHU IRU &DOHE /DQJGDOH ZKR KDG VXIIHUHGWKHORVVRIKLVULJKWDUPIURPDQDOOLJDWRU DWWDFN³,KDGPHW&DOHEDQGRWKHU))$PHPEHUV IURP 0RRUH +DYHQ DQG ZH UHDOO\ ZDQWHG WR GR VRPHWKLQJWRKHOS´&XUWLVVKDUHG7KHHYHQWZDV KHOGDWWKH2NHHFKREHH7UDFWRU6XSSO\DQGUDLVHG DOPRVW 6HYHUDOPHPEHUVDOVRYROXQWHHUHGDWWKHDQQXDO 5& 0DWWVRQ 0HPRULDO $UFKHU\ 6KRRW KHOG LQ $XJXVW$FFRUGLQJWR-XOLH³5&¶VIDPLO\GRHVD ORW IRU ))$ DQG LV YHU\ VXSSRUWLYH VR ZH KHOSHG RXW KRZHYHU ZH FRXOG OLNH VHUYLQJ WHD SXWWLQJ WRJHWKHU PDUVKPDOORZ JXQV IRU WKH OLWWOH NLGV WR SOD\ZLWKDQGFOHDQLQJXSDIWHUWKHHYHQW´ Ã&#x2C6;/CTOBERÃ&#x2C6;


7KLV VXPPHU $OO\VRQ DWWHQGHG WKH RQHZHHN :DVKLQJWRQ /HDGHUVKLS&RQIHUHQFHZKHUHDWWHQGHHVOHDUQHGWRIXO¿OOWKHLU SXUSRVH DQG VHUYH WKHLU FRPPXQLWLHV$V SDUW RI KHU ³/LYLQJ WR6HUYH´SODQVKHLVRUJDQL]LQJDFORWKLQJGULYHRIQHZDQG JHQWO\XVHGLWHPVWREHQH¿W2NHHFKREHH+LJK6FKRROVWXGHQWV LQQHHG 0DU\ LV KHDGLQJ XS D VFKRRO VXSSO\ GULYH DQG VR IDU KDV WKUHHORFNHUVIXOORIVXSSOLHVWKDWZLOOEHGLVWULEXWHGE\WKH2+6 *XLGDQFH&RXQVHORUWRVWXGHQWVDVQHHGHG6XSSOLHVKDYHEHHQ GRQDWHGE\ORFDOEXVLQHVVHVDQGLQGLYLGXDOVDQGDSSUR[LPDWHO\ UDLVHGDWFRQFHVVLRQVWDQGVPDQQHGE\))$PHPEHUVDW RWKHUHYHQWVLVJRLQJWRZDUGVDGGLWLRQDOVXSSO\SXUFKDVHV 7KURXJK D  1DWLRQDO ))$ (QYLURQPHQWDO *UDQW WKDW &XUWLV ZDV LQVWUXPHQWDO LQ REWDLQLQJ WKH FKDSWHU ZLOO EH GHYHORSLQJERRNOHWVWREHXVHGWRHGXFDWHHOHPHQWDU\VWXGHQWV DERXW WKH HQYLURQPHQW 7KH WKUHHSDUW VHULHV ZLOO IRFXV RQ :LOGOLIH &RQVHUYDWLRQ 0DQDJHPHQW /DQG 3UHVHUYDWLRQ  &RQVHUYDWLRQDQG:DWHU5HVRXUFHV $VLIWKRVHSURMHFWVDUHQ¶WHQRXJKWKH&KDSWHUDOVRSODQVWR FRQWLQXHLWVSDUWLFLSDWLRQLQDQQXDOHYHQWVOLNHWKH))$$OXPQL &OD\6KRRWWREHKHOGDW4XDLO&UHHN3ODQWDWLRQ2FWREHUWK WKH)DUP&LW\/XQFKHRQLQ1RYHPEHUWKH2+69HWHUDQ¶V'D\ SURJUDP 1DWLRQDO ))$ :HHN LQ )HEUXDU\ 2NHHFKREHH $J 9HQWXUHDQG$J/LWHUDF\'D\LQ$SULO 7KURXJKVXFKDFWLYLWLHVWKH\KRSHWR³EUHDNWKHVWHUHRW\SHV DQG VWUHVV WKH OHDGHUVKLS GHYHORSPHQW RSSRUWXQLWLHV WKDW ))$ KDV WR RIIHU´ H[SODLQHG %UDQGRQ 7KH\ DOVR KRSH WR EURDGHQ DZDUHQHVV RI DJULFXOWXUDO LQGXVWULHV WKDW H[LVW RXWVLGH RI 2NHHFKREHH /DVW \HDU WKH FKDSWHU KDG DERXW  PHPEHUV ZKLFK WKH\ DUHKRSLQJWRJURZ³,W¶VQRWMXVWWKHQXPEHUV±ZHUHDOO\ZDQW SHRSOHWREHPRUHLQYROYHG´H[SODLQHG6KLORK,WLVWKHKRSH RIWKHRI¿FHUWHDPWKDWE\³JHWWLQJRXWWKHUHPRUH´DPRQJWKH VWXGHQWERG\DQGLQWKHFRPPXQLW\WKH\ZLOOHQFRXUDJHJUHDWHU SDUWLFLSDWLRQLQDOOWKDW))$KDVWRRIIHUIRUERWKPHPEHUVDQG YROXQWHHUV,WKLQNWKH\¶UHRQWKHULJKWWUDFN Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

Heartland InTheFieldMagazine




Ã&#x2C6; Ã&#x2C6; Ã&#x2C6; Ã&#x2C6;Ã&#x2C6;)TSÃ&#x2C6; !G 6ENTUREÃ&#x2C6;4IME

T

KLV \HDU¶V +LJKODQGV &RXQW\$J9HQWXUHZLOOEH KHOG 2FWREHU WK ± WK DW WKH +LJKODQGV &RXQW\ )DLUJURXQGV 7KHDQQXDOWKUHHGD\SURJUDPSURYLGHV DQ RSSRUWXQLW\ IRU WKLUG JUDGHUV WR JDLQ H[SHULHQFH XQGHUVWDQGLQJ DQG DSSUHFLDWLRQRIRXUORFDODJULFXOWXUH 7KH FRVW RI PDWHULDOV IRU WKH IRXUWHHQ VWDWLRQV EXV WUDQVSRUWDWLRQ $J9HQWXUHWVKLUWVDVZHOODVFRZER\ KDWVIRUHDFKVWXGHQWDQGOXQFKHVIRUWKH YROXQWHHUVRYHUWKHFRXUVHRIWKHWKUHH GD\V LV IXQGHG HQWLUHO\ E\ GRQDWLRQV 2YHU  YROXQWHHUV DUH QHHGHG HDFK GD\ WR HQVXUH WKDW WKH SURJUDP UXQV VPRRWKO\ DQG DUH WKH NH\ WR WKH HYHQW¶V VXFFHVV 9ROXQWHHUV KHOS ZLWK KDQGVRQ DFWLYLWLHV DQG VHUYH DV EXV JUHHWHUV WLPHUV FRRNV RU VHUYHUV IRU WKHYROXQWHHUOXQFKHV0LGGOHDQGKLJK VFKRRO))$PHPEHUVDOVRYROXQWHHUDV JURXSOHDGHUV$JULFXOWXUHFRPPRGLW\ JURXSVEXVLQHVVHVRUJDQL]DWLRQVDQG $J9HQWXUHLVQ¶WMXVWIRUWKLUGJUDGHUV7KH1LJKW LQGLYLGXDOV MRLQ LQ D SDUWQHUVKLS WR 7LPH$J9HQWXUHLVRSHQWRWKHSXEOLFDQGZLOOEHKHOG PDNH$J9HQWXUH D IXQ H[FLWLQJ DQG 7XHVGD\2FWREHUWKZLWKDGLQHLQRUWDNHRXWVWHDN HGXFDWLRQDO H[SHULHQFH IRU HYHU\RQH GLQQHUSUHSDUHGE\WKH+LJKODQGV&RXQW\&DWWOHPHQ LQYROYHG 7LFNHWV DUH  IRU DGXOWV DQG  IRU FKLOGUHQ DQGGLQQHULQFOXGHVVWHDNIUHVKFRUQRQWKHFREJUHHQ ,QWHUDFWLYH VWDWLRQV IRFXVHG RQ EHDQV EDNHG SRWDWR UROO LFHG WHD DQG KRPHPDGH $OOLJDWRUV %HHI %HHV &DODGLXPV LFH FUHDP *XLGHG WRXUV RI WKH IRXUWHHQ$J±9HQWXUH &LWUXV'DLU\)DUP$QLPDOV)RUHVWU\ VWDWLRQVZLOOEHJLYHQDWDQGSPVRFRPHRQ *UDSHV 2UQDPHQWDO +RUWLFXOWXUH RXWIRUDQHYHQLQJRIIUHHIDPLO\HQWHUWDLQPHQW 3RXOWU\ 6WUDZEHUULHV :DWHU  6RLO &RQVHUYDWLRQ DQG 9HJHWDEOHV )RUDGGLWLRQDOLQIRUPDWLRQSOHDVHFRQWDFW'DQLHOOH SURYLGH VWXGHQWV ZLWK D EURDG EDVH 'DXP RU 'DUOHQH 3K\SHUV DW    RU RI NQRZOHGJH DERXW ERWK SODQW DQG -XG\%URQVRQDW  <RXFDQDOVRHPDLO DQLPDO VFLHQFH 3DUWLFLSDQWV HQMR\ 'DQLHOOH DW GGDXP#KDSSLQHVVIDUPVFRP RU 'DUOHQH DFWLYLWLHV VXFK DV WDVWLQJ KRQH\ DQG DWGDUOHQH#KDSSLQHVVIDUPVFRP PDNLQJ EHHVZD[ FDQGOHV VTXHH]LQJ WKHLU RZQ RUDQJH MXLFH DQG SODQWLQJ PLQLJDUGHQVWRWDNHKRPH

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;


Mark Your Calendars for

!GÃ&#x2C6;&EST T

KHVHFRQGDQQXDO$J)HVWZLOO EHKHOG6DWXUGD\1RYHPEHU WK DW $UFDGLD¶V 7XUQHU &HQWHU7KLV\HDU¶VHYHQWSURPLVHVWREH HYHQELJJHUDQGEHWWHUDQGZLOOIHDWXUH -XQLRUDQG:LOOLH(GZDUGVIURP+LVWRU\ &KDQQHO¶VKLW79VKRZ6ZDPS3HRSOH $J )HVW LV IDPLO\ IULHQGO\ HYHQW KRQRULQJ)ORULGD¶V$JULFXOWXUDOKHULWDJH DQG VSRWOLJKWLQJ WRGD\¶V DJULFXOWXUDO LQYHQWLRQV 3DUWLFLSDQWV DQG JXHVWV WUDYHOIURPDURXQG)ORULGDWRVKDUHDQG VHH KRZ DJULFXOWXUH VKDSHV RXU OLYHV )RU VRPH DJULFXOWXUDO SXUVXLWV SURYLGH HPSOR\PHQW ZKLOH RWKHUV HGXFDWH DQG SDVV RQ WKHLU NQRZOHGJH WR IXWXUH JHQHUDWLRQV  $QG ODVW EXW QRW OHDVW PDQ\HQMR\DJUHODWHGOHLVXUHDFWLYLWLHV :KHQ ZH FRPELQH GHPRQVWUDWLRQV RI WKHVH WKUHH EURDG FDWHJRULHV ZLWK DQ HDJHU FURZG ZH KDYH WKH EDVH RI $J )HVW2QWRSRIWKDWZHDGGDODUJHNLGV DUHD ZRQGHUIXO YHQGRUV OLYH PXVLF Ã&#x2C6;

/CTOBERÃ&#x2C6;Ã&#x2C6;

DQGJRRGIRRG6RPHRIWKHDFWLYLWLHVDW WKLV\HDU¶V$J)HVWZLOOLQFOXGHFRZER\ SRORZRUNLQJFRZGRJGHPRQVWUDWLRQV OLYHVWRFNVKRZVFODVVHVIURP8QLYHUVLW\ RI )ORULGD¶V ,)$6 DQG D PHHW DQG JUHHW RSSRUWXQLW\ ZLWK:LOOLH  -XQLRU (GZDUGV *DWHV ZLOO RSHQ DW DP ZLWKDGPLVVLRQDQGIUHHSDUNLQJ 7KHDQQXDO'H6RWR&RXQW\$J)HVW EDQTXHWZLOOEHKHOG)ULGD\1RYHPEHU WKDWSP7KHHYHQWZLOOSD\WULEXWH WR SLRQHHUV RI WKH FRXQW\¶V DJULFXOWXUDO KLVWRU\ DV ZHOO DV UHFRJQL]H DQ XSFRPLQJ\RXQJDJULFXOWXUDOLVW 'HVRWR&RXQW\LVSURXGWRIRUPDOO\ UHFRJQL]HWKHULFKDJULFXOWXUDOKLVWRU\RI WKH FRXQW\ ERUQ RQ WKH EDFNV RI FLWUXV JURZHUV IDUPHUV DQG FDWWOHPHQ DQG ZRPHQ7KHDJULFXOWXUDOGLYHUVLW\SDYHG WKH ZD\ IRU HFRQRPLF ZHOOEHLQJ DQG JURZWK ZLWKLQ WKH FRXQW\ DQG LV WRGD\ D VWDELOL]LQJ IRUFH GXULQJ D QDWLRQZLGH

HFRQRPLF FULVLV  :KLOH WKH FRXQW\ LV NQRZQ IRU WKUHH PDMRU KLVWRULFDO FURSV  FLWUXV FDWWOH DQG ZDWHUPHORQV WRGD\¶V'H6RWR&RXQW\ERDVWVDZLGH UDQJH RI DJULFXOWXUDO SURGXFWLRQV WKDW LQFOXGH GDLU\ EOXHEHUULHV KRUWLFXOWXUDO QXUVHULHVDQGDYDULHW\RIYHJHWDEOHV 'XULQJ WKH GHYHORSPHQW ERRP DJULFXOWXUH LQ 'HVRWR &RXQW\ VXIIHUHG DV ULFK DJULFXOWXUDO ODQG ZDV VROG IRU GHYHORSPHQW$VDUHVXOWRIWKHFXUUHQW HFRQRPLF FULVLV PXFK RI WKDW ODQG LV UHWXUQLQJ WR LWV KLVWRULFDO XVH  ,W LV LQ WKLV VSLULW DQG DV D WKDQN \RX WR WKRVH ZKR SUHFHGHG WKH FXUUHQW GD\ IDUPHUV UDQFKHUV DQG JURZHUV WKDW WKLV HYHQW ZDV FUHDWHG   3LRQHHUV WR EH KRQRUHG IRU WKHLU FRQWULEXWLRQ WR WKH DJULFXOWXUH LQGXVWU\ LQFOXGH +' 5\DOV 0RVH +ROOLQJVZRUWKDQG:*:HOOHV 6HYHUDO\RXQJIDUPHUVDQGUDQFKHUV KDYHDOVREHHQQRPLQDWHGDQGRQHZLOO XOWLPDWHO\ EH FKRVHQ DV WKH 'H6RWR &RXQW\ <RXQJ )DUPHU5DQFKHU RI WKH <HDU  7KHVH LQGLYLGXDOV DUH FDUU\LQJ RQ WKH WUDGLWLRQV RI WKH SLRQHHUV EHIRUH WKHP SUHVHUYLQJ DJULFXOWXUDO SURGXFWLRQ DQG WKH 'H6RWR &RXQW\ OLIHVW\OH7RGD\¶VIDUPHUVDQGUDQFKHUV PXVW GR PRUH WKDQ JURZ  7KH\ PXVW WUDQVLWLRQWKHLUIDPLO\RSHUDWLRQVWRQHZ WHFKQRORJLHV EH SROLWLFDOO\ VDYY\ EH DEOHWRQDYLJDWHWKHH[WHQVLYHUHJXODWRU\ IUDPHZRUNDQGEHSXEOLFVSRNHVSHRSOH IRUDQLQGXVWU\WKDWIHZXQGHUVWDQG7KH \RXQJIDUPHUUDQFKHUWKDWLVFKRVHQZLOO UHFHLYHDQHQJUDYHG+HQU\*ROGHQ%R\ 5LIÃ&#x20AC;H $J )HVW EDQTXHW WLFNHWV FDQ EH SXUFKDVHGDWWKH7XUQHU&HQWHUIRU HDFKRUWDEOHVRIHLJKWFDQEHUHVHUYHG IRU)RUPRUHLQIRUPDWLRQRQHLWKHU HYHQW SOHDVH FDOO WKH 7XUQHU &HQWHU DW  RU HPDLO MVXOOLYDQ# WXUQHUFHQWHUFRP Heartland InTheFieldMagazine




0/,,).!4)/.Ã&#x2C6;3%26)#%3Ã&#x2C6; 6WURQJEHHVZKHQ\RXZDQWWKHP:HDOVRKDYH KRQH\DQGVNLQFDUHSURGXFWVPDGHZLWKKRQH\ DQGLQJUHGLHQWVIURPWKHKLYH&DQWX$SLDULHV  7/2-Ã&#x2C6;#!34).'3Ã&#x2C6; $GGOLYLQJPLFUREHVWRLPSURYH\RXUVRLOXVH OHVVZDWHU&DOO6HDQ*UHHQ/HDI:RUP)DUP  ZZZ*UHHQ/HDI:RUP)DUPFRP #()#+%.Ã&#x2C6;-!.52%Ã&#x2C6;&/2Ã&#x2C6;3!,%Ã&#x2C6; 'U\DQGDYDLODEOHLPPHGLDWHO\&DOO7LP)RUGRU 'DQQ\7KLERGHDX   !+#Ã&#x2C6;'%2-!.Ã&#x2C6;3(%0(%2$Ã&#x2C6;0500)%3Ã&#x2C6;Ã&#x2C6; ROGHUIHPDOHVWKDWDUHZHHNVROGIURP P\¿UVWOLWWHU VDEOHVEONDQGWDQ WKH\¶UH HDDOVR,KDYHDQGOLWWHUWKDWKDV SXSSLHV PDOHVIHPDOHV WKDWZLOOEH UHDG\WRJRZKHQWKH\DUHZHHNV ROGDQGWKHVHDUHHD VROLGEODFNVDQG  YHU\QLFHO\PDUNHGVDEOHV )RUDGGLWLRQDO LQIRUPDWLRQSOHDVHFRQWDFW  RU HPDLOEXFNH\HRKLR#FHQWXU\OLQNQHW  #(%!0Ã&#x2C6;-%4!,Ã&#x2C6;2//&).'Ã&#x2C6; 'LVFRXQW0HWDO0DUW¶;¶VKHHWVLQVWRFN 3ULFHVIURPWR&XVWRPOHQJWKVDYDLODEOH ,I\RXEX\HOVHZKHUHZHERWKORVH&DOO 

$)3#/5.4Ã&#x2C6;%15).%Ã&#x2C6;3%26)#%Ã&#x2C6;"5.$,%Ã&#x2C6; &RJJLQVYDFFLQDWLRQWHHWKÃ&#x20AC;RDW &DOORU   Ã&#x2C6;*/(.Ã&#x2C6;$%%2%Ã&#x2C6; Ã&#x2C6;).#,5$%3Ã&#x2C6;Ã&#x2C6; (QGORDGHU%R[%ODGHDQG)RUNVDQGDQ ¶7UDLOHUZLWKUDPSVDQGHOHFWULFEUDNHV 7RWDOXVDJHKRXUV /LNHQHZFRQGLWLRQ &XUUHQWO\EHLQJVWRUHGLQDFRYHUHGEXLOGLQJ   Ã&#x2C6;-!33%9Ã&#x2C6;&%2'53/.Ã&#x2C6;Ã&#x2C6; SWRKSZKHHOGULYHVKXWWOHVKLIW K\GUDXOLFUHPRWHV &DOO Ã&#x2C6;2%!#(Ã&#x2C6;&/2+,)&4Ã&#x2C6; KRXUV&DOO



&ODVVLILHGV

!,, 02/Ã&#x2C6;&,!4"%$Ã&#x2C6;42!),%2Ã&#x2C6; ;ZLWKEHDYHUWDLODQGUDPSV7DQGHP SGD[HOV &DOO+DQN

3ULYDWHEHGURRPZDWWDFKHGEDWKURRP VKRZHU VN\OLJKW %XQNEHGV1HZEHDULQJVULPV WLUHV2%2125($621$%/( 2))(55()86(' &RQWDFW'DYLG6ZDUW GDYLG#DGYDQWDJHFFJFRP

0/24!",%Ã&#x2C6;"5,+Ã&#x2C6;&%%$%23Ã&#x2C6; ([FHOOHQW&RQGLWLRQ&DOO .%7Ã&#x2C6;(/,,!.$Ã&#x2C6;2%0/3Ã&#x2C6; 71$:'PRGHOVZIURQWEURRPVDQG ER[EODGHV1HYHUXVHGVROGQHZ6HOO EDODQFHRIZDUUDQW\ Ã&#x2C6;'2%!4Ã&#x2C6;$!.%Ã&#x2C6;&,!4"%$Ã&#x2C6;42!),/2Ã&#x2C6; 0HDVXUHV¶´*RRG)ORRU:LQFKHV 6WUDSV RQERWKVLGHV3ULFH &DOO(XJHQH7RODU Ã&#x2C6;4/9/4!Ã&#x2C6;7!2%(/53%Ã&#x2C6;&,!4"%$ /RZ+RXUV6LGH6KLIW([FHOOHQW&RQGLWLRQ2QH 2ZQHU3ULFH Ã&#x2C6;"!2.3Ã&#x2C6;7Ã&#x2C6;Ã&#x2C6;34!,,3Ã&#x2C6;&/2Ã&#x2C6;2%.4Ã&#x2C6; )W2JGHQDUHD&DOO/LVD Ã&#x2C6;#!4%20),,!2Ã&#x2C6;-4Ã&#x2C6;#(!,,%.'%2Ã&#x2C6; 42!#4/2Ã&#x2C6; +3ZLWKZKHHOGULYHPDNLQJLWPXFK VWURQJHUDQGPRUHYHUVLWLOHSWRVUHDUDQG PLGGOH8VHGIRUPRZLQJRQO\VROLJKWZHDU KUV([FHOOHQWWUDFWRUIRUDVPDOO IDUP*UHDWFRQGWLRQEDUQNHSWHPDLOIRUPRUH SL[JZKQVK#KRWPDLOFRP $UFDGLD)O Ã&#x2C6;*/(.Ã&#x2C6;$%%2%Ã&#x2C6; 42!#4/2Ã&#x2C6; Ã&#x2C6; 8VHG+UV(QG/RDGHU %R[%ODGHDQG)RUNV¶ 7UDLOHUZLWKUDPSVDQG HOHFWULFEUDNHV$OOOLNH QHZFRQGLWLRQ&DOO

 !#2%Ã&#x2C6;,/4Ã&#x2C6;).Ã&#x2C6;6)+).'Ã&#x2C6;%34!4%3NQRZQ DV³7KH3UDLULH´LVIRUVDOHE\RZQHU=RQHGIRU UHVLGHQWLDORUDJULFXOWXUDO:HVW(QGRIPLOH 5G/RWKDVEHHQFOHDUHGVXUYH\HGIHQFHG  JDWHG KDV'(3DSSURYDOIRUEXLOGLQJ,QFOXGHV VWRU\REVHUYDWLRQWRZHU)RULQIRSOHDVHFDOO %HWZHHQDPSP(67'DYLGDW 2ZQHU¿QDQFLQJWHUPVDYDLODEOH 12FUHGLW FKHFN &DVKRUZLWK2ZQHU )LQDQFLQJ5HTXLUHVGRZQ6HHPRUHDW ZZZÃ&#x20AC;RULGDSUDLULHFRP -520(9Ã&#x2C6;.#Ã&#x2C6; 6!#!4)/.Ã&#x2C6;2%.4!,Ã&#x2C6;Ã&#x2C6; &/26(7272:1 5(17%<7+(:((. &$// /DNH3ODFLG&KULVWLDQ6FKRRO6WXGHQWV+DYH <RXU3DUHQW V VLJQEHORZDQGUHWXUQWR0U*  BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

Ã&#x2C6;"%!54)&5, Ã&#x2C6;0!24)!,,9Ã&#x2C6;7//$%$Ã&#x2C6; !#2%3Ã&#x2C6;LQQRUWKHUQ$UFDGLDIRUVDOH=RQHG $JULFXOWXUDO&DOO   Ã&#x2C6;&//4Ã&#x2C6;Ã&#x2C6; 42!6%,Ã&#x2C6;42!),%2Ã&#x2C6;Ã&#x2C6; ,QWHULRUUHPRGHOHG ,PSRUWHG.HQWXFN\ FHGDUWDEOHZLWK EHYHOHGHGJH&XVWRP FHGDUIUDPHGFRXFK6LQJOH%HGLQOLYLQJURRP )XOONLWFKHQ VWRYHPLFURZDYHUHIULJHUDWRU 

723/$&($ &/$66,),('$'(0$,/ UKRQGD#KHDUWODQGLWIFRP


È

/CTOBERÈÈ

Heartland InTheFieldMagazine




-.,-1&3)8(4:39>+&72':7*&:

8WRRQTV-KIJNCPFU(QWPV[&ITKEWNVWTG +,*+/$1'6&2817<

8CVWTFC[4EVQDGT

,CVGU4RGPCVRO)KPPGT8GTXGFCVRO +QQFi+WPi+TKGPFUi1KXG'CPF 8VGCM 8JTKOR)KPPGT '>4'2KZGTU .EG5TQXKFGF NG 7GUGTXGF9CD HQT  VCDNG GUUQP

3COGQHDWUKP

PI 4RGP8GCVK

-QYGTVQP7GUKFGPEG :8-Y[8GDTKPI 'TKPIVJGYJQNGHCOKN[HQTCPKIJVQHITGCVHQQFOWUKEFCPEKPI HWP (CNNQTGOCKNLCPOGPIGU%GODCTSOCKNEQOHQT9KEMGVU .PHQ

9JCPM>QW-KIJNCPFU(QWPV[+CTO'WTGCW-GTKVCIG8RQPUQTU

Ă&#x2C6; Heartland InTheFieldMagazine

2FWREHU)ULGD\1LJKW/LYH )DPLO\)ULHQGO\)DOO)HVWLYDO The emergence of pumpkin spice lattes and college football games announce the arrival of fall! Main Street Wauchula, Inc. welcomes the change of seasons with the annual fall festival at the October 19th Friday Night Live. The Hardee County Ministerial Association is partnering with Peace River Electric Cooperative to provide booths that will stretch across Main Street as well as cake walks and prizes! The Fall Festival is sure to be family fun and will include numerous events that will entertain all ages. Families and businesses can bring a home created scarecrow to display at Heritage Park for just $10. A pumpkin patch, games, inflatables and a costume contest will keep the children busy! Peace River Electric Cooperative will be selling hotdogs for one dollar to benefit a charity in Hardee County. Food options also include the Main Street restaurants, which will stay open late for Friday Night Live participants. Downtown retail stores will also remain open for parents who are looking to spend some time planning for the approaching holiday season. Do not miss out on this community fall festival on Friday, October 19th! The Hardee County Ministerial Association is planning to provide a safe, Christian alternative to Halloween by having game booths operated by volunteers from as many Christian ministries and local organizations as possible. The cake auction and cupcake walk will help to raise money for the Hardee Help Center, and provide lots of music, candy and something fun for the whole family.

Ă&#x2C6;/CTOBERĂ&#x2C6;


Kathleen Shatto and John Macchia

Seacoastâ&#x20AC;&#x2122;s Rural Banking Team

TO AGRICULTURAL LOANS* MADE POSSIBLE If youâ&#x20AC;&#x2122;re in agriculture, you know thereâ&#x20AC;&#x2122;s no other business like it. When it comes time to purchase new equipment, acquire cattle, or obtain seasonal working capital, you need a partner there who can help make it happen. Thatâ&#x20AC;&#x2122;s exactly what we do at Seacoast. Weâ&#x20AC;&#x2122;re local, which means youâ&#x20AC;&#x2122;ll always talk to someone who understands your unique needs and the types of loans and operating lines of credit that can help you most. So while youâ&#x20AC;&#x2122;re growing your crops and livestock, weâ&#x20AC;&#x2122;re here to help grow your business.

TO A MORE HUMAN WAY TO BANK

Kathleen Shatto

John Macchia

OKEECHOBEE | GLADES | HENDRY

HIGHLANDS | DESOTO | HARDEE

863.467.4663

863.465.4834

SeacoastNational.com *Subject to credit approval. Certain restrictions may apply.

0<0$G5HVL]HLQGG

Ă&#x2C6;

30

/CTOBERĂ&#x2C6;Ă&#x2C6;

Heartland InTheFieldMagazine




+HDUWODQG·V*URZLQJ%XVLQHVVHV

7UDGHLQ\RXUROGWDWWHUHG $PHULFDQ)ODJIRUSURSHU GLVSRVDODW*RLQ 3RVWDO DQGUHFHLYHD1(: [  $PHULFDQ)ODJ)5((

6833257,1*285&20081,7<285 &28175< 285752236

Ã&#x2C6; Heartland InTheFieldMagazine

Ã&#x2C6;/CTOBERÃ&#x2C6;


$'9(57,6(

<285 %86,1(66+(5(

È

/CTOBERÈÈ

Heartland InTheFieldMagazine




$ATE¬

%VENT

$ETAILS4IME

/CT¬ST

&&!¬(ALL¬OF¬&AME¬)NDUCTEE¬2ECEPTION¬

&&!¬,EADERSHIP¬#ENTERˆ(AINES¬#ITY

/CT¬TH

&RIENDS¬OF¬THE¬.2!¬"ANQUET

4URNER¬!GRI #IVIC¬#ENTER ¬!RCADIA

/CT¬TH

2ED¬.ECK¬9ACHT¬#LUB

#OLUMBUS¬$AY¬7EEKEND ¬0UNTA¬'ORDAˆ ¬ 

/CT¬TH

(¬$AIRY¬3HOW

4URNER¬!GRI #IVIC¬#ENTER ¬!RCADIA¬

/CT¬TH

+ALEB¬h&REDv¬,ANGDALE¬"ENElT¬&UN¬$AY

#HALO¬.ITKA¬'ROUNDS ¬-OORE¬(AVEN¬

/CT¬TH TH

2EPRODUCTIVE¬-GT¬3CHOOL

"UCK¬)SLAND¬2ANCH ¬,AKE¬0LACID

/CT¬TH TH 3OUTHERN¬7OMENS¬3HOW

/RLANDO¬#ONVENTION¬#ENTER

/CT¬TH

&RIENDS¬OF¬THE¬.2!¬"ANQUET

¬PM ¬/KEECHOBEE¬3HRINE¬#LUB

/CT¬TH ¬ .OV¬TH

(EARTLAND¬-AZE

WWWTHEHEARTLANDMAZECOM

/CT¬TH

"OOTS¬AND¬0EARLS¬'ALA

+/!¬#ONVENTION¬#ENTER ¬/KEECHOBEE

/CT¬TH

$OWNTOWN¬"RADENTON¬&ARMERS¬-ARKET¬

/CT¬TH

#HARLOTTE¬,EWIS¬-EMORIAL¬"ARREL¬2ACE

%XHIBITION¬¬AM ¬SHOW¬¬NOON ¬&RED¬3MITH¬2ODEO¬!RENA ¬"RIGHTON

/CT¬TH

0ASTURE¬7EED¬$AY

/NA¬2ANGE¬#ATTLE¬2ESEARCH¬#ENTER ¬/NA

/CT¬TH

(IGHLANDS¬#OUNTY¬!G¬6ENTURE¬$INNER

&IREMENS¬&IELD ¬3EBRING

/CT¬TH TH (IGHLANDS¬#OUNTY¬!G¬6ENTURE

&IREMENS¬&IELD ¬3EBRING

/CT¬TH

$E3OTO¬#OUNTY¬#HAMBERS¬¬ !NNUAL¬-EMBER¬%VENT

h4OUCHDOWNS¬¬4AILGATES v¬#ONTACT¬$EBBY¬3NYDER¬ ¬ 

/CT¬TH

&RIDAY¬.IGHT¬,IVE &ALL¬&ESTIVAL

(ERITAGE¬0ARK ¬$OWNTOWN¬7AUCHULA¬ ¬PM

/CT¬TH

/KEECHOBEE¬&&!¬!LUMNI¬#LAY¬3HOOT

1UAIL¬#REEK¬0LANTATION

/CT¬TH

(IGHLANDS¬&ARM¬"UREAU ¬¬ !NNUAL¬-EETING¬¬$INNER

(OWERTON¬2ESIDENCE ¬3EBRING

/CT¬TH

0UNTA¬'ORDA¬&ARMERS¬-ARKET

¬AM

/CT¬TH ST¬ (UNSADER¬&ARMS ¬0UMPKIN¬&ESTIVAL

"RADENTON

/CT¬TH TH &LORIDA¬&ARM¬"UREAU¬#ONFERENCE

0ONTE¬6EDRA¬"EACH

/CT¬TH

$E3OTO¬#OUNTY¬#ATTLEMENS¬-EETING

4URNER¬!GRI #IVIC¬#ENTER ¬¬!RCADIA

/CT¬TH TH¬ &ALL¬&ESTIVAL

0ORT¬3T¬,UCIE¬#IVIC¬#ENTER¬ ¬ 

/CT¬TH

(ENSCRATCH¬&ARMS¬¬WWWHENSCRATCHFARMSCOM

!NNUAL¬0UMPKIN¬&ESTIVAL

/CT¬TH TH (UNSADER¬&ARMS¬0UMPKIN¬&ESTIVAL

"RADENTON¬ ¬ 

.OV¬TH

(ARDEE¬#OUNTY¬&ARM¬"UREAU¬!G¬&EST

7AUCHULA

.OV ¬TH

$E3OTO¬#OUNTY¬!G¬&EST¬"ANQUET

4URNER¬!GRI¬¬#ENTER ¬¬!RCADIA

.OV¬TH

!NNUAL¬#RAFT¬&AIR¬IN¬THE¬7OODS

&REEDOM¬2ANCH ¬/KEECHOBEE

.OV¬TH

$ESOTO¬#OUNTY¬!G¬&EST

4URNER¬!GRI¬#ENTER ¬!RCADIA

È Heartland InTheFieldMagazine

È/CTOBERÈ


È

/CTOBERÈÈ

Heartland InTheFieldMagazine




+RXUV 0RQ7KXUVSP )UL6DWDP 6XQ1RRQSP

Line Dancing ay Every Thursd Night!!! Karaoke every Friday & Saturday under the TIKI!

Live Music Every Sunday under the TIKI 4-7.

BUCS BLACKOUT GAMES will be available at the HOLE!!!

October band Dates:

Slick Willy 7-8 Lee Alcornâ&#x20AC;&#x2122;s Longshot Band 14-15 Logan Brothers 21-22 Damn Outlaws 28-29

Food and Drink Specials for College and NFL Football are as follows. Starting September 1st for College Football 11am-7pm and Sunday September 9th for NFL. TIKI ONLY!! $.50 wings $.50 tenders $1 Hamburger Sliders $1 BBQ Pork Sliders $10 Domestic Buckets $1.50 Drafts 2 for 1 Wells

(863) 314-9459 â&#x20AC;˘ 6813 US 27 South, Sebring, FL


Heartland Magazine October 2012