Issuu on Google+


Iklan/ Langganan: 081216327858

RP 3.500,-


The Fed Tunda Kenaikan Suku Bunga, Bukan Hadiah Bagi Indonesia

Tak Ada Gejolak, TapiJadi Bola Panas pertahankan suku bunga acuan di level 0 persen hingga 0,25 persen. Hanya satu anggota komite, yakni Jeffrey M. Lacker mengusulkan kenaikan The Fed fund rate sebesar 25 basis poin. “Perkembangan ekonomi dan keuangan global terkini dapat menahan kegiatan ekonomi dan cenderung memberikan tekanan ke bawah lebih lanjut tentang inflasi dalam waktu dekat,” kata The Fed dalam pernyataan resminya, Jumat (18/9) dini hari WIB. Gubernur The Fed Janet Yellen menyebut ekonomi AS terus tumbuh secara moderat.

JAKARTA (BM) – Melalui rapat Federal Open Market Committee (FOMC), Kamis (17/9) waktu Washington atau Jumat dini hari WIB, Bank Sentral Amerika Serikat (AS) Federal Reserve (The Fed) memutuskan untuk menunda kenaikan suku bunganya. Sekilas, kebijakan ini memang berimbas positif karena relatif tak ada gejolak. Tapi penundaan kenaikan The Fed rate justru akan menjadi bola panas karena ketidakpastian di pasar global, termasuk Indonesia. Dalam rapat FOMC, keputusan untuk tidak menaikkan suku bunga diambil melalui voting. Hasilnya, sembilan dari 10 anggota komite memilih untuk mem-

- Janet Yellen -

Suku bunga tidak naikkan, tidak ada gejolak. Tapi spekulasi akan datang lagi nanti, menjelang rapat FOMC.”

PEREKONOMIAN AS BELUM MENGUAT SEPENUHNYA Kecemasan akan perlambatan ekonomi global. Rendahnya tingkat inflasi di AS. Pergerakan pasar saham yang volatil pada Agustus.

- Darmin Nasution -


 Baca: Tak Ada ... Hal 7

Mungkin orang bisa membaca bulan depan ada FOMC meeting tidak besar (kemungkinan suku bunga naik). Bisa-bisa Desember belum tentu ada, dan bisa-bisa sampai 2016.” - Agus Martowardojo -

Banyak fokus kami pada risiko-risiko seputar Tiongkok, tetapi tidak hanya Tiongkok. Negara-negara berkembang secara lebih umum, dan bagaimana mereka mungkin berimbas pada Amerika Serikat."

Dua WNI Bebas, Pelaku Penyanderaan Tetap Diburu Menlu Apresiasi Pemerintah Papua Nugini JAKARTA (BM) – Drama penyanderaan dua warga negara Indonesia (WNI) berakhir. Ladiri Sudirman dan Badar yang disandera kelompok bersenjata di Papua Nugini berhasil dibebaskan, Kamis (17/9) malam waktu

Pemprov Jatim Berharap Hak PI Blok Ketapang Hal 03 Lucy-Rasiyo Perbaiki Berkas Sesuai Rekomendasi KPU Hal 08

nyepakati untuk bertemu kemarin siang,” kata Arrmanatha di Kemenlu, Jumat (18/9).  Baca: Dua ... Hal 7 BEBAS: Setelah melalui proses negosiasi, dua sandera WNI dibebaskan dari kelompok bersenjata pada pihak militer PNG, Kamis (17/9) malam waktu PNG. Tampak Sudirman (foto kiri) dan Badar (foto kanan) dibantu berjalan oleh petugas TNI saat tiba di Skouw, Jayapura, Papua, Jumat (18/9).

DPR Diminta Tak ‘Kambing Hitamkan’ Menkeu

Berkas BW P21 Kejagung Belum Putuskan Penahanan JAKARTA (BM) - Kejaksaan Agung (Kejagung) sampai sekarang belum memastikan apakah pimpinan KPK nonakif BambangWidjojantoakanditahanatautidaksetelahpelaksanaan pelimpahan tahap duanya ke Kejaksaan Negeri Jakarta Pusat. “Kita lihat dulu. Kan diserahkan ke Jakpus, kita belum dapat laporan,”kataJaksaAgungHMPrasetyo,Jumat(18/9). Selain itu, kata dia, pihaknya masih melihat urgensinya apa atau pertimbangan obyektif dan subyektifnya.“Tunggu laporan dari kejari dulu,” katanya.  Baca: Berkas ... Hal 7

Misbakhun: Proses Penyesuaian Tunjangan dari Anggota FOTO:BM/ANTARA

Sail Tomini Dibayangi Teror Kelompok Santoso Hal 02

setempat. Keduanya yang disandera sejak 9 September lalu dibebaskan pasukan tentara keamanan Papua Nugini (PNG). Juru bicara Kementerian Luar Negeri (Kemenlu), Arrmanatha Nasir, membeberkan kronologi pembebasan kedua WNI itu. “Informasi yang kami terima, pasukan tentara keamanan PNG dan penyandera awalnya me-

PENUHI PANGGILAN: Wakil Ketua KPK nonaktif Bambang Widjojanto memasuki kendaraan untuk menuju Kejaksaan Negeri Jakarta Pusat usai memenuhi panggilan Bareskrim Polri di Mabes Polri, Jakarta, Jumat (18/9).

JAKARTA (BM) - Anggota Komisi XI DPR, Muhammad Misbakhun, meminta berbagai pihak, termasuk rekan-rekannya di DPR, untuk tidak mengambinghitamkan Menteri Keuangan (Menkeu) Bambang Brodjonegoro terkait naiknya tunjangan

BNN: Prioritaskan Bandar

Temukan Piringan Batu Misterius di Rusia

Diklaim Bukti Pendaratan Alien Satu Juta Tahun Lalu Sepintas terlihat seperti sebuah batu biasa yang sangat besar, bahkan warnanya sama dengan batuan lain di sekitarnya. Terkikis oleh cuaca, memberikan penampilan seperti cakram yang sangat halus.

DPR diminta tak 'kambing hitamkan' Menkeu Memang itu salah satu 'pekerjaannya'..

Intinya jangan digelar 2015, gitu aja ribet.

MISTERIUS : Tampak piringan batu besar yang ditemukan di sekitar area Volgograd, Rusia.

TAPI tim peneliti paranormal di Rusia, yang menyebut namanya Kosmopoisk yakin bahwa, kemiripan bentuk batu yang seperti sebuah piring terbang ini, berasal dalam luar angkasa. Benarkah demikian? Laporan penduduk lokal di Rusia juga mengatakan, daerah di mana batu ini ditemukan, Medveditskaya Ridge, di distrik Zhirnovsky, dekat dekat Volgograd, Rusia, telah terkenal karena penampakan UFO dan aktivitas paranormal lainnya.  Baca: Diklaim ... Hal 7 FOTO : ISTIMEWA

Babak baru kisruh Pilkada Surabaya




anggota DPR. Sebab, usulan itu tidak datang semata-mata dari Menkeu dan belum tentu saat dibahas bisa disetujui bersama oleh DPR dan pemerintah. Misbakhun menjelaskan, pada setiap awal siklus pembahasan RAPBN berlangsung, memang ada sebuah kebiasaan bahwa setiap lembaga dan kementerian melakukan penyesuaian anggaran yang akan dibelanjakan pada tahun beBaca: DPR ... Hal 7 rikutnya.

“Orang yang mengerti ilmu fikih berarti ia bisa makrifat kepada Allah dengan ilmunya menyebabkan ia kenal kepada-Nya. Bahkan dengan ilmunya ia bisa mengajar orang lain sampai pandai.” - Syeikh Izzuddin bin Abdussalam -

Eksekusi Mati Jilid III Belum Pasti JAKARTA (BM) – Eksekusi terhadap terpidana mati tahap III, hingga kini belum ada kepastian dari Kejaksaan Agung (Kejagung) RI. Sempat muncul isu jika terbatasnya dana jadi penyebab negara mengeksekusi belasan terpidana yang sudah dijatuhi vonis mati ketika hearing dengan DPR RI. Namun isu tersebut dibantah Jaksa Agung HM Prasetyo. Dia menyebutkan, penundaan eksekusi mati jilik III karena Kejagung masih berkonsentrasi pada penanganan kasus lainnya. “Soal penundaan eksekusi mati itu sempat ditanyakan oleh anggota dewan terkait karena ketiadaan biaya.Waktu itu kan belum ada jawaban dari kami. Bukan karena itu, kami sedang konsentrasi hal lain yang lebih penting,” jawab Jaksa Agung HM Prasetyo, Jumat (18/9).  Baca: Eksekusi... Hal 7


berita metro


Galang Dukungan Tolak Serbuan Israel ke Masjidil Aqsa

Butuh Kepastian Hukum


ARURAT asap, emergensi narkoba dan berbagai ketimpangan di republik ini, muara utamanya belum ada kepastian hukum. Kalaupun ada proses penegakkan hukum dianggap sesuai dengan aturan main, berawal dari perhatian publik dan menjadi atensi atasan, belum menyentuh kesadaran dari pelaksana. Apalagi, kepekaan pemerintah memberikan kepastian hukum belum menyentuh ke seluruh lapisan. Kita belum mampu menangkis tudingan, bahwa hukum di Indonesia sangat tajam ke arah bawah dan tumpul ke atas. Lantas siapa yang mampu mewujudkan kepastian hukum? Jawaban normatif adalah aparat penegak hukum. Hakim, jaksa, polisi, dan advokat mempunyai kesetaraan dalam menegakkan supremasi hukum. Setidaknya, masyarakat memperoleh informasi awal, kasus yang masuk ranah darurat (emergensi) perlu ada punishment (hukuman) bagi pelanggar atau sesuai komitmen yang dibangun penguasa. Sebaliknya, bila keputusan muncul sekedar gertak sambal, semua bisa diselesaikan di balik meja dan lenyap tiada jluntrungnya, jangan terlalu berharap muncul keadilan dalam penegakkan hukum. Hingga sekarang kita masih berkutat dengan revisi Kitab Undang-Undang Hukum Acara Pidana (KUHAP) dan Kitab Undang-Undang Hukum Pidana (KUHP), belum mengkaji secara serius hukum di Indonesia dengan berbagai problematikanya. Andai mulai fokus pada sistem hukum, mekanisme hukum, model penghukuman, hingga proses luar biasa, termasuk hak amnensti, grasi, abolisi dan amensti dari presiden, nyaris mengadopsi dari produk hukum di luar negeri. Semua masih buram, karena peran dari Kementerian Hukum dan HAM pada takaranpolitik berbalut perundang-undangan. Sepatutnya, DPR melakukan hak inisiatif perubahan terhadap produk hukum yang sudah kadaluarsa. Bukan saat lempar tanggung jawab, kalau ada polemik, menyatakan dalam penelitian, pengkajian, dan penelaahan dari para ahli. Setelah persoalan meredup, akhirnya hilang begitu saja. Hemat kami, ada dua persoalan cukup mendesak, yaitu penanganan darurat asap di kawasan Kalimantan dan Sumatera hingga ke negara tetangga. Bahaya utama, selain menimbulkan penyakit sesak nafas, mata, batuk, dan terjadi iritasi kulit, tanpa sadar pemerintah membiarkan struktur tanah menjadi kerak (mengering) karena pengaruh panasnya api. Belum lagi, efek dari lahan gambut yang telah merusak sumber mata air. Apakah, pemerintah belum pernah mengeluarkan hasil penelitian bagaimana kandungan air di wilayah lahan gambut. Bila pemerintah pusat hanya pandai menyedot pendapatan uang daerah dan menerima setoran bawahan, maka tidak beda dengan rentenir, mau membagikan dana kepada si papa dengan bunga mencekik. Mereka tidak punya prikemanusiaan. Jujur, kita sangat mendukung pemerintah bertindak khusus dan menjadi prioritas utama menyeret perusahaan yang dengan sengaja membakar hutan dan lahan gambut demi keuntungan bisnis semata. Mereka tidak ambil pusing akibat dari tindakan brutal dan bentuk pelanggaran HAM berat. Apalagi pemerintah Malaysia sendiri ikut merespon positif untuk menjatuhkan sanksi berat terhadap perusahaan dari negeri Jiran yang tidak patuh terhadap hukum di Indonesia. Kesengajaan pembakaran hutan merupakan kejahatan multi sebagaimana penjahat narkoba telah meracuni generasi bangsa. Bencana asap bukan lagi konsumsi dalam negeri, negara luar telah memberikan perhatian lebih. Kita harus mampu berdaulat dan menyelesaikan berbagai kemelut. Evakuasi warga Malaysia yang tersebar di Pekanbaru, Riau dan daerah potensi rawan asap bagian dari upaya pencegahan. Sebaliknya, bagi pelaku yang telah sengaja membakar harus dijatuhi hukuman setimpal, termasuk larangan menjalankan bisnis di Indonesia. Sekali lagi, jangan sampai darurat asap hanya sebatas kepulan asap setelah itu lenyap tanpa bekas, karena ada penyelesaian diplomatik. Kita masih menunggu keseriusan dari Menteri LH dan Kehutanan Siti Nurbaya menindak 20 perusahaan nakal dengan tujuan membuka lahan baru untuk pengembangan ekspansi bisnisnya. Kita juga menunggu gebrakan dari Ketua Badan Narktoika Nasional (BNN) Budi Waseso (Buwas) mendesak agar eksekusi terpidana mati narkoba segera dilaksanakan Kejagung. Artinya, membiarkan keserakahan dan angkara murka terus berkeliaran tanpa ada kepastian, bukan berarti melanggar HAM. Sebaliknya, bakal tumbuh virus baru lebih berbahaya. Jangan menunda sesuatu yang sudah pasti, pasti menimbulkan perselisihan di belakang hari. Setuju? (*)


DISELIMUTI KABUT ASAP Dua orang calon penumpang melihat pesawat yang mendarat di Bandara Kualanamu yang diselimuti kabut asap di Kabupaten Deli Serdang, Sumatera Utara, Jumat (18/9). Dampak kebakaran hutan dan lahan yang terjadi di Riau, Sumsel dan Jambi tersebut sampai ke bandara Kualanamu.

Arab Saudi Fasilitasi Tuntutan Hukum Keluarga Korban Crane Jakarta (BM) – Pemerintah Saudi Arabia akan memfasilitasi keluarga korban jatuhnya crane di Masjidil Haram untuk menuntut Group Bin Ladin Saudi selaku pengembang dalam insiden yang menelan ratusan korban jiwa, 11 di antaranya merupakan jamaah haji asal Indonesia. “Instruksi raja, kepada siapa saja yang menjadi korban kecelakaan jatuhnya crane berhak untuk mengajukan tuntutan pengadilan dalam hal menerima hak khusus, yang menangani masalah tersebut,” kata Duta Besar Saudi Arabia untuk Indonesia Mustafa Bin Ibrahim Al Mubarak, Jumat (18/9). Mustafa menyatakan bahwa kecelakaan jatuhnya crane merupakan peristiwa yang pertama kali terjadi di Masjidil Haram. “Peristiwa crane jatuh belum pernah terjadi sebelumnya. Sejak 60 tahun lalu, hanya pernah terjadi badai topan yang dialami

di Masjidil Haram,” kata Mustafa. Ia menjelaskan bahwa adanya sejumlah alat berat di kawasan “Tanah Haram” tersebut demi kepentingan peningkatan pelayanan haji. “Perluasan yang dilakukan memang mengakibatkan pengurangan kuota jamaah haji, namun hal itu dilakukan guna menambah kapasitas jamaah dan juga meningkatkan keselamatan para jamaah,” jelasnya. Mustafa juga menegaskan pemberian santunan kepada korban meninggal dan mengalami cacat fisik permanen, sebesar satu juta riyal atau setara Rp 3,8 miliar. Sedangkan untuk korban luka ringan, diberi santunan sebesar 500 ribu riyal atau setara Rp 1,9 miliar. Tak hanya itu, dua keluarga korban meninggal akan menjadi tamu resmi kerajaan dalam musim haji 2016. Agar proses kompensasi lancar, Kedubes

SANTUNAN: Dubes Mustafa bin Ibrahim Al Mubarak (kanan) memberikan keterangan pers terkait santunan untuk korban meninggal dunia akibat crane jatuh di Masjidil Haram di Jakarta, Jumat (18/ 9). Mustofa membenarkan pernyataan Raja Salman Bin Abdul Aziz Hafidzahullah yang perintahkan pemberian santunan 1 juta riyal untuk tiap korban meninggal.

Arab Saudi akan berkoordinasi dengan pemerintah Indonesia. Dalam kesempatan kemarin, Mustofa juga mengungkap fakta penyerangan tentara Israel ke

Masjidil Aqsa. Kejadian ini ditindaklanjuti Arab Saudi dengan menggalang aksi penolakan . “Raja Salman bin Abdulaziz Al-Saud telah menghubungi pemimpin-

pemimpin negara di berbagai belahan dunia untuk menyampaikan informasi ini dan menolak tindakan Israel, termasuk kepada Presiden Joko Widodo. (at/epe)

Usulkan Moratorium Infrastruktur Besar di Jawa

DPD RI: Stop Bangun Jalan Tol dan Kereta Api Cepat AMBON (BM) – Masih kuatnya kesan pembangunan terlalu berpusat di Jawa, selalu jadi isu menarik ketika ada momen interaktif dengan warga yang tinggal di luar pulau terpadat di Indonesia tersebut. Seperti yang terjadi ketika anggota Tim Komite IV Dewan Perwakilan Daerah (DPD) RI, Prof Dr John Pieris sosialisasikan RUU APBN Tahun 2016 di Ambon, Jumat (18/9). Dia mengaku sudah mengusulkan ke pemerintahan Presiden JokoWidodo untuk melakukan moratorium infrastruktur

berskala besar di pulau Jawa, selama lima tahun. “Stop bangun jalan tol dan bangun kereta api cepat,” tandasnya. Menurut dia, kalau memang masih dipaksakan, pembiayaanjanganmenggunakan uang negara tapi murni dari swasta. “Harus swasta murni, bukan swasta BUMN seperti, Nindya Karya (NK), Hutama Karya (HK), Wijaya Karya (Wika), karena dana yang mereka kelola juga bersumber dari APBN,” tambah John. Usulan itu bukan tanpa sebab. John menyinggung pemerataan disparitas pembangunan antara

Jawa dengan wilayah lain di Indonesia. Terutama untuk kawasan Indonesia timur. Padahal secara sumber daya alam, kawasan ini menyumbang cukup besar pendapatan negara. Namun bagi hasil yang diterima sangat minim. John mencontohkan aturan bagi hasil produksi ikan. “Saya mau tanya kepada masyarakat Maluku, apakah yang dibagi hasil itu? Kalau ada yang belum tahu, bagi hasil itu hanya ada pada izin usaha, sedangkan hasil produksi diambil pemerintah pusat. Bagi

hasil izin usaha nilainya sangat kecil untuk daerah,” ujar John. Hasil produksi ikan di Maluku mencapai 1,6 - 1,8 juta ton/ tahun, itu pun bervariasi. Inilah total produksi nasional, apalagi produksi ikan di Maluku lebih tinggi dari daerah lain. “Tetapi anehnya, Maluku tidak mendapatkan hasil produksi dan hanya dapat hasil izin usahanya saja,” sergah John. Semua izin usaha perikanan, lanjut John, sudah dicabut Menteri Kelautan dan Perikanan Susi Pudjiastuti. Yang terjadi, muncul

gejolak di beberapa daerah, seperti yang terjadi di Banyuwangi dan Jember kendati belakangan hasil ikan di kedua daerah tersebut melimpah. “Kalau ikan hasil tangkap nelayan kecil melimpah, pemerintah harus bertanggungjawab, untuk menampung hasil yang banyak itu,” katanya. Karenanya, senator mewakili Provinsi Maluku tersebut, memandang perlu untuk memperjuangkan konsep Rancangan Undang-Undang (RUU) Otonomi Khusus Provinsi Kepulauan. (at/ epe)


Pendidikan Nasionalisme Berbasis Empat Pilar Kebangsaan KRISIS multidimensi yang dialami Indonesia sebagai sebuah bangsa (nation), tidak hanya pada sektor ekonomi maupun politik. Merujuk pada pandangan Ernest Gellner (1983), bahwa kebangsaan memiliki keselarasan makna dengan nasionalisme dan terbatas pada prinsip politik yang berarti satuan nasion harus sejalan dengan satuan politik. Negara-bangsa dengan sendirinya adalah negara yang didominasi oleh kelompok etnik yang merupakan penanda identitasnya—seperti bahasa atau agama—seringkali terkandung dalam simbolisme resmi dan institusi perundang-undangannya. Berbeda dengan pandangan Gellner, Benedict Anderson (1991) memandang nasionalisme sebagai kekuatan dan persistensi sentimen-imajinatif nasional karena pada prinsipnya nasion merupakan an imagined political community. Meski terdapat perbedaan dalam memaknai nasionalisme, namun, pandangan kedua tokoh tersebut memiliki titik temu pada gagasan bahwa bangsa adalah konstruksi ideologi demi menemukan keterkaitan antara kelompok kebudayaan dengan negara dan menciptakan komunitas abstrak. Hal tersebut sangat memungkinkan terjadinya “anomali nasionalisme”, yaitu goyahnya nasionalisme karena berpusat pada kesetiaan primordial dan solidaritas yang berbasis asal usul dan kebudayaan. Paska runtuhnya Orde Baru tahun 1998, ideologisasi nasionalisma dan kebangsaan, harus kita akui mengalami kemunduran. Kebanggan sebagai bangsa yang memiliki budaya dan tata nilai sendiri, mengalami kemunduran dengan lebih mencintai hasil-hasil kebudayaan dari bangsa lain. Belum lama masyarakat Indonesia, khususnya generasi muda, mengalami euforia terhadap budaya Korea atau yang dikenal dengan K-Pop, masyarakat Indonesia begitu memuja artis-artis India. Belum hilang sepenuhnya pemujaan terhadap artisartis India, masyarakat Indonesia menemukan idola-idola baru dalam sinetron

Oleh: Akhmad Fauzie

dari Turki. Tentu saja, kondisi ini suatu ironi nasionalisme yang akan semakin menggoyahkan kebanggaan sebagai bangsa Indonesia. Maka diperlukan upaya untuk memperkuat atau mencegah semakin goyahnya sentimen-imajinatif nasionalisme, salah satunya jalan yang strategis yakni melalui pendidikan. Undang-Undang Nomor 20 tahun 2003 tentang Sistem Pendidikan Nasional, dalam salah satu rumusannya mengharapkan bahwa pendidikan nasional akan membentuk peserta didik memiliki kekuatan keagamaan, pengendalian diri, kecerdasan, akhlak mulia, serta ketrampilan yang bermanfaat, baik bagi peserta didik sendiri, bagi masyarakat, bangsa dan negara. Pendidikan nasional bertujuan untuk menghasilkan sumberdaya manusia Indonesia, yang tidak hanya memiliki kecerdasan dan ketrampilan (hard skills), namun juga memiliki kompetensi pendukung sebagai pribadi yang berkarakter (soft skills). Adapun karakter yang sesuai nilai dan budaya bangsa, adalah karakter yang berbasis pada empat pilar kebangsaan, yaitu Pancasila, Undang-Undang Dasar 1945, Negara Kesatuan Republik Indonesia (NKRI) dan Bhineka Tunggal Ika. Permasalahannya adalah bagaimana model pendidikan nasionalisme berbasis pada penanaman nilai-nilai empat pilar kebangsaan dirancang dengan tujuan besar adalah mencegah semakin berkembangnya etnonasionalisme dan disintegrasi, di samping membentuk peserta didik, khususnya dari kalangan remaja, menjadi berkarakter empat pilar kebangsaan. Menjadikan empat pilar kebangsaan sebagai landasan pendidikan nasionalisme, khususnya bagi peserta didik, perlu melihat kembali kegagalan dalam pendidikan nasionalisme yang pernah dijalankan. Pancasila yang seharusnya dijadikan sistem nilai acuan, kerangka acuan ber-

pikir (kognitif), berolah rasa (afektif) dan bertindak (action) bagi seluruh bangsa, tidak lagi dijadikan kendaraan politik untuk mempertahankan kekuasaan. Nilainilai dalam Pancasila perlu dikembangkan dari habitus etnis yang diawali dari keluarga dengan memperhatikan modal sosial dan modal kultural. Diharapkan, nilai-nilai Pancasila tidak dianggap sebagai doktrin atau nilai-nilai yang mutlak. Upaya untuk menginternalisasi nilai-nilai Pancasila perlu memperhatikan perkembangan mental dan kedewasaan individu. Selaras dengan kajian dalam psikologi, bahwa pada setiap usia perkembangan, terdapat karakteristik atau ciri khas dalam wilayah pemikiran, perasaan dan tindakan. Bagi anak-anak dan remaja, nilai-nilai Pancasila harus diinternalisasikan secara konkret dan dikenal dengan baik melalui panca indera, karena pada usia anak-anak dan remaja, secara perkembangan kognitif-sosial membutuhkan stimulasi yang nyata, bukan abstrak. Lebih lanjut, untuk tingkat dewasa, penanaman nilai-nilai Pancasila sebagai bagian dari pendidikan nasionalisme disinkronisasikan dengan tujuan hidup sehari-hari dan juga penerapan di berbagai jenis lapangan. Internalisasi nilainilai Pancasila untuk menjadi “common platform” tidak dapat dilepaskan dari makna dan nilai Pembukaan UndangUndang Dasar 1945. Sebagai pernyataan kemerdekaan dan kedaulatan bangsa dan negara Indonesia, Pembukaan UndangUndang Dasar 1945 memiliki nilai-nilai yang perlu ditanamkan dalam pendidikan nasionalisme. Bahwa bangsa Indonesia lahir dari seuatu perjuangan panjang melawan penjajahan dan berkomitmen tidak akan melakukan penjajahan atas bangsa lain; bahwa bangsa Indonesia memiliki tujuan dan cita-cita mendasar sebagai hasil perumusan segenap unsur suku, agama dan ras, merupakan bangsa yang sehat secara kepribadian. Nilai-nilai Pancasila dan Undang-Undang Dasar 1945 meru-

pakan bukti nyata bahwa bangsa Indonesia mampu menjadi bangsa besar meski memiliki keragaman yang tercermin dalam nilai semboyan Bhineka Tunggal Ika. Pendidikan nasionalisme dengan berbasis pada empat pilar kebangsaan, khususnya pilar nilai Bhineka Tunggal Ika, dilaksanakan dengan penanaman nilai pengakuan akan keragaman masyarakat Indonesia, namun selalu bersepakat untuk mewujudkan persatuan sebagai Negara Kesatuan Republik Indonesia. Sebagai suatu usaha sadar dan terencana untuk mewujudkan proses pembelajaran agar peserta didik secara aktif mengembangkan potensi dirinya, maka, pendidikan nasionalisme pada tingkatan keluarga, diwujudkan melalui pembiasaan perilaku keseharian yang selaras dengan nilai-nilai empat pilar kebangsaan. Pada tingkatan sekolah, pendidikan nasionalisme dapat dilaksanakandenganmengajarkankecapakan hidup politik dan kecakapan hidup sosial. Artinya, peserta didik menjadi sadar politik dan sadar akan hak dan kewajibannya sebagai anggota masyarakat.Wujud kecakapan hidup politik antara lain kemampuan untukmenyampaikanpendapatsendiridan menghargaipendapatoranglainsertamampu mengambil keputusan bersama, meski terdapat perbedaan. Di sisi lain, dalam pendidikan nasionalisme, pihak sekolah harus mempromosikan pengertian terhadap kebaikan bersama yang akan mengajarkan peserta didik mencari keseimbangan antara hak individu dengan apa yang baik bagi masyarakat. Dengan hal upaya tersebut, maka, nilai-nilai luhur dari empat pilar kebangsaan tidak lagi menjadi doktrin, tetapi akanberkembangsebagaipandanganhidup yang selaras dengan perkembangan kebudayaan Indonesia yang tumbuh daru keberagaman suku, ras dan agama, dan inilah yang menjadi dasar lahirnya Undang-Undang Dasar 1945, semboyan BhinekaTunggal Ika dan Negara Kesatuan Republik Indonesia. (Dosen Fakultas Psikologi Universitas HangTuah)


berita metro


Wagub Minta Hasil Investigasi Diketahui Keluarga Korban BM/ANTARA

Tragedi Crane di Arab Saudi

KELUARGA KORBAN: Kerabat Siti Rukayah, korban musibah robohnya menara crane berbincang dengan Gus Ipul (kiri) di rumah duka di Ngajum, Malang, Rabu (16/9).

SURABAYA (BM) - Musibah robohnya crane di Masjidil Haram, Makkah menyisakan duka mendalam bagi keluaga jamaah haji asal Indonesia. Untuk sedikit menenangkan mereka, Wakil Gubernur Jawa Timur Saifullah Yusuf (Gus Ipul) meminta hasil investigasi dari Pemerintah Arab Saudi terkait musibah ini bisa diketahui ke-

luarga korban, khususnya yang meninggal dunia. Menurutnya, sangat penting hasil investigasi diketahui keluarga korban karena secara tidak langsung juga ikut menenangkan dan menguatkan keluarga yang ditinggalkan. “Keluarga harus tahu hasil investigasinya dari pemerintah resmi, jadi tidak menimbulkan

kabar simpang siur,” ujarnya kepada wartawan di Surabaya, Jumat (18/9). Gus Ipul juga meminta kepada pemerintah Arab Saudi menjadikan musibah ini sebagai evaluasi agar penyelenggaraan ibadah haji yang melibatkan jutaan masyarakat muslim seluruh dunia bisa lebih baik. “Banyak hikmah dari kejadian ini. Memang pembangunan di Masjidil Haram sangat bagus,

tapi harus menjadi bahan evaluasi agar kejadian serupa tak terulang,” ucapnya. Secara umum, katanya, penyelenggaraan haji tahun ini berjalan lancar, meski masih ditemukan sejumlah keluhan, seperti mogoknya bus pengantar jamaah, khususnya dari Indonesia. “Bus-bus harus yang layak, sebab kasihan jamaah yang busnya mogok. Apalagi di sana

cuacanya sangat panas sehingga berpengaruh terhadap kesehatan para jamaah yang tidak biasa dengan keadaan di sana,” katanya. Gus Ipul juga berharap tidak adanya lagi antre toilet di Arafah. “Sebelum-sebelumnya keterbatasan toilet menjadi keluhan jamaah. Semoga saat wukuf nanti berjalan lancar dan tak ada kendala bersifat nonteknis,” katanya. (zal/rdl)

Jumlah Sawah Terimbas Kemarau Meluas SURABAYA (BM) - Kemarau panjang yang terjadi di Jawa Timur terus menggerogoti lahan pertanian. Saat ini jumlah lahan pertanian yang mengalami kekeringan terus meluas. Dari data yang dihimpun Dinas Pertanian (Distan) Jatim, hingga kini lahan pertanian yang mengalami kekeringan mencapai lebih dari 28 ribu hektar. Padahal di pertengahan tahun ini sekitar 20 hektar saja yang dilanda kekeringan. Jumlah itu hingga kini juga terus bertambah seiring masih berlanjutnya musim kemarau panjang akibat El Nino. Kepala Bidang Produksi Tanaman Pangan Distan Jatim, Achmad Nurfalakhi menyebutkan,

hingga akhir Agustus 2015, total lahan padi yang mengalami kekeringan sudah mencapai 28.166 hektar. Luas itu naik dibanding data pertengahan Juli 2015 yang masih sekitar 20.978 Ha. Dia menyebutkan, kekeringan terbesar terjadi di Bojonegoro dengan luas lahan 10.623 hektar. Dengan perincian, kekeringan ringan mencapai 8.785 hektar, kekeringan sedang 445 hektar dan kekeringan berat sekitar 1.110 hektar. Sementara yang mengalami puso mencapai 283 hektar. Wilayah yang juga mengalami kekeringan yakni Tuban mencapai 2.816 hektar. Dengan perincian, yang mengalami kekeri-

ngan ringan mencapai 1.804 hektar, kekeringan sedang 908 hektar dan kekeringan berat mencapai 104 hektar. Selain Bojonegoro dan Tuban, lahan padi di Lamongan juga mengalami kekeringan yang cukup luas, yaitu sekitar 2.774 hektar. Dengan perincian yang mengalami kekeringan ringan mencapai 1.615 hektar, 559 hektar mengalami kekeringan sedang dan 471 hektar mengalami kekeringan berat. Sementara yang mengalami puso mencapai 129 hektar. “Kekeringan akan terus berlanjut jika tidak ada upaya pemberian air. Dan yang mengalami gagal panen juga akan bertam-

bah, karena yang mengalami kekeringan berat akan menjadi puso, yang mengalami kekeringan sedang akan menjadi berat dan yang ringan akan meningkat menjadi sedang,” ujarnya. Sementara saat ini, dari 28.166 hektar lahan yang mengalami kekeringan tersebut, sebanyak 1.966 hektar mengalami gagal panen atau puso. Sedangkan lahan padi yang mengalami kekeringan berat di seluruh Jatim mencapai 3.361 hektar. Meski demikian, Nurfalakhi optimistis, kekeringan panjang pada tahun ini tidak akan berpengaruh pada target produksi tanaman pangan di Jatim. Karena petani sudah sadar ketika

Kekeringan akan terus berlanjut jika tidak ada upaya pemberian air. Dan yang mengalami gagal panen juga akan bertambah, karena yang mengalami kekeringan berat akan menjadi puso, yang mengalami kekeringan sedang akan menjadi berat dan yang ringan akan meningkat menjadi sedang.” - ACHMAD NURFALAKHI -

Kabid Produksi Tanaman Pangan

aliran air sudah sulit, mereka langsung beralih menanam komoditas pertanian lain.


Distan: Lebih dari 28 Ribu Hektar Alami Kekeringan

SAWAH PUSO: Lahan sawah mengalami puso akibat kekeringan sehingga produksi padi menurun.

“Kebanyakan petani yang tahu lahannya alami kekeringan maka menanam komoditi lain yang tidak memerlukan air banyak, seperti semangka, garbis, kedelai, pacang ijo ataupun ka-

Pengoperasian Bandara BaweanTerkendala Runway Kadishub & LLAJ: Hanya Penyempurnaan Sisi Atas SURABAYA (BM) - Kepala Dinas Perhubungan dan LLAJ Jawa Timur, Wahid Wahyudi mengemukakan pengoperasian Bandara Pulau Bawean, Kabupaten Gresik, masih terkendala penyempurnaan sisi atas landasan ancang atau runway. “Seharusnya, dalam semes-

ter akhir 2014 sudah harus dilaksanaan oleh Direktorat Jenderal Perhubungan Udara, setelah itu baru bisa dilaksanakan operasionalnya,” katanya di Surabaya, Jumat (18/9). Menurut Wahid, secara keseluruhan untuk infrastruktur tidak ada masalah yang berarti untuk bandara atau lapangan

terbang Pulau Bawean, sebab semuanya sudah selesai dan siap dioperasionalkan. “Hanya masalah penyempurnaan sisi atas runway saja dan saya sangat berharap bisa segera dikerjakan agar bisa segera dioperasionalkan untuk mempermudah akses masyarakat,” kata Wahid.

Dia menjelaskan, Provinsi Jatim yang memiliki 38 kabupaten dan kota sangat memerlukan akses cepat transportasi karena dapat membantu perputaran ekonomi, sebab keberadaan jalan arteri sudah sangat padat. “Oleh karena itu, selain menggunakan kereta, program kita adalah menggunakan angkutan udara antar kota jarak dekat, se-

Pilkada Serentak

Pangdam: 10 Daerah Potensi Konflik

perti yang sudah terealisasi yakni Surabaya-Banyuwangi, Banyuwangi-Denpasar, SurabayaSumenep serta Surabaya-Jember,” katanya Dia berharap, bila lapangan terbang Bawean sudah siap, maka pemerintah juga sudah menyiapkan dana subsidi karena maskapai tidak akan untung untuk pengoperasi pertama. (ara/rdl)

SURABAYA (BM) - Pangdam V/Brawijaya Mayjen TNI Sumardi mengemukakan 10 daerah di Jawa Timur yang akan menggelar Pilkada, 9 Desember 2015, termasuk dalam wilayah berpotensi konflik. “Dari data yang disampaikan Badan Pengawas Pemilu (Bawaslu) Jatim, ada 10 dari 19 kabupaten/ kota berpotensi konflik,” ujarnya pada Seminar Pilkada Serentak di Jawa Timur Berintegritas dan Bermartabat yang diselenggarakan PWI Jawa Timur di Surabaya, Jumat (18/9). Kesepuluh daerah tersebut yakni Kabupaten Trenggalek, Kabupaten Sumenep, Kabupaten Jember, Kabupaten Banyuwangi, KabupatenTuban, Kabupaten Pacitan, Kabupaten Ngawi, Kota Blitar, Kabupaten Kediri dan Kota Pasuruan. Jenderal bintang dua itu menjelaskan faktor potensi kerusuhan antara lain terjadi pada saat kampanye dan rekapitulasi penghitungan suara. Kendati demikian, katanya, Jawa Timur menjadi daerah yang dikategorikan sebagai daerah sedang-sedang, bukan dalam skala kerawanan konflik parah. “Kami harapkan Pilkada serentak di Jatim berlangsung lancar, aman dan sukses tanpa adanya gesekan apapun. Kami yakin itu karena masyarakat di Jatim sudah sangat dewasa menghadapi ini,” kata mantan Gubernur Akademi Militer tersebut. Selanjutnya, untuk mengamankan pelaksanaan Pilkada, KodamV/Brawijaya menyiapkan satuan-satuan kewilayahan dalammembantupengamananyangdilakukankepolisiankarena memang sifanya sebagai backup.“Tapi kami menyiapkan satuan tempur jika sewaktu-waktu diminta bantuan pengamanan,” kata jenderal lulusan Akmil 1984 tersebut. (ara/rdl)



HARGA GULA TEBU CURAH NAIK Pekerja mengaduk gula tebu curah yang telah dimasak di salah satu industri gula tebu di Tulungagung, Jumat (18/9). Harga gula tebu curah saat ini mengalami kenaikan dari sebelumnya Rp 64.000 menjadi Rp 70 ribu per kilogram sebagai dampak membaiknya rendemen tebu selama kemarau panjang.

cang tunggak,” jelasnya. Selain itu, optimisme tersebut juga didukung oleh naiknya produktivitas padi di Jatim dari 60 kwintal per hektar menjadi 62,62 kwintal per hektar. (zal/rdl)

Mayjen TNI Sumardi

Megaproyek JIIPE Senilai Rp 8 T di Pesisir Manyar-Kalimireng Disoal Dewan

Ganggu Alur Pelayaran dan Pelaku Ekonomi di Empat Kawasan Pelabuhan kawasan bersifat strategis, bupati Gresik itu hanya sifatnya memberi rekomendasi, tapi izinnya tetap dari gubernur.

Pembangunan megaproyek Java Integrated Industrial Port Estate (JIIPE) senilai nyaris Rp 8 triliun dengan luas 3.000 hektar di kawasan pesisir Manyar-Kalimireng Kabupaten Gresik disoal DPRD Jatim. Proyek diperkirakan akan mengganggu alur pelayaran.

SELAIN berpotensi mengganggu alur pelayaran, JIIPE juga bisa membuat pelaku ekonomi di Kawasan Pelabuhan Tanjung Perak, Teluk Lamong, Pelabuhan Socah Madura maupun Tanjung Tembaga Probolinggo gulung tikar pada 2017. Ketua Komisi D (Pembangunan) DPRD Jawa Timur, Bambang Suhartono, mengaku sudah tahu lama soal rencana pembangunan JIIPE ini. “Itu

proyek sudah lama, yang membangun bukan Pemda atau Pelindo tapi murni investor swasta,” terang politisi yang akrab disapa Bambang Ger ini, Jumat (18/9). Dia berpendapat, seharusnya proyek tersebut ada kajian yang lebih mendalam. Karena bila sudah jadi nanti, akan berptensi mengganggu alur pelayaran Surabaya Barat (APBS). Pasalnya, berkaitan dengan



Bambang Suhartono

“Nah, gubernur dalam memberikan izin, itu harus ada dasarnya yang kuat, sampai sekarang saya cek ternyata masih belum selesai dikaji oleh Bappeda Jatim,” papar Bambang. Nantiya, lanjut Bambang, dasar yang dipakai adalah Kajian Lingkungan Hidup Strategis (KLHS). Dari hasil kajian itu gubernur bisa mengizinkan keseluruhan, sepersepuluh atau hanya seperempatnya. “Atau bisa juga keputusan gubernur itu meminta agar ditinjau ulang secara keseluruhan,” terangnya. Pentingnya kajian itu, kata Bambang, karena kawasan tersebut ada kaitannya dengan Alur Pelayaran Barat Surabaya (APBS) yang selama ini menjadi jalur utama pelayaran semua

kapal yang mau masuk keluar dari pelabuhan Tanjung Perak dan sekitarnya. Kalau pelabuhan itu jadi, pelabuhan itu lokasinya sangat menjorok mendekati APBS. “Bayangkan, pelabuhan ini kapasitas besar, pasti parkirnya banyak kapal. Pasti akan menutup akses kapal ke Teluk Lamong, Tanjung Perak dan Pelabuhan Socah Madura yang menuju ke timur. Termasuk ekonomi jalur laut di wilayah Tanjung Tembaga Probolinggo sangat terdampak,” paparnya Hanya saja, proyek ini tetap berjalan meski ditolak warga Manyar Gresik. Pihak DPRD Jatim hanya berharap Pemprov melalukan kajian serius terkait pelabuhan JIIPE sesuai kewena-

ngan provinsi. “Kita tidak bermaksud menghambat investasi di Jawa Timur. Sebaliknya justru menginginkan investasi bertambah di Jatim. Tapi ivestasi ini perlu ditata, agar tidak menjadi masalah di kemudian hari,” tukasnya. Yang dikhawatirkan nanti, bisa saja masyarakat Madura demo di Gresik, atau para pelaku usaha pelayaran di Tanjung Perak protes ke Gresik karena banyak kapal yang tidak bisa masuk ke pelabuhan Tanjung Perak, Teluk Lamong, Socah Madura dan Tanjung Tembaga Probolinggo. “Dampaknya pasti ke pelabuhan lain,” jelasnya. Untuk diketahui, Megaproyek JIIPE ini memang cukup bagus untuk kelas pelabuhan di In-

donesia. Ini karena kedalamannya lautnya jauh lebih dalam dibanding pelabuhan lainnya. Jika melihat maketnya, JIIPE sendiri dibangun di atas lahan seluas 2.933 hektar (ha) yang terbagi atas tiga zona. Di antaranya zona residential estate seluas 765 hektar, industrial estate seluas 1.761 hektar, dan sea port estate seluas 406 hektar. Khusus sea port estate ini, lokasinya paling menjorok di tengah laut. Inilah yang memicu bahaya di kemudian hari. Saking bahayanya, lokasi sea port ini juga bisa mengganggu APBS yang selama ini menjadi jalur utama pelayaran kapal-kapal besar sebelum sandar di Pelabuhan Tanjung Perak dan sekitarnya. (*)





Warga Keluhkan PJU Jembatan Rusak

M.Thoif Zamroni

dengan komposisi perolehan kursi di DPRD Jember. Dengan rincian Fraksi Gerindra 5 orang, FKB, FKS dan FPDIP masing-masing empat orang, sedangkan sisanya ada tiga dan dua sesuai dengan jumlah kursi. Hal ini sudah sesuai dengan tata tertib pembentukan Pansus di DPRD

Jember. Thoif mengatakan, semangat Pansus Pilkada bukan hanya pilkada sukses pelaksanaan, akan tetapi semuanya, bagaimana bila ada pesta demokrasi dengan perbedaan pendapat. ”Yang terpenting pilkada yang akan datang tidak menimbulkan konflik di masyarakat bawah,” jelasnya. Dalam pelaksanaannya diperlukan kedewasaan dari semua pihak. Hal ini bukan hanya dari penyelenggara pilkada, namun juga butuh keterlibatan semua pihak agar menggunakan hak pilihnya pada tanggal 9 Desember 2015. ”Melalui Pansus ini juga akan mengawal agar partisipsi masyarakat dalam pilkada tinggi,” imbuhnya. Terkait dengan penyerapan anggaran yang dialokasikan dalam kegiatan pilkada Jember ada anggaran yang cukup besar untuk penyelenggaraan Pilkada Jember 2015 dari ABPD sekitar Rp. 70 miliar

SITUBONDO (BM)- Banyak lampu penerangan jalan umum (PJU) mengalami kerusakan, sehingga tidak menyala pada malam hari. Banyak warga setempat dan pengendara motor mengeluh, karena suasana menjadi gelap dan rawan kecelakaan. Seperti PJU di jembatan Cappore, Kelurahan Ardirejo, Kecamatan Panji, Situbondo. Lampu dibeberapa tiang jembatan dalam beberapa minggu padam. Kerusakan PJU diharapkan menjadi perhatian instansi terkait. Setidaknya dilakukan pendataan dan perbaikannya, karena sudah banyak yang rusak. Menurut warga sekitar, sudah harus dilakukan perbaikan ataupun penggantian

untuk KPU dan Rp.16 miliar untuk Panwaslih serta sebagian untuk bantuan pengamanan. ”Kami ingin penyerapannya sesuai dengan aturan yang ada,” terang Thoif. Terkait dengan dibentuknya Pansus DPRD Jember, karena itu merupakan salah satu Tupoksi DPRD Jember adalah pengawasan anggaran. Dikarenakan anggota DPRD Jember ini menjadi representasi dari rakyat Jember yang wajib bersama-sama mengawasi yang dilakukan penyelenggara sesuai dengan aturan. Sehingga pihaknya berharap jika Pilkada selesai dan sukses, maka diharapkan tidak sampai menimbulkan masalah hukum dikemudan hari, terutama pada penyelengara pemilu. Sementara itu, dalam Pansus ini pihaknya juga akan mengawasi pelaksanaan Pilkada, terutama dalam kaitan penggunaan aset negara dalam pelaksanaan pilkada.(uul/edi/dra)

Angka Penceraian Menurun

Malam harinya dilanjutkan selamatan desa, ribuan warga Desa Kemiren keluar rumah. Mereka memenuhi pinggir jalan untuk mengikuti selamatan desa. Nasinya berbentuk kerucut alias tumpeng. Lauknya khas yakni Pecel Pithik. Selamatan desa Tumpeng Sewu ini sebagai bentuk syukur atas berkah Tuhan Yang Maha Esa. Bupati Banyuwangi Abdullah Azwar Anas mengatakan, tradisi Tumpeng Sewu sebagai bagian dari tradisi dan kearifan lokal. ”Tradisi ini menggambarkan keterbukaan dan keramahan Suku Using, yang ingin kita perkenalkan secara luas,” ujar Anas. (hel/edi/dra)


Masyarakat Using Gelar Selamatan Desa Tumpeng Sewu BANYUWANGI(BM) - Masyarakat adat Using Desa Kemiren Kabupaten Banyuwangi menggelar selamatan desa, kemarin malam. Pemkab Banyuwangi menamakan acara itu selamatan Tumpeng Sewu dalam dua tahun terakhir ini. Tumpeng Sewu akhirnya dimasukkan dalam kalender pariwisata Banyuwangi dan masuk dalam rangkaian Banyuwangi Festival. Selamatan desa itu digelar seminggu sebelum hari raya Idul Adha. Pagi hari warga Using Kemiren menjemur kasur ‘abang-cemeng’ (merah-hitam) mereka. Mereka menjemur kasur mulai pagi hingga sore hari.

lampu . “Sebab suasana malam hari menjadi gelap gulita, apalagi jalan di jembatan tersebut menikung,” ungkap Asis seorang pedagang kaki lima di sekitar jembatan itu, Jumat (18/9). Matinya lampu di jembatan itu cukup membuat pengguna jalan merasa was-was. Warga sangat berharap agar instansi terkait melakukan perbaikan lampu yang rusak, karena selama ini belum ada tanda-tanda untuk perbaikan. ”Kami berharap agar pemerintah kabupaten melakukan perbaikan, karena sarana umum ini besar manfaatnya bagi masyarakat,” kata warga lain. (edo/edi/dra)

TRADISI: Masyarakat adat Using Desa Kemiren Kabupaten Banyuwangi menggelar selamatan desa.

BONDOWOSO (BM) - Kesiapan mental untuk proses perkawinan merupakan salah satu faktor mengurangi angka perceraian, hal itu disampaikan wakil panitera Pengadilan Agama, Pandit Syah Ristance, Jumat (18/9). Dikatakan selama ini dari beberapa pengajuan proses perceraian diantaranya kurang siap mental seseorang untuk melakukan proses perkawinan, sehingga masih seumur jagung langsung melakukan proses perceraian. “Kami menghimbau terutamanya kepada tokoh agama untuk memberikan pengertian yang mendasar kepada masyarakat sebelum melakukan proses perkawinan, manfaatnya, calon yang akan melakukan proses perkawinan sudah siap mentalnya tidak senangnya saja yang dia pahami, tetapi pahitnya juga dipahami,” terang Pandit. Pengadilan Agama pada tahun 2015, terhitung mulai Januari sampai Agustus sebanyak 1.345 perkara yang diterima. Berkurang diband-



JEMBER (BM) - Dewan Perwakilan Rakyat Daerah (DPRD) Jember akan membentuk Panitia Khusus (Pansus) Pilkada. Dibentuknya Pansus ini tidak lain untuk mengawasi jalannya Pemilihan Kepala Daerah agar kondusif dan melakukan pengawasan terhadap penggunaan anggaran ABPD sebesar Rp 90 miliar yang dialokasikan untuk peyelenggara pilkada. Pansus ini ditetapkan dalam rapat Paripurna Internal DPRD Jember. Dalam Rapat Paripurna yang dipimpin Wakil Ketua DPRD Jember Ayub Junaedi menunjuk Ketua DPRD Jember M.Thoif Zamroni menjadi ketua Pansus. Pansus yang beranggotan 25 orang ini akan mengawasi tahapan pilkada dan mengawal pelaksanaan pilkada Jember 2015 agar pesta demokrasi rakyat Jember berjalan dengan aman dan kondusif. Pantauan Berita Metro, anggota pansus terdiri dari lintas fraksi yang sesuai


Awasi Penggunaan Dana APBD, Dewan Bentuk Pansus Pilkada

Pandit Syah

ingkan dengan tahun 2014 yang mencapai 2.130 perkara yang diterima terhitung dari Januari sampai dengan bulan Desember. Seperti warga Desa Creme Kecamtan Crème, Anik (25) yang mengajukan proses perceraian dikarenakan hal sepele, menurutnya atas cemburu sang suami yang berlebihan harus berlanjut ke pengadilan agama, padahal menurutnya dia baru menikah 3 tahun dan sudah mempunyai seorang anak. (diq/edi/dra)


BUDAYAKAN OLAHRAGA: Peserta gerak jalan santai yang diikuti seluruh SKPD serta para Guru di Gor A Yani Kota Probolinggo.

SKPD Ikuti Gerak Jalan


PROBOLINGGO (BM) - Angin kencang, membuat perahu milik seorang nelayan di Mayangan Probolinggo karam. Perahu berukuran 13x4 meter karam diperairan selat Madura, membuat perahu berisikan 5 orang itu membawa semen sebanyak 200 sak dari pelabuhan Mayangan menuju pulau Gili Ketapang Probolinggo. Beruntung insiden tersebut tidak ada korban jiwa, hanya beberapa orang sempat terkulai lemas akibat berusaha berenang kebibir pantai setelah perahu yang ditumpangi nyaris terbalik. ”Anginnya kencang, untung kami belum berada ditengah laut, kalau posisi kami berada ditengah laut, mungkin kami sudah meninggal,” jelas Hasim (50) warga Gili, salah satu penumpang perahu Jumat (18/9) kemarin. Dikatakan Hasim, selain angin kencang, perahu juga terjadi masalah pada kemudi perahu. Saat itu menahan arus angin


Angin Kencang, Perahu Bermuatan Karam

KARAM: Perahu milik seorang nelayan yang mengangkut orang dan barang di perairan selat Madura.

kerusakan. “Kami paksakan untuk terus menuju ke Gili, karena di perahu ini bebannya sangat berat. Kami kewalahan saat kemudi rusak,

yang membawa perahunya ke arah lain. Dirinya dan teman lainnya tidak mampu mengendalikan hembusan angin hingga harus dipaksakan dan berakibat

dihempas angin dan susah mengendalikan beban berat berupa semen 200 sak,” imbuh Hasim. Selang satu jam lima orang nelayan termasuk Hasim, men-

gaku trauma dengan peristiwa kali ini, karena membawa beban erat dengan perahu yag bukan layaknya untuk membawa menyeberang lautan.(sip/dra)


Ditinggal ke Pasar Rumah Ludes Kebakaran

LUDES: Rumah H Syukur yang ludes dilahap si jago merah dan hanya tinggal menyisakan puing yang hangus. PERWAKILAN

PROBOLINGGO (BM) - Ditinggal berjualan di pasar Ketapang Kota Probolinggo, rumah seorang pedagang di Keluarahan Ketapang, Kecamatan Kademangan Kota Probolinggo, Jumat (18/9) ludes dilalap si jago merah. Rumah milik H Syukur (45) yang merupakan salah satu pedagang di pasar Ketapang Kota Probolinggo ludes, hingga menjadi arang tak tersisa. Kebakaran yang diduga akibat pembakaran sampah yang dilakukan dibelakang rumah oleh orang lain ini, mulai membesar karena tiupan angin hingga menyambar

tumpukan kayu di belakang rumah dan menyambar bagian dalam rumah . Siti Maliha (47) salah seorang tetangga korban yang bersebelahan mengatakan, bahwa pada pukul 07.00 asap sudah mulai muncul dari atap rumah, kemudian dirinya berteriak dan didengar warga lain yang langsung membantu memadamkan api dengan peralatan seadanya . ”Saya lihat api sudah besar, makanya saya lari. Warga ambil ember dan menyiramkan air selokan untuk memadamkan api. Rumahnya lagi ditinggal pemiliknya dagang di pasar,

mas,” katanya kepada Berita Metro. Siti Maliha juga menambahkan kebakaran yang terjadi kemungkinan bukan karena masak ditinggal diatas kompor. “Kebakaran kemungkinan dari banyaknya tumpukan gabah dan bawang merah yang terbakar akhirnya tersambar hingga menjadi besar,” tambahnya . Petugas pemadam kebakaran menurunkan 2 unit mobil pemadam. Adanya alat pemadam yang datang dan berhasil memadamkan api pada pukul 08.30 dengan dibantu warga sekitar. (ard/fik/dra)

PROBOLINGGO ( BM ) - Pemerintah Kota Probolinggo melalui Dinas Pemuda Olahraga Budaya dan Pariwisata (Dispobpar) melaksanakan gelar gerak jalan santai yang diikuti seluruh SKPD serta para Guru, Jumat (18/9) di Gor A Yani Kota Probolinggo. Gerak jalan santai dihadiriWalikota Probolinggo Hj. Rukmini, Wawali H.M Suhadak, Sekdakot Jhony Haryanto beserta seluruh jajaran SKPD se-Kota Probolinggo. Gerak jalan dalam rangka hari jadi Kota Probolinggo yang ke 656 dan hari olahraga nasional ke 32 dengan mengambil tema ”Gelorakan budaya olahraga untuk Indonesia hebat” Ketua Panitia Penyelenggara dari Dispobpar Luluk mengatakan, bahwa kegiatan tersebut merupakan hal yang sangat positif, yaitu

dengan berolah raga tubuh menjadi sehat dan kuat dan tentunya tidak mudah terkena penyakit. Olahraga harus di masyarakatkan guna kesehatan masyarakat yang jasmani. Lomba di ikuti seluruh SKPD serta guru se Kota Probolinggo jumlah total ada 95 kelompok, start di mulai dari Gor A Yani berjalan menuju Alun-alun setelah itu melewati Jl. Suroyo, Jl. Panglima Sudirman dan Kembali Finish Gor A Yani. Sementara itu dalam kesempatan yang sama Walikota Hj. Rukmini menyampaikan, dengan mengikuti acara gerak jalan santai pagi ini akan memiliki manfaat untuk kesehatan seperti mengurangi berat badan, Osteoforosis, Diabetes dan lain sebagainya. (ard/fik/kur/dra)

Disbudpar Lestarikan Budaya Tradisional PROBOLINGGO(BM)-Dinas Kebudayaan dan Pariwisata (Disbudpar) Kabupaten Probolinggo akan terus melakukan upaya pelestarian terhadap budaya tradisional. Hal ini disampaikan Kepala Disbudpar setempat, Anung Widiarto, Jumat (18/9). Menurutnya, pelestarian budaya tradisional itu dilakukan agar budaya tradisional tetap eksis di tengah perkembangan jaman. Salah satu bentuk upaya pelestarian tersebut dengan menyuguhkan budaya tardisional di setiap even.

“Budaya tradisional ini warisan nenek moyang kita. Makanya kita harus tetap menjaga dan melestarikannya,” ungkapnya. Salah seorang pemerhati seni budaya asal Kabupaten Probolinggo, Supriyono menjelaskan, kehadiran budaya barat di Indonesia bisa mengancam keberadaan budaya tradisional. Agar budaya tradisional tidak tergeser oleh perkembangan jaman, para seniman dan budayawan seyogyanya lebih serius dalam memperjuangkan pelestariannya. (ugi/sip/dra)

Situbondo: Edy Sudibyo (koord), Edo Firman, Abdul Hakim, Sudarsono; Bondowoso: Bambang, Sodiq; Jember: Ulum Subektian, Ach. Rullah; Lumajang: Santono Priambodo, Fitroh; Banyuwangi: Helmi. Manajer Iklan/Langganan: 081 249 455 05


berita metro



Proyek Perbaikan Saluran Air di Candi Panggung, Dibiarkan Tak Terurus

Timbulkan Polusi Udara dan Sebabkan Kecelakaan MALANG (BM) - PDAM Kota Malang melakukan perbaikan saluran air di sepanjang Jalan Candi Panggung hingga Jalan Akordion. Tragisnya, perbaikan demi kepentingan PDAM itu justru mengobrak-abrik Jalan Akordion di Kelurahan Tunggul Wulung. Praktis, proyek perbaikan itu dikeluhkan warga sekitar. Sebab, kondisi jalan yang sebelumnya bagus justru mengalami rusak parah. Pantauan di lokasi, kondisi dua jalan itu kini jadi rusak parah. “Setiap saat debu berterbangansebabkan polusi udara,” kata Agung, warga setempat, Jumat (18/9). Itu karena, kata dia usai PDAM melakukan pembongkaran jalan, hanya ditutup menggunakan tanah dan tak dikembalikan ke kondisi semula. Yaitu jalan beraspal yang bagus dan nyaman. Proyek ini, kata dia, masih berlangsung hingga kawasan Jalan Candi Panggung tepat di samping kantor RRI Malang. Sehingga akses jalan dari kawasan itu terpaksa harus melalui jalan kampung sebagai jalur alternatif. Menurut Jufri (38), seorang warga Jalan Candi Panggung, sejak jalan rusak akses menuju kawasan rukonya semakin sulit. Bahkan, ia yang berbisnis kuliner lalapan ini mengaku mengalami penurunan omset sejak kondisi jalan rusak.

“Sudah lama rusak begini, hampir satu bulan lebih. Warga mengeluh karena akses jalan sulit dan omset pendapatan warung saya menurun karena akses jalan seperti ini,” katanya,Jumat (18/9). Menurutnya, PDAM harusnya langsung melakukan perbaikan jalan setelah melakukan pembongkaran sehingga akses jalan tidak rusak seperti saat ini. “Ini sepertinya proyeknya molor, kan masih dilakukan pemasangan pipa belum lagi nanti pengaspalan, akan butuh waktu lama,” tandasnya. Warga lain, Lamsia, juga mengeluhkan kondisi jalan rusak ini. Selain akses jalan rusak, ia kerap menemui pesepeda motor yang jatuh karena jalan tidak kondusif. “Kemarin suami saya nolong orang jatuh sampai tiga kali, karena jalannya rusak seperti ini,” ucap Lamsia. Ungkapan Lamsia dibenarkan Yuni, pegawai Griya Laundry yang berada di Jalan Candi Panggung. Menurutnya, sejak kondisi jalan rusak akibat proyek PDAM, ia sering mengetahui ada pengguna motor jatuh.”Kemarin ada suamiistri terjatuh, kasihan dia jatuh pas di lubang yang dibuat PDAM,” ungkapYuni. Selain kondisi jalan yang rusak, debu yang beterbangan akibat proyek PDAM juga dikeluhkan warga. Jupri, salah seorang pengusaha kuliner di Jalan Candi Panggung mengaku setiap hari harus

TAK TANGGUNG JAWAB : Proyek perbaikan pipa milik PDAM Kota Malang yang diresahkan warga setempat karena dibiarkan hingga menimbulkan polusi udara dan kecelakaan.

menyiram pelataran depan warungnya karena debu sangat mengganggu. “Sehari bisa siram jalan ini sampai tiga hingga lima kali,” kata Jupri. Setali tiga uang, Yuni pegawai Griya Laundry, juga sangat terganggu dengan debu yang beterbangan hingga masuk tempat usahanya. “Harapannya PDAM segera memperbaiki jalan disini, kare-

na sangat mengganggu warga,” tegas dia. Terpisah,Wakil Ketua Komisi C DPRD Kota Malang, Subur Triono saat dikonfirmasi menyatakan karena itu merupakan kepentingan PDAM seharusnya mempertimbangkan keselamatan pengguna jalan. “Kalau saja penggalian itu sesuai dengan bestek maka pengerjaannya akan baik dan tidak

menimbulkan gejolak,terutama keselamatan pengguna jalan,” kata Subur Triono ketika dikonfirmasi via sellulernya, kemarin. Dijelaskan,tahun lalu telah dibangun pipa PDAM oleh pemerintah Kota,Namun hal itu disebutkan tidak sesuai spek.Apalgi menurut dia,ketinggian tanah dilokasi penggalian PDAM itu tidak merata. (lil/nov)

Dinas Pasar Mulai Pasang Banner Relokasi Pedagang Pasar Blimbing

KAMUFLASE : Tower yang berada di Hutan Kota Malabar Kota Malang yang juga dipersoalkan karena menyalahi aturan.

Keberadaan Tower di Hutan Kota Malabar Dipersoalkan MALANG (BM) - Ternyata tak hanya revitalisasi saja yang dipersoalkan. Sebab, keberadaan tower di Hutan Kota Malabar juga disoal. Maklum, tower itu berada tepat di tengah Hutan Kota Malabar. Kondisi tower terkamuflase karena berwarna coklat dan tertutup dengan daun. Itu ditengarai sudah berdiri sejak tiga tahun lalu. Menurut Juru bicara Walhi Jatim, Purnawan D Negara, Jumat (18/9), jika mengacu pada Undang-Undang RI Nomor 26 tahun 2007 tentang Penataan Ruang dan Perda Tata Ruang serta Wilayah (RTRW), harusnya keberadaan tower dihindarkan. “Sebab, bangunan itu mengganggu luasan kawasan,” kata dia. Menurut dia, dalam Perda RTRW ada aturan yang menyebut tidak boleh ada bangunan

yang menutup luasan kawasan ruang terbuka hijau. “Termasuk dalam hal ini hutan kota,” kata Purnawan. Ia menyebut, pendiriam tower itu tidak tepat karena tidak mendukung fungsi ekologis yang ada. Diakuinya, memang dalam kawasan ruang terbuka hijau (RTH) boleh ada iklan yang sifatnya komersil, namun, jika dalam bentuk tower hal itu sangat tidak tepat. “Meski ada perjanjian kerjasama (PKS) harus mengacu pada ketentuan perda, jadi kami menilai tower itu tidak tepat,” ungkapnya. Ia menambahkan, harusnya Pemkot Malang berani menolak keberadaan tower lantaran melanggar ketentuan dalam peraturan daerah. “Kalau menurut hemat Walhi, tower harus dipindahkan,” pungkasnya. (lil)

MALANG (BM) - Pemerintah Kota (Pemkot) Ma- tempat penampungan sementara bagi pedagang bisa lang melalui Dinas Pasar setempat memasang ban- layak digunakan berdagang. “Penambahan fasilitas ner di kawasan pasar Blimbing. Isi banner itu terkait terus kami upayakan sehingga nanti tanggal 23 Seprelokasi pedagang ke tempat penampungan semen- tember siap ditempati,” tandasnya. tara mulai 23 September 2015 mendatang. Seperti diketahui sejumlah pedagang Pasar Banner itu berisi permintaan agar segera pindah Blimbing, masih belum memutuskan menerima itu, Jumat (18/9) terlihat dipasang di depan halaman tawaran relokasi, karena mereka ketakutan tidak pasar dan pintu masuk pasar Blimbing. Menurut ke- mendapat lapak berjualan selain meminta kejelapala Dinas Pasar Kota Malang Wahyu Setianto ada san soal siteplan pasar yang akan dibangun serta enam banner berwarna kuning yang sudah terpasang tahapan yang jelas. dengan ukuran besar dan kecil. Akan tetapi, menurut salah satu pedagang buah “Isi benner itu bertuliskan ‘Relokasi Pedagang Pasar yang ada di Pasar Blimbing Rokaya, mengaku, sudah Blimbing di Tempat Penampungan Sementara (TPS) diberi tahu soal tempat penampungan sementara. Stadion Blimbing mulai tanggal 23 September 2015’. “Kemarin sempat ada pemberitahuan,” kata dia, keItu harus dipatuhi,” kata dia. marin. Wahyu mengatakan banyak pedagang pasar Ia menegaskan tidak akan pindah jika tempat peBlimbing yang khawatir nasibnya akan seperti peda- nampungan sementara tidak mencukupi. “Kalau cukgang di pasar Dinoyo. Ketakutan itu adalah pedagang up ya pindah, kalau gak cukup ya tetap disini. Saya ya disuruh membayar lapak usai pasar direnovasi in- ikut saja,” ucap Rokaya. vestor PT Karya Indah Sukses (KIS). Di tempat yang berbeda, Rudi, pedagang mainan “Jadi dari sosialisasi yang kami lakukan ternyata dengan tegas menolak pindah karena lapak di Stadion banyak pedagang ketakutan. Sebab, mereka khawat- Blimbing dianggapnya kurang . “Kalau lapaknya ir yang nantinya akan membayar,” terang Wahyu, Ju- kurang saya gak mau pindah,” ujar Rudi. (lil/nov) mat (18/9) kemarin. Kepada pedagang, ia menjelaskan, tidak benar jika mereka nanti harus membayar lapak setelah pasar dibangun. “Saya sudah sampaikan kepada pedagang jika mereka nanti akan memiliki kios tanpa membayar alias nol rupiah,” jelasnya. Sementara itu, Wahyu Setianto menegaskan, sesuai data pedagang aktif sebanyak 1.790 pedagang akan menempati tempat penampungan sementara di Stadion Blimbing. “Memang data pedagang yang aktif itu ada 1.790, itu yang nanti akan dipindah sementara ke stadion. Tapi ketika pasar sudah jadi sebanyak 2.250 pedagang punya hak lapak,” kata Wahyu. SIAP-SIAP : Petugas Dinas Pasar Kota Malang saat memasang sejumlah Ia menjelaskan Dinas Pasar Kota banner di sekitar pasar. Hal itu, menurut kepala pasar setempat harus Malang saat ini terus berupaya agar dipatuhi.

Jelang Idul Adha, Pedagang Hewan Kurban Serbu Kota Malang MALANG (BM) - Hari Raya Idul Adha 1436 Hijriah jatuh pada 24 September mendatang. Meski begitu, pedagang hewan kurban dari luar daerah sejak Jumat (18/9) sudah mulai ‘menyerbu’ Kota Malang. Mereka menggelar barang dagangannya berupa sapi dan kambing di beberapa titik. Di antaranya, di Jalan Kesatriyan, Jalan Wisnu Wardana dan Jalan Danau Kerinci. Bahkan, di Jalan Martadinata hingga Jalan Letjen Sutoyo, Jalan A Yani juga mulai ditempati para penjual hewan kurban dari luar kota. Begitu juga di kawasan Jalan Bengawan PERWAKILAN

Solo hingga Jalan Raden Intan. Para pedagang hewan kurban dari luar daerah itu kebanyakan berasal dari Kabupaten Malang, Kabupaten Blitar, Kabupaten Pasuruan dan Kabupaten Probolinggo. Martiana seorang warga Desa Majang Tengah Kecamatan Dampit Kabupaten Malang juga tak mau ketinggalan. Dia membuka penjualan hewan kurban di Jalan Danau Kerinci Sawojajar Kota Malang. Marti, sapaan akrabnya mengaku hampir tiap tahun berjualan di tempat itu. “Sudah sekitar 16 tahun saya berjualan hewan kurban di lahan kosong ini. Saya lakukan itu ka-

lau menjelang Idul Adha,” ungkapnya. Tahun lalu, dia membawa 64 ekor kambing dan semuanya ludes terjual. Kali ini, dia membawa 58 ekor kambing untuk dijual kepada warga. ”Jenisnya macam-macam, ada kambing lokal dan peranakan. Misalnya, kambing kacang dan kambing etawa,” imbuhnya. Hewan-hewan itu dijual dengan harga variatif, mulai Rp 1,5 juta hingga Rp 4 juta. Ia memastikan, semua hewan yang dijual sudah memenuhi syarat dikurbankan, seperti dewasa dan sehat. “Sudah beberapa ekor terbeli, tapi kebanyakan tidak langsung diba-

wa. Dititipkan dulu di sini, jadi saya yang pelihara sampai diambil nantinya,” pungkasnya. Hal senada juga diungkapkan Matali, asal Pasuruan. Dia yang membuka dagangan hewan kurban di Jalan Dieng ini mengaku baru tahun ini jual di Kota Malang. ”Ada saudara di Malang yang ngajak.Ya, saya mau aja. Alhamdulillah sudah banyak yang laku,” kata dia. Kambing dan sapi yang dibawa dari Pasuruan jumlahnya lumayan banyak. Untuk kambing, dia membawa 75 ekor. Sedangkan sapi sebanyak 20 ekor. (lil/nov)


Kemenag Gelar Kursus Pra Nikah BATU (BM) - Kementrian Agama (Kemenag) Kota Batu menggelar kursus pra nikah di kantor Ikatan Persaudaraan Haji Indonesia Kota Batu, Jumat (18/ 9). Kursus tersebut diikuti sebanyak 270 pasangan. “Kursus pra nikah tersebut tujuannya agar menjadi keluarga sakinah mawaddah warahmah. Sebab, kualitas sebuah keluarga sangat ditentukan ketika pernikahan,” terang Kepala Humas Islam Kemenag Kota Batu, M Rosyad. Menurut dia, baik buruknya kualitas sebuah keluarga akan sangat menentukan terhadap baik buruknya sebuah masyarakat . Makanya, jika karakter yang dihasilkan oleh keluarga itu baik tentu akan berpengaruh baik kepada lingkungan sekitarnya. Tetapi sebaliknya, lanjut dia jika karakter yang dihasilkan jelek maka juga akan berpengaruh kuat kepada lingkungannya. Pada skala besar tidak mustahil akan mewarnai karakter sebuah bangsa . Hal itu mengingat, karakter bangsa hakekatnya tersusun dari kumpulan berbagai masyarakat. Kemudian masyarakat besar tersusun dari masyarakat kecil yang disebut keluarga. “Sedangkan sebuah keluarga tersusun dari ayah, ibu dan anak,” jelasnya. Maka dari itu, kata dia dalam melangsungkan pernikahan tentu saja dengan harapan yang besar agar pernikahannya bisa langgeng. Supaya harapan membangun rumah tangga bahagia terwujud, diperlukan pengenalan terlebih dahulu tentang kehidupan baru yang akan dialaminya nanti. Yang perlu diketahui, kata dia sepasang calon suami istri, diberikan informasi singkat tentang kemungkinan yang akan terjadi dalam rumah tangga. Dengan begitu, pada saatnya nanti mereka sudah bisa mengantisipasi dengan baik. (gus/nov)

Pemkot Batu Pastikan Menolak ADD BATU (BM) - Pemkot Batu memastikan diri untuk menolak alokasi dana desa (ADD) dari pemerintah pusat sebesar Rp 6,3 miliar. Kepastian tersebut diungkapkan Wali Kota Batu Eddy Rumpoko, Jumat (18/9). “Kita masih belum perlu untuk menerima anggaran dari pusat untuk pencanangan desa mandiri. Sebab, ADD dari APBD Kota Batu sebesar Rp 11,3 miliar masih cukup buat 19 desa yang ada,” kata Eddy Rumpoko. Menurut dia, dana desa dari pusat sebesar Rp 6,3 miliar tidak terlalu besar. Sebab, kalau dibagi untuk 19 desa yang tersebar di tiga kecamatan maka tiap desa hanya menerima sekitar Rp 300-400 juta. SedangkanADDdariAPBD KotaBatuuntuktiapdesa bisamencapaiRp750juta.Danasebesaritukatadiasangat cukupuntuk melaksanakanpembangunaninfrastruktur irigasi,pendidikan, kesehatandanbantuansosiallainnya. Dijelaskan dia bahwa untuk pembangunan infrastruktur itu pun sudah terprogram dalam APBD. Apalagi tiap desa disuntik dana bantuan langsung dari Pemkot Batu sebesar Rp 750 juta samapai Rp 1 miliar. “Jadi sudah cukup,” katanya. Dijelaskannya, pemerintah pusat memang mengalokasikan dana desa yang bersumber dari APBN sebesar Rp 6,3 milliar. Sedangkan anggaran yang tersedia di Pemkot Batu pada saat ini masih bisa memenuhi kepentingan tiap desa manakala membutuhkan tambahan. Makanya, dia lebih setuju kalau sekarang ini bantuan- bantuan bagi desa difokuskan untuk kesejahteraan masyarakat , pendidikan dan kesehatan. “Jadi, sepanjang bisa memenuhi kesejahteraan masyarakat akan dialokasikan,” tegasnya. (gus/nov)

Lahan Tebu Milik Perusahaan Molindo Terbakar MALANG (BM) - Kebakaran lahan tebu terjadi di Desa Mulyoarjo, Kecamatan Lawang, Kabupaten Malang, Jumat (17/9) sore. Ladang tebu itu milik perusahaan Molindo. “Lokasi kebakarannya di luar areal pabrik,” jelas Arman, staf Molindo, kemarin malam. Menurutnya, dari luas lahan 1 hektar yang terbakar separuhnya. Sisanya, tebu-tebu yang belum dipanen itu masih berdiri. Separuhnya ludes terbakar. Lokasi kebakaran berada di atas bukit. “Dari hasil investigasi kami, penyebabnya karena panas. Apalagi anginnya kencang,” kata dia. Kebakaran pertama kali dilihat oleh sekuriti perusahaan sekitar pukul 15.10. Dalam kurun waktu 1,5 jam kemudian, seluruhnya bisa dipadamkan. Pihak perusahaan mengerahkan tiga kendaraan tangki airnya ditambah dua kendaraan tangki air bantuan Kostrad yang sedang latihan di Puslatpur Sidodadi. Kemudian juga dua mobil PMK Kabupaten Malang untuk siaga. “Semua sudah dipadamkan. Nilai kerugiannya, masih belum tahu,” katanya. Menurut Arman, kebakaran ladang tebu milik Molindo baru pertama kali terjadi ini. Ditambahkan Nurul Kusnaeni, Kepala UPT PMK Kabupaten Malang, musim kemarau yang panjang berpotensi menimbulkan kebakaran. Sebab banyak lahan kering. Terpercik api sedikit saja ditambah angin kencang, maka sudah bisa mempercepat kebakaran. Bahkan bisa merembet ke tempat lain jika tidak segera di lokalisir. Beberapa kali kejadian yang dicatat di PMK Kabupaten Malangadalah kebakaran di ladang tebu.”Buat pemilik lahan, jika tebunya sudah ditebang dan niatnya dikabar, jangan ditinggalkan. Awasi, tunggu agar tidak merembet ke tempat lain misalkan ke pemukiman,” ungkap Nurul. (lil/nov)

Malang Raya: Aji A Haji (koord), M. Kholil, Agus Susanto; Iklan/Langganan: 081 333 4050 30

06 G E R B A N G M O J O

berita metro



Waspadai, Mayoritas Air Minum Tercemari Bakteri Ecoli

Sebabkan Diare Berkepanjangan dan Berujung Kematian MOJOKERTO (BM) - Dari hasil uji laboratorium yang dilakukan Dinas Kesehatan (Dinkes) Kabupaten Mojokerto, mayoritas air minum rumah tangga di Kabupaten Mojokerto tercemar bakteri ecoli. Dari 40 samplling (contoh) yang diambil sebanyak 33 contoh itu atau 82,5 persen dinyatakan positif terkontaminsai ecoli. Plt Kepala Dinkes Kabupaten Mojokerto Siti Asiah mengatakan dari 40 sampling, hanya tujuh sampling yang tidak tercemar bakteri ecoli. “Pengambilan sampling tersebut dilakukan di empat kecamatan yakni

Kecamatan Sooko, Trowulan, Puri dan Mojoanyar,” ungkapnya. Masih kata Asiah, bakteri ecoli muncul dari kotoran manusia. Jika sampai terkonsumsi, bakteri tersebut bisa menyebabkan diare. Diare berkepanjangan, lanjutAsiah,bisamemicudehidrasi,gangguanpertumbuhanhinggakematiandan yang pasti menurunkan produktifitas. “Kita menyarankan agar masyarakat merebus air sebelum dijadikan air minum katena bakteri ecoli mati, minimal air minum harus direbus dan dibiarkan mendidih selama tiga menit. Yang menyebabkan bakteri ecoli

muncul dalam air minum karena terlalu dekatnya jarak sumber air alias sumur dengan pembuangan kotoran,” katanya. Jarak sumur dengan pembuangan kotoran (septitank), lanjut Asiah, minimal 10 meter. Tujuannya agar resapan kotoran tidak merembes ke sumber air minum. Selain kandungan ecoli, air minum rumah tangga yang diuji ternyata juga banyak yang menunjukkan telah tercemar logam berat tapi tidak semua contoh tersebut juga diuji kandungan logam beratnya. “Dari tujuh contoh yang diuji logam berat, hanya ada tiga atau 42,9 persen

yang memenuhi syarat. Sementara sisanya sebanyak empat contoh atau setara dengan 57,1 persen tidak memenuhi syarat. Ini menunjukkan bahwa air minum rumah tangga sudah banyak yang tercemar logam berat,” ujarnya. Sehingga agar aman konsumsi, lanjut Asiah, perlu dilakukan sterilisasi dengan cara diendapkan atau membeli alat pemfilter logam berat yang bisa dipakai untuk air minum. Ini untuk menghindari agar logam berat tidak terkonsumsi lantaran dalam jangka panjang bisa menyebabkan kanker dan kerusakan organ dalam. (bet/nov) FOTO : BM/IST

Nyono Suharli

Sebanyak 9 Ekor Burung yang Dilindungi Disita dari Rumah Warga MOJOKERTO (BM) - Resort KonservasiWilayah 9 Mojokerto mengamankan satwa liar yang dilindung dari salah satu rumah warga di Desa Sajen Kecamatan Pacet Kabupaten Mojokerto, kemarin (18/9). Dari rumah Y (30), tim gabungan mengamankan sejumlah barang bukti satwa liar dilindung dalam keadaan hidup dan diawetkan. Kepala Resort Konservasi Wilayah 9 Mojokerto, Eko Setyo Budi mengatakan, ada empat jenis burung liar dan dilindungi yang diamankan. “Dua ekor burung kakak tua jambul kuning, tiga ekor burung nuri merah kepala hitam, dua ekor burung bayan dan satu ekor burung cendrawasi yang diawetkan,” ungkapnya. Masih kata Ketua tim pemantau dan identifikasi buaya muara di Kali Porong ini, awal mula diamankan sejumlah burung liar dan dilindungi ter-


LANGKA : Burung-burung yang disita dari Y karena satwa yang dilindungi sehingga kasusnya masih dikembangkan terutama dari mana Y mendapatkannya.

sebut dari informasi masyarakat sekitar empat hari lalu. Jika di rumah salah satu warga

tersebut terdapat banyak satwa liar yang dilindungi. “Petugas kemudian mela-

kukan penyelidikan, ternyata benar jika di rumah Y terdapat banyak burung yang dilindungil

Kemudian kita koordinasi dengan Polsek Pacet ke lokasi dan melakukan pengrebekan. Di lokasi, kita amankan empat jenis burung liar dan dilindungi. Barang bukti langsung kita amankan ke kantor,” katanya. Eko menambahkan, pemilik dapat dijerat pasal 21 undangundang Konservasi Sumber Daya Alam dan Ekosistim No 5 Tahun 1990 dengan ancaman 5 tahun penjara. Eko juga menjelaskan jika pihaknya masih melakukan penyelidikan terkait kepemilikan satwa liar dan dilindungi. “Dalam UU disebutkan, satwa liar dilindungi tidak boleh dimiliki, disimpan dan diperjualbelikan baik hidup maupun mati. Untuk satwa liar dilindungi juga masuk ranah kita dan masih melakukan penyelidikan, Y mendapatkan dari mana. Yang jelas empat jenis burung ini habitatnya di Irian Jaya,” katanya. (bet/nov)

Perampokan ADD Senilai Rp 114.8 Juta, Tanggung Jawab Kasun JOMBANG (BM) - Bupati Jombang Nyono Suharli menegaskan kasus kehilangan uang Anggaran Dana Desa (ADD) sebesar Rp 114,8 juta milik Desa Ngrimbi, Kecamatan Bareng akibat dirampok tanggung jawab Kepala Dusun (Kasun) Kopen Desa Ngrimbi Sucipto. Hal ini, Sebab, dia mengambil uang di Bank Jatim Kantor Kas Ngoro tanpa minta pengawalan polisi. “Dia yang harus bertanggungjawab. Selain tidak minta pengawalan polisi, juga tidak memberitahu kepala desanya,” kata Bupati Nyono Suharli, Jumat (18/9). Menurut Bupati Nyono, untuk mengambil uang yang berjumlah cukup banyak lebihlebih milik desa, seharusnya Kasun Sucipto meminta pengawalan polisi. “Saya sudah meminta agar pihak desa saat mengambil dana untuk desa meminta pengawalan polisi, kan gratis. Tapi ini tidak dilakukan. Lebih-lebih, kadesnya juga tidak


diberitahu saat mengambil. Jadi dia harus bertanggung jawab,” kata Nyono. Diberitakan sebelumnya, perampokan bermodus pecah kaca mobil terjadi di Jombang, tepatnya di Desa/Kecamatan Bareng, Kamis (17/9). Kali ini menimpa Sucipto (54), Kepala Dusun Kopen Desa Ngrimbi, Kecamatan Bareng. Dalam perampokan itu, ADD sebesar Rp 114,8 juta amblas digasak perampok. Saat kejadian itu uang baru saja diambil dari Bank Jatim Kantor Kas Ngoro. Selain dana desa, uang pribadi milik Sucipto sebesar Rp 3 juta juga disikat pelaku. Praktis, kerugian korban total mencapai Rp 117,8 juta lebih. Setelah peristiwa itu, korban melaporkannya ke polsek setempat. “Total yang dirampok sebesar Rp 117.866.000. Rinciannya, uang desa sebesar Rp 114.866.000 dan uang saya pribadi Rp 3 juta,” terang Sucipto kala itu. (syo/nov)

berita metro

Dua Wakil Ketua Dewan Kota Kediri, Belum Bubuhkan Tanda Tangan

Bakal Hambat Pembangunan dan Program Kerja KEDIRI (BM) - Kemungkinan tingginya sisa lebih selisih anggaran (Silpa) pada 2015 ini yang sama seperti tahun sebelumnya, dikabarkan kalangan Pimpinan DPRD Kota Kediri, belum mengajukan Perubahan Anggaran Keuangan (PAK) untuk meminta persetujuan gubernur. Ketua DPRD Kota Kediri Kholifi Yunon menyatakan masih menunggu 2 wakil ketua dewan yang belum membubuhkan tanda tangan. Meski dalam rapat paripurna yang digelar beberapa waktu lalu, 8 fraksi sudah menyatakan menerima dan mengesahkan perubahan tersebut. Padahal, di balik tersendatnya PAK itu, terdapat nasib warga Kota

Kediri, di mana Pemerintah Kota Kediri telah menyusun sejumlah program kerja demi kepentingan masyarakat banyak. Namun kenyataannya, justru terganjal masalah administrasi. Di mana 2 wakil Ketua DPRD Kota Kediri H Wara Reni .S Pramana dan KH O’ing Abdul Muid Shohib, yang hingga berita ini ditulis belum membubuhkan tanda tangan pada berkas PAK, yang seharusnya sudah disampaikan ke Gubernur Jawa Timur hingga batas akhir bulan ini. Sekretaris Daerah Kota Kediri, Budwi Sunu Hermanu membenarkan jika hingga saat ini berkas PAK yang seharusnya disampaikan ke Gubernur belum juga


Kholifi Yunon

terkirim. “Kami sangat berharap dengan telah selesainya proses pengesahan kemudian penyelesaian administrasi untuk kemudian disampaikan ke gubernur,” jelas

mantan Sekkota Mojokerto ini. Terkait permasalahan tersebut, Ketua Badan Kehormatan (BK) DPRD Kota Kediri H. Khamim Sujono belum bisa dikonfirmasi, telepon genggamnya tidak aktif sementara pesan yang dikirim juga tak mendapatkan respon. Meski demikian, sejumlah anggota dewan maupun para Kepala Satuan Kerja Perangkat Daerah (SKPD) di lingkungan PemkotKediri, sangat berharap agar berkas PAK tersebut segera mendapat persetujuan gubernur. “Harapan kami dengan dana PAK itu untuk mendukung program pembangunan dan pembayaran lainnya. Jika ini tidak segera diselesaikan yang pasti

pembangunan terhambat dan sejumlah program kegiatan tidak berjalan sesuai rencana. Sementara yang menjadi pokok adalah gaji para karyawan honorer maupun pihak outsourching tidak bisa terbayarkan,” jelas Kabag Humas Pemkot Kediri Apip Permana, Jumat ( 18/9). Sementara, KH O’ing Abdul Muid Shohib, Wakil Ketua DPRD Kota Kediri, saat dikonfirmasi Berita Metro,malahseolah-olahtidaktahu menahu perihal itu. Saat dihubungi melalui ponselnya yang bersangkutan malah mengaku tidak pernah keluar. “Waduh Maaf, saya kurang tahu menahu perihal itu maklum katrok “ katanya. (bud/nov)

Pembangunan Kios Baru Akan Dilanjutkan di Lokasi Pasar Ngronggo KEDIRI (BM) - Niatan Pemerintah Kota (Pemkot) Kediri akan memberikan izin atas pembangunan kios baru di lokasi pasar Grosir Ngronggo masih memunculkan sejumlah konflik di lingkungan Perusahaan Daerah (PD) pasar Joyoboyo. Usai diwarnai aksi demo yang sempat dilakukan puluhan karyawan harian yang menolak di-PHK, dimungkinkan akan terjadi perombakan direksi dan sejumlah jabatan penting pada badan usaha milik pemerintah daerah ini. Saat dikonfirmasi, H Syaiful Yazin Direktur Utama PD Pasar, Jumat (18/9), menjanjikan akan menggelar dialog dengan sejumlah direksi, staf dan perwakilan pedagang pada Senin (21/9) mendatang. Kondisi itu, dilakukan berdasarkan petunjuk Walikota Kediri Abdullah Abu Bakar. “Kami akan lakukan sesuai saran dan petunjuk Bapak walikota. Kami akan undang direksi, staf karyawan dan perwakilan pedagang untuk diskusi demi langkah ke dePERWAKILAN


DIIZINKAN : Pembangunan kios baru di Pasar Grosir Ngronggo yang berencana akan dilanjutkan kembali dan merubah manajemennya.

pan yang lebih baik,” jelas Yazin. Disisi lain, Walikota Kediri Abdullah Abu Bakar, mengatakan, bahwa dalam pembangunan nanti harus memikirkan dampak

ekonomi dan sosial. Bahwa selama ini, berdasarkan data yang masuk pihak penggelola PD Pasar belum mampu meraup keuntungan untuk disetorkan ke kas daerah.

“Selama ini berdasarkan data kami, belum ada PAD dari PD Pasar yang disetorkan ke kas daerah. Makanya kami minta untuk dilakukan perbaikan

manajemen, perubahan sistem kerja dan lebih utama meningkatkan SDM para staf karyawan di PD Pasar,” kata Walikota Kediri. Mas Abyu panggilan walikota menambahkan, pihak PD Pasar jangan hanya sekadar absen atau mencari keuntungan dari uang karcis. “Termasuk tiap kios saya usulkan agar memasang meteran listrik sendiri-sendiri,” jelas Mas Abu, saat ditemui usai memberangkatkan CJH dari Kota Kediri, waktu lalu. Menurut Mas Abu jika dikelola dengan baik, mulai dari kebersihan yang terjaga setiap karyawan selalu melakukan pelayanan, pemasukan uang dari karcis masuk, restribusi kebersihan dan pengunaan listrik dengan sistem tiap kios memasang meteran, dipastikan akan mampu menambahkan pendapatan daerah dari sektor pasar. “Kami percaya sepenuhnya kepada manajemen PD Pasar untuk mengelola dengan baik dan transparan,” tegasnya. (bud/nov)

sudut Kota tahu

Jukir Dilaporkan Polisi karena Mencium Pipi Wanita KEDIRI (BM) - Sebut saja Aisiyah warga Kelurahan Kampungdalem, Kota Kediri, pagi kemarin (18/9), melapor ke polisi karena menjadi korban perbuatan tidak senonoh yang dilakukan oleh juru parkir (jukir). Ceritanya, saat itu korban sedang berjualan sate dan berhenti di kawasan Alun-Alun Kota Kediri, yang kemudian didatangi Agung, jukir asal Kelurahan Tamanan Kecamatan Mojoroto Kota Kediri. Selanjutnya, dia langsung mencium pipi sebelah kanan korban sebanyak satu kali. Setelah melakukan aksinya, jukir ini bergegas kabur meninggalkan korban. Kaget dab merasa malu, korbanyang tidak tidak terima selanjutnya memilih melapor ke Polresta Kediri. Kasubbag Humas Polresta Kediri AKP Anwar Iskandar mengatakan, pihaknya masih mengumpulkan beberapa saksi guna proses hukum lebih lanjut. (bud/nov)

Anak di Bawah Umur Dilaporkan Dicabuli Tetangganya KEDIRI (BM) - Tidak terima anaknya dicabuli, ASS seorang ibu rumah tangga, warga Kabupaten Kediri melapor ke polisi. Ini lantaran, anak korban masih di bawah umur dan duduk di bangku kelas 1 SD. Kejadian itu bermula, saat ASS hendak menjemput anaknya yang kedua. Betapa kagetnya ia saat memergoki MLS (7), anak pertamanya keluar dari rumah LM (14), warga Desa Kedungdowo Kecamatan Mojo. Kemudian, ASS langsung mengajak pulang anaknya. Sesampainya di rumah, MLS ditanya oleh ibunya kenapa main ke rumah LM. Akan tetapi, MLS malah menangis, hingga bercerita bahwa ia diperlakukan tak senonoh. Atas kejadian tersebut, ASS memilih melapor Polresta Kediri. Kasubag Humas Polres Kediri Kota AKP Anwar Iskandar mengatakan bahwa pelapor mengatakan anaknya menjadi korban pencabulan. “Kami berkoordinasi degan Unit Perlindungan Perempuan dan Anak untuk nelidik kasusnya,” kata Anwar Iskandar. (bud/nov)

Mojokerto - Jombang: Prayogi Waluyo (koord), Aan Hidayat (Jombang) Iklan/Langganan : 081 134 647 71 I Kediri: Kediri Raya: Budi Arya Iklan/Langganan : 081 335 017 333


berita metro


The Fed Sebut Kenaikan Bisa Oktober, Hasil Survei Malah Desember SAMBUNGAN HALAMAN 1

Tak Ada ... Ini termasuk pengeluaran rumah tangga dan investasi bisnis. Selain itu, pembangunan perumahan juga sedang meningkat, meski ekspor masih lemah. Pasar tenaga kerja juga disebutnya telah menguat sejak pertemuan FOMC Juli. “Kami melihat itu, sehingga saya menekankan, ekonomi AS telah berkinerja baik dan mengesankan kami dengan kecepatan dimanaiamenciptakanlapangan kerja, dan kuatnya permintaan domestik,” kataYellen. Tapi, lanjut dia, The Fed mengakui adanya kekhawatiran dari sejumlah perkembangan termasuk beberapa pengetatan kondisi keuangan global. Dia bahkan menyatakan bahwa The Fed khawatir akan inflasi lemah dan perlambatan perekonomian Tiongkok dan Asia. “Banyak fokus kami pada risiko-risiko seputar Tiongkok, tetapi tidak hanya Tiongkok, negara-negara berkembang secara lebih umum dan bagaimana mereka mungkin berimbas kepada Amerika Serikat,” katanya. “Kami telah melihat arus keluar modal yang signifikan dari negara-negara mereka, tekanan pada nilai tukar mereka dan

kekhawatiran tentang kinerja mereka ke depan,” lanjut dia. Keputusan The Fed menahan suku bunga, dinilai banyak pihak akan memperlama masa ketidakpastian bagi para investor keuangan dunia. Bahkan Menko Perekonomian, Darmin Nasution menilai penundaan ini sama dengan menunda masalah. “Positifnya ya, tidak ada gejolak. Tetapi ini menunda persoalan,” jelas Darmin di kantor Presiden, Jakarta, Jumat (18/9). Menurut Darmin, seandainya The Fed menaikkan suku bunga, maka akan timbul gejolak di pasar keuangan. Namun gejolak diperkirakan hanya sebentar, dan masing-masing negara bisa kembali menata fundamental ekonominya. Dengan penundaan The Fed rate, Darmin mengingatkan masih akan timbul spekulasi di pasar keuangan dunia. Hal itu utamanya ketika FOMC akan menggelar rapat. “Dia (The Fed) tidak naikkan (suku bunga), tidak ada gejolak. Tapi spekulasi akan datang lagi nanti, menjelang ada lagi rapat FOMC,” kata Darmin. Dia kemudian sedikit mengulas latar belakang penundaan kenaikan The Fed rate tersebut. “The Fed fungsinya ada dua,

menjaga nilai dolar, dan menjaga employment (penyerapan tenaga kerja), kesempatan kerja. Nah, kenapa dia tidak naikkan, angka employment-nya belum bagus. Kalau bagus, sudah dia naikkan,” ujarnya. Selain itu, AS juga masih memiliki kerentanan dari sisi inflasi. Kemudian, dolar AS yang menguat terlalu tajam terhadap banyak mata uang juga mempengaruhi ekspor, sehingga berimbas pada pertumbuhan ekonomi. “Kalau dia naikkan, perbaikan yang terjadi di sana, bisa balik tidak bagus,” tegas Darmin. Jadi, lanjut Darmin, keputusan The Fed ini bukanlah hadiah yang bisa dinikmati Indonesia. “Dia bukan spare (memberi) waktu, tapi tidak bisa naikkan. Ini bukan hadiah yang bisa kita nikmati. Kenapa dia tidak naikkan? Karena dia anggap rugi kalau dinaikkan,” tegas Darmin. Gubernur BI Agus Martowardojo mengakui, sebelumnya banyak pihak berharap The Fed menaikkan suku bunga, agar ketidakpastian setahun ini bisa berakhir. Namun,The Fed malah menunda kenaikan suku bunga. Agus menyebut bahwa statement kebijakan The Fed kemarin disimpulkan dovish. “Berdasarkan data dependent mereka, akhirnya diputuskan

suku bunga tidak dinaikkan. Statement-nya disimpulkan dovish, artinya kecenderungan menaikkan bunga tidak tinggi,” kata Agus di Kantor Pusat BI, Jakarta, Jumat (18/9). Ini menjadi isyarat bahwa The Fed mengambil tindakan untuk tidak agresif dalam penguatan suku bunga, dan lebih memprioritaskan kemajuan pertumbuhan ekonomi. Dengan demikian, era bunga rendah ini kemungkinan masih akan berlanjut pada pertemuan FOMC.Tapi sampai kapan?Tidak adanya kepastian membuat pendapat para pengamat dan ekonom jadi terpecah. “Jadi ketika mereka putuskan tidak ada penyesuaian, mungkin orangbisamembacabahwabulan depanapakahadaFOMCmeeting tidakbesar(kemungkinankenaikan suku bunga). Bisa-bisa Desember punbelumtentuada,danbisa-bisa sampai2016,”kataAgus. GubernurThe Fed JanetYellen sebenarnya menyebut kemungkinan kenaikan suku bunga pada pertemuan FOMC, Oktober nanti. Namun data ekonomi AS tidak cukup kuat melawan perlambatan ekonomi global, sehingga diragukan bisa mendukungkenaikansukubunga itu. Karenanya, sebagian pihak memprediksi The Fed baru menaikkansukubungapada2016.

EVAKUASI WARGA MALAYSIA Sejumlah warga negara Malaysia berkumpul di Konsulat Malaysia Pekanbaru saat proses evakuasi di Kota Pekanbaru, Riau, Jumat (18/9). Pemerintah Malaysia mengevakuasi sekitar 120 warganya dari Provinsi Riau akibat kondisi darurat pencemaran udara akibat asap kebakaran lahan dan hutan mencapai level berbahaya.

Pelimpahan tahap II, berkas dan tersangka dari Bareskrim Polri menyusul berkas BW (Bambang Widjojanto) sudah dinyatakan lengkap atau P21 terkait kasus kesaksian palsu saat dirinya menjadi kuasa hukum dalam perkara sengketa Pilkada Kotawaringin Barat di Mahkamah Konstitusi (MK) pada 2010. BW dikenai Pasal 242 juncto Pasal 55 KUHP karena diduga mengarahkansaksiRatnaMutiara untuk memberikan kesaksian palsu dalam sidang sengketa Pilkada tersebut. Saat itu BW adalah Kuasa hukum dari Ujang


DPR ... Menurutnya, penyesuaian anggaran yang dibuat oleh lembaga dan kementerian mengacu pada asas kewajaran dan ketersediaan anggaran negara yang ada. “Biasanya disesuaikan dengan laju inflasi sehingga belanja setiap lembaga dan kementerian secara proyek tidak mengalami penurunan nilai ekonominya,” kata Misbakhun di Kompleks Parlemen, Senayan, Jakarta, Jumat (18/9). Misbakhun menegaskan bahwa usulan kenaikan tunjangan anggota DPR RI dalam RAPBN 2016 yang saat ini sedang dibahas merupakan sebuah siklus penyesuaian penyusunan anggaran. Menurutnya, usulan itu disusun oleh Sekretariat Jenderal (Sekjen) DPR yang memang secara kelembagaan mempunyai tugas untuk melakukannya. “Jadi, proses awal penyesuaian tunjangan anggota DPR

tidak datang dari menteri keuangan. Untuk itu adalah tidak tepat apabila kemudian ada pendapat menyalahkan Menkeu terkait isu kenaikan tunjangan anggota DPR karena usulan awal soal itu bukan dari dia,” ucap politisi Partai Golkar ini. Misbakhun menambahkan, sudah menjadi tugas Menkeu untuk menyusun RAPBN setiap tahunnya guna dibahas bersama dengan DPR melalui Badan Anggaran (Banggar) hingga disahkan menjadi APBN. Pembahasan RAPBN itulah yang akan menjadi keputusan bersama pemerintah dan DPR. “Siklus dan proses ini harus dipahami oleh semua pihak supaya pemahaman publik menjadi utuh atas adanya usulan tunjangan anggota DPR saat ini. Jangan sampai kemudian ada pihak yang menyalahkan Menteri Keuangan soal tersebut. Kalau sampai masih ada yang ingin mempersalahkan Menteri

Eksekusi ...

SAMBUNGAN HALAMAN 1 nesia, saya mengucapkan terima kasih atas bantuan dan kerja sama pemerintah Papua Nugini dan semua pihak yang terlibat,” kata Retno. Dalam upaya pembebasan kedua sandera itu, ujar Retno, Indonesia dan Papua Nugini berkomunikasi sangat intentif. Komunikasi dilakukan antara Kemenlu kedua negara, panglima angkatan bersenjata, dan tim lapangan diVanimo. “Presiden RI juga sudah berbicara melalui telepon dengan Perdana Menteri Peter O’Neil,” kata Retno. “Mereka (kedua sandera) dalam keadaan sehat dan sedang berada di KonsulatVanimo.” Meskipun kedua sandera dipastikan selamat, Retno memastikan penyelidikan atas pelaku penyanderaan akan berlanjut. Retno meminta pelaku penculikansegeraditemukandan diproses sesuai hukum yang

berlaku. Info sementara, kata Retno, pelaku penculikan adalah kelompok bersenjata yang terafiliasi dengan kelompok yang menyuarakan tuduhan adanya pelanggaran HAM di Papua. “Kejadian ini justru menunjukkan pada dunia tentang pelanggaran HAM dan tindakan kriminal yang dilakukan oleh kelompok tersebut.” Di sisi lain, pejuang kemerdekaan Papua Jeffrey Pagawak menagih bukti keterlibatannya menyandera dua WNI seperti dituduhkan aparat TNI dan Polri melalui pemberitaan sejumlah media. “Mana bukti negara ini (Indonesia) merupakan negara hukum. Saya minta pemerintah Indonesia buktikan keterlibatan saya menyandera dua orang itu,” kata Jeffrey, menanggapi pembebasan dua sandera. Sebaliknya, Jeffrey menjelaskan, penyandera dua warga Indonesia itu sudah diketahui, yakni Tentara Pembebasan

Nasional Organisasi Papua Merdeka pimpinan Lukas Bomay. Menanggapi pernyataan Retno bahwa pelaku penculikan adalah kelompok bersenjata yang terafiliasi dengan kelompok yang menyuarakan tuduhan adanya pelanggaran HAM di Papua, Jeffrey meminta Retno mengklarifikasi nama pelaku yang dimaksud. Sebab, ujar Jeffrey, semua orang Papua tahu organisasi yang menyuarakan pelanggaran HAM di Papua, seperti Elsham Papua, dan lembaga independen lainnya di dalam Papua maupun di luar negeri. “Kami minta klarifikasi Ibu Menteri,” kata Jeffrey. Menurut dia, cara-cara yang dilakukan Retno yang tidak menjelaskan pelakunya secara terbuka akan berbahaya karena akan mendapat respons banyak dari warga Papua. “Misalnya saya ditangkap, masyarakat Papua akan marah. Kami berjuang dalam jalur diplomasi,” ujar Jeffrey.(tmo/rdl)

Sebelum di-P21, BW Sempat Datangi Bareskrim Berkas ...

Amerika itu jadi salah satu yang ditunggu,” kata Agus. Kondisi ini juga akan berdampak pada nilai tukar rupiah. Di bursa saham Indonesia, pergerakan IHSG juga diperkirakan cenderung fluktuatif, setidaknya hingga akhir tahun nanti karena dibayangi ketidakpastian.TapisebenarnyaThe Fed bukan satu-satunya faktor yangperludiperhatikan.Sebab,aksi BankSentralEropa(ECB)danBank Sentral Tiongkok (PBoC) juga perlumendapatperhatianparainvestor. Contohnya langkah ekstrembanksentralChina(PBoC) mendevaluasi mata uang yuan, hingga membuat pasar global sempat panik. (ant/kon/rtr)

Fraksi Gerindra Minta Menkeu Revisi SK


Jeffrey Minta Nama Baiknya Direhabilitasi Saat tentara tiba di lokasi yang disepakati, kelompok penyandera tak menampakkan diri. Mereka malah masuk ke dalam hutan lebih dalam lagi. Pasukan tentara, kata Arrmanatha, lalu mengejar kelompok yang diduga Organisasi Papua Merdeka (OPM) itu ke dalam hutan. Pengejaran dilakukan terus hingga sore dan malam hari. Akhirnya pukul 19.30WIB kedua sandera dilaporkan telah berada di tangan pasukan tentara PNG. “Mereka berhasil mengambil dua WNI kita dengan tidak melakukan kekerasan yang berlebihan atau minimum force,” kata pria yang akrab disapa Tata itu. Menlu Retno LP Marsudi menyampaikan apresiasi sebesar-besarnya pada pemerintah Papua Nugini yang telah membantu pembebasan dua WNI yang disandera kelompok bersenjata. “Atas nama pemerintah Indo-

kenaikan suku bunga akan dilakukan pada Januari 2016.Tapi berdasarkan survei yang dilakukan RBS, pasar justru meramal kenaikan suku bunga akan dilakukan pada Maret 2016. Atas ketidakpastian itu pula, berbagai kemungkinan bisa melanda dunia, termasuk Indonesia. Sebab, ketidakpastian bisa berdampak pada dana asing yang masuk. Berdasarkan catatan BI, dana asing yang masuk dari JanuariSeptember tahun ini hanya Rp 40 triliun. Angka itu jauh lebih rendah dari periode yang sama tahun lalu senilai Rp 170 triliun. “Ini semua masih menunggu. Karena perkembangan di

Keuangan, maka itu adalah pembentukan opini yang sesat dan pasti mempunyai motif politik di balik itu,” paparnya. Sementara Ketua Fraksi Partai Gerindra, Ahmad Muzani tetap menolak kenaikan tunjangan tersebut. Dia meminta Menkeu merevisi SK. “SK-nya dikaji lagi. Ya kalau SK bisa direvisi, bagus,” katanya. Muzani menilai, sebenarnya wajar jika ada kenaikan tunjangan anggota DPR. Apalagi tunjangan anggaota DPR tidak pernah naik dalam dua periode terakhir. Namun, momentum kenaikan tunjangan ini tidak pas karena bersamaan dengan kondisi ekonomi Indonesia yang tengah melemah. “PHK naik, ekonomi berat, guru demo tanyakan nasib mereka, lalu kita yang jadi pejabat menaikkan tunjangan, tidak pas. Alangkah baiknya ditunda dulu. Berlaku yang lama saja,” katanya. SelainmemintaMenkeuuntuk merevisi SK, Muzani juga menegaskan akan meminta anggota fraksinyauntukmenolakkenaikan tunjangan ini saat pembahasan di Banggar.(kms/rdl)

Kejagung Tengah Fokus Penanganan Kasus Lain


Dua ...

Namunperludiingat,13dari17 pembuat kebijakan The Fed menginginkankenaikansukubunga padatahun2015.“Denganmayoritas pembuatkebijakandiFOMCmasih mengharapkan kenaikan suku bunga tahun ini, dan ekonomi domestik mempertahankan momentum, kami tetap berpegang bahwakenaikansukubunga(akan terjadi) pada Desember,” kata ahli strategidiRabobank,sepertidilansir dariReuters,Jumat(18/9). Dalam survei yang dilakukan CNBC pada sejumlah ekonom dan pengamat pasar modal, 64 persen responden meyakini The Fed akan menaikkan suku bunga pada Desember nanti. Sekitar 17 persen lainnya memprediksi

SAMBUNGAN HALAMAN 1 Iskandar yang kini menjabat sebagaiBupati.BWditangkapdan ditetapkan tersangka oleh penyidik Bareskrim Polri pada Januari 2015. “Sudah P21, tentunya sesuai dengan aturan kita limpahkan tahap kedua, itulah tahap kedua kita limpahkan ke kejaksaan,” kata Direktur Tindak Pidana Ekonomi Khusus Brigjen Bambang Waskito di Bareskrim Mabes Polri kemarin. Dia mengatakan berkas tersebut dilimpahkan ke Kejaksaan Negeri pusat. Senada dengan Jaksa Agung, dia tidak tahu apakah setelah pelimpahan

ini Bambang Wadjojanto akan ditahan atau tidak namun dia menegaskan bola sekarang ada di tangan Kejagung. “Itu semua kewenangan Kejaksaan,” kata dia. Salah satu kuasa hukum BW, Julius Ibrani mengatakan penandatanganan berkas tersebut akan dilakukan bersamasama BW, jaksa penuntut umum dan penyidik di Kejaksaan Negeri Jakarta Pusat, Kemayoran. Dia mengatakan dengan pelimpahan tersebut, maka tanggungjawab hukum kepolisian terhadap kasus Bambang Widjojanto telah selesai. BambangWidjojanto sempat mendatangani Bareskrim Jumat pagi didampingi kuasa hukumnya Abdul Fikar, di situ

polisi menjelaskan maksud dan tujuan dari pelimpahan ke kejaksaan dan seluruh materi pemeriksaan akhir. Setelah itu Bambang Widjojanto langsung menuju ke Kejaksaan Negeri Jakarta Pusat. Kepada media, BW mengatakan siap menerima semua keputusan hukum. BW dinyatakan non-aktif berdasarkan Keputusan Presiden (Keppres) yang dikeluarkan oleh Presiden Joko Widodo karena berdasarkan pasal 32 ayat 2 UU No 30 tahun 2002 tentang KPK menyatakan bahwa “Dalam hal Pimpinan Komisi Pemberantasan Korupsi menjadi tersangka tindak pidana kejahatan, diberhentikan sementara dari jabatannya. (at/epe)

Jaksa agung juga membantah pihaknya menargetkan ada 14 terpidana mati yang bakal dieksekusi di jilid III. “Kami tidak ada target-targetan, mana yang sudah memenuhi syarat segera kami eksekusi,” katanya. Demikian pula terhadap terpidana mati Marry Jane yang lolos dari pelaksanaan eksekusi mati tahap II karena masih menunggu proses hukum kasus perdagangan manusia di Filipina. “Kita tunggu prosedur hukum di Filipina,” katanya. Sepanjang 2015, Kejagung telah melakukan dua kali eksekusi mati, tahap pertama dilakukan pada Januari 2015 dan tahap II pada April 2015. Terpidana mati lainnya yang lolos dari pelaksanaan eksekusi mati tahap II, Sergei Areski Atlaoui melakukan gugatan perlawanan atas putusan Pengadilan Tata Usaha Negara (PTUN) Jakarta yang menolak gugatannya atas Keppres Grasi. Berbeda dengan Kejagung, Kepala Badan Narkotika Nasional (BNN), Komjen Pol Budi Waseso justru mendorong eksekusi mati segera dilakukan. Terutama terhadap bandar

narkoba yang telah dijatuhi vonis. “Saya akan mendorong itu agar tetap terlaksana sesuai apa yang ada di Undang-Undang,” katanya ketika kunjungi Bareskrim Mabes Polri. Buwas mengatakan BNN akan berkoordinasi terkait hal tersebut dengan Kementerian Hukum dan Hak Asasi Manusia terkait desakan ini. Sebagai Kepala BNN baru, Buwas yang tukar tempat dengan Kabareskrim Komjen Pol Anang Iskandar, telah menyiapkan berbagai langkah untuk memberantas penyalahgunaan narkoba di Indonesia. “Bukan gebrakan baru. Tapi ini akan ditingkatkan lagi lah ya. Kita lihat saja nanti,” ucapnya. Mengenai Revisi UU Narkoba yang diusulkan pihaknya beberapa waktu lalu, Budi mengaku itu tak ada kaitannya dengan kedatangannya ke Mabes Polri. Seperti diketahui, beberapa waktu lalu, Budi sempat melemparkan wacana revisi konsep rehabilitasi yang termaktub dalam Pasal 54 Undang-Undang Nomor 35/ 2009. Pasal yang memaparkan

tentang wajibnya pecandu narkotik menjalani rehabilitasi medis dan rehabilitasi sosial itu, kata Budi dikhawatirkan menjadi celah bagi bandar atau pengedar narkoba untuk mengelabui petugas dengan mengaku hanya sebagai pemakai ketika tertangkap tangan. “Tapi itu urusan saya dengan DPR, kami lakukan nanti setelah evaluasi ini selesai. Secepatnya lah, kalau bisa besok ya besok. Pasti nanti dikoordinasikan dengan Kumham. Nah ini semuanya sedang berjalan secara simultan,” tuturnya. Yang jelas, kata Buwas, revisi UU yang diusulkannya akan membenahi secara menyeluruh beberapa persoalan yang krusial dalam pemberantasan narkoba di Indonesia seperti pasal rehabilitasi tersebut. “Rehab itu kan diatur dalam UU, nanti hanya penyempurnaan proses rehab itu yang bagaimana agar efektif. Semua ada perbedaanya, pengguna yang baru, yang lama apalagi yang sudah jadi pecandu itu berbeda. Kalau tidak disempurnakan UU-nya akan merugikan negara karena rehab kan menggunakan uang negara. Jangan uang negara habis hanya untuk itu,” tukas dia. (at/dbs/ epe)

Selidiki Misteri Alam Semesta Diklaim ... Batu berdiameter empat meter ini, ditemukan pekan lalu. Hal ini membuat Vadim Chernobrov, seorang penyelidik paranormal terkenal di Rusia, dan timnya berangkat ke daerah ini, di mana sebelumnya ditemukan batu yang lebih kecil berdiameter 1-2 meter. “Hasilnya cukup kontroversial. Usia batu ini sekitar satu juta tahun. Pemeriksaan akan terus berlanjut. Para pakar UFO berharap untuk terus mencari jejak UFO di wilayahVolgograd,” kata Chernobrov yang kami kutip dari Kosmopoisk didirikan pada tahun 1980 oleh penulis fiksi

SAMBUNGAN HALAMAN 1 ilmiah Rusia, Alexander Kazantsev, insinyur ex-aerospace Mr Chernobrov, dan astronot Georgy Beregovoy, ditujukan untuk menyelidiki misteri alam semesta yang belum terkuak. Namun banyak yang skeptis, jika itu adalah batu biasa yang tergerus oleh erosi. Tapi Scott C Waring, editor harian UFO Sightings tampaknya setuju dengan kelompok ini, yang mengatakan temuannya itu berasal dari luar angkasa.”Terlihat seperti piringan batu yang pernah saya lihat di foto NASA,” tulis Scot Waring di situs UFO Sighting Daily. “Menurut saya UFO ini adalah

drone militer, yang sepertinya rusak dalam sebuah serangan di Mars dan terjatuh ke Bumi,” sambung dia. Menurut UFO Sighting Daily, terdapat beberapa piringan batu yang ditemukan di sekitar Volgograd. Piringan batu itu juga diperkirakan mengandung logam tungsten atau wolfram, yang biasa digunakan dalam teknologi militer. Para pencinta teori konspirasi memperkirakan piringan batu itu berumur sekitar satu juta tahun. Sejumlah pakar memeriksa keseluruhan aspek dari piringan batu itu, yang saat ini berada di museum Zhirnovsky. Lalu bagaimana dengan Anda? Percayakah dengan cerita tersebut. (mtc/vic/dbs/azt)



Polda Jatim Terjunkan 21.143 Personel, Siapkan 32.271 Senpi Wakapolda: Demi Keamanan, Semua Lini Kami Waspadai SURABAYA (BM) – Demi mengamankan Pilkada serentak, Polda Jatim bakal menerjunkan kekuatansebanyak21.143personel. Jumlah itu masih diback-up dengan 6.210 personel TNI dan Linmas 86.949 orang petugas. “Selain itu, kami juga terjunkan kapal 32 unit, 32.271 pucuk senjata api, helikopter 1 unit, 8.418 motor, 2712 mobil,

347 roda enam,” tegas Wakapolda Jatim, Brigjen Pol Eddy Haryanto dalam seminar Pilkada yang digelar PWI Jatim di Surabaya, Jumat (18/9). Untuk anggaran pengamanan Polda telah disiapkan dari Pemda sebesar Rp 64,9 miliar yang sudah fix dan Rp 3,8 miliar tambahan kontijensi (masih proses). Menurut Eddy, ada beberapa potensi gangguan Kamtibmas khusus menjelang Pilkada serentak, yakni isu politis Pilkada Surabaya, ormas fanatik (tidak siap kalah), gunung raung, lumpur Lapindo dan Jatim embrio

SIAP AMANKAN PILKADA: Personel kepolisian siap mengamankan Pilkada serentak di Jawa Timur. FOTO:BM/ANTARA

ISIS. “Jatim embrio ISIS, indikasi hilang 16 WNI, di antaranya 8 orang asal Jatim,” imbuhnya.

Polda juga mewaspdai distribusi logistik seperti di wilayah kepulauan di Sumenep, Ma-

dura. Yakni distribusi terlambat, alat perlangkapan dicuri, bencana alam, sabotase-pengha-

dangan-pengrusakan, palsu dan duplikasi surat suara. “Waspadai juga ada rekayasa DPT dengan pemalsuan data penduduk dan DPT ganda. Jadi semua kami waspadai,” tuturnya. Di tempat yang sama, Pangdam V/Brawijaya Mayjen TNI Sumardi meminta dukungan sinergitas segenap komponen Pemda dan TNI/Polri (tiga pilar), serta termasuk kalangan media dalam menjaga keamanan menghadapi Pilkada serentak. “Ada tiga ancaman, yakni potensi gangguan, ambang gangguan (kerawanan) dan

gangguan nyata,��� ungkapnya. Pangdam juga menjelaskan, permasalahan menonjol saat ini di Jatim yakni adanya radikal kiri dan kanan (aliran garis geras dan konflik Sunni-Syiah di Sampang), demo buruh, kerusuhan pilkada di Jatim, narkoba, kultur barat menggeser kultur lokal dan terorisme/ISIS. Kodam V/Brawijaya telah menyiapkan bantuan satuan kewilayahan memback-up kepolisian. Untuk potensi konflik yakni masa kampanye paling rawan hingga tahapan rekapitulasi suara.(zal/rdl)

Babak Baru Kisruh Pilkada Surabaya Tanggapi Laporan Koalisi Majapahit, Panwaslu Desak KPU RI Beri Penjelasan SURABAYA (BM) – Kisruh Pilkada Surabaya belum berakhir. Terbaru, diperbolehkannya Rasiyo mendaftar kembali yang dipersoalkan Koalisi Majapahit ternyata direspon Panwaslu. Bahkan, pengawas Pemilu di Kota Pahlawan itu mendesak KPU RI agar memberi penjelasan mengenai calon atau pasangan calon yang dinyatakan tidak memenuhi syarat (TMS) namun diizinkan kembali mendaftar. Utamanya terkait PKPU No 12/2015 dan Surat Edaran (SE) KPU RI Nomor 433 yang multitafsir. “Terkait hal ini, kami juga sudah mengirimkan surat ke KPU RI tanggal 15 September. Minimal KPU RI menjelaskan ke kami sebagai balasan surat,” kata Ketua Panwaslu Surabaya, Wahyu Hariyadi, Jumat (18/9). Permohonon penjelasan ini terkait denganlaporanKoalisiMajapahitkePan-


Tindak Lanjut Pawaslu

Menyoal pendaftaran kembali Rasiyo setelah TMS bersama Dhimam Abror.

Kumpulkan bukti-bukti dan melakukan klarifikasi terhadap semua komponen materiil pengajuan sengketa. Baik pelapor, terlapor, saksi dan bukti-bukti yang telah diterima.

Utamanya terkait Pasal 89A PKPU No 12/2015 dan Surat Edaran (SE) KPU RI No 433/KPU/VIII/2015 yang dinilai multitafsir.

waslu Nomor 002/LP/Panwas-SBY/IX/ 2015 yang diterima Senin (14/9) lalu. Sebagi tindak lanjut, Panwaslu mengumpulkan bukti-bukti dan melakukan klarifikasi. Tapi ternyata hal itu belum cukup untuk memutuskan penyelesaian sengketa yang diajukan Koalisi Majapahit. “Makanya KPU RI harus memberikan penjelasan secara tertulis atau datang langsung ke Surabaya,” ujar Wahyu. Menurut Wahyu, sengketa yang diajukan Koalisi Majapahit mengarah

Memanggil Bagiyon (Wakil Sekretaris I DPC Gerindra Surabaya/saksi ahli), Zainal Alim (Wakil Sekretaris II DPC Gerindra Surabaya/saksi), dan komisioner KPU Surabaya.

pada dugaan pelanggaran regulasi KPU RI tentang pembukaan kembali pendaftaran pasangan calon yang multitafsir. Khususnya keputusan KPU Surabaya mengenai pendaftaran Rasiyo, bakal calon walikota yang diusung oleh Partai Demokrat (PD) dan PAN. Regulasi yang dipermasalahkan Koalisi Majapahit yakni keputusan KPU Surabaya yang menetapkan pasangan Rasiyo-Dhimam

Abror tidak memenuhi syarat (TMS) dan tidak bisa didaftarkan kembali oleh parpol sesuai pasal 89A PKPU 12/2015. Sementara dengan SE 433/KPU/VIII/2015 dan setelah KPU Surabaya mendapat pelurusan pemahaman dari KPU RI, maka Rasiyo dinyatakan boleh didaftarkan kembali. “Setelah proses analisa dan kajian kami dalam dua hari ini, kalau diperlukan nanti kami akan

Kesimpulan Usai Proses Analisa: Minta KPU RI memberi penjelasan lewat surat balasan atau datang langsung ke Surabaya.

undang KPU RI untuk memberikan penjelasan,” tegasnya. Klarifikasi Pihak Terkait Sebagaimana proses penanganan sengketa, lanjutWahyu, pihaknya telah memanggil pihak yang bersengketa. Panwaslu juga memanggil dua orang saksi dan komisioner KPU Surabaya sebagai terlapor dalam sengketa. KlarifikasidilakukanKamis(17/9)malam. Panwaslu melakukan klarifikasi terhadap Wakil Sekretaris I DPC

Jelang Penetapan, Risma Berharap Tak Ada yang Aneh SURABAYA (BM) - Pasangan calon (paslon) Pilkada Surabaya akan ditetapkan Kamis (24/9) depan. Bakal calon walikota Tri Rismaharini (Risma) berharap tidak ada hal aneh lagi. “Semoga tidak ada yang aneh,” kata Risma, Jumat (18/9). Keanehan yang dimaksud Risma saat pasangan Dhimam Abror, Haries Purwoko menghilang ketika pendaftaran sehingga pasangan yang diusung Partai Demokrat dan PAN ini gagal mendaftar. Dengan guyonan khas, menurut Risma kejadian aneh tersebut wajib masuk dan tercatat dalam buku rekor dunia. “Iku kudune mlebu Guinnes Book World Record. Gak enek calon ilang pas daftar nek ndunyo. (Ini harusnya masuk Guinness Book World Record. Tidak ada calon hilang saat mendaftar),” ujar sambil FOTO:BM/MADJI tertawa lebar. Tri Rismaharini Risma bersama Whisnu Sakti Buana kembali maju dalam Pilkada Surabaya yang digelar 9 Desember 2015. Saat ini, pasangan petahana tersebut akan ditantang pasangan Rasiyo-Lucy Kurniasari yang diusung Partai Demokrat-PAN. Sebelumnya, Partai Demokrat-PAN sudah dua kali mencalonkan dua pasangan. Yang pertama bakal calon wakil Haries Purwoko menghilang saat pendaftaran. Kedua, saat penetapan Rasiyo-Dhimam Abror dinyatakan tidak memnuhi syarat (TMS). Saat ini, PAN-Demokrat mengajukan Rasiyo-Lucy Kurniasari. Dalam pemeriksaan berkas, hanya Lucy yang berkasnya belum lengkap. Dia harus melengkapi maksimal sampai Sabtu (19/9) hari ini.(sdp/rdl)


MENDAGRI PIMPIN APEL CAMAT SE-INDONESIA MENDAGRI Tjahjo Kumolo (kedua kiri) menginspeksi peserta apel Camat dan Satuan Polisi Pamong Praja (Satpol PP) se-Indonesia di Batam, Kepulauan Riau, Jumat (18/9). Apel kesiapan Camat dan Satpol PP se-Indonesia itu dilaksanakan dalam rangka mendukung suksesnya pelaksanaan Pilkada serentak pada 9 Desember 2015.


Wahyu Hariyadi

Gerindra Surabaya, Bagiyon selaku saksi ahli, serta Zainal Alim Wakil Sekretaris II DPC Gerindra Kota Surabaya sebagai saksi. Sementara dari KPU Surabaya yang menghadiri panggilan yakni Robiyan Arifin (ketua) dan tiga orang komisioner lainnya. Panwaslu melakukan klarifikasi terhadap semua komponen materiil pengajuan sengketa. Baik pelapor, terlapor, saksi, dan bukti-bukti yang telah diterima Panwaslu. Zainal Alim, salah satu saksi yang dipanggil oleh Panwaslu Kota Surabaya mengatakan, proses klarifikasi itu berlangsung kurang lebih satu jam. “Kurang lebih 20 pertanyaan. Pertanyaannya berkaitan pengetahuan tentang proses Pilwali Surabaya, lalu tentang kesaksian tentang pendaftaran Rasiyo-Lucy Kurniasari,” ujarnya. Zainal membeberkan kesaksiannya kepada anggota Panwaslu Surabaya Divisi Hukum dan Penanganan Pelanggaran bahwa dia memang hadir dan menyaksikan sendiri pendaftaran Rasiyo-Lucy yang diterima KPU pada 8 September lalu. Sedangkan Bagiyon, kata Zainal, menjadi saksi ahli terkait kejanggalankejanggalan regulasi perpanjangan pendaftaran paslon berdasarkan SE No 443/KPU/VIII/2015 yang diterbitkan KPURI.SEtersebutyangkemudianmenjadi dasar pembukaan kembali pendaftaran pasangan calon dan menyatakan Rasiyo bisa dicalonkan kembali. Padahal, sebelumnya, KPU Surabaya telah menyatakan sebaliknya, bahwa Rasiyo tidak bisa dicalonkan kembali berdasarkan pasal 89A PKPU 12/2015. Ketika ditanya mengenai pemanggilan ini, Robiyan mengaku biasa-biasa saja dan belum akan berkomentar mengenai hal ini. “Biasa saja, tidak ada komentar,” katanya singkat.(sdp/rdl)

Dari Seminar Pilkada yang Digelar PWI Jawa Timur

Bawaslu Masih Temukan Banyak Pemilih Ganda dan Fiktif Pilkada serentak di Jatim masih terganjal sejumlah persoalan. Selain kerawanan pelaksanaan, data pemilih juga masih bermasalah. FAIZAL ABDILLAH – SURABAYA DARI Pilkada ke Pilkada pemilih ganda selalu jadi masalah, bahkan tak jarang berujung konflik baik di tingkat pelaksanaan maupun gugatan. Mengacu temuan Bawaslu Jatim, untuk Pilkada tahun ini masih terdapat pemilih ganda di beberapa daerah di antaranya Kota Surabaya (806 orang), Si-

tubondo (14.530), Kabupaten Mojokerto (17.592) dan Kabupaten Lamongan (18.626). “Masih ada masalah data pemilih. Di beberapa daerah ditemukan pemilih ganda yang jumlahnyacukupbanyak,”tuturKetua Bawaslu Jatim, Sufyanto dalam seminaryangdigelarPWIJatimsoal Pilkada Serentak di Hotel Inna Simpang,Surabaya,Jumat(18/9). Tak hanya pemilih ganda, lanjut Sufyanto, pemilih fiktif juga masih banyak ditemukan. Di antaranya di Lamongan (6.683 orang) Kabupaten Malang (8.476), Situbondo (33.671) dan Jember (79.607). Sedangkan temuan pemilih meninggal yang direkom Bawaslu untuk dicoret

SEMINAR PILKADA: Para nara sumber dalam seminar Pilkada serentak yang digelar PWI Jatim di Surabaya, Jumat (18/9). FOTO:BM/FAISAL A

yakni 14.907 di Kab Mojokerto, Sumenep (18.282), Situbondo (20.473) dan Jember (46.193). Untuk pemilih yang masih

belum terdaftar dalam Pilkada serentak tahun ini tersebar di Lamongan (10.838 orang), Situbondo (12.792), Mojokerto

(13.239) dan Jember (52.003). Yang menarik, lanjut Sufyanto, ada 10 pemilih bernama Tuhan di Kabupaten Jember dan satu

pemilih bernama Tuhan di Kabupaten Banyuwangi. “Kami tidak bisa persoalkan nama Tuhan itu, biar lembaga keagamaan yang mengurusinya. Tapi kalau memang betul ada nama Tuhan itu di Jember dan Banyuwangi, harus dilayani dengan baik dan harus mendapat hak pilihnya,” katanya. Terkait potensi kerawanan yang terjadi pada Pilkada serentak diyakini bisa diatasi. Menurut Wakil Gubernur Jatim, Saifullah Yusuf (GusIpul) dengan sejumlah personel keamanan yang disiagakandarikepolisiandanTNI cukup untuk meredam potensi ini. “Kalau diukur dari tinggi rendahnya, Pilkada di Jawa Timur

mengarah ke rendah,” katanya. Apalagi, kata Gus Ipul, masyarakatJatimmemilikikesadaran politik yang tinggi sehingga tidak gampang terpancing dengan panasnya suhu politik. “Masyarakat kita ini sudah pinter, tidak mungkin melakukan hal anarkis. Apalagi saat ini kondisi ekonomi sedang lesu,” terangnya. Meski demikian, Gus Ipul tetap meminta penyelenggara Pilkada bersikap profesional untuk meminimalisasi konflik yang berkelanjutan. “Bawaslu dan KPU harus profesional. KPU dan Bawaslu ini ibarat EO (event organizer) Pilkada serentak. Sejauh ini saya melihatnya sudah bekerja profesional,” ujarnya.(*)



Asprov PSSI Jatim


(Piala Presiden 2015)

Menghadang Semangat Pemain Muda MALANG (BM) – Bentrok tim sarat pengalaman melawan tim yang mayoritas berisi pemain muda tersaji dalam leg pertama Babak 8 Besar Piala Presiden 2015. Arema Cronus yang diperkuat pemain-pemain berpengalaman akan menjamu Bali Unted Pusam di Stadion Kanjuruhan, Malang, malam ini (siaran langsung Indosiar, pukul 18:00 WIB). Sudah menjadi hal yang wajib jika tuan rumah Arema ngoto meraih kemenangan pada laga kali ini. Sebab, hasil bagus di kandang akan dimanfaatkan pasukan Singo Edan untuk bisa mendikte permainan Bali United di markas mereka, Stadion Dipta, Gianyar, Bali, pada leg kedua mendatang. Tapi, pelatih Arema Joko Susilo menegaskan timnya tak menargetkan banyak gol saat men-

jamu Bali United. Dia hanya ingin para pemain Arema memaksimalkan laga kandang saat menjamu tim asal Bali tersebut. “Kami tidak mengejar target menang berapa gol untuk mengamankan skor. Karena sesungguhnya menang 1-0 kalau di sana (Bali) kami draw, maka sudah lolos,” katanya dalam sesi jumpa pers jelang pertandingan, Jumat (18/9). Meski mematok hasil menang, namun hal tersebut bukanlah perkara mudah bagi Arema. Itu semua karena kekuatan skuat Indra Sjafrie tak bisa dipandang sebelah mata. Perlu diketahui, skuat yang menghuni Serdadu Tridatu dinilai sebagai salah satu skuat terbaik di turnamen gagasan Mahaka Sports and Entertainment ini. Sementara itu, meski skuad Bali United didominasi pemain

bertemu. Pada ajang Bali Island Cup, kedua tim berbagi hasil imbang. Lalu, pada laga persahabatan di Stadion Kanjuruhan Malang, Bali United sukses mengandaskan tuan rumah. Terakhir, pada ajang Sunrise of Java Cup di Banyuwangi beberapa waktu lalu giliran Arema sukses memetik kemenangan tipis. (dbs/dek)


PENTING MENANG: Menjadi tuan rumah leg pertama Babak 8 Besar Piala Presiden 2015 tidak membuat Arema Cronus menargetkan banyak gol saat jumpa Bali United, malam ini.

muda tidak menjadikan gentar menghadapi Arema. Mereka yakin, skuad muda mereka termotivasi menggoyang kemapanan pemain-pemain bintang Arema. “Semua tahu mayoritas pemain kami adalah pemain muda. Kami tetap siap,” ujar asisten pelatih Bali United Eko Purjianto.

“Tinggal kami motivasi ke pemain bahwa semua yang kita hadapiadalahlawanberat.Intinya, kami siap jelang pertandingan besok (malam ini, red). Kami paham kelebihan dan kekurangan mereka (Arema),” sambungnya. Sebelumnya, dalam berbagai ajang, kedua tim telah tiga kali

AREMA CRONUS I Made Wardana; Jonathan Al Farizie, Fabiano Beltrame, Purwaka Yudhi, Hasim Kipuw; I Gede Sukadana, Juan Revi; Lancine Kone, Samsul Arip, Dendi Santoso; Cristian Gonzales BALI UNITED PUSAM Ngurah Arya; Bobby Satria, Syaeful Anwar, Ricky Fajrin, Endra Permana; Fadil Sausu, Sandi Suta, Hendra Sandi; I Nyoman Sukarja, Sultan Samma, Lerby Eliandry

Gelar Piala Gubernur Jatim kelompok Umur SURABAYA (BM) – Kompetisi sepakbola yang terhenti akibat pembekuan PSSI oleh Kemenpora tidak membuat pembinaan usia muda mandek. Buktinya, Asosiasi Provinsi (Asprov) PSSI Jatim menggelar turnamen kelompok usia bertajuk Piala Gubernur Jatim U-15 dan U-17. Turnamen yang diikuti 77 tim ini rencananya digelar 3-20 Oktober mendatang. Digulirkannnya turnamen Amir Burhannudin ini karena PSSI Jatim tidak ingin pembinaan usia muda terhenti, meski kompetisi profesional mandek. PSSI Jatim tetap berkomitmen untuk menyelenggarakan pembinaan pemain muda. “Sebab bila tidak ada kompetisi, maka benih pesepakbola akan sulit untuk didapatkan,” terang Sekretaris Umum PSSI Jatim mir Burhannudin usai pertemuan dengan klub anggota dan Askab/ Askot di Kantor KONI Jatim, Jumat (18/9). PSSI Jatim berencana menggelar turnamen di 10 kota/ kabupaten di bumi Jer Basuki Mawa Beya ini. Turnamen ini akan diikuti total 77 tim kelompok usia (KU). Masing-masing sebanyak 37 tim KU-15 dan 40 tim KU-17. Selain mencari bibit pesepakbola potensial, PSSI Jatim juga ingin merangkul klub-klub yang sempat mendua. “Kami ingin turut menggairahkan persepakbolaan Tanah Air saat ini, utamanya di Jatim. Apalagi, setelah adanya kesalahpahaman saat terjadi dualisme kompetisi. Bercermin dari itu, kami mencoba membangkitkan semangat tim-tim Jatim dan juga pemerintah agar sadar jika sepakbola tidak akan mati oleh siapapun termasuk melalui politik,” tegas Amir. Rencananya, turnamen ini akan dibuka oleh Wakil Gubernur Jatim SyaifullahYusuf. Total hadiah yang disediakan oleh PSSI Jatim mencapai Rp 65 juta. Amir menyebutkan pihaknya menggunakan format home tournament. “Untuk tempat penyelenggaraan dimana saja akan dibahas lebih lanjut saat technical meeting (TM), Jumat (25/9) mendatang,” ujar pria yang juga berprofesi sebagai pengacara ini. (dek) BM/MADJI


Persebaya United

Kantongi Izin Kepolisian BM/ISTIMEWA

SURABAYA (BM) Persebaya United akhirnya bisa bernafas lega setelah pihak Panitia Pelaksana (Panpel) Pertandingan mengantongi izin dari kepolisian. Alhasil, laga Babak 8 Besar Piala Presiden 2015 antara Persebaya United melawan Sriwijaya FC di Gelora Bung Tomo bisa digelar, Minggu (20/9). Panpel Persebaya telah mengantongi surat izin keramaian dari Polrestabes Rahmad Sumanjaya Surabaya dan Polda Jatim. Surat dari Polrestabes sudah keluar sejak Selasa (15/9) lalu, menyusul dua hari berikutnya, surat izin dari Polda diterima Panpel Persebaya. "Soal perizinan sudah tidak ada masalah. Sekarang kami bisa mengalihkan konsentrasi untuk yang lainnya," jelas Sekretaris Tim Persebaya United Rahmad Sumanjaya, Jumat (18/9). Lancarnya pengurusan izin pertandingan ini pun membuat manajemenPersebayaUnitedlega.Sebab,sejakizinpertandingan antara Persebaya United menghadapi Persiba Balikpapan dicekal oleh kepolisian setempat atas instruksi Kemenpora (26/4) lalu, manajemen Persebaya United sempat khawatir hal itu juga berlaku di pertandingan ini. "Sekarang masyarakat Surabaya bisa melihat pertandingan sepak bola berkualitas lagi. Saya yakin, banyak yang menghendaki Persebaya United tetap tampil di pentas sepak bola nasional," ujar Rahmad. Rahmad meminta semua pihak mendukung kepolisian untuk menciptakan rasa aman dan nyaman di Kota Pahlawan selama pertandingan Piala Presiden berjalan hingga tuntas. Sebab, ini menyangkut nasib Persebaya United dan sepakbola Surabaya sendiri. Persebaya memang bakal sulit mendapatkan izin pertandingan dari kepolisian setempat jika terjadi masalah. "Imbasnya akan luas, bisa-bisa semua izin gelaran pertandingan sepak bola, dari level tertinggi hingga terendah pun bisa tidak keluar. Karena itu, mari kita bersatu demi Persebaya dan Surabaya," seru Rahmad. (dbs/dek)


GANGGUAN ASAP: Skuad Persib Bandung bisa kehabisan nafas jika laga melawan Pusamania Borneo FC diganggu kabut asap.

Asap Mengancam Stamina Persib SAMARINDA (BM) – Persib Bandung memiliki ‘musuh’ baru di perhelatan Babak 8 Besar Piala Presiden 2015. Mereka harus siap dikeroyok Pusamania Borneo FC, suporter tuan rumah dan asap. Ya, asap yang mengganggu sejumlah wilayah di Sumatera dan Kalimantan menjadi

musuh anyar Persib. Stamina penggawa Persib Bandung bisa saja terkuras saat melakoni laga melawan Pusamania Borneo FC (PBFC) di Stadion Segiri, Minggu (20/9). Ini benar-benar terjadi apabila ada kabut asap dalam pertemuan kedua tim.

Hal ini diutarakan oleh dokter tim Persib, Rafi Ghani. Oksigen yang tercemar dan terhirup disebutnya akan berefek karena membuat stamina pemain terkuras dengan cepat. “Pasti ada pengaruh karena mengurangi pengikatan oksigen. Sehingga pemain akan cepat ca-

pek dan lelah,” kata Rafi Ghani. Rafi Gani berharap kabut asap dalambatasnormal.Walaubegitu, ia tetap mencoba mengantisipasi gangguan, terutama sebelum pertandingan.“Antisipasinya pemain kami suruh memakai masker untuk meminimalisir terhirupnya karbon. Kalau memang

perlu dipakai, tapi tidak untuk di pertandingan,” terangnya. “Saya dengar tidak begitu pekat kabut di Kalimantan Timur. Saya yakin apabila kabut asap tebal, panpel melarang pertandingan. Selama di batas aman, tidak masalah,” sambungnya. (dbs/dek)

Uang Hadiah Untuk Bangun Tim NGAWI (BM) – Meski uang hadiah sebagai runner-up Piala Kemerdekaan 2015 belum be-

rada di genggaman, manajemen Persinga Ngawi telah berancang-ancang memanfaatkan


MODAL: Manajemen Persinga Ngawi menunggu hadiah uang runner up Piala Kemerdekaan 2015 sebesar Rp 1 miliar untuk membangun tim ke Divisi Utama versi Tim Transisi.

kocek sebesar Rp 1 miliar untuk proyek strategis. Manajer Persinga Dwi Rianto Djatmiko berencana mengalokasikan hadiah dari Tim Transisi itu guna pembinaan usia muda di internal Persinga dan biaya persiapan tim bila kompetisi Divisi Utama benar-benar diputar pada bulan Oktober atau November mendatang. “Uang Rp 1 miliar bagi kami sebagai tim kecil sangat berarti. Kami harus cermat dan jeli memanfaatkannya. Rencana saya, uang itu akan dipakai pembinaan pemain muda dan persiapan tim ke depan. Dari diskusi dengan teman-teman Tim Transisi, rencananya Oktober atau November akan diputar kompetisi.

Tapi, kami belum tahu konkretnya,” tutur Dwi Rianto Djatmiko. Tim yang dijegal PSMS 2-1 di Final Piala Kemerdekaan lalu, lanjut Antok, sapaan akrab Dwi Rianto Djatmiko, akan tetap dipertahankan. Alasannya, tim asuhan M. Hasan ini telah teruji kemampuannya. “Mulai babak penyisihan, kami hanya sekali kalah di final kemarin. Ini memang sangat menyesakkan. Tapi, dari hasi evaluasi manajemen dan tim pelatih, tim ini layak dipertahankan. Kalau pun ada tambahan pemain baru hanya di posisi tertentu yang selama ini memang lemah. Terutama kami harus mencari pelapis agar kinerja

tim tak pincang, saat ada pemain inti yang absen bertanding,” ujar Antok. Faktor lain yang harus digembleng adalah mental juara. Soal teknis dan kerja sama tim, Antok tak meragukan kemampuan Slamet Hariyadi dkk. “Untuk jadi juara, anak-anak harus punya mental juara, seperti dimiliki para pemain PSMS itu. Meski mereka kalah jumlah pemain dan ketinggalan gol, mental juaranya tetap kuat. Tim tangguh tak hanya soal materi pemain berkelas, tapi tiap pemain harus punya mental juara sehingga ketika dapat tekanan seberat apapun, mereka bisa melaluinya dengan tenang,” ucap Antok. (dbs/dek)

JADWAL PERTANDINGAN PIALA PRESIDEN 2015 PUTARAN PERTAMA SABTU, 19 SEPTEMBER Mitra Kukar v s PSM Makasar (siaran langsung Indosiar, pukul 15:00 WIB) Arema Cronus v s Bali United Pusam (siaran langsung Indosiar, pukul 18:00 WIB) MINGGU, 20 SEPTEMBER Persebaya United v s Sriwijaya FC (siaran langsung Indosiar, pukul 15:00 WIB) Pusamania Borneo FC v s Persib Bandung (siaran langsung Indosiar, pukul 18:00 WIB) PUTARAN KEDUA SABTU, 26 SEPTEMBER PSM Makassar v s Mitra Kukar Persib Bandung v s Pusamania Borneo FC MINGGU, 27 SEPTEMBER Sriwijaya FC v s Persebaya United Bali United v s Arema Cronus


berita metro






(Premier League Inggris)

Saatnya ‘The Blues’ Raih Tiga Poin Usung Misi Kuasai Derby London LONDON (BM) – Chelsea mencoba‘menularkan’ kemenangan telak di Champions League saat digelar‘Derby London’ menjamuArsenal,Sabtu(19/9)malam WIB di Stamford Bridge. Kemenanganakanmenyembuhkan luka The Blues awal pekan ini. Berstatus juara bertahan, secaramengejutkanskuadasuhan JoseMourinhomengawalimusim dengan sangat buruk. Hanya mampumeraihsatukemenangan, sekali seri dan tiga kali kalah merupakan catatan di lima laga awal Premier League musim ini. Hasil itu membuat Chelsea masih terpuruk di posisi 17 dan tertinggal 11 poin dari puncak klasemen, Manchester City. Bagaimana dengan laga melawan Arsenal? Tanpa Pedro Rodriguez dan Willian yang absen karena cedera, Mourinho tampaknya tetap mengandalkan Loic Remy dan Oscar dalam starting eleven, untuk mendukung Diego Costa di lini depan.


Tapi paling menarik untuk dinanti adalah komposisi empat bek Chelsea. Cesar Azpilicueta di bek kanan. Sementara Baba Rahman di bek kiri. Keduanya akan mendukung Gary Cahill

dan Kurt Zouma yang sepertinya akan kembali berduet di jantung pertahanan. Sedangkan tim tamu Arsenal melakukan rotasi besar-besaran. Satu nama yang bakal jadi sorotan adalah Petr Cech. Kiper Arsenal tersebut merupakan mantan ikon Chelsea di posisi

kiper selama satu dekade terakhir. Di lini tengah, nama Francis Coquelin akan kembali bermain sejak awal setelah hanya jadi pemain pengganti di pertandingan terakhir The Gunners. Dia akan ditemani Santi Cazorla untuk menyeimbangkan permainan. Sementara Mesut Ozil, Alexis

ARSENAL (4-2-3-1): Cech; Monreal, Koscielny, Paulista, Bellerin; Coquelin, Cazorla; Ramsey, Ozil, Sanchez; Walcott.

21:00 23:30

19:30 22:00 22:00

01:45 17:30 20:00 20:00 20:00 20:00 20:00 23:00


LIMA LAGA TERAKHIR CHELSEA 17-09-2015 12- 09-2015 29- 08-2015 23- 08-2015 16- 08-2015

Chelsea Everton Chelsea WBA Man City

4–0 3–1 1–2 2–3 3–0

Maccabi TA Chelsea Crystal Palace Chelsea Chelsea

LIMA LAGA TERAKHIR ARSENAL 17-09-2015 12-09-2015 29-08-2015 25-08-2015 16-08-2015

Dinamo Z Arsenal Newcastle Arsenal Crystal Palace

2–1 2–0 0–1 0–0 1–2

Arsenal Stoke City Arsenal Liverpool Arsenal

OPTIMIS: Kemenangan di Champions League menjadikan Chelsea optimis membekuk Arsenal di Premier League Inggris, Sabtu (19/9) malam WIB. Pundipundi gol Fabregas pun siap bertambah.

SABTU (19/9) PKL.23:30 WIB

malam WIB. City sejauh ini masih menunjukkan permainan sempurna di

Premier League. Mereka selalu menang dalam lime pertandingan awal, tanpa pernah kebobolan sekali pun. Tapi kubuWest Ham juga datang ke Etihad dengan motivasi

tinggi. The Hammers sudah mengumpulkan sembilan poin dari lima pertandingan Premier League musim ini. Mereka pun cukup nyaman menempati posisi lima klasemen sementara. Tapi yang lebih memukau, West Ham bisa menang melawan tim kuat macam Arsenal dan Liverpool. Yang terakhir, mereka juga mengalahkan Newcastle akhir pekan lalu.

PRAKIRAAN PEMAIN MAN CITY (4-2-3-1) : Hart; Sagna, Otamendi, Mangala, Kolarov; Toure, Fernandinho; Bruyne, Silva, Sterling; Aguero.


RAJA GOL : Tampilan Sergio Aguero yang tak bersinar di Champions League, bakal terbayar saat Man City menjamu West Ham, Sabtu (19/9) malam WIB. ‘Raja gol’ City pun bakal kembali berkibar.



WEST HAM (4-2-3-1) : Adrian; Jenkinson, Reid, Tomkins, Creswell; Kouyate, Noble; Lanzini, Payet, Moses; Sakho.


Namun Slaven Bilic menghadapi problema besar dengan banyaknya pemain penting yang mengalamicedera.TercatatadaZarate,Song,EnnerValencia, O’Brien dan Ogbonna yangmasihcedera.Selain itu, Jelavic dan Obiang juga belum tentu bisa tampildalamlagananti. Berita bagusnya, West Ham sudah bisa menurunkan Adrian yang sudah menjalani hukuman larangan bertanding tiga kali. Selain itu, Andy Carroll juga sudah bisa bermain meski kemungkinan besar akan turun sebagai pengganti. West Ham akan mencoba memanfaatkansetiapkesalahanyang dibuatolehCity.Sementaraitu,City secara umum masih bisa menurunkan para pemain terbaik mereka, jika memang terpaksa. Diprediksi,lagatetapakandimenangkanCitydenganskor2-0.(dbs/azt)


(Europa League Grup B)

Liverpool Hanya Raih Satu Poin turun minum. Liverpool baru bisa memecah kebuntuan pada menit ke-65 melalui Adam Lallana. Memanfaatkan assist dari Alberto Moreno, Lallana melepaskan tembakan ke sisi kanan gawang Bordeaux. Tim tamu pun unggul 0-1. Memasuki menit ke-81, Bor-

deaux berhasil menyamakan kedudukan menjadi 1-1 melalui Jussie. Pemain Brasil berusia 31 tahun itu mencetak gol melalui tendangan keras yang bolanya tak

mampu dihalau Simon Mignolet. Hingga wasit meniup peluit panjang, skor 1-1 tidak berubah. Sepanjang pertandingan, menurut catatan UEFA, Liverpool

menguasai bola 53 persen dan menciptakan enam tembakan akurat dari 10 usaha. Adapun tim tuan rumah menciptakan enam dari 11 percobaan. (dbs/azt)

SUSUNAN PEMAIN BORDEAUX (4-4-2) : Carrasso; Pallois, Pablo, Poundje, M-Belay; Chantome, Khazri (Jussie 69'), Gajic (Guilbert 86'), Saivet (Poko 76'); Rolan, Crivelli. LIVERPOOL (4-4-2) : Mignolet; Toure (Chirivella 28'), Sakho, Moreno, Gomez; Lallana, Coutinho, Can, Ibe; Rossiter (Brannagan 80'), Origi (Ings 73').

SABTU (19/9) WIB Udinese v s Empoli Live Bein Sport 2 MINGGU (20/9) WIB AC Milan v s Palermo Live Bein Sport 1 Chievo v s Inter Milan Live Bein Sport 1 Atalanta v s Hellas Verona Bologna v s Frosinone Genoa v s Juventus Live Bein Sport 1 AS Roma v s Sassuolo Live Bein Sport 2 Torino v s Sampdoria Carpi v s Fiorentina SENIN (21/9) WIB Napoli v s Lazio

LA LIGA SPANYOL 21:00 23:15 01:30 03:00 17:00 21:00 23:15

SABTU (19/9) WIB Real Madrid v s Granada Valencia v s Real Betis MINGGU (20/9) WIB Eibar v s Atletico Madrid Real Sociedad v s Espanyol Sevilla v s Celta Vigo Deportivo LC v s Sporting Gijon Villarreal v s Athletic Bilbao SENIN (21/9) WIB Barcelona v s Levante Las Palmas v s Rayo Vallecano

lintas arena

City Sulit Dihadang West Ham LIVE BEIN SPORT 1


01:30 01:30


(Premier League Inggris)

BORDEAUX (BM) – Sempat unggul lebih dulu, Liverpool harus puas hanya membawa pulang satu poin setelah bermain 1-1 dengan Bordeaux, pada matchday pertama Grup B Europa League,di Stade Bordeaux Atlantique, Jumat (18/9) dinihari WIB. Berkat hasil ini, kedua tim berada di urutan kedua klasemen sementara Grup B dengan raihan satu poin. Mereka tertinggal dua angka dari Sion yang berada di posisi puncak setelah menang 2-1 atas Rubin Kazan. Bordeaux dan Liverpool sama-sama bermain saling menyerang. Namun, dari sekian banyak peluang yang diciptakan oleh kedua tim, tidak ada yang berubah menjadi gol. Kedudukan 0-0 pun bertahan hingga




MANCHESTER (BM) – Tuan rumah Manchester City mencoba mempertahankan rekor selalu menang mereka di Premier League, saat menjamuWest Ham di Etihad Stadium, Sabtu (19/9)

21:00 21:00 21:00

SABTU (19/9) WIB Chelsea v s Arsenal Live Indosiar AFC Bournemouth v s Sunderland Aston Villa v s WBA Newcastle v s Watford Live Bein Sport 1 Stoke City v s Leicester City Live Bein Sport 2 Swansea City v s Everton Live Bein Sport 3 Manchester City v s West Ham Live Bein Sport 1 MINGGU (20/9) WIB Tottenham Hotspur v s Crystal Palace Live Bein Sport 3 Liverpool v s Norwich City Live Bein Sport 2 Southampton v s Manchester United Live SCTV


PRAKIRAAN PEMAIN CHELSEA (4-2-3-1): Begovic; Azpilicueta, Zouma, Cahill, Rahman; Matic, Fabregas; Hazard, Oscar, Remy; Costa.

Sanchez dan Aaron Ramsey akan mendapatkan tugas menggempur pertahanan The Blues bersama Theo Walcott. Menarik melihat bagaimana hasil akhir saat dua tim London tersebut bertemu di Stamford Bridge. Laga diprediksi dimenangkan tuan rumah Chelsea dengan skor tipis 1-0. (dbs/azt)



IMBANG: Liverpool memecah kebuntuan pada menit ke-65 melalui gol Adam Lallana. Tapi Bordeaux menyamakan skor 1-1 di menit ke-81 lewat gol Jussie. Kedua tim pun imbang 1-1.


Tommy Sugiarto

Tiga Tunggal Putra Terjungkal SEOUL (BM) – Tiga tunggal putra Indonesia yang bertanding di babak dua Korea Open Super Series 2015 akhirnya harus terhenti setelah dikalahkan lawan mereka, Kamis (17/9). Tommy Sugiarto, Ihsan Maulana Mustofa dan Jonatan Christie sama-sama tak berhasil mengatasi lawannya di lapangan. Tommy menjadi wakil tunggal putra yang pertama menelan kekalahan. Ia dihentikan Kento Momota setelah bertanding tiga gim selama 67 menit, 15-21, 21-14 dan 13-21. “Momota hari ini bermain lebih rapi dan tenang. Dia lebih tahu bagaimana cara merubah permainan dari game pertama dan kedua, dengan gim ketiga,” kata Tommy singkat. Sementara itu, Ihsan juga harus terhenti di tangan pemain Tiongkok, Tian Houwei. Tian masih terlalu tangguh untuk Ihsan, ia merebut kemenangannya dengan 21-17 dan 21-10. “Tian Houwei tipe pemain yang kuat.Tadi di lapangan kerasa banget saya susah menembus pertahanannya. Di otak sudah tahu mau main apa, tapi tadi saya seperti tidak bisa keluar. Saya tidak puas dengan permainan hari ini. Ada banyak evaluasi yg harus saya bawa pulang. Saya harus menaikkan kekuatan fisik saya di lapangan, lebih fokus dan meningkatkan kualitas permainan. Karena kalau di level ini kualitas pemainnya sudah bagus-bagus sekali,” jelas Ihsan panjang lebar. Jonatan yang main terakhir pun belum bisa merebut kemenangannya. Ia kalah dari pemain Jepang, Sho Sasaki, 1521, 21-16 dan 13-21. “Tempo permainan saya kebawa dia yang lambat. Permainan saya jadi susah keluar. Saya sudah berusaha keluar dari permainan dia, tapi tadi sempat berat aja di lapangan, nggak tahu kenapa,” kata Jonatan. Pemain ganda putra Hendra Setiawan/Mohammad Ahsan juga tersingkir pada perempat final Korea Open Super Series 2015 setelah dikalahkan pemain ganda tuan rumah, Kim Gi Jung/Kim Sa Rang, 17-21 dan 15-21. (kcm/azt)


berita metro



Dana Desa Habis untuk Gaji Perangkat Dinilai Sudah Sesuai Prosedur saat Sosialisasi TRENGGALEK (BM) – Kucuran dana desa termin pertama yang dicairkan ke kas 152 desa seKabupaten Trenggalek, pada periode April 2015, seluruhnya terserap habis untuk membayar gaji perangkat desa. Sekretaris Desa Rejowinangun, KecamatanTrenggalek Misroni dan Kepala Desa Karangturi, Kecamatan Munjungan, Puryono mengakui kondisi tersebut ketika dikonfirmasi secara terpisah di Trenggalek, Kamis (17/9). Baik Misroni maupun Puryono

beralasan jika alokasi dana desa untuk honor perangkat sudah sesuai prosedur sebagaimana arahan Badan Perencanaan Pemerintah Desa (Bappemas) setempat. “Penggunaan dana desa untuk siltap (penghasilan tetap) perangkat itu sudah sesuai prosedur sebagaimana arahan saat sosialisasi dana desa yang digelar Bappemas, beberapa saat sebelum pencairan,” kata Misroni. Ia menegaskan alokasi dana desa tersebut tidak sepeserpun yang dialokasikan untuk pos kegiatan

yang tidak sesuai dengan juklak/ juknis (petunjuk pelaksanaan dan petunjuk teknis) program dana desa yang bersumber dari APBN tersebut, karena berisiko melanggar hukum. Serapan dana desa baru akan dialokasikan untuk kegiatan pembangunan fisik seperti infrastruktur dan sarana publik lainnya setelah dana desa cair pada termin kedua yang diperkirakan turun pada periode September-Oktober. “Proses pencairan tahap kedua ini menunggu SPJ (surat pertang-

gungjawaban) tahap pertama serta penetapan APBDes oleh BPD (Badan Permusyawaratan Desa) sebagai persyaratan wajib, selain rekomendasi dari kecamatan,” terangnya. Menurut Misroni, seluruh dana yang diterima tersebut dialokasikan untuk membayar penghasilan tetap perangkat desa selama satu tahun. Rinciannya, gaji kepala desa Rp 2,5 juta per bulan dan delapan perangkat desa yang masing-masing menerima Rp 1,25 juta per bulan. Dua pos itu menyerap anggaran

sebesarRp 150 juta. Kendati masih menyisakan anggaran Rp 150 juta dari dana desa yang diterima, Misroni tak bisa menjelaskan peruntukannya. “Bendahara desa yang tahu detailnya,” kata Misroni. Terkait alokasi dana desa termin kedua untuk pembangunan infrastruktur desa, Misroni mengatakan dana tersebut akan dipergunakan untuk perbaikan jalan desa yang sebagian besar masih berupa semen cor dan sekarang sudah mulai rusak. (ant/azt)

Siapkan Stan Penampungan Pasar Nglames MADIUN (BM) – Dinas Koperasi, Perindustrian, Perdagangan, dan Pariwisata (Diskoperindagpar) Kabupaten Madiun, akan menyediakan stan penampungan bagi pemilik kios di Pasar Nglames yang terbakar beberapa waktu lalu agar dapat digunakan sebagai tempat berjualan. Kepala Bidang Perdagangan Diskoperindagpar Kabupaten Madiun, Agus Sujudi, Jumat (18/9), mengatakan pembangunan ulang kios belum dapat dilakukan karena dana alokasi khusus dinas setempat yang telah dianggarkan hanya diperuntukkan perbaikan los yang ada di dalam Pasar Nglames. “Untuk sementara akan disediakan stan penampungan. Pembangunannya masih menunggu keputusan dari Bupati Madiun,” ujar Agus Sujudi kepada wartawan. Selain masih menunggu keputusan Bupati, pihaknya masih melakukan pendataan pemilik kios yang menjadi korban kebakaran Pasar Nglames pada beberapa hari yang lalu. Sesuai data, terdapat enam kios yang terbakar dalam peristiwa tersebut, yakni kios milik Sunarso, Watini, Katijo, Sukadi, Palupi, dan Yayuk. Ratarata yang terbakar adalah kios buah-buahan dan bahan pokok. Agus menambahkan hasil pendataan akan diserahkan dan dibahas oleh tim bersama Bupati. Diharapkan setelah itu stan penampungan dapat segera dibangun. Menanggapi hal tersebut, Bupati Madiun Muhtarom mengatakan pihaknya masih menungguhasilpenyelidikanPolresMadiundanBPBDsetempat. “Kita masih menunggu hasil penyelidikan Polres Madiun dan BPBD untuk mengetahui apakah kebakaran itu murni bencana atau karena hal lain. Jika tergolong bencana, maka pembangunan kios dapat diambilkan dari dana darurat yang bisa digunakan penanggulangan bencana,” kata Bupati Muhtarom. Sebelumnya, sebanyak enam kios yang ada di Pasar Nglames, Desa Nglames, Kecamatan Madiun, Kabupaten Madiun terbakar pada Rabu (16/9). Tidak ada korban jiwa dalam kejadian tersebut, namun bangunan kios dan seluruh barang dagangan hangus terbakar. (ant/azt)

Kewalahan Layani Permintaan Air Bersih TULUNGAGUNG (BM) – Badan Penanggulangan Bencana Daerah (BPBD) Kabupaten Tulungagung, mengaku kewalahan melayani banyaknya permintaan pengirimanairbersihkedesa-desayangmengalamikrisis airakibatkemaraupanjangselamabeberapabulanterakhir. Menurut keterangan Kepala BPBD Tulungagung Soeroto,Kamis,kendalaterjadipadaketersediaanarmada ditingkatPDAMselakupenyediapasokanairbersihke-11 desa dari empat kecamatan yang ada di daerah tersebut. “Keterbatasan armada menyebabkan suplai air ke desa-desa sasaran tidak bisa cepat, karena harus bergantian,” terangnya. Soeroto mengungkapkan, dalam sebulan terakhir permintaan pengiriman air bersih terus bertambah. Saat ini tercatat ada 11 desa dari empat kecamatan yang sudah meminta bantuan air bersih yakni Desa Kresikan, Desa Pakisrejo, dan Desa Tenggarejo di Kecamatan Tanggunggunung, Desa Besuki, Kecamatan Besuki, Desa Pucanglaban, Kecamatan Pucanglaban, serta Desa Panggungkalak, Panggunguni, Kalidawe, Kaligentong, Sumberdadap, dan Banyuurip yang ada di wilayah Kecamatan Kalidawir. “Tercatat sebanyak 11 desa dari empat kecamatan yang sudah meminta bantuan pengiriman air bersih,” ungkapnya. (ant/azt)

Surplus, Pasokan AirWadukWonorejo


SAPI KERAPAN MENARIK MINAT WISMAN Wisatawan mancanegara (Wisman) mengamati sapi kerapan, di Pamekasan, Jumat (18/9). Kunjungan wisman pada Januari hingga Juli 2015 naik sekitar 2,69 persen dibanding periode yang sama pada 2014. Ini merupakan dampak pemberlakuan Bebas Visa Kunjungan (BVK) bagi 30 negara, serta gencarnya promosi Wonderful Indonesia di 18 negara.



hypnotis & hypnotheraphy 19/05


Hanya 3 jam mampu & kuasai seumur hidup 100%langsung bs di praktekkan &bnyak skali manfaat positif dari hypnotis

Hanya Rp 350 rb Jamin Sangat Bisa TERBUKTI, TERMURAH & 05/05

(Buka Setiap Hari 10.00 - 18.00) JL. Rembang no.7 Sby Hub: 70817307-08574679547-081233726177 Free: Modul, DVD, Sertifikat



TULUNGAGUNG (BM) – Perum Jasa Tirta memastikan pasokan airWadukWonorejo, Kabupaten Tulungagung, hingga pertengahan September 2015 masih surplus lebih dari 5,1 juta meter kubik. “Data kami tanggal 10 September lalu elevasi masih di atas pola. Pasokan air surplus 1,84 mdpl (meter di atas permukaan laut) atau setara dengan 5,1 juta meter kubik,” jelas Kepala Subdivisi (Kasubdiv) ASA II Perum Jasa Tirta I Waduk Wonorejo Kurdianto, Jumat (18/9). Dengan stok air yang masih berlimpah tersebut, ia berani memastikan pasokan untuk kebutuhan air di wilayah Kabupaten Tulungagung mencukupi. TerlebihkewajibanyangdisuplaidariWadukWonorejo untuk irigasi pertanian hanya sekitar 800 hektare di area lahan persawahan wilayah Kecamatan Gondang. Kebutuhan air untuk pertanian di area persawahan lain di wilayah Tulungagung, mulai dari Kecamatan Rejotangan, Ngunut, Sumbergempol, Kalidawir hingga Campurdarat selanjutnya disuplai dari saluran Lodagung yang dialirkan dari Sungai Brantas. “Sejauh ini tidak ada permintaan tambahan pasokan air untuk pertanian ke waduk, karena kebutuhan air irigasi di wilayah Tulungagung bagian timur, barat dan tengah telah dipenuhi melalui aliran Sungai Lodagung.WadukWonorejo hanya memenuhi kebutuhan hilir untuk air baku serta irigasi lokal di Kecamatan Gondang,” jelas Kurdianto. (ant/azt)


Pompa Air Tenaga Surya Solusi Atasi Kekeringan


Untuk memenuhi kebutuhan air pada sistem irigasi dengan pompa air tenaga surya bukan hal mustahil. Sebab, sebagai negara tropis, Indonesia diberikan panas melimpah sepanjang tahun. Walaupun ada musim hujan, pancaran sinar matahahari dipastikan masih akan menembus pelosok sudut negeri ini.

ENERGI MATAHARI: Andrew Joewono menunjukkan pompa air tenaga surya atau hybrid yang mampu mengatasi masalah kekeringan.

Pemanfaatan energi tenaga surya menginspirasi Dosen Jurusan Teknik Elektro Universitas Katolik Widya Mandala Surabaya (UKWMS), Andrew Joewono, menciptakan pompa air tenaga surya untuk mengatasi masalah kekeringan di berbagai daerah di Indonesia. “Kita manfaatkan saja panas matahari yang sudah ada ini untuk perairan sawah di Indonesia,” kata Andrew. Pemanfaatan sinar matahari untuk sistem irigasi di Indonesia dianggap paling murah dibandingkan dengan pompa iri-

gasi genset ataupun BBM. Apalagi, saat ini harga BBM sedang melambung tinggi. Hambatan lain di lapangan yang sering muncul adalah ketiadaan jaringan listrik PLN yang sulit menjangkau daerah persawahan. “Bila menggunakan genset atau BBM petani membutuhkan biaya lebih dari Rp 30 jutaan untuk satu bulan. Tapi, jika menggunakan pompa air tenaga hybrid ini hanya Rp 16 juta sepanjang tahun. Alatnya juga bisa disimpan, sewaktuwaktu bisa dipakai lagi,” papar Andrew.

Untuk mendesain sistem pengadaan air dengan bantuan sinar matahari tersebut, pria kelahiran 11 Oktober 1972 membutuhkan waktu lima bulan lebih. Proses utama yang dilakukan adalah membeli dua panel surya dengan harga Rp 2 jutaan masing-masing panel. Panel surya yang berukuran 1x1 meter yang memiliki kapasitas 100 wp diletakkan tepat dibawah sinar matahari. Dua panel surya itu kemudian dihubungakan secara pararel dengan dua kontroler inverter. Dimana, fungsi kontroler inverter ini untuk memantau dan menstabilkan tenaga yang diserap oleh sinar matahari. Dalam lima jam sistem kerja panel surya diklaim mampu menghasilkan 500 watt peak (Wp) atau 100 Wp per jam dengan tekanan konstan stabil 12 voltase dan 5 ampere. Kemudian, tenaga yang diserap itu

disimpan ke dalam aki yang disambungkan langsung ke pompa air jenis AC (Air Conditioner) yang sudah disambung dengan pipa air dengan capaian panjang hingga 50 meter. “Bila masih ada tenaga matahari, maka kinerja akan dibantu oleh tenaga matahari. Kalau matahari sudah terbenam maka masih ada simpanan tenaga dalam akinya,” jelas bapak satu anak tersebut. Menurut alumnus pasca sarjana teknik telekomunikasi ITS tersebut, kekuatan tenaga surya yang disimpan dalam aki memiliki kemampuan cukup tinggi. Dengan jarak kedalaman hingga setengah km, pompa tenaga surya ini bisa menyuplai 1 liter per detik. “Saya berharap bisa diproduksi massal karena ini sangat membantu sistem pengairan di Indonesia,” pungkasnya. (sdp/dek)

pelaksanaan eksekusi hukuman mati. Menurut Amir, Kejagung masih menunggu putusan yang tetap atau inkracht terhadap terpidana mati yang masih mengajukan grasi atau PK. ”Selama ini kan enggak ada pemajuan dan pemunduran. Kalau yang sudah inkracht pasti harus dilaksanakan, tapi kapannya ya banyak yang harus dipertimbangkan kan,”pungkas Amir.

Tersangka Kasus Alkes Udayana Segera Disidangkan JAKARTA (BM) - Pejabat Pembuat Komitmen (PPK) dalam proyek Alkes Rumah Sakit Khusus Infeksi Universitas Udayana tahun anggaran 2009 dengan tersangka Made Mergawa. Dalam waktu dekat segera disidangkan di Pengadilan Tipikor Bali. Komisi Pemberantasan Korupsi (KPK) telah merampungkan penyidikan kasus dugaan korupsi pengadaan alat kesehatan (Alkes) Rumah Sakit Khusus Infeksi Universitas Udayana tahun anggaran

2009. Hal itu diungkapkan langsung dari tersangka Made Mergawa, usai menjalani pemeriksaan di gedung KPK, Jakarta, Jumat (18/9).“Sudah P21,” ungkap Made, sebelum diangkut ke mobil tahanan KPK. “Sidangnya di Bali. Nggak tahu kapan sidangnya,” jelasnya. Made Meregawa merupakan Kepala Biro Umum dan Keuangan Universitas Udayana. Dalam kasus tersebut, Made dan Marisi Matondang yang merupakan Di-

rektur PT Mahkota Negara (perusahaan pelaksana), diduga telah bekerjasama merekaysa proyek Alkes itu. Lantaran perbuatan kedua orang itu, negara mengalami kerugian sebesar Rp 7 miliar. Made sendiri dijerat dengan Pasal 2 Ayat 1 atau atau Pasal 3 Undang-Undang (UU) Nomor 31 Tahun 1999, sebagaimana diubah dengan UU Nomor 20 Tahun 2001 tentang Pemberantasan Tindak Pidana Korupsi.(nis/dra)

Jatim Urutan 21 Nasional Dapodik SURABAYA (BM) - Kualitas kelengkapan data pokok pendidikan (dapodik) jenjang SMA/SMK di Jatim berada di urutan 21 dari 34 provinsi seIndonesia. Posisi tersebut cukup memperihatinkan mengingat Jatim merupakan salah satu provinsi maju. Berdasar dapodikmen Kementerian Pendidikan dan Kebudayaan (Kemendikbud) kemarin (18/9), peringkat pertama secara nasional diduduki Kalimantan Tengah, selanjutnya Bengkulu, Kalimantan Timur, Daerah Istimewa Aceh, Nusa Tenggara Barat, Daerah Istimewa Yogyakarta. Dikonfirmasi persoalan tersebut, Kepala Dinas Pendidikan (Dindik) Jatim Saiful Rachman menganggap wajar. Sebab, Jatim merupakan provinsi besar dengan jumlah sekolah yang banyak. Tidak bisa dibandingkan dengan provinsi kecil seperti Yogyakarta atau provinsi lainnya. “Jatim itu termasuk provinsi terbesar di Indonesia dan jumlah sekolahnya juga terbanyak. Sangat kompleks urusannya dengan sekolah, jadi itu wajar,” kata Saiful. Sekadar diketahui, kelengkapan data identitas satuan pendidikan Jatim di dapodik SMA/SMK baru sekitar 89,44 persen. Data pendidik dan tenaga pendidikan (PTK) baru masuk 82,73 persen, data peserta didik 69,5 persen, sarana dan prasarana baru 97,85 persen. Jika dipersentasekan rata-rata kualitas elengkapan data untuk Jatim baru 84,86 persen. Mantan Kepala Badan Diklat (Badiklat) Jatim ini menegaskan, pengisian dapodik merupakan hubungan langsung sekolah kepada Kemendikbud.

Namun, Saiful menjelaskan pengelola daerah wajib memberikan pantauan dan sosialisasi. Lambatnya pengisian dapodik, lanjut dia, kemungkinan besar karena sekolah tersebut belum menerima sosialisasi. Utamanya sekolah-sekolah baru yang juga diminta mengisi dapodik. Menurut Saiful, pihaknya tidak akan tinggal diam. Dindik provinsi memiliki peluang untuk membimbing sekolahsekolah supaya mengisi dapodik sampai tuntas. Menurut dia, dengan munculnya ancaman vonis dari Kemendikbud bagi sekolah yang tidak menuntaskan dapodik, dipercaya membuat sekolah lebih greget mengisi dapodik. “Kita tidak boleh menyalahkan sekolah 100 persen untuk masalah ini (kelambatan). Mengisi dapodik itu kewajiban. Sekolah akan kami dorong untuk menuntaskannya,” ujar Saiful. Ancaman Kemendikbud itu antara lain dana bantuan operasional sekolah (BOS) tidak dapat dicairkan, pengajuan program indonesia pintar (PIP) gugur/tidak bisa dicairkan.Pendidik dan tenaga kependidikan (PTK) sekolah tersebut tidak dapat mengikuti uji kompetensi guru (UKG). Lalu, siswa tidak bisa mengikuti ujian nasional (Unas). Dan sekolah yang sudah dihapus dari dapodik tidak bisa menerima bantuan sosial. (sdp/dek)


Kepala Pusat Penerangan Hukum Kejagung, Amir Yanto.

Namun, kata dia, Kejagung belum melakukan eksekusi hukuman mati untuk saat ini, karena Indonesia sedang menghadapi permasalahan ekonomi, sehingga tidak mungkin untuk melaksankan eksekusi hukuman mati saat ini. ”Sekarang muncul masalah ekonomi yang lebih gawat lagi. Jadi fokusnya pada masalah ekonomi yang lebih penting dulu,”jelas Amir. Amir membantah, bila Kejagung menunda pelaksanaan eksekusi hukuman mati. Menurut Amir, Kejagung masih menunggu putusan yang tetap atau inkracht terhadap terpidana mati yang masih mengajukan grasi atau PK. ”Selama ini kan enggak ada pemajuan dan pemunduran. Kalau yang sudah inkracht pasti dilaksanakan, tapi kapannya ya banyak yang harus dipertimbangkan kan,” pungkas Amir. (nat/dra)

HUKUM CAMBUK Tiga terpidana kasus khalwat (zina) dikawal aparat kepolisian, Satpol PP dan Polisi Syariat Islam (wilayathul hisbah) sebelum dilakukan eksekusi hukum cambuk di Masjid Baitusshalihin, Ulee Kareng, Banda Aceh, Aceh, Jumat (18/9). Mahkamah Syariah Kota Banda Aceh menetapkan hukuman cambuk antara dua hingga tujuh kali di depan umum kepada 18 pelanggar Qanun (Peraturan Daerah) tentang khalwat dan qanun tentang meisir (judi).

Buronan Kejari Surabaya Tertangkap di Bali SURABAYA (BM) - Pelarian Ir Muhammad Zahidi (42), akhirnya berhenti ditangan tim Kejari Surabaya. Warga Jl Muding Batu Siangan, Batubidak Kerobokan Kaja Bandung, itu ditangkap setelah 10 bulan menjadi buron. Sebelumnya dia tersandung kasus Pidana Umum yang membuatnya dipidana. Zahidi diketahui sebagai terpidana kasus penipuan yang kerap mangkir saat hendak dieksekusi. Penangkapan atas dirinya bermula dari informasi yang diterima Kasi Pidum Kejari Surabaya, Joko Budi Darmawan, jika Zahidi sedang berada di Bali. Tak ingin buruannya kabur lagi, Joko lalu membentuk tim yang dipimpin jaksa Karmawan. Tim lantas berangkat ke Bali dan melakukan pengintaian selama sehari. Rupanya, Zahidi berada di pulau Dewata untuk mengajukan gugatan cerai di Pengadilan Agama Denpasar. Dari informasi yang dihimpun, Zahidi berhasil dan digelandang ke Surabaya via Bandara Juanda. Tim dan Zahidi tiba di Juanda pukul 13.45 Wib. ”Berhasil diamankan tanpa perlawanan,” ujar Kepala Kejari Surabaya, Didik Farkhan Alisyahdi. Menurut Didik, terpisana sempat dibawa ke Surabaya, Kamis (17/9) untuk menyelesaikan proses administrasi. Tak lama sete-


JAKARTA(BM) - Kejagung belum melakukan eksekusi hukuman mati tahap kedua hingga saat ini, karena Indonesia sedang menghadapi permasalahan ekonomi, sehingga tidak mungkin untuk melaksankan eksekusi hukuman mati saat ini. Namun Kejaksaan Agung (Kejagung) menyambut baik usulan Kepala Badan Narkotika Nasional (BNN) Komjen Budi Waseso (Buwas) yang mendesak Kejagung segera melaksanakan eksekusi hukuman mati bagi para terpidana mati kasus narkotika. ”Ya sangat terima kasih sekali. Kita sambut baik usulannya,” ucap Kepala Pusat Penerangan Hukum Kejagung, Amir Yanto di Kejagung, di Jakarta Selatan, Jumat (18/9). ”Sekarang kan muncul masalah ekonomi yang lebih gawat. Jadi fokusnya pada masalah ekonomi yang lebih penting,”jelas Amir. Amir membantah, bila Kejagung menunda


Tunggu Inkracht, Kejagung Siap Laksanakan Hukuman Mati

BURONAN: Zahidi (kanan) saat digelandang di Bandara Juanda ke Kejari Surabaya

lahnya, Zahidi langsung dijebloskan ke Rutan Klas I Surabaya di Medaeng untuk menjalani pidana selama 1,5 penjara. Didik mengaku keberhasilan penangkapan terhadap buronnya tak lebih berkat koordinasi timnya dan institusi lain. ”Kami

bakal lebih intens memburu buron yang masih berkeliaran di luar sana,” tegas dia. Zahidi tersandung kasus pada 2007 lalu. Oleh majelis hakim Pengadilan Negeri (PN) Surabaya, dia dijatuhi vonis 1 tahun penjara atas tindak pidana penipuan yang dilakukan. Namun terdakwa melakukan upaya hukum banding dan kasasi. Dimana ditingkat Kasasi terdakwa diputus bersalah dan dijatuhi hukuman lebih berat, yakni 18 bulan penjara. Perkara ini berawal pada Kamis 15 Februari 2007 telah melakukan tipu muslihat terhadap korban H Syukur, warga Jl. Jagiran Surabaya, dengan modus transaksi jual beli 1 unit Mobil Toyota Land Cruiser V XL. L 1015 LE warna hijau metalik tahun 2000. Pada saat itu mobil diserahkan melalui saksi, Johan Prasetyo dan Saksi Antonius Ngilo sampai dirumah terdakwa di Jalan Muding Batu Sangiang Kelurahan Kerobokan Kaja, Kecamatan Kuta Bali. Setelah itu, terdakwa menyerahkan cek yang diterbitkan Panin Bank cabang Nusa Dua Bali dengan nomer cek 1300604514 dengan tanggal jatuh tempo 02Februari 2007 senilai Rp 575 juta, namun setelah korban hendak mengambil dana tersebut di bank, ternyata cek tersebut bodong. (arn/dra)


KSAL Belanda Kunjungi Ereveld Angkatan Laut Beri Penghormatan Terakhir untuk Korban Pertempuran Laut Jawa 1942 SURABAYA (BM) - Kepala Staf Angkatan Laut (KSAL) Belanda, Generaal Verkerk, melakukan ziarah ke Makam Kehormatan Belanda Kembang Kuning, Jalan Kembang Kuning, Jumat (18/9). Kedatangan jenderal bintang empat itu setelah mengikuti International Maritime Security Symposium (IMSS) di Jakarta itu disambut hangat Direktur Oorlogsgravenstichting Indonesia atau Yayasan Makam Kehormatan Belanda di

Indonesia, Robert van de Right. Didampingi Kepala Pengawas Makam RM Soekarjono serta beberapa petugas makam, Robert van de Right menerangkan ada tujuh makam Belanda atau ereveld di Indonesia yang dikelola oleh yayasan yang dipimpinnya saat ini. “Antara lain dua ereveld di Jakarta yakni di Menteng Pulo dan Ancol, kemudian dua di Semarang yakni Kalibanteng dan Candi, serta sisanya berada di Leuwigajah Ci-

mahi, dan ereveld Pandu di Bandung,” katanya. Untuk Ereveld Kembang Kuning juga disebut Ereveld “Angkatan Laut”, karena seluruh jasad yang dimakamkan di dalamnya adalah para personel Angkatan Laut maupun Marinir Belanda yang gugur saat terjadi perang di Laut Jawa pada 27 Februari 1942. Selain jasad mereka yang dimakamkan di Makam Kehormatan Belanda ini, pihaknya juga mem-

bangun sebuah monumen yang diberi nama Karel Doorman untuk mengenang mereka utamanya yang gugur saat perang di Laut Jawa itu. “Di sini juga turut dimakamkan para wanita dan anak-anak yang wafat di kamp perang milik tentara Jepang,” kata Robert kepada General Verkerk. Setelah menyimak keterangan dari pimpinan yayasan mengenai sejarah singkat Ereveld Kembang

Kuning, General Verkerk beserta rombongan meletakkan karangan bunga pada salah satu makam, dan melakukan penghormatan terakhir disertai penaburan bunga. Rencananya, setelah kunjungan ke Makam Kembang Kuning itu, orang nomor satu di Angkatan Laut Belanda itu berkunjung ke PT PAL di Kawasan Ujung, Koarmatim, Surabaya, untuk melihat perkembangan proses pembuatan Kapal Patroli Rudal.(at/epe)

Angka Inden Tinggi, Khusus untuk KK Surabaya

Pemkot Ajukan Bangun 78 Rusunawa Lagi SURABAYA (BM) – Ledakan jumlah penduduk terus terjadi, namun tidak dibarengi dengan ketersediaan pemukiman layak huni akibat terbatasnya lahan. Persoalan itu yang kini dihadapi kota Surabaya. Pemukiman vertikal jadi solusi untuk memenuhi kebutuhan tempat tinggal warga, meninggalkan hunian reguler. Pemerintah Kota (Pemkot) Surabaya bahkan sudah ajukan usulan ke Kementerian Pekerjaan Umum untuk proyek pembangunan 78 blok Rumah Susun Sewa (Rusunawa) baru di lahan siap bangun. Ke-78 blok itu tersebar di berbagai wilayah di Surabaya namun yang terbanyak di kawasan timur kota, sebanyak 32 blok. “Usulan ke Kementerian Pusat ini sesuai dengan keinginan ibu walikota agar pembangunan Rusunawa terus bertambah guna mengurangi jumlah warga yang inden (mengantre huni),” kata Kabid Pengelolaan Bangunan dan Tanah Dinas Pengelolaan Bangunan dan Tanah (DPBT) Surabaya Agus Suprio, Jumat (18/9). Terkait syarat bagi warga yang ingin tinggal di Rusunawa, Agus menyebut warga tersebut harus ber-KTP dan ber-KK (Kartu keluarga) Surabaya, lalu anggota keluarganya tidak lebih dari empat orang anak karena ruangannya bertipe 24 C sekaligus demi kenyamanan keluarga yang menghuni Rusunawa tersebut. Selain itu dike-

Sebaran 78 Rusunawa Baru Surabaya Barat :


25 blok

Surabaya Timur:

Bulak Keputih

20 blok 12 blok

Surabaya Selatan:

Dukuh Menanggal Jambangan

6 blok 1 blok

Surabaya Pusat:


4 blok

tahui RT dan RW. “Yang bersangkutan tidak punya tempat tinggal. Ini mutlak. Bila diketahui memiliki tempat tinggal, akan didiskualifikasi. Juga harus berpenghasilan karena nanti membayar listrik dan air,” sambung Agus. Menurut Agus, selain mengajukan usulan pembangunan Rusunawa, Pemkot Surabaya juga telah memastikan sebagian Rusunawa siap dihuni. Rusunawa Romokalisari, misalnya. Rencananya, bangunan lima lantai tersebut akan diresmikan Walikota Tri Rismaharini, Senin 21 September 2015. Sehingga, warga Surabaya yang berada di Kecamatan Tandes dan sekitarnya yang telah mendaftar, dapat menempati Rusunawa Romokalisari. “Untuk tahap awal ini kita lakukan kepehunian empat blok berjumlah 196 unit. Untuk blok lainnyasegeramenyusul.Seninnanti secarasimbolisakandiberikankunci kepada perwakilan kepala keluarga yang akan menempati Rusunawa

Romokalisari,” ujar Agus. Agus menjelaskan, warga yang menempati diutamakan para nelayan dan warga sekitar Romokalisari. Dan itu berdasarkan hasil seleksi terhadap warga yang sudah mendaftar huni ke DPBT sejak 2009 silam. Mereka yang masuk sebagai penghuni tahap awal ini merupakan pendaftar pada 2009 dan 2010. Rinciannya berasal dari Kecamatan Tandes, Sukomanunggal, Benowo dan Kenjeran. “Jadi antrenya sesuai urutan dan kita fokus pada nelayan sekitar Rusunawa,” ujarnya. Secara fisik, Agus menyebut kamar di Rusunawa Romokalisari lebih mirip dengan flat dan juga lebih manusiawi. Ini karena sudah ada ruang tamu, kamar tidur dan dapur plus kamar mandi tertutup. Ini berbeda dengan sebagian Rusun lainnya yang kebanyakan diplot terbuka sehingga kemudian dipetak sendiri oleh penghuninya. Untuk infrastruktur yang ada, selain listrik, PDAM juga sedang proses untuk masuk.

INLINE story Sulitnya mencari hunian murah dan layak membuat banyak kelas menengah memilih menyingkir dari kota kelahirannya. Pembangunan rusunawa dengan fasilitas lengkap dan bertarif murah seperti Rusunawa Romokalisari diharapkan bisa memecahkan persoalan itu. Namun fakta terkadang berbicara lain. Meski sudah diplot murah, karena tingginya peminat, banyak unit rusunawa yang dijual di bawah tangan dengan harga selangit.

“Rusunawa Romokalisari lebih nyaman ditinggali. Kami juga bekerja sama dengan Dinas Kebersihan dan Pertamanan agar sisa tanah yang ada dibuat taman dan taman bermain untuk anak-anak,” ujarnya. Status bangunan Rusunawa tersebut memang masih aset pemerintah pusat, tetapi Pemkot diberi hak untuk pengelolaan dan juga menarik iuran sewa. Biaya


LEBIH LAYAK: Rusunawa Romokalisari yang sudah siap menampung penghuni diklaim lebih layak dibanding unit rusun lainnya. Lahan rusunawa Keputih menggunakan bekas TPA Sukolilo (foto insert).

sewanya pun cukup terjangkau oleh warga. Untuk hunian di lantai II, biaya sewanya Rp 53 ribu rupiah per bulan, di lantai III biaya sewanya Rp 48 ribu rupiah per bulan, di lantai IV biaya sewanya Rp 43 ribu rupiah dan lantai V biaya sewanya Rp 39 ribu rupiah. Untuk lantai I tidak disewakan karena lebih difokuskan pada fasilitas umum. Tetapi ada dua unit untuk warga berkebutuhan khusus. Sesuai Perda, warga yang menghuni Rusunawa tersebut harus membayar tiga kali biaya bulanan sekaligus sebagai uang jaminan.(sdp/epe)

Klaim Kantongi Restu Walikota

Warga Peduli KBS akan Praperadilkan Kapolrestabes


PENJARAHAN KOLEKSI: Terhentinya proses hukum dugaan raibnya ratusan koleksi KBS, dengan penerbitan SP3 oleh Polrestabes Surabaya, memunculkan perseteruan baru.

SURABAYA (BM) -Warga Surabaya Peduli Kebun Binatang Surabaya (KBS) menemui Walikota Tri Rismaharini di ruang kerjanya, Jumat (18/ 9), guna melaporkan terbitnya SP3 (Surat Perintah Penghentian Penyidikan) dari Polrestabes Surabaya soal kasus penjarahan lebih dari 420 satwa KBS. “Iya benar, saya dan pak Trimoelja ditemui ibu Risma di ruang kerjanya,” kata pemerhati Satwa Singky Soewadji. Singky mengatakan jika walikota

merestuiWarga Peduli KBS yang akan menempuh jalur hukum yakni praperadilankan Kapolrestabes Surabaya, Kombes Pol Yan Fitri Halimansyah menyusul terbitnya SP3. Ia menceritakan kronologis perkembangan terkini proses hukum penjarahan satwa KBS yang di SP3 dan rencana praperadilankan Kapolrestabes. Hal sama juga dikatakan Praktisi Hukum, Trimoelja D Soerjad. Ia mengatakan pihaknya akan mengawal

proses hukum secara maksimal demi kebaikan dan kemajuan KBS. Selain itu, lanjut dia, pihaknya sudah mengirim surat keberatan kepada Kapolda Jatim tentang tindakan Kapolrestabes Surabaya yang tidak mau memberikan copy atau salinan SP3 kasus pertukaran satwa KBS tersebut. Hingga kini belum ada kejelasan apakah Kapolda Jatim nantinya berniat membalas surat dari warga peduli KBS itu. (sdp/at/epe)

lintas kota

Perbedaan Idul Adha Menunggu Sikap Pemkot SURABAYA (BM) – Anggota Komisi D DPRD Surabaya, Khusnul Khotimah berharap Pemkot dalam hal ini Dinas Pendidikan segera mengirimkan surat edaran terkait perbedaan Hari Raya Idul Adha. Sesuai ketetapan pemerintah, hari raya kurban jatuh pada 24 September 2015. Namun sebagian warga, terutama dari unsur Muhammadiyah melaksanakan lebih cepat sehari. “Dinas pendidikan sebaiknya segera membuat surat edaran terkait Idul Adha tahun ini yang berbeda,” katanya, Jumat (18/9). Dinas Pendidikan Pemuda dan Olahraga Pemerintah DIYYogyakarta sudah membuat surat edaran yang isinya, demi menjaga toleransi menyikapi perbedaan Idul Adha, sekolah diliburkan pada 23 September. Sedangkan penyembelian hewan kurban di satuan pendidikan dilaksanakan pada 24-26 September. “Kami berharap apa yang dilakukan di Yogyakarta bisa dilaksanakan di Surabaya. Ini untuk menjaga toleransi dalam menyikapi perbedaan hari Idul Adha,” ujarnya. Kepala Dinas Pendidikan Surabaya M. Ikhsan mengatakan pihaknya menunggu petunjuk dari Dinas Pendiidikan Provinsi Jatim. “Kalau sudah ada petunjuknya nanti kita segera menyesuaikan,” katanya. (sdp/at/epe)


Dewan Harap Pjs atau Plt Walikota Bekerja Maksimal MENDEKATI berakhirnya masa jabatanWalikota Surabaya, Tri Rismaharini 28 September 2015, kinerja Pemerintah Kota (Pemkot) disoroti DPRD Surabaya. Pemkot Surabaya, diminta segera bersiap setelah Risma, sapaanTri Rismaharini, meninggalkan kursi jabatannya yang diduduki sejak lima tahun lalu. Ketua Komisi A DPRD Surabaya Herlina Harsono Njoto menjelaskan, setelah Risma tidak lagi berkuasa, Pemkot Surabaya akan dipimpin oleh penjabat sementara (Pjs) walikota atau pelaksana tugas (Plt) walikota. Kepastian siapa yang memimpin Surabaya menunggu surat keputusan (SK) dari menteri dalam negeri (mendagri). Meski Pemkot Surabaya tidak memiliki walikota, namun

kekosongan pinpinan tidak akan terjadi. Semua roda pemerintahan akan dijalankan oleh Pjs atau Plt. Karena itu, Herlina berharap kondisi Surabaya tetap stabil meskipun nanti pucuk pemerintahan dipegang oleh Pjs maupun Plt. Politisi asal Fraksi Demokrat ini memastikan, semua pelayanan publik dan lainnya harus berjalan lancar dan maksimal. Seperti pelayanan terhadap masyarakat, penetapan APBD 2016, dan Pilwali 9 Desember tetap bisa dilaksanakan tepat waktu. “Dalam masa transisi yang kami inginkan birokrat berjalan sesuai aturan dan bersifat profesional,” katanya. Herlina mengatakan, ketika Pemkot Surabaya dikendalikan oleh Pjs atau Plt, maka kewenangannya berbeda dengan wali-

Dalam masa transisi yang kami inginkan birokrat berjalan sesuai aturan dan bersifat profesional,


kota. Pengganti walikota memiliki batasan wewenang dalam menjalankan tugasnya. Meski kewenangannya dibatasi, Pjs dan Plt nantinya tetap

bisa mengambil kebijakan strategis jika memang sangat diperlukan. Hanya saja, Pj atau Plt bisa menjalankan kebijakan strategis jika mendapat perse-


tujuan dari Mendagri. “Jika Mendagri setuju Pjs bisa melakukan mutasi,” tandasnya. Wakil Ketua Komisi A, Adi Sutarwijono menambahkan,

pembatasan kewenangan Pjs maupun Plt itu sesuai pasal 132 (a) Peraturan Pemerintah Nomor 49/2008, tentang Pemilihan, Pengesahan, Pengangkatan, dan Pemberhentian Kepala Daerah danWakil Kepala Daerah. “Empat batasan tersebut harus diperhatikan benar jika memang Mendagri telah menurunkan SK untuk penempatan Pjs,” katanya. Sementara itu, Wakil Ketua DPRD Surabaya Masduki Toha menilai penting kejelasan soal siapa yang bakal menggantikan Tri Rismaharini. Karena itu, Masduki mendesak Mendagri segera memutuskan siapa Pjs walikota. Sebab, saat ini ada agenda penting yang harus dibahas legislatif dengan eksekutif, di antaranya pembahasan PAK 2015 dan APBD 2016.

Politisi asal Fraksi PKB ini mengatakan, kepastian Pjs walikota juga untuk mengantisipasi adanya kekosongan pemerintahan. Masduki mengatakan, seharusnya sudah ada kepastian sebelum jabatan walikota selesai. “Kalau sampai tanggal 28 September Mendagri belum mengeluarkan surat keputusan soal penjabat walikota, maka akan dijabat oleh pelaksana tugas (Plt), yaitu sekretaris kota (sekkota), sambil menunggu pemilihan kepala daerah berlangsung,” terang dia. Dengan adanya kepastian pimpinan balai kota selama masa transisi, jelas Masduki, segala bentuk pelayanan publik maupun program Pemkot Surabaya masih bisa berjalan. Sehingga tidakberdampakmerugikanbagi warga Surabaya. (adv/arn)




Lambannya Realisasi DAK Disorot

Undang Dishub, Dewan Hearing BRT

SIDOARJO (BM) - Lambannya realisasi Dana Alokasi Khusus (DAK) untuk pembangunan fisik Tahun 2014 Dinas Pendidikan (Dindik) Sidoarjo, mendapat perhatian dari Ketua Pusat Advokasi Kebijakan (Pusaka) Sidoarjo, Fatikhul Faizun. Menurut Fathikul, hal itu terjadi karena kurang matangnya perencanaan. Sehingga dampaknya pembangunan fisik untuk puluhan lembaga SD, SMP dan SMA sederajat itu, tak bisa diselesaikan dalam kurun waktu 1 tahun anggaran. ”Meski berdasarkan petunjuk pelaksanaan dan petunjuk teknis tak masalah. Tetapi, kalau realisasi pembangunan fisik sampai dua tahun anggaran itu karena Dindik tidak matang dalam perencanaan,” kata Fathikul Faizun, Jumat (18/9). Selain itu, ia juga meminta bangunan fisik rehab gedung sekolah harus diselesaikan dan dibangun sesuai spesifikasi. Hal ini agar tidak menimbulkan persoalan jika bangunannya tak sesuai spesifikasi. ”Kami minta dilaksanakan sesuai aturan dan bahannya sesuai dengan speknya,” imbuhnya. Diberitakan sebelumnya, DAK Tahun 2014 di Dindik Sidoarjo untuk puluhan SD, SMP dan SMA sederajat baru bisa dicairkan 70 persen. Sisa 30 persen baru akan direalisasikan tahun 2015 ini. (adi/azt)

SIDOARJO (BM) - Rencana pengoperasian kembali Bus Rapid Transit (BRT) Trans Sidoarjo masih bergulir. Kalangan sopir angkot, Jumat (18/9) siang, mengikuti dengar pendapat (hearing) di kantor DPRD Sidoarjo bersama Kepala Dinas Perhubungan (Kadishub) Sidoarjo, Joko Santosa. Dalam hearing tersebut, pengusaha angkutan Joyoboyo-Sidoarjo-Porong (JSP) Junaedi mengatakan, pihaknya tetap menolak BRT. Alasannya akan mematikan mata pencaharian sopir angkot. Junaedi menjelaskan, saat ini penumpang angkot sepi. Apalagi jika nantinya BRT tetap dioperasikan, maka tak menutup kemungkinan angkot akan habis. ”Jangankan untuk makan, setoran masih belum mencukupi. Ditambah lagi ada BRT, mau makan apa kita,” ungkap Junaedi. Bahkan, Junaedi bersama sopir angkot lainnya sepakat, jika BRT tetap dioperasikan, mereka akan menggelar demo besar-besaran. “Uji coba silahkan karena ini bagian dari program pemerintah, tapi kalau tidak memungkinkan, maka kita akan unjuk rasa, antara 1.500 sampai 2.000 sopir angkot di


Sopir Angkot Tetap Tolak Pengoperasian

DENGAR PENDAPAT: Tampak rapat dengar pendapat DPRD Sidoarjo yang membahas Bus Rapid Transit (BRT) Trans Sidoarjo dengan mengundang Kadishub Joko Santosa dansopir angkot.

wilayah Sidoarjo,” jelasnya. Sementara Kadishub Sidoarjo, Joko Santosa mengatakan, Dishub tetap akan mengoperasikan BRT. Alasannya, untuk mengurai kemacetan. Bahkan rencananya, minggu depan BRT diujicobakan selama tiga

bulan. ”Bahasanya bukan kompensasi. Tapi membantu sopir dan pengusaha angkot untuk mendapatkan tambahan penumpang. Nanti kita berikan branding. Kita cari produk produk yang mau bekerja sama. Soal berapa

nilainya kita masih belum tahu,” ujar Joko. Joko juga menjanjikan akan merekrut tenaga tambahan kru BRT dari tenaga angkot. “Bisa sopir atau kernet. Kira-kira kita butuh 20 orang yang nantinya dites untuk masuk ke Damri,” pungkasnya. (adi/azt)


Korban Lumpur Gelar Tasyakuran

SYUKURAN: Bupati Sidoarjo, Saiful Ilah menghadiri syukuran yang digelar korban bencana Lumpur Lapindo dari sejumlah desa di Kecamatan Porong, Sidoarjo, Jumat (18/9).

SIDOARJO (BM) - Ratusan korban bencana Lumpur Lapindo dari sejumlah desa di Kecamatan Porong, Sidoarjo, yang tergabung dalam Sekretariat Gabungan (Setgab) Korban Lumpur Petak Area Terdampak (PAT) menggelar syukuran di Desa Renojoyo, Kecamatan Porong, Sidoarjo, Jumat (18/9). Warga tetap berharap sisa 78 berkas lahan yang belum dicairkan bisa segera terealisasi. ”Kami menggelar acara ini sebagai syukuran. Tetapi, kami harap puluhan berkas lainnya yang belum terselesaikan bisa diselesaikan,” terang Koordinator Setgab Korban Lumpur PAT, Yudo Wintoko warga

RT 04, RW 01, Desa Renokenongo, Kecamatan Porong, Sidoarjo. Acara itu, lanjut Yudo dihadiri perwakilan warga Desa Renokenongo, Siring dan Desa Jatirejo. Ia irinya mengungkapkan bahwa rasa syukur perlu disampaikan lantaran masalah bencana lumpur itu, sudah mencapai 9 tahun terakhir. Dan baru tahun ini bisa terealisasi. Lebih jauh, Yudo menjelaskan ke-78 berkas yang belum terselesaikan pencairannya itu karena ada beberapa masalah. Di antaranya, terganjal masalah ahli waris, pemblokiran karena masalah internal keluarga, status

tanah sengketa dan persoalan lainnya. ”Makanya sekarang warga Renokenongo 600 Kepala Keluarga (KK) ini membuat kampung dan perumahan bersama secara mandiri di Desa Renojoyo di atas 9 hektar lahan agar kami bisa berkumpul lagi bersama warga sekampung,” ujarnya. Bupati Sidoarjo, Saiful Ilah yang datang di akhir acara berjanji berusaha mencari jalan keluar bagi warga terdampak lain yang proses pencairannya belum terselesaikan. ”Kita usahakan nanti semua bisa dicairkan. Termasuk yang 78 berkas itu,” tandasnya. (adi/azt)

Dorong Petani Gunakan Sumur Bor SIDOARJO (BM) - Dinas Pertanian, Perkebunan, dan Peternakan Pemkab Sidoarjo mendorong para petani menggunakan sumur bor untuk memenuhi kebutuhan air saat musim kemarau seperti sekarang ini. Kepala Dinas Pertanian, Perkebungan, dan Peternakan Sidoarjo, Anik Pudji Astutik, Jumat (18/9) mengharapkan dengan adanya sumur bor tersebut maka kebutuhan pasokan air untuk pertanian bisa mencukupi. ”Kami juga telah menyerahkan bantuan dari Kementerian Pertanian berupa mesin pompa guna memudahkan pengairan di areal persawahan di Kabupaten Sidoarjo,” katanya. Ia mengatakan untuk saat ini kebutuhan air di areal persawahan di Kabupaten Sidoarjo bisa dibilang masih bisa dipenuhi. ”Kalaupun toh ada yang kekeringan, kami akan melakukan koordinasi lintas sektoral seperti dengan Dinas Pengairan Kabupaten Sidoarjo untuk membantu para petani,” katanya. Ia berharap, dengan adanya berbagai upaya yang dilakukan tersebut, maka para petani bisa memaksimalkan hasil panen tanaman padi mereka. ”Bahkan saat ini di beberapa wilayah di Kabupaten Sidoarjo sedang dilakukan panen raya. Itu artinya, kondisi di Kabupaten Sidoarjo tidak begitu mengalami kekeringan seperti di daerah lainnya,” katanya. Selain memberikan bantuan mesin pompa, pihaknya juga sudah memberikan bantuan traktor tangan kepada para petani untuk membantu mengolah sawah. (ant/azt)



Kades Gelar Apel Prasasti Cungkrang II


NAIK DELMAN: Membawa replika prasasti Cungrang II panitia berkeliling desa diikuti ribuan peserta kirab yang mendapat sambutan meriah.


UPACARA: Tampak jajaran Kades se-Kec Gempol saat mengikuti apel Prasasti Cungrang II di lapangan Bulusari, Jumat (18/9).

prasasti banyak yang rusak, maka Dr Brandes tidak bisa secara

lengkap membaca prasasti Cungrang ini,” lanjut H Yudono saat

membaca sejarah prasasti Cungrang. (bib/nam/azt)


Resmikan Gedung Packing Mangga

SAMBUTAN: Kepala Desa Oro-oro Ombo Kulon, Kec Rembang, Kab Pasuruan, Hariono saat memberikan sambutan. PERWAKILAN

PASURUAN (BM) - Untuk meningkatkan perekonomian petani mangga dibutuhkan kemasan yang menarik . Tujuannya menarik minat konsumen, serta menjaga kualitas mangga agar tetap terjaga. Dengan pengemasan yang bagus , harga jual mangga pun ikut terdongkrak. Sebagai daerah yang masyarakatnya menggantungkan mata pencarian sebagai petani mangga ,maka diperlukan sarana memadai ,apalagi mangga di daerah tersebut sudah menembus pasar ekspor hingga ke Hongkong, Thailand, Singapura. “Maka saat ini diresmikan

gedung packing mangga di Dusun Watu Lunyu, Desa Oro-oro Ombo Kulon, Kecamatan Rembang, Kabupaten Pasuruan,” kata Kepala Desa Oro-oro Ombo Kulon, Hariono saat memberikan sambutan. Menurut ia, dengan adanya gedung packing maka kemasan mangga yang akan dipasarkan, tampilanya menarik sehingga harga jualnya meningkat. Serta menjaga agar mangga tidak cepat rusak atau membusuk. “Gedung ini semoga dapat dimanfaatkan sebaik-baiknya oleh para petani mangga di desa ini,” pungkas Hariono. (bib/an/ar/azt)


PASURUAN (BM) - Jajaran kepala desa (Kades) se-Kecamatan Gempol serta Muspika mengggelar apel Prasasti Cungrang II di lapangan Bulusari, Jumat (18/9), dipimpin inspektur upacara Camat Gempol, Drs H Moch Ridwan MM. Usai upacara dilanjutkan pembaca sejarah Prasasti Cungkrang II oleh Kades Bulusari H Yudono, yang intinya menceritakan sejarah Prasasti Cungrang II dari data yang diperoleh di Trowulan, Mojokerto. Ada lima lempeng batu bertuliskan A, B, C, D dan E dengan menggunakan bahasa Jawa Kuno. “Ini menceritakan mengenai penetapan daerah Cungrang sebagai daerah Sima atau daerah bebas pajak. Prasasti ini dikeluarkan oleh Sri Maharaja Rakehino Empu Sindok pada 18 september 929 Masehi,” kata Yudono. Lebih lanjut dikatakan Yudono, prasasti Cungrang ini diterjemahkan oleh Dr Brandes yang dimuat dalam Oud-Java se Oorkonden ke aksara Latin. “Namun dengan kondisi huruf


Sejarah Penetapan Daerah Bebas Pajak

PESERTA KIRAB: Asisten I Drs Soeharto MSi bersama Camat Gempol, Moch Ridwan, Kades Bulusari, Yudono saat menyambut kedatangan para peserta kirab.

KPU Kota Mulai Pasang APK PASURUAN (BM) - KPU Kota Pasuruan baru-baru ini telah memasang beberapa alat peraga kampanye (APK), di antaranya di Jl Panglima Sudirman, depan kantor KPU, dan di Jl Dr Wahidin, serta Jalan Raya Pasuruan-Probolinggo. Terkait keterlambatan pemasangan APK, Ketua KPU Kota Pasuruan, Fuad Fatoni mengatakan , pihaknya tidak bisa memasang APK tepat waktu lantaran masih menunggu desain dari Timses Paslon.

Selain itu, proses lelang juga membutuhkan waktu sehingga KPU Kota Pasuruan tidak bisa memasang APK sesuai jadwal, yakni per 27 Agustus 2015. Menurut Fatoni, pihaknya sudah langsung mengirimkan desain yang diterimanya ke perusahaan jasa percetakan yang telah ditunjuk melalui proses lelang tersebut. “Sudah kita kirimkan. Artinya kalau Timses cepat membuat desain, kita ya akan cepat juga,” imbuh Fatoni. (bib/an/azt)

Sidoarjo: Yahdar Balhmar (koord), Syaikul Hadi; Pasuruan Raya: Ah. Habib (koord), Aan Wijayanto; Iklan/Langganan: 0813 3491 7807


berita metro


Wali Siswa Sekolah Negeri Lamongan Resah Banyaknya Pungutan di Sekolah

Komite Sekolah Setali Tiga Uang LAMONGAN (BM) - Maraknya pungutan liar (pungli) yang ditarik pihak sekolah membuat sejumlah wali siswa merasa keberatan dan terbebani. Pungli yang berkedok sumbangan ini dilakukan sebagian besar lembaga pendidikan negeri di Kabupaten Lamongan. Seorang wali murid yang enggan disebut namanyamengatakanbahwaanaknyayangsekolah di salah satu sekolah negeri di Lamongan ditarik iuran sebesar Rp 135.000 per bulan dan pungutan lainnya sebesar Rp. 725.000 setahun. Beban wali siswa bertambah ketika pihak sekolah menarik uang gedung sebesar Rp 3.000.000.“Memangbanyaktarikandisekolahanak saya. Mulai iuran tiap bulan hingga uang gedung. Katanya sekolah negeri gratis tapi kok malah banyak biayanya,” keluhnya, Jumat (18/9). Wali siswa tersebut tidak berdaya untuk menolak tarikan dari pihak sekolah karena kuatir anaknya nanti diperlakukan tidak baik pihak sekolah. Karena itu, dirinya hanya pasrah dan menuruti kemauan pihak sekolah. “Gimana lagi wong keputusan komite sekolah juga begitu. Kalau protes nanti nasib anak saya gimana,”ujarnya. Terkait maraknya pungli di sejumlah sekolah ini menanggapi statemen dari Sun’ah yang menyebutkan bidang teknis dan penggu-

na anggaran adalah Edy Suwito sebagai sekretaris dinas, Kandam sebagai Dikmenumjur dan Kabid TK SD. Sementara itu, Kepala Dinas Pendidikan (Disdik)Lamongan,BambangKustiono,mengatakan bahwa bidang pengguna anggaran tidakhanyaBidangTKSD,BidangDikmenumjur dan PLS saja, Bidang PEP juga termasuk bidang teknis dan pengguna anggaran. “Mestinya tidak harus begitu. Jadi begini, di semuaSatuanKerjaPerangkatDaerah(SKPD) sayatermasukpenggunaanggaran.Ketikaanggaran sangat besar maka butuh orang lain sebagaipenggunaanggaran,”jelasnya. Jadi, tambah Bambang setiap ada pencairan anggaran yang mengurusi adalah Pak Adi. Karena anggaran tersebut ada di sekretariat dan diurusi kepala bidangnya. Bambangmenambahkanbahwaapayang dikatakan Sun’ah Kabid PEP bahwa bidang yang dipimpinnya bukanlah bidang teknis, dianggap Bambang sebagai kurangnya pemahaman Sun’ah terhadap definisi bidang teknis. Bambang juga menampik bahwa lembaga pendidikan yang menarik sumbangan bukanlah pungli. Sumbangan yang diadakan pihak sekolah itu telah mendapat izin Dharma Bakti. Sedangkan sekolah gratis, lanjut

Bambang, dana yang berasal dari pemerintah yang jumlahnya sangat minim dan hanya bisa mencukupi kebutuhan dalam standar minimal. Ditandaskan Bambang, untuk sekolah yang maju yang memiliki program yang banyak tentunya juga memerlukan dana yang besar juga. Anggaran dari pemerintah tidak akan mencukupi untuk melaksanakan programprogram tersebut. Salahsatujalanuntukmenutupikekurangannya adalah dengan menarik dana dari dari wali siswa. “Sekolah dinyatakan gratis itu gratis yang bagaimanadulu.Memangada,danadaripemerintah itu ada tapi kan minim sekali,” imbuhnya. Bambang menambahkan, bahwa setiap sekolah yang maju itu programnya banyak. Kalau tidak dibantu dari sumbangan wali siswa dipastikan tidak bisa jalan. “Maka dari itu dari sumbangan wali siswa itu nantinya program dapat jalan,”jelasnya. Bambang juga menampik lembaga pendidikan yang menarik sumbangan mengambil acuan perda. Sekolah mengajukan sumbangan dengan izin ke Bupati Lamongan dan besarnya sumbangan dikomunikasikan dengan komite sekolah yang merupakan reperesentatif wali siswa. “Bukan perda. Jadi perda itu ada karena perdanya merupakan payung hukum-

nya. Sekolah mengajukan izin ke bupati mengenai sumbangan itu,” tandasnya. Masih kata Bambang, kadang di situ juga terjadi tawar menawar sebelum akhirnya diputuskan dan disepakati dan dibentuk rekanan dan diajukan kepada bupati. Ia mencontohkan SMPN 1 Lamongan di mana sekolah tersebut setiap ruangannya menggunakan AC untuk membentuk sekolah yang nyaman untuk siswanya. “Untuk masuk SMA negeri kalau tidak ada sumbangan, mana bisa SMA 1 dan SMA 2 bisa membangu masjid sebesar itu. Dan gedug sekolah itu apa dibiayai pemerintah seluruhnya, tentu tidak,” tandasnya. Terpisah, Majelis Pembina PMII Kabupaten Lamongan Ispandoyo mnegatakan sumbangan yang diminta lembaga pendidikan yang secara tegas menyebutkan nominal menjadi satu keresahan para wali siswa. Sumbangan tersebut dinilai Ispandoyo keluar dari substansi tentang sumbangan bahkan terkesan pungli atau pemerasan. Sumbangan yang terjadi di sekolahan di Kabupaten Lamongan seharusnya diambil sikap tegas Pemkab Lamongan. Bukan sebaliknya melegalkan sumbangan yang digagas lembaga pendidikan. (han/nun/zen/nov)

Pastikan Tahun Ini, Populasi Hewan Ternak Mencukupi LAMONGAN (BM) - Dinas Peternakan dan Kesehatan (Disnakkes) Hewan Lamongan memastikan populasi ternak di Lamongan mencukupi untuk memenuhi kebutuhan saat hari raya kurban. Disebutkan Kepala Disnakkes Hewan Sukriyah melalui Kabag Humas dan Infokom Sugeng Widodo, Jumat (18/9), bahwa populasi ternak sampai dengan Juli 2015 tercatat sebanyak 100.264 ekor sapi potong. Di antaranya 22 sapi perah, 288 kerbau, 95.847 ekor kambing dan 78.785 ekor domba. Sedangkan jumlah hewan kurban pada 2014 tercatat sebanyak 3.014 ekor sapi dan 25.418 ekor domba.

Sehingga, kebutuhan hewan kurban tahun ini diperkirakan masih bisa dipenuhi dari peternak Kabupaten Lamongan sendiri. Untuk memberikan jaminan kualitas hewan kurban, Disnakkes Hewan akan melakukan pemeriksaan kesehatan H-3 atau pada Selasa ( 22/9). Pmeriksaan itu akan dilakukan di seluruh 27 kecamatan yang ada di Kabupaten Lamongan. Kepada konsumen, dia menyarankan saat pemilihan hewan kurban yang harus diutamakan adalah hewan itu sehat dan cukup umur. Diterangkan, hewan kurban yang cukup umur jenis sapi dan kerbau berumur kurang lebih 22 bulan.

SEHAT DAN CUKUP UMUR : Sejumlah hewan kurban yang akan dikurbankan, Disnakkes Hewan Lamongan meminta masyarakat tak salah pilih dalam membeli ternak tersebut.

Sedangkan kambing dan domba usianya antara 12-18 bulan. “Adapun yang dapat digunakan untuk menge-

tahui umur hewan dengan melihat catatan kelahiran ternak tersebut. Atau jika tidak, bisa dilihat dari gig-

inya,” terangnya. Dijelaskan Sukriyah lebih jauh, Jika gigi susu tanggal 2 buah di depan, itu menandakan hewan tersebut telah berumur sekitar 1218 bulan. Jika sapi maka berumur kurang dari 22 bulan. Sedangkan ciri-ciri hewan kurban yang sehat, yakni dilihat dari fisiknya. Antara lain, pergerakannya yang aktif, bulunya halus dan tidak rontok. Kemudian mata bersinar dan jernih. “Bentuk tubuh standar, hidung terlihat basah bersih dan tidak mengeluarkan cairan, mulut dan gusi bersih tidak ngiler, celah kuku tak terluka, kulitnya lentur dan elastis,” imbuhnya. (nun/han/ zen/nov)

Sehari 2 Laka, Korban Luka-luka dan Tewas LAMONGAN (BM) - Kecelakaan antara truk yang bermuatan air mineral merak cleo dengan dump truk serta sepeda motor terjadi di jalan penghubung Lamongan dan Surabaya. Akibat kecelakaan tepat di Desa Nginjen Pandanpancur Kecamatan Deket Lamongan, Kamis (17/9), itu tak ada korban jiwa hanya mengalami luka-luka. Menurut keterangan saksi yang mengetahui, bermula saat truk bermuatan air mineral cleo bernopol W 9033 YR yang dikemudikan Sukron (23) asal Sukorejo Pasuruan mengalami pecah ban. Sehingga ia harus memarkir di ruas jalan sebelah kanan arah Lamongan. Kemudian sebuah dump tuck nopol W 9366 UD yang dikemudikan Friadi Tri Hudiarto (42), asal Tuban meluncur dari arah belakang. Dan bersamaan dengan itu ada motor nopol W 2883 LR yang dikendari Purnomo (35), asal Desa Medungo Kecamatan Glagah Lamongan. Akibat jarak yang begitu dekat, supir dump truk tersebut tidak sempat menghindari truk yang mengalami pecah ban sehingga menghantam bak sebelah kiri dan menyenggol pengendara motor tersebut. Hantaman keras dump truk membuat truk yang bermuatan air mineral itu terdorong hingga melewati pembatas jalan hingga air mineral tumpah dan menggenangi jalan. Sedangkan dump truk mengalami rusak berat dibagian kanan. Dari kejadian itu sopir truk termasuk pengendara motor mengalami luka-luka dan langsung dilarikan ke Rumah Sakit Muhammadiyah Lamongan. Sementara itu, pada malam harinya kecelakaan juga terjadi. Sukarno (36), asal nganjuk tewas seketika setelah tertabrak sebuah kereta barang di perlintasan kereta api (KA) Desa Deket Kulon Kecamatan Deket Lamongan. Kejadiantersebutbermulasaatkeretabarang dengan nomor Kereta Api 121 dengan masinis Dadang Supriyadi warga Depo Pasar Turi SurabayadanasistenA’ansertaTeknisiGunawan asal Sidoarjo, melintas dari arah timur. Kemudian Sekitar pukul 20.45, saat kereta barang itu melintas tanpa perlintasan Desa Deket ternyata menabrak korban yang saat itu sedang duduk di rel sembari telepon sehingga korban terpental dan seketika di lokasi kejadian. (nun/han/zen/nov).


berita metro

Ketua DPC Apindo Kabupaten Gresik, Perkirakan 7.500-10.000 Buruh di-PHK

Soal UMK, Pemerintah Berpihak ke Buruh GRESIK (BM) - Ketua DPC Asosiasi Pengusaha Indonesia (Apindo) Kabupaten GresikTri Andi Suprihartono memerkirakan akan terjadi Pemutusan Hubungan Kerja (PHK) antara 7.500 sampai 10.000 karyawan di Gresik. Alasannya, selama ini penetapan Upah Minimum Kabupaten (UMK), pemerintah selalu berpihak kepada buruh.“Ada banyak faktor pemicu dari masalah PHK itu. Salah satunya adalah penetapan UMKyang tak pernah berpihak ke pengusaha,” ujar Tri Andhi yang baru terpilih lagi memimpin Apindo Gresik periode 2015-2020, pada Jumat (18/9). Sementara itu, tambah dia UMK Gresik pada 2015 sebesar Rp 2.707.500, hanya selisih Rp 2.500 dengan Surabaya yakni sebesar Rp 2.710.000. “Masak UMK Gresik lebih besar dari UMK Jakarta yang hanya Rp 2,7 juta,” imbuhnya. Akibat tingginya UMK itu, ungkap Tri Andi, setahun terakhir di Gresik

sudah ada PHK sebanyak 4.000 lebih karyawan serta relokasi perusahaan. “PHK besar tersebut terjadi di lima perusahaan padat karya di antaranya Driyorejo dan Kebomas,” ungkap Tri Andhi. Ditambahkan dia, tiga perusahaan di antaranya melakukan relokasi produksi ke luar Gresik.Tiga perusahaan yang relokasi itu adalah perusahaan tekstil Kebomas dengan 1.500 karyawan yang dimiliki dan mem-PHK 1.200 karyawannya. Perusahaanituakhirnyamemindahkan produksinya ke Pekalongan Jawa Tengah. Sedangkan UMK Kota Pekalongan pada 2015 hanya Rp 1.291.000.SedangkanUMKKabupaten Pekalongan hanya Rp 1.271.000 atau masing-masing lebih murah Rp 1.416.500 dan 1.436.500 dibandingkam UMK Gresik. “Wajar saja ke Pekalongan sebab UMK di sana separuh lebih murah dari UMK wlayah Gresik,” ujarnya.

Ditambahkan dia, sebanyak 300 karyawan saja yang mau ikut ke Pekalongan diberi upah sesuai UMK setempat dan masa kerja dihitung nol tahun. “Tentunya ditambahi sedikit bonus untuk karyawan lama,” imbuhnya. Perusahaan kedua yang relokasi di luar Gresik adalah perusahaan tekstil di Driyorejo yang pindah ke Nganjuk. Dari 3000 karyawan yang dimiliki sebanyak 2000 karyawan di-PHK. Cuma seribu karyawan bersedia ikut ke Nganjuk dengan upah sesuai UMK setempat yaitu Rp 1.265.000. Ketiga adalah perusahaan alat pertanian dari Driyorejo pindah ke Lamongan. Meski berbatasan langsung dengan Gresik, UMK 2015 Lamongan hanya Rp 1.410.000. Di perusahaan ini sebanyak 500 karyawan di-PHK dari 1.500 total karyawan yang dimiliki. “Komponen buruh di perusahaan sekarang mencapai 45 persen dari biaya produksi. Agar perusahaan bisa

tetap berjalan maka variabel itu harus dipangkas hingga 30 persen. Caranya dengan merumahkan sejumlah karyawan atau merelokasi,” terangnya. Belum lagi pertumbuhan ekonomi terus melambat. Dari data yang dihimpun, setelah mencapai puncaknya di tahun 2012 pertumbuhan ekonomi Gresik terus melambat. Pertumbuhan ekonomi Gresik pada 2012 sebesar 7,43 persen. Kemudian pada 2013 turun menjadi 7,14 persen, terakhir tahun 2014 hanya 7,03 persen. “Pertumbuhan ekonomi secara nasional juga melambat,” cetusnya. Belum lagi dolar saat ini menurut dia tembus Rp 14.000 lebih per dolar Amerika Serikatnya. Otomatis biaya produksi juga membengkak sementara daya beli masyarakat menurun. “Ini juga bisa jadi pemicu adanya PHK,” imbuh Tri Andhi. (uki/ nov)

Pengerjaan Stadion Gelora Joko Samudro Dikebut GRESIK (BM) - Peresmian Stadion Gelora Joko Samudro yang sebelumnya direncanakan pada Selasa (22/9)

terlihat masih belum sepenuhnya selesai. Alhasil, sejumlah pekerja mau tak mau haris mengebut

TAHAP I : Pengerjaan Stadion Gelora Joko Samudro yang akan diresmikan Bupati Sambari Selasa (22/9), terus dikebut hingga pembangunan tahap I itu kelar.


pengerjaan proyek itu. Bupati Gresik Sambari Halim Radianto, memang memastikan bahwa peresmian stadion milik Pemerintah Kabupaten Gresik yang diberi nama Gelora Joko Samudro di Bukit Lengis JalanVeteran tersebut pada 22 September mendatang. Pihaknya, juga menyadari bahwa pembangunan stadion tersebut belum sepenuhnya sempurna. Karena pembangunan tersebut masih tahap pertama. “Karena masih tahap satu dengan anggaran Rp 280 miliar. Tentu masih ada tahap selanjutnya yang akan menyusul,” kata Sambari. Menurut dia, proses peresmian tahap pertama sudah direncanakan secara matang. Semula peresmian stadion di kawasan Bukit Lengis itu akan diresmikan pada 9 September,

namun mundur. Sementara, Kepala Dinas Pekerjaan Umum Kabupaten Gresik, Bambang Isdianto menyampaikan, proses pembangunan stadion sudah sesuai rencana. Di antaranya pemasangan rumput yang dilakukan secara vertikal. stadion yang berkapasitas 23 ribu tempat duduk itu sebagai implementasi rencana pembangunan jangka menengah daerah (RPJMD) tahun 2011-2015. Stadionyangterlihatseperti‘Damar Kurung’ atau menyerupai lampu lampionitu,banyakmenimbulkanpro dan kontra. Salah satu bentuk protes masyarakat sekitar stadion itu salah satunya karenaamblesnyasebagianareal pemakaman umum (TPU) di sisi timur.Selainitu,drainasesaluranairyang sampaisaatinibelunkunjungdiperbaiki pihakkontraktor.(sgg/uki/nov)

Penadah HP Curian dari Pelaku Pembunuh Karyawan PT Petrokimia Tertangkap GRESIK (BM) - Untuk mengungkap kasus pencurian dengan kekerasan yang mengakibatkan tewasnya Kepala bagian (Kabag), Perencanaan dan pengendalian (Candal), PT Petrokimia Kayaku Yakob Piter Tri Indriyatmoko (54), Polres Gresik bentuk Timsus. Upaya itu untuk memburu pelakunya. Tim I dipimpin langsung Kanit pidana umum (Pidum) Ipda Agung Joko Hariyono. Sedangkan, tim II dibawah komando, Kanit pidana ekonomi (Pidek) Ipda Turkhan Badri. Mereka, mengejar keberadaan tersangka yang diduga sebagai tunggal itu. Dibentukan dua timsus untuk memburu pelaku pencurian disertai pembunuhan dibenarkan oleh Kasatreskrim Polres Gresik AKP Iwan Hari Poerwanto, kemarin (18/9). “Memang benar kami membentuk tim untuk melakukan penyelidikan pelaku pencurian hingga membunuh korbannya,” tegasnya. Dijelaskan, bila pihaknya memang sudah mengantongi ciri-ciri

pelaku.”Dari sejumlah barang bukti dan keterangan sejumlah saksi kami sudah kantongi pelaku. Doakan mudahmudah segera tertangkap “tegasnya. Lebih lanjut Iwan menegaskan, hasil penyelidikan, timsus sudah menemukan barang bukti HP milik korban yang dijual ke salah satu konter di Surabaya.”Penadahnya kami tangkap dan telah ditahan,” tegasnya. Nah dari keterangan penadah itu polisi sudah mengetahui ciri-ciri tersangka. “Tetap kami lakukan pengejaran keberadaan pelaku hingga tertangkap,”tukas mantan Kanit Jatanum Polrestabes Surabaya ini. Seperti diberitakan sebelumnya, diduga memergoki pencuri yang sedang beraksi di rumahnya, Yakob Piter Tri Indiatmoko (54), warga Perum Gresik Kota Baru (GKB), Jalan Bintan 41, Desa Yosowilango, Kecamatan Manyar, tewas ditikam pisau lipat pelakunya pada kejadian (16/9), pukul 03.00 lalu. (uki/nov)

Pasca Pembunuhan, Perumahan Bintan Diportal GRESIK (BM) - Dua hari setelah aksi pencurian berujung pembunuhan terhadap Tri Indriyatmoko (Pak Moko), warga Jalan Bintan Perumahan Gresik Kota Baru (GKB) membentuk tenaga keamanan dan membuat sistem kendaraan keluar masuk menjadi satu pintu, Ju- DITUTUP DAN DIJAGA : Suasana di gang menuju rumah Tri Indriyatmoko, korban yang dibunuh pelaku pencurian mat (18/9). dengan kekerasan yang terjadi di Jalan Bintan. Hasil kesepakatan rapat yaitu mulai awal Oktober 2015 daraan. “Malam hari nanti akan ditutmendatang ada petugas jaga mulai up semua pintu gang-gang, tinggal satu pagi dan malam hari. “Pagi sampai pintu keluar yang bisa dilintasi dan bisa siang satu orang penjaga, malamnya dipantau dari pos satpam,” imbuhnya. dua orang penjaga,” kata Munaswadi, Jumlah iuran yang dikumpulkan warga Jalan Bintan Perumahan GKB. warga Jalan Bintan sudah disepakati Untuk mencegah pengguna jalan besarnya Rp 75.000 untuk membayar berlalu lalang keluar masuk Jalan Bintenaga pengamanan. “Ya nanti kami tan, warga langsung menutup salah satu mencari tenaga kerja petugas keamanpintu portal agar tidak bisa dilintasi kenan,” katanya. (uki/nov)

Lamongan: M. Zainuddin (koord), Thafhanul Fahri Iklan/Langganan: 0857 3233 5005 Gresik: Masduki (koord), Moch. Sugeng Iklan/Langganan: 0821 7997 3350










1,1% FTSE


0,7% KLCI


0,4% DJIA


0,1% NASDAQ 4,894



JUAL (Rp/gr)





BELI (Rp/gr)








JUAL: 14.395,00 BELI : 14.375,00

JUAL: 10.360,21 BELI : 10.330,21

JUAL: 16.517,95 BELI : 16.417,95

JUAL: 10.479,92 BELI : 10.399,92


IDR/USD: 14,371



BPK Terpilih Jadi Auditor Eksternal Badan Nuklir Internasional JAKARTA(BM)-Badan Pemeriksa Keuangan (BPK) RI terpilih menjadi auditor eksternal Badan Internasional

Energi Nuklir (International Atomic Energy Agency/IAEA) untuk periode 2016-2017. Dalam Sidang Umum ke-59

IAEA di Wina, Austria, BPK RI dipilih oleh menjadi auditor eksternal oleh mayoritas negara dari 164 anggota IAEA.

Penutupan Akhir Pekan, Rupiah Menguat

IAEA berfungsi sebagai forum antar-pemerintah untuk kerjasama ilmiah dan teknis dalam penggunaan teknologi nuklir dan tenaga nuklir secara damai di seluruh dunia. Kantor pusat IAEA terletak di Wina, Austria.IAEA berfungsi sebagai forum antar-pemerintah untuk kerjasama ilmiah dan teknis dalam penggunaan teknologi nuklir dan tenaga nuklir secara damai di seluruh dunia. Kantor pusat IAEA terletak di Wina, Austria, dan beranggotakan 164 negara. (nis/dra)

Seiring dengan berkembang pesatnya pertumbuhan ekonomi akan memacu sektor industri akan kebutuhan alat - alat pekerjaan dan mesin pengolah dari skala kecil hingga terbesar untuk membantu meningkatkan produksi lebih banyak di berbagai bidang industri. Karena hal tersebut, dari PT. INTRA MEDIA PROMOSINDO selaku event organizer dengan senang hati menyediakan fasilitas dengan menggelar pameran bertajuk "1st SURABAYA TOOLS & MACHINERY EXPO 2015" di kota Surabaya tanggal 14 - 18 Oktober 2015 di JX International Expo (Jatim Expo) Surabaya Bidang - bidang industri peralatan dan permesinan yang akan di pamerkan seperti dari :Mesin Industri Pertanian,Mesin Industri Perkayuan,Mesin Industri Percetakan,Mesin Industri Perbengkelan, Mesin Industri Metal,Mesin Industri Peralatan,Mesin Industri Kelautan,Mesin Produksi,dan masih banyak lagi lainnya. (*)


MENGUAT: Seorang karyawan menghitung uang pecahan 100 Dollar Amerika di salah satu gerai penukaran valuta asing, Jakarta, kemarin.

dah berada diposisi Rp14.285 per USD. Dimana kisaran perdagangan ada di Rp14.278Rp15.510 per USD. Mengacu Bloomberg, rupiah berada di level Rp14.374,4 per USD, sedang dalam perdagangan berada pada kisaran Rp4.378,7-Rp14.489,3 per USD. Selanjutnya, menurut kurs tengah Bank Indonesia (BI), rupiah berada di posisi Rp14.463 per USD. Menguatnya nilai tukar rupiah pada sesi sore ini dikarenakan pelaku pasar uang yang kembali khawatir karena sen-

timen kedepan masih bervariasi akibat kebijakan the Fed itu. Kepala Riset Monex Investindo Futures, Ariston Tjendra menambahkan ditundanya kenaikan suku bunga the Fed membuat ketidakpastian baru di dalam outlook ekonomi global. Sementara itu, dalam kurs tengah Bank Indonesia (BI) pada Jumat (18/9) mencatat nilai tukar rupiah bergerak melemah menjadi Rp14.395 dibandingkan sebelumnya diposisi Rp14.460 per dolar AS.(nat/dra)

Imbas Perlambatan Pertumbuhan, Penjualan Semen Jadi Stagnan SURABAYA(BM)-Kondisi perekonomian nasional yang masih labil, berimbas pada kebutuhan masyarakat khususnya di sektor properti seperti pembangunan perumahan, hotel dan apartamen yang bahan bakunya menggunakan semen. Tercatat pasar semen domestik mengalami penurunan 5% menjadi 28.7 juta ton pada semester pertama tahun ini. Menyiasati hal itu, pemerintah memberi kebijakan untuk menurunkan harga semen BUMN sebesar Rp 3,000 per sak guna merangsang peningkatan kebutuhan pasar yang tidak efektif. Bahkan memberikan dampak penurunan terhadap keuntungan perusahaan semen. PT Holcim Indonesia Tbk sebuah perusahaan publik Indonesia yang mayoritas sahamnya (80,65%) dimiliki dan dikelola Lafarge Holcim group yang berbasis di Swiss mencatat hingga akhir semester satu mampu mempertahan-

Pameran Surabaya Tools & Machinery 2015


JAKARTA(BM)- Nilai rupiah menulai menunjukkan keperkasaannya atas dolar AS meski Bank Sentral AS batal menaikkan suku bunga pada September ini. Rupiah kembali mendekati level psikologis Rp 14.300 per dolar AS. Nilai tukar rupiah yang ditransaksikan antarbank di Jakarta pada Jumat sore (18/9) bergerak menguat menjadi Rp14.300 dibandingkan posisi sebelumnya di posisi Rp14.400 per dolar AS. “Nilai tukar rupiah sempat menguat tipis tadi pagi seiring bank sentral Amerika Serikat (the Fed) yang kembali menunda kenaikan suku bunganya. Namun, dalam perjalanannya hingga sore ini rupiah bergerak tertekan menyusul minimnya sentimen positif dari dalam negeri,” kata pengamat pasar uang Bank Himpunan Saudara, Rully Nova di Jakarta, Jumat. Mata uang rupiah yang kian menguat, membuat mata uang Garuda kini berhasil menyentuh level Rp14.200-an per USD. Jumat (18/92015) sore, su-

Sidang Umum IAEA dihadiri oleh Kepala Perwakilan Tetap RI di Wina, BATAN dan Bapeten. “BPK RI berkomitmen tinggi memberikan hasil pemeriksaan yang berkualitas tinggi atas laporan keuangan IAEA,” ujar Anggota VI BPK Bahrullah Akbar dalam pidatonya dihadapan anggota IAEA, Jumat (18/ 9). IAEA merupakan organisasi independen yang didirikan 29 Juli 1957 dengan tujuan mempromosikan penggunaan energi nuklir secara damai serta menangkal penggunaannya untuk keperluan militer.


kan pangsa pasar sebesar 13.9%, namun total volume penjualan mengalami penurunan 4.9%. Sebagai dampak penurunan volume, jika dibandingkan periode yang sama tahun lalu, perusahaan mengalami penurunan pendapatan sebesar 1.4% menjadi Rp 4.86 triliun pada semester pertama ini. Menurut Presiden Direktur, CEO Holcim Indonesia Gary Schutz, mengungkapkan saat ini lebih pada mempertahankan pangsa pasar dikarenakan persaingan yang semakin meningkat, serta dibawah tekanan pasar yang melimpah. “Hal-hal yang mendasar di Indonesia tidak berubah. Saat perekonomian kembali pulih dengan terealisasinya proyekproyek infrastruktur yang tertunda dan stimulus ekonomi lainnya seperti paket Kebijakan Ekonomi yang baru diluncurkan presiden Jokowi September ini, kami percaya akan membantu ekonomi

menjadi lebih baik dan Holcim juga telah melakukan perampingan untuk mengurangi biaya-biaya operasional kami,” tegas Gary Schutz di Surabaya kemarin Sementara PT Semen Indonesia (Persero) Tbk perusahaan semen miliki negara (BUMN) ini mencatat selama tahun 2014 volume penjualan (termasuk Thang Long Cement Vietnam) mencapai 28,5 juta ton, meningkat 2,6% dibanding 2013 sebesar 27,8 juta ton. Disusul pendapatan perusahaan plat merah ini sebesar Rp26,99 triliun, meningkat 10,1% dibanding 2013 sebesar Rp24,50 triliun. Untuk Laba Usaha mencapai Rp7,16 triliun, meningkat 1,3% dibanding 2013 sebesar Rp7,06 triliun. Direktur Utama Semen Indonesia, Suparni mengatakan tahun 2014 lalu konsumsi semen di Indonesia tercatat sebesar 59,91 juta ton atau mengalami pertumbuhan sebesar 3,3% dari tahun lalu (58,00 juta ton). (top/dra)

HARGA IKAN LAUT NAIK Aktivitas jual beli ikan di pusat grosir ikan Pasar Pabean, Surabaya, Jumat (18/9). Cuaca buruk beberapa minggu ini menjadi penyebab utama kenaikan harga ikan serta turunnya perolehan hasil tangkapan nelayan.

Garap Pasar UKM, Gelontorkan Dana 9 Triliun SURABAYA (BM)- Ditengah situasi perekonomian yang masih labih para pengelola lembaga perekonomian berlomba mengeluarkan jurus untuk mensiasati kondisi perekonomian yang pertumbuhannya sangat lambat saat ini. Para pengusaha kecil atau yang biasa disebut UKM menjadi sasaran sebagai mitranya. Tak terkecuali BPTN yang mendesain pinjaman kepada UKM berupa BPTN Mitra Bisnis. Inovasi ini diharapkan mampu menjadi solusi bagi pengusaha kecil dan menengah, melalui solusi financial yang dapat diandalkan, seperti pembukaan akses ke pasar yang lebih baik dan pengembangan kapasitas bagi nasabah. PT Bank Tabungan Pensiunan Nasional Tbk (BTPN) saat ini serius melakukan pendekatan kepada UKM


Ongki Wanadjati Dana

(Usaha Kecil Menengah). BTPN bersedia mencairkan dana pinjaman kepada UKM sebesar Rp200 miliar. Keseriusan terhadap UKM dilakukan dengan produk BPTN Mitra Bisnis di Jatim. Dalam setahun BPTN bersedia mengucurkan dana sebesar Rp200 miliar untuk kebutuhan UKM. Satu nasabah bisa meminjam dana se-

besar Rp500 juta hingga Rp2 miliar. Saat ini, BPTN telah menyediakan anggaran sebesar Rp 9 triliun untuk pinjaman ke mikro, sedangkan UKM sebesar Rp3 triliun. “Fokus kami memang pada UKM, saat perekonomian seperti saat ini, para UKM yang bisa bertahan,”terang Deputy President Director PT Bank Tabungan Pensiunan Nasional Tbk (BTPN), Ongki Wanadjati Dana di Surabaya, kemarin. ”Kami memahami betul beratnya tantangan yang dihadapi para pengusaha kecil dan menengah. Makanya kami kenalkan BPTN Mitra Bisnis, program ini bisa menjadi pilihan bagi nasabah menengah,” paparnya Saat ini, ada sekitar 36 juta pengusaha mikro. Jumlah tersebut menjadi sangat potensial, dan BPTN mentargetkan bisa merebut market

melalui BPTN Mitra Bisnis sebesar 2 hingga 3%. Meski demikian, dengan melihat kondisi perekonomian yang tidak menentu, BPTN tidak terlalu agresif. Bahkan, perkiraan awal jumlah nasabah yang mengambil kredit akan menurun dari tahun-tahun lalu. Sebab, pemerintah terus memperhatikan keberadaan UKM dengan mempermudah proses perizinan. Sementara potensi pasar di segmen pengusaha mikro dan kecil bagi BTPN akan semakin besar, apalagi BTPN memiliki produk perbankan untuk permodalan usaha mikro, kecil dan menengah. Kalau melihat potensi, jelas sekali yang paling banyak adalah pengusaha mikro, jadi kalau usaha mikro itu dipercepat tentu akan mempengaruhi pertumbuhan ekonomi. (top/dra)

Pasar Smartphone Bersaing Ketat, Bidik Segmen Premium SURABAYA(BM)-Pemenuhan target dalam persaingan pasar smartphone yang semakin sengit dimanfaatkan konsumen untuk lebih selektif dalam memilih smartphone yang pas.Produsen asal China, Oppo saat ini bersaing dikelas menengah dengan dua produk line up yakni Mirror 5 dan R7 Lite bisa tembus diangka 65 persen. Chief Community Officer Oppo, Aryo Medianto mengaku kebutuhan dan keinginan konsumen akan smartphone dalam negeri ini masih sangat terbuka dan mampu menyerap pasar. Terutama di Surabaya, produk gadget merupakan barang konsumtif di kalangan pengguna dengan mobilitas pekerjaan maupun melakukan jejaring sosial media. “Saat ini kontribusi Kota Surabaya naik sekitar 18 persen. Peningkatan

Dia menambahkan, dari fitur kedua produk dengan tekstur potongan berlian di bagian cover belakang menggunakan lapisan anti gores fiber glass dan sistem operasi Android 5.1 Lollipop. Pada prosesor quad core 1,2 GHz Qualcomm Snap dragon 410, kartu gra-


SEGMEN PREMIUM: Produsen smartphone asal China membidik segmen premium untuk memenuhi kebutuhan konsumen yang selektif memilih produk gadget berkualitas.

penetrasi ini sebagai daya dorong menguatnya pasar yang ditandai pada kuartal pertama tahun ini mencapai 8,8 persen untuk nasional dan

sekaligus ,mencatat masuk kategori lima besar smartphone di Indonesia paling diminati,” jelasnya, Jumat (18/ 9) di Surabaya.

fis Adreno 306, RAM 2 GB, baterai 2.420 mAh, dan memori internal 16 GB dengan slot microSD up to 128 GB dan resolusi kamera 540x960 pixel dan untuk Oppo R7 Lite dibenamkan kamera utama 13 MP dan kamera depan 8 MP. “Bandung, Surabaya, Makassar

dan Medan masih jadi unggulan sebaran pasar. Metode pameran dan juga dukungan store, sedangkan outlet mencapai 8000, serta layanan purna jual 47 service center. Tahun ini sih kami menargetkan bisa 50 service center sampai akhir tahun,”imbuhnya.(jey/dra)

Berita Metro Edisi 19 September 2015