Page 1

Senin, 20 Juni 2011 18 Rajab 1432 H/ 19 Go Gwee 2562 Terbit Pertama: 29 November 1998

Eceran Rp 2.500,http://www.equator-news.com

Kalimantan Barat Sebenarnya

Riam Merasap Kongkalikong? Warga menjerit. Delapan tahun dibohongi mendapatkan layanan air bersih. Duit dikuras, proyek hanya jadi besi tua. BPKP dan peran Bupati dipertanyakan. Benarkah ada yang masuk angin ? KETAPANG. Megaproyek gagal Riam Merasap Ketapang mulai diuraikan satu persatu untuk mengungkap kejanggalan penggunaan Rp 135 miliar. Karena delapan tahun tak kunjung berfungsi, bidikan awal mengarah kepada konsultan perencana. Dana perencanaan konsultan mencapai Rp 900 juta. Perencanaan tidak tepat guna dan ini merupakan salah satu bukti bahwa pembangunan air bersih Riam Berasap jelas merugikan masyarakat, ungkap Umar Mansyur, Pemuka Masyarakat Ketapang kepada Equator, Minggu (19/6). Umar mengaku lupa perusahaan yang bertindak sebagai konsultan pada proyek selama tiga tahun berturut-turut dimulai pada 2003. Namun Umar sangat mengetahui dana yang dialokasikan untuk konsultan. Tokoh yang rajin melontarkan kritis ini mengaku sanksi atas hasil audit Badan Pemeriksaan Keuangan dan Pembangunan (BPKP) yang menilai tidak adanya kerugian negara dalam pembangunan proyek air bersih tersebut. Padahal, kerugiannya sudah sangat jelas. Ratusan miliar duit negara terkesan dihamburhamburkan. Sementara, masyarakat tidak dapat menikmati hasil dari mega proyek tersebut, ujar Umar. Megaproyek ini mulai dibangun di masa kepe Halaman 7

Morkes Effendi

Morkes Klaim Tanpa Masalah Hukum Kejati Kembali Menuai Kritik K ETAPANG . Mantan Bupati Ketapang, Morkes Effendi menilai, mencuatnya dugaan penyimpangan megaproyek Riam Berasap kental bermuatan politis. Sarana air bersih yang gagal beroperasi itu dianggap tanpa masalah hukum. Alasannya, Kejati dan Polda sudah melakukan SP3 (Surat Perintah Penghentian Perkara). Riam Merasap itu sudah selesai. Di Kejaksaan sudah SP3. Di Kepolisian juga, kalau tidak salah Kapolda waktu itu pak Nanan Sukarna sudah menyatakan SP3. Jadi secara hukum tidak ada masalah lagi, jelas Morkes kepada Equator ditemui usai Diklat Kader Fungsional DPD Golkar Ketapang, Sabtu (17/6) malam di Gedung DPD Golkar Ketapang. Warga Desa Simpang Tiga dan sekitarnya memasuki musim panas mulai kesulitan mendapatkan air bersih. Air di lokasi proyek gagal Riam Halaman 7 Merasap yang tertampung di booster Dusun Siduk digunakan dengan cara manual. KAMIRILUDDIN

Kalbar Siap Kirim 700 Pramuka

Ekonomi

Daniel Johan berdialog dengan Kelompok Tani.

Kalbar Potensial Garap Program Mandiri Pangan PONTIANAK. Kalbar memiliki luas daerah yang memadai untuk mengembangkan komoditas pangan. Sudah saatnya Kalbar menjadi bagian dari gerakan kemandirian dan kedaulatan pangan nasional. Ini juga menjadi upaya kita dalam meningkatkan Pendapatan Asli Daerah maupun Indeks Pembangunan Manusia di Kalbar, kata Daniel Johan, staf khusus Menteri Pembangunan Daerah Tertinggal (PDT) pada pelatihan pemberdayaan petani dan penanaman perdana di Bengkayang dan Sambas, Jumat lalu (18/6). Daniel menekankan, pangan merupakan kebutuhan dan hak dasar rakyat yang tidak bisa ditawar-tawar pemenuhannya. Pengabaian atas Halaman 7

Pemilukada

Syahdan-Bruno Ajukan Gugatan Money Politik NGABANG. Pasangan calon bupati dan wakil bupati Landak nomor urut satu, Syahdan Anggoi- Honorius Bruno mengajukan gugatan kepada Mahkamah Konstitusi (MK), Jumat (17/6) dengan laporan money politic (politik uang). Gugatan yang kita ajukan bukan terkait hasil L Lifkoi Vantar Pemilukada Landak. Tapi berkaitan money politic yang dilakukan pasangan yang memenangkan Pemilukada Landak, beber L Lifkoi Vantar SH MHum, Advokat dan Konsultan Hukum dari Pasangan Syahdan-Bruno dalam keterangan persnya, Minggu (19/6). Ditegaskan Lifkoi, bahwa sudah diterima daftar Tanda Terima Gugatan Nomor 300_0/PAN. MK/2011, tanggal 17 Juni 2011. Sedangkan Halaman 7

Injet-injet Semut Riam Merasap Kongkalikong? -- Eeeh... muncul asap lagi.

- Bang Meng

Harga Eceran :

Mempawah Rp 2.500,-

Aparatur pemerintah bersama masyarakat membersihkan lingkungan menyambut HUT KKU ke-4 sekaligus peringatan hari Pertasi Kencana tingkat Kalbar yang di pusatkan di kabupaten ini. KAMIRILUDDIN

KKU Tuan Rumah Pertasi Kencana Kepala Daerah se-Kalbar Bakal Hadir S UKADANA . Pemprov Kalbar menunjuk Kabupaten Kayong Utara sebagai tuan rumah kegiatan Pertasi Kencana 2011. Seluruh kepala daerah se Kalbar dipastikan datang ke kabupaten ke 13 di Provinsi Kalbar guna memperingati Pertasi Kencana yang dirangkai dengan HUT Kabupaten Kayong Utara ke-4 yang jatuh pada 26 Juni 2011. Sekretaris Daerah (Sekda) Kabupaten Kayong Utara, H Hendri Siswanto SSos ditemui Equator di rumah dinasnya belum lama ini mengungkapkan, hari Pertasi Kencana Tingkat Provinsi Kalbar yang selalu diperingati tiap tahun akan dibuka secara resmi

oleh Gubernur Kalbar. Kegiatan ini digelar pada 4-7 Juli 2011. Acara ini, dikatakan Hendri, akan dipusatkan di lapangan sepakbola persis disamping gedung DPRD Kabupaten Kayong Utara, Desa Sutera, Kecamatan Sukadana. Lapangan dimaksud, menurutnya, belum diberi nama nanti akan dirembukkan dengan masyarakat guna menetapkan nama lapangan dimaksud. Kita ingin dengar masukan masyarakat agar nama lapangan itu nantinya benar-benar tepat, ujarnya. Sekda menyampaikan, pameran Pertasi Kencana ini diharapkan akan lebih menonjolkan

nama Kabupaten Kayong Utara di lingkup Provinsi Kalimantan Barat. Terlebih, Kabupaten Kayong Utara merupakan daerah otonomi baru dan masih terbelakang. Dalam kegiatan tersebut, masing-masing kabupaten/kota se Kalbar akan menampilkan pameran yang menggambarkan potensi daerahnya masing-masing yang sesuai dengan tema peringatan Pertasi Kencana. Selaku tuan rumah, Sekda mengungkapkan, pihaknya telah menyiapkan sekitar 30 stand untuk memfasilitasi masing-masing daerah dalam kegiatan pameran. Halaman 7

P ONTIANAK . Kwartir Daerah (Kwarda) Pramuka Provinsi Kalbar menyiapkan 700 anggotanya untuk dikirim mengikuti Jambore Pramuka Tingkat Nasional (Jamnas) di Bumi Perkemahan Teluk Gelam Kabupaten Ogan Komering Ilir (OKI) Sumatera Selatan, 2-9 Juli 2011. Pelepasan rombongan Pramuka Kalbar 26 Juni oleh Gubernur Kalbar. Mereka diberangkatkan ke Jakarta menggunakan kapal laut, kata Drs H Suryadi MSi, Ketua Kwarda Pramuka Kalbar kepada sejumlah wartawan di sela rapat koordinasi di Hotel Merpati, Minggu siang (19/6). Jambore ini diperkirakan diikuti sekitar 40 ribu orang, termasuk anggota pramuka internasional. Sebelumnya yaitu tanggal 25 Juni, perwakilan anggota Pramuka Penggalang (tingkat SMP) usia 11 hingga 15 tahun yang akan mengikuti Jambore tingkat nasional itu akan ditampung di SPN (Sekolan Polisi Negara) Pontianak. Dalam penampungan itu, mereka diberikan pembekalan seputar materi yang akan dilom-

bakan dalam event tersebut, ujar Suryadi. Suryadi menilai, kegiatan Jambore Pramuka itu sangat penting bagi anggota pramuka yang notabene generasi muda. Dengan mengikuti kegiatan itu, diharapkan mereka mampu mendalami sikap patriotik dan memupuk rasa kebersamaan dalam bingkai Negara Kessatuan Republik Indonesia. Pelaksanaan jambore tahun ini sangat istimewa karena di tahun 2011 ini, pramuka genap berusia 50 tahun. Pramuka juga harus berbesar hati karena akhirnya pemerintah dan DPR mengesahkan Undang-Undang Pramuka Nomor12 Tahun 2010, bebernya. Menurut Suryadi, dikirimnya perwakilan pramuka Kalbar dalam kegiatan nasional bahkan internasional, memang tidak luput dari besarnya perhatian pemerintah daerah dan DPRD se-Kalbar. Pasalnya, biaya yang digunakan dalam kegiatan tersebut bersumber dari pemerintah dan DPRD selaku pihak yang Halaman 7

Suryadi dan Salbiah. ABDU SYUKRI

Atlet Kalbar Menyongsong PON XVIII Riau (bagian 4) Oleh : Uun Yuniar

Persiapan sejak awal akan lebih baik untuk mempersiapkan atlet yang hendak berlaga di Pra PON Oktober 2011 di Riau. Seperti Cabor lain, Pengprov PTMSI Kalbar gencar mempersiapkan atlet terbaiknya.

Singkawang Rp 2.500,-

Cabor Tenis Meja Menggodok Atlet Terbaik Berkaca pada Pra PON empat tahun silam, batasan umur untuk seorang pemain adalah 30 tahun. Namun, untuk tahun 2011 ini kemungkinan mengalami perubahan. Menurutnya, Ketua Pengprov Persatuan Tenis Meja Seluruh Indonesia (PTMSI) Kalbar, Drs Firdaus Zar in, skuad inti Pra PON ,tetap mengandalkan pada hasil Porprov X lalu. Namun, tak sedikit jawara dan peraih emas di Porprov X itu melewati batas umur yang ditentukan oleh PB PTMSI. Makanya, PTMSI Kalbar akan langsung menentukan pemain-pemain mana yang layak mewakili Kalbar di

Bengkayang Rp 2.500,-

Sambas Rp 2.500,-

ajang Pra PON. Kita ingin yang terbaiklah. Kita berharap di Pra PON ini, Kalbar bisa mencatatkan sukses dan merebut prestasi terbaik, tegasnya. Untuk itulah saat ini PTMSI Kalbar terus melakukan persiapan untuk mencapai target tersebut. Kita akan berupaya semaksimal mungkin untuk merebut prestasi terbaik di Pra PON dan PON, katanya. Menurutnya, seleksi daerah ini dilakukan sebagai salah satu cara merekrut atlet untuk dipersiapkan menjadi pemain terbaik agar tenis meja Kalbar bisa lolos ke PON XVIII yang dilaksanakan di Riau pada Halaman 7

Landak Rp 3.000,-

Sanggau Rp 3.000,-

Sintang Rp 3.000,-

Melawi Rp 3.000,-

Kapuas Hulu Rp 3.000,-

Ketapang Rp 3.000,


2

interaktif

Senin, 20 Juni 2011



Equatorial

Rakyat Kesulitan Air Bersih, Proyek Rp 135 M Mana Hasilnya? Warga di Kabupaten Ketapang, secara umum masih kesulitan air bersih. Sebagian pihak mengambil air di Gunung Palung di Kecamatan Sukadana, Kabupaten Ketapang. Tiap hari pemandangan truk dengan bak besar membawa tabung besar, mengangkut air bersih dari Gunung Palung, Sukadana, Kabupaten Kayong Utara (KKU). Entahlah apakah pengambil air bersih itu membayar kompensasi ke Pemerintah Kabupaten (Pemkab) Kayong Utara, belum diketahui pasti. Pastinya Gunung Palung yang gugusannya mayoritas di Kayong Utara, airnya sering dibawa ke Kota Ketapang dan sekitarnya. Kemudian dari sepanjang ruas jalan Desa Siduk Kecamatan Sukadana, KKU, sampai ke Kota Ketapang, sudah biasa terlihat pemandangan warga mengantre mendapat jatah air bersih. Itu pun mengais dari bocorkan pipa air bersih. Menjadi kontradiksi ketika ada proyek pengadaan air bersih Riam Merasap Ěśsebagian warga tempatan menyebutnya Riam BerasapĚś sudah menelan biaya di kisaran Rp125-135 miliar. Proyek dikerjakan antara tahun 2003 sampai 2009, akan tetapi pemandangan warga mengantre air bersih masih mudah dilihat. Air bersih adalah salah satu jenis sumberdaya berbasis air yang bermutu baik dan biasa dimanfaatkan oleh manusia untuk dikonsumsi atau dalam melakukan aktivitas mereka sehari-hari termasuk di antaranya adalah sanitasi. Untuk konsumsi air minum menurut departemen kesehatan, syarat-syarat air minum adalah tidak berasa, tidak berbau, tidak berwarna, dan tidak mengandung logam berat. Walaupun air dari sumber alam dapat diminum oleh manusia, terdapat risiko bahwa air ini telah tercemar oleh bakteri (misalnya Escherichia coli) atau zat-zat berbahaya. Walaupun bakteri dapat dibunuh dengan memasak air hingga 100 ° C, banyak zat berbahaya, terutama logam, tidak dapat dihilangkan dengan cara ini. Air merupakan unsur yang vital dalam kehidupan manusia. Seseorang tidak dapat bertahan hidup tanpa air, karena itulah air merupakan salah satu penopang hidup bagi manusia. Ketersediaan air di dunia ini begitu melimpah-ruah, namun yang dapat dikonsumsi oleh manusia untuk keperluan air minum sangatlah sedikit. Dari total jumlah air yang ada, hanya lima persen saja yang tersedia sebagai air minum, sedangkan sisanya adalah air laut. Selain itu, kecenderungan yang terjadi sekarang ini adalah berkurangnya ketersediaan air bersih itu dari hari ke hari. Semakin meningkatnya populasi, semakin besar pula kebutuhan akan air minum. Sehingga ketersediaan air bersih pun semakin berkurang. Seperti yang disampaikan Jacques Diouf, Direktur Jenderal Organisasi Pangan dan Pertanian Dunia (FAO), saat ini penggunaan air di dunia naik dua kali lipat lebih dibandingkan dengan seabad silam, namun ketersediaannya justru menurun. Tanpa akses air minum yang higienis mengakibatkan 3.800 anak meninggal tiap hari oleh penyakit. Begitu peliknya masalah ini sehingga para ahli berpendapat bahwa pada suatu saat nanti, akan terjadi pertarungan untuk memperbuatkan air bersih ini. Sama halnya dengan pertarungan untuk memperebutkan sumber energi minyak dan gas bumi. Di samping bertambahnya populasi manusia, kerusakan lingkungan merupakan salah satu penyebab berkurangnya sumber air bersih. Abrasi pantai menyebabkan rembesan air laut ke daratan, yang pada akhirnya akan mengontaminasi sumber air bersih yang ada di bawah permukaan tanah. Pembuangan sampah yang sembarang di sungai juga menyebabkan air sungai menjadi kotor dan tidak sehat untuk digunakan. Pembabatan hutan dan penebangan pohon yang mengurangi daya resap tanah terhadap air turut serta pula dalam menambah berkurangnya asupan air bersih ini. Selain itu pendistribusian air yang tidak merata juga ikut andil dalam permasalahan ini. Berkaitan dengan krisis air ini, diramalkan 2025 nanti hampir dua pertiga penduduk dunia akan tinggal di daerahdaerah yang mengalami kekurangan air. Ramalan itu dilansir World Water Assessment Programme (WWAP), bentukan United Nation Educational ScientiďŹ c and Cultural Organization (Unesco), lemabaga otonom Persatuan Bangsa Bangsa (PBB) yang bermarkas di New YorkĚśAmerika Serikat. ***

Pengantar: Tumpahkan unek-unek, kritik, pujian ataupun komentar Anda tentang layanan umum dalam kolom SMS InterAktif. Untuk SMS yang belum dimuat harap bersabar, antre! Kami tidak melayani SMS berbau SARA dan menyudutkan pribadi tanpa fakta.

5HGDNVLPHQHULPDRSLQLSHPEDFDPDNVLPDOKDODPDQNZDUWRXNXUDQKXUXI6LODNDQNLULPNHHPDLOUHGDNVL#HTXDWRUQHZVFRP

Siapa Bilang PKR Tak Masuk Akal? Oleh: Syarif Ibrahim Alqadrie

Ungkapan Gubernur Kalbar Drs Cornelis MH di Pontianak Post (16/6/2011:17), Equator (16/6-2011:1) dan Borneo Tribun (16/6-2011:1) bertajuk, Kapuas Raya Tak Masuk Akal, dinilai oleh sejumlah pengamat politik, akademisi, wartawan, alumni, mahasiswa, tokoh masyarakat dan anggota legislatif sebagai bukan hal baru. Rekan-rekan tersebut, yang peduli terhadap daerah ini‒yang Gubernur nilai masih keteteran dan moratmarit ̜ terutama sejak empat tahun lalu, menyayangkan pernyataan senada yang ia ucapkan beberapa kali, bahwa Provinsi Kapuas Raya (PKR) tak masuk akal. Tulisan ini tidak membahas proses pembentukan PKR yang terletak di bagian utara Kalimantan Barat ini, tetapi hanya ingin mengungkapkan hasil diskusi terbatas antar sejumlah unsur masyarakat berkaitan dengan pernyataan Gubernur Kalbar tersebut. Siapa Bilang dan Atas Dasar Apa? Diskusi informal antar sesama rekan-rekan tersebut tentang Ketidak-masuk-akalan pendirian PKR berlanjut dua kali setelah 16/6. Siapa bilang pembentukan provinsi di kawasan pedalaman jauh (interior upland areas) tak masuk akal? tanya seorang wartawan yunior. Atas dasar apa Gubernur membuat pernyataan seperti itu? Apakah perkataan beliau didasarkan pada kajian akademis? tanya mantan mahasiswa saya tanpa memberi kesempatan kepada saya menjawab pertanyaan sebelumnya. Seorang Gubernur tidak pantas berbicara tentang apakah upaya pemekaran provinsi baru, seperti PKR dari provinsi induknya, Kalbar, masuk akal atau tidak, tanpa dasar akademis yang kuat, lanjut rekan

akademisi lain. Tapi, mungkin itu merupakan hasil kajian Bappeda Provinsi Kalbar, saya mencoba menenangkan rekan tadi, walaupun saya tahu bahwa tidak satu pun instansi dari kabupaten atau provinsi induk yang akan dimekarkan pernah melakukan kajian seperti itu. Kajian mendalam hanya dilakukan oleh para tokoh, akademisi dan elit dari wilayah yang akan dimekarkan saja. Kepentingan, Etika dan Norma Politik Apa yang diungkapkan oleh rekan tersebut membuat saya bingung, terutama ket ika seorang mantan anggota legislatif Kalbar dari salah satu partai besar menghubungkan sikap pemimpin puncak provinsi ini dengan politik dalam arti sempit. Pernyataan Gubernur menurut rekan tadi, Adalah tidak etis berdasarkan norma politik berkaitan baik dengan kepentingan politik sempitnya jangka pendek dalam memenangkan Pilgub 2012, maupun dengan kepentingan ekonomi bagi biaya kampanye politiknya. Untuk kalimat terakhir ini, saya belum melihat hubungannya dengan fakta yang mendasari pernyataan Gubernur seperti dimuat tiga koran terbitan Kamis (16/6) itu. Rekan tadi menambahkan, kekhawatiran Gubernur Kalbar sekarang ini akan ketidakberhasilannya memenangkan Pilgub 2012 bilamana PKR berdiri dan operasional sebelum pilgub terlaksana. Pada kenyataannya, 40 persen dari seluruh anggota masyarakat yang memiliki hak pilih di Kalbar terletak di kawasan pedalaman jauh yang menjadi basis PKR. Mereka berasal dari Kabupaten Kapuas Hulu, Sintang, Melawi, Sekadau dan Sanggau. Selebihnya yaitu 60 persen, masyarakat yang memiliki hak pilih terletak di kabupaten dan kota pada kawasan pedalaman dekat (interior valley areas) Kalbar, yang terdiri dari Kota Pontianak, Singkawang, Kabupaten Pontianak, Sambas, Ketapang, Bengkayang, Landak, Kubu Raya dan Kayong Utara. Itu berarti bahwa jika PKR telah berdiri, Gubernur Kalbar pada Pilgub 2012 akan kehilangan suara pendukungnya sebanyak 40 persen suara di Kawasan Pedalaman Jauh, yang menjadi basis provinsi baru itu. Dengan hanya 60 persen suara, Gubernur

Mentang-mentang Guru

M

ASALAH

Lahan seluas 6,4 hektar di Kompleks GOR Khatulistiwa, Pontianak dialih fungsikan menjadi pusat bisnis. Padahal, Undang-undang (UU) Nomor 3 Tahun 2005 tentang Sistem Keolahragaan Nasional, pada Pasal 67 ayat 7 disebutkan bahwa, setiap orang dilarang meniadakan dan/atau mengalihfungsikan prasarana olahraga yang telah menjadi aset/milik pemerintah atau pemerintah daerah tanpa rekomendasi menteri dan tanpa izin atau persetujuan dari yang berwenang sesuai dengan peraturan perundang-undangan. Sanksi bagi pelanggaran itu sudah sangat jelas karena merupakan tindak pidana. Pasal 89 ayat 3 UU Nomor 3 Tahun 2005 dengan tegas mengatakan, setiap orang yang mengalihfungsikan atau meniadakan prasarana olahraga yang telah ada, baik sebagian maupun seluruhnya tanpa izin sebagaimana diatur dalam Pasal 67 ayat 7, dipidana dengan pidana penjara paling lama lima tahun. Jadi kalau Pemprov Kalbar melalui pejabatnya terbukti mengalihfungsikan aset olahraga di kompleks KONI Kalbar dapat dipidanakan. Apa komentar Anda?

T

ANGGAPAN

Apabila mau dibangun untuk kepentingan bisnis, kami tetap menolak dan demi kemajuan olahraga di Kota Pontianak dan Kalimantan Barat pada umumnya. Untuk Pemerintah Provinsi (Pemprov) Kalbar dan Asisten 3 Setda Pemprov Kalbar, apakah tidak ada wilayah lain untuk dibangun pihak ketiga, atau berapa Bapak dikasi uang oleh pihak ketiga, sehingga menghalalkan segala cara. Pikir dong Pak. 081256407639 24-5-2011

Harian

Jawa Pos Media Group

10.17

HP : 0819-5267-5378

Ini saran dan keinginan kami sebagai siswa-siswi. Tolong dan harapan kepada guru yang terhormat, Bapak Andreas CP SPd. Kami mohon apabila satu diantara kami berbuat salah terhadap Bapak, janganlah Bapak mempermainkan nilai kami semua. Adakah Bapak sedikit rasa sosial dan kemanusiannya terhadap kami. Apakah ini yang disebut seorang guru. Jangan Bapak kira sebagai seorang guru bisa seenaknya mempermainkan nilai kami. Memangnya pantas ya, seorang guru begitu. Kami sekolah disini mencari ilmu dan nilai, bukan mencari masalah dengan Bapak, tapi kenapa Bapak mempermainkan nilai kami. Kami yang tidak tahu-menahu terkena imbasnya juga, apa salah kami? Tugas kami kerjakan, ulangan umum kami kerjakan. Tapi apa hasil dan buktinya, semuanya sia-sia. Ulangan kami belajar, tapi nilai ulangannya sangat tidak memuaskan. Padahal materi sudah kami pelajari dan pelajaran yang dipelajari juga ada yang menyangkut/keluar. 085750763375 16-6-2011

20.19

Hai sobat-sobat guru Kabupaten Sambas! Yang merasa haknya terabaikan (tunjangan sertiďŹ kasi) Desember 2010, ayo bicara, jangan diam aja. Ayo kita perjuangkan bareng. Daerah lain sudah dibayar enam bulan yang lalu, kita kok sampai hari ini belum, aneh kan? Ada apa denganmu hai para guru. Jangan cuma ngomong kasak-kusuk di belakang, tunjukkan bahwa kita nggak bisa dibodoh-bodohi. Selamat berjuang!

07.44

Laksanakan Amanah

bersaudara di Kalbar, Dayak dan Melayu, dalam pembagian kekuasaan politik melalui pembagian kekuasaan dalam politik etnis. Kelima, pembentukan PKR adalah proses pencarian tak pernah henti terhadap tokoh-tokoh abadi yang berpihak pada rakyat dari berbagai kelompok (messiahs). Kesadaran etnis di dalam masyarakat Dayak Kalbar berdasarkan aliran mesianisme menimbulkan anggapan akan hadirnya messiah-messiah di daerah ini (lihat Alqadrie, Mesianisme dalam Kebudayaan Dayak di Kawasan Pedalaman Kalbar dalam Paulus Florus dkk, hal 18-39. Kebudayaan Dayak: Transportasi dan Aktualisasi, Jakarta, 1994). Namun, sang messiah belum hadir sampai sekarang. Terbentuknya PKR diharapkan akan melahirkan messiahmessiah di kalangan tokoh-tokoh moderat, demokratis dan pemersatu pada lima kabupaten di Kawasan Pedalaman Jauh. Sambil mengkritik tulisan saya itu, rekan dosen UGM menekankan bahwa messiahmessiah hanya akan muncul di kawasan pedalaman jauh‒PKR‒tidak di tempat lain, karena tokoh masyarakat di kawasan itu lebih lembut, kompromistis, santun dan lebih bisa merangkul semua kelompok. Kita tunggu, semoga.

Penulis adalah Pengamat Sosial dan Dosen Tamu di NIAS, Denmark dan CSEAS, Kyoto, Jepang

TELEPON PENTING Kriiiing....!!!!

Rumah Sakit RS. Soedarso RS. St. Antonius RS. YARSI

737701 732101 739685

Polisi Poltabes Ptk Polsek Ptk Kota Polsek Ptk Barat Polsek Ptk Selatan Polsek Ptk Timur Polsek Ptk Utara

734900 7558880 774766 736184 742910 883126

Pemadam Kebakaran Din Kebakaran Kota PMK PB PMK Bintang Timur PMK Merdeka PMK Sei Raya

730897 736344 585511 7171666 7159596

PDAM PDAM

767999

PT. PLN (PERSERO) WILAYAH KALBAR CABANG PONTIANAK Pelanggan PLN yang Budiman. Bersama ini kami himbau agara segera melunasi rekening listriknya agar terhindar dari sanksi pemutusan aliran listrik yang dilaksanakan oleh petugas PLN. Untuk diketahui bahwa PLN akan mengadakan program pemutusan / pembongkaran terhadap pelanggan-pelanggan PLN yang menunggak secara serantak pada bulan mei-juni 2011 ini. Rekening listrik dapat dibayar si semua loket PPOB (Payment Point Online Bank) baik itu di kantor PLN, Bank, Kantor Post ataupun Payment Point yang tersebar diseluruh area kerja PLN Wilayah Kalimantan Barat. Kami menghimbau juga agar para pelanggan membayar langsung dan tidak menitipkan uang ke petugas untuk menghindari hal-hal yang tidak diinginkan. Demikian himbauan dari kami atas kerja samanya kami hanturkan Terima kasih. MANAGER TTD

Selamat dan sukses atas ditetapkannya saudara kami, Heri sebagai Wakil Bupati Landak. Semoga amanah yang diberikan masyarakat dapat dijalankan sebagaimana mestinya dan doa kami selalu menyertaimu. Amin. 081256277166 17-6-2011

nelis akan tercatat dalam sejarah dan di dalam hati kita semua, seperti Sultan Hamid Al-Qadrie dan Oevang Oeray sebagai pemersatu berbagai kelompok etnis di Kalbar, seandainya ia tidak memandang rendah (look down/inferior) rakyat dan para tokoh Kawasan Pedalaman Jauh dengan menyatakan secara terbuka PKR sebagai tak masuk akal. Peringatan Dini dan Messiah Mengapa berdirinya PKR hanya tinggal menunggu waktu saja? Dosen Sosiologi Politik Universitas Gajah Mada (UGM), dan Dosen Pemerintahan Lokal dan Otonomi Daerah (Otda) Untan, melihat lima hal berkaitan dengan pertanyaan di atas. Pertama, para bupati dan staf, anggota legislatif, tokoh masyarakat dari lima kabupaten di kawasan pedalaman jauh dan sejumlah akademisi dari dalam dan luar Kalbar telah mempersiapkan cukup lama proses pembentukan PKR. Kedua, studi kelayakan dilakukan oleh unsur-unsur nomor satu di atas menunjukkan bahwa, pendirian PKR adalah sangat positif bagi kepentingan rakyat di kawasan itu. Ketiga, para anggota DPR RI, DPRD Kalbar dan DPRD pada lima kabupaten mendukung sepenuhnya pendirian PKR. Oleh karena itu, adalah tidak masuk akal, seandainya ada pejabat strategis mengatakan PKR tak masuk akal. Empat, pendirian PKR merupakan upaya bijaksana dan sistem peringatan dini dan salah satu cara serta alat dalam pengelolaan konflik untuk mencegah benturan antara dua kelompok etnis

HIMBAUAN

Jangan Diam

082158423044 18-6-2011

Kalbar sekarang dipastikan akan kalah dalam Pilgub 2012. Kekhawatiran dan Marwah Kalaupun pada Pilgub Kalbar 2012 PKR belum terealisir, yang berarti bahwa seluruh jumlah penduduk Kalbar yang memiliki hak pilih dari 11 kabupaten dan dua kota masih menumpahkan suara mereka pada Pilgub Kalbar. Ini juga berarti bahwa Gubernur Kalbar periode 2007-2012 tidak perlu khawatir akan kehilangan 40 persen suara. Lalu, mengapa ia perlu mengatakan bahwa PKR tak masuk akal? Apakah itu bukan berarti ia menganggap enteng dan menginjak-injak marwah (dignity), hak asasi dan hak demokratis rakyat dan para tokoh masyarakat di Kawasan Pedalaman Jauh yang cinta damai? tanya seorang rekan alumni Universitas Tanjungpura (Untan) keturunan dari salah satu anak suku (sub kelompok etnis Dayak) di Kapuas Hulu. Pertanyaan yang bernada ďŹ losoďŹ s ini tidak begitu saja dapat saya jawab. Namun, saya lebih cenderung mengarahkan jawaban secara normatif, bahwa Gubernur Kalbar sekarang tentu sudah paham dengan aspirasi dan hak demokrasi seluruh rakyat Kawasan Pedalaman Jauh untuk membangun dan meningkatkan standar hidup mereka sejajar dengan apa yang telah dinikmati oleh provinsi lain di Indonesia, khususnya di Kalbar. Karena itu, adalah arif dan bijaksana bila Gubernur yang kita cintai ini segera menyetujui dan memperjuangkan berdirinya PKR, segera setelah Pilgub 2012 dilaksanakan. Sebelum dan setelah pesta demokrasi 2012 usai, Cor-

FAUZI ARUBUSMAN

Untuk layanan pengaduan pelanggan melalui SMS Anda dapat mengirimkan SMS ke :

No. HP : 08115718811

11.41

Penerbit: PT Kapuas Media Utama Press. Pembina : Dahlan Iskan. Direktur/Pemimpin Umum: Djunaini KS. Pemimpin Redaksi/Penanggung Jawab: R Rido Ibnu Syahrie. Koordinator Liputan: Hamka Saptono. Dewan Redaksi: Mahmudi, Anton Perdana, Yuni Kurnianto, Elfrida Sinaga, Misrawie, Hermanto. Staf Redaksi: Budi Yoyok, Abdu Syukri, Julianus Ratno. Umum dan Personalia: Djailani Kasno. Kota Pontianak: Arman Hariadi. Biro Mempawah: AlÂż Shandy (Jl Teratai Blok A No 3 Telp 0561-691326). Biro Kubu Raya: Mordiadi. Biro Singkawang: Indra Nova Jatra Kusuma. Biro Sambas: M Ridho (Jl. Sukaramai Komp Didis Permai Blok G10, Desa Dalam Kaum, Sambas Telp. 0562-392738). Biro Sanggau: M Khusyairi (Ka Biro) (Jl H Juanda Kel Beringin Telp 0564-21525). Biro Landak: Kundori (Jl Jalur 2 Ngabang depan Wisma Usaha Jaya Pal.2 Ngabang). Biro Kayong Utara: Kamiriludin (Ka Biro) (Jalan Simpang Tiga Desa Siduk, Kecamatan Sukadana). Ketapang: Kiram Akbar. Biro Sekadau: Antonius Sutarjo (stinger). Biro Kapuas Hulu: Kholil Yahya (Jl M Yasin,Putussibau utara No 3 (Telp. 0567 22877). Biro Melawi: Sukartaji (Ka Biro) (Jl Juang Nanga Pinoh. Telp. 0568-22069). Biro Sintang: Jl Oevang Oeray Baning Sintang (lantai 2 Graha Pena Kapuas Post Sintang). Biro Bengkayang: Yopi Cahyono. Promo Bisnis: Darussalam. Sekred: Juliati Fitria.

SIUPP: Nomor. 792/Menpen SIUPP/1998 Tanggal 9 Desember 1998. Terbit 7 kali/minggu

Alamat: Jalan Arteri Supadio Km 13,5. Telepon: (0561) 768677 (hunting), 725550. Fax: (0561) 768675. Telepon: (0561) 743344 (hunting), 760646. Fax: (0561) 760147.

Pracetak/Tata Wajah: Mustaan (Koordinator), Dennis, Hermansyah, Defri, Yudi . Website: Hendra Ramawan (Koordinator). Keuangan: Dian Widiastuti. Iklan: Uray Kamaruzaman (Manager), Jenggo, Deny A, A Jaiz. Pemasaran: Rosadi Jamani (Manager), Divisi Even: Mohamad Qadhafy. Distribusi: Abubakar. Iklan Jakarta: Jl. Jeruk Purut-Al-Ma’ruf No. 4 Pasar Minggu, Jakarta Selatan 12560 Telp. 78840827 Fax. (021) 78840828 Tarif iklan per milimeter kolom: Hitam putih Rp 7.000,00. Spot colour: Rp 10.500,00. Full colour: Rp 15.000,00. Iklan baris: Rp 5.000,00/baris (minimal dua baris maksimal 10 baris). Harga Eceran: Rp 2.500,00. Harga Langganan: Rp 65.000,00/bulan, (luar kota tambah ongkos kirim). Bank: Bank Mandiri Cabang Pontianak Sidas. Percetakan: PT Akcaya Pariwara. (Isi di luar tanggung jawab percetakan).


3

Investor Harus Siapkan Fasum

P R O

pontianak

Senin, 20 Juni 2011

STKIP-PGRI Pontianak Siap Menerima Mahasiswa Baru Surat Tanda Lulus (STL) dari sekolahnya. Pasfoto ukuran 4 x 6 cm sebanyak 2 lembar, Menyerahkan Surat Keterangan Dokter, sebanyak 1 lembar, Membayar biaya pendaftaran sebesar 150 ribu untuk satu prodi pilihan, dan 200 ribu rupiah untuk 2 prodi pilihan.STKIP-PGRI Pontianak didirikan pada tanggal 25 Juli 1981 oleh pengurus Daerah PGRI Kalimantan Barat. Keberadaannya dalam rangka meningkatkan kesejahteraan Guru sebagai anggota PGRI sekaligus dalam upaya peningkatan kualitas pendidikan. STKIP-PGRI Pontianak bernaung dibawah yayasan Pembina Lembaga Pendidikan Persatuan Guru Republik Indonesia (YPLP-PGRI), dengan ijin Operasisional dari Kopertis Wilayah II Palembang No. 16/a Tahun 1981. STKIP-PGRI Pontianak mulai beroperasi sejak Tahun akademik 1981/1982, berdasarkan Keputusan Dirjen Dikti Depdiknas (d/h. depdikbud) Nomor 507/DIKTI/ Kep/1992. (oVa)

Gedung STKIP yang baru di Jalan Ampera. Pontianak-Setiap investor atau pengembang yang ada di Kota pontianak harus melengkapi Rencana Tata Bangunan dan Lingkungan (RTBL). Dengan demikian tidak alasan lagi bagi pengembang untuk menghindari kewajibannya, Saat ini bisnis di bidang property semakin berkembang tapi tidak sedikit dari mereka yang nakal dan tidak menyiapkan fasilitas umum (fasum), demikian dikatakan Bahari, ST, alumni Fakultas Teknik Untan. Warga Kota Pontianak ini menyarankan, terhadap pengembang yang sudah terlanjur tidak membuat fasilitas umum dan fasilitas sosial di kawasan yang telah dikembangkannya, pantas diberikan sanksi dengan mengganti seluas lahan yang wajib disediakan tidak jauh dari perumahan yang dibangunnya. Jika mereka tidak merealisasikannya, maka oknum pengembang itu harus dimasukkan dalam daftar hitam (black list) oleh pemerintah Kota Pontianak. Terlepas dari tekanan itu, yang paling bagus sebenarnya kesadaran sendiri dari para pengembang untuk membangun fasilitas umum dan fasilitas sosial tersebut. Artinya, tanpa dipaksa atau takut dengan sanksi, para pengembang diharapkan memberikan dukungan sepenuhnya pengembangan dan perwujudan Kota Pontianak menjadi kota yang rapi, nyaman, teduh dan bersih. Kota yang tertata rapi memang tidak mudah untuk diwujudkan pada perumahan yang ada. Kota Pontianak ini diharapkan muncul dari pengembangan kawasankawasan permukiman yang baru seperti yang dibangun para pengembang yang ada sekarang. Kawasan perumahan yang tidak dilengkapi dengan fasilitas umum dan fasilitas sosial sudah pasti tidak layak disebut sebagai kawasan perumahan ideal. Jika pengembang melengkapinya secara sempurna, akhirnya akan memunculkan keuntungan bagi perusahaan pengembang itu sendiri. `Image yang baik perusahaan akan jadi pembicaraan di kalangan masyarakat. Bukankah hal ini sudah menjadi media promosi yang luar biasa bagi pengembang untuk menarik konsumen. Kita yakin, seorang pengembang akan terus mengembangkan bisnisnya lebih besar dan lebih bagus. Mereka tidak akan cukup puas membangun sebuah perumahan beserta fasiltas umum dan fasilitas social, ucapnya. Saat ini, bisnis perumahan sudah menawarkan kelengkapan berbagai fasilitas pendukung yang diberikan. Tidak hanya jalan, rumah ibadah, dan tempat bermain, tapi juga sarana olahraga, sekolah, sarana kesehatan, hingga pusat perbelanjaan. Karenanya jika Pemko Pontianak ke depan harus mewajibkan kepada para developer untuk menyediakan lahan untuk pembangunan Tempat Pembuangan Sampah (TPS), kita memperkirakan, hal tersebut tidak akan terlalu menjadi persoalan bagi pengembang. Sejatinya, tanpa diwajibkan, pembangunan TPS merupakan suatu kelengkapan yang harus dibangun atau dimiliki sebuah perumahan. Tujuannya, untuk mendukung program kebersihan dan kesehatan masyarakat. Perumahan merupakan salah obyek penilaian yang menjadi bagian dari penilaian sebuah kota. Baik buruknya penilaian perumahan akan berdampak terhadap penilaian seluruh obyek. Jika baik dapat mendukung atau mendongkrak obyek yang lain mendapat penilaian rendah, sebaliknya jika buruk maka akan memerosotkan penilaian yang sudah bagus. (oVa)

Pontianak- Pendaftaran Penerimaan Mahasiswa baru STKIP-PGRI Pontianak Tahun Akademik 2011/2012 telah dibuka dan ditutup pada tanggal 25 Agustus 2011, hingga saat ini STKIP-PGRI terus melakukan upaya perbaikan untuk menciptakan tenaga pendidik yang handal yang ada di Kalimantan Barat. Menurut Budi Ananda,ST, Bagian Humas Rektorat STKIP, Seleksi masuk Perguruan Tinggi adalah kegiatan seleksi calon mahasiswa untuk memasuki Perguruan Tinggi. Pola ujian Tulis dan ujian Praktek bagi Program Studi tertentu. Penyelenggaraan seleksi ini dilaksanakan oleh Panitia Seleksi Penerimaan Mahasiswa Baru (SPMB) STKIPPGRI Pontianak. Ujian tulis Seleksi Masuk Perguruan Tinggi diselenggarakan

DIJUAL

Ruko Siap Pakai Fasilitas Lengkap Lokasi Strategis, Jl H. Rais A. Rahman (Sui Jawi Dalam) Cocok Untuk Minimarket Tempat Parkir Luas,

Hubungi : 0811 567 613

pada jam dan hari yang telah ditentukan. Proses pengolahan hasil ujian dilakukan dengan menggunakan komputer dan secara selektif. Untuk pemilihan program studi setiap peserta mempunyai kesempatan memilih maksimal dua program studi yang berbeda. Urutan pilihan program studi menunjukakan prioritas pilihan. Dalam proses pengolahan data hasil ujian, apabila pilihan pertama telah penuh, maka pilihan jatuh pada pilihan yang kedua, untuk penilaian kelulusan berdasarkan ranking. Didalam mengisi Formulir Pendaftaran atau Lembar Jawaban Ujian hendaknya peserta ujian membaca dengan teliti dan seksama semua petunjuk yang tertera dalam buku panduan Peserta dan naskah Soal Ujian SPMB. Setiap

kesalahan yang terjadi karena tidak mengikuti petunjuk tersebut akan berakibat tidak terbacanya isian oleh komputer. Oleh karena itu, Buku Panduan Peserta SPMB merupakan satu-satunya panduan dalam pengisian formulir pendaftaran maupun Lembar Jawaban Ujian yang akan mempermudah proses mengurus pendaftaran dan Herregistrasi. Penyelenggaraan Seleksi Penerimaan Mahasiswa baru (SPMB) STKIP-PGRI Pontianak bertujuan untuk memperoleh mahasiswa yang memiliki kemampuan akademik untuk mengikuti dan menyelesaikan pendidikan di Pendidikan tinggi sesuai dengan ketentuan yang berlaku. Di Tahun akademik 2011/2012, Syarat Penerimaan Maha-

siswa Baru Tahun Akademik 2011/2012 STKIP-PGRI Pontianak memiliki persyaratan sebagai berikut : Fotocopi Ijajah Lulusan, (SMA/SMu/ Ma/Diploma/Sederajat) sebanyak 1 (satu) lembar yang telah dilegalisir. Lulusan Tahun 2011 wajib menyerahkan

Pendaftaran Penerimaan Mahasiswa baru STKIP-PGRI Pontianak Tahun Akademik 2011/2012 telah dibuka dan ditutup pada tanggal 25 Agustus 2011 Sekretariat: Jalan Ilham No. 45/Jalan Ampera Pontianak. Saran, Anjuran, dan pengaduan dapat disampaikan via SMS ke 082157484048

10 Program Studi yang dimiliki STKIP-PGRI Pontianak : 1. S-1 Pendidikan Bimbingan dan Konseling (BK) 2. S-1 Pendidikan Pancasila dan Kewarganegaraan (PPKn) 3. S-1 Pendidikan Matematika (P.Mtk) 4. S-1 Pendidikan Jasmani, Kesehatan dan Rekreasi (Pen jaskes) 5. S-1 Pendidikan Sejarah (P. Sjrh) 6. S-1 Pendidikan GeograďŹ 9P. (Geo) 7. S-1 Pendidikan Fisika (P.Fis) 8. S-1 Pendidikan Bahasa dan Sastra Indonesia (P.BI) 9. S-1 Pendidikan Bahasa Inggris (P. Ingr) 10. S-1 Pendidikan Teknologi Informasi dan Komputer (P.TIK)


kalbar raya

4 Sintang di Jatah 1000 Sambungan Baru

Senin, 20 Juni 2011

Persami Pramuka SPP Singkawang

Sintang. Program sejuta sambungan listrik baru, akhirnya sampai di Sintang, PT Perusahaan Listrik Negara (Persero) Ranting Sintang. Kabupaten yang rencananya menjadi ibu Kota Provinsi Kapuas Raya (PKR), mendapatkan jatah 1000 sambungan baru. 1000 sambungan baru itu untuk semester pertama tahun 2011 ini, mungkin kedepan akan ada tambahan lagi, ungkap Manejer PLN Ranting Sintang, H Suharman pada wartawan belum lama ini. Dikatakan Suharman, untuk penyambungan baru tetap selektif dan memberikan prioritas pada kawasan y a n g o ve r s p a n i n g d e n g a n g a r d u y a n g o ve r l o a d . Guna mendukung rencana tersebut PLN Ranting Sintang akan menambah gardu di sejumlah titik. Kita masih menunggu trafonya. Kalau sudah ada, maka memungkinkan untuk penyambungan di beberapa daerah yang dimaksud, ucapnya. Suharman menjelaskan, hingga saat ini, daya yang dimiliki pembangkit di wilayah Sintang, masih di backup dari mesin sewatama. Hal itu dikarenakan daya pembangkit yang dimiliki PLN Sintang masih sangat terbatas. Mudah-mudahan PLTGB dan PLTU cepat operasional. Kalau kedua ini operasional, kebutuhan listrik dapat lebih tercukupi, terangnya. Kembali ditanya mengenai sambungan baru, Suharman berharap, masyarakat tidak mudah percaya begitu saja, terutama pada orang yang menawarkan jasa bisa mengurus pemasang an di PLN. Datang saja sendiri ke kantor kami, pengumumannya ada berikut biaya untuk sambungan baru, kata dia. Dicontohkan Suharman, jika mengajukan pemasangan baru untuk daya 900 volt ampere, maka biaya yang harus dikeluarkan terdiri dari biaya penyambungan Rp 675 ribu ditambah biaya materai. Jadi biaya sambung an baru ke PLN itu tidak besar, ucapnya. Diluar biaya itu, lanjut Suharman, sudah bukan lagi tanggungjawab PLN karena biasanya ada biaya lain yang dikeluarkan warga terkait pemasangan jaringan dalam rumah dan tiap instalatir punya harga berbeda. Yang jelas PLN hanya menerima biaya sejumlah yang sudah sesuai dengan ketentuan, biaya pemasangan jaringan dalam rumah tergantung instalatir karena biasanya ditentukan per titik sambungan, jelasnya. Jika masyarakat ingin mengajukan sambungan baru, ia mengatakan carilah instalatir yang resmi dan jelas terdaftar di PLN. Untuk di Sintang ada lima instalatir resmi yaitu Alika Teknik, Riri Mandra, Koperasi Mekar, Prima Nusantara dan Tri Manunggal Sakti. Kami harapkan masyarakat tidak memasang lewat jalur tidak resmi sehingga harus mengeluarkan biaya tinggi apalagi sekarang jangan mudah percaya dengan pihak yang mengatakan bisa mengurus sambungan baru dengan cepat, pungkasnya. (din)

Bangun Kader Saka Bumi Kritis

Butuh Kesadaran Lalu Lintas Lemah Sintang. Sudah pemandangan sehari-hari di Sintang, melihat pengendara kendaraan bermotor tidak menaati lampu pengatur lalu lintas. Meskipun keberadaannya baru, namun aturan itu mesti diikuti. Sejauh ini sejak lampu pengatur lalu lintas ini dioperasikan, masih ada sekitar 30 persen pengendara yang tidak tertib, kata Kasat Lantas Polres Sintang, AKP M Roni Mustofa. Dikatakan Roni, untuk membangun kesadaran masyarakat akan tertib berlalu lintas tentunya butuh waktu dan peran dari semua pihak. Kami tetap berupaya untuk meningkatkan kesadaran masyarakat tentang tertib berlalu lintas melalui berbagai sarana yang ada, yang jelas soal disiplin ini kembali pada kesadaran masyarakat, ucapnya. Pada kondisi lampu pengatur lalu lintas tid a k b e r f u n g s i , t e n t u ny a p i h a k k e p o l i s i a n s e l a l u siap melaksanakan peng aturan di persimpang an. Kalau lampunya t idak berfungsi terutama ket ika jam padat kendaraan, anggota kami selalu stand by untuk melakukan pengaturan, jelasnya. Mengenai pos lalu lintas yang dibangun Dinas Pe r h u b u n g a n d i k a w a s a n s i m p a n g l i m a , i a m e n gatakan sampai saat ini memang belum diserahkan untuk dioperasionalkan pihak satuan lalu lintas. Sebenarnya itu sangat membantu kami dalam memantau lalu lintas, sekaligus untuk kamtibmas, artinya di pos itu bisa disiagakan anggota kami selama 24 jam, tetapi semuanya kembali pada Pemkab karena memang belum diserahkan untuk difungsikan, tukasnya. (din)

Ketua Kwarda Pramuka Kalbar, Drs H. Suriyadi MSi saat membuka perkemahan SMK SPP Kalbar di Singkawang. Anton Perdana. Singkawang. Pelaksanaan perkemahan Sabtu dan Minggu (Persami) yang digelar Sekolah Pertanian Pembangunan (SPP) Kalbar, Singkawang diharapkan Ketua Kwartir Daerah (Kwarda) Kalbar, Drs H. Suriyadi MS, MSi, menjadi tonggak awal membangun kader saka bumi yang peka terhadap lingkungan. Sebab sebagai saka yang tertua di Dunia, Saka Taruna Bumi terbukti memberikan kontribusi yang besar bagi pembangunan. Apalagi dari luas wilayah 504 km² Kota Singkawang, sekitar 50 persen lebih menjadi areal pertanian dan perkebunan. Singkawang memang sudah

menjadi kota. Tapi ingat, sebenarnya sektor pertanian masih menjadi andalan Kota Singkawang. Buktinya sektor ini menyerap tenaga kerja yang cukup besar, bahkan lahan yang dimiliki Kota Singkawang untuk pertanian juga masih luas. Tadi sebelum sampai disini kita lihat sendiri, bagaimana hamparan tanaman padi yang menguning, tutur Suriyadi, saat memberikan sambutan di hadapan 200 peserta membuka Persami, Sabtu (18/6) di SPP Kalbar, Singkawang. Suriyadi pun memberikan apresiasi pada seluruh peserta, yang ikut ambil bagian Persami kali ini. Karena SPP Kalbar di Sing-

kawang, menjadikan Pramuka sebagai agenda rutin. Kegiatan pramuka ini sangat indah. Karena disini tidak ada sekat yang memisahkan antara anak dengan seorang ayah, dimana seorang ayah menjaga jarak dengan sang anak. Sebab di pramuka mengenal sebutan kakak dengan adik, sehingga terbangunlah sebuah keakraban, terangnya. Kembali pada para anggota pramuka di SPP Kalbar, Singkawang, Suriyadi menuturkan, seluruh kegiatan para anggota pramuka disini akan difokuskan pada kegiatan yang berbasis pertanian. Langkah ini penting,

untuk menunjang disiplin ilmu yang dimiliki para siswa. Saka Taruna Bumi adalah wadah bagi para Pramuka untuk meningkatkan dan mengembangkan kepemimpinan, pengetahuan, pengalaman, keterampilan dan kecakapan para anggotanya. Sehingga mereka dapat melaksanakan kegiatan nyata dan produktif serta bermanfaat dalam mendukung kegiatan pembangunan pertanian. Pembinaan Saka Taruna Bumi dilakukan oleh Gerakan Pramuka bekerjasama dengan Departemen Pertanian, LIPI, dan Lembaga Holtikultura. Kita juga akan mendorong, para anggota disini untuk ber-

interaksi langsung dengan masyarakat. Sebab melalui pramuka, siswa dapat mengabdikan dirinya mereka, yakin Suriyadi. Diutarakan Suriyadi pula, beberapa krida dalam Saka Taruna Bumi, seperti krida pertanian dan tanaman pangan, krida pertanian tanaman perkebunan, krida perikanan, krida peternakan, dan krida pertanian tanaman holtikultura. Seluruh Krida ini menunjang kegiatan yang dapat dilakukan Pramuka, urainya. Usai memberikan sambutan, Suriyadi lantas di daulat untuk melepaskan balon ke udara, sebagai pertanda dibukanya kegiatan Persami. (ton)

Promo Tepat Sasaran Hanya Rp15.000/hari

* Syarat dan Ketentuan Berlaku

JASA ANGKUTAN BARANG OJEK PICK UP

Melayani : • Rental/sewa pick up (L300), Carry, Grand Max, Zebra, Hilux • Angkutan (Pindahan rumah, kost dll) • Antar Jemput barang (dalam & Luar kota)

085654695608 081256815588

Tidak Melayani SMS

Buat apa Bayar Mahal Kalau hasil nya Sama

Pasang 6 x Terbit 7 Kali Pasang 25 x Terbit 30 Kali

Mitra Dalam Perjalanan Anda

LEMBAGA PELATIHAN KERJA SWASTA Full ac Melayani : 1. Pelatihan mekanik motor reguler 2. Pelatihan mekanik mobil reguler 3. Pelatihan analisa engine dgn komputer/Scanner EFI 4. Penyediaan alat Scanner EFI 5. Service mesin EFI, Reset Oil, Mobil : Asia, Amerika dan Eropa

Jl. Tabrani Ahmad No. 16-19 Sui Jawi Dalam Pontianak Barat Telp (0561) 773672 HP 0811563377

Khusus menjual :

DINAS KEBERSIHAN DAN PERTAMANAN KOTA PONTIANAK Jl. Kom Yos Sudarso

SEDOT WC Hub: Telp. (0561)772807

Fasilitas: 1 Unit instalasi pengolahan IPLT 2 Unit kendaraan jenis vacuum truck

TRANSPORT MELAYANI : - Antar Jemput Luar - Dalam Kota - Menerima pengiriman dokumen & Paket TUJUAN : - Sintang - Pontianak (PP) H u b

: 081352462870 085348154631 ALAMAT :

PONTIANAK SINTANG (081256599913) (082149172370) Jl. KH. ACHMAD DAHLAN No. 24 Jl. MT. HARYONO (Armada Kijang Innova) (Pintu Gerbang BTN)

LUXIO

Buruan Beli Daihatsu Dapatkan Promo Undian “DAHSYAT “DAHSYAT” ” Promo Undian Bulan Juni S/d Oktober 2011

Gran Max Pick up

Xenia VVT-i

DP mulai 10%

TERIOS • SIRION • LUXIO • GRAN MAX PU/MB 08125747270 Hub: 0561-7062289

SUI JIN

THERAPY

REFLEXIOLOGI TITIK-TITIK AMPUH

Xenia

DP mulai 10 %

11Jutaan

Daihatsu Daihatsu Sebar Sebar Hadiah Hadiah Terbesar! Terbesar!

DISCOUNT s/d 25 Jutaan

DP 10%

DP 10% S/d 4 Th

Grand Max PU-BOX Gran Max

MUDAH & CEPAT 081256606125 0561 753897 7

Segera Hubungi :

DODY 08125608423, 0561-7565151

5,1

*

5

Tahun

( FREE Angsuran 1 Bln)

Hubungi :



Melayani : • Lebih 1000 Model Undangan Terbaru • Aneka Souvenir Kawinan ( Ratusan Model Ready Stock) • Cetak Yasin, Kop, Bon, Nota, Digital Printing

Kunjungi Workshop Kami :

%

Dp 10 %

Kardiansyah 081257282270 085654400673

Proses Mudah dan Cepat

Pontianak - Sanggau

Percetakan ANUGRAH Jl. Kh. Wahid Hasyim No. 60 Pontianak Telp. (0561) 7057240, 7537420 (depan supermarket asoka baru) Percetakan CV. ADI MULIA Jl. Komyos Sudarso Gg. Teratai 1 No. 9 Pontianak Telp. (0561) 773093, 08164983624

Tersedia Ra dio HT

RANGER RAS CABIN

UHF / VHF

Murah, Bergaransi, Berkualitas

D PH

IZIN PRAKTEK DINKES NO. 448/574 PKPM 2002

DITANGANI LANGSUNG OLEH SHINSHE MURSYID AL MUDAWALI HP. 081345500116 Jl. Tanjungpura Gg. Kamboja No. 19 Samping Ramayana Mall Pontianak Buka: 08.00-20.00 WIB

Bunga

Proses

PENYAKIT YANG DAPAT DISEMBUHKAN

EJAKULASI DINI • LEMAH SYAHWAT • MANI ENCER • IMPOTEN • PROSTAT • HERNIA • KANKER PAYUDARA • KANKER RAHIM • KEPUTIHAN • TERLAMBAT DATANG BULAN • BELUM PUNYA KETURUNAN • KISTA • AMANDEL • ASAM URAT • MATA RABUN • FLU/PILEK MENAHUN • TELINGA BERNANAH • AMBAYEN/WASIR • STROKE • DIABETES • GINJAL • TUMOR • LIVER • REMATIK • GONDOK • POLIP • AYAN • MAAG • SIPILIS • JANTUNG • ASAM URAT • ASMA • DARAH TINGGI/RENDAH • EXIM/GATAL-GATAL

Tenor

SWIFT-APV-SX4-X OVER

JOHANES

Undangan & Souvenir tak

ce

DP

ARIS TAXI

Dapatkan Cash Back s/d 15 jt

Telp. (0561) 743999

Innovation for Tomorrow

Express Express

Innovation for Tomorrow

Jl. KH. Ahmad Dahlan No. 18 Pontianak (Jl. Penjara / dpn Jl. Beringin)

Kontak Person : Deny 0811570832 Jaiz 085245411544 Telp Iklan : 0561-721229

MURA

FORD FIESTA

265 jt

- Melayani Carter Dalam & Luar Kota - Pengiriman Barang Telp : (0561) 7161816 Telp (0561) 3305303 Hp : 085245502235 (0561) 779655 081522675500 Hp : 081256271689 Sanggau Pontianak Kantor Cabang : Kantor Pusat : Jl. Ahmad Yani No. 24 Jl. Tabrani Ahmad (Samping Hotel Komp : Hasia Permai Merpati) No. B 8

184 jt RANGER | ESCAPE |EVEREST | FIESTA Hubungi: RIDHO F.S Hp: 081345366649

TOKO NAVIGASI Jl. Agus Salim 36 Ptk.

0561-760452


5 jendela usaha

Info

Selular

Tips Merawat Hp Tua Kendati jenis handphone (Hp) baru terus diproduksi dari berbagai vendor kenamaan, hingga vendor-vendor baru, tentunya masih banyak yang tidak bisa meninggalkan kegemarannya pada Hp tipe lama. Apalagi Hp tersebut memiliki kenangan tersendiri, misalnya telah mengantarkan kesuksesan, berhasil memfasilitasi ketemu dengan jodohnya, mendapatkan pekerjaan yang diidam-idamkan dan lainnya. Untuk merawat benda bersejarah ini memerlukan kerja keras, karena bagaimana pun juga penggunanya tentu tidak mau Hp-nya yang sudah butut tidak dapat digunakan lagi. Tips untuk merawat Hp tua cukup gampang, di antaranya menggunakan sarung Hp untuk mengantisipasi kemungkinan jatuh atau tertetes air. Bila sarung yang dipilih, tentunya Hp itu akan tetap mulus. Bila masih sering menggunakan Hp tua t e r s e b u t , h e n d a k ny a pengguna memerhatikan charger-nya dengan baik, sebagainya baterai dicas setelah tenaganya benar-benar habis dan jangan dicabut sebelum benarbenar ini. Kendati masih dapat digunakan, alangkah baiknya Hp yang sudah tua di-service secara rutin, hal ini untuk memastikan komponen di dalamnya tetap terjaga dengan baik. Jangan lupa untuk rajin membersihkan debu yang menempel di Hp butut tersebut, serta memperlakukannya dengan baik, karena terkadang sedikit saja tersenggol atau terjatuh akan mudah tergores dan lainnya. (dik)

Icip-icip

Gaya Mobil Batik Membawa Omzet Ciamik Minat akan modifikasi mobil dengan motif batik ikut menyemarakkan bisnis rumah modifikasi. Selain tampil berbeda, nilai mobil yang telah dibatik, biasanya, juga ikut melonjak. Alhasil, prospek bisnisnya juga cukup cerah. Batik memang sudah menjadi tren baru bagi industri pakaian. Perkembangan desain motif ini begitu pesat. Dari objek yang berkaitan dengan pakaian atau kain, kini, batik telah merambah ke media lain. Salah satunya mobil. Tengok saja langkah PT Mercedes-Benz Indonesia yang baru-baru ini meluncurkan mobil Smart edisi terbatas dengan bodi berbalut motif batik. Microcar yang diproduksi Daimler AG ini menawarkan desain badan mobil dengan motif urban batik dan archipelago camouflage yang mampu menyedot

melukis motif batik pada bodi tiga mobil itu. Tommy Dwi Djatmiko, pemilik Mastomcustom Graphic Airbrush System, Jakarta Selatan, juga tengah menggarap proyek modifikasi otomotif dengan corak batik. Tahun lalu, bekerja sama dengan desainer Carmanita, ia sukses membatik Mercy C 250 CGI atas permintaan PT Mercedes-Benz Indonesia. Saya optimistis, bisnis ini akan meningkat, ujarnya. Decky Irawan, pemilik Beta Motorsport di Surakarta, juga melihat tren membatik mobil terus meningkat. Ia pernah mengecat batik sebuah mobil dengan tema Modis buat Manten Jawa . Karyanya ini memenangi tiga piala sekaligus dalam sebuah kontes modifikasi di Surabaya, awal Mei lalu. Mobil modifikasi batik mulai menjadi tren.

pasti selalu bernilai tinggi dan elegan. Apalagi sentuhannya itu sangat meng-Indonesia, katanya. Bisnis Menjanjikan Berbekal kecintaan ini, selain membatik mobil, Pay juga mengembangkan motif batik ke beberapa media, seperti

minat orang. Beberapa rumah modifikasi menikmati pesanan untuk membatik mobil dan media lain. Pay Sholahuddien, pemilik Pay Air Gafix di Jakarta Timur, misalnya, pernah mendapat pesanan membatik tiga mobil taksi milik Blue Bird. Ia membutuhkan waktu sekitar sepuluh hari untuk

Dulu cuma tempelan animasi, sekarang mulai beralih ke motif batik, katanya. Berbeda dengan modifikasi biasanya, membatik mobil atau objek lain memang butuh suasana berbeda. Menurut Pay, semua harus berawal dari kecintaan pada batik. Motif batik pada benda apa pun itu tidak akan ditelan oleh zaman,

Mungkin, satu-satunya ekskavator di dunia dengan motif batik adalah yang pernah kami buat atas permintaan PT Kobexindo, ujar Pay. Ekskavator itu ia garap selama sepuluh hari. Meski menyatakan masih tahap merintis bisnis pembatikan mobil, Pay bilang, tarif modifikasi motif batik tidak

Semur daging khas Betawi ini lengkap bumbunya. Aromanya wangi dan rasa bumbunya gurih-gurih manis dan pekat. Disantap dengan nasi hangat, wouw... sedap! Bahan: 500 g daging sapi has luar atau lulur 2 sdm minyak sayur 3 cm kayu manis 2 butir cengkih 2 lembar daun salam 150 ml kecap manis 500 ml air 3 buah kentang, kupas, potong 4, goreng setengah kering Haluskan: 5 butir kemiri 6 butir bawang merah 4 siung bawang putih ¼ butir pala ½ sdt merica bubuk 1 sdt garam Cara membuat: * Potong daging melintang serat 1,5 cm. Sisihkan. * Tumis bumbu halus hingga wangi dan matang. * Masukkan irisan daging, aduk hingga kaku dan berubah warna. * Tuangi air, tambahkan kecap manis, kayu manis, cengkih dan daun salam. * Beri kecap dan air. * Masak dengan api kecil hingga bumbu meresap dan daging hampir lunak. * Masukkan kentang, masak kembali hingga kuah kental dan daging empuk. * Angkat dan sajikan hangat. (dtc)

casing handphone, laptop, kulkas, motor, bahkan ekskavator.

murah. Ia mematok biaya Rp 8 juta untuk membatik sebuah mobil, Rp 18 juta untuk membatik satu

unit ekskavator dan Rp 2,5 juta untuk membatik sebuah motor. Modal dalam membatik otomotif ini sekitar 30 persen dari total biaya yang saya kenakan, jelasnya. Tarif modifikasi sebesar itu sebanding dengan manfaatnya. Dengan mengandalkan desain unik, Tommy melihat, nilai mobil batik lebih tinggi ketimbang modifikasi biasa. Sekadar informasi, harga mobil Mercy C 250 CGI yang pernah digarap Tommy sekitar Rp 670 juta. Tapi, setelah bodinya dibatik , dengan proses lelang, mobil itu dinilai seharga Rp 1 miliar. Menurut Tommy, bagi pencinta seni, bisa jadi, mobil seharga miliaran masih lebih murah, jika dibandingkan dengan penghargaan pada hasil seni. Meski begitu, Orang yang tidak suka batik dan seni mungkin akan berpendapat beda, katanya. Namun, Ratno Halim, in-

stalatur Some Sound Car Audio di Jakarta yang pernah membatik mobil Toyota Alphard Vellfi re milik VJ Daniel Mananta, mengingatkan, lan-

tar a n berkaitan dengan motif budaya atau etnik, kelangsungan bisnis modifikasi motif batik ini sangat bergantung pada pelanggan. Tapi, kalau dari sisi ekonomi ternyata menguntungkan, bukan tidak mungkin modifi kasi mobil dengan desain batik bisa menjadi ladang investasi cantik. Baik dari sisi estetika dan kepopuleran, mobil semakin bernilai. Sebab, dengan adanya karakter batik pada sebuah mobil, orang akan lebih mudah mengingat siapa empunya, katanya. Decky memberi gambaran, dari pengalaman selama ini, keuntungan dari penjualan mobil yang sudah dimodifikasi batik antara 15-20 persen dari harga jual mobil. Margin ini bisa semakin tebal jika tepat memilih desain. Misalnya, Saya memakai motif batik parang karena dulu motif ini hanya dipakai kaum bangsawan. Jadi dengan desain itu, mobil tampak sangat anggun, katanya. (peluangusaha)

Tupai Terbang, Permintaannya Melayang Tinggi

Semur Betawi

Daging

Senin, 20 Juni 2011

Indonesia terkenal sebagai salah satu tempat bermukim banyak satwa yang unik dengan kemampuan istimewa. Salah satu satwa itu adalah tupai terbang. Dalam lima tahun terakhir, permintaan para penghobi akan jenis hewan mamalia ini meningkat cukup pesat. Tupai terbang atau flying squirrel (Hylopetes winstoni) merupakan hewan berkemampuan istimewa. Ia adalah satu-satunya jenis tupai yang bisa melayang terbang di udara.Keistimewaan ini didukung perangkat glider, yakni lapisan kulit di sisi kiri dan kanan yang menghubungkan kaki depan dan belakang binatang tersebut. Saat si tupai meregangkan keempat kakinya, lapisan kulit ini pun terkembang bagai sayap burung. Keberadaan selaput inilah yang membuatnya mampu melayang di udara. Tupai pun menggunakan kemampuan ini untuk berpindah tempat dari satu pohon ke pohon yang lain. Lalu, ekornya yang cenderung luwes menjadi pengendali arah penerbangannya. Catatan rekor ketinggian jelajah si tupai penghuni belantara Asia, Eropa dan Amerika Utara ini juga luar biasa. Mereka bisa terbang hingga ketinggian 50 meter. Hanya, tupai yang mendiami hutan di Asia mempunyai ukuran lebih kecil, yakni panjang

tubuh 20 centimter dengan ekor 15 centimeter. Bobot terberat tubuhnya maksimal 2,5 kilogram. Tupai ini memiliki mata membulat yang besar dan cakar tajam di ujung jemarinya. Hewan pengerat yang suka bersuara ribut ini juga punya banyak ragam warna. Umumnya, paduan bulu cokelat dan abu-abu. Tapi ada varian lain, yakni abu-abu secara keseluruhan atau bulu merah kecokelatan di bagian atas dan putih kotor atau krim cerah di bagian bawahnya. Warna-warna ini menjadi bagian dari sistem pertahanan dan penyamaran di alam liar.Menurut Angga Bima, penjual tupai terbang di Bandung, permintaan akan hewan lucu ini terbilang meningkat dari tahun ke tahun. Awal tahun ini, ia menjual 10 hingga 20 ekor per bulan. Kini, penjualannya sudah mencapai 100 ekor per bulan. Banderol harga tupai terbang berumur satu tahun berkisar antara Rp 100 ribu hingga Rp 150 ribu per ekor. Per bulan saya bisa meraih omzet Rp 12 juta, ujarnya. Angga biasanya melayani pemesanan dari Jakarta, Bandung, Semarang dan beberapa kota di Sumatra dan Kalimantan. Para konsumen biasanya memesan via telepon dan Angga mengirimkannya lewat paket. (peluangusaha)


sosialita

6

Senin, 20 Juni 2011

Menepis Gerakan Liberalisme dan Pluralisme di STAIN

Klub Alquran Upaya Pengamalan Islam PONTIANAK. Islam adalah agama utuh yang mempunyai akar, dimensi, sumber, dan pokok-pokok ajarannya sendiri. Siapa yang konsisten dengannya maka ia termasuk Firqah Najiyah (kelompok yang selamat). Siapa yang keluar atau menyimpang darinya, maka ia termasuk firqah-firqah yang halikah (kelompok yang binasa), pokok-pokok ajaran tersebut terdapat dalam AlQur an dan Sunah Nabi. Untuk meningkatkan kemampuan mahasiswanya dalam memahami Alquran, Sekolah Tinggi Agama Islam Negeri Pontianak (STAIN) mendirikan Klub Quran ada tahun 2010. Berdirinya klub ini berkeinginan untuk mewujudkan STAIN sebagai kampus Qur ani dengan menggaungkan ayat-ayat Alquran di setiap sudut kampus. Saat ini Klub Quran telah mempunyai anggota sekitar 100 anggota yang terdiri dari tanfidz (penghafal Al- Qur an), qiraah, tahsin serta khat (kaligrafi Islami) yang berkumpul untuk diskusi dua kali dalam seminggu. Kini, usia klub Alquran sudah hampir setahun dalam mem-

Salah satu gedung di STAIN. berikan bimbingan kepada mahasiswa yang ingin belajar Alquran, baik dari tahsin (belum pandai baca aquran), tahfiz (hafal Alquran) dan terakhir tilawah (tingkatan lagu dalam Alquran). Sejak berdirinya klub tersebut dibina oleh Udi Yulianto Lc MA, alumni Universitas Al Azhar Mesir. Dia memiliki kepedulian tinggi untuk mempelajari dan mengamalkan Alquran di lingkungan STAIN. Belajar dalam Klub Alquran ini para mahasiswa diajarkan sesuai dengan ajaran Islam. Kemudian, para mahasiswa ini disuruh untuk mencintai dan

memahami Alquran semata. Mahasiswa hanya disuruh untuk mencintai dan memahami Alquran saja, tidak lebih, kata Udi selaku Ketua Pengelola Klub Alquran ini kepada Equator di ruangannya (11/06) Kehadiran klub Al-Qur an ini sekaligus menepis isu mengenai adanya gerakan liberalisme dan pluralisme di STAIN Pontianak. Dijelaskan Udi, di STAIN ini tidak ada yang diajarkan berbagai macam paham atau aliran Islam seperti Islam liberal, plural dan lain-lain. STAIN ini semua pengajaran berlandaskan keilmuan. Segala apapun pemahaman yang kita ajarkan,

STAIN Pontianak. kita cocokan dengan warisan kita yakini yaitu Alquran dan Hadis, jelasnya. Udi menargetkan, dalam klub ini ingin mahasiswanya dapat membaca dengan benar. Alqur an Kemudian, dengan adanya Klub Alquran ini supaya menjadikan STAIN ini sebagai pusat menara agama. Disamping menghasilkan para penghafal dan penafsir Al-Qur an. Klub Alquran sebagai salah satu fondasi agama. Untuk itu, mesti terus dikembangkan agar bisa memberikan pemahaman yang luas kepada mahasiswa,

ujar salah satu dosen yang mengajar fafsir hadis ini. Selanjutnya, perkembangan mahasiswa dalam mengikuti klub ini mengalami kemajuan pesat. Salah satu anggota klub itu Siti Fatimah menjelaskan, para mahasiswa kini sudah bertambah dalam jumlahnya. Selain itu juga banyak yang sudah pandai membaca Alquran . Banyak mahasiswa yang awalnya tidak pandai baca Alquran dengan benar, tetapi setelah ikut klub ini mereka bisa membaca Alquran dengan benar, jelasnya. Quran merupakan pedo-

man umat Islam. Jangankan masyarakat awam, mahasiswa Islam saja banyak di antaranya belum pandai membaca Alquran. Padahal, mereka adalah calon dai yang akan menyampaikan dakwah Islam ke masyarakat. Kalau hal tersebut dibiarkan, malu juga kita apabila ada mahasiswa STAIN justru tidak pandai membaca Alquran. Untuk itulah, kita gencar mengajak mahasiswa yang merasa kurang pandai membaca Alquran untuk bergabung dengan klub ini, ajak Udi. Tidak hanya mengajarkan membaca Alquran, Klub Alquran juga mendalami tafsir. Setiap kandungan ayat Alquran dibahas dan didalami berdasarkan keilmuan Islam dengan memperhatikan persoalan kekinian. Banyak persoalan baru yang mesti dibahas dalam kerangka pikir Alquran dan Hadis. Setiap persoalan yang muncul di masyarakat bisa dibahas berdasarkan kaidah Alquran. Sebab, Alquran merupakan pedoman kita. Apa saja persoalan yang kita hadapi, mesti kembali ke Alquran dan hadis. Itulah anjuran dari Nabi kita Muhammad SAW, papar Udi.

Adanya aliran sesat yang marak di masyarakat. Mereka seolah-olah ahli dalam menafsirkan Alquran berdasarkan akal dan pikirannya sendiri. Padahal, untuk memahami Alquran dibutuhkan ilmu yang mendalam. Jadi, tidak sembarangan ingin menafsirkan Alquran. Salah satu yang mesti dipegang, orang yang bisa menafsirkan Alquran adalah orang yang benar-benar bisa dipegang omongannya, amanah, jujur, serta memiliki ketakwaan yang tinggi, ulas Udi. Klub Alquran terbuka untuk siapa saja. Sekretariatnya ada di STAIN Pontianak. Klub ini benar-benar murni untuk mengupas masalah Alquran. Bagi yang tidak bisa membaca, klub ini bisa mengajarkannya. Jika ingin memahami, klub ini bisa memberikan tafsir per ayat. Begitu juga jika ingin belajar menulis Alquran, klub ini juga bisa mengajarkannya, termasuk bagi penghafal al-Qur an. Mari kita jaga Alquran dengan mempelajari dan mengamalkannya. Insya Allah, kalau kita mengikuti apa yang ada dalam Alquran, hidup kita akan selamat dunia dan akhirat, ajak Udi. (pik)

Surya Paloh: Kita Memerlukan Pahlawan Baru

500 Massa Hadiri Pelantikan Nasdem Kota dan KKR PONTIANAK. Keberadaan Nasional Demokrat (Nasdem) makin kuat di Kota Pontianak dan sekitarnya. Sebagai bukti, saat pelatikan pengurus Nasdem Kota Pontianak dan Kubu Raya, tidak kurang 500 massa menghadiri acara tersebut di Hotel Aston Pontianak, Sabtu (18/6). Ketua Umum DPP Nasdem, Surya Paloh yang hadir dalam acara tersebut menjadi magnet tersendiri. Surya Paloh yang dielu-elukan kedatangannya tampil memukau. Dengan gaya pidatonya yang khas, dia mengajak seluruh kader Nasdem untuk peka terhadap persoalan masyarakat dan negara. Siapa lagi yang peduli terhadap nasib sesama saudara kita. Siapa lagi yang peduli terhadap negara ini, kecuali kita sendiri, teriaknya dengan penuh berapi-api di hadapan kader Nasdem. Nasdem dilahirkan untuk lebih banyak berbuat untuk masyarakat Indonesia. Siapa yang telah bergabung dalam tubuh organisasi ini, untuk melakukan tindakkan perubahan reformasi menuju Indonesia baru. Untuk itulah saya harus memperingatkan kita semua yaitu harus meraih cita-cita besar dan cita-cita yang luhur. Untuk mendapatkan ini, tidak mung-

kin kita hanya dengan berdiam diri, bahkan tidak cukup hanya berdoa. Tapi diperlukan suatu semangat dan keuletan, tekat lahir dan batin dengan memberikan apa yang mampu kita berikan untuk sebuah cita-cita kita bersama, paparnya. Indonesia pada saat ini memerlukan anak-anak bangsa untuk berjuang, menegakkan kembali kerangka keadilan, pranata hukum, dan segala bentuk tindakan yang ada di Negeri ini. Supaya untuk membangun Indonesia baru kedepan, yang lebih baik dan mantap. Kita memerlukan pahlawanpahlawan baru, pejuang baru, dan orang-orang pergerakan

baru yang ingin bertanggungjawab terhadap maju dan mundurnya bangsa yang dia miliki, tegasnya. Sementara itu, Ketua Nasdem Kalbar, Abdullah Alkadrie SH MH menyatakan, sebagai pengurus Nasdem Kota Pontianak dan Kubu Raya, semoga dapat melaksanakan tanggung jawabnya untuk melakukan konsolidasi. Bagi pengurus Nasdem yang baru dilantik ini, dengan tentunya saya berharap bisa mengembangkan tugas kita dengan baik dalam organisasi Nasdem ini. Dengan ini saya berkeyakinan bahwa Nasdem Kota Pontianak dan Kubu Raya. Insallah akan

71 anggota Nasdem Kota Pontianak dan Kubu Raya di lantik.

memberikan yang terbaik kepada masyarakat Indonesia pada khususnya masyarakat Kalbar, harapnya. Ditambahkan Abdullah, Hasil rapat koordinasi pada Desember nanti Nasdem sudah berada di desa-desa. Maksudnya, Nasdem akan membentuk jaringan sampai ke desa-desa dengan harapan bisa mengubah Indonesia menuju Indonesia baru. Ketua Nasdem Kota Pontianak, Drs H Firdaus Zar in M Si mengatakan, dalam pelantikan Nasdem ini, mempunyai nilai plus di mata masyarakat. Ke depannya Nasdem memiliki program-program aksi yang

akan direalisasikan. Jadi bukan program yang main-main, tetapi program aksi benarbenar dapat memberikan menfaat bagi masyarakat Kalbar dan Nasdem sendiri, jelasnya. Kita akan berusaha untuk memberikan hal yang terbaik demi Nasdem dan masyarakat Kalbar sendiri. Saya yakin, kawan-kawan pengurus Nasdem Kota Pontianak dan Kubu Raya adalah orang-orang yang profisional dalam segala hal, terutama dalam berorganisasi, kata Firdaus yang juga Seketaris KONI Kalbar ini. Nasdem bukanlah partai politik, melainkan organisasi kemasyarakatan. Namun, mereka

Burhan, harapnya. tahu tentang politik itu sendiri. Acara pelantikan ini juga Dalam kesempatan acara pelantikan ini, Firdaus me- dihadiri beserta tokoh-tokoh nyerahkan bantuan dana Rp Nasdem dari Jakarta. Juga 1.000.000 kepada anggota hadir Wakil Bupati Kubu Raya, A n d r e a s Nasdem yang telah meninMukhroggal dunia satu bulan lalu, tein, dan atas nama Burhan Udin Bidin sejumlah pemegang KTA Nasdem. Jadi tokoh Kalbagi anggota kami yang telah bar dan memegang KTA mendapatkan Pontimusibah, akan mendapatkan a n a k . asuransi dari Nasdem sendiri, (hakim) kata Ketua BKPRMI Kota Pontianak ini. Pemberian bantuan ini salah satu kepedulian Nasdem kepada anggotanya yang terkena musibah. Kemudian, bagi anggota Nasdem yang telah memegang KTA, akan mendapatkan asuransi kecelakaan, apabila mereka tertimpa musibah. Dengan bantuan dana ini, mudahan-mudahan bisa membantu sedikit beban keluarga yang ditinggalkan kepergian almarhum Ketua Nasdem Kota Pontianak, Firdasu Za in

500 massa serius dalam mendengar pidato dari Surya Paloh.

JUAL RUMAH Jl Gajah Mada 30 Gg Dungun No 28, fas: PLN, PAM, telp, 3KT, 1KM, tp strategis, hrg nego. Hub : 762813

JUAL RUMAH

SINTANG

SAMBAS

BANTUAN MODAL

Komplek Warga Sejahtera Jl. Komyos Sudarso Fas : PDAM, Telp, Listrik Hub : 085345038038

Ingin berlangganan & pengecer Harian Equator di Sintang. Hub : HP. 081345184340/08115705595

Ingin berlangganan Harian Equator di Sbs. Hub : 085245698977

Hibah Bantuan modal Usaha Hub : 082154360123

MELAWI

SINGKAWANG

Ingin berlangganan Harian Equator di MELAWI Hub : 0568-22069

Ingin berlangganan Harian Equator di SKW Hub: 081256056477

SANGGAU

BENGKAYANG

Ingin berlangganan Harian Equator di Sanggau Hub : 0564-21525

Ingin berlangganan Harian Equator di BKY Hub : 085288031117

PAKET 25X TERBIT

2 baris Rp. 100.000 3 baris Rp. 150.000

TERBANG SETIAP HARI DENGAN

BOING 737 PNK - JKT

4x

jam : 07.05, 08.10 11.50, 16.50 Wib Telp. (0561) 734488

JKT - BANJARMASIN

1x

jam : 16.30 Wib Telp. (0511) 58996

JKT - BALIKPAPAN

1x

jam : 07.30 Wib Telp. (0542) 739225

PNK - JOG - SUB (PP)

1x

jam : 14.20 Wib

BALIKPAPAN-TARAKAN

1x

jam: 09.35 Wib Telp. (0542) 887 0808

PONTIANAK-

JKT - P. PINANG

2x

jam : 08.35, 14.30 Telp. (0717) 437 183, 436 980/82

JKT - PEKANBARU

3x

jam : 08.00, 10.40, 16.00 Telp. (0761) 856 031

JKT - PALEMBANG

1x

jam : 13.10

Telp. (0711) 378 666

JKT - JAMBI

2x

jam : 10.50, 14.00 Telp. (0741) 7550643, 7551861

JKT - MEDAN

3x

jam : 07.00, 17.05 13.00, Telp. (061) 451 2080

JKT - PADANG

3x

jam : 07.00, 10.50, 16.20 Telp. (0751) 446600

YOGYAKARTA

PEMANGKAT

JUAL RUMAH

Berlangganan Harian Equator di Pmngkt Hub : AGUS 081256032440

Jl.Tabrani Ahmad Gg. Peramas Dalam No.6A Full Keramik,PLN, PDAM,1 KM,1 WC, 2 KT, Hrg 200 Jt Nego Hub : 081345293798081256706358

EKO SERVICE

SEDOT WC HUB TELP.

744880

Fasilitas Selang baru tanpa bau, pengalaman 25 th di bidang WC. Juga menerima servis AC (rumah & kantor) DISCOUNT 60% GARANSI

JKT - SEMARANG

2x

jam : 06.00, 16.30

jam : 16.10, 18.10

2x

JKT - MAKASAR

3x

jam : 07.14 (SUB), 10.20 21.00 (SUB) Telp. (0411) 365 5255

JKT - KUPANG

jam : 06.00 14.30 (SUB) Telp. (0380) 830555

-SURABAYA

: : : : : :

0811570832 0561-7911322 081345645582 0561-7092490 0561-7557007 085345038038

jam : 21.00, 04.00 (SOQ) (Selasa, Rabu, Sabtu) 03.00, 22.45 Jam : 22.45 (UPG) (Selasa, Kamis, Jumat, Minggu) Telp. (0986) 215666, 835, 836, 837, 838

* Ruko 2 lantai Uk. 4x12 ( Cck Utk Kantor) * Rumah Tempat Tinggal Uk. 8x16 (2 Lt) Jl. Imam Bonjol / Pinggir jalan

Hub 08179199650

jam : 16.15 Telp. (0778) 458 866

jam : 11.25 (Selasa, Kamis, Minggu) Telp. (082) 244299

JKT - GUANGZHOU Jam. 08.10 (Selasa, Kamis, minggu)

JKT - DENPASAR

2x

(021) 3840 888

Kantor Cabang : Kelapa Gading : (021) 45851555 Bandung : (022) 6046699 DARI TERMINAL 1B BANDARA SOEKARNO-HATTA Computer Sabre/Abacus

PONTIANAK YOGYAKARTA SURABAYA BALIKPAPAN (PP)

PNK - BATAM

jam : 14.50 (Senin, Rabu, Jumat, Sabtu) Telp. (0778) 458 866

PNK - SINGAPURA

TERBANG SETIAP HARI DENGAN

JKT - JEDAH (PP) (PAKET UMRAH)

BOING 737 AIR BUS 319

Selasa, Kamis, Minggu Jam 13.25

-SINGAPURA -JEDAH

Reservasi PONTIANAK

atau hubungi BIRO PERJALANAN ANDA

Telp. (0361) 767 633 jam : 07.10, 14.00, 16.50 Telp. (0778) 458 866

PROGRAM ANGSURAN UMRAH YANG DISELENGGARAKAN BATAVIA AIR BEKERJA SAMA DENGAN PPUH YANG DITUNJUK

(0561)734488

jam : 13.15, 19.45

JKT - BATAM

3x

Reservasi JAKARTA

DI KONTRAKAN

PNK - KUCHING

jam : 06.00, 07.15, 09.15 14.30, 17.20, 19.20, 21.00 Telp. (031) 504 9666

jam : 09.05, 15.30 (Balikpapan) Telp. (0431) 877 878, 879 674/77

Deny Jaiz Hadi Uray Yuzo Solihin

JKT - MANOKWARI

Telp. (0274) 32262

JKT - MANADO

• • • • • •

BATAM - MEDAN

jam : 20.00, 22.45 Telp. (0967) 550666, 683, 684

JKT - SURABAYA

7x

PEMASANGAN IKLAN HUBUNGI :

JKT - JAYAPURA

Telp. (024) 3549888

JKT - YOGYA

2x

Komp Batara Indah 1 Blok ii no 18. 2 Lt, 4 kmr, PLN, PDAM. Sebidang tanah jl karet tepi jln luas 10x20. Tanah kaplingan 18x10 d sungai raya dalam. Hub: 08125733579.

Komp. Mitra Indah Utama 6 C.61 Type 48,PLN,Sumur Bor,SHM,Serdam Hub : 081257989839

UMRAH

Trust Us To Fly Harga Paket Umrah Mulai

Rp. 12.500.000,Paket Perjalanan Umrah selama 9 hari 7 malam Paket umrah diangsur dengan jangka waktu angsuran: - Paket angsuran 6 bulan - Paket angsuran 12 bulan - Paket angsuran 24 bulan - Paket angsuran 36 bulan


7

sambungan

Siswa Berprestasi Dikirim ke Jepang BENGKAYANG. Pemerintah Kabupaten Bengkayang selangkah lebih maju dalam meningkatkan kualitas Sumber Daya Manusia (SDM) nya. Betapa tidak, bagi siswa berprestasi asal Bumi Sebalo, tahun ini akan dikirim ke Jepang untuk menjalani tugas belajar. Drs Kristianus Anyim MSi, Sekretaris Daerah Kabupaten Bengkayang mengatakan, mekanisme bantuan sosial yang akan diberikan untuk setiap organisasi kemasyarakatan dan tidak dalam bentuk berulangulang (Serpipat) pada organisasi yang sama, kecuali untuk organisasi yang berhubungan dengan

olahraga dan pendidikan dapat diajukan berulang-ulang. Untuk beasiswa anak berprestasi, pemerintah prioritaskan. Karena berkaitan dengan generasi jangka panjang, dan merupakan aset Pemda Bengkayang yang akan menjadi penerus bangsa yang akan datang ungkap Anyim di gedung satu atap Bupati Bengkayang, belum lama ini. Berdasarkan Peraturan Menteri Dalam Negeri nomor 59/ 2007 tentang perubahan Peraturan Menteri Dalam Negeri nomor 13/2006 dan perubahan Peraturan Menteri nomor 21/2001 tentang pedoman pengelolaan

keuangan Daerah. Maka kebijakan ada di tangan Pemda. Pemerintah tidak ingin pemberian bantuan sosial salah persepsi dan tidak tepat sasaran, karena bantuan sosial harus pada orang yang benar-benar memerlukan, tetapi jika untuk beasiswa tidak ada alasan untuk tidak direalisasikan Beberapa tahun ini kita sudah mengirim banyak mahasiswa yang dibiayai oleh Pemda, rencana tahun ini kita akan menyekolahkan siswa Bengkayang yang berprestasi sampai ke Jepang, asalkan dia masih warga asli Kabupaten Bengkayang, jelasnya. (cah)

Drs Kristianus Anyim MSi

BI Pelototi Bisnis Jasa Pengiriman Uang Non-Bank BANDUNG. Bank Indonesia (BI) meminta pelaku bisnis Kegiatan Usaha Pengiriman Uang (KUPU) non-bank untuk mencatatkan diri sebagai badan hukum. Sebab sampai saat ini, masih ada pelaku bisnis KUPU yang menggunakan nama pribadi. Padahal, sudah ada UU Nomor 3 Tahun 2011 tentang Transfer Dana yang mensyaratkan pelaku binis KUPU non-bank harus berbadan hukum. Analis Madya Senior yang juga Ketua Tim Pemngaturan Sistem Pembayaran pada Direktorat Akunting dan Sistem Pembayaran BI, Puji Atmoko, menyatakan bahwa sampai saat masih terdapat bisis KUPU non-bank yang tidak berbentuk badan hukum. Berbicara dalam acara diskusi tentang UU Transfer Dana di Bandung, Sabtu (18/6), Puji mengungkapkan bahwa sampai saat ini terdapat 72 penyelenggara KUPU non-bank yang mengantongi izin dari BI. Bisnis KUPU antara lain banyak terdapat di daerah-daerah yang selama ini menjadi asal TKI.

Dari jumlah itu, yang belum berbadan hukum karena menggunakan nama pribadi ada 15 pelaku KUPU non-bank. Belum lagi yang tidak tercatat, ujarnya. Dia mencontohkan KUPU non-bank yang menggunakan nama pribadi yang marak di Batam, Kepulauan Riau. Dari catatan BI perwakilan Batam, terdapat 11 pelaku bisnis KUPU non-bank yang menggunakan nama pribadi di seluruh Kepri. Ada yang menggunakan nama Joni, Song Peng, Merry atau Hai Seng, sebut Puji. D i t a m b a h k a n ny a , b i s n i s KUPU non-bank yang menggunakan nama pribadi menjadi pilihan dalam pengiriman uang karena beberapa pertimbangan. Karena beroperasi 24 jam sehari, dan tujuh hari seminggu. Sementara bank jam operasinya terbatas. Bahkan KUPU yang pribadi itu terkadang mereka mau memberi talangan, jadi pengirim bisa ngutang dulu, imbuhnya. Puji juga mengatakan, KUPU memang merupakan bisnis

yang menjanjikan. Persaingan bisnis KUPU antarbank maupun non-bank pun semakin tinggi. Dari catatan BI, volume dan nilai transfer dana di Indonesia semakin meningkat signifikan dari tahun ke tahun. Sampai Mei 2011, ungkap Puji, rata-rata harian jumlah transfer dana melalui sistem kliring mencapai 406.252 transaksi dengan total nilai sekitar Rp 7,9 triliun/ hari. Sedangkan transfer dana melalui sistem BI-RTGS pun jumlahnya mencapai 62.765 transaksi.dengan total nilai Rp 215,57 triliun/ hari. Sedangkan rata-rata transfer dana melalui KUPU non-bank, hingga 21 April 2011 lalu mencapai 4.107 per hari dengan nilai transfer mencapai Rp 21,4 miliar per. Padahal setahun lalu, BI mencatat pada Juni 2010 hanya terdapat 2586 transfer per hari melalui KUPU non-bank dengan nilai Rp 10,2 miliar. Namun lagi-lagi Puji mengingatkan, sekarang bisnis KUPU harus berizin dan berbentuk badan usaha. Menurutnya, BI memberi kesempatan selama

dua tahun kepada pelaku bisnis KUPU non-bank yang menggunakan nama pribadi untuk membentuk badan usaha. Bagi yang telah berizin dari BI namun belum berstatus sebagai badan hukum, wajib berbadan hukum Indonesia dalam waktu dua tahun sejak UU Transfer Dana diundangkan sejak 23 Maret 2011, tambahnya. Karenanya, diperlukan adanya perlidungan hak dan kewajiban para pihak yang terlibat dalam transfer dana, seperti para pengguna jasa dan penyelenggaranya. Selain itu, setiap transfer juga harus dilaporkan ke BI. Badan usaha yang telah melakukan penyelenggaraan transfer dana dan memperoleh izin dari institusi lain di luar BI, seperti jasa pengiriman yang memperoleh Izin Kementerian Komunikasi dan Informasi, maka izinnya tetap berlaku dan diakui sebagai penyelenggara setelah melaporkan kegiatannya kepada BI dalam waktu paling lambat enam bulan, kata Puji.(ara/jpnn)

Izin Pertambangan Galian C Dipersulit BENGKAYANG. Proses pembuatan izin yang dilakukan Syaiful, warga Seluas untuk membuka usaha penambangan Galian C ternyata tak mudah. Ibarat bola, Ia terpaksa bolakbalik ke Dinas Pertambangan, Energi dan Mineral, Kantor Perizinan, Pelayanan Terpadu namun tak menghasilkan apa yang diinginkan. Ia pun beranggapan proses pembuatan izin di Bengkayang berbelit-belit. Mungkin Dinas (Distamben)

dan Kantor Perizinan (KP2T) Bengkayang bingung untuk memproses izin tersebut, karena mungkin saya adalah masyarakat Bengkayang pertama yang punya niat membuat izin penambangan Galian C, ungkap Syaiful, ditemui di kediamannya di Seluas, belum lama ini. Syaiful mengisahkan, keinginannya membuat izin atas usaha Galian C tidak lain adalah agar usaha yang dijalankannya resmi (legal), sehingga tidak dikejar-kejar akan rasa ber-

salah karena tak memiliki izin. Galian C yang dimaksud adalah penambangan pasir di alur Sungai Kumba, Seluas. Selain itu, dengan adanya keberadaan izin itu juga turut memberikan sumbangan pendapatan kepada daerah, yakni dengan membayar pajak. Syaiful menjelaskan, beberapa persyaratan untuk proses pembuatan izin yang dimaksudnya tersebut sudah dipersiapkan sejak akhir tahun 2010 lalu, seperti surat pengantar

Morkes Klaim Dijelaskan dia, untuk menetapkan suatu kasus di-SP3 bukanlah perkara sembarangan. Penegak hukum harus lebih dulu melakukan investigasi dan melakukan gelar perkara. Jika memang tidak ditemukan indikasi penyimpangan, baru kemudian dikeluarkan SP3. Mencuatnya kasus Riam Merasap, menurut Morkes dimungkinkan berkaitan dengan Pilgub 2012. Mungkin saja. Saya melihat lebih banyak nuansa politisnya ketimbang hukum. Kalaupun menyangkut masalah hukum yang mengeluarkan uang itu kan harus melalui Sekda, tutur magister ilmu hukum jebolan Universitas Tanjungpura itu. Selaku Ketua DPD Golkar Provinsi Kalbar, Morkes tegastegas menyatakan dirinya siap bertarung dalam Pilgub 2012 mendatang. Bahkan usai acara Diklat Kader Fungsional DPD

Golkar Ketapang, pernyataan tersebut diulangnya kembali. Saya siap maju di Pilgub nanti. Soal menang-kalah itu urusan belakangan, tegasnya. Ia mengatakan selain alasan untuk marwah (harga diri, red) partai Golkar, niatnya maju pada Pilgub untuk melawan kezaliman yang dilakukan kepemimpinan saat ini di Kalbar. Contohnya masalah aset KONI. Padahal soal KONI itu harusnya mendapat persetujuan DPRD lebih dulu. Saya juga terkadang kesal dengan anggota legislatif dari Golkar yang diam melihat kezaliman itu. Belum lagi soal proyek-proyek multi years, bebernya. Morkes juga mengkritik pengangkatan pejabat birokrasi di jajaran Pemprov Kalbar yang lebih menonjolkan unsur sektarian, bukan pada kompetensi yang dimiliki pegawai. Makanya harus kita lawan. Harus ada

.... . dari halaman 1 yang berani melawan kezaliman yang ada, tegasnya lagi. Sementara itu, sikap Kejati Kalbar yang menghentikan proses hukum dugaan korupsi proyek Riam Merasap di Kabupaten Ketapang terus menuai kritikan. Korps Adhyaksa tersebut diingatkan untuk mengedepankan prinsip keadilan dalam menangani perkara hukum. Kita minta Kejati tidak tebang pilih dalam menegakkan hukum, termasuk dalam perkara Riam Merasap ini, tegas Martinus Sudarno SH, anggota DPRD Kalbar dari Fraksi PDI Perjuangan kepada Equator, Minggu siang (19/6). Darno, panggilan akrab Martinus Sudarno, menilai ada keanehand alam keputusan Kejati Kalbar yang menghentikan proses hukum kasus tersebut. Barang yang sudah dianggarkan ratusan miliar, tapi tidak berfungsi, berarti ada yang

salah, yakin Darno. Kondisi proyek air bersih Riam Merasap menurut Darno hampir sama dengan proyek pipanisasi Poring di Kabupaten Melawi. Anehnya, Kejati justru getol menangani proyek di Melawi, sementara di Ketapang tidak disentuh. Makanya kita harapkan Kejati adil. Jangan karena ini daerah atau orang tertentu, tidak diproses, serunya. Legislator asal Daerah Pemilihan (Dapil) Sekadau-Sanggau itu menambahkan, Kejati mestinya tidak buru-buru menghentikan proses hukum kasus itu. Harusnya mereka lebih teliti agar permasalahan tersebut tidak menjadi blunder di kemudian hari. Belum diproses saja sudah dihentikan. Diperiksa dulu saksi-saksi. Ini kan untuk kepentingan rakyat banyak di Ketapang, tuntasnya. (kia/bdu)

Kalbar mengungkapkan, jumlah 700 peserta asal Kalbar tidak semuanya dari Penggalang. Untuk tiap kabupaten/kota (Kwartir Cabang/Kwarcab), kouta Penggalang yang ikut masing-masing 32 orang. Selebihnya ada Pembina, tim medis, dan peninjau. Khusus untuk penijau, urusan pembiayaan tanggungjawab mereka, tutur Syarif Abdullah. Syarif Abdullah menegaskan, semua kesiapan keberangkatan rombongan dari Kalbar sudah rampung. Seluruh rombongan direncakan akan diberangkatkan tanggal 27 Juni sekitar pukul 01.00 siang menggunakan kapal Mabuhai. Tanggal 29 pagi rombongan diperkirakan tiba di Jakarta. Begitu tiba, rombongan selanjutnya akan diberangkatkan ke Palembang, Sumatera Selatan mengunakan 14 buah bus. Setelah penutupan pada 9

Juli nanti, rombongan akan kembali ke Jakarta. Dari Jakarta kita akan menunggu jadwal kapal untuk kembali ke Kalbar, tuntas Syarif Abdullah. Aspek keamanan rombongan Kalbar selama mengikuti Jambore, Pimpinan Kontingen Wanita Jamnas Kalbar, AKP Salbiah menyakinkan keamanan rombongan akan menjadi perhatian serius. Berdasarkan pengalaman, saya rasa tidak ada masalah, tutur Salbiah. Wanita yang akhirnya menjadi anggota Polri karena aktif di Pramuka ini menegaskan, sebagai pimpinan kontingen wanita tingkat Kwarda, ia akan mengintensif koordinasi degan pimpinan di tingkat bawah. Di tingkat Kwarcab kan juga ada pimpinan kontingen. Jadi kita saling berkoordinasi. Kalau mengikuti Juklak dan Juknis yang sudah ada, saya rasa aman, tutur Salbiah. (bdu)

Kalbar Siap memutuskan anggaran, serta para orang tua Penggalang yang ikut berangkat. Memang dalam waktu dekat manfaat dari Pramuka belum begitu terasa. Namun dalam jangka panjang, kegiatan dan keberadaan Pramuka bisa mencerahkan pemikiran generasi muda serta memberikan citra positif bagi anggota Pramuka sendiri, ujarnya. Kalbar, lanjutnya, tidak hanya mengirimkan kontingennya pada ajang Jambore Pramuka Nasional 2011 di Palembang. Tetapi juga, berhasil mengirimkan anggotanya untuk mengikuti Jambore Asia Pasifik dan Jambore Dunia. Tahun lalu kami berhasil mengirim empat peserta ke Jambore Asia Pasifik di Filipina. Tahun ini, kami dapat bagian lagi untuk mengirim dua orang peserta untuk ikut Jambore Dunia di Swedia pada Juli men-

datang, masing-masing satu dari Kabupaten Sambas, dan satu dari Kabupaten Sekadau, ungkap Suryadi bangga. Ditegaskannya, Jambore Dunia yang akan diikuti nanti bukan suatu kompetisi hanya berupa permainan-permaianan yang menyenangkan. Karenya, dalam keikutsertaan tersebut, Kwarda Kalbar tidak memiliki target untuk menang atau semacamnya, tetapi memberikan wawasan kepada peserta asal Kalbar untuk melihat dunia. Dengan begitu, akan tampak bahwa Pramuka itu tidak ada perbedaan didalamnya. Semua membaur menjadi satu. Tidak ada perbedaan fisik, dan menjadi suatu pesan perdamaian dunia, pesan persaudaraan serta pesan penghargaan, tukasnya. Wakil Ketua Kwarda Kalbar, Drs H Syarif Abdullah Alkadrie yang juga menjabat sebagai Ketua Panitia Jamnas

dari Kepala Desa, Camat serta beberapa persyaratan yang dibutuhkan. Namun tak semua persyaratan yang diperlukan untuk membuat izin tersebut diketahui, Syaiful lantas berkomunikasi dengan pihak Dinas Distamben. Tetapi, setelah menunggu beberapa lama dan bertemu dengan pihak yang dimaksud, ia diarahkan untuk menanyakan persyaratan tersebut pada Kantor Perizinan, Pelayanan Terpadu. (cah)

.... . dari halaman 1

Senin, 20 Juni 2011

Kalbar Potensial pemenuhan pangan bukan hanya pelanggaran atas hak hidup dan asasi rakyat, tapi juga menjadi masalah besar ketahanan dan stabilitas negara. Bila upaya kemandirian dan kedaulatan pangan ini tidak segera direalisasikan, maka ancaman krisis pangan nasional akan menjadi masalah besar bangsa. Ancaman krisis pangan ini semakin nyata dengan adanya bencana alam, perubahan cuaca yang ekstrem, maupun tata niaga pangan internasional yang semakin monopoli dan tidak adil, bebernya. Masalah ketahanan pangan memang cukup mengkhawatirkan. Walau pun sudah banyak langkah yang dilakukan, tetap saja ada masyarakat yang mengalami kekurangan pangan pada fase yang kritis. Meski dunia mampu memberi makan 12 miliar manusia tanpa masalah, namun nyatanya 826 juta manusia di dunia saat ini menderita kekurangan pangan kronis, jelas Daniel. FAO pun mengakui bahwa krisis pangan tengah melanda

dunia dengan naiknya harga pangan hingga 75 persen maupun meningkatnya permintaan pangan. Sementara stok negaranegara produsen semakin sedikit. Saat ini 36 negara tengah menghadapi rawan pangan kronis. Sementara di Indonesia yang memiliki tanah subur dan sebagai negara agraris, 13,8 juta penduduknya menderita rawan pangan, seperti di NAD, NTT, Sulut, Lampung, Bali, Jatim, dan sebagian Kalimantan. Krisis pangan terjadi ketika kebutuhan pangan Indonesia telah tergantung kepada impor dan harganya tak terkendali, tegas Daniel. Berdasar neraca ekspor-impor pangan Indonesia pada 2008, nilai defisit mencapai Rp 28,7 triliun. Angka ini jauh di atas anggaran Kementerian Pertanian 2011 yang hanya sebesar Rp 18,7 triliun. Dan hingga Februari 2011 defisit ini tetap berlanjut. Daniel membeberkan, ada beberapa sebab yang membuat Indonesia tidak mandiri apalagi

Riam Merasap mimpinan Bupati Morkes Effendi yang berpasangan dengan Henrikus. Seharusnya pak Henrikus selaku Bupati Ketapang saat ini mempertanyakan hasil audit BPKP yang menyatakan tidak menemukan kerugian negara. Tidak mungkin tidak ada kerugian negara dalam kasus ini, tegasnya. Lebih jauh, Ketua Advokasi dan HAM Rumpun Masyarakat Arus Bawah (RMAB) Kabupaten Ketapang ini memaparkan indikasi kerugian negara sudah sangat jelas, dimulai dengan perencanaan tidak benar. Setiap perencanaan tidak benar tentunya berdampak pada kerugian negara. Kita tidak menuduh namun kita patut menduga mungkin ada oknum BPKP sudah masuk angin sehingga dengan berani menyatakan tidak ada kerugian negara, papar Umar. Menurut Umar, uang yang nilainya lebih dari Rp 100 miliar tersebut sesungguhnya berguna bagi kepentingan hajat hidup masyarakat. Hanya saja, uang negara terkesan dihambur-hamburkan lantaran proyek yang dibangun tidak memberikan manfaat bagi masyarakat. Makanya, Bupati Ketapang sekarang kita harap agar mempertanyakan hasil audit ini pada BPKP dan bila perlu tuntut BPKP secara hukum. Patut dipertanyakan dari mana kajiannya tidak merugikan negara. Sedangkan sudah jelas kehadiran proyek ini sama sekali tidak menguntungkan masyarakat, tuntasnya.

atlet kita tidak perlu diragukan lagi, tegasnya. Hal yang sama juga dilakukan oleh Pengprov (Persatuan Olahraga Dayung Seluruh Indonesia (PODSI) Kalbar. Bahkan direncanakan semua nomor lomba dayung akan dipersiapkan guna mengikuti Pra PON. Namun, diperkirakan nomor Dragon boat memiliki peluang untuk bisa lolos ke PON, ungkap Abdi selaku pengurus PODSI Kalbar terkait persiapan Kalbar dalam keikutsertaannya pada Pra PON yang akan berlangsung di Karawang pada Desember 2011. D i p e r s i a p k a n ny a s e m u a nomor lomba pada Dayung berdasarkan pemikiran yang secara geografis Kalbar memiliki potensi jika dibandingkan daerah lainnya. Hanya saja persiapan semua nomor lomba

juga tergantung dari pendanaan yang ada. Jika tidak memungkin semua nomor dipersiapkan, kemungkinan besar PODSI Kalbar akan fokus di nomor lomba kategori Dragon Boat, katanya. Menurut Abdi, dalam persaingan memperebutkan prestasi di tingkat nasional, Kalbar pernah mencatatkan sejumlah prestasi dengan tampilnya beberapa pedayung Kalbar memperkuat tim Dayung Indonesia pada kejuaraan Asia bahkan Internasional beberapa tahun yang lalu. Sehingga atas dasar itu pula PODSI Kalbar saat ini memiliki keinginan untuk bisa meraih prestasi serupa mengingat potensi pedayung Kalbar saat ini sangat menjanjikan bisa berprestasi. (bersambung)

pameran. Bahkan, peserta dari Kabupaten Kapuas Hulu dipastikan paling ramai. Informasinya rombongan dari Kapuas Hulu sebanyak 80 orang. Makanya, untuk menampung para peserta nantinya kita telah menyiapkan rumah penduduk untuk ditempati selama kegiatan berlangsung, sebab hotel maupun penginapan tak sanggup menampung jumlah peserta, jelasnya. Dibagian lain, Sekda menyampaikan, bahwa peringatan

HUT Kabupaten Kayong Utara ke-4 tahun ini dirayakan cukup semarak. Beragam cabang olahraga termasuk permainan rakyat dan hiburan masyarakat disuguhkan guna menyemarakkan acara tahunan ini. Banyak hadiah yang kita siapkan termasuk lebih dari 10 unit sepeda yang akan kita berikan bagi yang beruntung, selain dari pemerintah daerah hadiah juga banyak dari pihak swasta yang ikut berpartisipasi dalam acara ini, ujarnya. (lud)

.... . dari halaman 1

.... . dari halaman 1

Syahdan-Bruno jenis gugatan yang diserahkan yakni Permohonan Perselisihan Hasil Pemilukada Kabupaten Landak tahun 2011. Kemudian Surat Kuasa dan daftar serta alat bukti mulai dri P.1 s/d P.12 dengan masing-masing 12 eksemplar. Semua berkas-berkas diserahkan langsung oleh saya sendiri bersama rekan saya Drs Bakhtarudin Nur SH MH beberapa waktu lalu, kata Lifkoi.

.... . dari halaman 1 nya Kepala Desa Simpang Tiga, Rajali biasanya minta bantuan pengusaha untuk mendapatkan BBM. Terkadang Kepala Desa juga mengaku malu karena selalu meminta bantuan pengusaha untuk bisa mengalirkan air bersih Riam Berasap ke boster di Dusun Siduk, ujarnya. Sekadar diketahui, air bersih Riam Berasap yang dialirkan ke booster Dusun Siduk bersumber dari booster yang terletak di KM 2 Desa Riam Berasap Jaya, Kecamatan Sukadana. Booster KM 2 Desa Riam Berasap Jaya berkapasitas jauh lebih besar untuk menampung air jika dibanding dengan booster yang ada di Siduk. Sedangkan pusat instalasi air bersih Riam Berasap berada di KM 12. Sebelumnya, Herman Wimpy juga meminta ada ketegasan dari pejabat yang berkuasa sekarang untuk menyikapi persoalan air bersih Riam Berasap. Ketua DPC PPD Kabupaten Ketapang ini meminta agar pemerintahan sekarang tidak lepas tanggungjawab. Pemerintah sekarang harus tegas, apakah proyek ini dilanjutkan atau tidak. Jika lanjut harus tegas katakan lanjut dan jika tidak maka bagaimana pertanggungjawabannya kepada masyarakat. Apakah besi yang tertanam akan dijadikan besi tua dan ini juga sudah sangat merugikan ujar Ketua Front Pembela Merah Putih (FPMP) Kabupaten Ketapang ini lantang. (lud)

KKU Tuan Kita juga menyiapkan stand untuk pihak lain yang ingin ikut andil dalam kegiatan ini. Bagi kita Pertasi Kencana ini sangat membawa dampak positif dan ini juga bisa menjadi bagian pengalaman bagi Kayong Utara jika nanti dipercaya untuk menjadi tuan rumah MTQ tingkat Kalbar, ungkap Hendri menjawab Equator. Sejauh ini, diakui Hendri, sudah banyak peserta dari kabupaten/kota se Kalbar yang daftar untuk menampilkan

berdaulat dalam pangan. Antara lain, kebijakan privatisasi, liberalisasi, dan deregulasi yang tidak tepat. Persoalan-persoalan tersebut membuat Indonesia tidak memiliki kekuatan dalam mengatur produksi, distribusi, dan konsumsi di sektor pangan. Indonesia telah tergantung oleh mekanisme pasar yang industri hilir dan distribusinya dikuasai monopoli kartel oleh sedikit perusahaan multinasional seperti Cargill dan Charoen Phokpand. Untuk itu, pelatihan pemberdayaan petani di Kalbar ini diharapkan menjadi bagian yang mampu mendorong kemandirian dan kedaulatan pangan di Kalbar. Jangan sampai Kalbar masuk ke dalam peta rawan pangan nasional, imbuhnya. Sebaliknya Kalbar harus menjadi bagian utama dalam mewujudkan kemandirian dan kedaulatan pangan nasional. Apalagi pemda provinsi dan kabupaten memiliki visi dan semangat yang sama mewujudkannya, kata Daniel lagi. (bdu/*)

Hanya janji Secara terpisah, Ahmad, warga Dusun Siduk, Desa Simpang Tiga, Kecamatan Sukadana Kabupaten Kayong Utara mengungkapkan, sudah bosan mendengar isu air bersih Riam Berasap akan dioperasionalkan secara maksimal. Bahkan, pemuka masyarakat Desa Simpang Tiga ini juga sudah puas mendengar kabar akan ada pemasangan instalasi ke rumahrumah. Dulu katanya bagi yang mau pasang ke rumah bayar Rp 700 ribu, dan saya senang mendengarnya karena tidak susahsusah lagi mendapatkan air bersih. Namun sampai sekarang tidak ada dan rupanya hanya janji semu, katanya. Desa Simpang Tiga sebelum Kabupaten Kayong Utara terbentuk pada 26 Juni 2007 lalu, merupakan bagian dari wilayah Kabupaten Ketapang. Bahkan, Ahmad pernah bekerja sebagai penjaga atau penanggung jawab booster (bak penampung air Riam Berasap) yang terletak di Dusun Siduk, Desa Simpang Tiga. Dulu saya digaji perbulan Rp 300 ribu, namun sekarang sudah tidak lagi. Namun, sekarang ada dua orang yang ditugaskan, dan kalau tidak salah masing-masing digaji Rp 600 ribu, jelasnya. Dikisahkan Ahmad, untuk mendapatkan air bersih Riam Berasap masyarakat harus sumbangan untuk membeli minyak solar supaya air Riap Berasap dapat disedot. Kalaupun tidak memungut sumbangan, diakui Ahmad, maka demi masyarakat-

Cabor Tenis 2012 mendatang. Selain itu, KONI Provinsi Kalbar juga memberikan kemudahan untuk PTMSI melakukan pemusatan latihan daerah (Pelatda) hingga Oktober mendatang. Kendati pada bulan Agustus menghadapi bulan Suci Ramadhan (puasa). Sehingga frekuensi latihan atlet kita kurangi pada bulan Puasa, ujarnya. Semua ini, pada dasarnya PTMSI Kalbar siap menghadapi Pra PON, meski kekuatan tim putri Kalbar belum bisa berbicara di tingkat nasional. Namun, tim tenis meja putra Kalbar sering berbicara di tingkat nasional. Selain itu, kelemahan atlet tenis meja Kalbar ada pada fisik. Sehingga hal ini yang akan menjadi prioritas Pengprov PTMSI Kalbar untuk mencari cara agar fisik para atlet bisa bagus. Sedangkan skill dan speed para

.... . dari halaman 1

Gugatan tersebut diserahkan ke MK tepat 3 hari sebagaimana yang telah diatur dalam peraturan KPU nomor 14 tahun 2011 pasal 30 ayat 2. Hal tersebut dilakukan atas dasar bukti-bukti yang kuat terkait dengan money politic dalam Pemilukada Landak. Jadi kami melakukan gugatan secara resmi. Adapun bukti-bukti dilapangan termasuk video

.... . dari halaman 1 sudah kami persiapkan sebagai alat bukti dan kalau memang terbukti maka harus diambil tindakan jelas sesuai aturan yang berlaku, tegas Lifkoi. Gugatan ini, kata Lifkoi, harus tetap berlanjut sesuai prosedur. Intinya pihak Syahdan-Bruno mengajukan ini sebagai proses berdemokrasi dan akan tetap menghormati aturan mainnya, tandasnya. (rie)


L GA 8

SENIN, 20 JUNI 2011

Jose Mourinho

Chelsea Serobot Neymar Berita dari Inggris mengklaim bahwa Real Madrid berhasil menelikung negosiasi Chelsea dengan Neymar, dan Jose Mourinho adalah dalang utamanya. The Sun melansir bahwa posisi tawar Los Blancos kini lebih kuat

Fernando Torres bersikukuh dirinya tidak merasa menyesal hengkang ke Chelsea, dan mengakui kalau musim lalu merupakan musim terburuk sepanjang karirnya di ajang Premier League. Torres hengkang dari Liverpool ke Chelsesa di bulan Januari lalu dengan nilai transfer sebesar 50 juta pound, dan selama bergabung dengan the Blues, Torres hanya mampu mencetak satu gol dari 18 kali penampilannya. Buruknya penampilan Torres di musim lalu, mencuatkan spekulasi jika Torres sulit beradaptasi dengan kehidupan di Stamford Bridge, meskipun ia langsung membantah kabar tersebut. Torres mengakui jika ia tidak pernah mencapai performa 100% semenjak memperkuat Liverpool ataupun Chelsea, tapi Torres berniat untuk melupakan semua kejadian buruk di masa lalunya. Bagi saya, musim lalu merupakan yang terburuk semenjak kali pertamanya saya datang ke Inggris, kata Torres seperti dilansir The Sun. Cedera yang membekap saya semenjak akhir Piala Dunia tahun lalu sudah merusak performa saya dan membuat segala hal menjadi rumit sepanjang karir saya, jelasnya. Dua belas gol sepanjang musim lalu tidak berarti bagi saya, karena saya tidak pernah bisa tampil 100%, baik untuk Liverpool ataupun Chelsea. Saya berusaha melupakan semua yang terjadi tapi saya tidak pernah menyesal bergabung dengan Chelsea. Saya yakin jika ritme permainan Chelsea sudah selaras maka kami akan sulit untuk dikalahkan, cetusnya. Sepanjang penampilannya di Chelsea, Torres tampak kesulitan saat dipasangkan dengan Didier Drogba, tapi penyerang internasional Spanyol tersebut bersikeras jika mereka mampu membangun kerjasama yang sukses untuk kedepannya. Saya tidak punya masalah dengan Drogba, ujar Torres. Sejujurnya, saya bisa menjalin kerjasama dengan Didier. Ia adalah seorang pesepak bola yang sensasional dan rivalitas yang terjadi di antara kami cukup positif untuk Chelsea, tambahnya. (BN)

Media Spanyol

Klaim Sanchez Sepakat ke Barca Kabar kedekatan Alexis Sanchez dan Barcelona kembali menguat. Yang terbaru, media Spanyol mengklaim kalau pemain Udinese itu akan segera merampungkan proses transfernya setelah menyetujui 39 juta euro (478 miliar rupiah) yang ditawarkan Barca. Seperti yang dilaporkan salah satu media Spanyol, Sport, Blaugrana meningkatkan pendekatan mereka atas Sanchez setelah usaha mereka untuk mendapatkan Giuseppe Rossi ditolak oleh Villarreal. Barca dikabarkan menaikkan tawaran mereka sebesar 39 juta euro dan mengajukan permohonan kepada tim nasional Chili untuk melepas Sanchez selama sehari dari latihan persiapan Copa America. Disebutkan, Senin (20/6) ini, Barca, Udinese, dan Sanchez a k a n segera merampungkan proses kontrak tersebut. Jika memang benar terwujudkan, hal ini berarti Barca dapat dikatakan mengalahkan Manchester City dalam memburu tanda tangan pemain berjuluk El Nino Maravilla ini. (foti/fjr)

19 tahun tersebut dari klubnya saat ini, Santos. Roman hanya mau mengeluarkan uang senilai 30 Juta poundsterling sementara, Mou berani menawar 10 Juta lebih banyak atau 40 Juta Pounds untuk Neymar. (sun/lex)

Piala Eropa U-21

Fernando Torres

Tak Menyesal ke Chelsea

dari The Blues Chelsea. Hal itu dipicu Jose Mourinho yang ingin mengalahkan mantan bos lamanya Roman Abramovich. The Special One berani mengucurkan uang yang lebih banyak untuk mengamankan jasa striker berusia

Islandia

3-1

Denmark

CONCACAF GOLD CUP Hasil (18/6) Meksiko 2-1 Guatamela (Meksiko Lolos ke Semi Final) Honduras 1-1 Kosta Rika (Honduras Lolos ke Seminal Menang Adu Penalti 4-2)

Senin (20/6) USA 0 : 1 Jamaica Panama 0 : 3/4 El Salvador

PIALA EROPA U-21 Hasil (18/6) Iceland 3 - 1 Denmark Switzerland 3 - 0 Belarus

GRUP A 1. Swiss 2. Belarusia 3. Islandia 4. Denmark

3 3 3 3

3 1 1 1

GRUP B: 1. Spanyol 2. Republik Ceska 3. Inggris 4. Ukraina

2 2 2 2

1 1 1 0 0 2 0 1

0 0 0 0

0 1 2 2

9 3 3 3

0 4 1 3 0 2 1 1

SEMIFINAL I: Rabu (22/6): Juara Grup A vs Runner-up Grup B SEMIFINAL II: Rabu (22/6 ): Juara Grup B vs Runner-up Grup A PEREBUTAN TEMPAT KETIGA: (sekaligus play-off perebutan 1 tiket Olimpiade 2012) Sabtu (25/6): Kalah SEMIFINAL I vs Kalah SEMIFINAL II di Aalborg

Tersingkir di Kandang Tuan rumah Denmark harus melupakan mimpi berjaya di negara sendiri pada kejuaraan Euro U-21 tahun ini. Skuad Dinamit Junior harus tersingkir dari turnamen usai dikalahkan Islandia U-21. Sialnya, Islandia yang sukses meraih kemenangan juga gagal melaju ke empat besar. Bertanding di Energi Nord Arena pada laga terakhir di penyisihan grup, Minggu (19/6) dini hari WIB, Denmark tampil dengan misi wajib menang untuk memastikan tiket semifinal. Sementara itu, Islandia yang sudah dipastikan tersingkir, usai menelan dua kekalahan beruntun di dua laga awal, tampil tanpa beban. Tampil dengan beban meraih kemenangan, membuat para pemain muda Denmark ini sedikit tertekan. Alhasil, Christian Eriksen dkk pun kerap gagal memanfaatkan setiap peluang yang didapat karena kurang tenang dalam

penyelesaian akhir. Skor kacamata pun bertahan hingga turun minum. Di awal babak kedua atau tepatnya menit 52, Islandia terpaksa bermain tanpa bimbingan pelatih, menyusul kartu merah yang diberikan wasit kepada Eyjolfur Sverrisson, diduga karena melontarkan kata-kata kasar. Namun, tanpa dukungan pelatih Islandia justru tampil lebih solid. Mereka bahkan berhasil membuat kejutan di menit ke-59, lewat aksi Kolbeinn Sigthorsson yang sukses mencetak gol pertama Islandia di turnamen ini dan sekaligus membawa timnya memimpin 1-0. Situasi kian buruk buat anak asuh Keld Bordinggaard setelah dua menit kemudian, Islandia menggandakan keunggulan lewat tandukan Birkir Bjarnason memanfaatkan umpan silang. Tertinggal dua gol, para pemain Denmark melakukan serangan sporadis demi

mengejar defisit gol. Kerja keras mereka sedikit memberikan harapan setelah Bashkim Kadrii berhasil memperkecil ketertinggalan menjadi 1-2 pada menit ke-81. Sayang, upaya keras tuan rumah akhirnya sia-sia setelah di penghujung laga, Islandia berhasil memperbesar keunggulannya menjadi 3-1 lewat gol Hjortur Logi Valgarosson. Dengan hasil ini, Denmark terpaksa harus mengubur impian lolos ke semifinal. Sementara bagi Islandia, kemenangan ini juga harus berujung sia-sia karena mereka juga gagal lolos usai kalah bersaing dengan Belarusia yang pada saat bersamaan kalah dari Swiss. Denmark, Islandia dan Belarusia diketahui memiliki poin sama, yakni tiga di klasemen akhir penyisihan grup. Namun, Belarusia berhak mendampingi Swiss ke semifinal, karena unggul dalam head to head. (acf/okz)

Bojan Krkic

Segera ke AS Roma Kepastian Bojan Krkic untuk memperkuat AS Roma musim depan rupanya akan segera terwujudkan. Direktur Olahraga Giallorossi, Walter Sabatini membenarkan kalau striker Barcelona itu akan merampungkan proses kepindahannya dalam hitungan hari saja. Bojan memang pemain muda Barca yang penuh talenta. Akan tetapi, dia selalu berada di bawah bayang-bayang Lionel Messi. Perjuangannya untuk mendapatkan tempat utama di tim Josep Guardiola kian sulit saja, setelah timnya itu mendatangkan David Villa di awal musim lalu. Jika transfernya memang benar terjadi nantinya, makan Bojan akan menjadi pemain Barcelona pertama yang akan menyusul Luis Enrique, pelatihnya semasa di Barcelona B dulu. Itu benar, dan saya dapat mengkonfirmasikan kalau ini adalah kesimpulan yang bisa direalisasikan, meskipun ini belum sepenuhnya sempurna, kata Sabatini kepada Rete Sport. Kami berharap dapat menyelesaikan transfer Bojan dalam beberapa hari ke depan, ujarnya. Media Spanyol memberitakan kalau Bojan datang ke Roma dengan biaya sebesar 10 juta euro (kisaran 122 miliar rupiah), meskipun sebenarnya pemain kelahiran Catalunya 28 Agustus 1990 lalu itu dibanderol Blaugrana sebesar 12 juta euro atau lebih dari 145 miliar rupiah. (foti/fjr)

A-G-E-N-D-A

Salah satu laga di liga Dara Nante Cup. M KHUSYAIRI/EQUATOR

Mandala Petik Poin Penuh

PS Sosok Tahan Bravo Imbang SANGGAU. Tim tuan rumah Mandala FC memetik poin penuh, setelah dalam laga babak 8 besar, lanjutan liga Dara Nante Cup di leg kedua, berhasil menggilas Entikong FC dengan score 2-1, Minggu (19/6). Laga di leg pertama, PS Sosok berhasil menahan Bravo, Kompi 642 Sanggau, dengan score akhir imbang 1-1. Merumput didepan seribuan supporter fanatiknya, Mandala FC yang diperkuat Heri Jumiadi, Abang Edy, Mafruzi, Safai, Mulyanto dan Erwin bermain ngotot sejak diawal laga. Bak gayung bersambut, Entikong FC pun mempertontonkan laga demikian. Entikong FC dimotori Hendriansyah, Purwanto, Siki dan Rony. Laga dimenit-menit awal, kedua tim sama-sama mengobarkan serangan yang dilancarkan dari berbagai sektor ke pertahanan lawan. Beberapa kali, peluang kedua tim hampir tercipta. Namun, berhasil dihalau barisan pertahanan masing-masing. Kedudukan imbang hingga jeda turun minum oleh wasit Juniardi. Usai jeda, kedua tim mengubah formasi serangan. Mandala FC lebih jeli membaca kelema-

han tim Entikong FC. Nasib apes bagi Entikong FC. Kemelut depan gawangnya, berbuah pelanggaran di finalti area. Heri sebagi eksekutor sukses mengoyak jala Entikong FC dengan sontekan keras dipojok kiri gawang. Permainan semakin a lot. Selang beberapa menit kemudian, Abang Edi melepaskan tendangan spekulasi dari jarak jauh, berhasil memperdayai kiper Entikong FC. Gol itu menambah keunggulan Mandala FC. Tertinggal 002, tak membuat Entikong FC patah arang. Bahkan semakin ganas berusaha mengejar ketinggalan. Pemain Entikong FC berhasil memperkecil kekalahan, setelah terjadi gol melalui tendangan pojok (corner kick). Gol itu mengubah kedudukan menjadi 2-1 untuk Mandala. Kedudukan itu bertahan hingga usai laga. Sementara laga di leg pertama, Bravo FC versus PS Sosok dengan hasil imbang 1-1 Laga ini dipimpin wasit Abang Dani, dengan inspektur pertandingan, Supardi serta komentator kawakan nan handal, Anjas Situmorang dari Semang-

gis Raya. Laga itu, Bravo FC berhasil merobek jala gawang PS Sosok terlebih dahulu, gol tercipta di menit, 23, melalui kaki Ratiman. Unggul 1-0, Bravo FC semakin gencar membombardir barisan pertahanan PS Sosok. Sebaliknya, PS Sosok pun semakin menggila untuk mengejar ketertinggalan 0-1 tersebut. Berkali-kali, pemain PS Sosok mencoba merangsek ke jantung pertahanan Bravo FC. Tapi selalu gagal dihalau pemain belakang Bravo FC yang notabene anggota TNI ini. Akhirnya, serangan demi serangan yang dilancarkan PS Sosok membuahkan hasil. Gol tercipta melalu kaki Agus, 40. Laga itu Bravo dimotori Ratiman, Ruslan, Aris, Supriono dan Gabriel. Sedangkan PS Sosok diperkuat Agus, Hendra, Budi, Kristo dan Pito. Score imbang 1-1 bertahan hingga usai laga. Laga 8 besar ini, berlangsung di GOR Sanggau Permai, menggunakan system setengah kompetisi. Berlaga hari ini, Senin (20/06) main pertama Entikong vs Mitra Andalas, main kedua PS Sosok vs POP. (SrY)

FINAL: Sabtu (25/6): Pemenang SEMIFINAL I vs Pemenang SEMIFINAL II di Aarhus

COPA AMERIKA 2011 GRUP A 1.Argentina 2. Kolombia 3. Kosta Rika 4. Bolivia GRUP B 1. Brasil 2. Paraguay 3. Ekuador 4.Venezuela GRUP C 1.Uruguay 2. Chili 3. Meksiko 4. Peru

KLASEMEN EURO 2012 GRUP A 1. Jerman 2. Belgia 3. Turki 4. Austria 5. Azerbaijan 6. Kazakhstan

7 7 6 6 6 6

7 3 3 2 1 1

0 2 1 1 0 0

0 2 2 3 5 5

22-3 15-10 9-7 10-10 5-18 2-15

21 11 10 7 3 3

GRUP B 1. Irlandia 2. Rusia 3. Slovakia 4. Armenia 5. Macedonia 6. Andorra

6 6 6 6 6 6

4 4 4 2 1 0

1 1 1 2 1 0

1 1 1 2 4 6

11-6 9-4 6-4 10 -7 5-8 1-13

13 13 13 8 4 0

GRUP C 1. Italia 2. Slovenia 3. Serbia 4. Estonia 5. Irlandia Utara 6. Kepulauan Faroe

6 5 5 4 4 5

4 2 2 2 1 0

1 1 1 0 2 1

0 2 2 2 1 4

11-1 7-4 7-8 6-5 3-3 3-16

16 7 7 6 5 1

GRUP D 1. Perancis 2. Belarus 3. Albania 4. Bosnia- Herzegovina 5. Romania 6. Luksemburg

6 6 5 4 4 5

4 2 2 2 0 0

0 2 2 1 2 1

1 1 1 1 2 4

8-1 3-1 4-4 6-4 2-5 0-8

13 9 8 7 2 1

GRUP E 1. Belanda 2. Swedia 3. Hongaria 4. Finlandia 5. Moldova 6. San Marino

6 6 7 6 6 7

6 5 4 2 2 0

0 0 0 0 0 0

0 1 3 4 4 7

21- 5 18 20- 6 15 18- 13 12 11- 11 6 7-9 6 0-33 0

GRUP F 1. Yunani 2. Kroasia 3. srael 4. Georgia 5. Latvia 6. Malta

6 6 7 7 5 5

4 4 4 2 1 0

2 1 1 3 1 0

0 1 2 2 3 5

8-3 10-3 10-7 5-5 4-7 1-10

14 13 13 9 4 0

GRUP G 1. Inggris 2. Montenegro 3.Swiss 4.Bulgaria 5.Wales

5 5 5 5 4

3 3 1 1 0

2 2 2 2 0

0 0 2 2 4

11-3 4-1 7-7 2-6 1-8

11 11 5 5 0

GRUP H 1.Portugal 2.Denmark 3.Norwegia 4.Siprus Islandia

5 5 5 4 5

3 3 3 0 0

1 1 1 2 1

1 1 1 2 4

11-7 7-4 6-4 5-8 2-8

10 10 10 2 1

GRUP I 1. Spanyol 2. Republik Ceska 3. Skotlandia 4. Lithuania 5. Liechtenstein

4 4 4 3 3

4 2 1 1 0

0 0 1 1 0

0 2 2 1 3

1-24 4- 3 4- 5 2-3 1-8

12 6 4 4 0

LIGA INGGRIS Mulai (13/8) Blackburn

v

Wolves

Fulham

v

Aston Villa

Liverpool

v

Sunderland

Man City

v

Swansea

Newcastle

v

Arsenal

QPR

v

Bolton

Stoke

v

Chelsea

Tottenham

v

Everton

West Brom

v

Man Utd

Wigan

v

Norwich


CUSTOMER SERVICE - Ingin berlangganan - Koran datang siang - Tidak terima koran

Hubungi: Bagian Pemasaran Hp. 081345479786 (Santo) 08125746667 (Abu Bakar) 08125639448 (Mulyadi)

PATR LI

Anak Tiri Digoyang di Atas Sampan

Operasi Simpatik

Incar Pengendara Langgar Aturan PONTIANAK. Jajaran Satlantas Polda Kalbar terus melakukan razia dan mengincar pelangg ar yang nampak. Razia merupakan Operasi S A Simpat ik 2011, melakukan penertiban terhadap Komisaris Besar Latif pengendara menggunakan knalpot racing. Operasi Simpatik tersebut digelar untuk menertibkan para pengguna sepeda motor, terutama yang tidak memiliki kelengkapan sepeda motor. Banyak kendaraan yang tidak memiliki kelengkapan teknis, terutama tidak memiliki knalpot standar. Seperti knalpot racing yang bisanya mengganggu pengedara lainnya, mereka juga diindikasikan sebagai pembalap liar, kata Kombes Pol Latif, Dir Lantas Polda Kalbar, Minggu (19/6). Latif mengatakan, sejauh ini masih banyak pengendara sepeda motor mengganti knalpot kendaraan mereka dengan knalpot racing. Padahal melanggar Undang-undang nomor 22/2009 tentang Lalulintas. Halaman 12 YAMSUL

Berduaan di atas sampan mengarungi Sungai Pawan, IM, 45, warga Kampung Sampit, Kecamatan Delta Pawan memperkosa anak tirinya, sebut saja Bunga yang baru berusia 10 tahun, Jumat (17/6).

RIFIN

Pencurian

Pergi ke Kebun, Rumah Dibengkas Maling PONTIANAK. Pergi ke kebun, rumah Aswandi, 51, di Komplek Palestin Indah Permai II, Jalan Husien Hamzah dibengkas maling, Sabtu (18/6) pukul 11.30. Maling mengambil emas dan beberapa barang elektronik lainnya saat rumah dalam keadaan kosong. Aswandi melapor ke Mapolsek Barat. Diceritakan Aswandi, bersama istri dan keluarganya pergi ke kebun sejak pagi. Padahal semua jendela dan pintu sudah dikunci. Baru mengetahui rumahnya dibengkas maling setelah pulang dari kebun. Saya kaget melihat isi rumah sudah berantakan, ujar Aswandi. Ketika dicek, ternyata teralis besi dan jendela kamar belakang sudah rusak dan terbuka. Aswandi langsung memeriksa barang-barang. Satu unit laptop, PS 3, HP serta gelang emas seberat 10 gram hilang. Menurutnya, diperkirakan pelaku masuk ke rumahnya dengan cara merusak jendela belakang dengan linggis. Lalu mengambil emas di kamar, PS3 dan laptop di ruang keluarga, serta HP di atas meja ruang tamu. Kemudian pelaku keluar kembali melalui jendela yang dibengkasnya. Karena semua pintu dan jendela lainnya masih terkunci, jelasnya. Mendapat laporan dari Aswandi, polisi melakukan olah TKP. Akibat kejadian itu, Aswandi merugi Rp12,8 juta. (sul)

ILUSTRASI

PONTIANAK. Saking nyenyaknya tidur, Rizal, 30, tak sadar rumahnya di Jalan Sungai Raya Dalam, Komplek Griya Pesona B21, dimasuki maling, Sabtu (18/6) dini hari. Maling mengambil laptop milik kontributor liputan televise swasta tersebut. Bahkan uang tunai dan STNK sepeda motor juga diembat. Rizal baru tahu rumahnya dibengkas maling, Minggu (19/6) pada pukul 05.00. Ketika Rizal dibangunkan Sukma, 28, istrinya. Pada pukul 22.00 Sabtu malam, sebelum keduanya tidur, ka-

Dk (tengah) tertunduk lesu di Polsek Barat. SYAMSUL ARIFIN

marnya masih rapi. Saya kaget waktu dibangunkan sama istri. Langsung saya lihat pintu belakang sudah terbengkas. Pintu pagar belakang rumah juga jebol, kata Rizal. Rizal memperkirakan kawanan pencuri beraksi pada Minggu dini hari. Dia dan istrinya sendiri sudah tidur pada pukul 22.00 di kamar tengah. Habis pulang jalan sebentar, kami langsung tidur. Saya memang agak letih habis liputan demo petani di Ketapang. Dua hari kurang tidur, ungkap Rizal. Rizal menuturkan, jika melihat

bekas jejak kawanan pencuri, masuk ke dalam rumah dengan cara membengkas jendela. Kemudian menjebol pintu pagar bagian belakang rumah. Jendela yang dijebol itu persis di kamar tidurnya. Namun dia mengaku sama sekali tidak mendengar suara gaduh maupun berisik. Uang Rp1,3 juta diambil dari kantong celana yang saya kenakan saat tidur. Komputer jinjing dan STNK sepeda motor juga di kamar tidur. Beruntung kamera saya di kamar sebelah, ungkap Rizal. Rizal menambahkan, beberapa

Barang bukti berupa alat isap, satu unit handphone, delapan paket sabu, serta uang yang diduga hasil penjualan barang haram tersebut diamankan polisi.

Warga Jalan Pembangunan, Sungai Rengas, Kecamatan Sungai Kakap ini mengaku sudah setahun mengonsumsi sabu. Dk mengaku membeli barang haram tersebut di Kampung Beting dari seorang bandar, seharga Rp3 juta. Rencananya sabu itu akan saya jual lagi, dikemas dalam plastik kecil transparan seharga Rp100 ribu sampai Rp150 ribu perpaketnya. Saya melakukan bisnis ini kurang lebih satu bulan, ungkap Dk saat diinterogasi. Berdasarkan informasi di lapangan, penangkapan terjadi saat jajaran Polsek Barat melakukan patroli rutin di daerah hukumnya. Tiba-tiba melihat Dk yang sudah lama menjadi incaran polisi. Dengan langkah sigap, akhirnya Dk berhasil dibekuk. Ketika petugas datang, saya sempat membuang kotak sabu warna merah itu. tapi polisi langsung tahu dan saya digiring ke kantor polisi, ujar ayah tiga anak ini.

Setelah berhasil meringkus Dk, polisi langsung menuju rumahnya dan menggeledah serta mencari barang bukti lain. Polisi menemukan peralatan untuk meracik sabu. Saya tidak tahu kalau suami saya itu adalah pengedar sabu. Kami ini orang tidak mampu. Kemarin saya baru datang dari tempat saudara, Rumah ini hanya dijaga oleh suami, tibatiba mendapat kabar buruk, terang Ely Istri Dk dengan nada sedih saat rumahnya digeledah polisi. Kapolsek Barat, Kompol I Gede S Wahyudi membenarkan adanya penangkapan tersebut. Dk juga menyembunyikan tiga paket sabu seharga Rp100 ribu per paketnya yang siap dijual. Dari tangan tersangka, sebanyak delapan paket yang disita untuk dijadikan barang bukti dan uang kurang lebih Rp2 juta. Tersangka melanggar undang-undang nomor 35/2009 ayat (1) tentang

Halaman 12

Judi Kolok-kolok Digerebek PONTIANAK . Jajaran Polsek Utara menggerebek lokasi perjudian kolok-kolok di warung depan Depot Pertamina, Jalan Khatulistiwa, Kecamatan Pontianak Utara, Sabtu (18/6) sore kemarin. Seorang bandar, dua pemasang beserta barang bukti uang Rp1,5 juta, tiga buah dadu kolok-kolok dan lapaknya diamankan. Dalam perjudian tersebut Ra selaku bandar. Sementara dua pemasang yang tertangkap bernisial Ta dan Zo. Penggerebekan ini berawal dari informasi masyarakat,

K ETAPANG .Perbuatan tak senonoh itu sudah dilakukan IM lebih dari dua kali. Perbuatan bejatnya baru diketahui setelah ketahuan menggarap anak tirinya di atas sampan. Awalnya tersangka merayu anak tirinya akan dibelikan kalung emas dan sepeda. Sekitar pukul 10 keduanya berangkat ke pasar menggunakan sampan, kata AKP Temangnganro Machmud SIK, Kasat Reskrim Mapolres Ketapang ketika dihubungi Equator via selular. Tanpa curiga, bocah bau kencur itu pun menuruti keinginan ayahnya. Karena membayangkan kalung emas dan sepeda di benaknya. Singkat cerita, IM pun mulai mengayuh sampan. Rupa-rupanya sampan yang mereka kendarai bukan menuju ke pasar, melainkan ke tengah sungai yang sepi. Setelah dianggap aman, IM yang birahinya telah naik keubun-ubun tak sanggup lagi menahan nafsu bejatnya. Pria tersebut menghentikan sampan di tengah Sungai Pawan. Dengan cara paksa, IM melucuti celana Bunga. Setelah tak lagi berpakaian, Bunga menuruti perintah ayah tirinya. Birahi IM memuncak

melihat bunga sudah setengah telanjang. Tanpa pikir panjang lagi, IM, langsung memperkosa Bunga di atas sampan. Padahal dia sadar yang diperkosanya itu adalah anaknya sendiri. Setan dan nafsu bejat telah memenuhi pikirannya. Usai melampiaskan birahinya, mereka kembali mengenakan pakaian. Dari situ Bunga tahu, kalau janji membelikan kalung emas dan sepeda hanya akal-akalan ayah tirinya. Sebelum pulang, IM, meminta agar Bunga tak menceritakan kejadian itu kepada siapapun. Rupanya Bunga yang tak mau terus-terusan jadi budak seks ayah tirinya mengadu ke AS, ibunya. Mendengar pengaduan itu, AS kaget bukan kepalang. Seperti disambar petir di siang bolong. Wanita tersebut tak menyangka IM tega melakukan perbuatan terkutuk. Hari itu juga AS melaporkan suaminya ke Mapolres Ketapang. Tersangka sudah kita tahan. Dia kita jerat dengan pasal 81 UU nomor 23/2002 tentang perlindungan anak. Ancamannya 15 tahun penjara, tegas Temangnganro. (KiA)

Rumah Kontributor TV Diacak-acak Maling

Pemakai dan Pengedar Sabu Dibekuk

PONTIANAK. Transaksi sabu, Dk, 42, diringkus jajaran Reskrim Polsek Barat di depan Gang Alpukat, Jalan Kom Yos Soedarso, pukul 10.30, Minggu (19/6).

Senin, 20 Juni 2011

ungkap Kompol S Alam SH SIK, Kapolsek Pontianak Utara. Dijelaskan Alam, laporan masyarakat tersebut dikatakan adanya sekelompok orang yang menggelar perjudian di warung depan depot Pertamina. Menerima informasi tersebut, Alam memerintahkan jajarannya melakukan penyelidikan di lapangan. Begitu dicek, ternyata informasi tersebut benar. Dari laporan masyarakat, ada yang menggelar perjudian kolok-kolok. Anggota kita langsung turun ke lokasi

dan melakukan pengecekan di lapangan, katanya. Kedatangan petugas yang dipimpin langsung oleh Alam ini membuat para pejudi kelabakan. Namun mereka tidak dapat melarikan diri, karena sudah dikepung petugas. Sehingga mereka hanya pasrah ketika tertangkap tangan sedang berjudi. Ketiga pemain judi akan menjalani proses hukum atas perbuatanya. Bandar akan dijerat pasal 303. Sedangkan pemain akan dijerat 303 bis dan dikenakan wajib lapor. Tersangka dan barang bukti

tas milik istrinya juga diambil kawanan pencuri. Namun tas tersebut ditinggal dekat pintu pagar belakang. ATM dan surat- surat dalam tas ditebarkan memanjang sama pencuri. Tidak dibawa kabur mungkin karena sulit diuangkan, katanya. Rizal mengungkapkan di kaca jendela yang dibengkas banyak menyisakan sidik jari berupa telapak tangan orang dewasa. Sebuah kayu panjang yang dipasangi paku berbentuk huruf L juga ditinggal pelaku. Mungkin itu alat untuk membengkas jendela,

Halaman 12

Kamar Rizal berantakan diacak-acak maling. SYAMSUL ARIFIN

JANTUNG, ASAM URAT DAN MAAG SEMBUH DENGAN SARANG SEMUT

Ibu Jamchin

Saya seorang ibu rumah tangga berusia 64th dan sudah lama menderita penyakit jantung, asam urat, dan maag. Selama ini sudah sering berobat ke dokter dan berbagai jenis obat yang diberikan oleh dokter sudah saya konsumsi. Tapi tidak juga sembuh, saya fikir sakit saya ini karena faktor usia dan sudah malas mau berobat lagi ke dokter. Tapi saya sering mendengar cerita dari tetangga kalau ada obat yang namanya Sarang Semut sangat bagus untuk sakit jantung. Karena ada keluarga dari tetangga saya yang sudah sembuh setelah konsumsi Sarang Semut, akhirnya saya menceritakan kepada suami saya dan kemudian suami sayapun mencari informasi dimana bisa membeli obat tersebut. Setelah Sarang Semut didapatkan, lalu saya konsumsi sesuai dengan aturan minum yang ada di Sarang Semut. Ternyata setelah mengkonsumsi Sarang Semut, saya juga mendapatkan kesembuhan. Sekarang jantung dan tekanan darah sudah normal, kesemutan di kaki jadi hilang. Sakit maag juga tidak pernah kambuh lagi semenjak konsumsi Sarang Semut. Sampai sekarang saya masih terus konsumsi Sarang Semut agar penyakit saya benar-benar sembuh dan tidak kambuh kembali.

SARANG SEMUT secara empiris dan tradisional dapat digunakan untuk membantu mencegah dan mengatasi : Berbagai jenis kanker dan Tumor, Jantung koroner dan berbagai gangguan jantung, Stroke, Menghilangkan benjolan pada payudara, Gangguan ginjal dan prostate, TBC / Paru-paru, Ambeien (wasir)baru maupun lama, Melancarkan dan meningkatkan Air Susu Ibu (ASI) Tidak disarankan mengkonsumsi Sarang Semut dalam bentuk lempengan, karena : • Tidak terjamin kehigienisannya karena hanya diproses melalui penjemuran berkali-kali menggunakan sinar matahari, sehingga dapat menimbulkan bakteri/jamur yang berbahaya bagi tubuh. • Dosis yang tidak tepat, karena setiap lempengan tidak memiliki kadar yang sama. • Tidak disarankan menggodok Sarang Semut berulang kali karena khasiatnya sudah jauh menurun atau hilang khasiatnya. • Tidak jelas jenis Sarang Semut yang dipergunakan, karena tidak semua jenis Sarang Semut berkhasiat sebagai obat. • Tidak dapat dipertanggung jawabkan siapa produsennya bila terjadi keracunan, karena produk lempengan tidak memiliki registrasi Badan POM. • Pastikan Sarang Semut yang anda beli adalah hasil produksi PT. PRIMA SOLUSI MEDIKA yang memberikan jaminan keaslian dan kualitas produk terbaik Keunggulan Sarang Semut PT. PRIMA SOLUSI MEDIKA : o Merupakan pioneer dan pemegang hak paten Sarang Semut di Indonesia o Terdaftar di balai POM dan memiliki sertifikasi halal. o Diproduksi dengan standar CPOTB (Cara Pembuatan Obat Tradisional yang Baik) Dapatkan di Apotik dan Toko Obat Terdekat Info Produk : 085245961665

ILUSTRASI

telah diamankan di Mapolsek Utara, selanjutnya dilakukan proses Hukum, tegas Alam. Alam mengimbau masyarakat Pontianak Utara dapat bersama-sama menjaga dan menciptakan situasi dan ke-

Halaman 12

DALAM KOTA Sei Raya : Apt. Amelia, Apt. Antara-Jl. Adi Sucipto Sui Raya Dalam : Apt. Sui Raya Dalam, Batara Kota : Apt. Kharitas Bak, Apt. Makmur II, Apt. Apt. Gajahmada, Apt. Mega Sari Farma, Apt. Mandiri, Apt. Nusa Indah, Hidup sehat, Jenaka, Asia, Sinar Abadi, Semi Abadi, Kapuas Jeruju : 168, Apt. Bersama, Apt. Sejahtera (Tj. Hulu), Apt. Siantan Jaya (Siantan), Ericia (Kobar), Apt. Therapy (Danau Sentarum), Labora - PAL V (Husin Hamzah) LUAR KOTA Sei. Pinyuh : Sanitas, Singkawang : Apt. Asean, 333 Pemangkat : Timur Jauh Sambas : Santos Bengkayang : Berkat Ngabang : Baru Meliau : Karunia Sanggau : Arjuna Sintang : Sahabat, Apt. Husada Nanga Pinoh : Lestari I, Lestari II Putussibau : Sahabat Ketapang : Tulus Budi, Sumber Sehat


kubu raya

10 

musyawarah kite

Butuh Penguatan SUNGAI RAYA. Program kegiatan pemerintah di Kubu Raya diharapkan memerhatikan faktor yang dapat memengaruhi pencapaian tujuan secara komprehensif. Mulai dari proses perencanaan, pengorganisasian. Yang tidak kalah pentingnya, adalah evaluasi dan melakukan penguatan monitoring program, sebab dengan evaluasi dan melakukan penguatan monitoring program sebagai salah satu fungsi kontrol pemerintah atas kebijakan yang telah dibuat dalam tiap kali menjalankan program, ungkap Musa, salah seorang Sarjana Pendamping Desa (SPD) Kubu Raya kepada wartawan. Menurutnya, sebagus apa pun program pemerintah yang telah dibuat, jika tidak diimbangi dengan evaluasi dan melakukan penguatan fungsi monitoring, maka akan sulit berjalan sesuai tujuan yang akan dicapai. Memasuki tahun keempat, Pemkab Kubu Raya melaksanakan roda pemerintahan, dan telah banyak menelurkan program-program dan direalisasikan. Bahkan telah banyak pula pemerintah Kubu Raya menerima prestasi dan penghargaan. Ini patut diapresiasi dan dihargai oleh seluruh elemen masyarakat. Namun demikian programprogram yang telah direalisasikan pemerintah tersebut terus eksis, katanya. Tentunya, lanjut Musa, juga perlu dievaluasi dan dilakukan penguatan monitoring program, mengingat indikator pencapaian keberhasilan program dari sebuah kebijakan yang telah dibuat tersebut. Apakah dampaknya sudah benar-benar dapat dirasakan dan dinikmati manfaatnya secara menyeluruh oleh masyarakat, ujarnya. Sebab itu, perlu evaluasi dan melakukan penguatan monitoring terhadap seluruh rangkaian program yang telah dibuat, dan direalisasikan seluruh jajaran instansi Pemkab dapat diminimalisir sedini mungkin. Mulai dari proses perencanaan dan pengorganisasian, sehingga implimentasi kebijakan dapat diawasi. Selain itu, efektivitas program akan lebih tepat sasaran. Berjalan sesuai tujuan dan keinginan yang dibutuhkan masyarakat. Bahkan kalau perlu, program-program yang dianggap kurang efektif dan efisien dipangkas, dialihkan ke program yang lebih menyentuh pada pencapaian kepentingan, guna meningkatkan kesejahteraan masyarakat. (oen)

Menuju Perubahan

Senin, 20 Juni 2011

Hari Ini Kelulusan SD Diumumkan SUNGAI RAYA. Hari ini, Senin (20/6), kelulusan siswa kelas enam SD diumumkan. Di Kubu Raya semua sekolah sudah mendapatkan nilai-nilai yang telah didistribusikan oleh Unit Pelaksana Teknis (UPT) Dinas Pendidikan Kubu Raya. Kepala Bidang Pendidikan Dasar Dinas Pendidikan Kubu Raya, Iskandar, mengatakan dari 9.703 siswa SD negeri hampir 99

persen lulus. I s k a n d a r, m e n a m b a h k a n setelah sampai di tangan sekolah, maka sekolah akan mengadakan rapat dewan guru untuk memverifikasi nilai anak didiknya, apakah sudah sesuai batas kelulusan yang telah ditentukan sekolah sebelumnya. Kami berharap pengumuman kelulusan nanti disikapi dengan biasa saja, mengingat pengumuman terse-

but merupakan hal yang biasa, imbuh Iskandar ditemui, Minggu (19/6). Menurutnya, sesuai aturan, paling lambat pada minggu ketiga bulan ini kelulusan SD sudah diumumkan. Dinas Pendidikan Kalbar juga sudah memberikan penegasan pengumuman hasil kelulusan tingkat SD pada 20 Juni 2011. Pengumuman ini dilaksanakan serentak di seluruh

Indonesia. Iskandar, mengimbau agar guru dalam pelaksanaan pengumuman kelulusan dapat mengawasi siswanya agar tidak melakukan aksi corat-coret. Selain itu, sebelum pelaksanaan Penerimaan Peserta Didik Baru (PPDB) dimulai, ijazah sudah harus diserahkan ke siswa. Kami tidak membatasi waktu pengisian ijazah, karena jumlah

KPRI Kubu Raya Dicontoh Singkawang SUNGAI RAYA. Kendati baru dua tahun terbentuk, KPRI Jaya Bersama Kubu Raya telah berhasil menunjukkan kemajuan cukup pesat. Itu membuat KPRI Singkawang dan Bank Kesejahteraan selaku lembaga keuangan yang mewadahi koperasi sangat terkesan, dan memberi apresiasi saat berkunjung ke KPRI Jaya Bersama, kemarin. Kami terkesan dengan KRPI Jaya Bersama Kubu Raya. Dalam waktu dua tahun sudah berkembang signifikan. Kami di Singkawang yang sudah terbentuk sejak tahun 2002, baru sekarang punya ruko satu dan tidak sebagus di Kubu Raya, ungkap Ketua KPRI Singkawang, Taslim kepada wartawan di Sungai Raya. Menurut Taslim, perkembangan cukup signifikan ini dapat dilihat dari manajemen yang

bagus, serta memiliki divisi yang cukup banyak dengan tenagatenaga yang andal dan proaktif. Apalagi yang cukup penting di sini, yaitu bupatinya sangat mendukung dan komitmen terhadap koperasi. Tentunya dengan adanya koperasi ini, maka akan dapat menyaingi perusahaan-perusahaan swasta, katanya. Hal itu, kata Taslim, merupakan terobosan baru bagi KPRI Jaya Bersama. Ini akan menjadi barometer di KPRI Singkawang. Dia memastikan sepulangnya ke Singkawang akan bertemu dengan Walikota untuk membahas perkembangan koperasi. Relationship Manajer Korwil Kalbar Bank Kesejahteraan, Iwan, menambahkan perkembangan KPRI Jaya Bersama merupakan satu revolusi baru bagi sebuah koperasi. Harus kita akui dan tidak dimungkiri perkembangan-

KPRI Singkawang saat mengunjungi KPRI Kubu Raya. YUNIARDI/EQUATOR nya sangat pesat. Kami melihat perkembangan KPRI Jaya Bersama ini tidak hanya berkembang dari sisi fisik dan manajemen, namun juga dari sisi kolektibilitas perbankannya sangat baik. Kami optimis bakal maju, katanya optimis.

Pun demikian, semua itu menurut dia mesti mendapat dukungan dari semua pihak. Diharapkan pencitraan tidak hanya untuk milik anggota semata, namun KPRI Jaya Bersama adalah milik masyarakat Kubu Raya. Target kita tetap sebagai

Bupati Imbau PNS Gunakan Sepeda ke Kantor SUNGAI RAYA. Memasyarakatkan penggunaan kendaraan roda dua, Pemkab Kubu Raya akan segera membentuk komunitas sepeda di lingkungan pemerintahan serta seluruh masyarakat Kubu Raya. Sebagai kabupaten baru, kita belum memiliki komunitas sepeda untuk para pegawai, dengan harapan para pegawai ini bisa menjadi contoh bagi masyarakat. Karena selain baik bagi kesehatan, penggunaan sepeda juga

siswa di masing-masing sekolah berbeda. Jumlah siswa yang ratusan tidak bisa disamakan dengan yang hanya puluhan, katanya. Namun, Iskandar, berharap ijazah dapat segera disampaikan kepada anak. Bagi anak yang akan melanjutkan sekolah ke luar kota, untuk sementara dapat menggunakan surat keterangan yang dikeluarkan sekolah. (oen)

bisa menekan emisi gas kendaraan, kata Bupati Muda Mahendrawan di Sungai Raya, Minggu (19/6). Menurut Bupati, hal penting lain yang bisa didapat dengan membentuk komunitas, yakni dapat menjalin silaturahmi dan sarana keakraban. Nanti Pemkab akan membentuk komunitas sepeda, agar para pegawai bisa berangkat ke kantor masing-masing menggunakan sepeda. Dengan bersepeda juga dapat menjalin si-

laturahmi serta menjalin keakraban, bahkan sekarang ini sudah banyak yang datang ke kantornya menggunakan sepeda, katanya. Bupati Muda, menjelaskan Pemkab akan mengupayakan agar tiap even bisa melibatkan para pelajar. Karena merekalah yang bisa menggairahkan sepeda ini. Bersepeda akan kita galakkan. Kita biasakan melalui even dulu, siapa tahu perlahan-lahan akan menjadi terbiasa, seperti beberapa

institusi lain sudah memiliki komunitas sepeda dan mudah-mudahan di Pemkab Kubu Raya dapat terbentuk, tutur Muda. Sementara itu Kepala Badan Lingkungan Hidup Kubu Raya, Aswin Fuad. mengatakan di jajarannya sendiri kegiatan bersepeda akan dilakukan pegawainya seminggu sekali. Di BLH Kubu Raya nanti tiap hari Jumat tiap minggu para pegawai yang sudah mempunyai sepeda, dan rumahnya

tidak terlalu jauh harus menggunakan sepeda. Dari saya akan memulainya tiap Jumat menggunakan sepeda, karena dengan bersepeda mudahmudahan gas emisi dapat berkurang, kata Aswin. Aswin, juga menjelaskan akan menggalakkan penanaman pohon, karena pohon dapat menyerap gas CO2 di udara sehingga harus terus ditumbuhkan dan dilakukan penanaman pohon. (oen)

penyokong utama sesuai dengan RAT KPRI Jaya Bersama. Kita tetap memberikan support penuh, tuturnya. Di tempat yang sama, Ketua KPRI Jaya Bersama, Guntoro, mengatakan pihaknya tetap berkomitmen membangun kemitraan dengan semua pihak. Baik itu PNS, masyarakat luas, maupun UMKM. Saat ini kita sedang mengambil langkah-langkah percepatan pembangunan di KPRI Jaya Bersama sendiri. Kita tetap fokus pada tempat-tempat strategis, serta siap melayani anggota dari semua lini, mulai dari petani, masyarakat luas, PNS hingga UMKM, tuturnya. KPRI Jaya Bersama memiliki 12 divisi, meliputi divisi beras lokal, simpan pinjam, perumahan PNS, penyewaan tenda, shooting dan pelaminan, fotokopi serta ATK, penjualan seragam, ticketing, oleh-oleh khas Kubu Raya, serta finance. (oen)

gema kabupaten pontianak  derap bestari

SDN 19 Juara Perjusami PERKEMAHAN Jumat, Sabtu dan Minggu (Perjusami) pramuka siaga yang dilaksanakan Gugus Depan (Gudep) Jenderal Suharto dan Fatmawati resmi ditutup, Minggu (19/6) siang. Para pramuka siaga SD Negeri 19 Mempawah Hilir yang bertindak sebagai tuan rumah, berhasil menyabet gelar juara umum. Pramuka siaga Gudep Jenderal Suharto dan Fatmawati berhak menerima piala tetap dan bergilir, setelah memenangkan perolehan medali emas dari tujuh Gudep SD di Kecamatan Mempawah Hilir, dan Mempawah Timur yang ambil bagian dalam Perjusami tersebut. Masing-masing emas diperoleh dari lomba puisi, peragaan busana, botol ajaib, bola nampan, engrang putra dan putri, melukis dan fashion show. Sedangkan juara kedua dan ketiga diraih SDN 09 Mempawah Hilir dan SDN 13 Mempawah Timur. Penyerahan piala pemenang dilakukan Mabigus SDN 19 Mempawah Hilir, Dwi Suhartini. Alhamdulillah, seluruh rangkaian acara baik kegiatan lomba dan lain yang kita laksanakan dalam Perjusami ini terealisasi dengan baik. Kegiatan berlangsung sukses, tertib, aman dan lancar, kata panitia penyelenggara Perjusami, Razali didampingi Hidayah. Razali, menjelaskan perjusami rencananya akan menjadi agenda rutin tiap tahun. Bahkan, Perjusami itu akan dikemas lebih semarak dan meriah. Termasuk memperluas dan memperbanyak jumlah peserta yang berpartisipasi. Untuk tahun depan, kami akan membagi dua kelompok pramuka siaga. Yakni pramuka siaga usia 7-10 tahun dan pramuka penggalang usia 11-14 tahun. Dengan dua kelompok ini, maka kegiatan Perjusami akan semakin semarak dan meriah, pendapatnya. Untuk itu, dia mengharapkan seluruh jajaran SD dapat meningkatkan pembinaan kepramukaan di sekolah masing-masing. Pendidikan kepramukaan memiliki peran penting dan strategis dalam membentuk karakter siswa yang tangguh dan berkualitas. Kami berharap partisipasi SD pada Perjusami pramuka siaga tahun 2012 mendatang lebih banyak. Jajaran SD dapat mempersiapkan pramuka-pramuka siaganya sejak sekarang, sarannya. Razali juga mengucapkan terima kasih kepada semua pihak yang telah berperan, serta menyukseskan kegiatan tersebut. Mulai dari Kwarcab Pramuka Kabupaten Pontianak, Dinas Pendidikan, Pemuda dan Olahraga (Disdikpora), SD Negeri 19 Mempawah Hilir dan pihak terkait lainnya. Terutama seluruh masyarakat di lingkungan perkemahan yang ikut serta menjaga dan mengawasi, sehingga kegiatan ini berjalan tertib, aman dan terkendali, pungkasnya. (hry/shn)

Kelulusan SD Capai 99,8 Persen MEMPAWAH. Dunia pendidikan di Kabupaten Pontianak terus menunjukkan perubahan ke arah yang lebih baik. Kenaikan persentase kelulusan SMP dan SMA diikuti pula oleh tingkat SD. Kelulusan SD tahun tahun ini mencapai 99, 8 persen. Pengumuman kelulusan tersebut akan dilakukan serentak di seluruh SD, Senin (20/6) hari ini. Hasil kelulusan SD tahun 2011 sudah kita terima dari Dinas Pendidikan (Diknas) Provinsi Kalbar. Rencananya besok (hari ini, red) akan kita bagikan ke seluruh SD, selanjutnya diumumkan. Untuk tahun 1 ini angka kelulusan SD diperkirakan mencapai 99, 8 persen, ungkap Kepala Bidang SD Disdikpora Kabupaten Pon-

tianak, Sukriadi kepada Equator, Minggu (19/6). Dijelaskan Sukriadi, jika angka kelulusan 99,8 persen tercapai, maka terjadi peningkatan dibandingkan tahun lalu yang hanya mampu meluluskan 97,8 persen siswa SD. Dari 4. 535 siswa dari 218 SD dan MI se-Kabupaten Pontianak yang mengikuti UN lalu, masih menyisakan beberapa siswa yang dinyatakan tidak lulus. Kita belum tahu siswa di SD mana saja yang tidak lulus. Setelah pengumuman besok (hari ini, red) barulah kita mengetahuinya, tuturnya. Sukriadi, Disdikpora mematok target kelulusan 100 persen tahun ini. Dia kaget setelah mengetahui ada perubahan me-

kanisme penentuan kelulusan siswa yang dilakukan Diknas Provinsi Kalbar. Kita juga bingung, mengapa kelulusan justru ditentukan dari Diknas Provinsi Kalbar sesuai Standar Kelulusan Minimal (SKM). Kami tinggal mengesahkan saja hasil kelulusan tersebut. Padahal, sebagaimana ketentuan Permendiknas, kelulusan ditentukan pihak sekolah, pendapatnya. Meski demikian, Sukriadi, memberikan apresiasi kepada semua pihak yang telah menyukseskan pelaksanaan UN SD tahunini. Berkat kerja keras semua pihak, persentase kelulusan siswa mengalami peningkatan membanggakan. Kami mengucapkan terima

Formasi CPNS 2011 Diusulkan MEMPAWAH. Ketua Komisi A DPRD Kabupaten Pontianak, Susanto, menyarankan Pemkab mengusulkan formasi penerimaan CPNS tahun ini. Penambahan tenaga PNS diperlukan untuk meningkatkan pelayanan publik kepada masyarakat. Formasi yang diusulkan

hendaknya sesuai kebutuhan. Kami menyarankan pada tahun ini Pemkab Pontianak mengusulkan formasi CPNS kepada Badan Kepegawaian Nasional. Mengingat pada tahun lalu daerah ini tidak melakukan penerimaan PNS baru, kata Susanto kepada Equator, Minggu (19/6).

Menurut Legislator PDI Perjuangan itu, terdapat beberapa hal penting yang menjadi dasar dan perlunya penambahan jumlah CPNS. Sebagaimana hasil laporan keterangan pertanggungjawaban (LKPj) Bupati Pontianak tahun 2010 lalu, yang mengungkapkan hampir seluruh

kasih atas dukungan dan partisipasi semua pihak, yang bersamasama menyukseskan kegiatan pendidikan khususnya tingkatan SD di Kabupaten Pontianak. Mulai dari sekolah, guru, siswa, orangtua dan pihak lain, hingga mendapatkan hasil kelulusan yang maksimal, ujarnya. Sukriadi, berharap para orangtua siswa dapat memperjuangkan, dan memerhatikan kelangsungan pendidikan anakanaknya. Jangan sampai setelah menyelesaikan pendidikan dasar, anak-anak lantas putus sekolah. Tidak melanjutkan ke jenjang pendidikan berikutnya. Hendaknya para orangtua dapat memberikan pendidikan tertinggi kepada anak-anaknya.

Minimal anak-anak menyelesaikan pendidikan hingga tingkat SMA, sebagaimana program pemerintah sukseskan pendidikan 12 tahun, sarannya. Terpisah, anggota DPRD Kabupaten Pontianak, MA Muhammadiyah, memberikan apresiasi atas keberhasilan Disdikpora dalam meningkatkan persentase kelulusan di seluruh tingkatan pendidikan. Yang terpenting bukan hanya persentase kelulusan yang harus ditingkatkan, melainkan juga kualitas SDM lulusan. Pihak sekolah hendaknya tidak hanya mengejar target angka kelulusan yang tinggi dengan mengesampingkan kualitas dan kuantitas siswa itu sendiri, katanya. (hry)

Struktur Organisasi Perangkat Daerah (SOPD) mengeluhkan kekurangan personel. Masalah PNS ini berkaitan dengan pelayanan publik. Kekurangan personel di lingkungan SOPD itu dipastikan berdampak terhadap lemahnya kinerja pelayanan masyarakat, pendapatnya. Misalnya, Sekretaris Fraksi PDI Perjuangan ini mencontohkan, lingkungan kerja Dinas Kepen-

dudukan dan Catatan Sipil (Dukcapil) yang kekurangan personel, sehingga pelayanan publik yang diberikan tidak maksimal. Mengingat dinas tersebut merupakan pusat pelayanan pembuatan KTP, Kartu Keluarga dan administrasi kependudukan lain. Salah satu tolak ukur keberhasilan kinerja pemerintahan itu adalah tingkat pelayanan kepada masyarakat. Solusi meningkatkan pelayanan, yakni menambah jumlah personel yang berkualitas sesuai kemampuan di bidang masing-masing, tuturnya. Lebih dari itu, pria yang juga anggota badan anggaran DPRD itu menilai, penerimaan CPNS merupakan wadah memberdayakan putra dan putri daerah, untuk berperan aktif dalam pelaksanaan pembangunan. Penerimaan hendaknya memprioritaskan warga lokal yang berkualitas dan prestasi. Terkait formasi, Susanto, menghendaki Pemkab jeli dan teliti. Usulkan formasi CPNS yang memang menjadi kebutuhan daerah dan masyarakat. Misalnya, bidang kesehatan, pendidikan, teknis di Dinas Pekerjaan Umum (PU) dan lainnya. Menyangkut anggaran tidak ada permasalahan. Pemkab dapat menghitung berapa tambahan belanja pegawai, apabila membuka formasi CPNS baru. Sehingga anggaran itu dapat disesuaikan dengan usulan Dana Alokasi Umum (DAU) kepada pemerintah pusat, sarannya.(hry)

Gubernur Cornerlis didampingi Sekda, Gusti Ramlana memberikan angpau setelah menyaksikan atraksi naga di halaman Kantor Bupati Pontianak, pekan lalu. HERY/EQUATOR


11 

suare kite

Ustad Ahmad Alhabsyi Lelang Cincin dan Pakaian

Alhabsy (kanan) menyerahkan cincin kepada pemenang lelang. Mordiadi Singkawang. Penceramah asal Palembang, Ustaz Ahmad Alhabsy melelang cincin kesayangannya beserta pakaian yang dikenakannya ketika Tablig Akbar di Kota Singkawang. Hasilnya disumbangkan untuk pembangunan Masjid Raya Singkawang. Dari lelang barang-barang kesayangan Ustaz Ahmad Alhabsy itu terkumpul dana sekitar Rp 28 juta. Para jemaah pun tidak mau ketinggalan menyumbangkan uangnya, sehingga pada malam Takbir Akbar itu terkumpul dana sekitar Rp 23 juta untuk pembangunan renovasi Masjid Raya Singkawang. Ustaz Ahmad Alhabsy khusus datang ke Kota Singkawang untuk memberikan ceramah mengenai peringatan Isra Mikraj di Masjid Raya Singkawang, Jumat (17/6) malam. Dalam Tablig Akbar yang dilaksanakan Panitia Hari Besar Islam (PHBI) Kota Singkawang dan Organisasi Masyarakat (Ormas) itu, Ustaz Ahmad Alhabsy menceritakan kisah Nabi Daud As dan hikmah bertasbih. Dilanjutkan dengan menceritakan hikmah dari Isra Mikraj, yang merupakan perjalanan Nabi Muhammad SAW untuk menerima perintah salat secara langsung dari Allah SWT. Selain menceritakan kisah Nabi Daud As dan Nabi Muhammad SAW, para jemaah yang hadir diajak untuk memanfaatkan titipan Allah agar menjadi berkah dengan bersedekah. Umur tidak perlu panjang. Namun yang penting adalah berkahnya, seperti halnya Imam Alghazali, hanya diberi umur 50 tahun, dan beliau mampu menulis 500 kitab. Begitu pula dengan harta, jadi jangan pernah meremehkan kata berkah, kata Ustaz Ahmad Alhabsy.Dia juga mengingatkan, hidup ini akan terasa indah, bila dapat memberikan manfaatkan bagi diri sendiri dan orang lain. Karena manusia yang terbaik adalah yang bertakwa kepada Allah dan bermanfaat bagi manusia lainnya. (dik)



Dukung Program Grass Sambas. Keinginan PT PLN (Persero) menuntaskan daftar tunggu sambungan listrik harus didukung. Melalui program yang diberinama Gerakan Sehari Sejuta Sambungan (Grasss) ujar Bupati Sambas dr Hj Juliarti Djuhardi Alwi MPH, pembangunan di Kabupaten Sambas akan mengalami kemajuan. Listrik sangat penting, karena merupakan sarana dasar bagi setiap negara dalam meningkatkan produktivitas dan kinerja masyarakat serta pemerintah. Bila listrik cukup, maka pembangunan akan berjalan dengan baik. Manfaatnya, investor akan datang dan menanamkan modalnya, sehingga mampu meningkatkan program yang diwacanakan pemerintah, jelas Juliarti dalam sambutannya usai kegiatan pemasangan sambungan listrik sistem pra bayar di Perumahan Villa Sejahtera V Jalan Terigas Desa Rambi, Kecamatan Sambas. Dijelaskan Juliarti, program token mirip voucher pulsa yang dilaksanakan PLN akan memudahkan masyarakat mengelola sendiri pemakaian listriknya. Semoga program ini dapat berjalan dengan baik. PLN juga harus secepatnya melakukan sosialisasi program ini ke masyarakat, supaya masyarakat memahami penggunaan listrik model baru ini, pintanya. (edo) 

muare ulakan

Perbaikan Dermaga Lambat

Senin, 20 Juni 2011

FKPSM Peduli Lansia dan Anak Putus Sekolah Singkawang. Forum Komunikasi Pekerja Sosial Masyarakat (FKPSM) Kalbar terus menggaungkan program kemanusiaan dalam bentuk kegiatan yang bertajuk Peduli Kesehatan Lanjut Usia (Lansia), karena masih banyak Lansia yang memerlukan uluran tangan dan kasih sayang. Dari hasil pendataan yang kita lakukan, ternyata tidak semua Lansia bernasib baik, misalnya mempunyai keluarga dengan ekonomi dan perhatian cukup, masih banyak yang membutuhkan uluran dan kasih saya kita, kata Maya Satrini, Ketua FKPSM Kalbar kepada wartawan, kemarin (19/6). Oleh karenanya jelas Maya, FKPSM tergerak melakukan berbagai upaya untuk menjadi pendamping para Lansia. Beberapa pengurus FKPSM diberi tugas sebagai

pendamping para Lansia yang kurang beruntung, ujarnya. Setiap hari, petugas-petugas dari FKPSM diberikan jadwal untuk mendampingi Lansia dalam melaksanakan aktivitas kesehariannya, seperti membantu memandikan, menyuapi dan menghibur. Bahkan memberi keterampilan sesuai dengan kemampuannya serta membekali kerokhanian sesuai agama yang mereka anut, ungkap Maya. Dia mengatakan, para petugas FKPSM hanya mempunyai tekad dan tenaga, tapi kekurangan sarana penunjang seperti materi. Makanya kami selalu terbuka untuk bekerjasama dengan pihak lain dalam mendampingi Lansia, kata Maya. Bagi organisasi-organisasi, masyarakat, pengusaha dan lainnya yang ingin bekerjasama akan senang hati diterima. Yang penting

kita sama-sama memiliki misi kemanusiaan atau sosial kepada sesama dan masyarakat, ujar Maya. Ketua Pelaksana Harian Pusat Pelayanan Terpadu Pemberdayaan Perempuan dan Anak (P2TP2A) Kota Singkawang ini menjelaskan, selama ini FKPSM telah menjalin kerjasama dengan berbagai organisasi dan pemerintah. Saat ini kami sedang mendata orang miskin di Kota Singkawang. Data ini akan dikoordinasikan dengan berbagai pihak yang memerlukan, seperti Pemerintah Kota Singkawang, Permasis dan lainnya, terang Maya. Pendataan orang miskin itu tentunya berkaitan erat dengan keberadaan Lansia yang membutuhkan bantuan. Dalam mengimplementasikan program, kami lakukan dengan cara mengintegrasikan dengan berbagai pihak dan disesuaikan

produk di pasaran. Jika dengan keadaan, kata dibina lebih serius, ini Maya. bisa dimanfaatkan seDia mencontohkan, bebagai oleh-oleh, tutur berapa waktu lalu FKPSM Maya. juga mengikuti SosialisaHal tersebut tambah si Bina Keluarga TKI dan Maya, tentunya santurut mensosialisasikangat menunjang potensi nya kepada masyarakat. Singkawang sebagai Kami juga mempunyai Kota Pariwisata. Naprogram Peduli Anak mun sayang, masih Putus Sekolah dengan banyak kendala yang cara memberi mereka kami hadapi, sehingga keterampilan, seperti ketproduk mereka masih erampilan memanfaatMaya Satrini tersendat-sendat, unkan barang bekas atau gkapnya. limbah menjadi berbagai Permasalahannya sangat klasik, cinderamata dan hiasan-hiasan, yakni terbatasnya permodalan ungkap Maya. Hasil dari Peduli Anak Putus dan sulitnya dalam pemasaran Sekolah itu sangat luar biasa, karena hasil produk. Mudah-mudahan anak-anak itu memang mempunyai banyak pihak yang tergerak untuk potensi yang sangat bagus. Hasil- menjadikan mereka binaan, harap nya tidak kalah dengan produk- Maya. (dik) .mordiadi

Aktualisasikan Pemikiran Sang Pencerah

Walikota Hasan Karman (kiri) sesaat setelah menerima film Sang Pencerah dari Ketua PD Muhammadiyah Singkawang Syamsul Hadi

SAMBAS

tumpahansalok

singkawang Spektakuler

Singkawang. Walikota Singkawang Dr Hasan Karman mengharapkan, warga Muhammadiyah dan Aisyah dapat membangkitkan semangat (spirit) Sang Pencerah dalam kehidupan menata masyarakat Kota Singkawang. Karena masyarakat merupakan pemeran utama dalam pembangunan. Sementara pemerintah merupakan pihak yang memfasilitasi, kata Walikota Hasan Karman pada pembukaan Musyawarah Daerah (Musda) Ketiga Muhammadiyah dan Aisyah Kota Singkawang, Sabtu (18/6) malam.Hasan mengharapkan dan percaya organisasi Muhammadiyah dapat terus memainkan perannya dalam mendorong dan membina masyarakat. Agar senantiasa berperan aktif sebagai subjek sekaligus objek dalam pelaksanaan pembangunan, harapnya. Hasan menginginkan Musda Muhammadiyah dan Aisyah menjadi

momentum pemulihan kembali jati diri bangsa dan mengaktualisasikan pemikiran Sang Pembaharu Muhammad Darwisy atau lebih dikenal dengan KH Ahmad Dahlan, pendiri Muhammadiyah yang kisah perjuangannya difilmkan dengan judul Sang Pencerah. Selain itu, Hasan juga berpesan kepada peserta Musda Muhammadiyah dan Aisyah untuk profesional, objektif serta mengikuti mekanisme organisasi yang telah diatur dalam menentukan langkah-langkah organisasi ke depan. Jauhi kehendak kelompok dan kepentingan tertentu, karena jika itu terjadi, secara tidak langsung kita memberikan contoh kepada kader dan masyarakat yang mengabaikan kemajemukan (pluralisme), mengesampingkan azas ke-Bhineka Tunggal Ika-an yang sering kita sebut-sebut untuk dipahami dan dilaksanakan, ingatnya.

Di tempat yang sama, Pengurus Wilayah (PW) Muhammadiyah Kalbar dr Oscar Primadi mengatakan, dengan semakin besar organisasi ini tentunya tuntutan perbaikan manajemen menjadi suatu keharusan. Pertama yang harus dilakukan kawan-kawan di daerah hendaknya melakukan konsolidasi organisasi hingga ke akar rumput, katanya. Menurut Oscar, sebenarnya Muhammadiyah itu harus kuat di akar rumput. Tetapi selama ini belum terkelola dengan baik. Oleh karenanya dengan momentum Musda ini, gerakkan kembali penguatan Muhammadiyah di akar rumput, agar lebih baik dan lebih bergairah kembali, katanya. Kedua, kata Oscar, yang mesti dilakukan yakni peningkatan Amal Usaha Muhammadiyah yang sudah berjalan, baik di bidang pendidikan, kesehatan maupun lainnya. Amal usaha ini sudah memang harus diintenskan. Membesarkan nama amal usaha ini sudah menjadi suatu keharusan, tegasnya. (dik)

sambas terigas

Tim Dayung Kiber Sambas di Malaysia

Lomba Dayung Bebas Sampah Sabah. Pantai bebas sampah dengan kemudahan menemukan tong sampah dan toilet membuat peserta Lomba Dayung Dragon Boat kagum. Pantai Teluk Ukas, Sabah, Malaysia tempat berlangsungnya lomba tingkat dunia ini ditata dengan apik. Penonton maupun peserta pun dilarang membuang sampah di pantai maupun di lokasi pertandingan. Kenangan itu dirasakan Tim Dayung Kijang Berantai (Kiber) yang berlaga mewakili negara Indonesia. Apalagi tempat penonton, undangan, peserta dan official sudah diatur, sehingga masing-masing tim memiliki tempat khusus yang telah disediakan panitia. Kebiasaan dan pola penataan pantai seperti ini patut ditiru. Dimana setiap 500 meter di lokasi pertandingan disediakan WC dan tempat sampah. Memang sepanjang jalan lokasi lomba dayung yang dipadati penonton tidak ada melihat sampah berserakan di pantai, kata Zul, salah satu Official Tim Dayung Kiber kepada Equator, Minggu (19/6) di Sabah, Malaysia. Dijelaskan Zul, dalam setiap pertandingan, MC Lomba Da-

yung Dragon Boat tidak hentihentinya mengingatkan peserta dan penonton, agar tidak membuang sampah sembarangan. Bahkan MC mengajak masyarakat agar setiap hari menciptakan hari bersih. Ini yang kita salut, memang pemandangan di lokasi pertandingan sangat bersih dari sampah, jelasnya. Di tempat yang sama, Misni Safari SP yang juga turut hadir dalam kegiatan Dragon Boat tersebut juga mengaku salut dengan persiapan panitia. Sepanjang jalan maupun tepian pantai tidak terlihat adanya sampah, karena Pemerintah Negeri Sabah selalu menyediakan fasilitas umum bagi pengunjung yang datang ke negerinya. Hal seperti ini harus bisa menjadi motivasi bagi daerah. Selain itu, kesadaran masyarakat juga tinggi dalam mendukung program pemerintah menjaga kebersihan, ungkap Ketua Ikatan Sarjana Pertanian (Ikasantan) Kabupaten Sambas ini. Misni berharap, penataan kota dengan menciptakan kebersihan bisa diadopsi Pemerintah Kabupaten Sambas. Tentunya harus diimbangi dengan sosialisasi bersama masyarakat,

Setiap 500 meter toilet dan tong sampah dengan mudah ditemukan di pantai Teluk Ukas, tempat berlangsungnya Lomba Dragon Boad. sehingga program yang dijalankan mendapat dukungan dari masyarakat. Sosialisasi penting bagi pemerintah dalam

mencari dukungan masyarakat untuk menjalankan program daerah. Apalagi program ini betul-betul berguna bagi ma-

syarakat. Ini yang harus kita tumbuhkan kepada masyarakat, dari hal yang tak bisa menjadi biasa, pungkasnya. (edo)

Usai Liga Galix, Camat Sambas Cup Digelar Akibat Dermaga Tebas-Perigi Piai belum berfungsi, masyarakat mengangkut jeruk menggunakan motor air. Tebas. Perbaikan Dermaga Tebas-Perigi Piai hingga sekarang belum selesai. Jamiat Jupri, Anggota DPRD Sambas Daerah Pemilihan (Dapil) Kecamatan Tebas, Jawai, Jawai Selatan dan Tekarang pun mempertanyakan lambatnya pengerjaannya. Akibatnya dalam dua minggu terakhir ini perekonomian masyarakat sangat terganggu, ungkap Jupri, belum lama ini. Masyarakat merasakan kesulitan dalam memasarkan hasil pertanian dan aktivitas perekonomian. Ini harus segera ditindaklanjuti oleh Dinas Perhubungan Kalbar, desaknya. Dermaga ini terangnya, merupakan satu-satunya alternatif tercepat bagi masyarakat dalam mengangkut hasil pertanian dan perkebunan menggunakan kendaraan roda empat. Termasuk juga dalam pengangkutan bahan material bangunan. Sebagai wakil rakyat, saya mengharapkan agar ini segera ditindaklanjuti, pungkasnya. (edo)

Rapat Tim Camat Sambas Cup 2011 di kediaman Camat Sambas.

Sambas. Usai Liga Galix selesai dilaksanakan, Panitia Gabsis Kecamatan Sambas yang tergabung dalam Sambas FC segera menggelar pertandingan sepakbola Camat Sambas Cup 2011. Pertandingan yang dilaksanakan di Lapangan Gabsis ini khusus bagi masyarakat Kecamatan Sambas. Rencananya akan digelar 27 Juni 2011 mendatang, kata salah satu panitia, Syarif M Luthfi kepada Equator dalam rilisnya, belum lama ini. Menurut Pak Long Luthfi̶sapaan akrabnya̶Camat Sambas Cup 2011 digelar untuk mengasah bakat penghobi sepakbola dan memotivasi pemuda agar menggandrungi sepakbola. Sehingga hasil dari pertandingan sepakbola yang merebutkan piala Camat Sambas ini, bisa melahirkan pemain handal yang dapat mewakili Kabupaten Sambas ke depan, harapnya.

Dijelaskan Pak Long Luthfi, sesuai hasil rapat panitia, ada aturan khusus terhadap usia pemain dalam pertandingan sepakbola Camat Sambas Cup 2011, diantaranya usia pemain kelahiran 1 Januari 1976 keatas untuk pemain antar desa se-Kecamatan Sambas. Sedangkan khusus pemain kelahiran 1 Januari 1975 kebawah diterapkan sistem cabut undi secara acak. Artinya pemain bisa bergabung dengan tim sesuai hasil cabut undi, jelasnya. Sebelum dimulai pertandingan, panitia akan melakukan pertemuan pra kompetisi atau teknikal meeting kategori bebas sesuai hasil cabut undi, yang akan dilangsungkan Kamis (22/8). Sedangkan Sabtu (25/6) untuk kategori antar desa di Aula Kantor Camat Sambas. Tentunya dengan menyerahkan daftar pemain yang beranggotakan 18 orang, pungkasnya. (edo)


melawi membangun

12 

apai kato kito

Klinik di Melawi Tak Ada Izin Pembuangan Limbah Nanga Pinoh. Beberapa klinik yang ada di Melawi ternyata selain belum memiliki izin operasional, juga tidak mengantongi izin pembuangan limbah. Hal tersebut disampaikan Kepala Dinas Kesehatan (Dinkes) Melawi, Simson SKm Mkes. Menurutnya, klinik yang ada diwajibkan mempunyai izin pembuangan libah atau izin pengolahan limbah. Izin tersebut berupa Sistem Pembuangan Air Limbah (SPAL). SPAL yang harus ada sertiďŹ kasi oleh tim. Di Melawi sudah ada tim SPAL yang di bentuk oleh Bupati, terangnya. Lebih lanjut Simson menjelaskan, selain harus memiliki SPAL dalam pengolahan limbah, klinik juga harus memiliki Analisis Dampak Lingkungan (Amdal). Dalam mengeluarkan Amdal harus ditinjau apakah memenuhi persyaratan atau tidaknya, ujarnya. Berkaitan dengan izin operasional klinik, Simson mengatakan, izin klinik terdiri dari berbagai macam. Ada izin klinik bersalin, ada izin klinik umum serta yang lainnya. Pada diklinik tidak dibolehkan untuk melakukan operasi atau pembedahan besar. Seperti sesar, bedah untuk penyakit usus buntu serta pembedahan besar lainnya. Jika ada klinik yang melakukan pembedahan besar, maka klinik tersebut sudah menyalahi aturan. Klinik sifatnya harus pengobatan dan perawatan, untuk klinik tidak bisa menerima rujukan, paparnya. Pembedahan yang dilakukan di klinik tidak dapat dilakukan. Sebab jika terjadi sesuatu pada pasien yang

Sawit Mesti Menyejahterakan Nanga Pinoh. Beberapa perusahaan sawit telah masuk ke Melawi. keberadaan perkebunan sawit yang dikelola perusahaan ini mesti memberi kesejahteraan pada masyarakat. Seraya, tetap menjaga keseimbangan alam. Kita sangat apresiasi dengan masuknya sawit ke Melawi. Pun begitu, kita sangat berharap sawit tersebut bisa memberi kemakmuran bagi masyarakat dan tidak merusak lingkungan, kata tokoh muda Melawi, Wahyudi, kemarin.Dijelaskannya, lahan di Melawi masih banyak yang terbuka dan masih belum dimanfaatkan. Hingga keberadaan sawit menjadikan lahan tidur menjadi lahan produktif.Pun begitu, ulasnya, keberadaan lahan sawit ini pasti di sekitar pemukiman dan dekat dengan perkebunan warga. Hingga itu, hak pengelolaan lahan jangan sampai dilanggar.Perusahaan yang ada di Melawi mesti menghormati kepemilikan warga yang telah diakui di antara masyarakat. Jangan sampai ada perusahaan yang mengambil lahan yang telah dikelola oleh perusahaan tanpa sepengetahuan pemiliknya. Kalau ada batas-batas pengelolaan yang tidak jelas hingga bisa memicu konik, hendaknya diselesaikan secara musyawarah. Orang Melawi sangat menghormati orang. Hingga jalur komunikasi sangat terbuka, terangnya.Selain itu, mantan Ketua Pencinta Alam (PA) Ciwanadri menegaskan pihak perusahaan masti mentaati aturan main. Jangan sampai, hutan lindung yang berada di kawasan perusahaan dihabisi. Hutan lingdung yang ada mesti dilestarikan. (aji)

Senin, 20 Juni 2011

Siswa SD/MI Lulus Semua Nanga Pinoh. Tahun 2011 ini merupakan tahun emas pendidikan Melawi. Setelah SMA/Sederajat dan SMP. Kini giliran SD/MI mengukir prestasi. Tak palang tanggung, seluruh siswa sekolah dasar ini lulus semuanya. Jelas, tak ada tangis saat pengumuman yang dilakukan, Senin (20/6) hari ini, di sekolah masingmasing. Tentunya, prestasi ini mesti dipertahankan sampai kapan pun. Agar tidak ada cerita pilu anak-anak

sekolah lagi. Esok (hari ini, red) akan diumumkan kelulusan siswa. Seluruh siswa di Melawi yang ikut ujian tahun ini lulus semuanya, kata Kepala Dinas Pendidikan (Disdik) Melawi, Drs Syamsul AriďŹ n MSi, kemarin. Tahun ini, siswa yang terdaftar ada 3297 orang. Pun begitu, 54 orang tidak ikut ujian. Yang mengikuti ujian sebanyak 3243 siswa. Jumlah yang mengikuti ujian ini lulus semuanya atau 100 persen.

Bukan hanya siswa yang mengikuti sekolah formal. Siswa yang mengikuti sekolah khusus pun mengukirkan prestasi serupa. Di Melawi ada lima orang siswa SLB yang mengikuti ujian. Semuanya lulus, ungkap Syamsul. Bila dibandingkan tahun lalu, jelas kelulusan tahun ini mengalami kenaikan. Tahun lalu tingkat kelulusan SD/MI pada angkat 99,87 persen. Pada waktu itu yang mengikuti ujian sebanyak 3195 siswa.

Ada kenaikan sekitar 0,03 persen dari tahun lalu. Tahun lalu masih ada yang tidak lulus. Bagaimanapun ada kenaikan dari segi persentasi kelulusan. Serta jumlah siswa SD/Mi yang lulus, terang Syamsul. Mantan camat Nanga Pinoh ini menyadari keberhasilan ini bukan semata-mata karena dari Disdik. Namun, keberhasilan ini merupakan keberhasilan bersama. Mulai dari Pemerintah Kabupaten Melawi, Disdik Melawi, Dinas Pendidikan

Cabang yang sekarang bergabung dengan Kecamatan, pengawas sekolah, guru, orang tua siswa. Terutama siswa sendiri selaku objek pendidikan. Kita berterima kasih pada semua pihak yang telah terlibat baik langsung maupun yang tidak lasung dalam pendidikan SD/MI di Melawi. Dukungan dan prestasi ini mesti ditaruskan di tahun mendatang, pungkasnya. (aji)

PAUD Maju Mandiri Gelar Perpisahan Nanga Pinoh. Pendidikan Anak Usia Dini (PAUD) Maju Mandiri yang baru berdiri sejak tahun 2010 lalu kini sudah berhasil mengeluarkan murid angkatan pertama dengan jumlah 21 orang. Murid angkatan pertama tersebut, Sabtu (18/6) kemari menggelar perpisahan. Perpisahan yang diselenggarakan saat ini merupakan perpisahan murid angkatan pertama sejak PAUD ini berdiri. Jumlahnya hanya 21 orang saja, kata Ketua Pengelola PAUD Maju Mandiri, Idham Sani SPd kepada Wartawan. Lebih lanjut Idham mengatakan, berkaitan dengan pola pendidikan yang diberikan kepada anak-anak PAUD Maju Mandiri yakni, asah, asuh dan asih. Di pola tersebut para anakanak PAUD belajar sambil bermain seperti TK-TK yang ada, ucapnya. Keberhasilan yang terlihat dengan mengeluarkan angkatan pertama tersebut bisa diacungkan jempol. Sebab PAUD tersebut menerima murid tanpa ditarik biaya sepeserpun terhadap murid-muridnya. Padahal PAUD tersebut berdiri dan berjalan secara mandiri tanpa ada bantuan dari pihak pemerintah. Kita berdiri dan berjalan tanpa bantuan pemerintah. Untuk anak yang masuk PAUD disini, tidak sepeserpun kita pungut biaya. Untuk persyaratannya, usia dari 3 tahun sampai 6 tahun, terangnya. Karena belum pernah mendapatkan bantuan, Idham berharap ke depannya pihak pemerintah bisa memerhatikan PAUD nya tersebut. Paling tidak bisa mendapatkan bantuan untuk bisa lebih mengembangkan PAUD Maju Mandiri itu, pungkasnya. (ira)

Para pengelola PAUD Maju Mandiri berfoto bersama dengan para muridnya saat perpisahan. DEDY IRAWAN/EQUATOR

sambungan patroli

Satpol PP Tangkap Basah Pemasang Iklan Tanpa Izin Singkawang. Satuan Polisi Pamong Praja (Satpol PP) Kota Singkawang menagkap basah Rid, pemasang iklan berupa poster ke tempat-tempat yang dilarang, seperti di sekitar pasar dan Jalan Setia Budi Kota Sinkawang, Sabtu (18/6). Rid memasang bahan promosi berupa poster dan kertas yang dilem ke rumah-rumah dan toko-toko di sekitar Pasar Kota Singkawang. Aktivitas ilegalnya ini dilaksanakan subuh hari, kata Karyadi, Kasatpol PP Kota Singkawang kepada wartawan, kemarin (19/6) Rid mengaku disuruh Ih, bosnya di Pontianak, untuk me-

masang poster di Kota Singkawang. Yang bersangkutan (Rid, red) sudah dua kali kita tangkap karena memasang iklan sembarangan, ungkap Karyadi. Menurut Karyadi, ulah Rid itu sudah disampaikan ke Ih di Pontianak. Selanjutnya Ih berjanji akan menaati peraturan dan ketentuan yang berlaku di Kota Singkawang terkait pemasangan iklan. Mereka menanggapi positif teguran kita. Masyarakat Singkawang sangat kooperatif terhadap langkah Pemkot Singkawang melalui Satpol PP Singkawang, ujar Karyadi. Menurut dia, penangkapan

terhadap Rid karena yang bersangkutan memasang poster, brosur tanpa izin dan menyalahi ketentuan sehingga merusak keindahan serta kebersihan Kota Singkawang. Penertiban seperti ini, kata Karyadi, dilakukan secara rutin dan tetap akan dilaksanakan secara berkelanjutan. Para pengusaha atau masyarakat melalui organisasi yang akan memasang media promosi maupun informasi, hendaknya menaati peraturan dan ketentuan yang berlaku, pintanya. Deng an mematuhi ketentuan pemasangan iklan, kata Karyadi, berarti mereka juga

Incar Pengendara Knalpot racing yang seharusnya digunakan pada tempatnya, seperti tempat balapan yang sudah di sediakan tempatnya. Bukan digunakan di jalan raya, karena menganggu banyak orang, ungkapnya. Latif menambahkan, dari segi aturan penggunaan knalpot racing, dilarang digunakan di jalan umum. Larangan penggunaan knalpot racing ini mengacu pada UU LLAJ Yo 29, 70 PP 44 mengenai persyaratan teknis yang meliputi persyaratan lampu dan komponen pendukung bagi kendaraan ber-

motor. Sepeda motor saat keluar dari dealer ada uji teknis dan kelaikan. Jadi perlengkapannya sudah standar, t idak perlu ditambah-tambah lagi, terang Latif Sedangkan untuk penggunaan helm diatur dalam pasal 61 ayat (2) UU LLAJ Yo 70 PP 43 yang berbunyi melanggar kewajiban menggunakan helm bagi pengemudi atau penumpang sepeda motor. Mayoritas pengguna knalpot racing ini adalah anakanak muda yang suka memodifikasi kendaraan. Namun

........ dari halaman 9 kendaraan knalpot racing ini sering kali disalahgunakan untuk kebut-kebutan di jalan raya. Kan ada knalpot standarnya. Lebih baik menggunakan itu, lebih aman dan sangat tidak mengganggu ketertiban orang banyak, katanya. Menurut Latif, selama Operasi Simpatik, pihaknya harus tindak tegas terhadap pengendara yang melakukan pelanggaran, supaya terus melengkapi kendaraan seperti kaca spion, menggunakan helm ganda, mengunakan knalpot standar, menghidupkan lampu pada siang hari.

Judi Kolok amanan yang kondusif. Selain itu juga, tidak menggelar aksi perjudian. Karena

Jika polisi menjaring pengguna knalpot racing, akan mendapat tilang dan mereka juga harus mengganti knalpot di tempat, sebelum membawa motor pulang, tegasnya. Latif mengimbau kepada pengguna jalan, khususnya yang mempunyai kendaraan bermotor, agar melengkapi surat-surat dalam perjalanan. Kita harus menyiapkan diri untuk membawa kartu identitas dalam mengendarai kendaraan, baik roda dua maupun roda empat. Takutnya dikemudikan hari terjadi hal-hal yang tidak diinginkan, papar Latif. (sul)

........ dari halaman 9 hal itu bertentangan dengan hukum. Polisi tidak akan segan-segan mengam-

bil tindakan tegas. Kepada masyarakat jangan seganseg an melapor ke polisi,

Pemakai dan kotika dengan ancaman 4 tahun hingga 15 tahun penjara. Kami mengimbau kepada seluruh lapisan masyara-

berperan dalam menciptakan keindahan, kebersihan, ketertiban dan keamanan Kota Singkawang. Untuk mewujudkan pembangunan, khususnya di bidang Pariwisata, ada empat pilar yang harus secara sistematis dan seimbang, yaitu Pemerintah, Pengusaha, Mass Media dan Masyarakat, ingatnya. Karyadi juga tidak lupa memberikan apresiasi kepada para pengusaha dan masyarakat yang telah menaati peraturan, terkait pemasangan iklan di Kota Singkawang. Semoga kerjasama yang baik seperti itu lebih ditingkatkan untuk masa-masa yang akan datang, harapnya. (dik)

apabila menemukan adanya aktivitas perjudian, tambahnya. (arm)

........ dari halaman 9 kat, jangan coba-coba menyimpan, menggunakan dan mengedarkan barang-barang Nakotika, apapun jenisnya. Jika itu terjadi, maka akan

dikenakan sanksi tegas sesuai dengan tindak hukum pidana yang berlaku, imbau Gede. Hingga berita ini diturunkan, Dk masih diinterogasi pihak

berwajib. Tersangka ini, selain mengedarkan dia juga telah mengonsumsi barang haram tersebut, papar Gede. (sul)

Tiga ABG Nyaris Dijual ke Singapura

Lubukbaja. Tiga remaja asal Bandung, Jawa Barat mengaku kabur dari salah satu hotel di kawasan Nagoya karena hendak dijadikan pramuria karaoke di Singapura oleh para cukong. Mereka lalu mendatangi Mapolresta Barelang untuk dilindungi. Para ABG yang diduga masih dibawah umur ini kini diamankan di shelter perlindungan perempuan dan anak (PPA) Polresta Barelang. Di temui wartawan kemarin, Cc, Nr dan Ls, inisial tiga wanita asal kota kembang itu mengaku dijanjikan gaji cukup menggiurkan oleh orang yang membawa mereka dari

Bandung ke Batam. Katanya gaji kami Rp6 juta setiap bulan, ujar Ls, satu dari mereka. Mereka mengaku sudah lima hari berada di Batam setelah transit di Jakarta. Oleh orang yang merekrut, ketiganya dijanjikan hanya bekerja di Batam sebagai pramuria. Tapi setelah tiga hari di Batam, kami akan dibawa ke Singapura untuk kerja di karaoke, kata Cc, korban lainnya. Mereka mengaku tidak punya pekerjaan tetap di kampung halaman. Ketika ditawari pekerjaan dengan iming-iming gaji besar, ketiganya menyanggupi untuk

mencari nafkah di kota ini dan bukan di Singapura. Karena takut diselundupkan ke negeri singa itu, ketiganya memilih kabur dari hotel dimana mereka ditampung ke kantor polisi. Kasus dugaan trafiking ini, ditutup rapat oleh Satreskrim Polresta Barelang. Tak satupun pejabat yang mau mengomentari kasus tersebut. Kanit PPA Satreskrim Polresta Barelang Iptu Yulianti Asril ketika dikonďŹ rmasi menampik pertanyaan wartawan seputar kasus ini. No comentlah, teriak Yulianti sambil bergegas masuk ke mobilnya di Mapolresta Barelang. (JP)

Waspada Maling Bermobil Pontianak. Saat ini para pelaku pencurian ada yang menggunakan mobil sewaan. Untuk itu masyarakat diminta waspada. Begitu juga dengan pemilik rental mobil agar tidak sembarangan menyewakan mobilnya kepada orang yang tidak jelas identitas. Dikhawatirkan si penyewa tersebut menyalahgunakan kendaraan yang disewanya. Polisi mengimbau agar pemilik rental tidak sembarang menyewakan mobilnya kepada orang yang belum dikenal. Karena dikhawatirkan mobil tersebut digunakan penyewa sebagai sarana melakukan pencurian, terang Kompol Bibit Triyono, Kapolsek Pontianak Timur. Selain itu dalam beberapa waktu terakhir, aksi kriminalitas yang beraksi di kediaman warga yang

ditinggal kosong kembali marak. Para pelaku beraksi dengan mengendarai mobil. Begitu memastikan rumah tersebut kosong, pelaku yang diperkirakan berjumlah lebih dari satu orang, lantas melancarkan aksinya. Tak jarang dari pelaku tersebut menggunakan mobil sewaan. Baru-baru ini aparat Polsek Timur berhasil mengamankan satu unit kendaraan yang diduga kuat digunakan pelaku tindak pidana untuk melancarkan aksinya. Sehingga bagi pemilik rental harus lebih waspada saat menyewakan mobilnya. Pastikan para penyewa ini memiliki identitas yang jelas, sehingga mobil tersebut tidak digunakan sebagai sarana untuk berbuat jahat. Identitas penyewa itu harus jelas, tinggalkan bukti identitas, semua itu tidak hanya

Rumah Kontributor dela, kata dia. Rizal dan istrinya bermukim di komplek Griya Pesona sejak tiga

bulan lalu. Sebelumnya selalu aman dan tidak pernah terjadi aksi pencurian. Aparat kepoli-

cukup berlandaskan kepercayaan, katanya. Selain dikhawatirkan mobil digunakan sebagai sarana kejahatan. Dikhawatirkan juga penyewa mobil tersebut malah menggadaikan mobil yang disewanya. Sehingga dengan kejelasan identitas penyewa mobil dapat menghindarkan beberapa dampak negatif yang timbul. Kewaspadaan itu perlu untuk mengantisipasi menjadi korban dari tindak pidana, imbaunya. Kapolsek juga mengimbau warga yang ingin bepergian dan meninggalkan rumahnya dalam keadaan kosong, pastikan ketika ditinggalkan dalam keadaan aman. Komunikasikan dengan tetangga terdekat agar dapat melakukan pemantauan terhadap rumah tersebut. (arm)

........ dari halaman 9 sian dari Polresta Pontianak telah mendatangi lokasi untuk melakukan olah TKP. (sul)


13 pemakaman lama penuh  ningkau nuan

Ketua DPRD Pantau Pelaksanaan Operasi Katarak Putussibau. Melalui fungsi kontrolnya, Ketua DPRD Kapuas Hulu, Ade M Zulkifli beberapa waktu lalu menyempatkan diri untuk memantau langsung pelaksanaan operasi katarak di RSUD dr Achmad Diponegoro, Putussibau. Operasi yang diselenggarakan atas kerja sama Dinas Kesehatan Ade M. Zulkifli̶lil dengan Persatuan Dokter Ahli Mata Indonesia (Perdami) ini disambut antusiasme warga. Pada saat pelaksanaan ratusan warga dari berbagai kecamatan datang mengantre untuk mendapatkan pelayanan. Hasilnya sebagian besar masyarakat Kapuas Hulu menderita katarak. Menurut Ade M Zulkifli dirinya selaku pimpinan dewan mengaku senang dengan program pemerintah daerah yang telah melaksanakan operasi katarak. Secara tidak langsung program ini telah membantu masyarakat, kita bisa bayangkan jika operasi ini tidak gratis, berapa banyak biaya yang harus dikeluarkan pemerintah, kata Telly, sapaan akrab Ade M Zulkifli. Pelaksanaan operasi sendiri dilakukan oleh empat dokter ahli mata. Program ini akan sangat membantu masyarakat Kapuas Hulu, apalagi bagi mereka yang mempunyai perekonomian rendah, sambungnya. Secara nasional program ini dilakukan di beberapa daerah termasuk daerah Kapuas Hulu. Telly menyampaikan kebanggaannya, pada saat kunjungannya tersebut, masyarakat bisa menyebarluaskan informasi operasi katarak ini kepada masyarakat lain yang belum mengetahui tentang program ini. Kesempatan ini tidak disia-siakan oleh masyarakat se-Kabupaten Kapuas Hulu, khususnya bagi usia produktif, mengalami katarak pada matanya, tuturnya. Operasi ini tidak hanya membuat masyarakat Kapuas Hulu bisa merasakan sinar kehidupan dunia. Tapi dikatakan Ade, lebih penting untuk lagi adalah bisa menyejahterakan kehidupan masyarakat pada umumnya. Operasi katarak dapat memulihkan mata orang, sehingga bagi kepala keluarga yang masih usia produktif, tentunya bisa beraktifitas seperti sediakala, untuk memenuhi nafkah keluarganya, paparnya. Lebih lanjut lagi Ade berkata, program ini merupakan suatu usaha pemerintah untuk lebih memberdayakan masyarakatnya. (lil)

uncak kapuas KAPUAS HULU

Senin, 20 Juni 2011

Membangun Bumi Kapuas Hulu

Dewan Masjid Bahas Rencana Isra Mikraj Putussibau. Perayaan Isra Mikraj Nabi Muhammad SAW 1432 H kali ini akan sedikit berbeda dengan tahun-tahun sebelumnya. Tahun ini pengurus Dewan Masjid Indonesia (DMI) Kapuas Hulu berencana untuk turun lapangan sesegera

mungkin, untuk menyesuaikan jadwal agar tidak bentrok kegiatan antara masjid yang satu dan lainnya. Kita sengaja membahas perayaan Isra Mikraj ini agar pelaksanaannya bisa lebih baik dari tahun-tahun sebelumnya. Dan

Gizi Modal Utama Tingkatkan IQ Putussibau. Kesadaran dan pengetahuan masyarakat tentang pentingnya gizi dalam pembentukan kualitas sumber daya manusia sangat penting sekali. Komposisi makanan dan gizi akan menentukan bagaimana kualitas SDM pada suatu bangsa.

Gizi yang buruk akan menciptakan generasi bangsa yang lemah dan tertinggal bila dibandingkan dengan bangsa lain, ungkap Siti Wahdah, koordinator pusat rehabilitasi gizi buruk Dinas Kesehatan Kapuas Hulu. Dikatakannya, pola makan, je-

Kapuas Hulu, kemarin. Penyusunan jadwal silaturahmi DMI kata Wahid ke berbagai masjid memang kerap dilakukan. Ini juga tugas DMI dalam memberikan pembinaan kepada masjid-masjid yang ada di bawah pengurus kabupaten,

kata Wahid. Sejauh ini, rencana turun ke kecamatan memang sudah di bahas jauh-jauh hari bersama pengurus lainnya. Namun untuk menetapkan waktu pelaksanaan kita langsung menggelar rapat, sambungnya. (lil)

Janin di dalam kandungan juga memerlukan makanan yang bergizi yang dialirkan melalui plasenta. Berdasarkan penelitian, kecerdasan anak juga sangat ditentukan sejak dari kandungan, pendidikan yang diberikan oleh orang tuannya dan lingkungan sekitarnya. Adanya kasus gizi buruk, tidak saja menghambat pertumbuhan dan perkembangan anak namun

akan menyebabkan penurunan IQ pada anak. Kebutuhan gizi tidak hanya di dapat dari makanan yang mahal dan modern namun banyak makanan tradisional di sekitar masyarakat juga mempunyai gizi yang sangat cukup. Seperti sayur-sayuran, buah-buahan, ikan, ayam baik yang ditanam atau dipelihara sendiri maupun yang terdapat liar di alam. (lil)

rapat ini untuk mengatur jadwal para penceramah yang akan turun ke masjid-masjid kecamatan, sehingga tidak ada jadwal yang bentrok, kata Abdul Wahud, Ketua Umum Dewan Masjid Indonesia ditemui usai rapat di Aula Kementerian Agama

nis makanan dan komposisi gizi makanan sangat urgen dalam pembentukan jati diri manusia. Sejak dari dalam kandungan, kebutuhan dan keseimbangan gizi harus telah disadari oleh calon ibu, suami, keluarga dan masyarakat sekitarnya.

Dari Rakor Kementerian PDT dan Bappeda

Wilayah Perbatasan Belum Tergarap Maksimal Putussibu. Sebagai daerah yang berbatasan langsung dengan Malaysia. Kabupaten Kapuas Hulu memiliki beragam potensi yang belum terg ali secara maksimal. Jika melihat dari letak geografis, terdapat sumber daya alam yang melimpah, jika dikelola dengan baik, akan mampu mewujudkan perekonomian yang maju dan sejahtera. Sungguh disayangkan semua potensi dan kekayaan alam itu, belum bisa digali oleh masyarakat Kapuas Hulu, ujar Baco Maiwa, anggota DPRD Kapuas Hulu pada saat menjadi pembicara pada Rapat Koordinasi Kegiatan Penguatan Kapasitas Kelembagaan Sosial Masyarakat dalam Upaya Percepatan Pembangunan Daerah Tertinggal, Kamis lalu. Dalam hal ini Baco menyampaikan kalau pemberdayaan ekonomi masyarakat, bertumpu pada potensi dan sumber daya lokal sendiri. Bayangkan saja kita mempunyai potensi hutan di Kapuas Hulu sekitar 70 persen adalah kawasan lindung yang

tentunya akan memegang peranan penting sebagai wilayah yang akan melindungi wilayah lainnya, paparnya. Terenting, katanya, bagaimana cara mengurus dan mengolah potensi menjadi sebuah keunggulan di daerah ini. Dari pohonnya saja, kayu belian merupakan jenis kayu yang berkualitas, sekarang tinggal kita untuk melestarikannya agar bisa menghasilkan kualitas terbaik, jelasnya. Perbatasan Kapuas Hulu berbatasan langsung dengan daerah Serawak̶Malaysia, di sana terdapat taman nasional seperti TNDS dan TNBK yang baru-baru ini sudah melakukan penandatanganan kesempatan antara pihak TNBK dengan masyarakat wilayah sekitar. Hal itu terang Baco akan berpotensi menjadi daerah konversi lintas batas pertama di Asia. Sekaligus tempat tersebut bisa dijadikan ekowisata dan wisata budaya, tuturnya. Jika dilihat dari luas perairan danau ada sekitar 12.885 hektar merupakan salah satu

kawasan perairan umum yang sangat potensial bagi produksi berbagai jenis ikan air tawar dan ikan yang punya nilai jual tinggi yg menjadi ciri khas Kapuas Hulu sebagai daerah perbatasan seperti Arwana. Contoh seperti Ikan Arwana jenis super red, contohnya. Sedangkan untuk luas kawasan budidaya, yang meliputi sekitar 48,79 persen dari luar Kabupaten Kapuas Hulu. Cukup berpotensial untuk pengembangan kegiatan pertanian, perkebunan maupun pemukiman. Banyaknya lahan tidur yang belum tergarap secara optimal. Sehingga Baco berharap agar peluang tersebut bisa dimanfaatkan oleh semua lapisan masyarakat dan sepenuhnya melalui dukungan pemerintah bisa dikembangkan. Mari kita bersama selalu mencari apa-apa yang menjadi peluang potensi daerah, masyarakat dan pemerintah mau bekerja sama dalam hal tersebut, untuk mendukung keseimbangan pembangunan yang berkesinambungan, harapnya. (lil)

Baco Maiwa

bumi daranante Kabupaten Sanggau Membangun pemakaman lama penuh  bangun kebersamaan

Hadi: Makmurkan Tempat Ibadah SANGGAU. Wakil Bupati Sanggau, Paolus Hadi SIP MSi menegaskan, keberadaan sebuah tempat ibadah bukan hanya untuk untuk berkumpul saja. Tetapi merupakan tempat yang suci dan sakral, maka sepantasnya lah selalu terjaga dan dirawat dengan (M Khusyairi) seksama. Tempat ibadah mesti Poulus Hadi selalu dimakmurkan, dengan harapan proses syiar senantiasa berjalan. Di samping itu, hendaknya selalu terawat dan terjaga, ujar Hadi, kemarin lalu. Hadi mengimbau agar warga masyarakat di Bumi Dara Nante, untuk selalu membina hubungan kerukunan antara sesama. Soalnya, dengan terbinanya kerukunan, merupakan modal sosial, dalam meningkatkan pembangunan di tengahtengah masyarakat. Intinya kerukunan. Jika ini sudah terbina dengan baik. Maka, segenap keinginan umat akan tercapai, tukasnya. Diakui, hingga kini Pemkab Sanggau belum bisa memberikan alokasi pembangunan insftruktur yang berimbang. Ia mencontohkan, masih banyak ditemui beberapa wilayah dan kawasan, yang belum mendapatkan pembagian kue pembangunan. Mencermati itu, pihaknya terus berupaya, bagaimana alokasi dana untuk pembangunan bisa menyebar dan tidak terfokus pada suatu kawasan. Memang ada beberapa wilayah yang belum optimal mendapatkan alokasi pembangunan. Untuk itu kita terus menggalang dan agar pembangunan bisa berjalan dengan optimal, paparnya.Ke depan tambah Hadi, arah pembangunan tidak hanya terfokus pada insfrastruktur saja. Tetapi akan diimbangi dengan peembangunan dan pembinaan di bidang keagamaan. Pembangunan fisik maupun non pisik mesti harus seimbang. Soalnya, merupakan pembinaan akhlak dan moral, timpalnya. Pembangunan keagamaan ini kata Hadi, mutlak dilaksanakan karena merupakan benteng keimanan bagi generasi muda, dalam mengimbangi derasnya arus globalisasi dan pengaruh negatif yang selama ini marak meracuni para generasi muda. Sangat penting pembinaan bidang keagamaan ini. Sebab merupakan benteng untuk antisipasi pengaruh negatif, tukasnya. Menanggapi hal itu Hadi, meminta kepada masyarakat di Kabupaten Sanggau untuk mempertahankan kegiatan keagamaan yang ada. Soalnya merupakan cerminan moral bagi masyarakat. Kegiatan keagamaan mesti dilaksanakan dengan berkesinambungan. Merupakan kegiatan positif dalam menegakkan sendi kehidupan bermasyarakat, tandasnya. (SrY)

Raja Sanggau Tutup Gawai Cup SANGGAU. Sedikitnya seribuan warga tumpah-ruah di lapangan sepak bola, terletak di Desa Lintang Kapuas, Sanggau, kemarin lalu. Usut punya usut, kedatangan warga dari berbagai dusun dan desa terdekat itu, untuk menyaksikan malam hiburan rakyat. Penutupan turnamen sepak bola Gawai Cup seri-2 yang digeber sekitar sebulan itu. Kegiatan itu ditutup secara resmi oleh Raja Sanggau, Pangeran Ratu Surya Negara, Drs H Gusti Arman MSi. Istimewanya, seremoni kegiatan itu, dihadiri Uskup Sintang Mgr Agustinus Agus Pr, merupakan salah satu putra terbaik Kabupaten Sanggau, kelahiran Lintang Kapuas. Selain itu dihadiri Camat Kapuas, Drs F Meron MSi serta sekretaris MABM Kabupaten Sanggau, Budi Darmawan SSTP MSi. Raja Sanggau dalam kesempatan itu meminta, ke depan event itu hendaknya semakin ditingkatkan. Selain itu, pria yang akrab disapa Pak Teh ini memuji dukungan masyarakat setempat atas digelarnya

event tersebut. Di mana, sejak awal hingga berakhir, berhasil terlaksana dengan sukses dan aman. Ini salah satu bukti, rasa kebersamaan di masyarakat Lintang Kapuas, sudah terjalin dengan baik. Event ini bisa berjalan dengan aman dan sukses, tegas mantan legislator di DPRD Sanggau ini. Dipaparkan, dalam sebuah laga sepak bola, menang dan kalah merupakan sebuah hukum alam. Tentunya, untuk mencapai sebuah kesuksesan, jelas melalui sebuah kerja sama keras tim yang mumpuni. Bagaimana pun, kesuksesan dalam sebuah laga, tak bisa diraih dengan mudah. Namun, melalui cucuran keringat dan kerja sama tim yang solid. Bagi yang juara, kedepan hendaknya dipertahankan. Nah, bagi yang belum, hendaknya dijadikan acuan untuk lebih cemerlang di masa mendatang, harapnya. Kesempatan itu, Raja Sanggau sempat menembangkan beberapa lagu kesayangan nya. Tak pelak, ketika pria yang akrab dengan

semua kalangan ini, mulai melantunkan tembangnya, beberapa warga yang hadir sempat berteriak membahana. Hidup Raja… Hidup Pak Teh. Turnamen itu, merupakan agenda rutin masyarakat setempat. Ketika akan menyambut perayaan gawai. Selain itu, juga didukung oleh Keraton Surya Negara Sanggau. Camat Kapuas, Drs F Meron M Si mengungkapkan, melihat antusiasisme masyarakat menggelar turnamen sepak bola di wilayah Kecamatan Kapuas. Ia berjanji ke depan, akan menggelar liga khusus untuk wilayah kecamatan Kapuas tersebut. Guna untuk dijadikan ajang penjaringan dan penyaringan bibitbibit sepakbola. Saya bangga dengan antusias masyarakat. Nah, kita berupaya akan menggelar liga khusus untuk Kecamatan Kapuas. Ini akan dijadikan ajang untuk seleksi bagi pemain, nantinya akan memperkuat tim Kapuas ke depan, tegasnya.

Raja Sanggau dan Uskup Sintang serta Sekretaris MABM Sanggau, berpoto bersama juara turnamen sepak bola di Lintang Kapuas, kemarin lalu. M KHUSYAIRI/EQUATOR Meron menambahkan, tim Kapuas menemui kegagalan dalam liga Dara Nante yang sedang digeber. Namun, demikian tak membuat mantan camat Parindu ini

patah arang, untuk melaksanakan pembinaan terhadap tim sepak bola Kecamatan Kapuas. Kekalahan itu, akan dijadikan bahan evaluasi untuk di masa mendatang. (SrY)

Rawa Bangun Digoyang Hiburan Rakyat SANGGAU. Salah satu upaya memancing warga untuk mengunjungi kawasan pasar Rawa Bangun, Sanggau. Pasca relokasi pedagang kaki lima (PKL) yang dilaksanakan Pemkab Sanggau, belum lama ini. Wujud kepedulian terhadap nasib para PKL. Beberapa kalangan masyarakat di kota Sanggau, berinisiatif menggeber hiburan rakyat selama dua hari berturut-turut di bangunan pasar tersebut, Sabtu (18/6) dan Minggu (19/6). Kegiatan hiburan itu dibagi dua sesi malam dan siang, dengan menggunakan organ tunggal serta di hibur beberapa artis lokal Sanggau. Hiburan rakyat tersebut, boleh dikatakan aksi spontanitas dari lamanya menunggu janji pemerintah, untuk menghidupkan kawasan Rawa Bangun itu. Ini merupakan wujud upaya kita mendukung kebijakan pemerintah. Bagaimana supaya Rawa Bangun ini, bisa dikunjungi warga yang akan berbelanja berbagai keperluan.

Bagaimana pun, keberadaan PKL ini mesti eksis, setelah dipindahkan, ungkap Iskandar Murjani dan Indra Putra, merupakan pemrakarsa hiburan malam, kemarin. Pria yang akrab disapa Ocel Maman ini menambahkan, keberadaan PKL mustahil bisa eksis, jika tanpa dukungan pembeli. Untuk itu, dengan adanya hiburan rakyat itu, merupakan upaya untuk menyedot animo masyarakat untuk mendatangi Rawa Bangun. Sehingga dengan sendirinya bisa tersosialisasi dengan sendirinya. Harapan kita, supaya PKL jangan sampai berpikir untuk kembali ke tempat asal mereka berjualan. Nah, ini merupakan salah satu media kita, untuk membantu pemerintah dan PKL, untuk mensosialisasikan keberadaan pasar Rawa Bangun ini, beber MC kondang di Kabupaten Sanggau ini. Sementara itu, Nasri Alisan ST dan Edi Siswanto pemrakarsa hiburan siang mengungkapkan, sejak dua

Suasana hiburan malam di Rawa Bangun Sanggau, kemarin (M Khusyairi) atau tiga hari yang lalu, dirinya telah mendengar, beberapa di antara PKL Rawa Bangun, sudah ada yang mau kembali ke tempat mangkal yang lama. Alasannya, Kredit Usaha Rakyat (KUR) yang dijanjikan Pemkab Sanggau, hingga kini belum direalisasikan. Selain itu, karena kawasan pasar tersebut sepi pembeli. Kita prihatin, omset mereka

menurun. Tapi kita hanya bisa membantu dari sisi ini menampilkan hiburan saja. Mudah-mudahan kita mampu melaksanakan ini, satu minggu sekali, ujarnya. Pihaknya kata Anas dengan berbagai kalangan masyarakat lainnya, akan mengupayakan untuk menjalin kerja sama dengan beberapa sektor yang memiliki korelasinya dalam

bidang perdagangan, seperti Kadin dan Hipmi Sanggau, untuk menggelar kegiatan lainnya. Intinya bisa membangkitkan keinginan masyarakat untuk berbelanja di Rawa Bangun tersebut. Ini upaya yang akan kita jajaki ke depan. Rencananya akan kita mulai minggu depan dan mudah-mudahan ini mendapatkan dukungan, pungkasnya. (SrY)


landak edo’

14 

injeh karaja

Petugas PLN memasang listrik prabayar. Kundori/Equator

PLN Luncurkan Grasss NGABANG. PLN Ranting Ngabang launching gerakan sehari sejuta sambungan (Grasss) tahap II dalam memperingati 66 tahun PT PLN di seluruh Indonesia, Jumat (17/6). Untuk Kecamatan Ngabang merupakan launching pertama sambungan prabayar dan penyalaan serta penyegelan, kata Urbanus, Manajer PLN Ranting Ngabang usai upacara. Urbanus bersama tim langsung memasang meteran prabayar. Untuk pertama kali dipasang di rumah seorang warga bernama Yusuf L Oukoil beralamat di kawasan Pulau bendu Jalan Raya Ngabang-Sanggau. Selain Pak Yusuf masih ada 15 pelanggan lain yang akan dipasang hari ini, karena Kecamatan Ngabang hari ini ada 16 calon pelanggan yang memesan pemasangan meteran prabayar di rumahnya, jelas Urbanus. Pada kesempatan itu, hadir juga tim penagihan dari Pontianak sebanyak lima orang. Tim melakukan penagihan bagi pelanggan yang menungga dan tidak mau membayar tunggakan rekeningnya. Karena kegiatan ini dipusatkan di Kecamatan Kuala Behe, maka selesai pemasangan rumah pertama di Ngabang sebagian tim berangkat berangkat ke Kuala Behe, tukas Urbanus. (rie)

Membangun Negeri Intan

Senin, 20 Juni 2011

PNS Harus Jadi Pioner Disiplin NGABANG. Sekda Landak, Ludis, mengimbau PNS di lingkungan Pemkab Landak membangun kesadaran disiplin. Disiplin PNS sudah diatur dalam peraturan perundang-undangan. Masing-masing kepala SKPD, agar mempelajari dan mensosialisasikan kepada pegawainya. Kalau dapat, kita ini PNS menjadi pelopor dalam menegakkan disiplin sebelum masyarakat kita berdisiplin, tegas Ludis saat memimpin upacara bulan 17 Juni lalu di kantor bupati. Menurut Ludis, disiplin yang diatur dalam peraturan perundang-undangan pada dasarnya terdiri dari tiga budaya. Yaitu budaya tertib, budaya kerja dan budaya bersih. Walaupun secara tegas tidak disebut secara nyata dalam peraturan, tapi harus dipahami jika disiplin mencakup tiga budaya. Budaya tertib, yakni kegiatan-kegiatan terlaksana dengan tertib, bukan hanya pekerjaan tapi dalam diri kita, mulai berpakaian dan dalam kehidupan masyarakat, perjalanan lalu lintas harus dilaksanakan kalau kita mau menegakkan budaya tertib ini, kata Ludis. Kemudian, budaya kerja. Jika dilihat, tanpa kerja PNS tidak dapat penghasilan. Tidak dapat melanjutkan kehidupan lebih baik. Karena itu, kerja bukan dilihat dari beban tapi merupakan kewajiban untuk kelangsungan hidup budaya kerja.

PNS di lingkungan Pemkab Landak saat apel bulanan tiap tanggal 17 di halaman Kantor Bupati. Kundori/Equator

Sedangkan budaya bersih, bukan hanya kita dilihat fisik bersih, dalam lingkungan kantor,

rumah tangga, dalam masyarakat juga dalam diri kita batin kita. Mulai dari perilaku kita

juga mengisyaratkan kita harus bersih. Nah ini prinsip disiplin yang ideal yang harus kita lak-

sanakan, tandas Ludis yang juga Ketua Dewan Adat Dayak (DAD) Landak itu. (rie/humas)

Landak Kirim Kontingen Jamnas IX ke Sumsel

IST

NGABANG. Cabang (Kwarcab) Gerakan Pramuka Landak mengirimkan 32 orang mengikuti Jambore Nasional ( Jamnas) ke IX di Bumi Perkemahan Teluk Gelam Kabupaten OKI, Provinsi Sumatra Selatan (Sumsel). Rombongan Tim Jamnas asal Landak ini akan diberangkatkan pada Minggu (26/6) mendatang oleh Kamabicab Landak Adrianus

Asia Sidot, kata Sekretaris Kwarcab Gerakan Pramuka Landak, Ngatiman kepada Equator, baru-baru ini. Setelah dilepas, rombongan langsung menuju Pontianak. Sampai di Pontianak, peserta Jamnas asal Landak akan dikarantina selama satu hari satu malam bersama peserta Jamnas se-Kalbar. Senin (27/6), semua rombongan akan bertolak ke Tanjung Priuk Jakarta den-

gan menggunakan kapal. Kemudian, dari Tanjung Priok langsung diberangkatkan ke Teluk Gelam OKI, Sumsel menggunakan bis. Kegiatan Jamnas akan berakhir pada 9 Juli mendatang. Setelah itu khusus rombongan Landak, 10 Juli akan melakukan refreshing dengan mengunjungi beberapa tempat hiburan seperti di Taman Mini Indonesia Indah (TMII) Jakarta, kata Ngati-

man yang juga Kepala SDN 16 Ngabang itu. Menurutnya, selama di Jakarta, kontingen akan dibawa jalan-jalan selama satu hari penuh. Kemudian akan bermalam selama satu malam di Jakarta. Nah, khusus rombongan Landak, 11 Juli baru akan pulang ke Pontianak menggunakan pesawat dan langsung pulang ke Ngabang. Adapun 32 orang peserta Jamnas asal Landak

ini, semuanya merupakan siswa SMP Penggalang yang direkrut dari seluruh Kecamatan yang ada di Landak. Perekrutan peserta Jamnas inipun disesuaikan dengan banyaknya gugus depan (gudep) dari tiap kecamatan se-Landak, tegas Ngatiman seraya menambahkan, mereka akan didampingi delapan pembina yang sudah memilikipersyaratan minimal mahir dasar. (rie)

bumi lawang kuari 

balai betomu

Silaturahmi Cegah Tawuran Pelajar SEKADAU. SMU Karya Sekadau memiliki banyak cara menghilangkan rasa penat anak muridnya terhadap proses belajar mengajar. Salah satunya menerima kunjungan sekolah lain saat waktu jeda usai ulangan umum hingga menjelang waktu bagi rapot. Kepala SMU Karya Sekadau, Drs Sumardi kepada sejumlah wartawan di sela-sela menerima kunjungan dari SMU Negri 01 Nanga Mahap, Sabtu (18/06) mengungkapkan, kunjungan antar sekolah berguna sebagai ajang refreshing, bertukar pengalaman, serta menganstispasi tawuran antar sekolah. Walaupun di Sekadau hal itu (tawuran antar sekolah, red) tidak pernah terjadi, namum sedini mungkin diantisipasi dengan cara silahturahmi antar sekolah, ucapnya. Sumardi mengungkapkan, kunjungan dari SMU Negri Nanga Mahap memang sudah lama di jadwalkan. Kedua sekolah sama-sama memanfaatkan waktu sengang setelah ulangan umum. Dalam kunjungan ini, ada beberapa kegiatan yang diadakan. Diantaranya pertandingan bola kaki putra-putri, volly ball putra-putri, tenis meja, basket dan bulu tangkis, pungkasnya. (tar)

Prestasi Olahraga Sekadau Rendah SEKADAU. Prestasi olahraga Sekadau saat ini belum bisa berbicara banyak di kancah provinsi. Buktinya, pada Olimpiade Olah Raga Siswa Nasional (O2SN) yang baru dihelat dipropinsi, Sekadau belum mampu bersaing dengan daerah-daerah lainnya. Kondisi ini menyedot perhatian anggota DPRD Sekadau, Albertus Pinus. Ia meminta instansi terkait, terutama Dinas Pendidikan Pemuda dan Olahraga untuk meningkatkan pembinaan terhadap atlet-atlet daerah yang berprestasi. Pembinaan terhadap atlet mesti ditingkatkan melalui pengadan tempat latihan, ungkap Pinus kepada Equator melalui pesan singkatnya, belum lama ini. Menurut Pinus, di Sekadau banyak sekali atlet yang berbakat. Namum sangat disayangkan kalau sarana untuk latihan masih minim. Sehinga sulit bagi mereka untuk berkembang, ujarnya. Pinus menambahkan, event-event penjaringan bakat yang gencar diadakan mesti ada tindaklanjutnya. Tujuannya, agar bakat putra-putri Sekadau dapat bersaing dengan daerah lainnya unutk mengharumkan nama Sekadau dalam cabang olah raga. Kalau hanya diadakan event untuk mencari bakat tetapi tidak ada tindaklanjutnya, percuma saja. Maka dari itu Dinas terkait harus menggiatkan pembinaan secara berkelanjutan agar kedepannya kita mampu mencapai prsetasi lebih baik, sarannya. (tar)

Pekerjaan Jalan SekadauSanggau Jangan Asal-asalan SEKADAU. Anggaran Rp 50 miliar untuk pelebaran ruas jalan dari perbatasan Sanggau ke arah kota Sekadau sudah dicairkan 30 persen. Namun proses pengerjaannya terkesan dilambat-lambatkan. Padahal dana 30 persen tersebut sudah dikantongi PT Angkasapuri Konsursindo (AK) selaku pengerja. Seharusnya PT AK sebagai pihak ketiga menyesuaikan dana yang sudah dikeluarkan oleh pemerintah. Tapi saya lihat kegiatan di lapangan sama sekali tidak menunjukan adanya kemajuan, kata H Mulyadi H Yamin, anggota DPRD Kalbar Daerah Pemilihan (Dapil) Seka-

dau-Sanggau kepada Equator, belum lama ini. Pelebaran jalan dari batas Sanggau menuju Kota Sekadau menelan lumayan besar. Karena itu, pekerjaannya harus dilakukan dengan serius. Jangan asal-asalan, karena warga Sekadau sudah merindukan jalan yang representatif, tutur Mulyadi. Ketua Komisi C (Bidang Pembangunan) DPRD Kalbar ini mengakui sudah menerima laporan warga bahwa kegiatan lapangan sudah berlangsung hampir tiga bulan. Namum anehnya, hasil pekerjaan belum terlihat keseriusan dari PT AK.

Sudah sepantasnya pekerjaan ini ditinjau ulang. Masayarakat Sekadau marah. Begitu dikerjakan jalan kembali hancur dan berdebu jika kemarau. Sebaliknya, jika hujan malah licin karena lumpur bekas tanah untuk pelebaran, beber pria kelahiran Sekadau itu. Mulyadi mempertanyakan kemana dana 30 persen yang sudah diambil oleh PT AK sebagai pelaksana. Pemerintah harus cepat turun tangan untuk mengecek hasil kerja dan disesuiakan dengan uang yang sudah diambil sebagai uang muka, imbuh politisi partai Golkar itu. (tar)

H Mulyadi H Yamin (kanan) bersama H Oesman Sapta Oedang saat di asrama mahasiswa Kalbar Rahadi Osman Yogyakarta, beberapa pekan silam. DOKUMEN/EQUATOR

PKK Ajak Pelajar Jaga Kebersihan SEKADAU. Kegiatan Jumat bersih yang diperkasai Pemberdayaan Kesejahteraan Keluarga (PKK) dan Kantor Lingkungan Hidup dan Pertamanan, Jumat (17/5) lalu dititikberatkan di Tugu PKK Sekdau. Panitia mengikutsertakan pelajar dari Sekolah Pendidikan Pertanian (SPP) Sekadau. Peserta acara Jumat bersih memungut sampah yang berserakan di sekitar arel tugu tersebut. Tampak hadir dalam kegiatan itu, Ketua TP PKK Sekadau Nyonya Scolastika Simon Petrus dan Wakilnya Nyonya Kristina Rupinus, Kepala Kantor Lingkunga Hidup dan Pertamanan Kabupaten Sekadau Agustinus Agus, pimpinan Radio Dermaga Dirgantara Nikodimus Bohot, dewan guru serta siswa-siswi SPP Sekadau. Dalam sambuatnnya, Agustinus Agus mengungkapkan, lingkung an yang kita huni mestinya dibuat nyaman agar para penghuninya merasa betah mendiaminya. Karena itu, sebagai kota yang masuk pringkat 5 gelar Adipura se-Kalbar,

Ketua TP PKK Sekadau berserta pengurus PKK dan kepala kantor LH-Pertamanan saat pengarahan sebelum memulai Jumat Bersih di Tugu PKK Sekadau, Jumat (17/6). ANTONIUS SUTARJO/EQUATOR

sudah sepatutnya kebersihan lingkungan terus di pacu, ucap Agus. Terkait keikutsertaan siswasiswi SPP Sekadau dalam kegiatan tersebut, Agus menyampaikan apresiasinya. Saya berterima kasih kepada siswa-siswi

SPP Sekadau yang turut hadir dalam acara Jumat bersih. Walaupun tidak semua sekolah sekadau yang ikut, namun ini merupakan moment yang baik dalam kampanye kebersihan lingkungan di Kabupaten Sekadau, tutur Agus.

Ketua TP PKK Sekadau, Nyonya Scoslastika Simon Petrus berpendapat sama tentang kebersihan. Ia menghimbau agar perlakuan terhadap kebersihan lingkungan jangan hanya pada saat tertentu saja, tapi setiap saat, termasuk dirumah, kare-

na kesehataan yang diperoleh adalah tuaian kebersihan yang dilakukan. Jadi lakukan terus kebersihan baik dirumah maupun disekolah, karena dirumah adalah prilaku awal kebersihan kita, kemudian baru diluar rumah termasuk saat ini, ajak Tika sapaan arkrab istri Bupati Sekadau tersebut. Wanita kelahiran Desa Menawai Tekam, Kecamatan Belitang Hilir ini menyebutkan, pada kegiatan HKG PKK yang dihelat di Pontianak bulan Mei lalu, Sekadau mendapatkan juara pertama hasil anyaman terbaik, yakni anyam Sampit dan Bakul. Anyaman ini merupakan buah kerajinan masyarakat dari desa Pantok Kecamatan Nanga Taman. Peridikat juara yang dicapai ini menjadi motivasi PKK dan Dekranas Sekadau untuk meningkatkan hasil kerajinan. Dekranas akan mengadakan pemgembangan motif sampit dan bakul di Desa Pantok melalui pemkayaan motif tanpa mengabaikan budaya daerah setempat, tukasnya. (tar)


15

geliat kayong utara Senin, 20 Juni 2011

Bayar Rp 80 Ribu Ambil Dokumen Lelang Diknas Melanggar Perpres Nomor 54/2010

Baharudin

SUKADANA. Pelaku jasa konstruksi di Kabupaten Kayong Utara harus mengeluar

Takzim Kaum

kan dana sebesar Rp 80 ribu untuk mengambil dokumen paket lelang proyek. Hal itu terjadi di lingkungan Dinas Pendidikan (Diknas) Kayong Utara. Pe n a r i k a n u a n g d a l a m pengambilan dokumen ini menjadi sorotan dan pertanyaan kalangan pelaku jasa konstruksi. Tak hanya saya, berdasarkan informasi dari rekan-rekan kontraktor untuk mendapatkan satu dokumen lelang yang disiapkan Disdik harus bayar Rp 80 ribu. Dokumen tersebut diambil di Foto C o p y Garuda

Simpang Tiga Dambakan Tanggul

PEMBANGUNAN tanggul air asin sangat didambakan masyarakat Desa Simpang Tiga, Kecamatan Sukadana. Camat Sukadana, Agus Suratman SE mengupayakan ikut mendorong agar tanggul yang dinantikan masyarakat ini bisa terakomodir dalam anggaran berikutnya. Soal tanggul ini, dikatakan Agus Suratman SE Agus, telah disampaikan masyarakat setempat ke anggota DPRD Kalbar, Sy Umar Alqadri sewaktu reses ke Desa Simpang Tiga, beberapa waktu lalu. Masyarakat, dikatakan mantan Kabag Humas dan Protokoler Setda Pemkab Kayong Utara ini, berharap agar Sy Umar yang juga mantan Pj Bupati KKU ini dapat menyuarakan aspirasi masyarakat di tingkat provinsi. Tetapi, Pak Sy Umar berjanji jika aspirasi masyarakat tidak dapat diakomodir di provinsi maka dirinya akan melakukan pendekatan melalui rekan di DPRD kabupaten, ujarnya. Tahun 2011 ini, dikatakan Agus, telah dianggarkan Rp 200 juta untuk membangun tanggul. Hanya saja, anggaran tersebur masih sangat minim sebab tanggul yang dikerjakan mencapai 10 kilometer. Karena minim, maka keinginan masyarakat mungkin anggaran tersebut dialihkan ke lokasi lain yang juga untuk tanggul, ucapnya. Di bagian lain, Agus yang juga mantan Camat Simpang Hilir menyampaikan, DPRD Kalbar akan membantu gapoktan berupa handtracktor, alat semprot rumput, serta bibit padi. Rencananya, bantuan ini akan disalurkan sekitar Juli mendatang. (lud)

Dai Ichi, Dusun Senebing, Desa Harapan Mulia, Kecamatan Sukadana, ungkap Baharudin, salah seorang kontraktor kepada Equator, belum lama ini. Walau uang yang dikeluarkan tak seberapa, namun hal ini menjadi sorotan karena tak sejalan dengan Perpres Nomor 54/2010 tentang Pengadaan Barang/Jasa Pemerintah. Jika mengacu pada Perpres, dikatakan Baharudin, hal tersebut sangat bertentangan. Sebab, dalam pasal 23 ayat (2) huruf c disebutkan biaya penggandaan dokumen pengadaan barang/jasa sudah menjadi tanggungjawab pihak penyedia jasa dalam hal ini pemerintah daerah melalui

dinas terkait. Kalau kita mencerna Perpres dimaksud, maka tidak ada bayaran alias gratis dalam pengambilan dokumen lelang karena sudah ditanggung pemerintah baik melalui APBN atau APBD, jelas Wakil Ketua Kadin KKU ini. Diakui Baharudin, kalangan kontraktor cukup resah adanya pembayaran untuk pengambilan dokumen lelang. Sebab, kalangan pelaku usaha kontruksi di daerah ini tak ingin terjadi hal-hal yang tak diharapkan. Apalagi, jika praktik pembayaran dalam pengambilan dokumen tersebut bertentangan dengan aturan. Sebetulnya, kita tidak be-

gitu keberatan namun jangan sampai menimbulkan masalah baru, karena tak mengikuti aturan yang ditetapkan, pesannya. Lebih jelas, Baharudin membacakan Perpres Nomor 54/2010 pasal 23. Pada ayat (1) disebutkan bahwa Penyusunan Rencana Umum Pengadaan Barang/Jasa pada K/L/D/I untuk Tahun Anggaran berikutnya atau Tahun Anggaran yang akan datang, harus diselesaikan pada Tahun Anggaran yang berjalan. Sedangkan pada ayat (2) K/L/D/I menyediakan biaya untuk pelaksanaan pemilihan Penyedia Barang/Jasa yang dibiayai dari APBN/APBD,

yang meliputi: a. honorarium personil organisasi Pengadaan Barang/Jasa termasuk tim teknis, tim pendukung dan staf proyek; b. biaya pengumuman Pengadaan Barang/Jasa termasuk biaya pengumuman ulang; c. biaya penggandaan Dokumen Pengadaan Barang/ Jasa; dan d. biaya lainnya yang diperlukan untuk mendukung pelaksanaan Pengadaan Barang/Jasa. Sistem yang dilakukan Dinas Pendidikan, diakui Baharudin, sangat berbeda dengan Dinas Perhubungan, Komunikasi dan Informatika (Dishubkominfo) dan Dinas Pendapatan, Pengelolaan Keuangan dan Aset Daerah (DPPKAD) Kabupaten

Kayong Utara. Di dua dinas ini, tidak perlu bayar melainkan para kontraktor yang ingin ikut tender cukup diberikan CD yang memuat dokumen lelang. Sepertinya system dengan CD ini lebih efektif dan tidak mubazir kertas serta paling penting tidak menyalahi aturan, tandasnya. Terpisah, Sekretaris Dinas Pendidikan Kabupaten Kayong Utara, Gunawan ST mengaku belum tahu perihal tersebut. Saya belum mengetahui hal tersebut. Nanti kita minta penjelasan panitia, kata Gunawan menjawab Equator via short massage service (SMS). (lud)

Jarang Ngantor, Kadis Jangan Dipertahankan SUKADANA. Kepala Dinas yang jarang di tempat kerja alias jarang masuk kantor, sebaiknya tidak dipertahankan. Demikian ditegaskan tokoh masyarakat Kabupaten Kayong Utara, Achmad Oemar menjawab Equator, Jumat (17/6).

Penegasan tersebut dilontarkannya, menyikapi rencana pelantikan SKPD di lingkungan Pemkab Kayong Utara dalam waktu dekat ini. Achmad Oemar yang akrab disapa Pak Ong mennilai, salah satu penyebab terjadinya ke-

munduran di birokrasi lebih disebabkan lantaran kepala SKPD jarang di tempat tugas. Makanya, saya berharap Pak Bupati jangan lagi meneruskan pejabat-pejabat yang sering tidak masuk kerja. Sebab hal tersebut sama saja tidak men-

dukung cita-cita Bupati untuk membangun daerah ini dengan serius, sebutnya. Selama ini, menurut Pak Ong, umumnya kalangan pejabat seperti kepala dinas hanya maksimal tiga hari kerja dalam sepekan. Yakni Selasa hingga Jumat. Sebab,

Songsong HUT Kayong Utara ke-4 (bagian-3)

kalangan pejabat dari luar daerah biasanya pulang meninggalkan KKU pada Jumat dan kembali pada hari kerja yakni Senin. Pejabat yang seperti ini harus menjadi bahan evaluasi kepala daerah dalam menetapkan kepala SKPD nantinya, sarannya. (lud)

Oleh: Kamiriluddin

Puskesmas Apung untuk Masyarakat Kepulauan S ELAIN bidang pendidikan, Pemkab Kayong Utara melalui Dinas Kesehatan terus berupaya memaksimalkan program kesehatan gratis. Sekarang ini, seluruh warga KKU masuk dalam program jaminan kesehatan daerah (Jamkesda). Bupati Kayong Utara H Hildi Hamid menegaskan, dirinya juga tidak lagi ingin mendengar ada warga yang sakit namun tidak mendapatkan pelayanan untuk pengobatan lantaran karena rupiah. Sebab selain pendidikan, kesehatan juga menjadi bagian dari visi kepemimpinannya selaku kepala daerah dalam masa ja-

batan lima tahun. Demikian pula terhadap pelayanan pengobatan. Untuk pengobatan yang dilakukan dengan memanfaatkan fasilitas serta jasa yang dibiayai oleh pemerintah dan pemerintah daerah digratiskan. Untuk masyarakat tiga desa yang ada di Kepulauan, yakni Desa Pelapis, Desa Padang dan Desa Betok Jaya, Kecamatan Pulau Maya Karimata, Pemkab membuat Puskesmas Terapung, jelasnya. Kapal Motor yang digunakan untuk Puskesmas Terapung ini, dikatakannya, adalah kapal bekas nelayan asing yang

mencuri ikan yang berhasil ditangkap masyarakat. Kapal tersebut kemudian direnovasi dan didesain senyaman mungkin untuk pelayanan ke masyarakat. Kabupaten ini juga memperbanyak Puskemas yang menyediakan rawat inap yang ada di setiap kecamatan. Lebih bagus membangun Pusekemas rawap inap dengan pelayanan setingkat Rumah Sakit. Dari pada membangun rumah sakit tetapi pelayanannya setingkat Puskemas, tutur Bupati ketika ditanya kenapa tidak membangun Rumah Sakit di tingkat Kabupaten. (bersambung)

Puskesmas Apung disambut antusias masyarakat kepulauan yang ingin berobat.

kabupaten ketapang 

Pempadahan

Tambah Jumlah Wasit Sepakbola 20 Hakim Lapangan Ikuti Pelatihan KETAPANG. Memasyarakatnya olahraga sepakbola di Kabupaten Ketapang, dipandang perlu menambah jumlah wasit sebagai hakim di lapangan hijau. Karena itulah, untuk pertama kalinya pelatihan wasit sepakbola dilakukan Dinas Kebudayaan Pariwisata Pemuda dan Olahraga Kabupaten Ketapang di Kecamatan Tumbang Titi, Rabu dan Kamis, 15-16 Juni lalu. Pelatihan yang dilaksanakan di Aula Pertemuan Kantor Camat Tumbang tersebut diikuti sekitar 20-an wasit dari Kecamatan Tumbang Titi, Nanga Tayap, Pemahan dan Sungai Melayu Rayak. Pelatihan wasit sepakbola untuk pertama kali dilakukan di Kecamatan Tumbang Titi tersebut dibuka Maluru, Camat Tumbang Titi didampingi Danramil Tumbang Titi dan Saiful Zalid, Kabid Pemuda dan Olahraga Disbudparpora Kabupaten Ketapang. Camat Tumbang Titi berharap pelatihan sepakbola ini merupakan momentum yang tepat. Sebab, pelatihan seperti ini memang sangat langka, dan olahraga sepakbola di Kabupaten Ketapang memang sangat diminati. Pelatihan ini tentu saja menambah wawasan wasit, sehingga dapat menghasilkan pertandingan yang berkualitas. Menurut camat, tujuan pelatihan wasit ini tentu saja untuk menambah wawasan wasit. Namun, ia menekankan agar menumbuhkan semangat sportivitas. Saya berharap dengan adanya pelatihan wasit ini, tentu saja ke depan wasit punya pemahaman yang cukup bermanfaat untuk memimpin pertandingan di lapangan, ujar Maluru. Lebih lanjut ia menyebutkan, dengan pelatihan ini diharapkan dapat meminimalisir terjadinya kecurangan saat pertandingan. Setiap tahun bisa dipastikan ada kegiatan pertandingan sepakbola, termasuk juga dalam rangka memperingati Hari Kemerdekaan RI (17 Agustus). Dihadirkannya nara sumber pelatihan wasit, seperti Marianus Ogok dan Irwan, peserta bisa memanfaatkan kesempatan tersebut untuk bertanya lebih banyak mengenai kasus-kasus dalam pertandingan kepada instruktur. Maluru mengaku cukup mengenal sosok instruktur pelatihan wasit, karena merupakan temannya ketika dibangku sekolah. Kami berterima kasih kepada Dinas kebudayaan Pariwisata Pemuda dan Olahraga Kabupaten Ketapang yang telah memfasilitasi pelatihan wasit sepak bola di Kecamatan Tumbang Titi. Ke depannya, kami juga siap untuk menerima dilaksanakannya pelatihan wasit atau event lainnya di Tumbang Titi, tentunya cabang olahraga lainnya , kata Maluru. Sementara itu, Bernard Irawan, Kasi Olahraga Disbudparpora Ketapang menuturkan pelatihan wasit sepakbola ini dilakukan untuk pertama kalinya di tingkat kecamatan. (KiA)

Manajemen PDAM Ketapang Rusak Tertinggal dari Kabupaten Lain KETUA Komisi III, Halipudin, menilai manajemen PDAM Ketapang saat ini masih rusak. PDAM Ketapang masih sangat jauh tertinggal dengan PDAM di daerah lain. Manajemen PDAM masih rusak. Tapi itu karena pembiayaan. Kalau kita mau memberikan biaya, kita harus lihat di mana kemampuan dan kelemahan selama ini, kata dia kepada wartawan. Ketua Komisi yang membahas penyertaan modal PDAM itu mengaku sempat mengunjungi PDAM Banjarmasin dan Tirta Musi Palembang. Hasilnya PDAM Ketapang sangat jauh tertinggal. Tapi lagi-lagi hal itu

disebabkan minimnya modal PDAM Ketapang. Kunjungan kami mencari referensi di tempat-tempat lain, memang ternyata jauh tertinggal. Itu tentunya karena dari permodalannya sangat kecil. Kalau Banjarmasin belajarnya dengan Pontianak, tapi lebih bagus sekarang. Bahkan terbaik di Kalimantan. Pengolahan dan manajemennya juga bagus, ungkapnya. Karena itu, ke depannya adanya penyertaan modal, PDAM Ketapang paling tidak mendekati meski tak harus menyamai dua PDAM tersebut. Ia mengatakan untuk merubah manajemen yang rusak bukan perkara mudah.

Halipuding mengaku sebelum penyertaan modal PDAM, Komisi III harus lebih dulu melihat aset-aset yang dimiliki PDAM Ketapang. Salah satunya dengan kunjungan ke Riam Berasap. Halipudin juga mengaku masih belum membicarakan soal nominal penyertaan modal yang bakal digelontorkan. Dalam penyertaan modal, kita tidak dapat dikeluarkan tanpa melihat asetaset. Tentunya kita mau melihat berapa aset yang ada, berapa yang masih produktif dan berapa yang harus kita ganti. Selain itu apa juga yang harus kita benahi, ujarnya. Riam Berasap Halipudin juga mengaku sem-

Halipudin

pat turun langsung ke Riam Berasap bersama dengan perwakilan PDAM Ketapang. Dijelaskannya, ada pemisahan antara Riam Berasap dengan PDAM lantaran belum ada serah terima. Orang PDAM ketika itu

cukup menyaksikan saja. Maka kita bawa orang PU dari Cipta Karya, karena itu masih dalam kewenangan PU. Masih dianggap milik pemerintah daerah yang ditangani Dinas PU. Jadi statusnya bukan milik PDAM, tegasnya. Dikatakannya, sepintas tidak ada korelasi antara kunjungan Pansus III ke Riam Berasap. Pasalnya, Pansus III membahas penyertaan modal untuk PDAM, sementara Riam Berasap masih belum diserahkan ke PDAM. Tapi ke depan, jika sudah layak dan PDAM mampu tentu akan menjadi milik PDAM. Tentunya dengan peralatan dan pembiyaan yang ideal menurut PDAM, itu akan mungkin menjadi milik PDAM, terangnya. (KiA)

Morkes Patah Hati, Banyak Kader Tak Kritis Jangan Menjadi Duri dalam Daging KETAPANG. Ketua DPD Golkar Provinsi Kalbar, H Morkes Eendi secara blak-blakan mengatakan banyak kader Partai Golkar Ketapang, terutama yang duduk di kursi legislatif berselingkuh dengan kekuasaan. Kinerja legislator dari Fraksi Partai Pohon Beringin itu dinilai melempem. Banyak Kader Golkar di Ketapang ini yang sudah menjadi penjilat. Saya dengar juga anggota DPRD dari Golkar berselingkuh dengan kekuasaan. Saya patah hati dan patah arang mendengarnya, ungkapnya ketika memberi kata sambutan dalam acara Diklat Kader Fungsional DPD Golkar Ketapang, Sabtu (17/6) malam di Gedung DPD Golkar Ketapang. Dikatakannya, selaku kader Golkar harus memiliki militansi yang tinggi. Berani mengatakan kebenaran meski harus bertolak belakang dengan penguasa. Ia juga tegas-tegas mengatakan bahwa Golkar bukanlah tempat

mencari makan. Kita tidak boleh membiarkan sesuatu yang tidak benar terjadi. Tegakkan keadilan. Coba lihat itu masyarakat yang antre BBM berhari-hari. Mestinya yang seperti itu harus dikritik, tegasnya. Morkes juga mengkritik kebijakan Pemkab Ketapang saat ini yang dinilainya banyak KKN. Lebih disesalkannya lagi, legislator Golkar justru tak banyak berbuat untuk mengungkapkan itu. Anak bupati bagi-bagi proyek. Apa Ketapang ini miliknya. Tapi anehnya, banyak orang-orang Golkar yang jadi penjilat, sesalnya. Pada kesempatan yang sama, mantan Bupati Ketapang itu juga sempat menyinggung soal pergantian Ketua DPRD Ketapang. Ia memperingatkan Ir Gusti Kamboja agar tunduk dan patuh kepada keputusan partai. Morkes bahkan terang-terangan mengatakan Kamboja dan Magdelan Lily telah berselingkuh dengan

kekuasaan lantaran tak menyetujui pergantian Ketua DPRD. Pak Kamboja saya ingatkan itu. Kalau memang tidak mau keluar saja. Tidak ada yang memaksa untuk masuk Golkar. Jangan menjadi duri dalam daging, cecarnya. Ia juga mengingatkan hal tersebut jangan sampai terulang kembali. Jika terjadi lagi, maka ia tak segan-segan merekomendasikan pemecatan terhadap kader bersangkutan. Bahkan jika kader seperti itu tak dipecat, ia rela melepaskan jabatannya sebagai Ketua DPD Golkar provinsi. Dipecat atau saya yang mundur, tantangnya. Morkes juga mengatakan, kekalahan dalam Pemilukada 2010 lalu akibat perubahan konstelasi politik. Tidak solidnya kader-kader Golkar yang ada. Sejak 1971, Ketapang ini Bupatinya dari Golkar, baru 2010 saja bukan dari Golkar, ujarnya. Ia mengatakan, pada dasarnya

Ketua DPD Golkar Propinsi Kalbar, H Morkes Eendi memberikan kata sambutan dalam Diklat Kader Fungsional DPD Golkar Ketapang di Gedung DPD Golkar Ketapang. Kiram Akbar/Equator

Golkar bukanlah partai orang Melayu, Cina, Jawa atau Dayak. Golkar adalah partai tengah yang nasionalis.

Ia juga menyayangkan adanya kader yang pindah partai karena identitas kesukuan atau agama atau lantaran sebab lain. (KiA)


Kom.Bisnis

16

Senin, 20 Juni 2011

OTOMOTIF AWARD 2011

- Yamaha Byson Sabet Gelar “Bike Of The Year�, Mengapa Bukan Honda CBR250? - TVS 3 Motor Raih 8 Award - MINERVA Sabet 6 Gelar Anugerah motor terbaik versi Tabloid OTOMOTIF sudah dilangsungkan Sabtu (21/5) lalu bersamaan event OTOBURSA di Senayan. Setelah membaca artikelnya di www.otomotifnet.com, terungkaplah siapa saja jawaranya. Untuk motor totalnya ada 65 penghargaan. Ditambah dua penghargaan khusus untuk kategori bike of the year dan rookie of the year . Untuk jawara di kategori Bike of The Year diraih Yamaha Byson. Kelebihan apa yang bisa menempatkan Byson lebih terhormat ketimbang Honda CBR250? Apakah hanya karena CBR250 sudah menerima gelar Rookie of The Year ? Apakah tidak mungkin sebuah motor menerima dua gelar sekaligus, bike of the year dan rookie of the year . Dijelaskan pula bahwa nominasi untuk kategori bike of the year antara lain Yamaha

Byson, Honda New Megapro, Bajaj Pulsar 220, Honda Scoopy dan Honda CBR 250R. Sedangkan nominasi untuk kategori rookie of the year diantaranya CBR250, New Megapro, Scoopy, Byson, Bajaj Pulsar 220 dan New Scorpio. Menyabet gelar Bike of The Year harus memenuhi banyak syarat. Mulai dari ďŹ tur, teknologi, desain, performa mesin (kecepatan), fuel consumption, penjualan (penerimaan pasar), harga (value for money) hingga problem yang muncul selama diterima masyarakat. Sedangkan TVS 3 Motor berhasil memborong 8 Award sekaligus. Antara lain , The Best Feature & Technology: TVS NEO X3i 110, The Best Value: TVS NEO X3i 110, The Best Design: TVS NEW ROCKZ 125, The Best Performace & Handling: TVS NEW ROCKZ 125, The Best Value: TVS NEW ROCKZ 125, The Best Design: TVS

NEW APACHE RTR 160, The Best Performance & Handling: TVS NEW APACHE RTR 160, dan The Best Fuel Consumption: TVS NEW APACHE RTR 160. Walau pendatang baru, MINERVA tak kalah ketinggalan dengan motor-motor lainnya. Di ajang ini MINERVA berhasil meraup enam gelar. Untuk KATEGORI SKUTIK 150-170 CC, MINERVA merebut The Best Design: MINERVA GTR 150, The Best Performance & Handling: MINERVA GTR 170 dan The Best Value: MINERVA GTR 150. KATEGORI SPORT 150 CC meraih The Best Value: MINERVA R150 VX, KATEGORI SPORT 250 CC mendapatkanThe Best Value: MINERVA NEW MEGELLI 250 RE, dan KATEGORI DUAL PURPOSE Berhasil meraih The Best Design untuk MINERVA MEGELLI 250S. (biz)

Tiga Fungsi dalam Sebuah Peranti Ini dia, Photo Frame Digital Printer, FunFab ™ Seri P80. Sekarang Anda dapat menampilkan dan mencetak foto digital langsung dari perangkat penyimpanan memory Anda tanpa komputer. Siapkan memory di tangan Anda! Cukup hanya nyalakan FunFab P80 anda, semua foto indah dan mengesankan Anda akan ditampilkan satu demi satu dengan slide show, dan dikelilingi dengan latar musik juga. Perangkat frame foto digital kini semakin banyak ragamnya. Namun bagaimana bila frame foto digital dapat berfungsi pula sebagai mesin cetak foto? Keunikan inilah yang dihadirkan lewat inovasi FunFab P80 dari Abit. Abit? Ya, ternyata solusi 2in-1 ini hadir dari produsen yang lebih dikenal sebagai pembuat motherboard itu. Dengan FunFab P80, koleksi foto yang ditampilkan pada frame foto ini juga dapat dicetak dengan mudah, bahkan tanpa keterlibatan PC. Dilihat sekilas, FunFab P80 memang tampak seperti bingkai digital kebanyakan dengan menampilkan layar LCD TFT 8 beresolusi 800x600 pixel. Namun jika melihat bagian belakangnya, tampak kompartemen printer foto yang menggunakan sistem dye-sub. Melalui kompartemen ini, foto dicetak dari lapisan pigmen warna yang disetrika dengan proses pemanasan. Bahan pelapis dan kertas foto sudah terbundel dan pemasangannya amat mudah, mirip dengan model printer foto berteknologi serupa. Sebagai frame foto digital, FunFab P80 juga menyediakan kartu pembaca berjenis SD/MMC, xD, MS serta

port USB Host dan port PictBridge untuk terkoneksi dengan gadget dan kamera digital. Selain membaca materi foto dari luar, FunFab P80 juga memiliki memori internal sebesar 128MB untuk menyimpan foto pribadi atau foto kenangan Anda. Selain kontrol navigasi disamping kiri layarnya, sebuah remote control juga disertakan sebagai pengendali jarak jauh. Dalam mencetak, peranti serbaguna ini menawarkan cetakan sebuah foto 4R (postcard) dalam waktu kurang dari 1 menit. Sistem pelapisan warnanya yang menghasilkan cetakan 300dpi terlihat sangat mulus dan berkat proses pelapisan khusus membuatnya setara dengan hasil cetak inkjet 4800dpi. Rata-rata foto yang dicetak tetap tampil tajam, sayangnya jumlah cetakan agak terbatas. Sebagai supplainya, Abit menawarkan dua macam pilihan cartridge yakni dengan isi 72 (C72) seharga US$ 28 dan isi 36 (C36) seharga US$ 16. Untuk menumbuhkan kreativitas pemakainya, Abit menambahkan beberapa aplikasi pengolah foto diantaranya adalah Print Creations yang berguna untuk mengkreasi foto kedalam template yang disediakan. Aplikasi lain datang dari Arcsoft Media Impression, Image Printing, dan Precious Photo yang semunya untuk membantu Anda memberikan hasil cetak foto yang lebih optimal. Produk kombinasi pendisplai dan pencetak FunFab P80 memang cukup unik, yang jelas memudahkan kita memajang foto sekaligus mencetaknya dengan instan. Sayangnya harga FunFab P80 juga terkatrol naik gara-gara fungsi tambahan itu.(biz)

Ingin Menjadi Pengusaha Perbengkelan, Yayasan BINTASIK Solusinya Pontianak. Yayasan BINTASIK merupakan lembaga pendidikan alternatif, modern, masa kini, dan tepat guna. Yayasan ini dirintis sejak tahun 1982 di Surabaya dan dikembangkan di Pontianak sejak tahun 1990 hingga mendapatkan legalitas badan hukum pendirian notaris di Pontianak No.1 Tanggal 1 April 1997 dan terdaftar di instansi terkait. Kurikulum Yayasan BINTASIK disusun berdasarkan pengalaman kerja puluhan tahun oleh para pendiri lembaga yang dipadukan dengan kurikulum dari Depnaker dan Diknas, serta kebutuhan para pengguna jasa mekanik otomotif. Kurikulum ini terbukti

menjadi kurikulum yang mampu meluluskan mekanik yang tepat guna, siap pakai, dan mandiri. Jurusan yang ditawarkan oleh Yayasan antara lain : Mekanik Mobil Bensin dan Solar, Mekanik Motor 2 dan 4 Tak, Pengelasan Body dan Las Ketok, Pengecatan Cat Duco dan Oven, Jahit Jok dan Interior, Ketangkasan Mengemudi + SIM A. Persyaratan untuk menjadi siswa sangatlah mudah, walaupun tidak tamat SD tetap bisa diterima. Lama pendidikannya adalah 2 bulan hingga 6 bulan tergantung dari jurusan yang dipilih, siswa dijamin lulus dan akan mendapatkan sertiďŹ kat, dan disalurkan kerja di bengkel atau perusahaan

bekerja sama dengan Depnaker. Biaya pendidikan di Yayasan BINTASIK juga sangat terjangkau bagi masyarakat. Bagi siswa dari luar kota, untuk mendapatkan subsidi asrama dan makan gratis meminta surat keterangan kurang mampu dari RT atau Kelurahan. Sebanyak 1451 siswa yang telah lulus dari Yayasan BINTASIK, dan 95% buka usaha sendiri. Materi pembelajarannya disampaikan dengan 15% teori dan 85% praktek. Metode ini terbukti mampu membuat siswa lebih mudah mengerti karena siswa dihadapkan langsung pada komponen yang sebenarnya. Pihak Yayasan

memberikan garansi sampai bisa, dengan kualiďŹ kasi siswa mampu bongkar pasang mesin hingga bisa normal hidup kembali. Bagi siswa yang mengambil jurusan mekanik mobil, dijamin dapat mengerjakan mobil mogok di jalan. Peluang kerja bagi lulusan Yayasan BINTASIK sangat beragam, mulai dari menjadi montir mobil/motor, buka usaha bengkel sendiri, bekerja di dealer , showroom, ekspedisi, jadi sopir pribadi, dll. Pendaftaran siswa dibuka setiap hari. Jadi tunggu apa lagi, segera daftarkan diri anda di Yayasan BINTASIK dengan alamat baru Jl. Prof. M. Yamin No. 5 Depan Masjid

Membentuk Payudara Indah Tanpa Operasi dan Rasa Sakit

Pontianak. Tak mesti melalui sayatan pisau operasi. Payudara kurang indah karena usia dan menyusui dapat kembali kencang dan kenyal dengan aneka perawatan berikut ini. Perawatan Digital SPM (Suction Pump Massage) Bust Digital ini adalah teknologi dari Jerman yang bisa mengencangkan dan membentuk payudara. Ketika payudara menjadi kencang dan terbentuk kembali, maka akan tampak lebih besar dan indah. Langkah perawatan menggunakan SPM Bust Digital ini, payudara dibersihkan terlebih dahulu, setelah itu digunakan fase limfatik dengan menggunakan pistol untuk membuka kelenjar limfe dan melancarkan peredaran darah. Apa hubungan kelenjar limfe dengan payudara? Payudara terdiri dari kelenjar payudara, peredaran darah, saluran limfatik juga terdapat di daerah ketiak dan sekitar leher. Jadi, pistol ini membantu agar proses terapi ini lebih lancar. Setelah itu, payudara dipijat manual dengan cream massage payudara. Setelah itu, digunakan bust cup yang bermanfaat untuk menyedot dan memompa payudara. Payudara menerima tekanan positif dan negatif yang baik untuk merangsang kelenjar payudara. Tahap berikutnya payudara diberi masker.

Radio Frequency/Thermwave Langkah penggunaan RF, pertama pertama bagian yang akan di terapi dibersihkan, setelah kering dioleskan krim kemudian digosok dengan alat RF. Untuk hasil maksimal, lakukan 5 hingga 10 kali perawatan dengan jeda satu minggu sekali. Hasil payudara indah dan kencang akan bertahan hingga sekitar satu tahun. Untuk perawatan lanjutan bisa diulang tiap 2-3 bulan sekali. Akupunktur Berguna untuk mengencangkan otot-otot dada (pectorales) yang ada di belakang payudara. Melalui terapi ini, payudara menjadi lebih kencang. Langkah perawatan dengan akupunktur adalah setelah payudara dibersihkan, dilakukan tusuk jarum pada titik-ti-

tik yang dituju. Ada 8-10 titik akupunktur yang dikerjakan di masing-masing payudara. Terapi ini membutuhkan waktu sekitar 15 menit pada tiap payudara. Jika diperlukan, dapat juga dipasang alat elektronik untuk merangsang titik akupunktur di payudara. Sebaiknya lakukan perawatan ini setiap minggu hingga 10 kali perawatan. Setelah itu, untuk menjaga hasil, cukup diulang sebulan sekali. Aquapunktur Mirip dengan akupunktur payudara, perbedaannya adalah aquapunktur menggunakan obat homeopathy atau anti aging yang berguna untuk membantu mengencangkan, menyamarkan ek dan kelainan pigmentasi, serta garis-garis halus pada payudara.

PELUMAS APA YG COCOK BUAT KENDARAAN KITA? Semua jenis oli pada dasarnya sama. Yakni sebagai bahan pelumas agar mesin berjalan mulus dan bebas gangguan. Sekaligus berfungsi sebagai pendingin dan penyekat. Oli mengandung lapisan-lapisan halus, berfungsi mencegah terjadinya benturan antar logam dengan logam komponen mesin seminimal mungkin, mencegah goresan atau keausan. 5100 ESTER 10W-40 menjaga kestabilan dan menjamin pengurangan friksi, bahkan pada suhu ekstrim atau beban berat. 5100 ESTER 10W-40 menjamin kinerja kopling basah yang eďŹ sien maupun keawetan kotak perseneling. Produk 5100 ESTER Fitur Semi-sintetis, mengandung ester. Mengurangi bising dan aus. Standar SAE/DOT 10W40. MOTUL 5100 sesuai untuk mesin 4-tak dengan kotak perseneling terpadu dan bisa digunakan dalam semua kondisi jalan dalam kota dan lintas alam.

$WMVKMCPFWNWDCTWDQNGJPIQOQPI!

+PHQ*WDWPIK &#;#/1614/167. %2$JGP[#OWU#NGZCPFGT &CRCVMCPFKDGPIMGNDGPIMGNVGTFGMCV +UVCPC/QVQT)NQDCN,C[C/QVQT2WVTK,C[C/QVQT)CNGT[/QVQRCTVFNN

Al-Asyraf Simpang Ampera Kotabaru Pontianak Telp. (0561)767508,

081522562229, 085750606162,0 81345708984. (biz)

STKIP PGRI Pontianak Berkembang Memenuhi Kebutuhan Masa Depan

Sarana dan prasarana pendidikan yang terus berkembang harus diikuti dengan peningkatan program. Meningkatnya perhatian pemerintah terhadap pendidikan disikapi STKIP PGRI Pontianak dengan penambahan program studi. Tentu saja peningkatan program harus didukung oleh sarana dan prasarana yang memadai. Perangkat lunak yang sudah dimiliki antara lain Statuta, Rencana Strategis (RENSTRA), RIP, Pedoman Etika Akademik, Kurikulum, Pedoman Operasional STKIP PGRI Pontianak yang terdiri dari Pedoman Penerimaan Mahasiswa Baru, Pedoman Penilaian, Pedoman Penyusunan Skripsi, Pedoman PPL, Pedoman KPKKN, Kalender Akademik, dan Pedoman Pembinaan Kemahasiswaan. Prasarana Kampus Utama seluas 4 Ha terletak jl. Ampera Kota Baru Pontianak, dan kampus 1 berdiri di atas tanah seluas 2 Ha, yang berstatus hak milik STKIP PGRI Pontianak, Jalan Prof. M. Yamin/Jl. Ilham Pontianak, STKIP PGRI Pontianak memiliki berbagai sarana dan prasarana belajar yang sangat memadai. Dengan Fasilitas Gedung 4 lantai. Ruangan Perkuliahan sebanyak 86 ruangan di lengkapi dengan pendingin ruangan/OHP , Media Pembelajaran (LCD Projector), Sarana Olah Raga, Ruang Seminar dan Ruang Ujian Skripsi, Ruang Micro Teaching dengan ge-

dung & perpustakaan 3 lantai, Ruang Dosen, Aula (Auditorium), Laboratorium Komputer, Laboratorium BK, Laboratorium MTK, Laboratorium Sejarah, Laboratorium PPKn, Laboratorium Bahasa dengan multimedia, dan Ruang Administrasi/Manajemen termasuk Program Studi yang kesemuanya dilengkapi dengan alat pendingin ruangan (full AC). Tempat Ibadah (Masjid) juga tersedia dilengkapi Kantin, Toko ATK dan Foto Copy serta lapangan parkir yang luas. STKIP PGRI Pontianak menerima Mahasiswa Baru TH Akademik 2011/2012 Persyaratan : 1. Foto Copy Ijazah (SMA/SMU/Diploma/sederajat) sebanyak 1 (satu) Lembar yang telah di legalisir. 2. Pas foto ukuran 4 x 6 sebanyak 2 lembar 3. Menyerahkan Surat Keterangan Dokter, sebanyak 1 lembar 4. Membayar biaya pendaftaran sebesar : a. Untuk 1 (satu) pilihan Rp 150.000,b. Untuk 2 (dua) pilihan Rp 200.000,Waktu dan Tempat Pendaftaran : Pendaftaran di mulai 1 April sampai dengan 25 Agustus 2011 Pendaftaran dilakukan pada : pagi hari : pukul 08.00 - 12.00 sore hari : pukul 14.00 - 17.30 Tempat Pendaftaran Kampus STKIP PGRI Pontianak Jl. Prof Dr M. Yamin/ Jl Danau Sentarum Telp. (0561) 748219

  

       


Harian Equator 20 Juni 2011  

Harian Equator 20 Juni 2011

Advertisement
Read more
Read more
Similar to
Popular now
Just for you