__MAIN_TEXT__
feature-image

Page 1

Hi-Line Hi-Line

FARM & FARM & RANCH RANCH

12 12 September September2018 2018

Homestead

www.glasgowcourier.com www.glasgowcourier.com

Header goes here

CONTINUED FROM PAGE 11 EXW ZRUNHG WR EXLOG VRPHWKLQJ RI YDOXH IRU generations to come. Many of us in ag, owe much gratitude to our great-greats that worked hard enough to HDUQWKHLUKRPHVWHDGVEXLOGWKHLUKRPHVWHDGV and pass on their homesteads Our family has the same motivation. We have it so much easier then the early homeVWHDGHUVEXWRXUKHDUWPLQGDQGERG\LVGHWHUPLQHGWRVHWGRZQURRWVEXLOGVRPHWKLQJ of value and then pass it on to our future generations. So if that means we have a “homestead,� I am honored that our place is referred to as such.

COVER BY MARY HONRUD / FOR FARM & RANCH

ELIZABETH SHIPSTEAD / FOR FARM AND RANCH

Pictured right: Beautiful wheat starting to turn for the harvest.

G LASGOW S TOCKYARDS I NC.

Understanding Dementia: Page 2

26th Annual Fall Feeder Classic

FALL SCHEDULE September 2018

Preventing Harvest Fires: Page 3 The Month in Weather: Page 3

Thursday

SALE TIME ".

Where You Gonna Find Em?

5IVSTEBZ 4FQUFNCFS 

6

All Class Cattle Auction

13

The 26th Big Fall Yearling Classic & All Class Cattle Auction

20

The One and Only Sheep Auction of 2018 & All Class Cattle Auction

27

All Class Cattle Auction

Saturday

29

Gordon & Francis Garrick Moving / Retirement Auction, Plentywood, Mt. www.glasgowstockyards.com for more info.

October 2018 Thursday

Expecting Over 2000 Head of NE Montana’s Outstanding Steers, Spayed & Tested Open Heifers.

4

Early Feeder Special & All Class Cattle Auction

11

Early Feeder Special & All Class Cattle Auction

18

Dunbar Bros. & Friends 12th Annual Bred Heifer Auction, Galpin Angus Bull & Heifer Calves, Feeder Auction & All Class Cattle Auction

25

Feeder Special featuring Red Angus Influence Feeders & All Class Cattle Auction

72 years of great service to Northeast Montana! 10#PYt(MBTHPX .5 tHTJ!OFNPOUOFU -JOEB.BSL/JFMTFO 0XOFST *WB.VSDI .BOBHFSt %FBO#BSOFT :BSE.BOBHFSt &E)JOUPO "VDUJPOFFSt

FPSNPSFJOGPSNBUJPO DPOTJHONFOUMJTU (PUP XXXHMBTHPXTUPDLZBSETDPN PSDBMM

LASGOW

2

TOCKYARDS NC. 1946 - 2018

November 2018 Thursday

4

All Class Feeder Special & All Class Cattle Auction

11

All Class Feeder Special & All Class Cattle Auction

ELIZABETH SHIPSTEAD / FOR FARM AND RANCH


2 2

Hi-Line Hi-Line

September2018 2018 September

What do “low cost� ag suppliers

FARM & & RANCH FARM RANCH

REALLY do for you?

When You Buy From Us, We Give You Added Value! Let's Work Together

We Can Only Continue To Provide Service In Our Communities If YOU Support Those Services! After The Initial Saleâ&#x20AC;&#x201D; WHAT Is Your 'LVFRXQW6XSSOLHU2ÍżHULQJ<RX"

When you buy your chemical & fertilizer from us we can help you with . . . Â&#x2021;&URS6FRXWLQJ Â&#x2021;:HHG,GHQWLĂ&#x20AC;FDWLRQ6HUYLFHV  Â&#x2021;6RLO$QDO\VLV Â&#x2021;&URS6SUD\LQJ  Â&#x2021;$SSOLFDWLRQ5HFRPPHQGDWLRQV Â&#x2021;)HUWLOL]HU$SSOLFDWLRQ â&#x20AC;˘ And Much More

We Have . . . $)XOO$JURQRP\6WDÍż$YDLODEOH

7R$OO2I2XU3DWURQV$FURVV2XU7UDGH$UHD

The People, The Know How And The Products To Cover All Your Needs . . .

     

:H2ÍžHU0DQ\6HUYLFHVWR2XU&XVWRPHUV Â&#x2021;2Q)DUP7LUH6HUYLFH Â&#x2021;6KRS6HUYLFHV 0LQRU5HSDLUV Â&#x2021;2LO )LOWHUV Â&#x2021;)HHG &U\VWDO\[  Â&#x2021;/DZQ&DUH,WHPV Â&#x2021;)HQFLQJ(TXLSPHQW

Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021;

%XON)XHO'HOLYHU\ 7LUHV%DWWHULHV%UDNHV +RXU*DV )XHO 2[\JHQ$FHW\OHQH7DQNV )XOO/LQH+DUGZDUH6WRUH

:H$OVR2ÍżHU)XOO&RPPRGLW\0DUNHWLQJ

Value Added Services . . . Use them to your advantage and maximize your yields!

Are You Getting This Kind Of Value Where You Buy?

!

Plus, if you pay in advance, earn a 6% premium Or 6% discount for cash at time of purchase!

Scobey â&#x20AC;˘ Flaxville â&#x20AC;˘ Peerless â&#x20AC;˘ Richland â&#x20AC;˘ Opheim â&#x20AC;˘ Four Buttes 487-2741

474-2231

893-4398

724-3353

762-3231

783-5519

www.glasgowcourier.com www.glasgowcourier.com

USDA Announces Details of Assistance for Farmers Impacted by Tariffs FOR THE COURIER U.S. Secretary of Agriculture Sonny Perdue on Aug. 27, announced details of actions the U.S. Department of Agriculture (USDA) will take to assist farmers in response to trade GDPDJHIURPXQMXVWLÂżHGUHWDOLDWLRQE\IRUHLJQ nations. President Donald J. Trump directed Secretary Perdue to craft a short-term relief strategy to protect agricultural producers while the Administration works on free, fair, and reciprocal trade deals to open more markets in the long run to help American farmers compete JOREDOO\$V DQQRXQFHG ODVW PRQWK 86'$ ZLOODXWKRUL]HXSWRELOOLRQLQSURJUDPV consistent with our World Trade Organization REOLJDWLRQV â&#x20AC;&#x153;Early on, the President instructed me, as Secretary of Agriculture, to make sure our IDUPHUVGLGQRWEHDUWKHEUXQWRIXQIDLUUHWDOLDWRU\WDULIIV$IWHUFDUHIXODQDO\VLVE\RXUWHDP at USDA, we have formulated our strategy to PLWLJDWHWKHWUDGHGDPDJHVVXVWDLQHGE\RXU farmers. Our farmers work hard, and are the most productive in the world, and we aim to protect them,â&#x20AC;? said Secretary Perdue. These programs will assist agricultural producers to meet the costs of disrupted markets: USDAâ&#x20AC;&#x2122;s Farm Service Agency (FSA) will administer the Market Facilitation Program (MFP) to provide payments to corn, cotton, GDLU\ KRJ VRUJKXP VR\EHDQ DQG ZKHDW producers starting Sept. 4. An announcement DERXW IXUWKHU SD\PHQWV ZLOO EH PDGH LQ WKH

coming months, if warranted. USDAâ&#x20AC;&#x2122;s Agricultural Marketing Service (AMS) will administer a Food Purchase and 'LVWULEXWLRQ3URJUDPWRSXUFKDVHXSWR ELOOLRQ LQ FRPPRGLWLHV XQIDLUO\ WDUJHWHG E\ unjustified retaliation. USDAâ&#x20AC;&#x2122;s Food and 1XWULWLRQ6HUYLFH )16 ZLOOGLVWULEXWHWKHVH commodities through nutrition assistance programs such as The Emergency Food Assistance Program (TEFAP) and child nutrition programs. Through the Foreign Agricultural Serviceâ&#x20AC;&#x2122;s (FAS) Agricultural Trade Promotion Program $73   PLOOLRQ ZLOO EH PDGH DYDLODEOH to develop foreign markets for U.S. agricultural products. The program will help U.S. agricultural exporters identify and access new markets and help mitigate the adverse effects of other countriesâ&#x20AC;&#x2122; restrictions. Âł3UHVLGHQW 7UXPS KDV EHHQ VWDQGLQJ XS to China and other nations, sending the clear message that the United States will no longer tolerate their unfair trade practices, which LQFOXGHQRQWDULIIWUDGHEDUULHUVDQGWKHWKHIW of intellectual property. In short, the President KDVWDNHQDFWLRQWREHQHÂżWDOOVHFWRUVRIWKH American economy â&#x20AC;&#x201C; including agriculture â&#x20AC;&#x201C; in the long run,â&#x20AC;? said Secretary Perdue. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s important to note all of this could go away tomorrow, if China and the other nations simply FRUUHFWWKHLUEHKDYLRU%XWLQWKHPHDQWLPHWKH SURJUDPVZHDUHDQQRXQFLQJWRGD\EX\VWLPH for the President to strike long-lasting trade GHDOVWREHQHÂżWRXUHQWLUHHFRQRP\´

According to www.alz.org: Alzheimerâ&#x20AC;&#x2122;s disease is the sixith- leading cause of death in the United States. Over 16 million Americans provide unpaid care for people with dementia. These caregivers provided an estimated ELOOLRQKRXUVRIFDUHYDOXHGDWRYHU ELOOLRQ Deaths from heart disease have decreased  SHUFHQW EHWZHHQ  DQG  ZKLOH GHDWKVIURP$O]KHLPHUÂśVKDYHLQFUHDVHG SHUFHQW'HPHQWLDNLOOVPRUHWKDQEUHDVWFDQFHUDQGSURVWDWHFDQFHUFRPELQHG PLOOLRQ$PHULFDQVDUHOLYLQJZLWK$O]KHLPHUÂśV%\WKLVLVSURMHFWHGWRULVHWR nearly 14 million. $O]KHLPHUÂśVLVWKHPRVWFRPPRQEXWQRW the only cause of dementia. Dementia is a JHQHUDOWHUPXVHGWRGHVFULEHPHPRU\ORVVDV ZHOODVRWKHUFRJQLWLYHDELOLWLHV$O]KHLPHUÂśV

Weather CONTINUED FROM PAGE 3 VXVWDLQHGZLQGVJUHDWHUWKDQPSKDQG days with winds greater than 20 mph. The KLJKHVWVXVWDLQHGZLQGZDVUHSRUWHGDWPSK and occurred on Aug. 4, and the highest wind gust was also recorded on Aug. 4, at 41 mph. As of press date, per the National Weather 6HUYLFH LQ *ODVJRZ WKH KLJKHVW REVHUYHG temperature for the month was 107 degrees RQERWK$XJDQGDQGWKHORZHVWZDV RQ$XJ7KHWRWDOOLTXLGSUHFLSLWDWLRQ UHSRUWHG DW *ODVJRZ ZDV ´ ZKLFK ZDV DSSUR[LPDWHO\´EHORZQRUPDO2YHUD hour period, the greatest precipitation total was ´ZKLFKRFFXUUHGRQ$XJ7KHRYHUDOO mean temperature for the month was approxiPDWHO\GHJUHHVZKLFKZDVDSSUR[LPDWHO\ WZRGHJUHHVDERYHQRUPDO The latest U.S. Drought Monitor was released on Aug. 21. With another dry month, for the most part, conditions have gotten typically worse across the state, and across the region DVZHOO&XUUHQWO\DSSUR[LPDWHO\SHUFHQW

FARM & FARM & RANCH RANCH

RIWKHVWDWHLVFODVVLÂżHGDVDWOHDVW$EQRUPDOO\ Dry and 11 percent of the state is in at least a Moderate Drought. Since last month, a couple areas of Severe Drought have popped up, such that just over two percent of the state falls within that category. For the region, a small DUHDLQQRUWKHUQ9DOOH\DQG3KLOOLSVFRXQWLHV have entered Severe Drought conditions. Moderate drought conditions have shifted VRXWK WR FRYHU PXFK RI 9DOOH\ DQG 3KLOOLSV FRXQWLHVZLWKDEQRUPDOO\GU\FRQGLWLRQVDORQJ WKH 0LVVRXUL 5LYHU9DOOH\ DV IDU HDVW DV WKH ZHVWHUQTXDUWHURI5LFKODQG&RXQW\:LEDX[ County and far eastern Dawson County are DOVR$EQRUPDOO\'U\ The state drought advisory committee is VWLOOORRNLQJIRUIHHGEDFNIURPIRONVLQYROYHG ZLWKWKHDJULFXOWXUHLQGXVWU\6SHFLÂżFDOO\WKH advisory committee is looking to hear from those directly involved in operations how drought affects them, and to know what conditions are like across the region. If you are LPSDFWHG E\ GURXJKW FRQGLWLRQV ÂżOO RXW WKH survey which will go to the Motnana Drought 0RQLWRU5HSRUWHUVXUYH\DUFJLVFRPVKDU HFEFFGEGHGIIDGE

Fire Safety

CONTINUED FROM PAGE 3 ZUDSSHG DURXQG EHDULQJV EHOWV RU RWKHU moving parts, make sure to remove and clean off. When the day is done, donâ&#x20AC;&#x2122;t park WKHKRWFRPELQHLQWKHVKHGWKHVKRSRURQ dry grass, as smoldering hot spots may still EHSUHVHQWZKLFKFDQFDWFKWKHEXLOGLQJVRU WKHJUDVVRQÂżUH ,IDÂżUHVKRXOGRFFXU\RXQHHGWRPDNH an action plan ahead of time and have steps LQ SODFH WR PDQDJH WKH ÂżUH ZKLOH NHHSLQJ yourself safe. Keep at least one fully-charge, SRXQG$%& GU\ FKHPLFDO ILUH H[WLQ JXLVKHU LQ WKH FRPELQH FDE DQG PRXQW D VHFRQG RQH RXWVLGH VR LW FDQ EH UHDFKHG from the ground level. Keep a water pump FORVHE\DQGKDYHDFHOOSKRQHRQ\RXDWDOO WLPHVWRDOORZWKHDELOLW\WRTXLFNO\FDOOIRU KHOSLQWKHHYHQWDÂżUHGRHVVWDUW7XUQRII WKHHQJLQHULJKWDZD\JUDEWKHQHDUHVWÂżUH H[WLQJXLVKHUJUDE\RXUSKRQHDQGJHWKHOS Stay a safe distance away while using the

Farm or â&#x20AC;&#x153;Homesteadâ&#x20AC;??

Still Building Up the Present for Future Generations ELIZABETH SHIPSTEAD FOR FARM& RANCH

is not a normal part of aging. Currently, the greatest risk factor is increasing age, with the PDMRULW\RISHRSOHZLWK$O]KHLPHUÂśVEHLQJ or older. However, it is not just a disease of old DJH(DUO\RQVHW$O]KHLPHUV DQG\RXQJHU  affects nearly 200,000 Americans. Alzheimerâ&#x20AC;&#x2122;s is a progressive disease, where dementia symptoms gradually worsen over a QXPEHURI\HDUV,QLWVHDUO\VWDJHVPHPRU\ ORVVLVPLOGEXWZLWKODWHVWDJH$O]KHLPHUÂśV LQGLYLGXDOVORVHWKHDELOLW\WRFDUU\RQDFRQversation and respond to their environment. Those with Alzheimerâ&#x20AC;&#x2122;s live an average of HLJKW\HDUVDIWHUWKHLUV\PSWRPVEHFRPHQRWLFHDEOHWRRWKHUVEXWVXUYLYDOFDQUDQJHIURP four to 20 years, depending on age and other health conditions. There is currently no cure for Alzheimerâ&#x20AC;&#x2122;s EXW WUHDWPHQWV IRU V\PSWRPV DUH DYDLODEOH and research continues. Although treatments cannot stop Alzheimerâ&#x20AC;&#x2122;s from progressing, they can slow the worsening of symptoms

In July, one of my pictures in the Hi-Line Farm and Ranch paper ended up captioned, ODEHOLQJ RXU SODFH DV WKH Âł6KLSVWHDG KRPHVWHDG´0\ÂżUVWUHDFWLRQZDVÂł2KGHDU:HÂśUH not a homestead!â&#x20AC;? In this day and age, a homestead is often folks with a small amount of acreage, doing WKHLUEHVWWRUDLVHWKHLURZQIRRG Anyone that knows the lengths these present-day homesteaders go to to grow their RZQIRRGDQGEHVHOIVXIÂżFLHQWZRXOGOLNHO\ EHRIIHQGHGLIWKH\NQHZKRZZHUROO Yes, I have a garden and 90 percent of the PHDWZHHDWZHUDLVHEXWZHVWLOOUHO\KHDYLO\ on our local grocery stores. ,ZRXOGGHVFULEHRXUSODFHDVDIDUPHYHQ though our farmland and pastureland does not ERUGHU RXU KRPH \DUG:H ZLQWHU RXU FRZV here, we keep much of our equipment here, and we have horses, chickens, dogs, and cats, WKDWUHVLGHRQRXUSODFH%HVLGHVZHPDNHRXU PRQH\IDUPLQJ6R,WKLQNDIDUPGHVFULEHV RXUSODFHEHVW 7KDWEHLQJVDLG,VWDUWHGWKLQNLQJRXWVLGH WKHFXUUHQWDJULFXOWXUDOER[HVRIIDUPUDQFK or homestead. Not that long ago, homesteads ZHUHYHU\SUHYDOHQW+RPHVWHDGVH[HPSOLÂżHG DIDPLO\ÂśVEORRGVZHDWDQGWHDUVWRPDNHLWLQD new area. They were a place to set down roots, to carve out what they desired for themselves and their children. They not only thought to make it through the next day or the next year,

See ALZHEIMER'S Page 3

See HOMESTEAD Page 12

From Science to Solutions: Understanding Dementia & Building Skills for Positive Outcomes ROUBIE YOUNKIN, MSU EXTENSION FOR FARM & RANCH

www.glasgowcourier.com www.glasgowcourier.com

Hi-Line Hi-Line

11 September2018 2018 11 September ÂżUHH[WLQJXLVKHU $OVR D IDUPHU QHHGV WR EH SUDFWLFDO WR ensure their safety and those around them. Approach the fire with caution, as with WKHVHGU\FRQGLWLRQVVPDOOÂżUHVFDQĂ&#x20AC;DUHXS quickly with the addition of air approaching WKHÂżUHZKHQWKHGRRURUKDWFKLVRSHQHG,I DÂżUHEHJLQVWRVSUHDGWU\WRFRQWDLQLWEXW make your safety a priority. 0LOOVDOVRVWDWHGWKH1HEUDVND([WHQVLRQ 2IÂżFH VWDWHV WKDW WRR RIWHQ GXULQJ KDUYHVW season, safe fueling practices are ignored as DZD\WRVDYHWLPH%XWWKRVHIHZVHFRQGV saved donâ&#x20AC;&#x2122;t matter when compared to the loss of farm equipment, loss of land or even ORVVRIWLPHVSHQWLQDKRVSLWDOEHFDXVHRI EXUQV)DUPHUVQHHGWRUHPHPEHUWRQHYHU refuel equipment with the engine running, DQG DOZD\V DOORZ KRW HQJLQHV WR FRRO  PLQXWHVEHIRUHUHIXHOLQJ,IIXHOVSLOOVRQDQ engine, wipe away any excess and allow the IXPHVWRGLVVLSDWHEHIRUHVWDUWLQJWKHHQJLQH ,Q DQ LGHDO ZRUOG IDUPHUV ZRXOG EH DEOHWRKDUYHVWWKHLUFURSVEDVHGXSRQWKHLU own time frames with every circumstance, weather included, under their control. Unfortunately, sometimes Mother Nature has other plans, which can either speed up or slow down the process. All farmers can do LVEHSUHSDUHGKDYHDQDFWLRQSODQDQGEH safe. Do what you can to protect your family, yourself, your equipment, and investment IURPZLOGÂżUHVDVWKHSRSXODUVD\LQJJRHV Âł2QH/HVV6SDUN0HDQV2QH/HVV:LOGÂżUH´

www.glasgowcourier.com

Sign up for your FREE Trial Subscription Today and get the latest in notable events, weather and sports.

One of my volunteer sunflowers in my garden.

ELIZABETH SHIPSTEAD / FOR FARM & RANCH

Youâ&#x20AC;&#x2122;re reading the Hi-Line Farm & Ranch The Ag Monthly For Northeast & North Central Montana. Reach thousands of readers with an ad in the Hi-Line Farm & Ranch


10

Hi-Line

September 2018

FARM & RANCH

www.havredailynews.com

Tariffs: Bekkerman: Some good signs are coming up â&#x2013; Continued from page 9 U.S. and buyers might stick with the deals they have made with other countries. He added that it is difficult to tell what the long-term effects of the tariffs might be. â&#x20AC;&#x153;If this continues into next year, we will certainly start seeing some real ramifications that could really affect farm businesses in a negative way,â&#x20AC;? Bekkerman said. â&#x20AC;&#x153;It is really important to see how quickly this can be resolved.â&#x20AC;? Some good signs are coming up, as well, Bekkerman said, with negotiations progressing with NAFTA and some movement

with the Farm Bill. Reopening negotiations with Mexico is certainly a good sign, he added. Bear Paw Development Corp. Executive Director Paul Tuss said the tariffs are fall out the political arena, and it is hard for producers to mitigate these tariffs. Tuss, a Havre Democrat who is challenging state Sen. Russ Tempel, R-Chester, in his bid for re-election in Senate District 14, added that, in the modern world, the world is shrinking when it comes to commerce due to global online markets. Tariffs, he added, are only going to hurt the econo-

my. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t think that was appropriate in the â&#x20AC;&#x2122;70s and â&#x20AC;&#x2122;80s when it occurred, and I certainly am not an advocate for these tariffs now,â&#x20AC;? he said, adding that although these tariffs may have an adverse effect on the market, Montana producers are work-

ing hard to push on through. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve got the best products that you can find anywhere in the world. Weâ&#x20AC;&#x2122;ve got the hardest-working people youâ&#x20AC;&#x2122;re going to find anywhere else in the world,â&#x20AC;? Tuss said. â&#x20AC;&#x153;Our farmers and ranchers â&#x20AC;&#x201D; our ag community â&#x20AC;&#x201D; know how to compete globally.â&#x20AC;?

www.glasgowcourier.com www.glasgowcourier.com

Hi-Line Hi-Line

FARM FARM & & RANCH RANCH

Preventing Fires and Staying Safe During Harvest Season MICHELLE BIGELBACH FOR FARM & RANCH Harvest season is upon us with some farmers already done for the season while others still have weeks to go. For those farmers who IHHOWKH\DUHEHKLQGDQGDUHUXVKLQJWRVWD\RQ schedule or get caught up, the rush to get the FURSV KDUYHVWHG FDQ QRW FRPH EHIRUH VDIHW\ of you, your land, your equipment and the ÂżHOGVQHDU\RX According to the National Weather Service in Glasgow, the month of August has seen EHORZDYHUDJH GU\ FRQGLWLRQV )RU WKH SDVW two seasons now, farmers have not had much relief in terms of Mother Nature cooperating ZLWKWKHPDQGWKHLUFURSV6HSWHPEHUÂśVRXWlook of precipitation doesnâ&#x20AC;&#x2122;t look promising, as the Climate Prediction Center does not KDYHFRQÂżGHQFHWRVD\ZKHWKHUWKHDPRXQWRI UDLQH[SHFWHGWRIDOOZLOOEHEHORZRUDERYH average. Not only does this dry weather hinder WKHJURZWKRIFURSVEXWLWDOVRLQFUHDVHVWKH likelihood of heavy machinery equipment VWDUWLQJRQÂżUHGXHWRUHVLGXHDQGGXVWDFFXPXODWLQJ:LWKEHORZDYHUDJHUDLQIDOOVDQG ZLQG\GD\VZKHQDÂżUHVWDUWVQRWRQO\GRHV WKHIDUPHUORVHRXWRQWKHHTXLSPHQWEXWWKH

ÂżUHFDQDOVRVSUHDGWRQHDUE\ODQGDQGRUHYHQ ZLSHDZD\WKHÂżHOG Shelly Mills from the Montana State UniYHUVLW\([WHQVLRQ2IÂżFHVWDWHGLQDVWXG\SURYLGHGWRWKH0LFKLJDQ([WHQVLRQ2IÂżFHWKHUH DUHQHDUO\FRPELQHÂżUHVLQWKH86RI ZKLFKWKHPDMRULW\RIWKRVHÂżUHV SHUFHQW WREHH[DFW ZHUHFDXVHGE\FURSUHVLGXH,Q our current dry conditions, our community IDUPHUVKDYHH[SHULHQFHGWKHLURZQÂżUHVZLWK IDUPHUVUHVLGLQJLQ9DOOH\&RXQW\WHOOLQJWKH Courier they have already had to extinguish DQGGHDOZLWKWKHDIWHUPDWKRIDÂżUHFDXVHG E\WKHLUHTXLSPHQW Managing the crop residue and dust accumulating on any heavy machinery, including FRPELQHVLVNH\WRGHFUHDVLQJWKHULVNRID ÂżUHVWDUWLQJDQGVSUHDGLQJLQWKHVHGU\FRQGLWLRQV )DUPHUV QHHG WR UHPHPEHU WKH WKUHH Pâ&#x20AC;&#x2122;s: Prevention, Preparation and Practicality. ,QSUHYHQWLQJWKHÂżUHIURPVWDUWLQJHQVXUH \RXU ÂżHOG HTXLSPHQW LV FOHDQ 3RZHUZDVK to remove any grease, oil and crop residue WKDW KDV DFFXPXODWHG 'XULQJ KDUYHVW EORZ dry chaff, leaves and other crop materials off the machine. Any materials that have EHHQ See FIRE SAFETY Page 11

Alzheimer's

CONTINUED FROM PAGE 2 and improve quality of life for those affected and their caregivers. *ODVJRZQHLJKERUKRRGKHDOWKSDUWQHUVDUH sponsoring a seminar for caregivers, Sept. DQGDWWKH&RWWRQZRRG,QQ9DOOH\ &RXQW\5HVSLWH)0'+9DOOH\9LHZ+RPH 3UDLULH 5LGJH 9LOODJH DQG 068 ([WHQVLRQ KDYH SDUWQHUHG WR EULQJ LQ 'HPHQWLD &DUH Trainer and Consultant Heather McKay to work with family caregivers as well as health care professionals. McKay is an award-winning occupational therapist and dementia care specialist, consultant, and international trainer/speaker, providing training for professional and family caregivers, services to individuals with aging issues, and consultation with facilities on topics related to dementia and Alzheimerâ&#x20AC;&#x2122;s care. 0F.D\ZLOOEHFRPLQJIURP1RUWK&DURlina where she is the director of disease management for Hospice of Alamance-Caswell and Life Path Home Health. She has worked in hospital, home health, and community settings. She has personal as well as professional experience with dementia caregiving and will address caregiving from a professional and personal perspective.

September2018 2018 3 3 September ,I \RX DUH DIIHFWHG E\ $O]KHLPHUÂśV dementia either personally or in a caregiving situation please plan to join us in the unique opportunity to learn from nationally renowned expert Heather McKay. Day One will focus on families and careJLYHUV7KHSUHVHQWDWLRQLVRSHQWRWKHSXEOLF DQG ZLOO WDNH SODFH RQ 7XHVGD\ 6HSW  from 10 a.m. to 6 p.m., at the Cottonwood ,QQ7KHUHLVQRFRVWWRDWWHQGWKLVHYHQWEXW goodwill offering is appreciated. Lunch will QRWEHSURYLGHG3UHUHJLVWUDWLRQLVVXJJHVWHG MSU Extension Family Economics Specialist Marsha Goetting will also present LQIRUPDWLRQVSHFLÂżFWR0RQWDQDDERXWOHJDO DQGÂżQDQFLDODOWHUQDWLYHVIRUWKRVHZLWK$Ozheimerâ&#x20AC;&#x2122;s and related dementias and their family caregivers. Day two and three will focus on dementia education training for professionals. The SUHVHQWDWLRQ ZLOO EH HLWKHU :HGQHVGD\ RU Thursday, Sept. 26, 27, whichever day would ZRUNEHVWIRU\RX7KHVHPLQDULVLGHQWLFDO IRUERWKGD\V7KHSUHVHQWDWLRQZLOOEHIURP DPWRSPDWWKH&RWWRQZRRG,QQ 6XLWHV/XQFKZLOOEHSURYLGHGGXULQJWKLV seminar. Please contact the Valley County ExtenVLRQ 2IÂżFH DW  RU 3UDLULH 5LGJH 9LOODJHDWIRUPRUHLQIRUPDWLRQRU UHJLVWUDWLRQIRUPV

www.glasgowcourier.com

The Month in Weather: Yet Again Hot and Dry Weather Persists MICHELLE BIGELBACH FOR FARM & RANCH August was another month across northeast 0RQWDQDFKDUDFWHUL]HGE\KRWDQGGU\ZHDWKHU 7KHÂżUVWZHWWLQJUDLQVRIWKHPRQWKGLGQRW RFFXUXQWLO$XJZKLFKLVRQO\ÂżYHGD\V away from the end of the month! There were ÂżYH GD\V GXULQJ$XJXVW LQ ZKLFK WKH KLJK temperature in Glasgow topped 100 degrees. /RRNLQJIRUZDUGWRZDUGV6HSWHPEHUFRQÂżGHQFHLQWKHWUHQGVIRUERWKWHPSHUDWXUHVDQG

precipitation across northeast Montana again is mostly low. The Climate Prediction Center IRUHFDVWIRU6HSWHPEHUOD\VRXWHTXDOFKDQFHV IRUHLWKHUDERYHRUEHORZQRUPDOSUHFLSLWDWLRQ DQGDVOLJKWO\KLJKHUSUREDELOLW\WKDWRYHUDOO WHPSHUDWXUHVZLOOEHDERYHQRUPDO /RRNLQJEDFNDW$XJXVWDVRISUHVVGDWH seven days in the month saw at least a trace of reported precipitation, and two days saw at least a tenth of an inch of accumulated precipitation. As for winds, two days saw See WEATHER Page 11

NEWTON MOTORS, INC. NEW & USED TRUCKS AND CARS

All In One Convenient Location

A.J. ETHERINGTON / FOR FARM & RANCH

A smoky haze fills the sky over the badlands near Fort Peck. Weather over the month of August has been characterized by hot, dry and smoke-filled conditions.

440 Highway 2 West â&#x20AC;˘ Glasgow â&#x20AC;˘ Across from the Fairgrounds 406-228-9325 â&#x20AC;˘ 406-228-4381 â&#x20AC;˘ 1-800-255-1472 Locally owned by the Newton Boys! Rent A Car Come in and see Doug, Terry, or Ted!


4

Hi-Line

September 2018

FARM & RANCH

Hi-Line

www.havredailynews.com

www.havredailynews.com

FARM & RANCH

Tariffs effect on the agricultural market unknown Derek Hann dshann@havredailynews.com Opinions about the effect of President Donald Trump’s tariffs on the agricultural market is almost as unclear as the market itself, although many agree that this past year has been hard on Montana’s agricultural producers. “Markets are never as simple as some commentators would like them to be,” said Vincent Smith, professor of economics at Montana State University. “The prices of a commodity, if we look at it at any point in time, are affected by a great difference of elements on the supply side as well as the demand side of things.” One of the things that is affecting the market, Smith said, is the predictions of record numbers or near-record numbers of crops in the market. Those predictions offset the commodities and inflate or deflate prices, he added. Montana State University associate professor Anton Bekkerman said the tariffs

Havre Daily News/Ryan Welch A riders trail cattle in the Bear Paw Mountains in July. The impact of President Donal Trump’s tariffs on agriculture, including a plan by China’s JD.com to buy $200 million worth of Montana beef and to invest in a beef processing facility in Montana, is not known.

Havre Daily News/Ryan Welch A farmer harvests wheat near Kremlin. Kremlin farmer Ryan McCormic says imposing tariffs could have a beneficial impact, forcing countries to negotiate for better trade agreements and forcing them to stop abusing international trade, but also says it could cause problems by reducing volume with some of the United States’ biggest trading partners. trade laws and rules, but the downside is that China made up 80 percent of the U.S. export market for soybeans. When one part of the market takes a large hit like that, McCormick said, the entire market usually takes a hit as well. He said the grain market has rallied this year, to the highest in three years. Smith said soybeans have received much attention because of the Chinese retaliatory tariffs, adding that this has damaged the market. At the same time though, he added, soybeans are set for record production levels because anticipation had been for relatively good prices. “The best possible outcome would be the

end of the ‘tariff war,’” Smith said, adding that the business relationships with these countries could be fractured and take years to repair. “The truth is I don’t have a definite answer,” he said, “but (farmers) have a reason to be upset with the trade war associated with the current administration’s policy.” Bekkerman said that with the Chinese retaliatory tariffs, U.S. exports will become more expensive and the Chinese market will look for other cheaper markets, adding that even if the trade war is settled soon, the markets lost might not return to the

n Continued on page 10

September 2018

9


8

Hi-Line

September 2018

FARM & RANCH

Hi-Line

www.havredailynews.com

Tariffs: McCormick: ‘I would agree someone had to call China’s bluff at some point’ ■ Continued from page 6 the community including president of Montana Grain Growers Association, said, overall, he believes everyone has had a good crop this year, although pulse crops have been down. He said the market is dependent on a combination of things such as tariffs and trade agreements, adding that tariffs have weighed on most of the market somewhat. All markets have their issues, he said. Things always could change or be fixed and done better, and renegotiations aren’t always a bad thing although there will be some pain to the market due to the rollbacks with some trade agreements. McCormick said that with his experience in the Montana Grain Growers Association he was involved in several pre-trade agreements but he doesn’t know what the outcome will be. But the tariffs could certainly be beneficial in the future, he added. “The one I think is really glaring is China,” he said, “and I would agree someone had to call China’s bluff at some point.” He added that China was ignoring all

Havre Daily News/Ryan Welch A farmer harvests wheat near Kremlin. Big Sandy farmer Lochiel Edwards says he has seen high volatility in markets this summer due to a variety of reasons. What the long-range impact of tariffs will be on markets remains to be seen, he says.

www.havredailynews.com

FARM & RANCH are causing an uncertainty in the market and that is disrupting the interactions between producers and buyers in the international market. He added that the future for these markets is unsure and dependent on how long the tariffs will be in place, what kind of negotiations are in the works and what will be the long-term impact of these tariffs. Bekkerman said the market has been volatile due to the political environment the nation is in. Lochiel Edwards, a farmer out of Big

Havre Daily News/Ryan Welch A farmer harvests wheat near Kremlin. Economic experts say they are not certain what the impact of tariffs on agricultural markets will be.

September 2018

5

Sandy who has served as president and in many other offices of Montana Grain Growers Association, said he has noticed some volatility in the market, with prices swinging farther and quicker than what is normal for the summer market. He said he believes that the primary reason for this is from the weather news from around the world, the weather the areas such as the Black Sea region and other main wheat regions are experiencing. But going into the market in the future for deliveries this winter may be affected by the tariffs, he added, it is hard to tell, markets have many moving parts and it is hard to pick out any one cause. “It is my belief that the tariffs have put

n Continued on page 6


Hi-Line

Hi-Line

FARM & RANCH Tariffs: Rismon: ‘It’s tough going’ 6

September 2018

www.havredailynews.com

NEW LISTING!

■ Continued from page 5 a damper on future prices,” Edwards added, and although tariffs have had no immediate effect they have created a nervousness in the market which tends to be translated into volatility. Edwards said this year the area has had good crops, although everything is maturing later in the year because of late planting due to the long winter. “The future is always an unknown in the ag market,” he added. Since the prices first started falling in 2013 and 2014 the low commodity prices have been sobering for many farmers, Edwards said, adding that everything is cyclical, high prices or low prices won’t last forever. Local farmer Shawn Rismon, who farms 15 miles north of Havre, said the market has taken a hit recently, due to the worldwide market and the drought being experi-

enced in the area. “It’s not very good,” Rismon said. “Grain prices need to go up. It’s tough going.”   Overseas, producers have had a high production year in other countries, but the world market is not very good, he said, adding that something needs to be turned around. He said the prices of grain haven’t changed very much since the 1970s, but the cost of operations has and has made it harder for farmers. Over his career, he said, he has seen ag markets like this before, but it’s something that farmers have to work through. It was not a terrible harvest, he added, but it was noticeable which areas got more rain than others. Ryan McCormick, a farmer out of Kremlin who has held multiple offices in

Missouri River Breaks Ranch 10 miles from the Breaks, 4980 +/- acres of deeded pasture land along with 7909 +/- acres of BLM allotment, and 1,120 +/- acres of State leased ground. Ranch also has a house, Quonset, shop, and other outbuildings. Call Koefod today for more information. Listing price $5,500,000

n Continued on page 8

Log on today www.koefod.com

Charles and Tami Good run the family wheat farm near Carter and own MaxAg of Montana. They have two sons, Jayden and Landon.

Enjoy Billings. And getting there, too.

Enjoy the ride.

capeair.com

800-CAPE-AIR

MFU works for family farms through legislation, education and cooperation. Just ask members Charles and Tami Good. “There’s 2.2 million farmers in the U.S. so anyway we can grow and band together to gain power or get a voice it’s important.”

Hop on a fast flight to Billings and enjoy all the city has to offer. Free parking, too. Havre

– Charles Good

Glasgow

Billings Logan International Airport

Sidney

29

$ from

Wolf Point

*

Glendive

each way Billings

Enjoy the ride.

capeair.com

800-CAPE-AIR

*Including all taxes and fees Fares are subject to availability and other conditions. Fares may change without notice, and are not guaranteed until ticketed.

Find out more about our advocacy efforts and education programs at: montanafarmersunion.com

www.havredailynews.com

FARM & RANCH

September 2018

7


Hi-Line

Hi-Line

FARM & RANCH Tariffs: Rismon: ‘It’s tough going’ 6

September 2018

www.havredailynews.com

NEW LISTING!

■ Continued from page 5 a damper on future prices,” Edwards added, and although tariffs have had no immediate effect they have created a nervousness in the market which tends to be translated into volatility. Edwards said this year the area has had good crops, although everything is maturing later in the year because of late planting due to the long winter. “The future is always an unknown in the ag market,” he added. Since the prices first started falling in 2013 and 2014 the low commodity prices have been sobering for many farmers, Edwards said, adding that everything is cyclical, high prices or low prices won’t last forever. Local farmer Shawn Rismon, who farms 15 miles north of Havre, said the market has taken a hit recently, due to the worldwide market and the drought being experi-

enced in the area. “It’s not very good,” Rismon said. “Grain prices need to go up. It’s tough going.”   Overseas, producers have had a high production year in other countries, but the world market is not very good, he said, adding that something needs to be turned around. He said the prices of grain haven’t changed very much since the 1970s, but the cost of operations has and has made it harder for farmers. Over his career, he said, he has seen ag markets like this before, but it’s something that farmers have to work through. It was not a terrible harvest, he added, but it was noticeable which areas got more rain than others. Ryan McCormick, a farmer out of Kremlin who has held multiple offices in

Missouri River Breaks Ranch 10 miles from the Breaks, 4980 +/- acres of deeded pasture land along with 7909 +/- acres of BLM allotment, and 1,120 +/- acres of State leased ground. Ranch also has a house, Quonset, shop, and other outbuildings. Call Koefod today for more information. Listing price $5,500,000

n Continued on page 8

Log on today www.koefod.com

Charles and Tami Good run the family wheat farm near Carter and own MaxAg of Montana. They have two sons, Jayden and Landon.

Enjoy Billings. And getting there, too.

Enjoy the ride.

capeair.com

800-CAPE-AIR

MFU works for family farms through legislation, education and cooperation. Just ask members Charles and Tami Good. “There’s 2.2 million farmers in the U.S. so anyway we can grow and band together to gain power or get a voice it’s important.”

Hop on a fast flight to Billings and enjoy all the city has to offer. Free parking, too. Havre

– Charles Good

Glasgow

Billings Logan International Airport

Sidney

29

$ from

Wolf Point

*

Glendive

each way Billings

Enjoy the ride.

capeair.com

800-CAPE-AIR

*Including all taxes and fees Fares are subject to availability and other conditions. Fares may change without notice, and are not guaranteed until ticketed.

Find out more about our advocacy efforts and education programs at: montanafarmersunion.com

www.havredailynews.com

FARM & RANCH

September 2018

7


8

Hi-Line

September 2018

FARM & RANCH

Hi-Line

www.havredailynews.com

Tariffs: McCormick: ‘I would agree someone had to call China’s bluff at some point’ ■ Continued from page 6 the community including president of Montana Grain Growers Association, said, overall, he believes everyone has had a good crop this year, although pulse crops have been down. He said the market is dependent on a combination of things such as tariffs and trade agreements, adding that tariffs have weighed on most of the market somewhat. All markets have their issues, he said. Things always could change or be fixed and done better, and renegotiations aren’t always a bad thing although there will be some pain to the market due to the rollbacks with some trade agreements. McCormick said that with his experience in the Montana Grain Growers Association he was involved in several pre-trade agreements but he doesn’t know what the outcome will be. But the tariffs could certainly be beneficial in the future, he added. “The one I think is really glaring is China,” he said, “and I would agree someone had to call China’s bluff at some point.” He added that China was ignoring all

Havre Daily News/Ryan Welch A farmer harvests wheat near Kremlin. Big Sandy farmer Lochiel Edwards says he has seen high volatility in markets this summer due to a variety of reasons. What the long-range impact of tariffs will be on markets remains to be seen, he says.

www.havredailynews.com

FARM & RANCH are causing an uncertainty in the market and that is disrupting the interactions between producers and buyers in the international market. He added that the future for these markets is unsure and dependent on how long the tariffs will be in place, what kind of negotiations are in the works and what will be the long-term impact of these tariffs. Bekkerman said the market has been volatile due to the political environment the nation is in. Lochiel Edwards, a farmer out of Big

Havre Daily News/Ryan Welch A farmer harvests wheat near Kremlin. Economic experts say they are not certain what the impact of tariffs on agricultural markets will be.

September 2018

5

Sandy who has served as president and in many other offices of Montana Grain Growers Association, said he has noticed some volatility in the market, with prices swinging farther and quicker than what is normal for the summer market. He said he believes that the primary reason for this is from the weather news from around the world, the weather the areas such as the Black Sea region and other main wheat regions are experiencing. But going into the market in the future for deliveries this winter may be affected by the tariffs, he added, it is hard to tell, markets have many moving parts and it is hard to pick out any one cause. “It is my belief that the tariffs have put

n Continued on page 6


4

Hi-Line

September 2018

FARM & RANCH

Hi-Line

www.havredailynews.com

www.havredailynews.com

FARM & RANCH

Tariffs effect on the agricultural market unknown Derek Hann dshann@havredailynews.com Opinions about the effect of President Donald Trump’s tariffs on the agricultural market is almost as unclear as the market itself, although many agree that this past year has been hard on Montana’s agricultural producers. “Markets are never as simple as some commentators would like them to be,” said Vincent Smith, professor of economics at Montana State University. “The prices of a commodity, if we look at it at any point in time, are affected by a great difference of elements on the supply side as well as the demand side of things.” One of the things that is affecting the market, Smith said, is the predictions of record numbers or near-record numbers of crops in the market. Those predictions offset the commodities and inflate or deflate prices, he added. Montana State University associate professor Anton Bekkerman said the tariffs

Havre Daily News/Ryan Welch A riders trail cattle in the Bear Paw Mountains in July. The impact of President Donal Trump’s tariffs on agriculture, including a plan by China’s JD.com to buy $200 million worth of Montana beef and to invest in a beef processing facility in Montana, is not known.

Havre Daily News/Ryan Welch A farmer harvests wheat near Kremlin. Kremlin farmer Ryan McCormic says imposing tariffs could have a beneficial impact, forcing countries to negotiate for better trade agreements and forcing them to stop abusing international trade, but also says it could cause problems by reducing volume with some of the United States’ biggest trading partners. trade laws and rules, but the downside is that China made up 80 percent of the U.S. export market for soybeans. When one part of the market takes a large hit like that, McCormick said, the entire market usually takes a hit as well. He said the grain market has rallied this year, to the highest in three years. Smith said soybeans have received much attention because of the Chinese retaliatory tariffs, adding that this has damaged the market. At the same time though, he added, soybeans are set for record production levels because anticipation had been for relatively good prices. “The best possible outcome would be the

end of the ‘tariff war,’” Smith said, adding that the business relationships with these countries could be fractured and take years to repair. “The truth is I don’t have a definite answer,” he said, “but (farmers) have a reason to be upset with the trade war associated with the current administration’s policy.” Bekkerman said that with the Chinese retaliatory tariffs, U.S. exports will become more expensive and the Chinese market will look for other cheaper markets, adding that even if the trade war is settled soon, the markets lost might not return to the

n Continued on page 10

September 2018

9


10

Hi-Line

September 2018

FARM & RANCH

www.havredailynews.com

Tariffs: Bekkerman: Some good signs are coming up â&#x2013; Continued from page 9 U.S. and buyers might stick with the deals they have made with other countries. He added that it is difficult to tell what the long-term effects of the tariffs might be. â&#x20AC;&#x153;If this continues into next year, we will certainly start seeing some real ramifications that could really affect farm businesses in a negative way,â&#x20AC;? Bekkerman said. â&#x20AC;&#x153;It is really important to see how quickly this can be resolved.â&#x20AC;? Some good signs are coming up, as well, Bekkerman said, with negotiations progressing with NAFTA and some movement

with the Farm Bill. Reopening negotiations with Mexico is certainly a good sign, he added. Bear Paw Development Corp. Executive Director Paul Tuss said the tariffs are fall out the political arena, and it is hard for producers to mitigate these tariffs. Tuss, a Havre Democrat who is challenging state Sen. Russ Tempel, R-Chester, in his bid for re-election in Senate District 14, added that, in the modern world, the world is shrinking when it comes to commerce due to global online markets. Tariffs, he added, are only going to hurt the econo-

my. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t think that was appropriate in the â&#x20AC;&#x2122;70s and â&#x20AC;&#x2122;80s when it occurred, and I certainly am not an advocate for these tariffs now,â&#x20AC;? he said, adding that although these tariffs may have an adverse effect on the market, Montana producers are work-

ing hard to push on through. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve got the best products that you can find anywhere in the world. Weâ&#x20AC;&#x2122;ve got the hardest-working people youâ&#x20AC;&#x2122;re going to find anywhere else in the world,â&#x20AC;? Tuss said. â&#x20AC;&#x153;Our farmers and ranchers â&#x20AC;&#x201D; our ag community â&#x20AC;&#x201D; know how to compete globally.â&#x20AC;?

www.glasgowcourier.com www.glasgowcourier.com

Hi-Line Hi-Line

FARM FARM & & RANCH RANCH

Preventing Fires and Staying Safe During Harvest Season MICHELLE BIGELBACH FOR FARM & RANCH Harvest season is upon us with some farmers already done for the season while others still have weeks to go. For those farmers who IHHOWKH\DUHEHKLQGDQGDUHUXVKLQJWRVWD\RQ schedule or get caught up, the rush to get the FURSV KDUYHVWHG FDQ QRW FRPH EHIRUH VDIHW\ of you, your land, your equipment and the ÂżHOGVQHDU\RX According to the National Weather Service in Glasgow, the month of August has seen EHORZDYHUDJH GU\ FRQGLWLRQV )RU WKH SDVW two seasons now, farmers have not had much relief in terms of Mother Nature cooperating ZLWKWKHPDQGWKHLUFURSV6HSWHPEHUÂśVRXWlook of precipitation doesnâ&#x20AC;&#x2122;t look promising, as the Climate Prediction Center does not KDYHFRQÂżGHQFHWRVD\ZKHWKHUWKHDPRXQWRI UDLQH[SHFWHGWRIDOOZLOOEHEHORZRUDERYH average. Not only does this dry weather hinder WKHJURZWKRIFURSVEXWLWDOVRLQFUHDVHVWKH likelihood of heavy machinery equipment VWDUWLQJRQÂżUHGXHWRUHVLGXHDQGGXVWDFFXPXODWLQJ:LWKEHORZDYHUDJHUDLQIDOOVDQG ZLQG\GD\VZKHQDÂżUHVWDUWVQRWRQO\GRHV WKHIDUPHUORVHRXWRQWKHHTXLSPHQWEXWWKH

ÂżUHFDQDOVRVSUHDGWRQHDUE\ODQGDQGRUHYHQ ZLSHDZD\WKHÂżHOG Shelly Mills from the Montana State UniYHUVLW\([WHQVLRQ2IÂżFHVWDWHGLQDVWXG\SURYLGHGWRWKH0LFKLJDQ([WHQVLRQ2IÂżFHWKHUH DUHQHDUO\FRPELQHÂżUHVLQWKH86RI ZKLFKWKHPDMRULW\RIWKRVHÂżUHV SHUFHQW WREHH[DFW ZHUHFDXVHGE\FURSUHVLGXH,Q our current dry conditions, our community IDUPHUVKDYHH[SHULHQFHGWKHLURZQÂżUHVZLWK IDUPHUVUHVLGLQJLQ9DOOH\&RXQW\WHOOLQJWKH Courier they have already had to extinguish DQGGHDOZLWKWKHDIWHUPDWKRIDÂżUHFDXVHG E\WKHLUHTXLSPHQW Managing the crop residue and dust accumulating on any heavy machinery, including FRPELQHVLVNH\WRGHFUHDVLQJWKHULVNRID ÂżUHVWDUWLQJDQGVSUHDGLQJLQWKHVHGU\FRQGLWLRQV )DUPHUV QHHG WR UHPHPEHU WKH WKUHH Pâ&#x20AC;&#x2122;s: Prevention, Preparation and Practicality. ,QSUHYHQWLQJWKHÂżUHIURPVWDUWLQJHQVXUH \RXU ÂżHOG HTXLSPHQW LV FOHDQ 3RZHUZDVK to remove any grease, oil and crop residue WKDW KDV DFFXPXODWHG 'XULQJ KDUYHVW EORZ dry chaff, leaves and other crop materials off the machine. Any materials that have EHHQ See FIRE SAFETY Page 11

Alzheimer's

CONTINUED FROM PAGE 2 and improve quality of life for those affected and their caregivers. *ODVJRZQHLJKERUKRRGKHDOWKSDUWQHUVDUH sponsoring a seminar for caregivers, Sept. DQGDWWKH&RWWRQZRRG,QQ9DOOH\ &RXQW\5HVSLWH)0'+9DOOH\9LHZ+RPH 3UDLULH 5LGJH 9LOODJH DQG 068 ([WHQVLRQ KDYH SDUWQHUHG WR EULQJ LQ 'HPHQWLD &DUH Trainer and Consultant Heather McKay to work with family caregivers as well as health care professionals. McKay is an award-winning occupational therapist and dementia care specialist, consultant, and international trainer/speaker, providing training for professional and family caregivers, services to individuals with aging issues, and consultation with facilities on topics related to dementia and Alzheimerâ&#x20AC;&#x2122;s care. 0F.D\ZLOOEHFRPLQJIURP1RUWK&DURlina where she is the director of disease management for Hospice of Alamance-Caswell and Life Path Home Health. She has worked in hospital, home health, and community settings. She has personal as well as professional experience with dementia caregiving and will address caregiving from a professional and personal perspective.

September2018 2018 3 3 September ,I \RX DUH DIIHFWHG E\ $O]KHLPHUÂśV dementia either personally or in a caregiving situation please plan to join us in the unique opportunity to learn from nationally renowned expert Heather McKay. Day One will focus on families and careJLYHUV7KHSUHVHQWDWLRQLVRSHQWRWKHSXEOLF DQG ZLOO WDNH SODFH RQ 7XHVGD\ 6HSW  from 10 a.m. to 6 p.m., at the Cottonwood ,QQ7KHUHLVQRFRVWWRDWWHQGWKLVHYHQWEXW goodwill offering is appreciated. Lunch will QRWEHSURYLGHG3UHUHJLVWUDWLRQLVVXJJHVWHG MSU Extension Family Economics Specialist Marsha Goetting will also present LQIRUPDWLRQVSHFLÂżFWR0RQWDQDDERXWOHJDO DQGÂżQDQFLDODOWHUQDWLYHVIRUWKRVHZLWK$Ozheimerâ&#x20AC;&#x2122;s and related dementias and their family caregivers. Day two and three will focus on dementia education training for professionals. The SUHVHQWDWLRQ ZLOO EH HLWKHU :HGQHVGD\ RU Thursday, Sept. 26, 27, whichever day would ZRUNEHVWIRU\RX7KHVHPLQDULVLGHQWLFDO IRUERWKGD\V7KHSUHVHQWDWLRQZLOOEHIURP DPWRSPDWWKH&RWWRQZRRG,QQ 6XLWHV/XQFKZLOOEHSURYLGHGGXULQJWKLV seminar. Please contact the Valley County ExtenVLRQ 2IÂżFH DW  RU 3UDLULH 5LGJH 9LOODJHDWIRUPRUHLQIRUPDWLRQRU UHJLVWUDWLRQIRUPV

www.glasgowcourier.com

The Month in Weather: Yet Again Hot and Dry Weather Persists MICHELLE BIGELBACH FOR FARM & RANCH August was another month across northeast 0RQWDQDFKDUDFWHUL]HGE\KRWDQGGU\ZHDWKHU 7KHÂżUVWZHWWLQJUDLQVRIWKHPRQWKGLGQRW RFFXUXQWLO$XJZKLFKLVRQO\ÂżYHGD\V away from the end of the month! There were ÂżYH GD\V GXULQJ$XJXVW LQ ZKLFK WKH KLJK temperature in Glasgow topped 100 degrees. /RRNLQJIRUZDUGWRZDUGV6HSWHPEHUFRQÂżGHQFHLQWKHWUHQGVIRUERWKWHPSHUDWXUHVDQG

precipitation across northeast Montana again is mostly low. The Climate Prediction Center IRUHFDVWIRU6HSWHPEHUOD\VRXWHTXDOFKDQFHV IRUHLWKHUDERYHRUEHORZQRUPDOSUHFLSLWDWLRQ DQGDVOLJKWO\KLJKHUSUREDELOLW\WKDWRYHUDOO WHPSHUDWXUHVZLOOEHDERYHQRUPDO /RRNLQJEDFNDW$XJXVWDVRISUHVVGDWH seven days in the month saw at least a trace of reported precipitation, and two days saw at least a tenth of an inch of accumulated precipitation. As for winds, two days saw See WEATHER Page 11

NEWTON MOTORS, INC. NEW & USED TRUCKS AND CARS

All In One Convenient Location

A.J. ETHERINGTON / FOR FARM & RANCH

A smoky haze fills the sky over the badlands near Fort Peck. Weather over the month of August has been characterized by hot, dry and smoke-filled conditions.

440 Highway 2 West â&#x20AC;˘ Glasgow â&#x20AC;˘ Across from the Fairgrounds 406-228-9325 â&#x20AC;˘ 406-228-4381 â&#x20AC;˘ 1-800-255-1472 Locally owned by the Newton Boys! Rent A Car Come in and see Doug, Terry, or Ted!


2 2

Hi-Line Hi-Line

September2018 2018 September

What do â&#x20AC;&#x153;low costâ&#x20AC;? ag suppliers

FARM & & RANCH FARM RANCH

REALLY do for you?

When You Buy From Us, We Give You Added Value! Let's Work Together

We Can Only Continue To Provide Service In Our Communities If YOU Support Those Services! After The Initial Saleâ&#x20AC;&#x201D; WHAT Is Your 'LVFRXQW6XSSOLHU2ÍżHULQJ<RX"

When you buy your chemical & fertilizer from us we can help you with . . . Â&#x2021;&URS6FRXWLQJ Â&#x2021;:HHG,GHQWLĂ&#x20AC;FDWLRQ6HUYLFHV  Â&#x2021;6RLO$QDO\VLV Â&#x2021;&URS6SUD\LQJ  Â&#x2021;$SSOLFDWLRQ5HFRPPHQGDWLRQV Â&#x2021;)HUWLOL]HU$SSOLFDWLRQ â&#x20AC;˘ And Much More

We Have . . . $)XOO$JURQRP\6WDÍż$YDLODEOH

7R$OO2I2XU3DWURQV$FURVV2XU7UDGH$UHD

The People, The Know How And The Products To Cover All Your Needs . . .

     

:H2ÍžHU0DQ\6HUYLFHVWR2XU&XVWRPHUV Â&#x2021;2Q)DUP7LUH6HUYLFH Â&#x2021;6KRS6HUYLFHV 0LQRU5HSDLUV Â&#x2021;2LO )LOWHUV Â&#x2021;)HHG &U\VWDO\[  Â&#x2021;/DZQ&DUH,WHPV Â&#x2021;)HQFLQJ(TXLSPHQW

Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021;

%XON)XHO'HOLYHU\ 7LUHV%DWWHULHV%UDNHV +RXU*DV )XHO 2[\JHQ$FHW\OHQH7DQNV )XOO/LQH+DUGZDUH6WRUH

:H$OVR2ÍżHU)XOO&RPPRGLW\0DUNHWLQJ

Value Added Services . . . Use them to your advantage and maximize your yields!

Are You Getting This Kind Of Value Where You Buy?

!

Plus, if you pay in advance, earn a 6% premium Or 6% discount for cash at time of purchase!

Scobey â&#x20AC;˘ Flaxville â&#x20AC;˘ Peerless â&#x20AC;˘ Richland â&#x20AC;˘ Opheim â&#x20AC;˘ Four Buttes 487-2741

474-2231

893-4398

724-3353

762-3231

783-5519

www.glasgowcourier.com www.glasgowcourier.com

USDA Announces Details of Assistance for Farmers Impacted by Tariffs FOR THE COURIER U.S. Secretary of Agriculture Sonny Perdue on Aug. 27, announced details of actions the U.S. Department of Agriculture (USDA) will take to assist farmers in response to trade GDPDJHIURPXQMXVWLÂżHGUHWDOLDWLRQE\IRUHLJQ nations. President Donald J. Trump directed Secretary Perdue to craft a short-term relief strategy to protect agricultural producers while the Administration works on free, fair, and reciprocal trade deals to open more markets in the long run to help American farmers compete JOREDOO\$V DQQRXQFHG ODVW PRQWK 86'$ ZLOODXWKRUL]HXSWRELOOLRQLQSURJUDPV consistent with our World Trade Organization REOLJDWLRQV â&#x20AC;&#x153;Early on, the President instructed me, as Secretary of Agriculture, to make sure our IDUPHUVGLGQRWEHDUWKHEUXQWRIXQIDLUUHWDOLDWRU\WDULIIV$IWHUFDUHIXODQDO\VLVE\RXUWHDP at USDA, we have formulated our strategy to PLWLJDWHWKHWUDGHGDPDJHVVXVWDLQHGE\RXU farmers. Our farmers work hard, and are the most productive in the world, and we aim to protect them,â&#x20AC;? said Secretary Perdue. These programs will assist agricultural producers to meet the costs of disrupted markets: USDAâ&#x20AC;&#x2122;s Farm Service Agency (FSA) will administer the Market Facilitation Program (MFP) to provide payments to corn, cotton, GDLU\ KRJ VRUJKXP VR\EHDQ DQG ZKHDW producers starting Sept. 4. An announcement DERXW IXUWKHU SD\PHQWV ZLOO EH PDGH LQ WKH

coming months, if warranted. USDAâ&#x20AC;&#x2122;s Agricultural Marketing Service (AMS) will administer a Food Purchase and 'LVWULEXWLRQ3URJUDPWRSXUFKDVHXSWR ELOOLRQ LQ FRPPRGLWLHV XQIDLUO\ WDUJHWHG E\ unjustified retaliation. USDAâ&#x20AC;&#x2122;s Food and 1XWULWLRQ6HUYLFH )16 ZLOOGLVWULEXWHWKHVH commodities through nutrition assistance programs such as The Emergency Food Assistance Program (TEFAP) and child nutrition programs. Through the Foreign Agricultural Serviceâ&#x20AC;&#x2122;s (FAS) Agricultural Trade Promotion Program $73   PLOOLRQ ZLOO EH PDGH DYDLODEOH to develop foreign markets for U.S. agricultural products. The program will help U.S. agricultural exporters identify and access new markets and help mitigate the adverse effects of other countriesâ&#x20AC;&#x2122; restrictions. Âł3UHVLGHQW 7UXPS KDV EHHQ VWDQGLQJ XS to China and other nations, sending the clear message that the United States will no longer tolerate their unfair trade practices, which LQFOXGHQRQWDULIIWUDGHEDUULHUVDQGWKHWKHIW of intellectual property. In short, the President KDVWDNHQDFWLRQWREHQHÂżWDOOVHFWRUVRIWKH American economy â&#x20AC;&#x201C; including agriculture â&#x20AC;&#x201C; in the long run,â&#x20AC;? said Secretary Perdue. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s important to note all of this could go away tomorrow, if China and the other nations simply FRUUHFWWKHLUEHKDYLRU%XWLQWKHPHDQWLPHWKH SURJUDPVZHDUHDQQRXQFLQJWRGD\EX\VWLPH for the President to strike long-lasting trade GHDOVWREHQHÂżWRXUHQWLUHHFRQRP\´

According to www.alz.org: Alzheimerâ&#x20AC;&#x2122;s disease is the sixith- leading cause of death in the United States. Over 16 million Americans provide unpaid care for people with dementia. These caregivers provided an estimated ELOOLRQKRXUVRIFDUHYDOXHGDWRYHU ELOOLRQ Deaths from heart disease have decreased  SHUFHQW EHWZHHQ  DQG  ZKLOH GHDWKVIURP$O]KHLPHUÂśVKDYHLQFUHDVHG SHUFHQW'HPHQWLDNLOOVPRUHWKDQEUHDVWFDQFHUDQGSURVWDWHFDQFHUFRPELQHG PLOOLRQ$PHULFDQVDUHOLYLQJZLWK$O]KHLPHUÂśV%\WKLVLVSURMHFWHGWRULVHWR nearly 14 million. $O]KHLPHUÂśVLVWKHPRVWFRPPRQEXWQRW the only cause of dementia. Dementia is a JHQHUDOWHUPXVHGWRGHVFULEHPHPRU\ORVVDV ZHOODVRWKHUFRJQLWLYHDELOLWLHV$O]KHLPHUÂśV

Weather CONTINUED FROM PAGE 3 VXVWDLQHGZLQGVJUHDWHUWKDQPSKDQG days with winds greater than 20 mph. The KLJKHVWVXVWDLQHGZLQGZDVUHSRUWHGDWPSK and occurred on Aug. 4, and the highest wind gust was also recorded on Aug. 4, at 41 mph. As of press date, per the National Weather 6HUYLFH LQ *ODVJRZ WKH KLJKHVW REVHUYHG temperature for the month was 107 degrees RQERWK$XJDQGDQGWKHORZHVWZDV RQ$XJ7KHWRWDOOLTXLGSUHFLSLWDWLRQ UHSRUWHG DW *ODVJRZ ZDV ´ ZKLFK ZDV DSSUR[LPDWHO\´EHORZQRUPDO2YHUD hour period, the greatest precipitation total was ´ZKLFKRFFXUUHGRQ$XJ7KHRYHUDOO mean temperature for the month was approxiPDWHO\GHJUHHVZKLFKZDVDSSUR[LPDWHO\ WZRGHJUHHVDERYHQRUPDO The latest U.S. Drought Monitor was released on Aug. 21. With another dry month, for the most part, conditions have gotten typically worse across the state, and across the region DVZHOO&XUUHQWO\DSSUR[LPDWHO\SHUFHQW

FARM & FARM & RANCH RANCH

RIWKHVWDWHLVFODVVLÂżHGDVDWOHDVW$EQRUPDOO\ Dry and 11 percent of the state is in at least a Moderate Drought. Since last month, a couple areas of Severe Drought have popped up, such that just over two percent of the state falls within that category. For the region, a small DUHDLQQRUWKHUQ9DOOH\DQG3KLOOLSVFRXQWLHV have entered Severe Drought conditions. Moderate drought conditions have shifted VRXWK WR FRYHU PXFK RI 9DOOH\ DQG 3KLOOLSV FRXQWLHVZLWKDEQRUPDOO\GU\FRQGLWLRQVDORQJ WKH 0LVVRXUL 5LYHU9DOOH\ DV IDU HDVW DV WKH ZHVWHUQTXDUWHURI5LFKODQG&RXQW\:LEDX[ County and far eastern Dawson County are DOVR$EQRUPDOO\'U\ The state drought advisory committee is VWLOOORRNLQJIRUIHHGEDFNIURPIRONVLQYROYHG ZLWKWKHDJULFXOWXUHLQGXVWU\6SHFLÂżFDOO\WKH advisory committee is looking to hear from those directly involved in operations how drought affects them, and to know what conditions are like across the region. If you are LPSDFWHG E\ GURXJKW FRQGLWLRQV ÂżOO RXW WKH survey which will go to the Motnana Drought 0RQLWRU5HSRUWHUVXUYH\DUFJLVFRPVKDU HFEFFGEGHGIIDGE

Fire Safety

CONTINUED FROM PAGE 3 ZUDSSHG DURXQG EHDULQJV EHOWV RU RWKHU moving parts, make sure to remove and clean off. When the day is done, donâ&#x20AC;&#x2122;t park WKHKRWFRPELQHLQWKHVKHGWKHVKRSRURQ dry grass, as smoldering hot spots may still EHSUHVHQWZKLFKFDQFDWFKWKHEXLOGLQJVRU WKHJUDVVRQÂżUH ,IDÂżUHVKRXOGRFFXU\RXQHHGWRPDNH an action plan ahead of time and have steps LQ SODFH WR PDQDJH WKH ÂżUH ZKLOH NHHSLQJ yourself safe. Keep at least one fully-charge, SRXQG$%& GU\ FKHPLFDO ILUH H[WLQ JXLVKHU LQ WKH FRPELQH FDE DQG PRXQW D VHFRQG RQH RXWVLGH VR LW FDQ EH UHDFKHG from the ground level. Keep a water pump FORVHE\DQGKDYHDFHOOSKRQHRQ\RXDWDOO WLPHVWRDOORZWKHDELOLW\WRTXLFNO\FDOOIRU KHOSLQWKHHYHQWDÂżUHGRHVVWDUW7XUQRII WKHHQJLQHULJKWDZD\JUDEWKHQHDUHVWÂżUH H[WLQJXLVKHUJUDE\RXUSKRQHDQGJHWKHOS Stay a safe distance away while using the

Farm or â&#x20AC;&#x153;Homesteadâ&#x20AC;??

Still Building Up the Present for Future Generations ELIZABETH SHIPSTEAD FOR FARM& RANCH

is not a normal part of aging. Currently, the greatest risk factor is increasing age, with the PDMRULW\RISHRSOHZLWK$O]KHLPHUÂśVEHLQJ or older. However, it is not just a disease of old DJH(DUO\RQVHW$O]KHLPHUV DQG\RXQJHU  affects nearly 200,000 Americans. Alzheimerâ&#x20AC;&#x2122;s is a progressive disease, where dementia symptoms gradually worsen over a QXPEHURI\HDUV,QLWVHDUO\VWDJHVPHPRU\ ORVVLVPLOGEXWZLWKODWHVWDJH$O]KHLPHUÂśV LQGLYLGXDOVORVHWKHDELOLW\WRFDUU\RQDFRQversation and respond to their environment. Those with Alzheimerâ&#x20AC;&#x2122;s live an average of HLJKW\HDUVDIWHUWKHLUV\PSWRPVEHFRPHQRWLFHDEOHWRRWKHUVEXWVXUYLYDOFDQUDQJHIURP four to 20 years, depending on age and other health conditions. There is currently no cure for Alzheimerâ&#x20AC;&#x2122;s EXW WUHDWPHQWV IRU V\PSWRPV DUH DYDLODEOH and research continues. Although treatments cannot stop Alzheimerâ&#x20AC;&#x2122;s from progressing, they can slow the worsening of symptoms

In July, one of my pictures in the Hi-Line Farm and Ranch paper ended up captioned, ODEHOLQJ RXU SODFH DV WKH Âł6KLSVWHDG KRPHVWHDG´0\ÂżUVWUHDFWLRQZDVÂł2KGHDU:HÂśUH not a homestead!â&#x20AC;? In this day and age, a homestead is often folks with a small amount of acreage, doing WKHLUEHVWWRUDLVHWKHLURZQIRRG Anyone that knows the lengths these present-day homesteaders go to to grow their RZQIRRGDQGEHVHOIVXIÂżFLHQWZRXOGOLNHO\ EHRIIHQGHGLIWKH\NQHZKRZZHUROO Yes, I have a garden and 90 percent of the PHDWZHHDWZHUDLVHEXWZHVWLOOUHO\KHDYLO\ on our local grocery stores. ,ZRXOGGHVFULEHRXUSODFHDVDIDUPHYHQ though our farmland and pastureland does not ERUGHU RXU KRPH \DUG:H ZLQWHU RXU FRZV here, we keep much of our equipment here, and we have horses, chickens, dogs, and cats, WKDWUHVLGHRQRXUSODFH%HVLGHVZHPDNHRXU PRQH\IDUPLQJ6R,WKLQNDIDUPGHVFULEHV RXUSODFHEHVW 7KDWEHLQJVDLG,VWDUWHGWKLQNLQJRXWVLGH WKHFXUUHQWDJULFXOWXUDOER[HVRIIDUPUDQFK or homestead. Not that long ago, homesteads ZHUHYHU\SUHYDOHQW+RPHVWHDGVH[HPSOLÂżHG DIDPLO\ÂśVEORRGVZHDWDQGWHDUVWRPDNHLWLQD new area. They were a place to set down roots, to carve out what they desired for themselves and their children. They not only thought to make it through the next day or the next year,

See ALZHEIMER'S Page 3

See HOMESTEAD Page 12

From Science to Solutions: Understanding Dementia & Building Skills for Positive Outcomes ROUBIE YOUNKIN, MSU EXTENSION FOR FARM & RANCH

www.glasgowcourier.com www.glasgowcourier.com

Hi-Line Hi-Line

11 September2018 2018 11 September ÂżUHH[WLQJXLVKHU $OVR D IDUPHU QHHGV WR EH SUDFWLFDO WR ensure their safety and those around them. Approach the fire with caution, as with WKHVHGU\FRQGLWLRQVVPDOOÂżUHVFDQĂ&#x20AC;DUHXS quickly with the addition of air approaching WKHÂżUHZKHQWKHGRRURUKDWFKLVRSHQHG,I DÂżUHEHJLQVWRVSUHDGWU\WRFRQWDLQLWEXW make your safety a priority. 0LOOVDOVRVWDWHGWKH1HEUDVND([WHQVLRQ 2IÂżFH VWDWHV WKDW WRR RIWHQ GXULQJ KDUYHVW season, safe fueling practices are ignored as DZD\WRVDYHWLPH%XWWKRVHIHZVHFRQGV saved donâ&#x20AC;&#x2122;t matter when compared to the loss of farm equipment, loss of land or even ORVVRIWLPHVSHQWLQDKRVSLWDOEHFDXVHRI EXUQV)DUPHUVQHHGWRUHPHPEHUWRQHYHU refuel equipment with the engine running, DQG DOZD\V DOORZ KRW HQJLQHV WR FRRO  PLQXWHVEHIRUHUHIXHOLQJ,IIXHOVSLOOVRQDQ engine, wipe away any excess and allow the IXPHVWRGLVVLSDWHEHIRUHVWDUWLQJWKHHQJLQH ,Q DQ LGHDO ZRUOG IDUPHUV ZRXOG EH DEOHWRKDUYHVWWKHLUFURSVEDVHGXSRQWKHLU own time frames with every circumstance, weather included, under their control. Unfortunately, sometimes Mother Nature has other plans, which can either speed up or slow down the process. All farmers can do LVEHSUHSDUHGKDYHDQDFWLRQSODQDQGEH safe. Do what you can to protect your family, yourself, your equipment, and investment IURPZLOGÂżUHVDVWKHSRSXODUVD\LQJJRHV Âł2QH/HVV6SDUN0HDQV2QH/HVV:LOGÂżUH´

www.glasgowcourier.com

Sign up for your FREE Trial Subscription Today and get the latest in notable events, weather and sports.

One of my volunteer sunflowers in my garden.

ELIZABETH SHIPSTEAD / FOR FARM & RANCH

Youâ&#x20AC;&#x2122;re reading the Hi-Line Farm & Ranch The Ag Monthly For Northeast & North Central Montana. Reach thousands of readers with an ad in the Hi-Line Farm & Ranch


Hi-Line Hi-Line

FARM & FARM & RANCH RANCH

12 12 September September2018 2018

Homestead

www.glasgowcourier.com www.glasgowcourier.com

Header goes here

CONTINUED FROM PAGE 11 EXW ZRUNHG WR EXLOG VRPHWKLQJ RI YDOXH IRU generations to come. Many of us in ag, owe much gratitude to our great-greats that worked hard enough to HDUQWKHLUKRPHVWHDGVEXLOGWKHLUKRPHVWHDGV and pass on their homesteads Our family has the same motivation. We have it so much easier then the early homeVWHDGHUVEXWRXUKHDUWPLQGDQGERG\LVGHWHUPLQHGWRVHWGRZQURRWVEXLOGVRPHWKLQJ of value and then pass it on to our future generations. So if that means we have a â&#x20AC;&#x153;homestead,â&#x20AC;? I am honored that our place is referred to as such.

COVER BY MARY HONRUD / FOR FARM & RANCH

ELIZABETH SHIPSTEAD / FOR FARM AND RANCH

Pictured right: Beautiful wheat starting to turn for the harvest.

G LASGOW S TOCKYARDS I NC.

Understanding Dementia: Page 2

26th Annual Fall Feeder Classic

FALL SCHEDULE September 2018

Preventing Harvest Fires: Page 3 The Month in Weather: Page 3

Thursday

SALE TIME ".

Where You Gonna Find Em?

5IVSTEBZ 4FQUFNCFS 

6

All Class Cattle Auction

13

The 26th Big Fall Yearling Classic & All Class Cattle Auction

20

The One and Only Sheep Auction of 2018 & All Class Cattle Auction

27

All Class Cattle Auction

Saturday

29

Gordon & Francis Garrick Moving / Retirement Auction, Plentywood, Mt. www.glasgowstockyards.com for more info.

October 2018 Thursday

Expecting Over 2000 Head of NE Montanaâ&#x20AC;&#x2122;s Outstanding Steers, Spayed & Tested Open Heifers.

4

Early Feeder Special & All Class Cattle Auction

11

Early Feeder Special & All Class Cattle Auction

18

Dunbar Bros. & Friends 12th Annual Bred Heifer Auction, Galpin Angus Bull & Heifer Calves, Feeder Auction & All Class Cattle Auction

25

Feeder Special featuring Red Angus Influence Feeders & All Class Cattle Auction

72 years of great service to Northeast Montana! 10#PYt(MBTHPX .5 tHTJ!OFNPOUOFU -JOEB.BSL/JFMTFO 0XOFST *WB.VSDI .BOBHFSt %FBO#BSOFT :BSE.BOBHFSt &E)JOUPO "VDUJPOFFSt

FPSNPSFJOGPSNBUJPO DPOTJHONFOUMJTU (PUP XXXHMBTHPXTUPDLZBSETDPN PSDBMM

LASGOW

2

TOCKYARDS NC. 1946 - 2018

November 2018 Thursday

4

All Class Feeder Special & All Class Cattle Auction

11

All Class Feeder Special & All Class Cattle Auction

ELIZABETH SHIPSTEAD / FOR FARM AND RANCH

Profile for Havre Daily News

Hi-Line Farm & Ranch Sept. 2018  

Hi-Line Farm & Ranch Sept. 2018  

Profile for havrenews
Advertisement

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded