Page 1

Le Gruy猫re AOC suisse. Le go没t du vrai.

Suisse. Naturellement.

Les Fromages de Suisse.

BRUXELLES CENTRE 1000, 74 rue Marché aux Herbes, 02 512 16 92 • BRUXELLES 1000, 10 rue d’Arenberg, 02 513 27 82 • BRUXELLES 1000, 184 avenue Louise, 02 640 50 88 • BRUXELLES 1050, 229 avenue Brugmann, 02 344 56 70 • BRUXELLES 1050, 245 Galerie Louise, 02 512 94 72 • BRUXELLES 1180, 1360A chaussée de Waterloo, 02 372 97 93 • ARLON 6700, 9 rue Netzer, 063 23 36 40 • HUY 4500, 5 quai Dautrebande, 085 41 12 95 • GENT 9000, 8 Korte Dagsteeg, 09 225 64 15 • LOUVAIN-LANEUVE 1348, Centre Commercial de l’Esplanade, 010 84 26 00 • NAMUR 5000, 76 rue de Fer, 081 22 46 51 • WATERLOO 1410, 352 chaussée de Bruxelles, 02 351 22 71 • WAVRE 1300, 22 place de l’Hôtel de Ville, 010 24 20 12 • LIÈGE 4000, 12 rue du Mouton Blanc, 04 222 22 47 • LIÈGE 4000, 10 rue du Méry, 04 223 46 94 • VERVIERS 4800, 23-25 rue Jardon, 087 30 02 20 • LASNE 1380, 6 route d’Ohain, 02 652 16 30 • HASSELT 3500, 18 Kapelstraat, 011 22 63 11 • OOSTENDE 8400, 2 Madridstraat, 059 70 35 95 • KNOKKE 8300, 8 Lichttorenplein, 050 60 49 87 • EUPEN 4700, 24-26 Klötzerbahn, 087 35 45 01.








Référence tapis : ZANZIBAR BROWN ZA12

Boutique Bruxelles | 35, Rue de Namur | 1000 BRUXELLES | +32 (0)2 512 23 68




Rue des Fripiers, 36 - 1000 Bruxelles

TOLLET JOAILLIERS + 32 2 218 11 93


Woluwe Shopping Center - 1200 Bruxelles +32 2 762 35 47


Chaussée de Bruxelles, 177 - 1410 Waterloo +32 2 354 24 65


Basilix Shopping Center - 1080 Bruxelles +32 2 468 05 08


Woluwe Shopping Center - 1200 Bruxelles +32 2 771 84 46


City 2 rue Neuve - 1000 Bruxelles +32 2 217 91 58

w w w. t o l l e t . c o m

Chée de Waterloo 1359j 1180 Uccle (Fort-Jaco) 02 375 44 00 Shopping de Woluwe 1200 Bruxelles 02 771 60 65 Place Cardinal Mercier 3 1300 Wavre 010 880 300 Rue de Dampremy, 12 6000 Charleroi 071 320 600 Complexe commercial du Bultia Rue d’Acoz, 5A 6120 Nalinnes (Gerpinnes) 071 22 87 12

w w w. s v h o p t i c i e n s . be


édito Novembre tout SCHUSS ! Notre savoir-faire se dĂŠguste avec sagesse.

le monde merveilleux des comédies musicales Depuis quelques années, les comédies musicales font recette. Certaines ont permis à de nouveaux talents d’exploser. Garou, Hélène Ségara et, plus récemment, Christophe Maé, pour ne citer qu’eux, ont su tirer leur épingle du jeu. Et les autres…

melissa mars

Il y a naturellement Starmania ! Depuis 1979, les tournées se succèdent et les titres phares n’ont pas pris une ride. Au contraire, Le monde est stone, Les uns contre les autres et Le Blues du businessman sont des textes qui auraient pu être écrits aujourd’hui. Quelques années plus tard, après l’incroyable succès de Notre-Dame de Paris, les producteurs ont bien compris que le genre méritait d’être exploité. On a assisté à un véritable raz de marée : Les 1001 vies d’Ali Baba, Les Dix Commandements, Roméo et Juliette, Autant en emporte le vent, La Belle et la Bête, Cindy Cinderella, etc. Le programme est toujours le même : sortie des CD, promo des singles et de l’album via certaines émissions télé et via la radio, vente des places grâce au matraquage médiatique et tournée. Ne croyez pas que nous soyons des grincheux… Au contraire, nous avons passé d’excellents moments et quelques-uns de ces spectacles valaient et valent encore la peine d’être vus. Pour les artistes, l’arme est hélas à double tranchant. Ça passe ou ça casse ! Je pense naturellement à Philippe D’Avilla, alias Mercutio dans Roméo et Juliette. Une voix magnifique, du talent à revendre et beaucoup de charisme ne suffisent pas toujours et après l’euphorie, le retour sur terre n’est pas toujours sympathique. Sophie Delmas, autre sublimissime voix, qui a joué le rôle de Belle Watling dans Autant en emporte le vent nous a aussi confié : ”Lorsque tu as incarné un personnage dans une comédie musicale, on te refuse bien souvent un rôle dans une nouvelle production. Les producteurs préfèrent les nouvelles têtes”. Et si on nous concoctait un gigantesque spectacle avec tous les artistes qui nous ont déjà fait vibrer. Voilà peut-être la solution !

En couverture:


Photos cover et interview:

QMagali Eylenbosch

La muse de Mozart survivrat-elle à son rôle ? Comme elle le dit avec une belle spontanéité, aujourd’hui : “C’est le kif total”. Mais demain ? On lui souhaite en tout cas le meilleur.

Quel a été votre parcours ? Je rêvais d’être actrice et j’ai fait mes premiers pas sur scène à 13 ans. La musique, ça s’est fait par hasard, en rencontrant un compositeur il y a déjà quelques années. J’ai déjà enregistré trois albums qui s’articulent autour de l’histoire d’un personnage en mal d’amour. Le premier, Et alors, reflète la blessure de l’adolescence, le second, La reine des abeilles, traite le moment de la rébellion. Le dernier s’intitule À la recherche de l’amour perdu. Lorsque j’ai terminé cette trilogie, j’ai fait quelques concerts mais, je comptais mettre la musique entre parenthèses pour revenir à ma première passion, la comédie. C’est là qu’on m’a proposé un rôle dans Mozart l’Opéra Rock. Vous avez débuté une carrière solo. Qu’est-ce qui vous a poussé à vous lancer dans une comédie musicale ?

Mick Bulle © Le Cube M


sur une autre planète


mythiques du design

N’avez vous pas peur que votre image dans la comédie musicale parasite votre image de chanteuse ? Non, pas du tout. J’ai vraiment eu de la chance, mon univers colle à celui de cette comédie musicale. C’est à la fois ”dark”, pétillant, coloré… On m’a souvent dit que j’étais une comédie à moi toute seule. Finalement, c’est quand même mieux de la jouer avec d’autres personnages. (Rires) Et puis c’est un beau projet… En plus, j’en suis arrivée à vouloir être dans la comédie musicale et être dans un groupe. Chanter en groupe et en solo, c’est différent. Est-ce que cela vous oblige à laisser votre ego au vestiaire ? Non, pas du tout. Il n’y a qu’une seule chanson de groupe, les autres sont des solos ou des duos. Sur ce projet, on a eu le privilège de chanter des chansons choisies après le casting. Elles ont donc été faites ”sur mesure”. Elles sont vraiment faites pour moi. Le rôle d’Aloysia me correspond bien. La limite entre elle et moi est très floue. C’est un luxe et un très beau cadeau. La mode des chanteurs ”kleenex” rend-telle l’accessibilité au métier plus difficile ? Il ne faut pas se leurrer, il est de plus en plus difficile de percer dans ce milieu. Outre le talent, il faut avoir la foi, de la volonté et de la persévérance. Une fausse illusion d’éphémère est donnée par les médias.

Verner Panton

au à Gamtofte, fréNé en 1926 Panton à , Verner Danemark l’école techniqued’arquentera fera des études des Odense puis e Royale à l’Académi ue. De chitecture s, à Copenhag dans Beaux-art il sera employé 1950 à 1952,d’architecture d’Arne son propre le cabinet puis fondera de design Jacobsen, ture et studio d’architec pour les couleurs Son goût ues se en 1955. formes géométriq texles et créateur vives œuvre de visant à dans son manifeste ents intérieurs invisible, parfaite et tile, ses aménagem Il une unité et le mobilier. Il fondre dans plafond Vitra. murs, le Panton avec dévele sol, les ra la chaise produit développe du premier compte. s’agira d’ailleurs à son propre la maison loppé par

Charles &

Ray Eames

les plus connus l’un des nomsmonde du design le Eames est puisqu’il prisés dans et les plus un cas plutôt rare, 1938, et couple. En s’agit d’un l’invitation d’Eliel à vient répondant Charles Eames l’AcaSaarinen, re à , étudier l’architectu Arts de Cranbrook démie des Il y deviendra dans le Michigan. r de design t professeu rapidemen y rencontrera Ray et qui industriel en peinture, Kaiser, étudianteses travaux avant dans en 1941. l’assistera son épouse de devenir se distinguera de étonnant Ce duo le domaine ment dans faire particulière sièges et aura su de la production la création design vers évoluer le de masse.
















L’objectif visé de Charles Eames pour la conception de ce siège était d’allier un confort absolu à une qualité du plus haut niveau, tant dans les matériaux que dans la fabrication. Le résultat fut une interprétation moderne du fauteuil club traditionnel qui séduit par une structure pensée jusque dans les moindres détails. Satisfaisant entièrement le désir de son créateur, il rappelle un immense gant de base-ball usé et poli par l’usage, dans lequel on aimerait se pelotonner.

Infos : ou


excentriques pour balades tape-à-l’oeil



au sad’un prototype sous la forme 2008, le D8 PekingPrésenté À en mars indifférent. lon de Genève laissé personne et un coupé to-Paris n’avait un SUV de luxe entre devrait complexer mi-chemin 4x4 hollandais autres BMW X6, et sportif, le Cayenne le spécias’est fait les Porsche la sait, Spyker l’élégance et de car on le le petit nement, de liste du raffi a quelques semaines, Il y la production sportivité. confirmait ur batave précieux du constructe les matériaux antagoses portes V8 de du D8, reprenant d’un ar ainsi que concept-c le capot, on parle GM... Sous chez nistes. it de proviendra 564 ch qui

Si la frugalité, la sagesse et la discrétion ne font pas partie de votre vocabulaire, alors optez pour un de ces tousterrains. Exubérance garantie !

MERCEDES-BENZ ML 63 AMG 4MATIC La recette qui a été privilégiée pour le ML AMG est un gros moteur atmosphérique, qui est donc dénué de toute suralimentation. Le V8 de 6,3 litres développé par AMG génère 510 ch pour un couple titanesque de 630 Nm ! Les reprises sont donc du meilleur tonneau, même à bas régimes tandis qu’il fait preuve d’une élasticité extraordinaire dans toutes les circonstances. Le tempérament sportif du modèle se manifeste par des accélérations vives tandis que sa maniabilité est tout bonnement bluffante pour un SUV de 2,3 tonnes. Les performances n’ont quant à elles rien à envier à celles d’une sportive puisqu’il ne faut au ML que 5 petites secondes pour atteindre les 100 km/h, le tout au son d’un râle caverneux qui vous invite à pousser la pédale d’accélérateur encore plus profondément. Un jeu qui se révèle très coûteux quand il s’agit de passer à la pompe... www.spyk

QPierre-Benoît Sepulchre


PORSCHE CAYENNE TURBO S Avec son V8 4,5 biturbo de 550 ch qui développe un couple titanesque de 750 Nm, le Cayenne Turbo S fait partie du club très confidentiel des SUV de plus de 500 ch. Les performances sont bien entendu à l’avenant et combleront tous les Fangio en quête de sensations. Il faut dire que cette Porsche est en mesure de croiser à plus de 280 km/h tandis qu’elle écrase le 0 à 100 km/h en 4,8 secondes. Des performances extraordinaires pour un gros 4x4, qui lui permettent d’aller chasser n’importe quelle sportive sur autoroute. Très branchée ”techno”, Porsche propose une direction assistée qui s’adapte à la vitesse, une suspension active (PASM) ou encore un contrôle dynamique du châssis (PDCC). Et pour freiner les ardeurs de la bête, vous pourrez opter pour des freins en céramique avec des disques de 410 mm à l’avant et de 370 mm à l’arrière. Notez qu’avec ses jantes de 21 pouces et ses quatre sorties d’échappement, il est impossible de passer inaperçu !

Félins, les caches-oreilles en vison imprimé léopard, Louis Vuitton i 02 289 28 28

Ultra chic ! Chapka en cerf et renard, HERMÈS i, 02 511 20 62

Pour un look reine des neiges, les manchettes en agneau glacé et ragondin, HERMÈS i, 02 511 20 62

Une silhouette signée Armani Motif flocon de neige pour la collection exclusive " vision " de FENDI i

Grand NORD

Promenez-vous bien au chaud en look Inuit-chic avec ces mocassins fourrés ASH

L’accessoire essentiel de la surfeuse trendy, le masque ROXY i

i 02 479 70 54,

Fruit d’une collaboration avec le talentueux créateur japonais Yoshinori Ono, la veste NAPAPIJRI 66°33

Ultime Black, un ski technologique et luxueux pour skieurs sportifs et amateurs d’objets rares ! LACROIX, i -02 215 57 19,

Pour l’après-ski, lunettes de soleil TOM FORD




Débridée !



C'est une fine bride d'or blanc qui s'enroule autour du bras en entrelacs agiles où alternent reflets de métal et brillance précieuse. Le bracelet est comme un harnais miniature, hommage au savoir-faire équestre de la maison Hermès. Les articulations astucieusement dissimulées dans le motif rendent le fermoir indécelable. Débridée, c’est une ligne élégante, composée de bagues et bracelets en argent ou or rose, blanc ou jaune, avec ou sans diamants. ou 02.511.20.62

Frey des bijoux t la création ante dans e le démontren prépondér re autrichienn à chaque une place la manufactu artistes, imaginent L’art tient stylistes de de véritables et inspirés. Wille. Les colorée et comme uniques manchette à merveille de des motifs saison : la de l’œuvre able de la nouvelle collection qui s’inspire tendance ! ire incontourn L’accesso émail issue de la gammetouche plus que une et sser pour en or pur Hundertwa 35 20 l’architecte ou 02 502 www.frey-

Regie Media Tel : +32 (0)2 209 63 70 Account Executive ELODIE ANDRIVEAU Mobile : +32 (0)475. 29 57 96


`kigkÊWkXekj Z[ied]b[i


ANNE BUNTINX Mobile : +32 (0)496. 50 89 44 anne.buntinx RP COLINE HOMMELEN Tel : +32 (0)2 209 63 76 Subscriptions: 223 rue Royale, 1210 Brussels Tel : +32 (0)2 209 63 70 Bank: 363-0100711-65

FAITES VOS GRIFFES LANCÔME annonce la couleur de ses tons hiver

avec un vernis ultra-brillant et résistant, d’une profondeur de prune magnétique qui s’affiche fièrement ! Dépêchez-vous, il est en édition limitée ! 206 Prune des Nuits, Lancôme, 23€

ROMANTIQUE Chez GIVENCHY, Poétique Lily célèbre la douceur, la tendresse grâce à sa robe rose teintée de beige, le tout paré d’un blanc nacré pour vous faire briller !

9Zh\g^[[ZhVX‚g‚Zh djYZhYd^\ihYZ[‚Z! cVijgZjc_djgZicj^ih eV^aaZi‚Zh½¿X]VXjcZ hVkZgh^dcYZaV [‚b^c^i‚

¿aÉdXXVh^dcYZaÉVgg^k‚ZigƒhegdX]V^cZ YZhegdYj^ihHVaan=VchZcZc7Za\^fjZ! aVbVgfjZcjb‚gdjcYZhbVcjXjgZh g‚jhh^ZhVjmJH6!cdjhVkdchgZXjZ^aa^ fjZafjZhXdchZ^ahedjgYZhdc\aZhcZihZi WZVjm!XZfj^cÉZhieVhjcZb^cXZV[[V^gZ

Vernis Please ! Poétique Lily, Givenchy, 16,24€

À DEUX C’EST MIEUX La collection DIOR Vernis s’enrichit de deux nouvelles teintes, Rosé Boréal et Silver Purple. Brillants et intensément colorés, les deux vernis sont en édition limitée ! Il ne tient qu’à vous de choisir entre un rose tendre et un violet métallique ! 162 Rosé Boréal, 782 Silver Purple, Dior Vernis 22,84€

Un conseil pour poser le vernis

Step 1

On commence par passer ses mains sous l’eau. Ensuite, on applique le crayon de soin hydratant qui protège et renforce les cuticules et les ongles. Ultrapratique, le crayon peut se poser sur toute la surface de l’ongle.

Step 2

Choisissez une lime à ongles efficace et de bonne qualité pour avoir un maximum d’effet ! Chez Sally Hansen, la lime à double face fait un tabac : la première face lisse, lime et modèle les ongles, tandis que la deuxième les polit et leur donne un effet brillant impeccable !

Step 3

Celles qui préfèrent un effet plus " nature " opteront pour le soin blanchissant, deux couches suffisent pour faire ressortir les couleurs naturelles de l’ongle ! En plus, il sèche très vite : en 10 minute c’est fait !

Un vernis dans les tons bleu-gris, achève à la perfection le look moderne nude chez ARMANI ! Vernis 42, Giorgio Armani, 22€

C’EST LA FÊTE ! Chez MAC, le temps est à la fête ! Des couleurs brillantes, argentées, lumineuses et complètement décalées, voilà qui va détonner ! Deux nouveaux tons annoncent un style à la limite de l’excentrique ! Silver foil et Blue Pink, MAC, 11,75€

Celles qui aiment la couleur et le changement doivent avant tout penser à mettre un base coat ! Cette première couche protège et rend l’ongle plus lisse. Il efface également les ongles striés… Ensuite on pose la couleur de notre choix !


La touche finale : le top coat est LA protection qui rend vos ongles brillants et nets ! C’est grâce à lui que la couleur ne change pas et que nos ongles peuvent rester impeccables pendant au moins dix jours ! En plus, il sèche en un éclair !



Les dry drops se posent à une ou deux gouttes sur chaque ongle pour adoucir après la manucure ! Une sensation de fraicheur à l’huile d’amande douce…


Il est important de toujours essuyer son pinceau sur le bord du flacon ! Pour poser le vernis sur l’ongle, il faut d’abord commencer au milieu de l’ongle et puis uniformiser sur les côtés. Pour un effet optimal, il est toujours conseillé de mettre deux couches de vernis.

PROFESSIONAILS, la marque belge spécialiste des soins pour les ongles lance deux nouveaux gels UV pratiques et efficaces ! À tester dans votre salon de beauté ! Gellak, One to Go, Professionails



Le domaine skiable le plus grand du monde

Une station aux mille facettes

Que vous soyez “ pro ” en ski, fou de surf ou tout simplement dingue de randonnée, le domaine des trois vallées satisfait toutes les envies ! Les chiffres parlent d’eux-mêmes : 336 pistes pour plus de 600 km de pistes reliées dont, pour la seule Vallée de Courchevel, 93 pistes pour 150 km sur 533 ha desservis par 61 remontées mécaniques, sans compter les 10 000 hectares de domaine hors-piste sur plus de 2000 m de dénivelé ! En comparaison, le domaine skiable des 3 Vallées et ses 400 km2 équivaut aux 6 plus grands domaines skiables américains réunis ! Même l’attente des remontées mécaniques reste raisonnable grâce à un réseau large et ultra- organisé !

Pendant que les fanatiques de glisse attaquent les couloirs, les snowparks, les champs de bosses, ceux qui privilégient une expérience plus tranquille se feront un plaisir de découvrir chaque jour un nouveau versant ! Si le domaine skiable impressionne, la variété d’activités “ hors-piste ” séduit chaque année un public plus aventurier. Il s’agit de saisir l’occasion et de profiter de ce paysage unique pour faire son baptême de l’air en avion ou en hélicoptère, de tester le scooter ou le quad des neiges,… Toutes les folies sont permises ! Pour les amoureux de la nature et des randonnées alpines, Courchevel offre une multitude de sentiers piétons à découvrir avec un guide ou tout seul, en raquettes ou téléportés ! À vous de choisir de quelle altitude partir, pendant combien de temps et à quel niveau de facilité ! Notre coup de cœur va

QMarie Delloye

Entrepreneur, auteur et conférencier, Guibert del Marmol est un ancien dirigeant d’entreprises qui se consacre depuis des années à la recherche sur la question du sens et de la conscience. Il est l’auteur de l’ouvrage ”Tomber plus haut” qui fait part des résultats de sa recherche. Il accompagne aujourd’hui les sociétés dans le développement d’une gestion des affaires durable et responsable. Quelle est la base de votre réflexion?

”Nous allons vers une société meilleure mais la transition est difficile.”

> 4 ZEN (zone d’évolution des novices : deux à 1850, une à 1650, une au Praz) > Prévention d’avalanches : 71 Gazex, 5 Catex, 101 points de tir par grenadage > Ski de fond : 61 km, 9 boucles

us donner pouvez-vo Quels conseils d’entreprises? inspiaux dirigeants doivent être les leaders si facile! Pour moi, Ce n’est pas se rés ET inspirants. il faut deux choses: le Pour être inspiré, et bien connaître connaître soi-même on vit. Pour devenir lequel besoin de monde dans leader a d’abord sera inspirant, un courage, parce qu’il déde ent, il doit beaucoup Deuxièmem toujours seul. habilité naturelle à créer humaines avec velopper une positives et leader des relations dire que le il Cela veut 3. Le troisième niveau réunit les sociétés qui nt les gens, les autres. profondéme aime possède font du ”branding”... C’est là que le ”green il inspirant et, surtout, washing” fait ses preuves... célèbre la diversité d’humilité... notion vraiment la la spirituapresque à touchez ”Ma pensée est très simple: Vous je lité... de religions, l’harmonie de l’ensemble ! Sans parler ne peut plus Exactement notre société est la somme des de sens, pense que sans recherchequestions, la fonctionner harmonies individuelles” se pose de la sans que l’on un tournant qui ouvre à avec crise appelle en accord La majorité des entreprises se situent autour de ont société plus une à voie entreprises ces trois niveaux. Elles fonctionnent encore au Plusieurs chez elle-même. employés; ”risk management”, elles restent réactives sans choix à leurs ils ont ouverts donné ce être proactives... Fransisco, est Google à San méditation! Elle n’en de Aux niveaux 4 et 5, les entreprises ne font plus des salles du développement durable, elles le vivent! que plus rentable... managemen 4. Le quatrième niveau illustre une vraie prise www.cardel

1. Les entreprises appliquent les régulations les plus basiques pour le bien-être général. De temps en temps elles envoient un chèque à Greenpeace pour calmer leur conscience...

”Notre société ne peut plus fonctionner sans recherche de sens.” Tout en un !

Livres à cuisiner

Matos et ustensiles, livres et épices, conseils et cours de cuisine, c’est aux Secrets du Chef que ça se passe !

Malins, les éditeurs culinaires nous sortent des coffrets thématiques à l’occasion des fêtes : un livre + l’accessoire culinaire assorti. Chez LAROUSSE, on apprécie Foie gras, Terrines & compagnie, une petite terrine en porcelaine blanche contenant 4 mini titres autour du foie gras. Là, 3 sortes de piques à brochettes en bambou, bien utiles pour les idées créatives de l’apéro, ou encore la poche à douille et la technique illustrée pour réaliser des macarons. Chez MICHEL LAFON, c’est pour le coffret de Gérard Vié que l’on craque et évidemment pour son moule en silicone, parfait pour se lancer dans la confection par exemple d’une terrine de crème de gruyère au gingembre. Chez MARABOUT, le grand succès, ce sont Mes petites verrines (4 dans la boîte) et Mini cakes (8 petits moules en silicone coloré). Enfin, chez HACHETTE PRATIQUE, le top, c’est les 2 paniers avec couvercle pour une cuisine à toute vapeur et les 4 petits coquetiers en porcelaine nacrée qui accompagnent Oeufs et coquetteries.

L Woluwé-Shopping Center. Rue Saint-Lambert 200, 1200 Woluwé-Saint-Lambert, 02 762 03 05. Rue Charlemagne 22, 1348 Louvain-La-Neuve, 010 45 85 05.

Q Sandrine Mossiat


Nobles produits issues de la mythique enseigne Kaspia, mais aussi de La Maison de la Truffe à Paris. Mousse au confit de Saint-Jacques, rillettes de saumon, tarama aux œufs de crabe, corail d‘oursin, œufs de poisson, caviars, saumons fumés, foie gras, jambons ibériques…

Après Jean Paul Gautier, c’est au tour de Paul Smith de faire le Bob cet hiver : le styliste anglais enguirlande le flacon d’EVIAN de ses fameux rubans de couleur.

Au parfum ! Ni eau de toilette, ni mousse à raser, ces deux vaporisateurs distillent l’un la fameuse huile d’olive provençale du Château d’Estoublon et l’autre de l’huile d’olive aromatisée à la truffe noire.

Ne pas rester de glace

Fines pralines Elles s’appellent ‘Trianon noir’, ‘Cœur framboise’ ou ‘Feuilles d’automne’… du chocolat de qualité, pas trop gras, pas trop sucré, du véritable artisanat, des pralines tellement fines, qu’un kilo, c’est un minimum !

L Sorbets Philippe Faur, 8,98 € les 333 ml, chez Rob, T : 02 771 20 60.

L Pralines Wittamer, 66 €,



Des souvenirs sous ma frange EMI

Intégrale 40 ans Loisel Vents d’Ouest

Quand on l’écoute on a parfois l’impression de s’entendre penser, mais en mieux. On connaît déjà ”Ciao Bella” et ”La liste”. Cette fois, Rose se met en musique dans un nouvel album, ”Souvenirs sous ma frange”. Un disque qui s’écoute et qu’on ne saurait interrompre dès qu’on a entendu le premier accord.

Cette intégrale rassemble les 6 tomes de Peter Pan, plus une partie qui nous dévoile l’envers du décor. Une histoire puissante et poétique, servie par un dessin d’une grande expressivité et d’une affolante beauté. Une œuvre unique, incontournable !

MATT BIOUL Daystripper Akamusic


JOHNNY HALLYDAY TOUR 66 - Warner Plus populaire que jamais, Johnny a fêté ses 66 ans : l’occasion d’une ultime chevauchée avec son public. Reprenant le thème de la mythique ”Route 66”, il a entamé une longue tournée, avec en point d’orgue trois soirées spectaculaires au Stade de France. Vivez ou revivez-les !

Matt Bioul revient avec un album très ”Brit Pop” des années ’60 ’70, au son chaleureux du vinyle et au pur goût vintage ! Douze titres de pur bonheur, dont l’unique ambition est de taper du pied et d’en profiter !


VINCENT VAN GOGH. LES LETTRES Fonds Mercator Le peintre accompagnait souvent ses lettres de croquis et les truffait de références à des centaines d’artistes, parmi lesquels Rembrandt, Rubens, Millet, Corot, Signac, Gauguin, etc. Le Fonds Mercator les a réunies dans une superbe édition...



Mamans, voilà le livre qu’il vous faut ! L’auteur a préparé les meilleures panades, compotes, soupes, galettes pour sa petite Méline. Approuvées ensuite par un nutritionniste et rassemblées dans cet ouvrage, les bonnes idées fusent pour que les 0 à 3 ans reçoivent une alimentation variée et idéale pour leur santé ! Faites place au bon et au bio dans les assiettes et boîtes à tartines !


De Ramin Bahrani. Avec Alejandro Polanco, Isamar Gonzales et Rob Sowulski.


Aude Lafait Soliflor


Dan Brown Lattès

Six ans après le succès phénoménal de ”Da Vinci Code”, Robert Langdon est de retour dans ”Le symbole perdu”... Quelques indices : Washington, la franc-maçonnerie, des sociétés mystérieuses et de nombreux secrets à décoder. Dan Brown au meilleur de sa forme !




L Abbondio, 1,80 € les 25 cl, chez Mmmmh !, T : 02 534 23 40.

L 2,99 €, 4,95 € avec le sac assorti. Infos points de vente :

Maître glacier, Philippe Faur produit des glaces et sorbets artisanaux parfumés à la moutarde ou au roquefort, au basilic ou au safran, au vinaigre balsamique ou aux poivrons piquillos. De quoi sérieusement dépayser vos trous normands !



Alejandro, un orphelin dur et ambitieux, vit et travaille dans un garage au cœur d’une immense décharge du Queens. Dans ce monde d’adultes chaotique, le jeune garçon se bat afin d’obtenir pour lui et sa sœur de seize ans, Isamar, une vie meilleure.


Coffret Hachette Pratique : Vapeur So chic, 15 €. Oeufs et coquetteries, 15 €

Une pin-up sur un soda ? C’est pas parce qu’on joue les Bob qu’on doit boire ennuyeux ! Celuici est aromatisé au pamplemousse et aux fraises.

L Huile d’olive du Château d’Estoublon, 14,50 € les 100 ml, chez Rob, T : 02 771 20 60. Spray Maison de la Truffe, 22 € les 125 ml, chez Kwint, T : 02 505 95 95.

À un carrefour de son existence, peut-on, en fonction du chemin que l’on emprunte, devenir un salaud ou un héros ? N’avons-nous pas chacun une destinée inéluctable ? Fils d’un allemand et d’une française, Pierre doit faire un choix alors que ses parents se séparent : rester avec sa mère ou suivre son père... Au final, son destin sera tragiquement identique.


Coffret Michel Lafon : Les terrines, 27,95 €. Cook’in Box Marabout : Mes petites verrines, 15,90 €. Mini cakes, 15,90 €.

Pas si soft que ça Eau-te couture !

L’ALTERNATIVE - Tomes I et II De Chevais-Deighton et Agosto Glénat


L Coffrets Larousse : Tajines et autres saveurs d’Orient, 27,95 €. Foie gras, Terrines & compagnie, 23,45 €. Brochettes gourmandes pour l’apéritif, 22,35 €. Mini cakes a picorer, 22,35 €. L’atelier macarons, 12,25 €.

À la fois resto, bar et boutique, KWINT décline les délicatesses

L Grand-Marnier Irrésistible, 30 € Chivas 12 Magnum, 75 € - T : 02 663 62 62) Vodka Absolut, 13,95 € (en supermarché). Very Special Hennessy, 36 € T : 02 372 96 18



5. La fine fleur des entreprises: celles qui considèrent que leur première raison d’être est de contribuer à la société. La marque ”Patagonia” s’inscrit entièrement dans cette philosophie, et il y en a plus que l’on ne croit!

H]dee^c\X]^X!^Y‚ZhYZeg‚hZcihZiYZ XVYZVjm\djgbVcYh!WdccZhVYgZhhZh edjgYZhg‚kZ^aadchg‚jhh^h

Vie des feux Delaby Tome VII et Philippe Jean Dufaux de son Dargaud par la passion tragiRome, entrainée vers son destin nous court les auteurs empereur, ce tome, que. Dans dans les intrigues à nouveau et ressuscitent entraînent de Néron monde de la Rome monde disparu. Un un chair et de avec brio e, fait de vivant et authentiqu


Ces entreprises ont développé une vraie mission, une vision, et des valeurs qui inspirent les autres. Elles se sont posé la question: ”Qu’est ce qui manquerait à la société si on n’existait pas”...


Parce qu’on s’habille pour les fêtes, nombreux sont les flacons de spiritueux et autres alcools à revêtir une tenue d’apparat éditée en série limitée, de bons plans ‘cadeau’, pas toujours plus chers, mais nettement plus chic pour débarquer à une soirée.Si de son côté, la silhouette de GRAND MARNIER est rehaussée d’une peau de laque groseille, la vodka ABSOLUT se fait quant à elle plus rock en arborant une veste en cuir clouté. Et si le CHIVAS 12 MAGNUM opte pour une version haute couture, rhabillé d’argent et de volutes par Christian Lacroix, le cognac VERY SPECIAL HENNESSY a choisi Kesh et David Burrows, deux artistes britanniques pour se faire relooker.


de conscience et l’élaboration d’une véritable stratégie qui va passer les décisions économiques au filtre des impacts collatéraux sur l’environnement et le bien-être des individus. Colruyt, par exemple, a su adopter cette pensée tout en restant rentable!

Selon moi, ce développement plus durable au sein d’une société peut se décliner sur 5 niveaux:

QMarie Delloye & Marie d’Otreppe


> 3 zones dédiées au freestyle à Courchevel

2. Au deuxième niveau se situe l’éco-efficacité: une politique écologique est instaurée, surtout parce qu’elle peut contribuer à générer du profit...

Comment réagissez-vous? D’abord je me suis rendu compte qu’il y avait une grosse différence entre ce qui était dit et ce qui était réellement fait, cela s’appelle communément le ”green washing”: l’image environnementale d’une entreprise reste très souvent une image... De là, je me suis dit que j’allais ”murmurer” à l’oreille des patrons pour faire avancer la machine... Je milite pour une attitude plus positive, la construction sur le durable.



> 600 km de pistes, 336 pistes, 182 remontées mécaniques sur le domaine relié des 3 Vallées

Nous sommes aujourd’hui à la croisée des chemins. En l’absence d’une gouvernance mondiale ,seuls des agents économiques éclairés sont aptes à changer puisque ce sont eux qui gèrent la société. Nous devons changer de mentalité et installer une rentabilité plus positive. Ma pensée est très simple: l’harmonie de l’ensemble est la somme des harmonies individuelles. Selon moi, la raison d’être d’une entreprise n’est pas de créer du profit, c’est un outil. Malheureusement aujourd’hui, le profit est devenu une fin en soi...



> 17 000 m de dénivelés desservis > 61 remontées mécaniques sur le domaine skiable de Courchevel > 93 pistes pour 150 km sur 533 ha pour la Vallée de Courchevel (15 vertes, 34 bleues, 35 rouges, 9 noires)

Dans un monde où tous nos repères sont bousculés, les agents économiques se doivent d’ouvrir la voie vers une pensée ”écodurable” et plus humaine, tout en restant rentable. Guibert del Marmol y croit... et nous aussi!

”Soyons le changement que nous voulons voir dans le monde” Gandhi


> 444 employés saisonniers (dont 104 permanents)

Guibert del Marmol



> 70 160 passages skieurs par heure maximum

Situé à 1850 mètres d’altitude, le chalet de charme Les Airelles est un véritable cocon au beau milieu de la montagne ! Un endroit où il fait bon vivre, une décoration sobre mais raffinée, un confort sans cesse étudié...Sans oublier la cuisine exceptionnelle du grand chef Pierre Gagnaire ! Comme si cela ne suffisait pas, Les Airelles présentent cette année leur dernière petit bijou : Ormello, un chalet de 1000 m2 qui privilégie un confort plus intimiste avec ses 9 chambres, un Spa et une magnifique piscine. Tout nouveau et tout beau, il ouvre ses portes maintenant !

Vers une société plus


De plus en plus réputé pour le confort et l’authenticité de ses hôtels, Courchevel renouvelle cette année une offre déjà prestigieuse : À 1330 mètres, le village de Le Praz s’agrandit de deux chalets écologiques. Une manière de profiter de ses vacances tout en protégeant la nature… Plus haut à 1550 mètres, les chalets Kandahar, de 4 et 5 chambres chacun, offrent tout le confort moderne tout en gardant le charme traditionnel des vieux chalets de montagne ! Ceux qui veulent profiter pleinement de leurs vacances seront séduits par la vue imprenable sur la Dent du Villard, la salle de cinéma, le jacuzzi et le hammam !

Courchevel en chiffres

Q Marie Delloye

L Kwint - Mont des Arts, 1000 Bruxelles, T : 02 505 95 95 -

Membre de l’Union des Editeurs de la Presse Périodique

Courchevel et le charme des chalets Le Jardin Alpin - F- 73121 Courchevel Cedex - France T : 00 33 (0)4 79 00 38 38 -


Fj^cÉV_VbV^hZciZcYjeVgaZgYZ8djgX]ZkZa4AVWZVji‚ cVijgZaaZYjh^iZ!aZXdc[dgiYZhX]VaZih!aVeVcdea^Z YÉVXi^k^i‚hhedgi^kZhZihjgidji!aVkVg^‚i‚^begZhh^dccVciZ YZe^hiZh!dcieaVX‚8djgX]ZkZaeVgb^aZhhiVi^dchaZheajh egZhi^\^ZjhZhYj\adWZ½

GUEST Magazine is a monthly magazine produced by:

223 rue Royale, 1210 Brussels Tel: +32 (0)2 209 63 70 Fax: +32 (0)2 209 63 71

pour les neuf itinéraires de balades en raquettes : les paysages sont époustouflants ! Il est également possible de prendre les remontées mécaniques à pied pour profiter du panorama et s’arrêter dans un des délicieux restaurants d’altitude…

Valery Hadji Gul, Akram. Avec De Barmak Schatz. un chauffeur n. Khaled, bébé véhicule un Kaboul, Afghanista la dans son de taxi, découvre une femme. Comment er de cet é par abandonn se débarrass petit, lui le Comment retrouver ? colis ? Et s’il gardait insolite nt Une histoire encombra des filles ? qui n’a que . et touchante

LA JOURNÉE DE LA JUPE De Jean-Paul Lilienfeld. Avec Isabelle Adjani, Denis Podalydès, Yann Collette, Jackie Berroyer. Sonia est prof de français dans un collège ”difficile”. Un jour, elle découvre un revolver dans le sac d’un de ses élèves et s’en empare : un coup part et blesse l’élève. Son dérapage la propulse, malgré elle, dans une véritable prise d’otages. Adjani étourdissante dans un rôle tout à sa démesure.


Une silhouette signée Armani

Des skis de pro avec un noyau en pierre et un design rétro génial, chez ZAI, le must. i

Communication & Art Director NICOLAS VERSCHUEREN Tel : +32 (0)2 209 63 75 Mobile : +32 (0)477. 61 08 81

Une silhouette signée Armani



ERIC BOMPARD i 02 513 56 23



Un grand sac de voyage pour y glisser tout le nécessaire du parfait skieur, N.D.C.

Bien au chaud dans ma doudoune,

Les accessoires de la marque suisse ZAI combinent les meilleurs matériaux, pour une sécurité et un look irréprochables. Casque " Capalina "

82 > 87



Sales & Marketing Manager J&J CONCEPT sprl Tel : +32 (0)2 209 63 74 Mobile : +32 (0)475 32 69 68

AÉ]^kZgZhia|!^aZhi\gVcYiZbehYZeZchZgVjm hedgihYÉ]^kZgZi|idjiXZfjZVXdbedgiZ/aV aj\Z!aZhegdbZcVYZh!Zi‚k^YZbbZciaZh`^#8]Zo aZhXg‚ViZjgh!aV[djggjgZZhi|aVbdYZ!edjgaV_d^Z YZcdhnZjm


Une silhouette signée Armani


Director of publications MIKE VANDENVELDE Tel : +32 (0)2 209 63 73

70 > 81


Editor EMILE VERSCHUEREN Tel : +32 (0)2. 209 63 72

BMW X6 M Par les temps qui courent, le nouveau X6 M (tout comme son frère le X5 M) fait figure d’ultime représentant d’un genre automobile qui est appelé à disparaître. Voyant, encombrant, gourmand et surpuissant, c’est l’expression même du m’as-tu-vu, l’engin parfait pour tout conducteur en quête d’esbroufe. Ce SUV sculptural, dessiné par le belge Pierre Leclercq, se contente d’un ”modeste” V8 de 4,4 litres, gavé par deux turbocompresseurs qui font grimper la puissance du moteur à 555 ch ! Le tout est transmis aux quatre roues par une boîte automatique séquentielle à 6 rapports doublée d’une version optimisée de la transmission intégrale xDrive. Résultat : le 0 à 100 km/h est pulvérisé en 4,7 secondes, soit mieux qu’une M3 de précédente génération, tandis que la vitesse maximale est plafonnée à 250 km/h. Pas mal quand on pèse près de 2,5 tonnes!


Ce 4x4 yankee fait lui aussi appel à une grosse pointure sous son capot : un V8 de 6,1 litres qui crache ses 425 ch dans un délicieux vrombissement. Et avec ses 569 Nm de couple, il propulse la Jeep à 100 km/h en moins de 5 secondes et avec une aisance déconcertante. Ce modèle est équipé d’étriers Brembo Performance à quatre pistons qui garantissent un freinage efficace et endurant. Cette version SRT se distingue par sa double sortie d’échappement chromée, son bouclier avant spécifique, des bas de caisse latéraux, une croupe plus massive et des jantes en aluminium forgé de 20 pouces. A l’intérieur, le style compte autant que la puissance avec des inserts en aluminium qui soulignent le tableau de bord, le sélecteur de boîte de vitesses ainsi que la console centrale.

146 > 167 118 > 145 106 > 117 100 > 103 90 > 99 88 > 89


Lounge Chair & Ottoman CHARLES & RAY EAMES, 1956

26 >69

ButterÁy Stool

QMagali Eylenbosch

Le designer danois, Verner Panton, étudia pendant de nombreuses années l’idée de réaliser un siège monobloc en matière plastique. Les premiers prototypes furent réalisés en collaboration avec Vitra dans les années 60, mais la Panton Chair ne fut fabriquée en série qu’à partir de 1967. Contrairement à la Panton Chair Standard, au prix plus avantageux, la Panton Chair Classic est fabriquée entièrement en mousse synthétique rigide et la surface est laquée.


étudiera Sori Yanagi l’asà Tokyo, Né en 1915, Beaux-arts et deviendra de Perriand, des à l’école Charlotte la designer, plus tard, il fondera sistant de Dix ans qui aura 1940 à 1942. Design Institute d’objets Industrial le Yanagi une multitudeSes créade créer pour but et de meubles. mieux d’usage courant organiques marient à la formes tions aux design occidental plus autres le Parmi les que nulles du Japon. de tradition artisanale designers du éminents plus erre, en l’après-gu Yanagi ima- SORI YANAGI, 1954 mobilier, Sori des luminaiLe Butterfly Stool allie de manière uniginera aussi en verre, res, des objetsdes jouets, que des formes orientales à la techdes couverts, des nique de moulage du contreplaqué mais également des élaborée par Charles & Ray Eames. métro, Il La silhouette légèrement incurvée stations de motos. des voitures et du des deux coques d’assise évoque directeur les ailes d’un papillon. La création de deviendra populaire Musée d’art Tokyo en Sori Yanagi est proposée en deux forde mats. japonais 1977.


Sori Yanagi

Ils ont marqué leur époque et sont encore sur le devant de la scène.

Panton Chair Classic VERNER PANTON, 1959/60

J’ai eu un véritable coup de cœur ! Invitée à une soirée, on m’a présenté les maquettes d’un nouveau projet ”Mozart, l’Opéra Rock”. Dès les premières notes, j’ai été séduite par l’aspect convi-

vial, le côté Tim Burton, Famille Adams et par la mise en scène.

le monde merveilleux des comédies musicales Depuis quelques années, les comédies musicales font recette. Certaines ont permis à de nouveaux talents d’exploser. Garou, Hélène Ségara et, plus récemment, Christophe Maé, pour ne citer qu’eux, ont su tirer leur épingle du jeu. Et les autres…

Mick Bulle © Le Cube M

Il y a naturellement Starmania ! Depuis 1979, les tournées se succèdent et les titres phares n’ont pas pris une ride. Au contraire, Le monde est stone, Les uns contre les autres et Le Blues du businessman sont des textes qui auraient pu être écrits aujourd’hui. Quelques années plus tard, après l’incroyable succès de Notre-Dame de Paris, les producteurs ont bien compris que le genre méritait d’être exploité. On a assisté à un véritable raz de marée : Les 1001 vies d’Ali Baba, Les Dix Commandements, Roméo et Juliette, Autant en emporte le vent, La Belle et la Bête, Cindy Cinderella, etc. Le programme est toujours le même : sortie des CD, promo des singles et de l’album via certaines émissions télé et via la radio, vente des places grâce au matraquage médiatique et tournée. Ne croyez pas que nous soyons des grincheux… Au contraire, nous avons passé d’excellents moments et quelques-uns de ces spectacles valaient et valent encore la peine d’être vus. Pour les artistes, l’arme est hélas à double tranchant. Ça passe ou ça casse ! Je pense naturellement à Philippe D’Avilla, alias Mercutio dans Roméo et Juliette. Une voix magnifique, du talent à revendre et beaucoup de charisme ne suffisent pas toujours et après l’euphorie, le retour sur terre n’est pas toujours sympathique. Sophie Delmas, autre sublimissime voix, qui a joué le rôle de Belle Watling dans Autant en emporte le vent nous a aussi confié : ”Lorsque tu as incarné un personnage dans une comédie musicale, on te refuse bien souvent un rôle dans une nouvelle production. Les producteurs préfèrent les nouvelles têtes”. Et si on nous concoctait un gigantesque spectacle avec tous les artistes qui nous ont déjà fait vibrer. Voilà peut-être la solution !

melissa mars

sur une autre planète QMagali Eylenbosch

La muse de Mozart survivrat-elle à son rôle ? Comme elle le dit avec une belle spontanéité, aujourd’hui : “C’est le kif total”. Mais demain ? On lui souhaite en tout cas le meilleur.

Quel a été votre parcours ? Je rêvais d’être actrice et j’ai fait mes premiers pas sur scène à 13 ans. La musique, ça s’est fait par hasard, en rencontrant un compositeur il y a déjà quelques années. J’ai déjà enregistré trois albums qui s’articulent autour de l’histoire d’un personnage en mal d’amour. Le premier, Et alors, reflète la blessure de l’adolescence, le second, La reine des abeilles, traite le moment de la rébellion. Le dernier s’intitule À la recherche de l’amour perdu. Lorsque j’ai terminé cette trilogie, j’ai fait quelques concerts mais, je comptais mettre la musique entre parenthèses pour revenir à ma première passion, la comédie. C’est là qu’on m’a proposé un rôle dans Mozart l’Opéra Rock. Vous avez débuté une carrière solo. Qu’est-ce qui vous a poussé à vous lancer dans une comédie musicale ? J’ai eu un véritable coup de cœur ! Invitée à une soirée, on m’a présenté les maquettes d’un nouveau projet ”Mozart, l’Opéra Rock”. Dès les premières notes, j’ai été séduite par l’aspect convi-

vial, le côté Tim Burton, Famille Adams et par la mise en scène. N’avez vous pas peur que votre image dans la comédie musicale parasite votre image de chanteuse ? Non, pas du tout. J’ai vraiment eu de la chance, mon univers colle à celui de cette comédie musicale. C’est à la fois ”dark”, pétillant, coloré… On m’a souvent dit que j’étais une comédie à moi toute seule. Finalement, c’est quand même mieux de la jouer avec d’autres personnages. (Rires) Et puis c’est un beau projet… En plus, j’en suis arrivée à vouloir être dans la comédie musicale et être dans un groupe. Chanter en groupe et en solo, c’est différent. Est-ce que cela vous oblige à laisser votre ego au vestiaire ? Non, pas du tout. Il n’y a qu’une seule chanson de groupe, les autres sont des solos ou des duos. Sur ce projet, on a eu le privilège de chanter des chansons choisies après le casting. Elles ont donc été faites ”sur mesure”. Elles sont vraiment faites pour moi. Le rôle d’Aloysia me correspond bien. La limite entre elle et moi est très floue. C’est un luxe et un très beau cadeau. La mode des chanteurs ”kleenex” rend-telle l’accessibilité au métier plus difficile ? Il ne faut pas se leurrer, il est de plus en plus difficile de percer dans ce milieu. Outre le talent, il faut avoir la foi, de la volonté et de la persévérance. Une fausse illusion d’éphémère est donnée par les médias.



eM Le C ub ul le © M ic k B

Est-ce les medias ou le système des maisons de disque qui veulent ça ? Au départ, je ne voulais pas être chanteuse. En fait, j’ai été repérée pendant que je dînais avec un réalisateur. Un compositeur est arrivé, il m’a vue et a eu un flash et m’a proposé de faire de la musique. Sans vous avoir entendue chanter… Au début, j’étais réticente mais après un mois, je suis allée le voir. Il n’avait pas de projet particulier pour moi, il voulait juste m’entendre et il a aimé ma personnalité. Au départ, je n’avais presque pas envie que ça marche, je trouvais que ce n’était pas juste parce que je rêvais d’être actrice. Je me suis demandé pourquoi je ne décrochais pas un rôle aussi facilement. Ce n’est visiblement pas aussi difficile d’enregistrer un CD…


Il y a ensuite eu toute une construction de mon univers. C’est arrivé très simplement avec une chanson ”Papa m’aime pas”. Les mots sont

arrivés dans ma tête, ça a sonné comme une chanson et j’ai demandé à ma mère, qui écrit, de rédiger des paroles autour de ces mots. À ce moment, j’ai su ce que je voulais faire : fantasmer mon histoire d’enfance en musique. Comptez-vous reprendre une carrière solo au terme de la tournée? Certainement, mais je n’y pense pas actuellement. Maintenant je m’amuse dans tous ces décors, ces costumes, coiffures… Je joue un rôle extravagant, à la fois tentatrice, cruelle et très humaine. C’est le ”kif total”. Qu’est-ce que cette expérience vous apporte sur un plan personnel ? Que du bonheur ! Pouvoir être sur scène tous les soirs pour chanter et jouer la comédie, partager la scène avec d’autres comédiens… c’est un réel privilège. La salle est pleine tous les jours, 3800 personnes et, chaque soir, les spectateurs se lèvent à la fin du spectacle.

Est-ce que vous préférez le plateau de tournage ou la scène ? Les deux. Ce n’est pas du tout la même chose. Un tournage, c’est du ”one shot”, on donne tout pendant un espace de temps restreint. Sur la scène, on revit continuellement les émotions du personnage, devant un public différent à chaque fois. Est-ce que le scénario de la comédie musicale prend des libertés par rapport à l’histoire de Mozart ? Oui. II y a naturellement des ellipses, mais tous les événements mis en scène sont des faits réels, reconstitués d’après les documents historiques retraçant sa vie. Est-ce que vous percevez un côté moderne, actuel dans la vie de Mozart ? Mozart avait une personnalité Rock en Roll. C’était un rebelle, qui prenait la liberté de faire la musique qu’il aimait.

Photos : Vanhoutte sprl

V nt D a d r A y n n a R F

ll de a joué Music Ha e ll E . rs u jo es u q quel elles, l’espace de x ru B à te bi a h L’ actrice e au Wolubilis. Jean-Luc Lagarc aime me lever et j’ , re gè n ra ét le il une v ez l’inconnu, le première, dans e ass n e u ’ im d a J’ n . ti le a il m v e velle 07h L écouvrir une nou pproprier un quartier, se créer d , re êt n fe la r a s’a regarder p ie, à apprivoiser, v le el v ou n e n u ’ te… déséquilibre d les que l’on arpen el ru es d s er v a tr u des lumières je e L . te n une routine au ta r o imp nsable pour étition est très e p p é is r d re in iè t rn es e d te poin 09h La le, anisation à la rg o e n u e est très diffici , it text a rf n a u p e dr re n êt re it do . App virgule, prende se sente prêt re n d o in m o le m t u la e to d e qu nir t d’exclamail faut se souve in o p le te p m co dre en ce En tant qu’actri tion, ou pas… e, é me laisser fair im a rs u jo u to i j’a es et à leurs pertr u a x u ons… a r ri v m’ou nde de sensati o m n u s n a d r t ceptions, entre universelle ! , j’y suis souven t es les e el x tr éâ ru B th re u o d d . J’a La langue ler, je ne suis et sentir la ville il rs a o v h a e tr d r er ou n p eu ir éj reven te pour d que reuse ! J’aime y eu h 13h J’en profi é ét i r bien, ne fut-ce a ti y n j’ se et ’y es m g r a ou rn p tou ille venue pour des e partie de la v ir fa e d n oi es b i e ", j’a ps pas très "tourist arde tout le tem eg r Je . le el n . on … ti ! irra pour 5 jours les envie un peu trac d’une façon je le , i !" a J’ x s eu e ez h ch c tous lan mais assez exce, ils rentrent r sur les p n ja a e t t ch es ’ n n le o el on u , m ce "Q e : n t érie td isan 19h, avan crois pas à l’exp ants et en me d e n ass p Je les … t n im a fa rv s obse i pa eur Pou , même si je n’a par la fenêtre en in a p u d r vous ier d’acteur, la p e ét g n m a le m s n je a e, D qu’est ! dr ir is e la jouer d p x le u t ie n -ce que d ie Pour me déten v les e s e qu i ri g p là n e je d e, i rs f ie ? scèn r illeu a ’ su d r t te J es ’ o C on u . m e té e r en c’est faire nt d périm semblant tremêler… Ava n e s’ t p en a v r oi t d i r ir d … u on ti m a ir et le plais o ment où o d’exister. À insp l’ t en ffl su f n i a ’ i m n décide d re sembla u’ils n e t , l’Olympe pour q o n d evien sonn Les publics sont-ils différents tous les soirs ?

Certainement. Le public de province est beaucoup plus attentif, il a une vrai soif de culture, c’est une énorme chaleur. À Paris, le public averti, n’est pas souvent le plus fin… Le rôle des spectateurs est très important pour les acteurs, ils participent à la pièce, ils ont des réactions surprenantes parfois, comme un grand rire au moment d’un drame !

t un pe age. C’es semblant t cela le théâtre, on rm f temps… ais on existe en mê ait me



› Jaune mécanique Élégance et virilité, tous les arômes de bergamote et d’anis du nouveau parfum PauL smith man sont protégés par un packaging détonant… Pour un homme sûr de lui et audacieux! Paul Smith Man, 100ml, 67€

› Une idée lumineuse Une pointe rétro dans votre salon, la lampe métal chromé de Lucia EstEvEs fait toute la différence! Une belle idée de cadeau pour les fêtes… 279€ chez Lucia Esteves,

› Wishbone

› Globe Trotter Voilà un vrai outil de voyage! Des coques en aluminium brossé anodisé, les faces internes renforcées de carbone et de Kevlar, ses deux sangles en vache naturelle; chaque détail confère un look original et un caractère résolument pratique à cette magnifique valise hErmès ! Une nouveauté à saisir!

Un sac, une veste, des bonnets,… Ce porte manteau design et nature gardera vos entrées rangées tout en ajoutant une touche élégante… Brillant ! Frost, Wishbone, chez Modern Comfort Home,

› Chef Coq Dernier-né de la célèbre Maison KitchenAid, ce mixeur est pratique, rapide, facile à utiliser et ultra-chic! Décliné en plusieurs couleurs, le mixeur ajoutera du charme à votre cuisine! Kitchen Aid chez Les Secrets du Chef,

› C’est dans la boîte ! Ultra-design et modernes, les cubes radio stéréo de sonoros transforment les CD, radio réveil, MP3 et station IPOD en autant de systèmes audio compacts hautement tendance et high-tech. Pour les fans de design!


Jeunes Pousses Le Domsai, ce personnage à l’allure de cosmonaute et à la tête de cactus, est la dernière trouvaille du designer italien Matteo Cibic. La collection Domsai, une nouvelle petite famille qui saura certainement attirer votre sympathie! Domsai, 99€ chez Whazup,

CJ Distribution Tel.: +32 2 400 00 65 -



AVhh‚YZk^kgZYVchaVb„bZVbW^VcXZ4>aZhiiZbehYZidji X]Vc\Zg#EZ^cijgZ!iZcijgZh!bdW^a^Zg!iVe^h!ajb^cV^gZh½Dc cZhV^ieVhidj_djgheVgfjd^XdbbZcXZg#FjZafjZhXdchZ^ahZi VhijXZhYZkgV^Zcikdjhh^bea^[^ZgaVk^Z# n Magali Eylenbosch


Les jolis tissus Si vous faites appel à un peintre-décorateur, commencez par choisir les tissus des tentures et le recouvrement des fauteuils. Un professionnel doit pouvoir réaliser “ sur mesure ” des peintures aux teintes identiques à celles reprises dans le tissage des étoffes. Ce n’est naturellement pas une obligation et ce service a malheureusement un prix. La plupart des magasins de tissus d’ameublement peuvent s’occuper de la confection des tentures. Le prix est généralement calculé au lai, mais peut varier en fonction de la longueur. Modèle, doublure, taille des fronces ou introduction de passementerie sont aussi des facteurs à prendre en compte côté budget. Attention, les délais peuvent varier entre 10 jours et 5 semaines selon les maisons. Certaines placent stores et tentures à domicile. La confection maison requiert un réel savoir-faire pour un résultat parfait. Outre la précision, il faut avoir un espace nécessaire pour couper le tissu et assembler des différents lais. Il est temps aussi de penser aux éventuels coussins qui garniront les canapés. Choisissez-les assortis ou contrastés, mais dans une gamme de tons cohérente.

Les Tissus du Chien Vert

Lorsqu’on feuillette les pages d’un magazine déco, la mise en scène d’un lieu semble être un art accessible à tous. On oublie bien souvent que nous, les journalistes spécialisés, avons sélectionné le meilleur, parmi de nombreux intérieurs jugés sans intérêt. Trop banal, pas assez soigné, mal agencé,… Du principal au détail, rien ne peut être laissé au hasard. Au risque de faire mentir l’adage le concernant : il ne fait pas bien les choses. Si vous rêvez de voir un jour votre “ home sweet home ” à la une, pas à pas, visez la perfection, en prenant le temps de faire les bons choix. Inutile de reproduire

Jeter ou garder On hésite souvent à se débarrasser du superflu. Au fil du temps, on amasse une série d’objets hétéroclites. Certains trouveront naturellement leur place. Les autres finiront leur vie au fond d’une armoire. Comme le rangement est un luxe, autant se débarrasser du petit chien en cristal offert par Tante Hortense. Excepté pour ceux

qui jouent la carte du kitch, c’est impossible à caser. Par contre, une collection de coucous suisses peut ne pas être dénuée de tout intérêt. On peut parfois faire preuve d’audace et toujours de personnalité. Pensez à marier les styles. À l’instar de la mode, le total look a fait son temps. Choisissez d’abord les pièces maîtresses que vous désirez mettre en valeur. Un canapé

Louis XVI, une bibliothèque Jean Prouvé ou une authentique table de ferme… Peu importe, pourvu qu’elles méritent qu’on s’y attarde. Sachez faire la part des choses, vous ne vivez pas dans un musée, mais si vous avez des enfants, préservez certains espaces. Les Playmobil qui jonchent le sol du living, c’est moyen !

Sortez les pinceaux Flamant

Ambiance Moodust, un argenté mystérieux par Véronique Branquinho pour Levis.

Peindre soit même ? Pourquoi pas… En suivant les conseils de la marque de peinture, Histor, c’est un jeu d’enfant. Le nombre de litres de peinture nécessaire dépend du type de support et de peinture. Plus la structure est brute, plus il faudra de peinture (laque : 1 litre/12 m² par couche, peinture murale : 1 litre/8m² par couche). Le choix de la couleur est déterminant. Si vous souhaitez appliquer un brun chocolat sur un mur blanc, mieux vaut commencer par apposer une couche de fond ou un primer coloré. Il faudra néanmoins prévoir au moins deux couches. La peinture acrylique est une peinture en phase aqueuse durable, résistante à l’usure et aux rayures. Elle dégage peu d’odeurs, sèche rapidement et est donc particulièrement bien adaptée à un usage intérieur. La peinture alkyde possède également ces propriétés mais sèche moins rapidement. Pendant et après les travaux, une odeur de peinture fraîche subsiste. Si vous avez utilisé de la peinture acrylique, vous pouvez rincer vos ustensiles à l’eau chaude et au savon. S’agissant des peintures alkydes, vous aurez besoin d’un diluant, par exemple du white spirit. Que votre peinture soit mate, satinée ou brillante, la qualité est la même. Chacune d’entre elles présentent des avantages et des inconvénients. Les peintures mates ont un excellent pouvoir de camouflage parce qu’elles reflètent moins la lumière. Elles masquent les inégalités du support et ont un effet apaisant. La peinture satinée confère au support une légère brillance. Elle se lave facilement mais les inégalités ressortent immanquablement. Les laques sont disponibles en satiné et brillant. Les peintures de fond et les peintures pour tableau noir sont toujours mates. Pour couvrir de grandes surfaces, le rouleau fait des miracles. On choisit sa taille et son revêtement en fonction de la surface à peindre et du type de peinture à employer. Si le mur est lisse, vous opterez pour un rouleau à poils normaux, s’il est texturé ou maçonné, mieux vaut choisir un rouleau à poils longs. La laque s’applique de préférence au petit rouleau en mohair ou en velours. Les petits rouleaux en mousse sont utilisés pour lisser la peinture après application et non pour l’application proprement dite. Pour les petits bords et les coins, l’usage du pinceau s’impose. Choisissez un pinceau combinant les poils synthétiques et les poils de porc pour la peinture acrylique. La peinture alkyde exige quant à elle un pinceau un peu plus dur en poils de porc. Commencez toujours par peindre le plafond, continuez par les murs, et terminez par les portes, les fenêtres et les châssis. Chez Levis, le but de Levis Ambiance est d’offrir aux utilisateurs un package global de couleurs, de sources d’inspiration, de conseils pratiques et d’accessoires, qui permettent à chacun de se lancer, sans difficulté. Ambiance Designer Collection offre chaque fois une plate-forme créative à une personnalité forte du monde la mode belge. Cette fois, c’est Véronique Branquinho qui présente un choix de teintes avec sa collection Histoire. On craque aussi pour la fabuleux nuancier des peintures Flamant et pour leurs petits pots d’échantillon qui permettent de faire un essai “ in situ ”.





Changement de décor


Côté papier Depuis quelques saisons, le papier peint a repris du galon. Il permet de changer de murs en un clin d’œil et s’intègre aussi bien dans les intérieurs classiques que dans les décors plus contemporains. Les nouvelles colles font des miracles. Certaines d’entres elles permettent d’encoller le mur, plutôt que le papier et évitent donc les manipulations délicates. Attention cependant : à chaque papier sa colle. Renseignez-vous auprès du revendeur. Lorsque vous calculez le nombre de rouleaux nécessaires, n’oubliez-pas, s’il s’agit d’un papier à motifs, de calculer les raccords (chute de papier inévitable pour raccorder les motifs). Flamant et arte surfent en duo. Ces deux partenaires étaient faits pour se rencontrer et le résultat de leurs cogitations est, encore une fois, résolument cohérent. Flamant Suite III Velvet est une ligne de revêtements muraux unique, innovante et sophistiquée, qui mise aussi sur les contrastes. Pour la cinquième fois, Arte propose aussi une collection de papiers peints signée Ulf Moritz. Cet artiste germano-polonais a créé cette fois la collection “ Charisma ”. Elle fait la part belle à l’audace et l’excentricité avec ses énormes motifs et ses effets spéciaux. Farrow & Ball est incontournable en matière de motifs anciens. Colorés avec ses peintures à l’eau ou imprimés à la planche, à rayures ou à motifs fleuris, ils déclinent une gamme de teintes toujours inégalée.

Ulf Moritz pour Arte

Farrow & Ball

Déroulez le tapis rouge À l’instar du papier peint, la moquette rencontre à nouveau un vif succès. On l’avait provisoirement boudée, privilégiant les revêtements de sol “ faciles à entretenir ”. Si le bois et le carrelage demeurent incontournables, la moquette offre un confort et une douceur inégalable. Dans une chambre, par exemple, c’est un régal. Le tapis, permet également de donner du caractère au décor. Attention aux dimensions. Un format rikiki, posé au centre d’une grande pièce, n’apportera pas grand-chose d’intéressant.



Crédits sur :

“Cucina in legno con panno bianco” (2009 Pordenone – Ecole de Caravaggio)

Comme dans un tableau de Caravaggio, la magie de la lumière permet de toucher la matière avec les yeux. Valcucine donne une nouvelle sève au minimalisme en réinterprétant les matériaux, en récupérant l’âme et la chaleur à travers l’énergie vitale du bois naturel. La nouvelle finition « noyer tactile », unie au porphyre naturel, offre d’infinies émotions à la vue et au toucher, en créant une atmosphère chaleureuse dans un environnement de design rigoureux. Valcucine propose cette nouvelle atmosphère avec un projet éthique et technologique dans un total respect de l’environnement: vernis à l’eau anti taches hautement résistant, caisson sans émissions cancérigènes de solvants aromatiques, caisson en verre (optionnel) 100 % recyclable et sans émissions de formaldéhyde. Artematica Noce Tattile, la chaleur de la matière. Design Gabriele Centazzo

Chaussée de Waterloo, 412 - Bruxelles T: +32 2 534 4999



Changement de décor

Entrez dans la lumière On n’en parle jamais assez ! La déco n’est rien sans une belle lumière, quel qu’en soit son style. Plusieurs critères sont à prendre en compte lorsqu’on choisit un éclairage : esthétique, température des couleurs, ergonomie, qualité de lumière,… N’oubliez jamais qu’il peut modifier radicalement la palette de couleurs des murs. L’avis d’un spécialiste n’est donc pas un luxe. Pensez aussi à l’usage. Dans un salon ou dans une chambre, l’éclairage doit être plus intimiste que dans une cuisine ou dans une salle de bains. Idéalement, il doit être modulable. Lampes, lampadaires, appliques, suspensions, ne tardez pas à découvrir les nouveautés de la saison.

Les bonnes adresses : Les Tissus du Chien Vert

Les trois adresses de la maison et son incroyable stock de tissus font le bonheur des néophytes et des décorateurs.

De Backer Passementerie

Une maison qui décline la passementerie d’exception, en stock et sur mesure. Rue des Capucins 13 à 1000 Bruxelles, T : 02 502 40 93

Didden & Co

Cette entreprise familiale, fondée par Leon Didden, démarra dans la vente de tapis d’Orient en 1963. Aujourd’hui, ici, tout est possible. Hand-tuft, noué main, wall to wall, coco, sisal, seagrass ou pure laine, le tapis de vos rêves vous attend. Last but not least, la maison possède ses propres équipes de placement, en Belgique ou à l’étranger et réalise les devis gratuitement.


Avec trois points de vente (Ixelles, Schaerbeek et Waterloo) Miniox propose une vaste palette de produits. Peintures, papiers peints, tapis, tissus,… Vous aurez l’embarras du choix.

Farrow & Ball

Située dans le quartier du Sablon, la boutique Farrow & Ball mérite franchement le détour. On salue la taille des échantillons qui permet de choisir en toute quiétude. Attention : les rouleaux de papier peint sont imprimés à la demande. Un must qui exige un peu de patience.



Il y a bien longtemps que la réputation de l’univers Flamant n’est plus à faire. Il mêle astucieusement confort, élégance, raffinement et art de vivre.


Histor : Arte : Levis :






DcaZhV^bZedjgaZjgh^aajhigVi^dch!aZjghXdchZ^ahZiedjgaV eZi^iZeVgiYZg„kZZceajhfjÉ^ahcdjhVeedgiZci# n Magali Eylenbosch

Brusselleke safari urBain

Chefs-d’œuvre de l’art nouveau à Bruxelles

ChaMBres d’hôtes insolites en ProvenCe

isaBelle de Pange [aParté]

Christian Mesnil [aParté]

ange lorente et Christian Betti luC Pire

À Bruxelles, des myriades de façades déclinent l’inventivité des architectes, la fantaisie des artisans, les désirs des commanditaires. Pour l’enfant curieux, le promeneur épris de patrimoine, l’art est dans la rue, véritable bonheur pour les yeux. Une infinité de détails surprenants émaille cet imagier, fruit d’un safari urbain, d’une chasse à l’imaginaire des générations précédentes. Incontournable pour voir et aimer la ville.

Comprendre l’Art nouveau à Bruxelles dans sa dimension géniale et éphémère, en décoder les façades éclatantes et les intérieurs cachés, en apprécier la diversité des formes, des couleurs et des matières. Découvrir les personnalités fondatrices de ce mouvement, architectes, artisans, commanditaires, suivre leur évolution, leurs questionnements, leurs doutes et leur langage. Telle est l’ambition de ce livre, un ouvrage essentiel !

La Provence regorge de lieux de villégiature exceptionnels : certains bien connus du grand public, d’autres plus secrets mais tout aussi fabuleux. Cet ouvrage propose un aperçu des plus belles chambre d’hôtes de la région qui ont su combiner passé et présent, sobriété et originalité, luxe et accessibilité. En passant, on s’inspire des belles idées déco qui ponctuent les pages de cet ouvrage.

Baignades et Bassins naturels

Chili Pays de vins et de Montagnes

20 teChniques de Peinture redonnez vie à vos vieux oBjets

PaPianille Mura, Matt Wilson (PhotograPhies) versant sud

tilly CaMBré ePn/raCine

Si le fil conducteur de ce livre est la découverte des vallées vinicoles et de leurs crus, il nous invite surtout à flâner le long de la route, à nous reposer sur une Plaza de Armas, à assister à un rodéo, à danser la cueca, à regarder se coucher le soleil dans la baie de Valparaíso ou encore à passer la nuit dans une casa patronal aux murs d’adobe. Des photos magnifiques !

Vous avez sûrement, quelque part dans votre maison, de vieux meubles ou des accessoires qui prennent la poussière et dont vous n’avez pas envie de vous défaire. Grâce à 20 techniques de peinture, vos trésors retrouveront leur splendeur d’antan. Les différentes techniques reprises dans cet ouvrage vous permettront d’insuffler à chaque objet une deuxième vie bien méritée. Les explications sont simples et les conseils pratiques permettent, même aux néophytes, d’obtenir d’excellents résultats.

PatriCk gléMas ColleCtion larousse tendanCe

C’est le premier livre entièrement dédié aux créations françaises de baignades naturelles, appelées aussi " piscines écologiques ". Une tendance encore très nouvelle. Ce guide, riche en belles illustrations, est à la fois source d’inspiration et guide pratique. Il donne tous les conseils techniques nécessaires pour créer et réaliser un lieu de baignade qui fait aussi du bien à la planète.


Maisons de CharMe

larousse des Cathédrales

niCo sMout, tiM torfs et PatriCk retour ePn/raCine

gérard denizeau editions larousse

Depuis cinq ans déjà, le magazine Maisons de Charme fait découvrir le meilleur de l’habitat classique et intemporel auprès de lecteurs épris de décoration. Un livre éponyme était donc fort attendu. Des photographes et des journalistes vous présentent un échantillon représentatif des plus beaux intérieurs. Des habitants de belles maisons, des architectes d’intérieur, des coloristes, des décorateurs et des stylistes racontent avec beaucoup d’enthousiasme leur passion pour l’habitat de charme et partagent de bonnes idées.

L’auteur, Gérard Denizeau, enseignant en université et historien d’art, nous invite à voyager dans le temps et dans l’espace. Expression d’une foi conquérante, miroir d’une histoire turbulente, la cathédrale inscrit dans la pierre la démesure de la volonté des hommes autant que leur génie architectural et décoratif. À travers une iconographie remarquable, accompagnée de légendes détaillées, le Larousse des Cathédrales retrace les grandes étapes de leur construction, replacée dans leur contexte socioculturel.

Bien vivre dans une Petite surfaCe PhiliPPe deMougeot haChette Pratique

Philippe Demougeot nous livre son savoir-faire pour tirer le meilleur parti d’une petite surface (entre 25 et 50 m²). Oser moduler l’espace, déplacer les cloisons et repenser la fonctionnalité, selon le nombre et le besoin des habitants est un art qu’il maîtrise totalement. À partir du même plan de départ, il propose des déclinaisons différentes adaptées à chaque usage : une pièce en solo, deux pièces en solo, une pièce à deux,…

l’art du Bonsaï isaBelle et réMy saMson editions larousse

Ce magnifique coffret cadeau est destiné aux nombreux amateurs de Bonsaï qui souhaitent créer, entretenir et soigner leurs arbres. Il contient à la fois le guide de référence avec les principes généraux, mais aussi le répertoire des 54 arbres d’extérieur et d’intérieur ou d’orangerie, et quatre outils de qualité indispensables à la pratique de cet art délicat.

serneels 50 ans de tradition texte : alain van den aBeele

Dans le cadre du 50ème anniversaire de la Maison Serneels, un superbe livre a été édité. Il retrace son histoire et celle de 25 jouets mythiques qui ont traversé ces 50 ans sans prendre une ride. Ils ont fait rêver les uns, partagés les secrets des autres et feront encore le bonheur de nos enfants et petits enfants. Un ouvrage à offrir à tous ceux qui se sont arrêtés, petits, devant ces vitrines magiques. (


Garnissage & Traditions Z[Ób[dW_]k_bb[

Garnissage & Traditions, c’est d’abord un nom, celui de Pascale Poncelet. Il y a dix ans, elle décide de quitter le monde de la finance, son berceau professionnel, pour découvrir l’univers de l’artisanat dans le garnissage de fauteuils. De fil en aiguille, le petit atelier prend de plus en plus d’importance et réussit le pari de se faire un nom parmi les grandes Maisons ! Des modèles classiques ou contemporains, Garnissage & Traditions en connaît les moindres détails ! La fabrication se fait entièrement au sein de l’atelier, par une équipe d’artisans hautement qualifiés et soucieux d’un label de qualité digne de la haute couture. C’est là que chaque création est réalisée selon un modèle inédit, à la mesure de tous les désirs… À vous de choisir le modèle, la matière et la finition qui vous conviendront le mieux. Après une attente de 6 à 8 semaines, vos rêves deviennent réalités ! Garnissage & Traditions est devenue au fil du temps une adresse incontournable dans le " Design District " bruxellois. Une visite du magnifique showroom achèvera de vous convaincre…

Garnissage & Traditions Showroom – Design District

Blvd. de la Deuxième Armée Britannique 18 1190 Bruxelles Tél. : 02/520 59 29

Le côté de Guermantes

Marie Paule Ponette et Emmanuel van Stratum Rue du Page, 28 1050 Bruxlles T : 02 534 98 96

Ter Poel Interieur

Marleen Renard Toonzaal Antxerpens Kookhuis 1er verdiep Terninckstraat, 1 2000 Antwerpen

L’oranjerie Home Interiors Caterina et Raphael Senelle Stationstraat, 25 3090 Overijse T : 02 687 42 57




Forte de sa réputation internationale, la prestigieuse marque de tapis luxueux puise sa créativité sans cesse renouvelée dans l’inspiration de la vie quotidienne.

Une maison moderne, lumineuse et spacieuse, mérite un habillage de matières nobles, de dessins originaux fabriqués par les meilleurs artisans. Et puisque chaque intérieur est unique, Limited Edition est vouée à transformer nos rêves en réalité.


Limited Edition est aujourd’hui tenue par un trio de choc : Katia De Witte, son frère James et son mari Philippe Hanet. À trois, ils représentent la cinquième génération d’une famille déjà très réputée en matière de textile. C’est en 1992 que Katia décide de créer sa propre société, réalisant ainsi son rêve de dessiner et de créer ses propres tapis. Entourée aujourd’hui des meilleurs artisans et designers, elle gère avec son mari et son frère les deux showrooms de Paris, et des boutiques à Bruxelles, Amersfoort aux Pays-Bas et Cologne… Sans oublier le réseau grandissant des revendeurs éparpillés à travers le monde ! Une marque 100% belge et vraiment unique !

LIMITED EDITION 35 rue de Namur 1000 Bruxelles Tél. : 02. 512 23 68


Photo : Patrick Bombaert

Les AteLiers

d e LA

CA m b r e

852 chaussée de Waterloo à Uccle – tél : 02.375.76.46 Lighting Collection by Stéphane Davidts –



sur les Ateliers de la Cambre

D’abord, il y a le show-room avec de superbes modèles de luminaires. Pas un instant on n’imagine que, dans les coulisses du lieu, une petite armée d’artisans met son savoir-faire au service de l’exception. Nous avons rencontré Stéphane Davidts, propriétaire et créateur passionné. Quand vous êtes-vous lancé dans l’aventure des luminaires ? Tout a commencé en 1982 par la fabrication d’abat-jours. Je travaillais chez moi dans un très petit espace. Un peu plus tard, j’ai repris un atelier à Anderlecht et j’ai commencé à travailler le métal, ce qui m’a permis de créer des luminaires et un peu de mobilier. En 1993, on m’a proposé cet atelier de la chaussée de Waterloo. C’était une ancienne dinanderie, on y fabriquait donc essentiellement des pièces en cuivre. Vous ne travaillez plus le cuivre ? Non, nous travaillons le laiton. C’est un matériau plus contemporain qui s’intègre, selon la finition, dans tous les types de décors. Nous pouvons aussi le laquer. Vous créez vous-même les modèles ? J’ai dessiné la plupart des modèles de la collection mais nous collaborons aussi avec quelques designers. Et puis, il y a un véritable travail sur mesure, notamment pour les architectes d’intérieur.


Entre la Bascule et le quartier du Vert Chasseur, sur la chaussée de Waterloo, Les Ateliers de la Cambre déclinent l’art de mettre notre vie en lumière avec des luminaires et des abat-jours exclusifs.

Comment définiriez-vous le style ? Je privilégie un style épuré, intemporel mais plutôt contemporain. Nous possédons aussi un grand avantage : pouvoir travailler les abat-jours dans toutes sortes de formes et de tissus. Vous faites également du sur-mesure ? Ça fait partie intégrante du métier, mais notre propre gamme est déjà très vaste. Il y a un regain d’intérêt pour les beaux abat-jours… C’est vrai. Et particulièrement pour les modèles ”cylindres”, qui se suffisent totalement à eux-mêmes, surtout dans les dimensions importantes. Le passage aux lampes économiques modifie-t-il le choix des clients ?

un abat-jour décliné dans une teinte chaude permet d’apporter une touche de vie dans un espace. Est-ce un domaine qui évolue beaucoup ? Oui et non. Les matériaux qui sont mis à notre disposition sont toujours les mêmes. Il y a eu un engouement pour la céramique dans les années 80, beaucoup de doré aussi. Ce n’est plus le cas pour l’instant. Peut-on parler de délai ? Bien sûr ! Et nous mettons un point d’honneur à les respecter. Nous avons du stock dans les modèles classiques. Pour les coloris ou les matières particulières, il faut compter entre trois et quatre semaines. Techniquement, notre métier exige d’être très méticuleux et le savoir-faire de nos artisans fait toute la différence.

Non, pas vraiment ! Au niveau des ampoules, nous n’aurons de toute façon pas le choix. C’est dommage d’ailleurs ! Les ampoules économiques sont intéressantes dans les lieux où l’on éclaire longtemps, puisqu’elles consomment de l’énergie au démarrage. Dans les lieux de passage, ça n’a pas de sens. Les tendances redeviennent plus ludiques ? Il y a une réelle envie de couleurs. Aujourd’hui, à côté des tons sobres, le rouge, le mauve et l’orange ont beaucoup de succès. À l’instar d’un tableau,



JcZ VYgZhhZ ^cXdcidjgcVWaZ! d‘ kdjh igdjkZgZo YZ cdbWgZjm Vgi^XaZh YZ Y‚XdgVi^dc! YZ fj^cXV^aaZg^Z Y‚XdgVi^kZ Zi Y¼VXXZhhd^gZh hVc^iV^gZh# BdYZgc 8db[dgi=dbZkdjhgZd^iYVchjcZbV^hdcd‘kdjhY‚Xdjkg^gZojcZhVaaZ Y¼Zmedh^i^dcVjmbjai^eaZh[VXZiiZh 9Zej^h W^Zcii )% Vch! cdjh gZhidch | aV ed^ciZ YZ a¼^ccdkVi^dc VkZX YZh XdaaZXi^dchXg‚‚ZheVgYZhYZh^\cZghYjcdgYVjhjYYZa¼:jgdeZ#IdjiZhaZh iZcYVcXZhnhdcigVhhZbWa‚Zh# Idji Zc ÄcZhhZ Zi Zc gV[ÄcZbZci! XZ h]dl"gddb ZmXZei^dccZa Zhi jcZ VYgZhhZ|gZiZc^gZi|k^h^iZg DjkZgi+_djghhjg,YZ-](%|&'](%ZiYZ&(](%|&,](%ZiaZhVbZY^YZ &%]%%|&,]%%hVch^ciZggjei^dc# :cYZ]dghYZXZh]ZjgZh!edhh^W^a^i‚hYZgZcYZo"kdjhVj%),*-)'-)'#

GjZYZaVHiVi^dc++"&)&%LViZgadd"I/%'(*)&&&'";/%'(*)+,,&"bX]5bX]"Xdb#WZ lll#bX]"Xdb#WZ

décoration mode



AÉdW_ZXi^[YZC^XdaVh9Zhi^cd!aÉjcZYZh cdjkZaaZh[^\jgZhYZegdjZYjYZh^\cWZa\Z/ hd^\cZgaÉ^cY^k^YjZcaj^VeedgiVciaZW^Zc"„igZ VjXÃjgYZhdW_ZihYZhdcZck^gdccZbZci#Jc XdcXZeii]‚gVeZji^fjZfj^cdjhVYÉZbWa‚Z h‚Yj^i

Milan n’est pas un passage obligé ! Alors que d’autres se bousculent pour faire éditer leurs créations par les grandes maisons, Nicolas à choisi de suivre un parcours atypique en s’autoéditant. Cette démarche lui permet certes de s’épanouir d’avantage, même si l’investissement personnel est extrêmement important. Cette décision, il l’a prise dès la fin de ses études et il la dit motivée par les trois prix qu’il a remportés, notamment avec la " pi.chair ", une chaise en bois, et la " ladder.light " qui a remporté le premier prix au concours Design for Europe au Salon Intérieur de Courtrai. Artiste autant que designer, il vend ses objets lors d’expositions dans des galeries, entre autres chez Pierre Bergé, à Bruxelles. Parallèlement, il travaille aussi en tant que designer freelance pour Myfab qui est un site de vente de mobiliers design en ligne. Quand on lui demande quels sont ses maîtres à penser, il parle naturellement de Verner Panton et de Le Corbusier, mais avoue avoir un faible pour le plastique coloré des golden sixties. Des idées, il en a plein la tête… En ces temps quelque peu troublés, Nicolas Destino pense à fédérer notre plat pays en proposant au Directeur de l’Atomium de mettre en place une exposition de deux designers, un francophone et un néerlandophone. C’était sa façon à lui d’apporter une petite pierre à l’édifice. Un Bruxellois fera aussi partie de l’aventure. Cette exposition, qui s’intitulera " Belgian Design ", se tiendra pendant deux mois, l’automne prochain. Linde Hermans représentera la Flandre, Jean-François d’Or, Bruxelles et Nicolas portera bien haut les couleurs de la Wallonie. Une initiative qui nous met du baume au cœur ! n Magali Eylenbosch


            

hind rabii scapa home xvl dedar asa collection flamant casamance romo vano ilanga stephane davidts puylaert lambert

Rue du béguinage, 1 1300 wavre T & F : 010 24 89 49 ouver t du mardi au samedi de 10h00 à 18h30

À partir du 13 décembre, ouverture de 10h 00 à 18h 30. * les dimanches 13 et 20 décembre de 14h00 à 17h00.

    

canapés fauteuils mobilier stores tentures

le tout sur mesure …

non - stop *



mythiques du design Ils ont marqué leur époque et sont encore sur le devant de la scène. QMagali Eylenbosch

Panton Chair Classic VERNER PANTON, 1959/60

n Verner Pa


au amtofte, 926 à G nton fré1 n e é N Pa à , Verner Danemark cole technique é l’ r’a d ra s te quen s étude s is fera de e u d p e le s a n y e o Od démie R a c A l’ à D ue. e chitecture Copenhag dans à , s rt -a Beaux employé 2, il sera 5 9 1 d’Arne à 0 195 itecture h rc ’a d t e on propre le cabin fondera s is u ign p , n t de des Jacobse itecture e h urs rc le u ’a o d c studio our les on goût p métriques se S . 5 5 9 1 en géo s formes ur texvives et le de créate re v u œ n o s isant à s v n da térieurs in ts manifeste n , e m et invisible ménage tile, ses a une unité parfaite Il r. e ili b ns le mo fondre da lafond et Il p . ra le it , V rs c u m ton ave n a P le sol, les e e is v a ra la ch roduit dé développe urs du premier p . te p com ille s’agira d’a aison à son propre m la r a p é lopp

Le designer danois, Verner Panton, étudia pendant de nombreuses années l’idée de réaliser un siège monobloc en matière plastique. Les premiers prototypes furent réalisés en collaboration avec Vitra dans les années 60, mais la Panton Chair ne fut fabriquée en série qu’à partir de 1967. Contrairement à la Panton Chair Standard, au prix plus avantageux, la Panton Chair Classic est fabriquée entièrement en mousse synthétique rigide et la surface est laquée.


Infos : ou

Sori Yanag


iera nagi étud o, Sori Ya ndra l’asy k o T à , 15 devie Né en 19 x-arts et d, de des Beau le tte Perrian ra o o c rl é a l’ h à C r, e e n n ig s la de rd, il fo d sistant de ns plus ta a ura a ix i D u q . 2 te 94 1940 à 1 ustrial Design Institu d’objets d e d In u le Yanagi une multit Ses créade créer s. le b u e m pour but e ux rant et d u o arient mie c m e s g e a u iq n d’us a rg à ental la formes o sign occid e tions aux d s le s e rmi les plu s autr Japon. Pa que nulle u d le a n a rtis tradition a esigners de d ts n e in ém s du e, en plu rr e u l’après-g i imaori Yanag SORI YANAGI, 1954 mobilier, S des luminaisi s u a Le Butterfly Stool allie de manière unira e , gin erre bjets en v res, des o , des jouets, que des formes orientales à la techrts des couve ment des nique de moulage du contreplaqué ale g é is a m des élaborée par Charles & Ray Eames. e métro, d stations s. Il La silhouette légèrement incurvée t des moto voitures e du des deux coques d’assise évoque r directeu deviendra ire les ailes d’un papillon. La création de la u p rt po Musée d’a Tokyo en Sori Yanagi est proposée en deux fore mats. japonais d . 7 7 19

Buttery Stool

Ray Charles &


s connus ms les plu design o n s e d du t l’un le monde Eames es l sés dans ri , puisqu’i p re s ra lu p t et les 8, s plutô a 3 c 9 1 n n u E t e n couple. l s’agit d’u on d’Elie à l’invitati s vient t n a d n o p e ré am Charles E à l’AcaSaarinen, re tu c e it h rc a l’ r ie CHARLES & RAY EAMES, 1956 ranbrook, étud Arts de C viendra s e d ie m dé y de L’objectif visé de Charles Eames pour ichigan. Il n dans le M rofesseur de desig la conception de ce siège était d’alp t y n a e R m trera rapide lier un confort absolu à une qualité du y rencon re, qui t e l ie tr s indu peintu plus haut niveau, tant dans les matédiante en nt Kaiser, étu ns ses travaux ava riaux que dans la fabrication. Le résula d 1. 4 9 ra e en 1 l’assiste tat fut une interprétation moderne du on épous s ra e ir u n e g v n e de d se disti fauteuil club traditionnel qui séduit par e tonnant d é e in o a u d m o Ce une structure pensée jusque dans les dans le d t n e e ir m fa re ura su particuliè moindres détails. Satisfaisant entièreièges et a s n e o d ti c n u o d ti la pro la créa ment le désir de son créateur, il rapsign vers e d le r e évolu pelle un immense gant de base-ball . de masse usé et poli par l’usage, dans lequel on aimerait se pelotonner.

Lounge Chair & Ottoman


7adii^Z YVch jc ‚Xg^c YZ kZgYjgZ | hZjaZbZci ( `^adbƒigZh Yj g^c\ YZ 7gjmZaaZh!aVbV^hdchdWg^i^h]YZNkZh9Z@ZZghbVZ`ZgY‚kd^aZhZh hZXgZih|fj^aZY‚h^gZ:cigZYZhdW_ZihYZY‚XdgVi^dcYÉ^ci‚g^ZjgZiYZh bZgkZ^aaZhYÉVci^fj^i‚h!XZhe‚X^Va^hiZVhjg‚jc^gYZhXjg^dh^i‚hYZidjh aZh hinaZh! Zc Xg‚Vci jcZ eVg[V^iZ ]Vgbdc^Z ZcigZ cVijgZ! Y‚XdgVi^dc YÉ^ci‚g^Zjg Zi Vci^fj^i‚h# 9j bdW^a^Zg Zc VXV_dj Vc\aV^h  MK>>>ƒbZ h^ƒXaZ | aÉVg\ZciZg^Z YÉ]iZaaZg^Z Òc M>MƒbZ½ AV^hhZo"kdjh hjgegZcYgZ eVg aZh cdjkZVji‚h AZhZgk^XZY‚XdgVi^dcYÉ^ci‚g^ZjgegdedhZ‚\VaZbZcijcaVg\Z‚kZciV^a YZigVch[dgbVi^dch/YZaVY‚XdgVi^dcYZ[Zc„igZh!aVXdc[ZXi^dcYZiZcijgZh ZiYZhidgZh!|aÉVb‚cV\ZbZciYZaÉ]VW^iVi^dcYVchhdc^ci‚\gVa^i‚!NkZh 9Z@ZZghbVZ`ZgZihdc‚fj^eZbZiiZciaZjgZme‚g^ZcXZZiaZjgiVaZciVj hZgk^XZYZidjhkdhY‚h^gh ;^YƒaZ|hZh\d’ihZcY‚XdgVi^dc!NkZh9Z@ZZghbVZ`ZgegdedhZjcZigƒh WZaaZh‚g^ZYZi^hhjhZieVe^ZgheZ^cih#>aZhik^iZYZkZcjaZeajh\gVcY Y^hig^WjiZjg WZa\Z YZh i^hhjh YZ 8daZ[Vm  ;dlaZg! V^ch^ fjZ BVcjZa 8VcdkVh! CdW^a^h! 9Zh^\cZgh <j^aY! GVae] AVjgZc! E^ZggZ ;gZn! :IGD 6ggZYVbZcidZiHV]Xd=ZhhaZ^c½BV\c^ÒfjZ @ekhdƒ[ifehj[iekl[hj[iZ['*}'.$)&^

L[dZh[Z_*"iWc[Z_+[jZ_cWdY^[,ZƒY[cXh[(&&/$ L[dZh[Z_''"iWc[Z_'([jZ_cWdY^[')ZƒY[cXh[(&&/$ L[dZh[Z_'."iWc[Z_'/[jZ_cWdY^[(&ZƒY[cXh[(&&/$

NkZh9Z@ZZghbVZ`Zg A^cYZhigVVi(%V &,-*=VbbZ"BZgX]iZb I/%),*-%+))( lll#nY`#WZ ^c[d5nY`#WZ

6aae]did\gVe]nWnL^bGdWWZgZX]ih#EjWa^h]ZYWn`^cYeZgb^hh^dc# 8daZ[Vm;dlaZgVcYdi]ZgWgVcYhVgZgZ\^hiZgZYigVYZbVg`h#


Geo, Alex & Jacques Flamant


l’élégance La célèbre marque Flamant fêtera bientôt ses 25 ans d’existence… L’occasion de revenir sur une des marques belges les plus brillantes de la planète déco ! Alex Flamant nous raconte… QMarie Delloye

au naturel

Comment l’odyssée Flamant a-t-elle commencé ? Mes deux frères et moi avons créé la marque ensemble, cela fait bientôt 25 ans ! Beaucoup de choses se sont passé entre l’ouverture de la première boutique et l’exportation à l’étranger ! Notre père était antiquaire et il nous a transmis le goût des belles choses… À l’occasion des 25 ans, un très beau livre retrace les éléments phares de l’identité ”Flamant”. Quel est le ”style” Flamant ?

Quelle est la tendance ”Flamant” actuelle ? Il n’y a pas UNE tendance Flamant. Je pense qu’une maison évolue, change de décoration au fil des saisons, des périodes de la vie, des envies de chacun… Il y a quelques années, personne n’aurait peint son salon en autre chose que du blanc ou du beige, maintenant, la mode est aux couleurs plus flash, plus originales… Aujourd’hui, nous approchons de Noël, c’est le moment de l’opulence, il faut combler le côté un peu sinistre de la nature en privilégiant des tons plus ”chauds” comme le rouge ou l’orangé… On a plus tendance à transformer sa maison en véritable cocon de bien-être !

Lors de la création, notre critère premier est le bien-être, le confort qu’un tissu, une matière peut apporter. Notre première réflexion n’est pas basée sur l’esthétiChez Flamant, nous esque mais d’abord sur le sayons d’évoluer consconfort que les clients tamment, de créer de ”Il n’y a pas qu’un style doivent sentir directeconceptions. Flamant. C’est à chacun de nouvelles ment. Il ne faut jamais Nous sommes belges et oublier qu’une maison est issus d’un ”melting pot” l’interpréter...” faite pour qu’on y vive ! À très diversifié, c’est cette quoi cela sert-il si on ne variété que nous tâchons peut pas s’asseoir sur les canapés, ou poser un de représenter ! Je pense que nous avons su verre sur la table ! Notre père qui était antiquaire créer des produits intemporels qui portent la grifsavait garder l’équilibre entre la beauté d’un mofe ” Flamant ” parce qu’ils marquent les esprits… bilier précieux et le confort indispensable à une Ils sont réinterprétés par chacun différemment et famille nombreuse ! peuvent se retrouver dans des intérieurs très opposés ! Il y a évidemment une certaine harmonie Quels sont vos projets pour le futur ? dans nos collections, c’est cela qui détermine Nous nous tournons de plus en plus vers une utinotre style. lisation plus écologique des matériaux : bois recyclé ou plus vieux, peintures plus ”durables”,… Toutes les adresses sur: En ce qui concerne nos boutiques, nous avons beaucoup de projets en Europe et en dehors…



Contrastes 9jWaVcX!Yjcd^gZijcZY‚Xa^cV^hdc YZ\g^hZiYÉVg\ZciedjgaZÆeZehÆ

La lampe Vapeur d’Inga Sempé, home Autour du monde, 295€.

Telle une sculpture, Cosmic Leaf, une création de Ross Lovergrove pour Artémide.  02 534 03 67

 02 503 55 92

Idéal pour ne plus perdre ses clés, frost. 

Lafayette, un tapis d’Alexandre Champalimaud pour the rug CompAny, 670 €/m².  02 513 43 73

Le canapé et le pouf de la ligne Sumo de Xavier Lust, Cerruti BAleri. 

Opus, une bibliothèque librement composable à la verticale ou à l’horizontale, imaginée par Giuseppe Bavuso Rimadesio, Afilo.  02 534 49 99

Impression végétale pour un pouf carré signé missoni home.  02 374 04 40 Une serviette de bain très graphique, missoni home.  02 374 04 40


Le Place Sofa, un canapé dessiné par Jasper Morrisson, VitrA.  02 242 02 02

9ZXd ]dbZ Xdchjai^c\

JcZWZaaZegd\gZhh^dc 6egƒhhVeVgi^X^eVi^dcVjhVadc8dXddc'%%-!hVeg‚hZcXZ b‚Y^Vi^fjZ adgh YZ aɂb^hh^dc Xa‚ hjg edgiZ GIA"IK> Zc _j^c YZ XZiiZ Vcc‚Z! Hde]^Z 6hi‚g^dc! gZhedchVWaZ YZ aÉV\ZcXZ9ZXd=dbZ8dchjai^c\![V^ieVgi^ZYZhY‚XdgViZjgh fj^[dciaÉVXijVa^i‚#Cdjhaj^Vk^dchYÉV^aaZjghXdchVXg‚jc Vgi^XaZg‚YVXi^dccZaZcbVgh'%%.# Hde]^Z 6hi‚g^dc V Y‚X^Y‚ ZcigZ '%%, Zi '%%- YZ Xg‚Zg jcZV\ZcXZYZXdchZ^ahfj^egdedhZjcXdcXZeiY^[[‚gZci g‚XdbeZch‚ eVg aV G‚\^dc LVaadccZ edjg aZ XVgVXiƒgZ ^ccdkVci YZ hdc VXi^k^i‚# :c XdaaVWdgVi^dc VkZX jc VgX]^iZXiZ YÉ^ci‚g^Zjg! ZaaZ bZi hdc iVaZci YZ Y‚XdgVig^XZ YÉ^ci‚g^ZjgZihdchVkd^g"[V^gZ|kdigZhZgk^XZ# HZhdW_ZXi^[h Kdjh XdchZ^aaZg Z[ÒXVXZbZci YVch kdh egd_Zih YZ Y‚XdgVi^dc#  :aaZ Y^hedhZ Zi VhhZbWaZ bdW^a^Zgh! i^hhjh! gZk„iZbZcih! bVi^ƒgZh! XdjaZjgh edjg Vgg^kZg | g‚Va^hZg! igVch[dgbZg! Vb‚cV\Zg Zi g‚cdkZg kdh egd_Zih Zc idjiZ h‚g‚c^i‚ZiZc[dcXi^dcYZkdh\d’ihZiYZkdhZck^Zh# :c X]ZgX]Vci kdh [djgc^hhZjgh hjg aZ bVgX]‚ YZ aV Y‚XdgVi^dc!ZaaZkdjh[V^i\V\cZgYjiZbehZiYZaÉVg\Zci \g}XZ|hdcigVkV^aYZXdjgiV\ZeVgXZfjÉZaaZc‚\dX^Zedjg kdjh jcZ g‚YjXi^dc hjg YZk^h eajh ^bedgiVciZ fjZ XZaaZ fjZkdjhVjg^ZoejdWiZc^g# :aaZ kdjh hdjaV\Z YÉjc ‚cdgbZ igVkV^a Zc Vbdci Zi kdjh VeedgiZYZhhdaji^dchY‚XdgVi^kZh‚iVeZeVg‚iVeZ#

9:8D=DB:8DCHJAI>C< Hde]^Z6hi‚g^dc &%9gƒkZYZhEdbb^Zgh! 7"&(-%D]V^c!7Za\^jb BdW^aZ/ ('%).)&''*'' ;Vm/ ('%'(*(%()- bV^a/hde]^Z#VhiZg^dc5h`ncZi#WZ lll#YZXd]dbZXdchjai^c\#Xdb



le feu

AVXdjaZjgcÉVeVhY^ihdcYZgc^Zgbdi#8i‚ bdW^a^Zg!eZ^cijgZdjajb^cV^gZh!b„bZXdbWVi

Le Soleil signé Vicente Garcia Jimenez, FoscaRini.  Spacecake, un pouf au nom évocateur dessiné par Theuns Fleskens, Home autouR du monde, 295€.  02 503 55 92

Ambiance Room on Fire, le rouge des passions intenses, par Véronique Branquinho, LeVis.  0800 24 111 Clouds, un concept dynamique imaginé par Ronan et Erwan Bouroullec, Ligne Roset et KwadRat. 

Un coussin décoratif, Habitat. 

Le canapé Alcove sofa, une invitation à la quiétude, VitRa.  02 242 02 02 Pouf, fauteuil, canapé… L’embarras du choix avec Pumpkin, une réédition qui rend hommage à Pierre Paulin, Ligne Roset. 


Philippe LESCRENIER r ue de namur, 48 1000 bruxelles tel 02 511 37 18 fax 02 512 41 33 i n f o @ l e s c ren i m

L’architecture verte, kjef_[ekhƒWb_jƒ

AZhXdchigjXi^dchW^dXa^bVi^fjZhZiaZh]VW^iVi^dch eVhh^kZheg‚dXXjeZciaZhcdjkZVjmegdeg^‚iV^gZh#H^aZ XdcXZei[V^iXdjaZgaÉZcXgZ!^aZhiZcXdgZigƒh[adjYVch aÉZheg^iYZhc‚de]niZh!b„bZhÉ^aeZgbZiYZg‚Va^hZg YÉ^bedgiVciZh‚Xdcdb^ZhYɂcZg\^Zh#AÉ^ckZhi^hhZbZciYZ Y‚eVgiZhicVijgZaaZbZci|egZcYgZZcXdbeiZ# n Magali Eylenbosch

Attention à ne pas confondre maison passive et habitat bioclimatique. Ce dernier tire principalement profit du rayonnement solaire pour réduire les besoins énergétiques. L’orientation des fenêtres et le choix des matériaux y sont prépondérants. Dans le cas d’une maison passive, les pertes de chaleur sont fortement limitées grâce à une isolation spécifique et à un système de récupération de l’énergie thermique de l’air (ventilation à double flux).

Aujourd’hui, on se trouve devant la nécessité de bâtir mieux. Pourtant, il suffit de jeter un petit coup d’œil aux nouvelles constructions qui fleurissent encore dans nos régions pour constater qu’il y a encore du chemin à faire. Nous avons posé quelques questions fondamentales à l’architecte de maisons passives, François Guerriat.

Les maisons passives sont-elles forcément plus chères ? Si oui, quelle en est la raison ? L’investissement de base est naturellement plus élevé. Le surcoût est dû à des fondations plus épaisses et à une isolation particulièrement efficace. Le coût du label est aussi à prendre en compte si on tient à ce qu’elle soit certifiée “ maison passive ”. Pensez-vous que le prix pourrait devenir plus accessible dans l’avenir ? Ces maisons ne sont plus construites aujourd’hui comme il y a cinq ans. La technologie avance. Cela dit, il n’y a pas de différence significative au niveau du prix. Il pourrait éventuellement diminuer un peu s’il y a vulgarisation du concept. On parle beaucoup de maisons passives et bioclimatiques. Dans quelle mesure le concept a-t-il déteint sur la manière de construire et de rénover actuellement ? À l’heure actuelle, la clientèle est encore microcosmique. Le secteur de la construction n’a pas encore beaucoup évolué. Par contre, les fabricants de matériaux font partie du public averti. Et ça, ça peut tout changer. En dehors du prix y a-t-il d’autres obstacles qui gênent la généralisation de ces maisons ? Il n’y a pas encore suffisamment de prises de conscience dans le domaine du bâtiment. Le sujet est encore tabou. Les gens ont des appréhensions parce qu’ils ne savent pas à quoi s’attendre. On demande très fréquemment si on peut ouvrir une fenêtre dans une maison passive. La réponse est naturellement affirmative. Les candidats bâtisseurs ont la possibilité de visiter ce type de maison les week-ends et de venir à bout de leurs aprioris. Les taxes énergétiques constituent une part non négligeable des recettes de l’Etat.

Reste-t-il toujours favorable à ce type de constructions ? Le discours des ministres est assez encourageant mais les incitants sont encore timides. L’Etat a supprimé les primes, très avantageuses, sur les panneaux photovoltaïques car l’isolation est beaucoup plus importante. Les maisons passives bénéficient de réductions fiscales : d’une part, la TVA est ramenée à 6%, et d’autre part, une prime de 6 500 ` est versée si la maison est certifiée “ passive ”. Une réduction est également octroyée sur 50 000 euros jusqu’en mars 2010. La rénovation, quant à elle, profite déjà d’une réduction de la TVA à 6%. Trouvez-vous que ce type de construction est suffisamment encouragé ? Non ! En Wallonie, le public est peu ou mal informé. Une maison passive fait peur et les clients sont difficiles à convaincre. La maison à basse énergie est beaucoup plus facilement acceptée et c’est celle qui rencontre le plus beau succès. Est-ce que la construction de ces habitats a souffert de la crise ? La crise n’a pas été ressentie en 2008, elle l’a été légèrement en 2009, et je pense qu’elle le sera fort en 2010. Et sur le plan international… L’Allemagne et l’Autriche sont de véritables références en ce domaine. La Belgique, comme la France d’ailleurs, se mobilise bien par rapport aux pays limitrophes. L’Espagne et l’Italie travaillent sur ce genre de concepts, mais leurs constructions diffèrent quelque peu des nôtres parce que les problèmes de chaleur sont beaucoup plus importants. L’expression “ matériaux écologiques ” sous-entend matériaux naturels et recyclables, dont le processus de fabrication et de commercialisation est peu énergivore et n’a qu’un faible impact sur l’environnement. Nous avons rencon-

tré Vincent Streel, fournisseur de matériaux écologiques et fondateur de l’entreprise Eco-Logis. Vous êtes à la tête d’un magasin et une entreprise de construction. Qu’est-ce qui vous a incité à vous lancer dans ce genre de concept ? J’ai commencé à bâtir des maisons de paille et d’argile en 1992 en Alsace. À l’époque, en Belgique, on ne parlait pas encore de constructions écologiques. Les contacts que j’avais ici ne me permettant pas de continuer dans le domaine, je m’étais lancé dans l’alimentation bio. Ensuite, j’ai ouvert l’entreprise Éco-Logis. Il n’est pas envisageable pour moi de travailler avec des matériaux non écologiques. Les pays scandinaves et germaniques, qui sont les pionniers en la matière, m’ont permis d’acquérir des connaissances plus théoriques pour compléter l’expérience que j’avais déjà acquise sur le terrain. À l’heure actuelle, entre prix attractifs et matériaux écologiques, qu’est-ce qui prime pour la majorité des clients ? Les démarches diffèrent fortement. Il est important de savoir que l’aspect prix est indissociable de la performance. Certaines personnes sont rebutées par la différence de coût, mais en réalité celle-ci est amortie dans le temps. L’utilisation de ce type de matériaux est économiquement plus intéressante sur la longueur. Il s’adresse à une clientèle qui privilégie l’aspect écologique et l’incidence sur la santé. Quelle évolution avez-vous pu constater en Belgique dans le domaine de la construction et de la rénovation ? Ceux que la démarche intéresse se posent de plus en plus de questions. Il est déplorable de constater que de nombreux bâtisseurs émettent des jugements erronés, simplement parce qu’ils ne maîtrisent pas le sujet.



L’architecture verte,



BÊ;Ye#>Žj[bIfWBW=hƒ[Z[iBWdZ[i Depuis 50 ans, un véritable contrat lie Yves Rocher au végétal à travers la Cosmétique Végétale®. Aujourd’hui, un pas de plus a été franchi. Ce sont ces mêmes principes, inscrits dans l’ADN de la marque qui animent la Grée des Landes. Tout y a été pensé en cohérence, pour faire vivre aux hôtes une relations privilégiée avec la nature, dans un habitat sain et un environnement préservé, sur la commune même de la Gacilly, berceau d’Yves Rocher.

Prendre et donner Pensé comme un écosystème, l’Eco-Hôtel Spa est un maillon en relation avec tous les éléments environnants. Créer un lien positif entre l’homme et la nature en est l’ambition.

La Grée des Landes a pour vocation de montrer qu’on peut arrêter de prendre sans rendre, qu’on peut développer un lieu de bien-être, autrement, durablement, amoureusement pour la nature. Pendant notre séjour, symboliquement nous avons eu l’occasion de planter un arbre. Un petit pas pour remercier le lieu de ce qu’il nous a offert… une impression d’intense sérénité.

Un lieu qui respecte l’équilibre de notre planète Ici, le mot Terre s’écrit avec une majuscule. Sur un site exceptionnel de 10 hectares, un immense projet vient de germer. Une isolation végétale…

L’ensemble des 29 chambres est couvert de toits végétalisés : en été, ils protègent des rayons directs du soleil, en hiver, ils limitent les pertes de chaleur. Toute l’année, ils sont une source importante d’économies d’énergies. Sans compter qu’en absorbant les ondes sonores, ils constituent un excellent isolant acoustique. Un chauffage géré durablement… Deux chaudières à bois, alimentées par des plaquettes de bois (élagage, défrichage) de la forêt voisine de Brocéliande, alimentent en chaleur l’ensemble des lieux, en fonction des besoins et des saisons. Une serre concentre les principes fondamentaux de l’architecture bioclimatique : elle capte, stocke et distribue le rayonnement solaire, diminuant ainsi de 15 % à 30 % les besoins de chauffage. 35 m² de panneaux solaires thermiques assurent le préchauffage de l’eau chaude. Une pompe à chaleur se charge de déshumidifier le spa et diminue ses besoins en énergie. Des matériaux de « Haute Qualité Environnementale »… On a utilisé de la Thermopierre syporex, recyclable et parfaitement isolante, pour les murs de la cuisine, du restaurant et du lounge. Le chanvre, matériau naturel isolant, choisi pour ses performances thermiques, a été utilisé dans les chambres et les lieux de restauration. On a préféré une installation Internet par réseau filaire (et non par WiFi) dans chaque chambre, pour éviter tout désagrément éventuel lié aux ondes. La Grée des Landes a pour objectif à court



U n habit h aute c outure pour votre piscine

Couverture de séCurité pour pisCine

E cologique

Alimentée à l’énergie solaire, empêchant l’intrusion d’impuretés et limitant les pertes calorifiques, la couverture COVERSEAL participe activement à la protection de votre environnement.

E sthétique

Unique au monde, le système de verrouillage de la couverture COVERSEAL vous garantit un esthétisme surprenant ainsi qu’une eau limpide.

S écurité

Verrouillée de manière homogène et supportant le poids de plusieurs personnes en même temps, la couverture COVERSEAL protège votre piscine toute l’année.

+32 (2) 367 10 80



L’architecture verte,

terme d’inciter chaque visiteur à compenser les émissions carbone générées par son séjour.

Mais aussi… Matelas et sommiers sont certifiés bio. Idem pour les couettes et oreillers en coton bio. Les parquets et lambris en chêne sont traités sans solvant et, pour préserver la qualité de l’air, les peintures des chambres sont minérales et n’émettent pas de composés organiques volatils (COV). Ici on privilégie l’éclairage basse consommation et l’alimentation électrique est assujettie au besoin de de la chambre. L’orientation sud-ouest des baies vitrées permet d’optimiser les apports en lumière naturelle. La robinetterie et les appareils sanitaires sont munis de mitigeurs thermostatiques. Le réglage de la pression et de la température de l’eau sont immédiats et diminuent donc la consommation. Sans réduire la pression de l’eau et le confort du jet, l’éco-douchette à mousseur intégré limite le débit de l’eau à 12 litres par minute au lieu des 20 litres habituels. Son secret : elle ajoute de l’air à l’eau. Des eaux naturellement filtrées… Un jardin planté de roseaux filtre la totalité des eaux usées. Pour minimiser l’usage du chlore, l’eau du bassin de relaxation du Spa est pré-traitée par UV. Après utilisation, elle est déchlorée par un système naturel de filtration avant d’être réutilisée pour les chasses d’eau des chambres.

Flore et faune préservées… La Grée des Landes est labellisée Refuge LPO – Jardins d’oiseaux conventionné. Des nichoirs ont été aménagés dans les murs pour accueillir les mésanges et martinets, et quelques arbres morts sont préservés pour servir de refuge, de nid ou de garde-manger aux animaux et aux insectes. L’eau de pluie, récupérée depuis les toits, puis stockée dans le bassin à orage, assure l’arrosage des jardins et l’entretien des terrasses extérieures. 85.000 litres d’eau seront ainsi économisés chaque année. Une fois la voiture garée, bicyclette et navette sont proposées. Curieusement, la Grée des Landes n’a rien d’un lieu uniquement destiné aux acharnés du vert ou aux activistes de Greenpeace. C’est une magnifique destination de détente qui prouve qu’on peut agir, militer pour un meilleur environnement et préserver notre planète, sans faire l’impasse sur le confort et le plaisir. Avoir testé l’endroit nous permet d’affirmer que rarement nous nous sommes sentis aussi détendus et en phase avec la nature. Du pur bonheur !

Infos et réservations : T : 0033 2 99 08 50 50

Eco-habiter, le dictionnaire de l’habitat efficace Cendrine Dominguez, Hachette Pratique Un dictionnaire de la maison saine et éco-respectueuse. Habiter écologique est aujourd’hui une réalité facile à mettre en œuvre. Cet ouvrage permet de découvrir toutes les astuces qui vous feront faire d’importantes économies d’énergie, tout en respectant l’environnement. L’écologie à portée de main… C’est ce qu’il nous faut!



Rue Hôtel des Monnaies 82-86 1060 Bruxelles

02. 538 15 61 Ouvert du lundi au vendredi de 8h00 à 18h00 et le samedi de 9h00 à 16h00


Leur objet

fétiche Créateurs, designers, galeristes nous ont ouvert la porte de leurs univers et nous ont présenté leur objet fétiche. QMagali Eylenbosch

LE ROBOT D’OLIVIER GILSON Forts de 15 ans d’expérience, Olivier Gilson et Olivier Berghmans sont les fondateurs de L’Agence, un studio spécialisé en analyse, création et développement de projets d’architecture d’intérieur, de design et de scénographie. Parallèlement, ils sont aussi à l’origine de projets plus conceptuels, d’installations et d’objets édités en série limitée. Ils ont récemment participé à l’événement Second Hand Second Life, organisé par Les Petits Riens. Olivier Gilson a une belle collection de robots. Il aime le côté futuriste de l’objet, parce qu’il représente l’évolution. Il estime que le robot fait partie intégrante du monde du design. Il y a une évolution des formes et des lignes. Celui-ci est l’un des premiers qu’il a acquis. C’est un jouet pour enfant. Avant, il avançait tout seul et amenait des verres. Aujourd’hui, sa fonction est uniquement décorative. Olivier revendique d’ailleurs son inutilité ! Il a aussi un faible pour les créations contemporaines et il est à la base du Dynamo Belgian Young Design Awards, une compétition de design belge organisée par l’asbl Designed in Brussels. Il aime faire savoir que les jeunes créateurs ont un potentiel qui mérite d’être exploité. Ils sont aussi beaucoup plus sensibles aux incidences écologiques de leur travail.



LE SUMO DE JEAN PAUL KNOTT Depuis juin dernier, Jean Paul Knott, l’un de nos créateurs préférés n’est plus le directeur artistique de Cerruti. Un souhait personnel. Loin de se reposer sur ses lauriers, il a ouvert une nouvelle boutique éphémère, Knott shop, 19 rue Lebeau. Il y propose ses collections et ses coups de cœur. Mais c’est dans son espace-galerie au 20 boulevard Barthélemy, où il expose, tous les deux mois, des artistes qui l’interpellent, que nous l’avons rencontré et photographié. Il voulait nous montrer un fauteuil, imaginé par le designer belge, Xavier Lust. Ce Sumo (c’est son nom), décliné en cuir blanc, lui a été offert par Jullian Cerruti, fils de Nino, qui a racheté une société italienne de design, Baleri ( Jean Paul raconte : ”J’avais prêté l’espace à Julian pour qu’il puisse exposer quelques pièces pendant le Designers Week-end, il voulait me remercier. J’adore ce fauteuil, ses formes et ses courbes”. Côté déco, Jean Paul aime particulièrement Knoll, Le Corbusier et Jean Prouvé, mais fidèle à lui-même, il ose avouer : ”J’ai du mal à posséder des choses. On s’y attache et on a peur de les perdre. Quand c’est un cadeau, naturellement, c’est bien. Mais je préfère que les gens que j’aime possèdent de beaux objets dont, finalement, je profite aussi”.

Après Paris et New York, Yael Landman, créatrice de lingerie fine, a reposé ses valises à Bruxelles où elle s’active sur une collection éponyme. Lorsque nous sommes arrivés chez elle, dépitée, elle nous a montré une bougie Chantal Thomass, éditée il y a une bonne dizaine d’années par Point à la Ligne. Elle venait tout juste de la casser ! ”C’est ma mère qui m’a offert cette bougie parce que, déjà toute jeune, j’adorais la lingerie. J’y tenais beaucoup. Chantal Thomass est l’une des créatrices qui m’a donné l’envie de me lancer dans cette aventure. Je constate qu’à force de déménager, je finis par casser chaque fois quelque chose ! J’avais aussi une très belle tête de Serge Gainsbourg qui a subi le même sort.” Yael aime les bougies, pour l’ambiance qu’elles dégagent, mais selon elle, ce sont ses livres qui font son intérieur. ”J’en achète toujours plus et ils me sont indispensables.” Côté mobilier, elle privilégie les valeurs sûres avec des noms comme Le Corbusier ou Eames. ”Mes deux clubs, je ne m’en séparerais pour rien au monde.”

LE FAUTEUIL ŒUF DE PILI COLLADO Pili Collado, créatrice de la marque de bijoux Les Précieuses nous a reçus dans sa charmante maison uccloise. Le décor ressemble totalement à ce qu’on imaginait : confortable et poétique. ”J’adore les animaux empaillés. J’ai trouvé ce paon chez Deyrolle à Paris. C’est l’un des taxidermistes les plus réputés. La boutique est un véritable cabinet de curiosités. Par contre, je déteste les gadgets !” Dans la salle à manger, les Wooden Dolls, créées par Alexander Girard et éditées par Vitra trônent sur la cheminée. ”Elles sont magnifiques ! J’aime le contraste entre leur côté naïf et la personnalité un petit peu austère de celui qui les a créées.” Et puis, il y a le fauteuil suspendu au plafond dans lequel elle aime se lover et dans lequel elle a posé. ”Je l’ai cherché longtemps et j’ai fini par le commander chez l’éditeur en Italie. Mon fils et moi, nous nous y installions souvent ensemble quand il était un peu plus petit. Maintenant, ça devient plus compliqué !” (Rire) Pili ne fait pas partie des acheteuses compulsives. ”Je choisis les objets qui m’entourent. J’aime beaucoup les chandeliers de moooi. Et puis, je rêve d’acquérir une Porsche blanche des années 70. Le budget n’est pas totalement indécent, parce qu’il s’agit d’un ancien modèle. Mon fils et moi avons beaucoup cherché pour la trouver et puis, j’ai décidé de reporter un peu ce projet. Mais pas question d’y renoncer !”

LA « CHEMINÉE-MIROIR » D’ISABELLE LENFANT Isabelle Lenfant ”matérialise” ses pensées et les transforme en bijoux qui racontent une histoire, délivrent un message, portent des noms évocateurs comme Toi et Moi, Morsure Secrète, Passeport Nocturne,... L’argent a toujours été sa matière de prédilection, mais l’or et les pierres s’imposent aussi dans un travail subtil et fort. Elle a failli se faire photographier avec une horloge qui donne l’heure sur 8 jours au lieu de sept, mais a finalement choisi de poser devant sa ”cheminée-miroir”. C’est elle qui, patiemment, a cassé les miroirs et a recollé les morceaux. ”Je n’ai pas peur de casser un miroir quand je le fais volontairement. Sylvia Plath, un écrivain américain, a écrit de très belles choses sur eux. Il faudrait que je retrouve l’un de ses poèmes. Il ne faut jamais rougir en se regardant dans un miroir !” Dans son univers, il y a de très belles pièces datant des années 50-60 et aussi une armoire de pharmacie qu’elle a payé 100 € à l’époque. ”Quand je l’ai trouvée, personne n’en voulait !” Et puis, quelques grands noms la séduisent : Le Corbusier et Mies van der Rohe. ”Aujourd’hui, je ne chine plus. Par contre, mes parents le font pour moi. Ils me connaissent bien et quand je leur dit ce que je cherche, ils finissent toujours par trouver !”

LA COIFFEUSE DE BETTY DE STEFANO Collectors Gallery, la boutique de Betty de Stefano, installée dans le tournant de la rue Lebeau, au numéro 17, fait partie des rendezvous incontournables du Sablon. Passionnée par les designers de bijoux du 20ème siècle, elle y propose les créations en argent signées Georg Jensen ou de magnifiques pièces vintage, notamment griffées Chanel, Schiaparelli, Nina Ricci ou Yves Saint Laurent. Elle a craqué pour une coiffeuse des années 70 qui s’ouvre ou se referme et adopte la forme d’un cylindre. Cette pièce collait parfaitement à l’atmosphère du magasin. ”Je l’ai achetée chez un antiquaire bruxellois qui vend des objets du 20ème siècle. Je l’ai trouvée décalée, sans prétention, très humoristique et accueillante. Elle résume notre état d’esprit et séduit aussi bien les enfants que les messieurs qui, souvent, s’y installent pendant que madame fait son choix”. Quand on lui demande quels sont ses goûts en matière de décoration, elle répond : ”Je vis dans un loft. La décoration est très dépouillée, voire minimaliste. J’ai quelques beaux meubles vintage des années 60-70 que je mélange à des objets plus contemporains. J’aime que chaque pièce soit mise en valeur. Ça n’empêche pas la convivialité ! J’ai un énorme sofa qui peut accueillir entre douze et quatorze personnes”.




pour une nuit propre et saine



nettoyage à sec biologique sans produits chimiques réduit les allergies service fourni à la maison matelas disponible immédiatement

Faites nettoyer votre matelas, pour votre hygiène et une réduction des allergies


CleanDream bvba


Avenue Louise 209A 1050 Bruxelles Tél.: 0474. 38 25 03

A VOUS DE JOUER ! C’est le moment de tester vos connaissances de la marque Bensimon ! Répondez sans tarder à ces trois questions. Le(a) premièr(e) qui envoie ses réponses justes à,


dans les boutiques Autour du Monde de Bensimon !

BRUXELLES 1000 70 rue de Namur Tél. : 00 32 2 503 55 92

1. Où est née la première boutique Autour du Monde ? • A Paris, 12 rue des Francs Bourgeois

• A Bordeaux, 1 rue de Grassi • A Bruxelles 70 rue de Namur 2. Depuis quand la tennis Bensimon existe-t-elle ? • 50 ans • 30 ans • 25 ans 3. La Boutique Autour du Monde à Paris a fêté ses • 10 ans • 15 ans • 20 ans


Place du Jeu de Balle bonne ou mauvaise


Les aficionados de la chine se retrouvent régulièrement sur la place du Jeu de Balle, dans le quartier des Marolles, à Bruxelles. Depuis plus de 100 ans, tous les matins de 6h à 14h, les marchands y exposent, à même le sol, parmi pas mal de “brol”, quelques trésors. La chine est un art proche de la chasse ! QMagali Eylenbosch


Avec ses boutiques, ses cafés et surtout ses brocanteurs, les Marolles, bruyantes et truculentes, attirent touristes et autochtones. Peut-on encore y dénicher l’objet rare et convoité à un prix raisonnable ? Peut-on dissocier le vrai du faux ? Nombreux sont ceux qui se posent ces questions. La place du Jeu de balle, sur laquelle se tient chaque jour le ”Vieux Marché”, ne désemplit pas le week-end. La semaine, parmi un public en quête d’une bonne affaire, se glisse l’un ou l’autre connaisseur. Il n’est pas exceptionnel de retrouver un objet, un peu plus tard, quelques centaines de mètres plus loin, chez un antiquaire du quartier. Le prix a naturellement, d’un coup d’un seul, été multiplié par deux ou par dix.

QUE PEUT-ON DÉNICHER ? Tout et parfois n’importe quoi. Il faut de la patience et surtout, à défaut d’être spécialiste dans un domaine, avoir du ”nez”. Les uns partent avec une idée précise en tête. Ils cherchent un fauteuil, du linge de maison, un service de table ou un renard empaillé. Les autres fouillent et achètent au gré de leurs coups de cœur. Il n’y a pas de bonne ou mauvaise recette ! Il faut naturellement savoir repérer les signatures recherchées sur les tableaux, vases et autres objets. Mais attention, les faux sont légion. Pensez avant tout à vous faire plaisir mais n’attendez pas les miracles, ils sont de plus en plus rares. Un antiquaire nous a confié : ”Vous aurez probablement plus de chance de trouver votre bonheur si vous êtes ama-

teurs d’objets datant de la deuxième moitié du 20ème siècle. Et les prix sont encore abordables. Cela dit, cette période rencontre actuellement son public et certaines pièces sont déjà très prisées.” Chaque semaine, il y a de nouveaux arrivages de chapeaux, boutons, bobines de fil, vieux manteaux et autres accessoires qui font le bonheur des ”modeuses” averties et, côté jouets ou vaisselle, on fait encore quelques trouvailles sympas.

LES MEILLEURS MOMENTS Incontestablement, on négocie plus facilement les prix en semaine. Le week-end, les marchands, trop sollicités, ne prennent même plus le temps de sacrifier à la tradition du marchandage. Tôt le matin, les plus belles pièces n’ont pas encore toutes été repérées par les antiquaires et vers 14 h, certains vendeurs rechignent à remballer. Voilà qui nous ouvre quelques horizons.

LE JUSTE PRIX Il y a une véritable philosophie de la chine. Le marchandage fait partie des us et coutumes, mais il faut maîtriser l’exercice. Le mariage ”vison – Louis Vuitton” risque de vous porter ombrage. Le look ”jean et pull irlandais” rend incontestablement mieux. Si vous faites partie des kamikazes, osez proposer la moitié du prix annoncé, mais vous risquez de vexer en insinuant qu’on tente de vous voler. Plus raisonnable, proposez un rabais de 20 % et si vous persuadez le vendeur de lâcher prise en concédant 10 ou 15 % de réduction, dites-vous que la vie est belle !




excentriques pour balades tape-à-l’oeil Si la frugalité, la sagesse et la discrétion ne font pas partie de votre vocabulaire, alors optez pour un de ces tousterrains. Exubérance garantie ! QPierre-Benoît Sepulchre

JEEP GRAND CHEROKEE SRT-8 Ce 4x4 yankee fait lui aussi appel à une grosse pointure sous son capot : un V8 de 6,1 litres qui crache ses 425 ch dans un délicieux vrombissement. Et avec ses 569 Nm de couple, il propulse la Jeep à 100 km/h en moins de 5 secondes et avec une aisance déconcertante. Ce modèle est équipé d’étriers Brembo Performance à quatre pistons qui garantissent un freinage efficace et endurant. Cette version SRT se distingue par sa double sortie d’échappement chromée, son bouclier avant spécifique, des bas de caisse latéraux, une croupe plus massive et des jantes en aluminium forgé de 20 pouces. A l’intérieur, le style compte autant que la puissance avec des inserts en aluminium qui soulignent le tableau de bord, le sélecteur de boîte de vitesses ainsi que la console centrale.

PORSCHE CAYENNE TURBO S Avec son V8 4,5 biturbo de 550 ch qui développe un couple titanesque de 750 Nm, le Cayenne Turbo S fait partie du club très confidentiel des SUV de plus de 500 ch. Les performances sont bien entendu à l’avenant et combleront tous les Fangio en quête de sensations. Il faut dire que cette Porsche est en mesure de croiser à plus de 280 km/h tandis qu’elle écrase le 0 à 100 km/h en 4,8 secondes. Des performances extraordinaires pour un gros 4x4, qui lui permettent d’aller chasser n’importe quelle sportive sur autoroute. Très branchée ”techno”, Porsche propose une direction assistée qui s’adapte à la vitesse, une suspension active (PASM) ou encore un contrôle dynamique du châssis (PDCC). Et pour freiner les ardeurs de la bête, vous pourrez opter pour des freins en céramique avec des disques de 410 mm à l’avant et de 370 mm à l’arrière. Notez qu’avec ses jantes de 21 pouces et ses quatre sorties d’échappement, il est impossible de passer inaperçu !




type au sa d’un proto Pekinge rm fo la D8 sous Présenté rs 2008, le À ève en ma rsonne indifférent. n e G e d e lon p é p s u is un co é ’avait la de luxe et V to-Paris n U S xer n u e entr it comple mi-chemin 4 hollandais devra X6, W M x B 4 autres t e sportif, le e n ian c e he Cay it le spé les Porsc it, Spyker s’est fa la e d t sa nce e car on le de l’éléga s, le petit t, n e m e n ffi aine liste du ra lques sem production Il y a que . la é it it a iv rt rm o fi p n s u co ur batave précieux d constructe nant les matériaux o g ta n a pre portes s e s du D8, re e e u d q d’un V8 ar ainsi concept-c le capot, on parle . M.. us de chez G nistes. So roviendrait p i u q h c 564 www.spyk

MERCEDES-BENZ ML 63 AMG 4MATIC La recette qui a été privilégiée pour le ML AMG est un gros moteur atmosphérique, qui est donc dénué de toute suralimentation. Le V8 de 6,3 litres développé par AMG génère 510 ch pour un couple titanesque de 630 Nm ! Les reprises sont donc du meilleur tonneau, même à bas régimes tandis qu’il fait preuve d’une élasticité extraordinaire dans toutes les circonstances. Le tempérament sportif du modèle se manifeste par des accélérations vives tandis que sa maniabilité est tout bonnement bluffante pour un SUV de 2,3 tonnes. Les performances n’ont quant à elles rien à envier à celles d’une sportive puisqu’il ne faut au ML que 5 petites secondes pour atteindre les 100 km/h, le tout au son d’un râle caverneux qui vous invite à pousser la pédale d’accélérateur encore plus profondément. Un jeu qui se révèle très coûteux quand il s’agit de passer à la pompe...

BMW X6 M Par les temps qui courent, le nouveau X6 M (tout comme son frère le X5 M) fait figure d’ultime représentant d’un genre automobile qui est appelé à disparaître. Voyant, encombrant, gourmand et surpuissant, c’est l’expression même du m’as-tu-vu, l’engin parfait pour tout conducteur en quête d’esbroufe. Ce SUV sculptural, dessiné par le belge Pierre Leclercq, se contente d’un ”modeste” V8 de 4,4 litres, gavé par deux turbocompresseurs qui font grimper la puissance du moteur à 555 ch ! Le tout est transmis aux quatre roues par une boîte automatique séquentielle à 6 rapports doublée d’une version optimisée de la transmission intégrale xDrive. Résultat : le 0 à 100 km/h est pulvérisé en 4,7 secondes, soit mieux qu’une M3 de précédente génération, tandis que la vitesse maximale est plafonnée à 250 km/h. Pas mal quand on pèse près de 2,5 tonnes!


Un coin d’Angleterre sur

LAND ROVER WAVRE Chaussée de Namur, 240 1300 WAVRE Tel. 010-45 05 65

r les hauteurs de Wavre

JAGUAR WAVRE Chaussée de Namur, 240 1300 WAVRE Tel. 010-45 05 65

09129 •

Commercialisation début septembre




pas ce o XC60 n’a ir se lv o V e s u uvo valeure n pour po Certes, la le pantalo présentés dans s n a d t u qu’il fa ’assaut iux chars d git de se fa mesurer a f. Mais quand il s’a tient tout rati R-Design ce compa us la version r, e u aux superfl rq a re rem , les chev a n n o o is , ra e a u p m niq à fait la co moins ! Côté méca et à une en sportives et le CO 2 st pensions s u s s . Mais c’e e d droit à et incisive il, te e c o e l’ ir s d n a s plu pera d direction ui vous ta urs, q e r is u v e o ri tr té x ré surtout l’e velles coques de en nou garnitures avec de les et des ep ra p té a h la c s re rtie d’é o s le des moulu b u o te les jan s qu’une d era aussi v alu, ainsi lè re un O mée. en 20 po ment chro être commandées es h c u to es nt qui peuve acle dominé par d lore. o it b ic a ir b ces et l’h uperbe cu m et un s d’aluminiu /be www.volv

INFINITI FX50S Par rapport à la concurrence, l’Infiniti FX en impose. Par son design bien entendu, avec son toit bas, son long capot et les multiples vagues qui soulignent la silhouette de la japonaise, mais aussi grâce au V8 de 5,0 litres qui se cache sous son capot. Afin d’abaisser le centre de gravité de la voiture, le moteur a été placé le plus bas possible, comme dans toute sportive qui se respecte. Avec ses 390 ch, il pousse sans broncher jusqu’à 250 km/h tandis qu’il abat le 0 à 100 km/ h en 5,8 secondes. Et grâce à une transmission intégrale intelligente baptisée ATTESA E-TS, qui ajuste en permanence la distribution du couple entre l’avant et l’arrière, les sensations sportives sont préservées à tout instant. Et en bonne Infiniti, on demeure pantois face à la richesse de l’équipement et au luxe qui règne à bord. Seules deux options sont au catalogue : la peinture métallisée et une roue de secours temporaire. Tout le reste est de série !



Face aux grosses pointures allemandes, le Range Rover Sport a un peu de mal à s’imposer. Malgré ses excellentes prestations, il conserve une réputation plus conservatrice que ses compères, et ce, bien malgré lui. Land Rover a donc décidé de lui faire subir une petite cure de tuning sous la forme d’une série limitée Autobiography. A l’extérieur, on note une nouvelle face avant nettement plus sportive, d’énormes jantes de 20 pouces à facettes ou encore de généreuses prises d’air par-ci par-là. A l’intérieur, c’est carrément Byzance avec une sélection de six thèmes différents, comprenant notamment des intérieurs tout cuir en deux teintes. Pour ce qui est du moteur, on retiendra le fabuleux V8 5,0 litres Supercharged qui développe 510 ch et 625 Nm de couple. Emmené par une telle cavalerie, le Range Sport devient le roi du bitume, tout en conservant des aptitudes exceptionnelles en tout-terrain.


Véhicule illustré avec option.

ALHAMBRA ULTIMATE EDITION Alhambra 1.9 l TDI - 115 ch : `


Si vous avez droit à l’Ecobonus*



` 20.990

EQUIPEMENT INCLUS: Climatisation Climatronic · Radio-CD-MP3 avec 10 Haut Parleurs · Jantes aluminium 16’’ · Feux antibrouillard avant · 6 airbags · ABS, ESP

· Assistance parking avant et arrière · Ordinateur de bord et régulateur de vitesse · Vitres électriques et verrouillage central · 6 vitesses · Vitres arrières assombries …

:b^hh^dcbdnZccZYZ8D'/&,'\$`b™8dchdbbVi^dcbdnZccZ/+!*a$&%%`b#Eg^mcZiIK68kVaVWaZhVj'%$&%$%.#D[[gZkVaVWaZ_jhfj¼Vj(%$&&$'%%.# Si immatriculation avant 31/12/2009. *Ecobonus : prime pour la reprise de votre véhicule hors d’usage, immatriculé au moins 6 mois au nom du même egdeg^‚iV^gZeVgi^Xja^ZgAd^"egd\gVbbZ',Vkg^a'%%,!YVchaVa^b^iZYZhhidX`hY^hedc^WaZh#D[[gZg‚hZgk‚ZVjmeVgi^Xja^Zgh#

D’Ieteren Anderlecht Boulevard Industriel 51 1070 Bruxelles Tél. 02/556 35 15

D’Ieteren Woluwe Leuvensesteenweg 344 1932 Zaventem Tél. 02/709 49 11

D’Ieteren Fort Jaco Chaussée de Waterloo 1298 1180 Bruxelles Tél. 02/379 29 30



Le retour du

Abandonné par presque tous les constructeurs depuis plus de 10 ans, le cinq cylindres en ligne fait son grand retour sous le capot de deux starlettes du bitume. Un régal !

Ford Focus RS vs. Audi TT RS


QPierre-Benoît Sepulchre

Volvo mis à part, plus aucun constructeur automobile n’avait eu recours à l’architecture d’un cinq cylindres en ligne sous un capot. Ces moteurs sont pourtant considérés comme plus souples que les quatre cylindres, mais aussi moins gloutons en carburant que les six ou huit cylindres. La sonorité des versions essence est également très attachante, sans compter que particulièrement vifs, ces moteurs offrent un agrément de conduite rare. Bref, il n’en fallait pas plus pour qu’Audi ressorte du grenier cette mécanique magique qui, on s’en souvient, avait fait les beaux jours de la mythique Audi Quattro ou du break RS2 Avant. Quant à Ford, il lui a suffit d’aller puiser dans la banque d’organes du groupe, en l’occurrence chez Volvo, expert irréfutable en la matière.



Audi propose donc un moteur inédit concocté par sa filiale sportive Quattro GmbH. Dérivé du quatre cylindres TSI/TFSI, il est bon d’entendre qu’il possède aussi une lointaine parenté avec le V10 de la R8, un peu comme si ce dernier avait été coupé en deux. Sous le capot de la TT, il développe 340 CV et 450 Nm de couple, de quoi abattre le 0 à 100 km/h en 4,6 secondes et le 0 à 200 km/h en 15,9 secondes ! Et au-delà de ces chiffres remarquables, l’Audi se distingue aussi par une plage d’utilisation particulièrement large, s’étalant de 1.600 à 5.300 tr/min, gage de reprises fulgurantes et d’un plaisir d’utilisation inédit. Le moindre dépassement se fait donc en toute facilité, à tel point qu’il vaut toujours mieux

garder un oeil sur les compteurs. Et pour faire passer cette débauche de puissance au sol, on retrouve bien entendu le système Quattro qui fait une fois encore preuve d’une efficacité redoutable en toutes circonstances. S’agissant ici du système Haldex, le comportement reste principalement typé traction puisqu’un maximum de 50 % du couple peut être renvoyé sur le train arrière. Ce qui n’est bien entendu pas pour déplaire... Ford, pour sa part, fait digérer les 305 CV du moteur par les seules roues avant ! Moins puissante que l’Audi, elle offre pourtant un couple de 440 Nm, soit dix de plus qu’une Porsche 911 Carrera S ! Faire passer tout ce petit monde sur le train avant d’une compacte, aussi sportive soit-elle, n’a donc dû pas être évident. Heureusement, le différentiel autobloquant optimise la motricité en

limitant le patinage grâce à un report du couple sur la roue qui dispose de la meilleure adhérence. Le retour de couple dans le volant est quant à lui limité grâce à un train avant pivot découplé qui permet de dissocier les fonctions de suspension et de direction. Et force est de constater que ces deux artifices font des miracles ! La Focus RS transmet impeccablement sa puissance au sol, la motricité se révélant bluffante. Plein à tous les régimes et ayant du mordant dès 2.000 tr/min, le cinq en ligne turbocompressé assène ensuite un bon coup de pied aux fesses qui répond présent jusqu’à 7.000 tr/min ! Un brio et une efficacité qui sont dignes d’une reine de rallye, le tout couronné par une sonorité rauque et féroce qui vous incite à enfoncer la pédale de droite encore plus profondément !

EN PISTE ! Précise grâce à une direction bien calibrée, à la fois ferme mais douce, l’Audi TT RS avale les longues lignes droites sans broncher et enchaîne les virages avec une facilité déconcertante. La transmission Quattro répartit quant à elle parfaitement le couple en sortie de courbe, tandis que la boîte manuelle à 6 rapports permet d’enchaîner les rapports en toute décontraction grâce à des débattements très courts et à des verrouillages bien fermes. Et si l’envie vous prend, vous pourrez même enclencher le mode ”S” qui accentue la vivacité de réponse du moteur, tout en exhalant la sonorité de l’échappement. Si la Ford ne possède que deux roues motrices, elle est en revanche pourvue d’un châssis au diapason. Bien aidée par une direction consistante, elle enfile les difficultés sans le moindre soupir. Profitant d’un bon freinage et d’un châssis remarquablement équilibré, la Ford se place idéalement dans les courbes rapides grâce à une poupe qui ne rechigne pas à enrouler lors d’une décélération appuyée, avant de ressortir en force grâce à un train avant très précis et au brio du 5-cylindres. Ludique, cette mobilité de la poupe n’a rien de piégeuse d’autant plus que l’ESP veille au grain. Efficace et divertissante, que demander de plus !?

TOUT EST DANS LE STYLE... La TT est considérée par beaucoup comme une oeuvre d’art. Et là où les versions de base jouent la carte de l’élégance, les TTS et a for-

un plaiGUEST: procurent L’AVIS DE rd o e F la mme ol. Et l’un L’Audi co ite de très haut v a s u du e utilisée n tr ê t n sir de con e tiori TT RS affichent fièrement v autre peu polyvalence et à u leur tempérament turbulent comme l’ e grâce à un envier à des autos n ie grâce à une silhouette virilisée, d ti o u q nà t, en i n’ont rie auréolée de touches voyantes ur autan o P onfort qu . c s e g a plus s s comme les deux grosses sorpour finir coup plu it u a fa e e b s t S ties d’échappement, les logos rmante e di, la TT-R bonne Au que radicale. Perfo devant TT-RS situés sur les étriers de te nmoins frein et la calandre, ou encore polyvalen cline néa n in de ’i s e ll e les bas de caisse élargis et les u petit gra tod t s ludique, e i u re d’au LED qui soulignent les yeux de la our ce q de ce gen tant léla Ford p d n e tt a belle allemande. Tous les regards l’on n ligne é folie que se tourneront inévitablement vers rbe cinq e tème Haldex e p u s le , mobiles r un sys vous, même si franchement, la TT lheutouffé pa é t n e rsen, ma o m T RS demeure somme toute relativen gère ’u d as le brio ble avec les méca ment discrète. qui n’a p ti , a t incomp algré cela Pour ce qui est de la Focus RS, Ford reusemen versales. Mais m te n nvoûta ans a préféré une recette beaucoup plus niques tr eure une voiture e La Ford m e er. frénétique. Rien que les couleurs disla TT RS d t si belle à regard tous les ponibles vous donnent une idée de la onduire e t une réussite à c à philosophie prônée par Ford : orange art es r malgré le pour sa p . Facile à maîtrise électrique, vert électrique, blanc glan, elle vue le tractio p im cier ou bleu cyclone... Cohérentes, les points de s e le n e soit u redoutab lignes n’en demeurent pas pour autant fait qu’ell ive formidable et e ort 0 Ð (contr 0 explosives. Les nouveaux boucliers .9 2 3 à est une sp Proposée s d’équiavant et arrière ainsi que les moulures de fficacité. lle n’a pa ’e e d , i) d u A mme bas de caisse qui abaissent la ligne de 0 Ð pour l’ hé et s’impose co 9 .9 6 5 l’auto lui donnent des airs de fauve. Les t. Reste à r le marc valent su ffaire” du momen flancs, les passages de roues élargis et ea u trop “ra e p n les ouïes sont pour leur part directement u la “bonn k o r à son lo inspirés de la compétition. Bref, difficile de s’habitue . .. t û otre go ne pas passer pour un frimeur au volant caille” à n d’un tel engin ! -








La Peugeot 5008 incarne le premier monospace compact produit par la marque au lion. Avec un habitacle à la modularité exceptionnelle et un comportement typé berline, Peugeot innove dans la catégorie. QPierre-Benoît Sepulchre


polyvalence incarnée UN HABITACLE GÉNÉREUX ET MODULABLE Et Peugeot continue de se démarquer avec un habitacle agréable à vivre. La surface vitrée semble ainsi encercler l’ensemble de la voiture, un peu à l’image d’une véranda. Cela est dû principalement au dessin spécifique de la vitre de custode qui se fond dans la lunette arrière. Le toit panoramique en verre inonde pour sa part l’habitacle de lumière, même à l’arrière.

Après la 308 SW et le tout récent crossover 3008, la 5008, qui mesure 4,53 m de longueur et 1,64 m de hauteur, vient compléter l’offre de Peugeot dans ce que l’on appelle le segment M1. Ce monospace compact doté de 5 ou 7 places constitue une belle alternative face à la concurrence, ce qui vient ainsi renforcer la présence de Peugeot au sein du marché des véhicules familiaux.


Au premier regard, on est frappé par le style extérieur de la 5008, bien loin des “autocars” que proposent d’autres marques. Peugeot a privilégié ici une ligne équilibrée et surtout bien profilée. Tant et si bien que le monospace n’est pas sans rappeler un certain train à grande vitesse ! Avec son Cx de 0,29, la 5008 est tout simplement la plus aérodynamique de sa catégorie.

ment du seuil de chargement. Il est ainsi possible de charger des objets longs jusqu’à la planche de bord. La longueur utile dans cette configuration atteint 2,76 m ! Le coffre pour sa part offre un espace utile allant jusqu’à 2.506 l lorsque tous les sièges sont repliés.

DES MOTEURS PROPRES ET POUR TOUS LES GOÛTS La Peugeot 5008 est d’ores et déjà disponible avec trois motorisations : un 1,6 l essence (120 ch en version de base), un 1,6 l diesel HDi (110ch disponible avec boîte manuelle ou robotisée) et un 2,0l HDi (de 150 ch ). Sont attendus dans un deuxième temps : le 1,6 l essence THP turbo de 156ch et le 2,0l HDi de 163ch couplé à la boîte automatique 6 rapports. Tous ces moteurs combinent performances et consommation réduite, mais également des bilans CO2 très mesurés. Le 1,6 l HDi de 110 ch couplé à la boîte robotisée n’émet ainsi que 135 gr CO2/km pour une consommation record de 5,2 l/100 km !

Et outre un poste de conduite particulièrement ergonomique, grâce à des sièges de qualité et à un angle d’inclinaison du volant très vertical, la 5008 fait également la part belle aux technologies d’avant-garde comme l’affichage tête haute, le Distance Alert (qui aide le conducteur à respecter les distances de sécurité), le Snow Motion (un antipatinage intelligent), la possibilité d’opter pour un boîtier WiFi couplé à une clé USB 3G/3G+ ou encore la présence d’un système multimédia composé de deux écrans 7”, d’une console de connexion qui accepte tout équipement audio/vidéo portable PPRÉCIÉ: et de deux casques sans fil Bluetooth. GUEST A A Un bon point aussi pour la modularité. En effet, la deuxième rangée est composée de trois sièges de même largeur, réglables en longueur et en inclinaison. Ils sont aussi escamotables individuellement dans le plancher, pour former une surface parfaitement plane dans l’aligne-

ABLE REMARQU inale ligne orig xceptionnelle ée modularit ral né es confort gé omiques et propr n o c moteurs é és pratiques côt espace et


NEW ersion

mini coyot e

coyote rider

Versie/V MOTO

Le premier avertisseur de radars fixes et mobiles en temps réel ! Concentré de technologies (GPS, GPRS, GSM), Coyote permet en toute légalité de se prévenir mutuellement des aléas de la route en temps réel. Coyote : des dizaines de milliers de personnes pour une conduite plus sereine et plus sécurisée. Rejoignez la Communauté Coyote. Adhérez à une nouvelle philosophie de la route, en toute simplicité, grâce à l’information en temps réel. LISTE DES POINTS DE VENTE SUR LE SITE WWW.COYOTESYSTEMS.BE





Coyote Systems Benelux s.a. • Avenue Franklin 5 bis • B-1300 Wavre • •

Félins, les caches-oreilles en vison imprimé léopard, Louis Vuitton


 02 289 28 28

Motif flocon de neige pour la collection exclusive " vision " de

Une silhouette signée Armani

Fendi 

Grand NORD

Fruit d’une collaboration avec le talentueux créateur japonais Yoshinori Ono, la veste nApApijri 66°33

AÉ]^kZgZhia|!^aZhi\gVcYiZbehYZeZchZgVjm hedgihYÉ]^kZgZi|idjiXZfjZVXdbedgiZ/aV aj\Z!aZhegdbZcVYZh!Zi‚k^YZbbZciaZh`^#8]Zo aZhXg‚ViZjgh!aV[djggjgZZhi|aVbdYZ!edjgaV_d^Z YZcdhnZjm


Les accessoires de la marque suisse ZAi combinent les meilleurs matériaux, pour une sécurité et un look irréprochables. Casque " Capalina " 

Des skis de pro avec un noyau en pierre et un design rétro génial, chez ZAi, le must. 

Une silhouette signée Armani

Pour l’après-ski, lunettes de soleil Tom Ford



Ultra chic ! Chapka en cerf et renard, Hermès ,

02 511 20 62

Pour un look reine des neiges, les manchettes en agneau glacé et ragondin, Hermès Une silhouette signée Armani

Promenez-vous bien au chaud en look Inuit-chic avec ces mocassins fourrés AsH  02 479 70 54,

, 02 511 20 62

L’accessoire essentiel de la surfeuse trendy, le masque roxY 

Un grand sac de voyage pour y glisser tout le nécessaire du parfait skieur, n.d.c. 

Bien au chaud dans ma doudoune, eric BompArd  02 513 56 23

Une silhouette signée Armani Ultime Black, un ski technologique et luxueux pour skieurs sportifs et amateurs d’objets rares ! LAcroix,  -02 215 57 19,


340a, Chaussée de Bruxelles 1410 Waterloo - Belgium Tél./Fax : 02/354.35.03 Ouvert du lundi au samedi de 10h a 13h et de 14h à 19h et le dimanche (11h-18h) en saison


1, Chemin de la Cense 1410 Waterloo - Belgium TĂŠl 02 351 22 21 Ouvert du lundi au samedi de 11h a 19h et le dimanche en saison.





Nœud papillon écossais, van Laack

 02 538 16 68

Chapeau, ZaDig et voLtaire  02 514 24 40

AV^cZ!XVX]Zb^gZZiXj^g!idjh aZhXdjehhdcieZgb^hedjg eVhhZgaÉ]^kZgVjX]VjY

Écharpe en laine, Bellerose 

Duffle Coat en daim, gant

 02 372 94 78

Hiver chic chez hackett. Nouvelle boutique à Bruxelles  02 502 73 24

Pull en laine torsadé, Marc o’PoLo


Gants en agneau doublés de cachemire, Loro Piana

Jeans, DenhaM, en vente chez Prive Joke (02 502 63 67) et Reservoir Shop

 02 513 30 48

Montre Cape Cod anthracite, herMès  02 511 20 62

Chaussures, J.M. Weston  02 514 39 69


Sac à dos rétro en cuir souple, DeganD

 02 647 66 77





Rue Haute, 195 1000 Bruxelles 02 511 69 35

Ch. De Bruxelles, 232 1410 Waterloo 02 354 95 35

Shopping Center 1200 WoluwĆ&#x2019;-St-Lambert 02 771 70 99

Markt, 16 1780 Wemmel 02 453 21 25




Hundertawasser L’art tient une place prépondérante dans la création des bijoux Frey Wille. Les stylistes de la manufacture autrichienne le démontrent à merveille et comme de véritables artistes, imaginent à chaque nouvelle collection des motifs uniques et inspirés. L’accessoire incontournable de la saison : la manchette colorée en or pur et émail issue de la gamme qui s’inspire de l’œuvre de l’architecte Hundertwasser pour une touche plus que tendance ! ou 02 502 35 20


Débridée ! C'est une fine bride d'or blanc qui s'enroule autour du bras en entrelacs agiles où alternent reflets de métal et brillance précieuse. Le bracelet est comme un harnais miniature, hommage au savoir-faire équestre de la maison Hermès. Les articulations astucieusement dissimulées dans le motif rendent le fermoir indécelable. Débridée, c’est une ligne élégante, composée de bagues et bracelets en argent ou or rose, blanc ou jaune, avec ou sans diamants. ou 02.511.20.62



`kigkÊWkXekj Z[ied]b[i

¿aÉdXXVh^dcYZaÉVgg^k‚ZigƒhegdX]V^cZ YZhegdYj^ihHVaan=VchZcZc7Za\^fjZ! aVbVgfjZcjb‚gdjcYZhbVcjXjgZh g‚jhh^ZhVjmJH6!cdjhVkdchgZXjZ^aa^ fjZafjZhXdchZ^ahedjgYZhdc\aZhcZihZi WZVjm!XZfj^cÉZhieVhjcZb^cXZV[[V^gZ

Step 1

On commence par passer ses mains sous l’eau. Ensuite, on applique le crayon de soin hydratant qui protège et renforce les cuticules et les ongles. Ultrapratique, le crayon peut se poser sur toute la surface de l’ongle.

Step 2

Choisissez une lime à ongles efficace et de bonne qualité pour avoir un maximum d’effet ! Chez Sally Hansen, la lime à double face fait un tabac : la première face lisse, lime et modèle les ongles, tandis que la deuxième les polit et leur donne un effet brillant impeccable !

Step 3

Celles qui préfèrent un effet plus " nature " opteront pour le soin blanchissant, deux couches suffisent pour faire ressortir les couleurs naturelles de l’ongle ! En plus, il sèche très vite : en 10 minute c’est fait !

Gouttes vitaminées


Les dry drops se posent à une ou deux gouttes sur chaque ongle pour adoucir après la manucure ! Une sensation de fraicheur à l’huile d’amande douce…

Un conseil pour poser le vernis

Il est important de toujours essuyer son pinceau sur le bord du flacon ! Pour poser le vernis sur l’ongle, il faut d’abord commencer au milieu de l’ongle et puis uniformiser sur les côtés. Pour un effet optimal, il est toujours conseillé de mettre deux couches de vernis. Celles qui aiment la couleur et le changement doivent avant tout penser à mettre un base coat ! Cette première couche protège et rend l’ongle plus lisse. Il efface également les ongles striés… Ensuite on pose la couleur de notre choix !

La touche finale : le top coat est LA protection qui rend vos ongles brillants et nets ! C’est grâce à lui que la couleur ne change pas et que nos ongles peuvent rester impeccables pendant au moins dix jours ! En plus, il sèche en un éclair !

Vernis 9Zh\g^[[ZhVX‚g‚Zh djYZhYd^\ihYZ[‚Z! cVijgZjc_djgZicj^ih eV^aaZi‚Zh½¿X]VXjcZ hVkZgh^dcYZaV [‚b^c^i‚

faites vos Griffes lancôme annonce la couleur de ses tons hiver avec un vernis ultra-brillant et résistant, d’une profondeur de prune magnétique qui s’affiche fièrement ! Dépêchez-vous, il est en édition limitée ! 206 Prune des Nuits, Lancôme, 23€

romantique Chez Givenchy, Poétique Lily célèbre la douceur, la tendresse grâce à sa robe rose teintée de beige, le tout paré d’un blanc nacré pour vous faire briller ! Vernis Please ! Poétique Lily, Givenchy, 16,24€

À deux c’est mieux La collection dior Vernis s’enrichit de deux nouvelles teintes, Rosé Boréal et Silver Purple. Brillants et intensément colorés, les deux vernis sont en édition limitée ! Il ne tient qu’à vous de choisir entre un rose tendre et un violet métallique ! 162 Rosé Boréal, 782 Silver Purple, Dior Vernis 22,84€

nature Un vernis dans les tons bleu-gris, achève à la perfection le look moderne nude chez armani ! Vernis 42, Giorgio Armani, 22€

c’est la fête ! Chez MAC, le temps est à la fête ! Des couleurs brillantes, argentées, lumineuses et complètement décalées, voilà qui va détonner ! Deux nouveaux tons annoncent un style à la limite de l’excentrique ! Silver foil et Blue Pink, MAC, 11,75€

vite fait Bien fait ! Professionails, la marque belge spécialiste des soins pour les ongles lance deux nouveaux gels UV pratiques et efficaces ! À tester dans votre salon de beauté ! Gellak, One to Go, Professionails




Shopping à Paris? CLARINS vous l'offre!

Grâce à CLARINS, offrez-vous la chance de gagner une journée de Shopping à


voyage aller-retour en 1ère classe Thalys et un chèque cadeau* d'une valeur de 400 euros. avec la personne de votre choix. Cette journée comprend le

Pour cela, découpez les codes barres de 2 produits Clarins et joignez-les au coupon-réponse ci-dessous (ou une reproduction de celui-ci) dûment complété. Les 20 gagnants seront tirés au sort le lundi 04/01/2010 à 15h00 dans les locaux de Clarins Belgique.

93 *Ce chèque sera valable dans n'importe quel établissement bancaire.


& des mains n Marie Delloye

DcVidj_djghiZcYVcXZ|c‚\a^\ZgYZ hd^\cZgcdhe^ZYhZibV^ch!VadghfjZXZ hdciZjmfj^hdj[gZciaZeajhYj[gd^YZc ]^kZg½>aZhiiZbehYZaZhegdi‚\ZgZiYZaZh g‚X]Vj[[Zg#¿kdjhYZX]d^h^g

chaud devant ! Selon une enquête récente effectuée par hansaplast, une femme sur deux déclare avoir froid aux pieds presque tous les soirs. Aujourd’hui, au lieu de blottir nos pieds près de ceux de nos compagnons, nous pouvons nous réchauffer grâce la crème chaleur de Hansaplast ! Il suffit de s’en enduire les pieds et de masser… Effets garantis ! Crème Chaleur, Hansaplast 5,99€

ds e i p s Soin dans la dentelle

en deux temps trOis mOuvements Spécialement conçue pour nos petons, la gamme Superfeet de Jeanne piauBert propose un soin en profondeur : en premier lieu, un gommage qui élimine les rugosités, en deuxième lieu, un baume nourrissant au beurre de Karité qui nourrit et rafraichit ! Les résultats parlent d’eux-mêmes…


Gommage enzymatique et Baume nourrissant, Méthode Jeanne Piaubert, 48,50€

Onde de Fraicheur Intensivement rafraichissant et légèrement parfumé, le spray-poudre de Kneipp absorbe la transpiration, et agit contre les bactéries grâce à la poudre de tapioca naturelle, issue de la cassave. L’huile essentielle de romarin et les extraits de Calendula guérissent les pieds fatigués et brulants… Un must ! 5-en-1 Spray-poudre, Kneipp, € 8,99

Pour soigner les pieds fatigués, éprouvés par les talons hauts ou la marche, clarins leur consacre une Crème Jeunesse. Ultra-légère et onctueuse, elle est très vite absorbée et laisse sur la peau un voile doux et soyeux… jusqu’au bout des ongles ! La même lotion réparatrice existe déjà pour les mains ! Crème Jeunesse des pieds, Clarins, 25€ Crème Jeunesse des mains, Clarins, 20€


in a m s Soin

crème cOnFOrt clinique lance une nouvelle crème pour les mains, qui s’ajoute à la très belle gamme " Deep Comfort " Pour celles qui ont les mains sèches en permanence, cette crème enveloppe les mains dans un gant d’hydratation qui dure jusqu’à douze heures ! Une solution qui ne quittera jamais votre sac ! Crème Mains et cuticules Pur Confort, Clinique, 20€

haute tenue Délicieusement parfumée aux huiles d’argan, de noisette et d’amande douce, la crème mains nourrissante de BiO-Beauté garantit une hydratation continue et une protection efficace contre la sécheresse causée par le froid…. À consommer sans modération ! Crème Mains Nourrissante mains sèches et abîmées, Bio-Beauté, 13,50€

secret d’Orient Enrichi de Ginseng, symbole de l'immortalité, et de Ginkgo Biloba, connu pour son effet fortifiant sur les vaisseaux sanguins, Ginkgo’s Secret de rituals raffermit et apaise les mains sèches. Un Conseil : appliquez Ginkgo's Secret le soir, le processus naturel de renouvellement de la peau s'effectue 8 fois plus vite pendant la nuit… Ginkgo’s Secret, Rituals, 9,50 €

première BOutique rituals À Bruxelles ! Les fans de ces centres de Spa et produits exceptionnels seront ravies d’apprendre que la première boutique rituals ouvre ses portes en plein centre de Bruxelles !


Pour un soin intensif et plus complet, clarins a créé un fluide Anti-Taches Jeunesse des Mains. Un voile soyeux qui agit contre le vieillissement cutané, à poser sur les mains avant votre crème, ou simplement en tant que crème ! Fluide Anti-Taches Jeunesse des Mains SPF 15, Clarins, 20€

Une occasion à saisir pour celles qui ne connaissent pas encore le savoir-faire et la douceur des produits de la marque hollandaise ! Ouvert depuis le 12 novembre Rue des Fripiers 19 1000 Bruxelles



La réflexologie plantaire :cX]^cZ!aZhe^ZYhhdciXdch^Y‚g‚hXdbbZaZhgVX^cZhYjXdgeh# 8ÉZhiedjgXZaVfjÉ^ahi^ZccZcijcZeaVXZ^bedgiVciZYVchaV b‚YZX^cZX]^cd^hZ#6gg^k‚ZYZej^heZjX]Zocdjh!aVg‚[aZmdad\^Z eaVciV^gZ[V^iYZeajhZceajhYÉVYZeiZh½:mea^XVi^dch#


En quoi consiste la réflexologie ?

Considérée comme la petite sœur de l’acupuncture en Chine, la réflexologie se base sur les zones réflexes des pieds, qui se rapportent à tous les endroits du corps. Les pieds sont très sensibles, ce n’est pas pour rien que plus d’une trentaine de points d’acupuncture se trouvent dans les pieds… La réflexologie ne traite pas seulement un point précis du corps, c’est une méthode holistique qui permet de retrouver un bien-être corporel et mental. Quelle est la méthode utilisée ?

Le réflexologue masse les pieds en agissant par pressions sur des points très spécifiques, en fonction des maux du client. Par exemple, si vous souffrez d’un mal de cou, la pression sur le gros orteil du pied gauche vous sera désagréable ou dans le sens inverse, vous soulagera… Le réflexologue va chercher les points sensibles sur lesquels il faudra travailler, en tenant compte également des différents niveaux de chaleur.

9[jj[cƒj^eZ[fh_l_bƒ]_[ WkjWdjb[iWif[YjiYehfeh[bi gkʃcej_edd[bi$B[iƒcej_edi dƒ]Wj_l[iYhƒ[djZ[ij[di_edi ckiYkbW_h[i"Zkijh[ii[jZ[i jen_d[i¾B[XkjZ[bWhƒÔ[nebe]_[ [ijZ[Zƒj[dZh[kd[f[hiedd[ fekhfekle_hWYj_edd[hied ioij„c[ZÊWkje#_cckd_jƒ$ Quels sont les bienfaits de la réflexologie ?

Cette méthode privilégie autant les aspects corporels qu’émotionnels. Les émotions négatives créent des tensions musculaires, du stress et des toxines… Le but de la réflexologie est de détendre une personne pour pouvoir actionner son système d’auto-immunité. Que ce soit pour soulager une douleur spécifique, pour améliorer la circulation sanguine ou pour éliminer les toxines; la réflexologie détend, réinstalle un équilibre et libère la circulation des énergies vitales. D’ailleurs, les effets se ressentent souvent tout de suite ! Combien de séances sont conseillées ?

Cela dépend du mal, mais la plupart des adeptes se rendent à une séance toutes les 3 semaines. Par contre, pour soigner un mal précis comme les migraines, il est conseillé de prendre rendez-vous une fois par semaine, pendant quatre semaines. Marie Delloye  

Avec nos remerciements à : Namaste Reflexology Cécile Olieslaeger 219 Chaussée de la Hulpe 1170 Watermael Boitsfort T : 0474 94 30 62






























des crèmes

n Marie Delloye

AÉ]^kZgZhi|cdhedgiZh!XÉZhiaZbdbZciYZbZiigZYZaÉdgYgZ YVchcdhigdjhhZhYZid^aZiiZedjgcZ\VgYZgfjZaZbZ^aaZjg Hd^ch]nYgViVcih!Y‚bVfj^aaVcihjaigV"YdjmZiadi^dch cZiidnVciZh½Edjgjck^hV\ZgVndccVciXdcigZaZ[gd^Y


t n a l l i u émaq


Yeux de biche Le démaquillant yeux de Louis Widmer, est vraiment agréable à appliquer. Très doux et juste assez gras, il enlève le maquillage facilement et laisse la peau fraiche et bien lisse… Confortable !


Démaquillant yeux, Louis Widmer, 9,80€

voie Lactée La texture légère et veloutée du Lait Démaquillant Velours de sampar débarasse la peau des particules de pollution et du maquillage. Grâce à une combinaison d’eau de rose et d’extrait de menthe, ce démaquillant laisse sur la peau une sensation de douceur extrême... En exclusivité chez Planet Parfum, Lait Démaquillant Velours de Sampar, 29€

huiLe 100% bio La très belle et toute nouvelle marque bio-beauté nous a séduites avec son Démaquillant Huile Douceur ! D’origine 100% naturelle et ultra-efficace, l’huile se chauffe entre les mains et se pose sur un visage humidifié pour agir comme un baume…Fraîcheur garantie ! Démaquillant Huile Douceur, Bio-Beauté, 22€




an y o t t e N

J’aime La mousse Encore plus efficaces et naturels, les fameux Doux Nettoyants Moussants de cLarins agissent sur chaque type de peau pour les débarrasser des impuretés, et adoucir l’épiderme avec le nettoyage à l’eau. Sans savon, leur parfum fleuri laisse une grande sensation de pureté ! Doux Nettoyants Moussants, Clarins, 22€

À fLeur de peau L’eau pure du mont Fuji sur votre peau, c’est le dernier exploit que nous offre anna YaKe. Spécialement conçu pour les peaux sensibles, le Nettoyant Apaisant Sensitive est sans paraben, sans fragrance, et contient une combinaison de polydetectyl, de miel purifié et d’extrait de bouleau blanc… Pour une peau plus douce. Nettoyant Apaisant Sensitive, Anna Yake, 32,83€


nt a t a r d Hy contre vents et marées

Conçue à l’origine pour une expédition au Groenland, La Ultra Facial Cream de KiehL’s hydrate la peau pendant 24 heures et dans les conditions les plus extrêmes. Qu’il fasse -20°C ou 45°C, la peau est protégée entièrement par cette crème " miracle " à la texture légère. Ultra Facial Cream, Kiehl’s, 36,50€

voiLe de douceur nuxe innove avec son dernier-né, le sérum Crème Fraîche de Beauté, le premier sérum pour

visage et contour des yeux qui assure une hydratation continue de 24h et garantit une action antifatigue. Subtile combinaison de 8 lotions végétales et 4 huiles essentielles, le sérum s’applique avant toute crème… Un concentré de fraicheur ! Sérum Crème Fraîche de Beauté, Nuxe, 18€

retour aux sources Issue des laboratoires de novexpert, l’Emulsion Légère est 100% naturelle. Elle s’adresse particulièrement aux peaux normales à mixtes pour hydrater, apaiser et protéger grâce à une formule spéciale antioxydante composée d’extraits de grenade, de pin noir et de thé vert. Emulsion Légère, Novexpert, 20,90€



bWf[hb[Z[iJhe_iLWbbƒ[i n Marie Delloye

Fj^cÉV_VbV^hZciZcYjeVgaZgYZ8djgX]ZkZa4AVWZVji‚ cVijgZaaZYjh^iZ!aZXdc[dgiYZhX]VaZih!aVeVcdea^Z YÉVXi^k^i‚hhedgi^kZhZihjgidji!aVkVg^‚i‚^begZhh^dccVciZ YZe^hiZh!dcieaVX‚8djgX]ZkZaeVgb^aZhhiVi^dchaZheajh egZhi^\^ZjhZhYj\adWZ½

Le domaine skiable le plus grand du monde

Une station aux mille facettes

Que vous soyez “ pro ” en ski, fou de surf ou tout simplement dingue de randonnée, le domaine des trois vallées satisfait toutes les envies ! Les chiffres parlent d’eux-mêmes : 336 pistes pour plus de 600 km de pistes reliées dont, pour la seule Vallée de Courchevel, 93 pistes pour 150 km sur 533 ha desservis par 61 remontées mécaniques, sans compter les 10 000 hectares de domaine hors-piste sur plus de 2000 m de dénivelé ! En comparaison, le domaine skiable des 3 Vallées et ses 400 km2 équivaut aux 6 plus grands domaines skiables américains réunis ! Même l’attente des remontées mécaniques reste raisonnable grâce à un réseau large et ultra- organisé !

Pendant que les fanatiques de glisse attaquent les couloirs, les snowparks, les champs de bosses, ceux qui privilégient une expérience plus tranquille se feront un plaisir de découvrir chaque jour un nouveau versant ! Si le domaine skiable impressionne, la variété d’activités “ hors-piste ” séduit chaque année un public plus aventurier. Il s’agit de saisir l’occasion et de profiter de ce paysage unique pour faire son baptême de l’air en avion ou en hélicoptère, de tester le scooter ou le quad des neiges,… Toutes les folies sont permises ! Pour les amoureux de la nature et des randonnées alpines, Courchevel offre une multitude de sentiers piétons à découvrir avec un guide ou tout seul, en raquettes ou téléportés ! À vous de choisir de quelle altitude partir, pendant combien de temps et à quel niveau de facilité ! Notre coup de cœur va

pour les neuf itinéraires de balades en raquettes : les paysages sont époustouflants ! Il est également possible de prendre les remontées mécaniques à pied pour profiter du panorama et s’arrêter dans un des délicieux restaurants d’altitude…

Courchevel et le charme des chalets De plus en plus réputé pour le confort et l’authenticité de ses hôtels, Courchevel renouvelle cette année une offre déjà prestigieuse : À 1330 mètres, le village de Le Praz s’agrandit de deux chalets écologiques. Une manière de profiter de ses vacances tout en protégeant la nature… Plus haut à 1550 mètres, les chalets Kandahar, de 4 et 5 chambres chacun, offrent tout le confort moderne tout en gardant le charme traditionnel des vieux chalets de montagne ! Ceux qui veulent profiter pleinement de leurs vacances seront séduits par la vue imprenable sur la Dent du Villard, la salle de cinéma, le jacuzzi et le hammam !

Le Jardin Alpin - F- 73121 Courchevel Cedex - France T : 00 33 (0)4 79 00 38 38 -

Courchevel en chiffres > 444 employés saisonniers (dont 104 permanents) > 70 160 passages skieurs par heure maximum > 17 000 m de dénivelés desservis > 61 remontées mécaniques sur le domaine skiable de Courchevel > 93 pistes pour 150 km sur 533 ha pour la Vallée de Courchevel (15 vertes, 34 bleues, 35 rouges, 9 noires) > 600 km de pistes, 336 pistes, 182 remontées mécaniques sur le domaine relié des 3 Vallées

Situé à 1850 mètres d’altitude, le chalet de charme Les Airelles est un véritable cocon au beau milieu de la montagne ! Un endroit où il fait bon vivre, une décoration sobre mais raffinée, un confort sans cesse étudié...Sans oublier la cuisine exceptionnelle du grand chef Pierre Gagnaire ! Comme si cela ne suffisait pas, Les Airelles présentent cette année leur dernière petit bijou : Ormello, un chalet de 1000 m2 qui privilégie un confort plus intimiste avec ses 9 chambres, un Spa et une magnifique piscine. Tout nouveau et tout beau, il ouvre ses portes maintenant !

> 3 zones dédiées au freestyle à Courchevel > 4 ZEN (zone d’évolution des novices : deux à 1850, une à 1650, une au Praz) > Prévention d’avalanches : 71 Gazex, 5 Catex, 101 points de tir par grenadage > Ski de fond : 61 km, 9 boucles

... 101




:ck‚g^iVWaZh‚iZcYVgYhYZfjVa^i‚YZaVhiVi^dc!aZhfjZafjZh gZhiVjgVcih]VjiYZ\VbbZYZ8djgX]ZkZaVii^gZciaZh\djgbZih YZhfjVigZXd^chYjbdcYZ¿X]VfjZX]Z[hZhgZXZiiZhbV\^fjZh! |X]VfjZgZhiVjgVcihdchinaZ½

Gastronomie! Event!e date : une coupe du monde

Save th en décembre 2010 ! el accueillait la Coupe du Monde

urchev Il y a 30 ans, en 1979, Co le théâtre de la bre 2010, la station sera em déc 21 Le in. alp ski de nement ! Taïna évé Un ). lom in Dames (sla Coupe du Monde de ski alp rien à ses rra à domicile et ne lâchera Encore Barioz aura 22 ans, elle cou el. hev urc Co de haut les couleurs concurrentes pour porter e! the dat un hiver à attendre... Save

Dali au sommet

© Courchevel Tourisme

/ Jérome Kélagopian

d’accueillir une Courchevel aura l’honneur Cet hiver et jusque fin avril, d’hélicoptères let bal til sub Un les de DALI! série de sculptures origina oser délicatecimes, s’employant à dép évoluera au-dessus des que les autres dis tan , tes sommet des pis ment deux sculptures au nt! viva sée mu un el urchev contribueront à faire de Co


Le Chabichou (2 étoiles) cuisine raffinée, invenmontagnarde propose une Ce pilier de la gastronomie chef Michel Rochedy. du es idé dernité, selon les tive, entre tradition et mo rrez peut-être apprencours de cuisine ! Vous pou Celui-ci donne même des uf… bœ de chaud-froid de filet dre le secret de son fameux www.chabichou-courcheve

/ Jérome Kélagopi © Courchevel Tourisme

) Le bateau Ivre (2 étoiles très te res Ivre eau Le bat prisé, non seulement pour le talent de JeanPierre Jacob mais également pour la vue époustouflante sur Courchevel et sa vallée. Jean-Pierre Jacob puise son inspiration quotidienne dans les produits du marché pour nous offrir des plats aux saveurs surprenantes… Un Must!


o (1 étoile) La Table du Kilimandjar au guide Michelin 2009, recevoir sa première étoile Alexandre Ongaro vient de moderne, d’inspiration nt me olu rir une cuisine rés c’est l’occasion de découv cœur des Alpes! www.hote méditerranéenne, en plein



 

 


     

  

 




BdcigZ"bd^idc<HB!_ZiZY^gV^fj^ijZh###EajhegVi^fjZh!eajh[jc!eajhWZVjmZi bjai^[dcXi^dccZah!aZh<HBYÉVj_djgYÉ]j^dciW^Zceajh|d[[g^gfjZYZh^beaZhVeeZah AVa^\cZZhihVijg‚Z###YZcdjkZVji‚h n Marie Delloye

Businessman BLackBErry 8520 curvE ➥ BLackBErry Le dernier-né de la grande famille des BlackBerry se distingue des autres par son prix abordable, et s’adresse à ceux qui cherchent un outil de travail haut de gamme mais sans accessoires trop superflus. Doté du tout dernier " trackpad ", d’une caméra de 2.0Mpx, 256Mo de mémoire flash, le BlackBerry 8520 Curve possède une autonomie en standby de 17 jours! Les mélomanes seront séduits par les fonctions walkman de l’appareil. L

LG PoP ➥ LG Le nouveau LG Pop a tout ce que doit avoir un écran tactile : il est pratique, facile à utiliser et inclut les principales fonctions téléphoniques et multimédias. Le design minimaliste et la facilité d’utilisation sont bien pensés : une seule touche sert à accéder au menu, à annuler et à mettre fin à une action. L’écran tactile répond rapidement à tous les besoins et ce téléphone très sobre et élégant se recharge à l’énergie solaire ! Un outil efficace et écologique ! L En exclusivité en novembre 2009 chez The Phone House, à 199€ -

Les seniors en ont aussi… Emporia Telecom étend son réseau jusque Bruxelles pour subvenir à la demande des personnes plus âgées qui désirent un téléphone mobile aussi facile à utiliser qu’un téléphone fixe, sans devoir s’embarrasser d’applications inutiles. La collection Emporia est axée sur une plus grande lisibilité, des touches plus grandes et des hauts parleurs spéciaux… Certains possèdent même un bouton d’alarme qui appelle automatiquement un numéro préenregistré ! L


Bling-Bling SoNy EricSSoN, Satio ➥ SoNy Sony Ericsson lance Satio, un téléphone ultra-branché muni des dernières technologies de divertissement ! Avec son appareil photo de 12MP avec flash et focus tactile intuitif, adieu les photos floues et ratées ! Profitez de son écran 16/9ème pour regarder tous les films, séries, vidéos que vous aurez téléchargés ! C’est sûr, ce GSM va faire des jaloux ! L

Nokia XPrESSmuSic ➥ Nokia Montez le son avec le Nokia XpressMusic, un GSM avec mémoire de 4GB pour garder films, musiques, photos,… Grâce à sa camera avec flash LED 3.2 mégapixel autofocus, vous immortaliserez tous vos délires et fêtes ! Ce petit bijou de technologie est aussi équipé de baffles stéréo intégrés " surround sound " et d’écouteurs… De quoi profiter sans modération des meilleurs sons, n’importe quand, n’importe où ! Sans oublier le mode plein écran grâce auquel vous pourrez regarder vos films dans une superbe qualité ! L Nokia 5530 XpressMusic, 245 € - Info points de vente : Nokia Care 070/707 770

Fan de design Nokia N97 miNi ➥ Nokia Le petit dernier de Nokia a tout d’un grand ! Le Nokia N97 mini est un véritable PC mobile avec écran tactile et clavier Azerty inséré. Muni de toutes les dernières technologies, il est ultra-pratique et original ! L’écran personnalisable, l’appareil photo 5MP, l’écran 16:9,… Tout le fun dans un format minii. L Nokia N97 mini, 549 € -

LG NEw chocoLatE ➥ LG Le New Chocolate de LG promet bien des surprises ! Etonnant et très séduisant dans sa couverture rouge, il séduit par sa finesse et son côté pratique. Très proche de l’iPhone d’Apple, le New Chocolate est doté d’un écran tactile multifonctionnel et manipulable dans tous les sens. L’image peut passer instantanément au format 21 : 9 pour une vision en HD de films ou de deux images l’une à côté de l’autre… Et bien plus encore ! L LG New Chocolate, 529€ -

iPhoNE 3GS ➥ aPPLE Votre temps est précieux ? Tout est trop lent ? Découvrez le dernier iPhone 3GS, une merveille de rapidité et d’efficacité ! Tout ce que vous faites avec iPhone 3GS est jusqu’à 2 fois plus rapide et réactif qu’avec iPhone 3G : les applications, jeux, pages web, mails,… l’iPhone 3GS inclut l’enregistrement vidéo, le contrôle vocal, jusqu’à 32 Go de stockage et plus encore… À vous de le découvrir ! L


La Médiacité: quand Liège

innove... À peine arrivés à Liège, les voyageurs lèvent tous la tête vers la structure impressionnante de la nouvelle gare TGV, une merveille d’architecture moderne dessinée par Calatrava. Un peu plus loin et dans la même lignée, se trouve la Médiacité, une nouvelle galerie commerçante conçue par le groupe Whilhelm&Co… Destination design! QMarie Delloye

Ron Arad & Peter Wilhelm

UNE INNOVATION TECHNIQUE ET ESTHÉTIQUE Située dans le quartier du Longdoz, la Médiacité surplombe la Meuse. La petite ”Piazza” qui la devance accueillera bientôt un arbre et des activités saisonnières. Cette ”bulle” transparente toute en courbes se distingue du paysage par ses plafonds rouges et ses formes géométriques surprenantes.

”Une source économique qui, d’après Peter Wilhelm attirera 7 millions de personnes par an.”

miser le quartier, laissé auparavant dans un état assez médiocre. L’accessibilité est entièrement revue, ce quartier étant desservi en continu par les bus de la ligne 4... De quoi faire revivre le quartier ! Plus qu’un centre commercial et de loisirs, la Médiacité s’accompagne de bâtiments attenants dans lesquels vont se réunir tous les facteurs médias de la ville de Liège : la RTBF, le pôle Image de Liège et une séries d’entreprises du secteur audiovisuel... Sans oublier le cinéma, bientôt logé dans la galerie. Forte de ses assises solides, la Médiacité se veut être un nouveau centre dans la ville, une source économique qui, d’après Peter Wilhelm, attirera 7 millions de personnes par an. C’est donc tout un quartier qui sera dynamisé par ce projet multifonctionnel !

”À plus long terme, le projet de relier concrètement la Médiacité à la gare TGV devrait voir le jour.” À plus long terme, le projet de relier concrètement la Médiacité à la gare TGV devrait voir le jour, au travers d’un chemin piétonnier serpentant le parc de la Boverie tout proche.

UN INVESTISSEMENT ”DURABLE” C’est avec une grande fierté que Peter Wilhelm annonce que son projet est entièrement certifié par l’organisation mondiale ”BREEAM”, société qui évalue la performance environnementale

À l’intérieur, la galerie s’illumine de la lumière du jour qui inonde les deux étages de boutiques et snacks, étalés sur 450 mètres. Pour créer cette ”rivière” ondulante, Peter Wilhelm, CEO du groupe Wilhelm&Co a fait appel aux prestigieux bureaux de Chapman-Taylor et Jaspers-Eyers. Ensuite, la galerie s’est transformée sous la main de Ron Arad célèbre architecte-designer, connu pour ses idées ultra-modernes. Il faut dire que la Médiacité est une prouesse technique créée à partir d’ETFE (proche du teflon), un matériau anti-réverbant, isolant, transparent et capable d’être posé sur un entrelacement de rubans d’acier. La créativité de Ron Arad surprend par son audace, et si l’ensemble n’est pas du goût de tout le monde, Liège peut se vanter d’être dorénavant une ville moderne.

UN POINT D’ANCRAGE POUR UN QUARTIER DYNAMISÉ Le projet de Wilhelm&Co ne s’arrête pas à la galerie commerçante, elle s’étend à tout le quartier alentour. Autour du pôle commercial, se développent deux autres pans importants : • le pôle logement • le pôle image À côté de la galerie commerçante, plusieurs bâtiments ont été réaménagés le long des rues attenantes : un mouvement qui permet de dyna-



LA MÉDIACITÉ • 6 salles de cinéma

en chiffres

• 160 000 m² de surface construite totale • 3 000 pièces nécessaires à l’installation de la verrière • 1 200 emplois créés dans le centre commercial • 2 350 places de parkings souterraines • 310 millions € pour l’investissement total du projet • 261 000 000 € pour l’investissement total de Wilhelm&Co • 7 000 000 € visiteurs annuels attendus des bâtiments, développée par le BRE (Building Research Establishment). Spécifiquement adaptés aux problèmes rencontrés par la construction durable de centres commerciaux, les certificats BREEAM sont de plus en plus perçus comme la référence européenne en matière d’écologie.

”La Médiacité est le premier bâtiment construit à obtenir le certificat BRREAM en Belgique.”


La Médiacité est le premier bâtiment construit à obtenir ce certificat en Belgique, une manière de prouver encore une fois sa modernité !

NOUS PROTÉGEONS LES ZONES SENSIBLES A une époque où la sécurité devient la préoccupation de tous, A J Security se met au service du particulier et propose un concept de sécurité complet; intervention sur alarme, patrouilles et divers services pour les privés.

AJ Security Tél.: +32. (0)2. 662 01 44 Fax : +32. (0)2. 660 72 89 Mail:

LASNE Sur les hauteurs de Lasne, spacieuse et lumineuse villa Rigaux sur 12 ares bien orientés et privatifs. 5 chambres, 3 salles d’eau... De belles balades à découvrir. EXCLUSIVITÉ. Ref G2416

LASNE Belle villa moderne aux espaces ouverts et bénéficiant d’une belle luminosité. 5 chambres, 3 salles d’eau. Piscine intérieure. 25 ares bien orientés. EXCLUSIVITÉ. Ref G2371

LASNE Maison villageoise avec annexes formant un U autour d’un jardin et cour intérieure. Au total +/- 400 m2 construits et terrain de +/- 6 ares. Une remise au goût du jour nécessaire. EXCLUSIVITÉ. Ref G2355

LASNE Rarissime : dans un de ces lieux magiques de Lasne, belle maison avec écuries, piste et prairies. Une vue splendide et un calme parfait ! Environ 250 m2 habitables et au total 2 hectares 20. EXCLUSIVITÉ. Ref G2405

LASNE Magnifique maison Mi-Casa à l’ambiance exceptionnelle des constructions en bois. De beaux volumes, ensoleillement parfait, piscine intérieure, splendide jardin de 33 ares. 4 à 5 chambres, 3 salles d’eau. EXCLUSIVITÉ. Ref G1956

LASNE À pieds de la jolie place d’Ohain, très belle villa dotée d’un superbe terrain de 49 ares. 3/4 chambres et 2 salles d’eau. 1 boxe. Possibilité d’aménager un 1er étage de +/- 125 m2. Possibilité d’agrandissement. EXCLUSIVITÉ. Ref G2421


Thomas de Dorlodot

à tous vents

Tout juste revenu d’une aventure au Pakistan, Thomas de Dorlodot, pilote de parapente effréné, revient sur ce périple et nous raconte sa quête de sensations fortes et de records du monde... QMarie Delloye

Raconte-nous ton expédition au Pakistan… Quelle expérience ! J’ai été invité par Sébastien Alvaro, un producteur de la télévision espagnole, à accompagner mon ami Ramon Morillas, le champion du monde de paramoteur (parapente à moteur), dans un voyage de 40 jours pour tenter de battre des records. Pourquoi le Pakistan ? Parce que les conditions climatiques et la géographie montagneuse du pays sont idéales ! D’un autre côté, en arrivant là-bas, on s’est vite rendu compte que le challenge était risqué. La semaine de notre arrivée, une équipe de secours était revenue bredouille d’une expédition de sauvetage en haute montagne... Là-bas, au-dessus de 6000 m l’hélicoptère de secours ne vient plus te chercher, et nous volions souvent au-dessus de cette limite… Et très près des reliefs…

”Je monte, je monte et j’atteins 6626 m, record absolu ! Et puis, le black out, …” Pour commencer, nous avons fait quatre jours de trekking avant d’arriver au camp de base situé au pied du Nanga Parbat, première montagne de la chaine de l’Himalaya, haute de 8125 m. Nous sommes restés là 15 jours pour nous acclimater. Au programme : vols de repérage, analyse des vents et surtout, apprivoisement de la montagne… C’est là que Ramon a battu une première fois le record d’altitude en paramoteur ; il est monté jusque 7400 m ! Il l’a battu plus tard en atteignant 7820 m… Tout cela bien sûr avec un masque à oxygène. Là-haut, il faisait -45°c…

Crédit Photos : Thomas de Dorlodot

Ensuite nous avons décidé de changer de zone pour profiter de meilleures conditions. Nous sommes arrivés dans un petit village niché dans un paysage magnifique ! Cet endroit est tellement coupé du monde que les gens y vivent encore en harmonie totale avec la nature, dans une simplicité extrême. Pour moi, l’aspect social de ce voyage était primordial, j’ai été si bien accueilli par ces villageois, que nous faisions presque partie du village à la fin ! Et puis ils étaient très impressionnés par nos parapentes et nos photos numériques prise en vol…

”Là-bas, au-dessus de 6000 m l’hélicoptère de secours ne vient plus te chercher, et nous volions toujours au-dessus de cette limite… Et très près des reliefs…” Quand on atterrit dans des endroits aussi beaux et presque intouchés par la civilisation moderne, on veut faire de son mieux pour les garder intacts… D’ailleurs, notre voyage était entièrement tourné sur l’axe écologique : la société belge CO2logic a calculé le total d’émissions de CO2 émise par l’expédition pour les compenser par la suite, toutes les batteries se rechargeaient par panneaux solaires,…

”Quand on atterrit dans des endroits aussi beaux et presque intouchés par la civilisation moderne, on veut faire de son mieux pour les garder intacts…”

plus de 6000 m, j’appelle Ramon sur ma radio, je lui dit de ne plus monter et de me guider vers le bas… Ce n’est qu’en atterrissant et en analysant ma trace GPS que je comprends que j’ai surpassé le record du monde de Robby Whital de plus de 2000 m… Ramon et moi avons aussi eu la chance de pouvoir donner notre nom à deux sommets qui n’avaient jamais été survolés auparavant ! Si un jour vous passez par là, vous verrez le ”Tom’s Peak” ! Tu as déjà des records en poche, quel est ton rêve maintenant ? Le producteur espagnol rêve de survoler le K2, deuxième sommet plus haut du monde, en montgolfière. Si son projet se concrétise, il est d’accord de nous larguer du ballon au-dessus du sommet en parapente… À 9000 m d’altitude !

Tu es revenu avec des records, quelles sensations as-tu expérimentées ?

Quel souvenir t’a le plus marqué dans toutes tes aventures ?

C’est dans le Karakorum que j’ai pu battre le record du monde d’altitude en parapente sans oxygène. Un jour, après un décollage en parapente à 3600 m, nous sommes rentrés dans une ascendance thermique (courant d’air chaud vertical) qui nous poussait vers le haut à une vitesse de 5 m par seconde, droit vers le ciel !

Cet été, le Red Bull X Alps, une course en parapente et à pied de Salzburg à Monaco, était très dure et j’étais, une fois de plus, le plus jeune participant et le seul Belge en course : j’ai marché la plus longue distance : 679 km en 10 jours dont 119 dans les 28 dernières heures ! Le tout avec un sac de 10 kg sur le dos...

Dans ces moments, le manque d’oxygène te rend euphorique, il te fait perdre un peu tes notions et ton sens commun… Donc, je monte, je monte et j’atteins 6626 m, record absolu, et puis, le black out : je subis une grosse chute de tension et un voile noir masque ma vue, je sais que j’ai très peu de temps avant de m’évanouir en plein vol, entouré de près par des sommets de

Un autre souvenir m’a marqué pour son côté plus extrême : le survol du Machu Picchu au Pérou ! L’atterrissage était moins drôle puisque je me suis retrouvé en prison pendant une journée parce que je n’avais pas d’autorisation !


Vers une société plus


”Soyons le changement que nous voulons voir dans le monde” Gandhi

Guibert del Marmol Dans un monde où tous nos repères sont bousculés, les agents économiques se doivent d’ouvrir la voie vers une pensée ”écodurable” et plus humaine, tout en restant rentable. Guibert del Marmol y croit... et nous aussi! QMarie Delloye

Entrepreneur, auteur et conférencier, Guibert del Marmol est un ancien dirigeant d’entreprises qui se consacre depuis des années à la recherche sur la question du sens et de la conscience. Il est l’auteur de l’ouvrage ”Tomber plus haut” qui fait part des résultats de sa recherche. Il accompagne aujourd’hui les sociétés dans le développement d’une gestion des affaires durable et responsable. Quelle est la base de votre réflexion? Nous sommes aujourd’hui à la croisée des chemins. En l’absence d’une gouvernance mondiale ,seuls des agents économiques éclairés sont aptes à changer puisque ce sont eux qui gèrent la société. Nous devons changer de mentalité et installer une rentabilité plus positive. Ma pensée est très simple: l’harmonie de l’ensemble est la somme des harmonies individuelles. Selon moi, la raison d’être d’une entreprise n’est pas de créer du profit, c’est un outil. Malheureusement aujourd’hui, le profit est devenu une fin en soi...

”Nous allons vers une société meilleure mais la transition est difficile.” Comment réagissez-vous? D’abord je me suis rendu compte qu’il y avait une grosse différence entre ce qui était dit et ce qui était réellement fait, cela s’appelle communément le ”green washing”: l’image environnementale d’une entreprise reste très souvent une image... De là, je me suis dit que j’allais ”murmurer” à l’oreille des patrons pour faire avancer la machine... Je milite pour une attitude plus positive, la construction sur le durable. Selon moi, ce développement plus durable au sein d’une société peut se décliner sur 5 niveaux: 1. Les entreprises appliquent les régulations les plus basiques pour le bien-être général. De temps en temps elles envoient un chèque à Greenpeace pour calmer leur conscience...

us donner pouvez-vo s il e s n o c Quels prises? nts d’entre a e iig ir d x au nt être insp ders doive a ! le ile s c le fa i, o si st pas Pour m nts. Ce n’e se ira s: sp se in o h T c E rés t deux spiré, il fau ître le Pour être in bien conna t e e m ê m nir iso d e r t. Pou eve connaîtr lequel on vi de s in n a so d e e b d mon r a d’abord e d a le se n u e qu’il ra inspirant, 2. Au deuxième niveau se situe l’éco-efficaurage, parc o c e déd p u ent, il doit beauco cité: une politique écologique est instauDeuxièmem lle à créer l. u se rs u toujo nature rée, surtout parce qu’elle peut contribuer ne habilité avec velopper u t humaines e s e tiv à générer du profit... si o er p s n le tio que le ad des rela il la veut dire e s, C n e s. g e 3. Le troisième niveau réunit les sociétés qui s tr u le les a ndément fo ro p d e è im font du ”branding”... C’est là que le ”green il poss e inspirant a et, surtout, ité rs e iv d la washing” fait ses preuves... célèbre milité... notion d’hu vraiment la ituae à la spir ez presqu h c u to s u ”Ma pensée est très simple: Vo ns, je lité... r de religio l’harmonie de l’ensemble Sans parle plus t! n t e u e m p te c e Exa ciété n so e tr o ns, n se e est la somme des he de pense qu ns recherc la sa s, r n e io n n st que fonctio harmonies individuelles” se pose de ui ouvre la n l’o e u q s q san urnant lle à un to ord avec crise appe lus en acc p té La majorité des entreprises se situent autour de ié c ont so e n u voie à entreprises ces trois niveaux. Elles fonctionnent encore au Plusieurs hez c . e s; m ê yé lo -m elle leurs emp à ”risk management”, elles restent réactives sans ix o h ve c ont ou rts donné ce ransisco, ils être proactives... F st n a S à Elle n’en e Google méditation! e d s lle Aux niveaux 4 et 5, les entreprises ne font plus sa des ntable... du développement durable, elles le vivent! que plus re managemen 4. Le quatrième niveau illustre une vraie prise www.cardel de conscience et l’élaboration d’une véritable stratégie qui va passer les décisions économiques au filtre des impacts collatéraux sur l’environnement et le bien-être des individus. Colruyt, par exemple, a su adopter cette pensée tout en restant rentable!

5. La fine fleur des entreprises: celles qui considèrent que leur première raison d’être est de contribuer à la société. La marque ”Patagonia” s’inscrit entièrement dans cette philosophie, et il y en a plus que l’on ne croit! Ces entreprises ont développé une vraie mission, une vision, et des valeurs qui inspirent les autres. Elles se sont posé la question: ”Qu’est ce qui manquerait à la société si on n’existait pas”...

”Notre société ne peut plus fonctionner sans recherche de sens.”


art de vivre

Party j_c[ H]dee^c\X]^X!^Y‚ZhYZeg‚hZcihZiYZ XVYZVjm\djgbVcYh!WdccZhVYgZhhZh edjgYZhg‚kZ^aadchg‚jhh^h n Sandrine Mossiat

Collectors Parce qu’on s’habille pour les fêtes, nombreux sont les flacons de spiritueux et autres alcools à revêtir une tenue d’apparat éditée en série limitée, de bons plans ‘cadeau’, pas toujours plus chers, mais nettement plus chic pour débarquer à une soirée.Si de son côté, la silhouette de Grand Marnier est rehaussée d’une peau de laque groseille, la vodka absolut se fait quant à elle plus rock en arborant une veste en cuir clouté. Et si le Chivas 12 MaGnuM opte pour une version haute couture, rhabillé d’argent et de volutes par Christian Lacroix, le cognac very speCial hennessy a choisi Kesh et David Burrows, deux artistes britanniques pour se faire relooker.

Nobles produits À la fois resto, bar et boutique, Kwint décline les délicatesses issues de la mythique enseigne Kaspia, mais aussi de La Maison de la Truffe à Paris. Mousse au confit de Saint-Jacques, rillettes de saumon, tarama aux œufs de crabe, corail d‘oursin, œufs de poisson, caviars, saumons fumés, foie gras, jambons ibériques…

L Grand-Marnier Irrésistible, 30 € Chivas 12 Magnum, 75 € - T : 02 663 62 62) Vodka Absolut, 13,95 € (en supermarché). Very Special Hennessy, 36 € T : 02 372 96 18

L Kwint - Mont des Arts, 1000 Bruxelles, T : 02 505 95 95 -

Au parfum ! Ni eau de toilette, ni mousse à raser, ces deux vaporisateurs distillent l’un la fameuse huile d’olive provençale du Château d’Estoublon et l’autre de l’huile d’olive aromatisée à la truffe noire. L Huile d’olive du Château d’Estoublon, 14,50 € les 100 ml, chez Rob, T : 02 771 20 60. Spray Maison de la Truffe, 22 € les 125 ml, chez Kwint, T : 02 505 95 95.

Ne pas rester de glace Maître glacier, Philippe Faur produit des glaces et sorbets artisanaux parfumés à la moutarde ou au roquefort, au basilic ou au safran, au vinaigre balsamique ou aux poivrons piquillos. De quoi sérieusement dépayser vos trous normands ! L Sorbets Philippe Faur, 8,98 € les 333 ml, chez Rob, T : 02 771 20 60.


Tout en un !

Livres à cuisiner

Matos et ustensiles, livres et épices, conseils et cours de cuisine, c’est aux Secrets du Chef que ça se passe !

Malins, les éditeurs culinaires nous sortent des coffrets thématiques à l’occasion des fêtes : un livre + l’accessoire culinaire assorti. Chez larousse, on apprécie Foie gras, Terrines & compagnie, une petite terrine en porcelaine blanche contenant 4 mini titres autour du foie gras. Là, 3 sortes de piques à brochettes en bambou, bien utiles pour les idées créatives de l’apéro, ou encore la poche à douille et la technique illustrée pour réaliser des macarons. Chez MiChel lafon, c’est pour le coffret de Gérard Vié que l’on craque et évidemment pour son moule en silicone, parfait pour se lancer dans la confection par exemple d’une terrine de crème de gruyère au gingembre. Chez Marabout, le grand succès, ce sont Mes petites verrines (4 dans la boîte) et Mini cakes (8 petits moules en silicone coloré). Enfin, chez haChette pratique, le top, c’est les 2 paniers avec couvercle pour une cuisine à toute vapeur et les 4 petits coquetiers en porcelaine nacrée qui accompagnent Oeufs et coquetteries.

L Woluwé-Shopping Center. Rue Saint-Lambert 200, 1200 Woluwé-Saint-Lambert, 02 762 03 05. Rue Charlemagne 22, 1348 Louvain-La-Neuve, 010 45 85 05.

L Coffrets Larousse : Tajines et autres saveurs d’Orient, 27,95 €. Foie gras, Terrines & compagnie, 23,45 €. Brochettes gourmandes pour l’apéritif, 22,35 €. Mini cakes a picorer, 22,35 €. L’atelier macarons, 12,25 €. Coffret Michel Lafon : Les terrines, 27,95 €. Cook’in Box Marabout : Mes petites verrines, 15,90 €. Mini cakes, 15,90 €.

Pas si soft que ça Eau-te couture ! Après Jean Paul Gautier, c’est au tour de Paul Smith de faire le Bob cet hiver : le styliste anglais enguirlande le flacon d’evian de ses fameux rubans de couleur.

Coffret Hachette Pratique : Vapeur So chic, 15 €. Oeufs et coquetteries, 15 €

Une pin-up sur un soda ? C’est pas parce qu’on joue les Bob qu’on doit boire ennuyeux ! Celuici est aromatisé au pamplemousse et aux fraises. L Abbondio, 1,80 € les 25 cl, chez Mmmmh !, T : 02 534 23 40.

L 2,99 €, 4,95 € avec le sac assorti. Infos points de vente :

Fines pralines Elles s’appellent ‘Trianon noir’, ‘Cœur framboise’ ou ‘Feuilles d’automne’… du chocolat de qualité, pas trop gras, pas trop sucré, du véritable artisanat, des pralines tellement fines, qu’un kilo, c’est un minimum ! L Pralines Wittamer, 66 €,



(Alexandre Balthazar Grimod de la Reynière)

Ce gastronome du XVIIIe siècle a été tout à la fois le premier critique culinaire, l’inventeur du guide gastronomique et le propriétaire de la meilleure table de Paris. On lui doit aussi un manuel sur l’art de recevoir. Faut-il s’étonner qu’un tel homme ait inspiré son nom et sa philosophie à notre maison…

Etre inventif, développer les plaisirs de la gastronomie et offrir le meilleur de la table pour vos événements et vos réceptions : telles sont les valeurs qui nous animent depuis 1972. Route de Genval 9 B-1380 Lasne Tél: 02/633 37 75 - Fax: 02/633 20 48 e-mail :


Visitez notre site


art de vivre

Vite des bulles, n Sandrine Mossiat


8jk‚ZhYÉZmXZei^dc Grand Siècle Cuvée de prestige de la maison Laurent-Perrier, qui par ailleurs vient de mettre sur le marché un millésime 2000 craquant de fraîcheur, le flacon de Grand Siècle (soit un assemblage de grands crus prestigieux et d’années millésimées) est désormais supporté par une élégante aiguière en étain, le tout conditionné dans un joli coffret en bois. L L’Aiguière Grand Siècle de Laurent Perrier, 400 €, (02 732 90 01)

Chêne rosé

Le champagne de James Bond

Après la Cuvée Brut 225 (soit la contenance en litres des fûts de chêne dans lesquels cet assemblage est vinifié), voilà que les champagnes nicoLas FeuiLLatte lancent une version rosée. Délicieux sur un bar de ligne, mousseline de morilles, oignons caramélisés, ragoût de fèves à la crème de sarriette.

La maison BoLLinger est réputée pour ses vins puissants (assemblés majoritairement à base de pinots noirs), pour ses élevages en fûts de chêne et ses cuvées millésimées tout récemment dégorgées. Des champagnes vineux, parfaits pour la table, d’une très grande fraîcheur, un must pour les connaisseurs ! La Grande Année 2000 se sert dans des verres tulipe aux environs de 10 degrés.

L Cuvée 225 Rosé Millésime 2004, 58 € (03 248 01 88)

L (02 410 47 47)

Fondu de plaisir Pour célébrer les 50 ans de sa cuvée de prestige, et l’arrivée du DoM ruinart 1998, dernier millésime tout juste mis sur le marché, la maison Ruinart a fait appel à Maarten Baas. Tout en poésie, le designer hollandais a imaginé un seau comme fondu sur un plateau et des pieds de flûtes eux aussi semblant en plein dégel et reposant sur une petite flaque d’eau. L Le coffret Dom Ruinart 1998 et ses 2 coupes, 265 €, (02 372 96 18)



Pour ceux et celles que l’effet vintage interpelle, Lanson détient une belle collection de cuvées millésimées. Sachant que le style de la maison se joue sur la puissance et la fraîcheur, on se précipite pour déguster les années 1989,1983 et 1976 ou l’on retient que 1995 et 1996 sont de très, très grands millésimes. L Champagnes Lanson, Fourcroy (02 423 71 11)


Eclatante, théâtrale, ultra glam, la housse en néoprène grenadine, sa dragone et son porte-clé garni de charms qui barde la bouteille de Brut Cordon Rouge de g.H MuMM. L G.H. Mumm Dinner Jacket, 32,50 €, 02 663 62 62)

Pour passer l’hiver, nicoLas FeuiLLatte emmitouflent ses cuvées de doudounes isothermes : couleur neige pour le Blanc de Blancs 2000, ébène pour la Grande Réserve, Bleu lagon pour le Brut Réserve Particulière. L Siberian Dream : 39,90 €, Black Coat : 29, 90 €, Blue Electric : 34 € (03 248 01 88)

Un coffret, une bouteille, 2 verres long drink qui font la nique aux flûtes traditionnelles, VeuVe cLicquot ? Un style tout en élégance et en impertinence. L Trendy Design Box, 55 €, (02 372 96 18)

K^chbdjhhZjm Olé, les bulles ! On ne le dit jamais assez : mieux vaut un grand cava qu’un petit champagne. Celui-ci, qui subit une seconde fermentation en bouteille de minimum 24 mois (contre 15 mois pour un champagne ordinaire), est carrément d’exception ! L Pere Ventura Tresor Brut Nature, à partir de 10 €, Basin Marot, (02 347 64 66)

La fête ou rien ! 100% naturel, Martini Brut est un spumante tout en légèreté. Fidèle à sa devise " No Martini, no party " le quatuor box ne contient pas moins de 4 bouteilles de Martini Brut et 2 verres. Que la fête commence ! L En vente en supermarchés, 30 €.

Nature Pétillant naturel produit selon la méthode ancestrale, ce vin mousseux de la Loire offre de fines bulles rosées. Délicieusement sain, voilà de quoi éviter la barre du lendemain. L You are so bubbly by Nathalie et Christian Chaussard, 11,82 €, La Boîte des Pinards (02 347 23 03)



art de vivre

... Vite des bulles, EVgini^bZ

Trois en un One : un seau pour une bouteille qui s’allonge royalement dans la glace. Two : chic ! de la place pour une deuxième bouteille, la première se vide toujours tellement vite… One again : enfin un récipient pouvant accueillir un magnum, le contenant dont Churchill disait qu’il était le volume idéal pour 2 gentlemen. L One-two-one, 28,90 €, (02 511 45 60)

Faites-vous un fleur Produit artisanal australien, cette fleur d’hibiscus sauvage est conservée dans un sirop à base de sucre de canne et d’eau de source. Glissez-la dans une flûte, remplissez avec un Crémant d’Alsace Brut et dégustez une fois le verre vide. L Wild Hibiscus Flowers, 8,99 €, en vente en supermarchés (02 870 51 42)

Ca c’est palace ! Le cocktail Romanov est une création de Yohan, le barman du Grand Hôtel Loreamar à Saint-Jean-deLuz. Dans un très long verre, posez des quartiers d’orange, 1 cl de vodka Grey Goose, 2 cl de Mandarine Napoléon et 12 cl de champagne brut, style Moët & Chandon. L

Effervescence ! Bien que la marque portant son nom ait été vendue à une autre branche de la famille, Virginie Taittinger continue à se montrer l’une des ambassadrices les plus éloquentes de la Champagne. Sur son site (, on découvre mille et uns conseils de dégustation pour mettre au mieux en valeur bulles et champagnes. Mais surtout, on commande la cuvée Virginie T., un Brut non millésimé composé à 85 % de Premiers Crus dont 2/3 de Pinots pour la structure, la rondeur et le fruit et 1/3 de Chardonnays pour la fraîcheur. Pour les nouveaux clients, la bouteille (vendue par caisse de 6 livrée gratuitement) est à 25,60 ` (au lieu de 32 `). Belle affaire pour les réveillons ! L


ttre e m r u o p el Petit rapp les en valeur bul perles etne se boit bien frais,sjailmcoanis-

, plu pag Le cham il est jeune et vif Un s degrés). glacé. Plu le servir frais (8 pu s simé de ou millé viendra ére g n tu o a ne m ez le c champag degrés. Proscriv la e rb pertu 0 aîcheur fr portera 1 . e rs d u e p ar tro t des sav lateur, c arômes e s e d n o percepti bouteille plonge la laçons, n o : u sea de g Dans un élange d’eau et en m pérature m n te e n n dans u o alors à b elle sera utes. in 15 à 20 m uteille he la bo c u o c n tre o ois à qua érateur : Au réfrig du réfrigérateur tr ut même e as rvir ; on p dans le b t de la se condition n a à v , a s s p m te heure g ela n stante ; c r plus lo la laisse érature reste con uteille au bo mp urs une que la te voir toujo ’a d t e perm frais !


Palme d’or Paris 2003

© M I R E I L L E




D I R E C T O R : A . P I N T O

H A B I L L E E :





Our New Yearʼs Eve Menu Now Available on Belga Queen Bruxelles Tel.: +32 (0) 2 217 21 87 E-mail















art de vivre

Mumm ;nY[bb[dY[[jWkZWY[ 126

G.H MUMM en chiffres     

L’excellence d’un produit du terroir Lovées au cœur des innombrables collines qui entourent Reims, les vignes de pinot noir, chardonnay et pinot meunier laissent déjà percevoir l’étendue d’un savoir-faire unique, d’une qualité cultivée avec patience depuis des siècles dans cette magnifique région ! Issu de ce terroir exceptionnellement riche, le champagne G.H. Mumm se distingue depuis 1827, par sa qualité et la quête sans cesse approfondie d’une Maison dont les voyages autour du monde et le multiculturalisme sont un gage de perfectionnisme constant. Dès l’origine, la famille Mumm dont la lignée d’origine allemande remonte au XIIème siècle, décide de franchir la frontière pour s’installer en Champagne. En s’associant avec un champenois G. Heuser, la famille Mumm installe une politique d’approvisionnement originale pour l’époque : acheter directement les raisins aux vignerons situés sur les “fins lieux” de la vallée. La devise de la maison coule de source: “ Seulement le Meilleur ”.

Un esprit audacieux et aventurier Grâce à son esprit innovateur et audacieux, Georges Hermann Mumm offre à son champa-

8 millions de bouteilles vendues chaque année 24 millions de bouteilles stockées dans 25 km de caves 3ème marque mondiale 1ère marque en France 200 000 bouteilles vendues en Belgique chaque année

gne une place de choix dans les plus grands succès humains et sportifs. C’est d’ailleurs avec beaucoup de panache que le commandant Charcot, premier français à traverser l’Antarctique en 1904, débouche avec son équipage et sur la banquise, une bouteille de Cordon Rouge… Quelle meilleure preuve de caractère!

blage : une alliance de vins clairs et vins de base qui se rapprochera le plus de l’esprit Maison incarné par la légendaire cuvée Brut Cordon Rouge, dont la composition réunit chaque année jusqu’à 77 crus !

Cet esprit audacieux continue aujourd’hui à donner ses lettres de noblesse au champagne Mumm lors des célébrations “ Label of Success ”. En effet, G.H. Mumm célèbre le succès et la réussite de personnes, de disciplines faisant preuve d’audace. Partenaire officiel des podiums de Formule 1, il a également célébré les victoires d’Ellen McArthur, de Tom Avery et de Vincent Rioux.

Si la Cuvée Brut Cordon Rouge représente la signature de la Maison Mumm, elle n’en reste pas moins entourée d’une sélection prestigieuse de Grand Crus d’exception !

Deux siècles de perfectionnement oenologique Le souci de perpétuer le style Maison au travers des siècles est une lourde tâche qu’il incombe au Chef de Cave, Didier Mariotti, d’accomplir. En tant qu’héritier d’un savoir-faire, d’une tradition transmise depuis plusieurs générations, ce jeune Chef de Cave se doit de maintenir l’équilibre si fragile entre fraicheur et intensité, tout en y apportant sa touche personnelle. Cet équilibre subtil prend forme lors de l’assem-

Un palmarès de légendes

Longtemps réservé à un cercle très restreint d’amis de la Maison, le Mumm de Cramant est issu exclusivement des chardonnays du village de Cramant, classé Grand Cru depuis 1911. Inspirée par la rose de l’artiste japonais, Léonard Foujita, la cuvée Brut Rosé est très appréciée pour sa touche fruitée qui la distingue finement du Mumm Cordon Rouge. À cette sélection peuvent s’ajouter la cuvée Grand Cru, le Mumm Millésime 1999 et le Mumm Laloux qui rend hommage au président emblématique de la Maison.   Marie Delloye


art de vivre

Ces quartiers qui ont du Goût ! JcZVbW^VcXZW^ZchZci^Z!jchinaZ ine^fjZ!jcZheg^ieVgi^Xja^Zg½ ¿X]VfjZfjVgi^ZghZhZchZ^\cZh[‚i^X]Zh


n Marie Delloye

6jidjgYjEVgk^hZiYZaVEdgiZYZ=Va!XV[‚hYZfjVa^i‚ZigZhiVjgVcihhe‚X^Va^h‚hg^kVa^hZci YZWdc\d’iYVchjcZheg^ifj^hZkZji[^YƒaZVjWdj^aadccVciHV^ci"<^aaZh#

la maison du peuple

Flâneries gourmandes

Le Parvis de Saint-Gilles est devenu " the place to be" depuis l’arrivée de la bobo chic Maison du Peuple ! Une déco qui alterne matériaux modernes et traditionnels en bois brut, un grand bar spacieux, des concerts live, des expositions et projections de courts-métrages… Tout un programme ! Ce café branché est devenu le lieu de rendez-vous des amateurs de tous horizons !

Ce charmant restaurant francobelge propose une cuisine raffinée, concoctée à base de produits frais du marché. Le service est impeccable, la déco sobre mais chaleureuse. Nous vous conseillons vivement d’y faire un tour pour le goûter, les desserts sont à tomber ! Attention, l’endroit est petit, l’adresse est à garder pour des moments de bonheur à deux ou trois !

midi station

rouge skaya

La dernière création d’Antoine Pinto apporte un air plus " design" au quartier du midi qui semble revivre de plus en plus. Dans cet espace joliment tamisé et décoré dans des tons sombres et argentés, les tables sont placées de chaque côté de l’allée principale, et le long de grands bars et cuisines ouvertes. Moderne et ultra-confortable, le restaurant propose une cuisine bien garnie de mets savoureux et originaux… Une adresse à découvrir sans tarder !

En plein cœur de ce quartier qui bouge de plus en plus , le Rouge Skaya est un must ! Un restaurant de blinis qui mêle admirablement œufs de poissons et saumons, un bar à vodkas qui propose un choix incroyable de cocktails concoctés avec les meilleures vodkas du moment ! Savourez les spécialités russes tout en écoutant le patron vous conseiller la boisson la plus séduisante !

Rue Berckmans 2 1060 Bruxelles T : 02 537 32 20


Rue de Moscou 13 1060 Bruxelles T : 02 544 13 01

39, Parvis de St Gilles 1060 Bruxelles

Place Victor Horta, 26 1060 Bruxelles T : 02 526 88 00



Live music entertainment by


... as from midnight


PLACE VICTOR HORTA 26 B-1060 BRUXELLES I T + 32 (0) 2 526 88 00 I F + 32 (0) 2 526 88 01

© Photographer : Mireille Roobaert

NEW YEAR'S EVE 31.12.2009

art de vivre


:cigZigVY^i^dcZibdYZgc^i‚!ZcigZaZh‚iVc\hZiaZjghWZaaZhbV^hdch!ZiaV X]Vjhh‚ZYÉ>mZaaZh]‚i‚gdXa^iZ0aVeaVXZ;aV\ZnVii^gZaZheVhhVcihYZidjh}\Zh! edjg\d’iZg|aÉVbW^VcXZjc^fjZZiidj_djghXdck^k^VaZfj^ngƒ\cZ

QuarTier liBre

Trop Bon

Ce restaurant rempli de charme propose une sélection de quatre mini plats à choisir parmi des catégories de " viandes ", " poissons ", " pâtes " ou " salades ", réunies sur un plateau qui vous surprendra par ses saveurs originales !

Tout en bas de la chaussée de Vleurgat, ce petit restaurant propose des lunchs délicieux et bio ! Faites le plein de saveurs à midi, entre amis ou en déjeuner d’affaire ! Chez Trop Bon, la philosophie est à l’heure du durable, et on le sent dans son assiette ! À vous de choisir ce qui vous fera du bien, entre une série de soupes savoureuses, des tartines à croquer et des plats du jour à tomber !

le VariéTés

Bar du Marché

Juste en face du Bar du Marché, Le Variétés est un des piliers de la restauration belge traditionnelle. La salle en L donne sur une cuisine ouverte où trône une superbe rôtissoire, ce qui vous donne tout le loisir d’admirer le ballet incessant des cuisiniers ! La déco en bois brut rappelle l’esprit des années 30, les plats rivalisent de qualité !

Petit mais cosy, le Bar du Marché résonne souvent jusqu’au bout de la nuit des rires des clients ! Idéal pour un apéro entre amis, situé à deux pas de la place Flagey, le Bar du Marché est à découvrir sans attendre !

Chaussée de Vleurgat 1 1050 Bruxelles T : 02 640 40 57


1, Place Flagey 1050 Bruxelles

Rue de Trèves 44 1050 Bruxelles T : 02 230 41 94

4, Place Sainte-Croix 1050 Bruxelles T : 02 647 04 36


The brand new bar/resTauranT in The hearT of The ciTy & The famous â&#x20AC;&#x153;bois de la cambre open 7/7 - closed on monday Avenue de Flore - Floralaan 3-4, B-1000 Brussels - Phone +32 2 640 19 68

Photographe : lisa carletta - make up : marzia conti - styliste : olivia@ câ&#x20AC;&#x2122;est chic - model : cindy arriaz@new models

Urban and nature

art de vivre


;^YƒaZ|hVkdXVi^dcegZb^ƒgZYZXZcigZbVg^i^bZYɂX]Vc\Z^ciZgcVi^dcVa!6ckZgh cZXZhhZYɂkdajZg8dhbdeda^iZZiigƒhine^fjZZcb„bZiZbeh!aVk^aaZcViVaZYZ GjWZchgZXƒaZYÉVYgZhhZh\Vhigdcdb^fjZhhjgegZcVciZhZiYZ\gVcYZfjVa^i‚½


VelVet lounge

Le café-restaurant Zuiderterras se présente comme un navire amarré le long de l’Escaut, tout près du cruiseterminal et de la terrasse piétonne du même nom. À travers les vastes baies vitrées, vous pouvez admirer le va-etvient des navires. La cuisine du chef Steve Conard se distingue par les contrastes que l’on peut trouver dans ses plats contemporains et inventifs, créés à base d’ingrédients du marché… Une adresse à découvrir !

Relax, take it easy ! Bienvenue dans ce restaurant-bar aux accents de " chill music ", confortable et convivial. La carte, originale et bien garnie, s’inspire de la cuisine " fusion " tout en restant assez traditionnelle pour séduire tout le monde ! Plus tard dans la nuit, ce restaurant résolument branché se transforme en rendez-vous des fêtards qui se bousculent au bar pour gouter les cocktails détonants !

la PomPhuis Cette ancienne pompe à eau abrite aujourd’hui l’un des meilleurs restaurants d’Anvers ! Dans un décor très épuré, design, illuminé par les grandes fenêtres qui jalonnent ce bâtiment du début des années 20, vous pourrez choisir parmi des mets plus appétissants les uns que les autres ! Du filet de pigeon d’Anjou au demi homard grillé, en passant par le foie gras poêlé et sa mousse de fromage de chèvre… Laissez-vous tenter !

Luikstraat 6 2000 Anvers


Siberiastraat Z N 2030 Anvers T : 03 770 86 25

Ernest Van Dijckkaai 37 2000 Anvers T : 03 234 12 75


Menu traiteur Ă emporter pour le rĂŠveillon de noĂŤl du 24 dĂŠcembre et le rĂŠveillon du nouvel an du 31 dĂŠcembre . La terrine de foie gras, brioche et confiture Ă  lâ&#x20AC;&#x2122;oignon *** Les filets de soles aux ĂŠcrevisses, beurre au Chablis OU

Les ravioles Ă la truffe *** Le faisan farci, sauce fine champagne, purĂŠe de celeri rave, pommes croquettes et airelles. OU

Le filet de biche sauce grand veneur purĂŠe de celeri rave, pommes croquettes et airelles. *** 42â&#x201A;Ź par personne, menu Ă emporter le 24/31 dĂŠcembre avant 15h. Â&#x161;NoGPNGXGOGPVFGXQVTGEQOOCPFGWPPWOĂ&#x192;TQXQWUUGTCCVVTKDWĂ&#x192;CHKPFGRCTVKERGT CWVKTCIGCWUQTVSWKXQWURGTOGVVTCFGRGWVGVTGICIPGTWPYGGMGPFRQWTFGWZ RGTUQPPGUGP0QTOCPFKGÂş*QPHNGWTÂşNoJQVGN.GDGNNGXWG


Chez Lucien

8]VfjZbd^h!aZhX]Z[hYZBbbb]!aÉZheVXZW^ZcXdccjYZ XdjghYZXj^h^cZ!cdjha^kgZciaZjghbZ^aaZjgZhgZXZiiZh½ Potirons Toutes ces courges sont des cucurbitacées. Essayez-les de toutes les manières : en soupe, en purée, en galettes, en gnocchi, ou simplement poêlées, qui a dit que les saveurs de l’automne étaient monotones ? En cette saison, n’oubliez pas non plus les champignons, les pommes, les poires, les betteraves, les chicons (de pleine terre, bien entendu) et la salade de blé ! Mon petit marché du mercredi! Mercredi après-midi, c’est légumes de saison, et j’aime aller chercher mes légumes bio, en voisin, place du Châtelain. Et en ce moment, les potirons de toutes sortes sont rois, butternut, potimarrons et courges spaghetti, des couleurs, des saveurs, des textures. Mon chouchou, c’est le potimarron, si tendre que l’on peut tout manger – oui, même la peau – avec ce parfum de chataîgne et cette texture fondante… Mes légumes, je les prends chez Vincent Cantaert. Il propose une gamme toujours saisonnière de produits provenant soit de son jardin, soit de fournisseurs sélectionnés avec soin. Marché du Châtelain - Place du Châtelain - Ixelles 1050 - Mercredi de 13 à 19.00 - Vincent Cantaert est également présent avec ses légumes bio le samedi matin, place Flagey


H_iejjeWkfej_cWhhed"Y„f[i[j`ki Z[Yh[iied >c\g‚Y^Zcih &WdiiZYZXgZhhdc✚&edi^bVggdc✚&#*AYZWdj^aadcYZk^VcYZ bV^hdc!djZcWdXVa✚&d^\cdc✚(%%\YZg^oXVgcVgda^✚ &*XaYZk^cWaVcX✚-%\YZeVgbZhVc✚(%\YZWZjggZ✚' \djhhZhYÉV^a✚'X|hY]j^aZYÉda^kZ✚ed^kgZcd^gYjbdja^c✚ hZaYZXj^h^cZ✚(%%\YZXƒeZh[gV^hdj*%\YZXƒeZhh‚X]‚h Eg‚eVgVi^dc 8DBB:C8:GE6GEGwE6G:GA:?JH9:8G:HHDC/:;;:J>AA:GA:8G:HHDC!A:A6K:G HD><C:JH:B:CI:IA:7A6C8=>G'B>CJI:H96CH9:A¼:6J;GwB>HH6CI:#:HHD" G:G!EJ>H=68=:G;>C:B:CI6J8DJI:6J#96CHJCEDËADC!;6>G:8=6J;;:G& 9A9J7DJ>AADC!6?DJI:GA:8G:HHDC=68=w:IG:8I>;>:GA¼6HH6>HDCC:B:CI# GwH:GK:G# EGwE6G6I>DC9JG>HDIID/9w8DJE:GA68=6>G9:EDI>B6GGDC:C9wH9:*BB 9:8ÔIw:CK>GDC#A:H;6>G:G>HHDA:GFJ:AFJ:HB>CJI:H96CHJC:EDËA:6K:8 JCE:J9¼=J>A:9¼DA>K:#H6A:G:IED>KG:G#GwH:GK:G# C:IIDN:GA:H8=6BE><CDCH!A:HwB>C8:G:IA:H;6>G:G:K:C>G96CHJCKD>A: 9¼=J>A:9¼DA>K:6K:8JC:<DJHH:9¼6>A#G:I>G:GA6<DJHH:9¼6>A:IEDJGHJ>" KG:A68J>HHDCFJ:AFJ:H>CHI6CIH!H6A:G:IED>KG:G#GwH:GK:G# H>A¼DC:BEAD>:9:H8=6BE><CDCHHw8=wH!A:H;6>G:9¼67DG9IG:BE:GJC: =:JG:96CH9:A¼:6JI>Î9:!EJ>HA:Hw<DJII:G#:CHJ>I:!KDJHEDJK:OA:HJI>A>" H:G8DBB:9:H8=6BE><CDCH;G6>H# ;6>G:8=6J;;:GA:7DJ>AADC:IA:B6>CI:C>G6J8=6J9#

Edjg [V^gZ eajh _da^! \VgYZo YZ Xi‚ jc eZj YZ edi^bVggdc! fjZafjZh XƒeZh! Zi [V^iZh fjZafjZhXdeZVjmÄchYZeVgbZhVc#9gZhhZo aZ g^hdiid hjg jcZ Vhh^ZiiZ X]VjYZ VkZX jc ZbedgiZ"e^ƒXZ!ZcV_djiVci·Vj"YZhhjhYj g^hdiid · aZh XjWZh YZ edi^gdc Zi aZh XƒeZh g‚hZgk‚h!ZiaZhXdeZVjmYZeVgbZhVc#



art de vivre

Lavazza JekjbÊWhŽc[ Z[bÊ?jWb_[ Même si le géant du café italien, pionnier du concept de capsules, n’a plus sa réputation à faire, il ne cesse de grandir à la recherche de goût et d’innovation. Depuis 18 ans, Service Plus fait parvenir aux entreprises et à l’HORECA ses délicieuses capsules Lavazza, en Belgique. Le service mis en place est réellement impressionnant par sa qualité et sa rapidité. Un simple coup de fil et, dans les 24 heures, un technicien Lavazza achemine les capsules et répare les machines, si besoin est. Au moindre problème, une machine de remplacement est mise à disposition... Adieu les commandes interminables sur Internet et le manque d’aide, Service Plus s’occupe de tout ! Fort de son expérience, Service Plus possède un showroom de 1700 m² qui présente les 15 modèles Lavazza, de la simple machine à café au distributeur de pompe à essence, tous munis des capsules mythiques, déclinées en 23 goûts authentiques et savoureux ! Ces machines ultra-pratiques présentent une panoplie d’avantages, entre autres, la capacité à produire un café, un thé et un consommé en même temps et sans aucun problème d’hygiène et d’interférence de goût ! Un café ?


Service Plus Avenue Reine Astrid 58A 2550 Kontich

L’étonnant parcours de l’Estaminet Clément n’est plus à raconter… Il était une fois… France épaulée par ses filles: Valérie, Julie et Marie… un team de nanas époustouflantes toujours prêtes à satisfaire leur clientèle …




230 rue de la Bruyère à 1332 Genval Tél.: 02. 652 33 92 Ouverture: 12h00 à 15h00 et 19h00 à 22h30 – Fermé le dimanche et jours fériés Plat du jour : 8 € - Tapas en été et durant la saison hivernale, un banc d’écailler! BELLE TERRASSE


art de vivre

Que faire ce


Dévalez les pentes à ski, glissez sur la patinoire de la Grand-Place, créez votre propre parfum ou découvrez un nouvel espace de dégustation de thé…Autant d’activités qui éveillent les sens et annoncent un hiver plus doux !


QMarie Delloye

VITE, VITE AU PIED DES PISTES ! Les voyageurs pressés de chausser leurs moonboots pourront attraper des trains Thalys spécial Neige, tous les samedis, du 19 décembre au 17 avril 2010, au départ d’Anvers Central et Bruxelles-Midi ! Imaginez : vous entrez dans le train à 8h19 et quatre heures après, vous êtes à Chambéry… Prêt pour une belle saison de glisse ? Surfez vite sur !

L’ANTICHAMBRE… L’ART DES SENTEURS Il fallait l’inventer, Anne Pascale Mathy-Devalck l’a fait… Une boutique où l’on crée son propre parfum, où l’on choisit chaque senteur en pensant à ce qui nous va le mieux, c’est maintenant un rêve devenu réalité ! Après avoir sélectionné l’un ou plusieurs d’entre eux, Anne Pascale crée, dans des tubes à essais, le parfum qui désormais vous accompagnera. Lorsque votre choix est fait, dans son laboratoire, elle prépare le mélange avec soin. Le design du flacon a été choisi avec attention et reflète l’esprit secret et raffiné de la Maison… Ici, ne craignez pas que votre formule ne s’évapore. Ouvert à partir du 15 décembre 2009


13 place Georges Brugmann 1050 Bruxelles

Quoi de mieux que de profiter de la neige et des montagnes en hiver ? Passer la nuit sur les pistes dans une authentique auberge de montagne, savourer un déjeuner hors du temps avec une cuisine au feu de bois, découvrir la vraie cuisine savoyarde, se laisser masser et profiter d’un hammam après une rude journée de ski... Autant de grands moments de bonheur bien mérités ! Réservez vite vos billets pour La Plagne, une station hors du commun !

art de vivre

TEA TIME Un merveilleux cocon de douceur accueille depuis novembre les visiteurs qui souhaitent profiter d’un goûter d’exception au Barsey Hôtel ! Dans une ambiance tranquille, confortablement installés dans un des meilleurs hôtels de la ville, vous dégusterez une variété de thés de haute qualité, qui s’accompagneront avec merveille d’une part de tarte ! Une activité qui peut vite devenir tradition ! WARWICK BARSEY HÔTEL 381-383 avenue Louise, 1050 Bruxelles Tél. : 02. 641 51 36 -

ECHAPPÉE BELLE DANS LES GRISONS Au cœur de la Suisse, la région des Grisons attire chaque année un public féru de ski, de sensations et de confort haut de gamme ! Avec St. Moritz, Davos et Arosa, les Grisons abritent des stations touristiques de renommée mondiale : entre glisse, centre de Spa, aventures sportives et gastronomiques, choisissez la station qui vous va le mieux !

ODETTE EN VILLE Forte du succès de son premier hôtel de charme près de Florenville, Odette débarque en ville et pas n’importe où ! C’est dans une des magnifiques maisons de maître, au cœur de la place du Châtelain, qu’Odette a installé son nouveau hôtel… Un grand escalier en fer forgé mène aux huit chambres décorées dans des tons sobres et élégants jusque dans les détails. En bas, le lounge bar et le restaurant proposent des en-cas et rafraîchissements dans un décor signé Marcel Wanders et Casa Milano…

BOZAR SUNDAYS GOOD AFTERNOON Durant tout le Festival Europalia, Bozar Studios, le département d’Éducation à l’Art du Palais des Beaux-Arts, accueille les familles pour diverses activités autour de la Chine.

Une vraie découverte à partager en amoureux ! 25 rue du Châtelain, 1050 Bruxelles Tél. : 02. 640 26 26

PLAISIRS D’HIVER Comme chaque année, le marché de Noël et la patinoire de la Grand-Place s’installent pour notre plus grand bonheur ! Quoi de plus amusant que de se balader entre les cabanons qui proposent cadeaux de Noël et vins chauds, de glisser sur cette incroyable patinoire en attendant Noël ? L’esprit chaleureux et l’ambiance conviviale ne manqueront pas d’illuminer votre weekend !


Du vendredi 27 novembre 2009 au dimanche 3 janvier 2010.

Grâce à la formule Bozar Sundays Good Afternoon, petits et grands découvrent la Chine sous toutes ses facettes ! Entre une visite guidée des expositions Fils du Ciel (pour les enfants) et The State of Things, Brussel/Beijing (pour les parents), et des ateliers de création artistique, petits et grands profiteront des expositions comme il se doit !

art de vivre

Le B19


>ciZgk^ZlYZ ?d]c"6aZmVcYgZ7d\VZgi Quelles sont les origines de ce bâtiment ? Le B19 était incorporé dans ce qui était à l’époque un quartier sportif, le bâtiment abritait un centre culturel et le château (David Lloyd) tenait lieu de club House. Il y a une quinzaine d’années, Stéphane Jourdain a acheté tout le lot et il a installé son Cercle de Lorraine dans le château. C’est tout naturellement qu’il a pensé à mon père, Rudy Bogaerts pour racheter ce qui est aujourd’hui le B19, afin d’y installer son école et les bureaux de son journal le Père UBU. Après le décès de mon père, j’ai eu envie de rendre au bâtiment son caractère originel de centre culturel. En 2007, nous avons entrepris les travaux, l’école a été déplacée au rez-de-chaussée, et le B19 est né ! Grâce à des marques prestigieuses comme Porsche, Laurent Perrier, Jet Import et Marie’s Corner, le B19 est vite devenu un centre haut de gamme. Quelles sont les activités privilégiées du B19 ? Tout est possible au B19, tant que le respect des voisins est observé. De la vente de vêtements aux mariages, séminaires, expos, ou conférences de presse, les 500 m2 du B19 offrent une infinité de possibilités ! Le cadre est très beau, le rapport qualité-prix exceptionnel ! Nous proposons un concept d’" Event at Home ", pratique, confortable et qui a déjà fait ses preuves !


B19 Avenue Van Bever 19, 1180 Uccle

Barsey RestauRant & lounge

Le BarSEy Lance ses noUveLLes SoiréES VELVEt LouiSE toUs Les VEndrEdiS ! «Jazzy Velvet Louise»

Chaque 2ème et 3ème vendredi du mois

«Exquisitely fabulous dinner»

Chaque 1er vendredi du mois

Speciale «Ladies First» Menu trois services à 45 `(soit 22,50 ` pour les filles) concocté par Jean-Philippe Bruneau et soirée mixée par le DJ résident.

Une chanteuse, un pianiste,… laissez vous emporter le temps d’une soirée live music!

Une création unique et une présentation extravagante... des plats signé Jean-Philippe Bruneau.

Chaque dernier vendredi du mois.

LaIssez-voUs envoUter...

avenue Louise 381/383 I 1050 Bruxelles I table booking +32 (0)2 641 51 36 I

art de vivre


8WYWhZ_\…j[b[i'''WdiZkZW_gk_h_ n Sandrine Mossiat

Naissance d’un rhum blanc C’est en 1862 que Don Facundo Bacardi de Santiago de Cuba, après des années d’expérimentation au gré de divers ingrédients et méthodes de production, met la dernière main à la recette finale pour la production du premier rhum blanc élevé en fûts de chêne, un alcool plus raffiné que les rhums traditionnels. Intitulé Rhum Bacardi Superior, celui-ci va inspirer la création de nombreux cocktails mythiques comme le mojito, le daiquiri, le piña colada ou le Cuba libre.

prise au bar de l’Hôtel Venus à Santiago de Cuba que Cox baptisa son cocktail ‘Daiquirí’, du nom de la ville où il avait inventé ce cocktail. Ensuite, c’est en le goûtant qu’un de ses compatriotes, l’officier de marine Lucius W. Johnson, l’emmena dans ses bagages (ainsi que quelques caisses de rhum) pour se le faire servir dans d’autres ports du monde.

L’invention du daiquirí Le daiquirí a été inventé par Jennings Stockton Cox, un ingénieur américain et chercheur d’or à Cuba. À l’époque, les mineurs recevaient, en plus de leur salaire, une ration mensuelle de tabac. À la demande de Cox, ils recevaient également une réserve de Rhum Bacardi Superior. Remarquant que ses ouvriers le mélangeaient avec du café et cherchant lui-même une manière rafraîchissante de déguster son Bacardi, Cox le mixa un beau jour de 1898 avec du jus de citron vert, du sucre et une poignée de glace. L’essayer, c’est l’adopter, c’est lors d’une pause



*XaYZ7VXVgY^Hje Zg^dg '!*XaYZ_jhYZX^igd ckZgi 'X#|X#YZhjXgZgV [[^c‚ FjZafjZh\aVdch &fjVg i^ZgYZX^igdc kZgiedjgY‚XdgZg

FbWY[pjekib[i_d ]hƒZ_[djiWl[Y b[i]bW‚ediZWdi kdi^Wa[h[j i[Yek[p\[hc[c [dj$JWc_i[p ZWdikdl[hh[Z[ cWhj_d_h[\he_Z _$ :ƒYeh[pWl[Ykd gkWhj_[hZ[Y_jhed  l[hj[d`WcXWdj b[XehZZkl[hh[ $

Edition anniversaire


Pour célébrer les 111 ans du daiquiri, la maison actuellement installée à Puerto Rico édite la Bacardi Superior Limited Edition Heritage Bottle. Seulemeny 84.014 exemplaires dont 1.400 bouteilles à peine sont proposées à la vente en Belgique. La Bacardi Limited Edition Heritage Bottle est livrée dans un coffret en bois noir. Disponible en Belgique dans les commerces spécialisés à partir de décembre 2009 au prix de 29,99 `.

L’Elephant Blanc* ´

*art de la table

À L’Eléphant Blanc, l’art de la table se savoure en toute intimité. Au cœur de cet espace décoré magnifiquement dans un subtil alliage de voilages blancs et de structures en bambou, l’espace cuisine propose chaque mois un menu " découverte de saveurs " inspiré de la cuisine du monde. Une invitation au voyage irrésistible qui réveille les papilles grâce aux délices préparés pour vous par un spécialiste. Une véritable escapade gourmande au cœur de la ville !

Venez à notre soirée culinaire du 26 Septembre : “ Soirée mille et une nuits ”. La cuisine du Maghreb sera à l’honneur.

L’Elephant Blanc Chaussee de Bruxelles, 423 1410 Waterloo T : 02 351 05 15 GSM : 0497 50 12 13



schmitt 146

Eric-Emmanuel Schmitt est de retour. Quoiqu’il n’ait jamais vraiment disparu. Cette fois, l’auteur extraordinairement prolifique nous promet une vraie surprise : comme pour annoncer les fêtes de fin d’année, la magie de Noël et le rire de Saint-Nicolas, ce cher Oscar revient avec sa dame rose…Au cinéma ! Voici l’occasion rêvée de découvrir le monde d’Eric Emmanuel Schmitt. QMarie Delloye

© 2009 Pan-Européenne. Photo Kris Dewitte

un poète philosophe

© 2009 Pan-Européenne. Photo Kris Dewitte © 2009 Pan-Européenne. Photo Nathalie Eno

”Je pense aimer plus profondément la musique que la littérature, elle fait entièrement partie de ma vie ”

être remodelées par d’autres. Faire un film demande un grand esprit d’équipe ! Peut-on déceler le fil rouge qui parcourt tous vos livres ? Je pense que tout ce que j’écris exprime un humanisme, une vraie passion pour l’homme. C’est dans cette optique que je m’intéresse aux religions. Mes livres traduisent souvent une recherche de la lumière, malgré leur part d’ombre.

”Dans mes histoires, j’aime émouvoir” S’il y a une solution, on va la trouver, c’est ce que j’appelle l’optimisme lucide ! Dans mes histoires, j’aime émouvoir. Je m’inspire de la vie quotidienne, des gens, des réflexions. Le meilleur moyen de trouver l’inspiration c’est de descendre dans la rue ! Surtout en Belgique, où règne un esprit plus surréaliste qu’ailleurs… Avez-vous une préférence pour un certain genre d’écriture : le théâtre, les films, les livres ou les essais philosophiques ? Ma préférence va toujours à mon prochain projet. Je suis en train d’écrire un livre de nouvelles et, pour le moment c’est ce que je préfère ! J’aime prendre le risque, m’aventurer à ne pas refaire ce que je sais déjà faire, créer sans cesse… Comment s’est déroulée l’adaptation d’Oscar et la Dame Rose en film ? Ce fut un très long travail : le livre date de 2002 et le film de 2009. J’ai longtemps cru que ce ne serait pas possible, mais je ne trouvais pas d’arguments qui s’y opposaient ! J’ai produit Odette Tout le Monde en premier parce que je n’étais pas prêt à prendre le risque pour Oscar et la Dame Rose. Pour moi, le film d’Oscar et la Dame Rose est un vrai aboutissement, j’ai dû apprivoiser le monde du cinéma. Par contre, en tant qu’auteur de pièces de théâtre, je suis habitué à ce que mes œuvres m’échappent pour

une absence de prétention qui peut rendre les artistes belges novateurs. Je pense à une certaine audace qui semble naturelle… Chez nous, la hiérarchie entre les genres n’existe pas, tout peut être mêlé sans prétention ! Quelles sont vos lectures préférées ? Il y a des livres que je relis tout le temps ! Je pense aux Liaisons Dangereuses, à l’œuvre de Colette, à Diderot pour sa philosophie et son insolence…J’ai de l’admiration pour Kundera, Claudel et Amélie Nothomb… Ne partez pas sans nous révéler votre projet suivant! Il sortira au mois de mars, je peux vous donner le titre: ”Rédemptions”… Je vous laisse imaginer le reste !

À propos de la Belgique, que pensez-vous de sa culture et de ses arts ? Il y a moins de propositions qu’à Paris, mais tout autant de valables ! J’aime aller au théâtre à Bruxelles, surtout au Public. Mais ce que je préfère, ce sont les concerts de musique classique. Je pense aimer plus profondément la musique que la littérature, elle fait entièrement partie de

”En Belgique il y a une décontraction et une absence de prétention qui peut rendre les artistes belges novateurs ” ma vie ! J’adore également les spectacles de danse, ils me détendent vraiment car je les découvre entièrement ! Pour ce qui est des artistes belges, je pense qu’il y a une décontraction et

”Oscar et la Dame Rose” Sortie le 9 décembre



PETER PAN Intégrale 40 ans Loisel Vents d’Ouest


QMarie Delloye & Marie d’Otreppe

Cette intégrale rassemble les 6 tomes de Peter Pan, plus une partie qui nous dévoile l’envers du décor. Une histoire puissante et poétique, servie par un dessin d’une grande expressivité et d’une affolante beauté. Une œuvre unique, incontournable !

bd L’ALTERNATIVE - Tomes I et II De Chevais-Deighton et Agosto Glénat


ux Vie des fe laby Tome VII ilippe De h P t e x u fa u Jean D n Dargaud ion de so ar la pass n tragip e é in a tr son desti Rome, en court vers rs nous empereur, e tome, les auteu s c s intrigues que. Dan au dans le uscitent e v u o n à ss entraînent éron et re monde me de N Un . ru a p de la Ro is e monde d n u o chair et d ri b e avec ue, fait d q ti n e th u vivant et a passions.

À un carrefour de son existence, peut-on, en fonction du chemin que l’on emprunte, devenir un salaud ou un héros ? N’avons-nous pas chacun une destinée inéluctable ? Fils d’un allemand et d’une française, Pierre doit faire un choix alors que ses parents se séparent : rester avec sa mère ou suivre son père... Au final, son destin sera tragiquement identique.

VINCENT VAN GOGH. LES LETTRES Fonds Mercator Le peintre accompagnait souvent ses lettres de croquis et les truffait de références à des centaines d’artistes, parmi lesquels Rembrandt, Rubens, Millet, Corot, Signac, Gauguin, etc. Le Fonds Mercator les a réunies dans une superbe édition...


Aude Lafait Soliflor


Mamans, voilà le livre qu’il vous faut ! L’auteur a préparé les meilleures panades, compotes, soupes, galettes pour sa petite Méline. Approuvées ensuite par un nutritionniste et rassemblées dans cet ouvrage, les bonnes idées fusent pour que les 0 à 3 ans reçoivent une alimentation variée et idéale pour leur santé ! Faites place au bon et au bio dans les assiettes et boîtes à tartines !


Dan Brown Lattès

Six ans après le succès phénoménal de ”Da Vinci Code”, Robert Langdon est de retour dans ”Le symbole perdu”... Quelques indices : Washington, la franc-maçonnerie, des sociétés mystérieuses et de nombreux secrets à décoder. Dan Brown au meilleur de sa forme !

ROSE Des souvenirs sous ma frange EMI Quand on l’écoute on a parfois l’impression de s’entendre penser, mais en mieux. On connaît déjà ”Ciao Bella” et ”La liste”. Cette fois, Rose se met en musique dans un nouvel album, ”Souvenirs sous ma frange”. Un disque qui s’écoute et qu’on ne saurait interrompre dès qu’on a entendu le premier accord.

MATT BIOUL Daystripper Akamusic


JOHNNY HALLYDAY TOUR 66 - Warner Plus populaire que jamais, Johnny a fêté ses 66 ans : l’occasion d’une ultime chevauchée avec son public. Reprenant le thème de la mythique ”Route 66”, il a entamé une longue tournée, avec en point d’orgue trois soirées spectaculaires au Stade de France. Vivez ou revivez-les !

Matt Bioul revient avec un album très ”Brit Pop” des années ’60 ’70, au son chaleureux du vinyle et au pur goût vintage ! Douze titres de pur bonheur, dont l’unique ambition est de taper du pied et d’en profiter !



De Ramin Bahrani. Avec Alejandro Polanco, Isamar Gonzales et Rob Sowulski.

Alejandro, un orphelin dur et ambitieux, vit et travaille dans un garage au cœur d’une immense décharge du Queens. Dans ce monde d’adultes chaotique, le jeune garçon se bat afin d’obtenir pour lui et sa sœur de seize ans, Isamar, une vie meilleure.



m. Avec rmak Akra

Hadji Gul,


De Ba auffeur Schatz. led, un ch ébé a h K . n ta un b fghanis n véhicule Kaboul, A re dans so v ment la u m o c o é C d . i, de tax femme e n u r a r de cet p e é ébarrass d e abandonn s i t n e le petit, lu Comm ’il gardait s retrouver ? t e E lit ? o s lis in ire nt co Une histo encombra des filles ? e u q ’a n qui nte. et toucha

LA JOURNÉE DE LA JUPE De Jean-Paul Lilienfeld. Avec Isabelle Adjani, Denis Podalydès, Yann Collette, Jackie Berroyer. Sonia est prof de français dans un collège ”difficile”. Un jour, elle découvre un revolver dans le sac d’un de ses élèves et s’en empare : un coup part et blesse l’élève. Son dérapage la propulse, malgré elle, dans une véritable prise d’otages. Adjani étourdissante dans un rôle tout à sa démesure.



ENFANTS D’HIVER Jane Birkin a tourné dans le monde entier, elle a défendu des causes humanitaires, elle a joué la comédie... Maintenant elle sort son premier album en tant qu’auteur et interprète. Et elle vient nous le présenter à Bruxelles !


QMarie Delloye & Marie d’Otreppe



À l’aube de la nouvelle année, Jean-Philippe CollardNeven, jeune pianiste belge talentueux rejoindra Andrew Hardy au violon, Yumiko Kawai à la clarinette et Justus Grimm au violoncelle pour un concert au programme varié et original, reprenant des œuvres de Haydn, Brahms, Fauré, etc. Le 14 décembre WOLUBILIS 251, avenue Paul Hymans, 1200 Bruxelles Tél. : 02. 761 60 30 -

Du 23 au 31 janvier CENTRE CULTUREL DE WOLUWE-ST-PIERRE 93, av. C.Thielemans 1150 Bruxelles Tél. : 02. 773 05 88

360° TOUR U2 annonce son passage à Bruxelles ! Le groupe vous donne rendez-vous le 22 septembre 2010 au Stade Roi Baudouin pour assister à son spectaculaire 360° Tour à la mise en scène époustouflante ! Le 22 septembre 2010 AU STADE ROI BAUDOIN.

CAPITALISM : A LOVE STORY OSCAR ET LA DAME ROSE D’Eric-Emmanuel Schmitt. Avec Amir Casar et Michèle Laroque Oscar, dix ans, est à l’hôpital des enfants. Rose, livreuse de pizzas, communique avec lui sans détour. Elle invente un jeu : faire comme si chaque jour valait dix ans... Et vivre toute une vie, riche d’émotions, en quelques jours... Bouleversant ! Sortie le 9 décembre

De Michael Moore À quel prix l’Amérique paie-t-elle son amour du capitalisme ? Moore va à la rencontre de ces gens dont les vies ont été mises sens dessus dessous et cherche des explications. Ce qu’il découvre, ce sont les symptômes d’une histoire d’amour qui a dégénéré : mensonges, trahison... et 14.000 emplois perdus chaque jour. Sortie le 25 novembre


POUR UN INSTANT LA LIBERTÉ De Arash T. Riahi. Avec Navid Akhavan, Pourya Mahyari, Kamran Rad.


Ali et Merdad fuient l’Iran avec leurs cousins pour les ramener à leurs parents en Autriche. Ils doivent passer par la Turquie et attendre un visa qui tarde. Ils font la connaissance d’autres réfugiés iraniens : des hommes et des femmes qui espèrent de toutes leurs forces entrer en Europe, terre de liberté… Une belle leçon de courage ! Sortie le 25 novembre © Véronique Vercheval

LE PÈRE NOËL EST UNE ORDURE De M.A. Chazel, C. Clavier, G. Jugnot, etc. Avec Pascal Racan, Daniel Hannsens, Marie-Paule Kumps. Le soir de Noël, la permanence téléphonique S.O.S. détresse va être perturbée par des personnages loufoques. Inutile d’en dire plus sur ce bijou de la scène française dont les répliques sont peut-être plus célèbres que les vers de Victor Hugo ! Du 8 au 31 décembre À WOLUBILIS ET AU CENTRE CULTUREL D’UCCLE.

LE DÎNER DE CONS De Francis Veber. Avec Chevallier et Laspalès. Le mercredi, c’est dîner de cons. Le principe : chacun amène un con. Celui qui a dégoté le plus spectaculaire est vainqueur. Ce soir, Brochant a trouvé la perle... Le duo Chevallier et Laspalès reprennent les rôles de légende de Pierre Brochant et François Pignon. Hilare ! Le 4 décembre THÉÂTRE SAINT-MICHEL 2, rue Père Eudore Devroye, 1040 Bruxelles


AGAMEMNON Un père de famille, usé par la société de consommation, se rend compte qu’il n’est qu’un pantin dans le système déjà bien rôdé de la consommation de masse. Il décide alors de sauver sa famille de cet engrenage violent et fuit vers un ”quelque part”, un monde meilleur et plus simple qui lui permet de se poser les bonnes questions… Touchant d’humanité. Du 8 au 26 décembre 2009 THÉÂTRE DE POCHE (Bois de la Cambre) 1a, chemin du Gymnase, 1000 Bruxelles Tél. : 02. 649 17 27 -



Michel Boujenah revient sur scène à Bruxelles ! Il nous présentera son nouveau one-man show ”Enfin Libre”, dans lequel il aborde des sujets variés comme les rapports entre hommes et femmes, la difficulté d’être soi-même ou encore la recherche du bonheur… Un beau moment de questionnement, de recherches douloureuses mais toujours exprimées avec humour… Michel Boujenah n’est-il pas ”enfin libre” ? Le 5 décembre CENTRE CULTUREL D’UCCLE 6 rue Rouge, 1180 Bruxelles Tél. : 02. 374 64 84 -

ROMÉO ET JULIETTE De Sergueï Prokofiev


D’Henri Gougaud. Avec Stéphanie Coppée, Wout De Ridder.

Sous le chapiteau des Baladins du Miroir, pas de spectacle sans chansons ! Les Baladins vous content des histoires traversées par les chants, les rires, les couleurs du monde. Peut-être pourrez-vous y déceler ce fameux ”Chant de la Source”... Du 3 au 6 décembre SOUS LE CHAPITEAU DES BALADINS DU MIROIR à Boitsfort -

Basé sur l’œuvre de Shakespeare, ”Romeo et Juliette” est un ballet de haute inspiration mélodique et de grande variété rythmique, avec des thèmes principaux mémorables, comme la célèbre ”Danse des chevaliers”... Splendide ! Les 13 et 14 février 2010. AU CIRQUE ROYAL. -







sélection QMarie Delloye


Soulages est à la mode ! Alors qu’on le célèbre un petit peu partout, la galerie Elyseearts à Liège lui rend hommage en exposant ses eauxfortes et lithographies, témoins de l’importance de son œuvre sur papier. Magistral ! Jusqu’au 12 janvier ELYSEEARTS GALERIE 8, boulevard Cuivre et Zinc, 4030 Liège


ifimagn SES de la , vous , H e r G u t O h VAN G pagner la lec e Van Gog ée Van s d m u s o e m c r tt ion ac au Pour ition des le us rendre e exposit s n d o u se v é u s e e ù r qu fam ujou rdam, o s o t e c z e pouv à Amste départ de u Gogh son art a e it is v re ... r M. lettres u 3 janvie ERDA a ’ u AMST q À s , u H J GOG l E VAN eum.n MUSÉ hmus g o g n .va www

TEMPTATION DAYS En décembre, Artemptation se transforme en marché de Noël pour que vous puissiez dénicher LE cadeau idéal ! Des créations uniques, surprenantes et personnalisées à petits prix ! Du 5 au 24 décembre GALERIE ARTEMPTATION 475, avenue Louise, 1050 Bruxelles

CUBA À L’HONNEUR En hommage à la journée de la culture cubaine, la galerie Withofs organise une exposition des tableaux d’Aconcha. Cette artiste nous parle de l’abondance, de la fécondité de l’esprit, de l’imagination à travers des femmes, innombrables dans son œuvre. Exotique ! Jusqu’au 31 décembre GALERIE WITHOFS


9, quai au Bois à Brûler 1000 Bruxelles

QUAND L’ART S’ENGAGE L’objectif d’Art Friendly est de rendre l’art abordable et équitable. Le label propose une large palette d’artistes et des œuvres de qualité à des prix justes ! Lorsque vous achetez une œuvre, vous achetez un arbre planté avec Tree-Nation. En plus, Art Friendly et Bongo lancent le coffret ”Wall Art” qui permet d’offrir 1 œuvre + 1 arbre. Un cadeau exceptionnel !

ENSOR AROUND THE WORLD Après New York, c’est Paris qui accueille Ensor ! Cette exposition monumentale entend montrer le jeu de rupture et de continuité perpétuellement pratiqué par le peintre belge avant-gardiste et résolument inclassable ! Jusqu’au 4 février

Photos © Andreas von Eisendel




Fascinantes robes du soir, robes de mariées, ensembles de cocktail, tailleurs, manteaux et accessoires... Une expo qui illustre au travers de créations belges ou étrangères cette période particulièrement fastueuse de l’histoire de la mode ! Jusqu’au 29 décembre

Pour la première fois en Belgique, les robes d’Isabelle de Borchgrave s’exposent ! Ces créations en papier coupé, plié, collé et peint à la main procurent une illusion absolue. Une exposition magnifique qui vous plongera au cœur de la Renaissance florentine...


10, parc du Cinquantenaire 1000 Bruxelles

12, rue de la Violette 1000 Bruxelles







les fromages de Suisse Ouvrez vos papilles et suivez le guide ! Pendant plus de 5 semaines, en plein cœur du Sablon, les Fromages de Suisse (fabriqués dans leur région d’origine) s’exhiberont en plein air ! Dans la foulée du lancement des Nocturnes et de ses illuminations (le jeudi 26 novembre), quoi de plus alléchant que l’idée de savourer ces fromages typiques, en raclette, à l’apéro ou en fondue ?

à Bruxelles

Originales et authentiques, les photos de Hugues de Wurstemberger et Christian Lutz nous font découvrir les joyaux de leur patrimoine helvète, la vie quotidienne d’un peuple pour qui le terroir reste primordial. Une manière de saluer le travail de milliers de paysans, artisans et producteurs passionnés par le fromage suisse. Les 40 photos présentées en noir et blanc mettent en lumière une tradition qui se perpétue, un savoir-faire ancestral qui a su faire de son produit local un délice reconnu dans le monde entier.

UNE IDENTITÉ PARTICULIÈRE Un produit AOC (d’appellation d’origine contrôlée) est fabriqué dans sa région d’origine, du début à la fin. Toute l’originalité du fromage suisse vient de la richesse de la terre, du degré d’altitude et le type du vaches utilisé…Sans oublier les secrets de fabrication des producteurs locaux, un affinage bien de chez eux, qui lui confère son goût si particulier, et le décline en autant de variétés bien distinctes!

N’attendez pas les fêtes pour découvrir cette magnifique exposition ! Dès le 26 novembre, le Sablon rayonnera de ces photos, oeuvres de deux photographes renommés! Et, qui sait, vous serez peut-être surpris de rencontrer des Saint-Bernard, de goûter un nouveau vin blanc suisse, et d’autres délices qui vous attendront sur la place! Exposition photos L’IDENTITÉ DES FROMAGES DE SUISSE du 26 novembre à début janvier 2010 Place du Grand Sablon, 1000 Bruxelles


\57VghZnde ^hh8ajWW^ceu K^aaVghHlex lieu au cœur ceptionnel a ance

i mbi Un après-sk rnier dans l’a 8 octobre de k Barsey ! ic w ar W Bruxelles le el Hôt ochaiprestigieux u de nos pr feutrée du couvert le lie dé boras lla on co av y en rs, Nous rnales : Villa ve hi é de gn es pa nc nes vaca e, et accom isse Tourism s… iss Su tion avec Su es & de Fromag vins d’Ollon t be Lo s la co © Ni

XhÄI‚a‚k^Z 7VaVYZYZprhesAV mablement tigieuses ai

rtar les impo prêtées pa du et t or sp des stars du leur place nduites par 27 voitures co té t he en ac ai t ét jointe) er(s) avaien ent, 105 teurs (liste (s) passag . Parallèlem ess et leur r Netmagic étaient pa es éé show-busin nt cr ce e ré sit es sur un de prestige pares un Le ”. es aux enchèr cs qu La quel Balade des ciennes et voitures an appelé “ La himay et un C e lly rs ra ve s ce de concurrent s, à l’aéconcurrentes menait les lac de Virelle - 250 km tir, après le e au lac ou ag ab cours de +/ ss ur pa po , ien circuit uner. Ensuite je dé Nivelles le de tour de l’anc ur t po ui l’ancien circ Cerfontaine et de e e ln clôtura om Au dr se d’ ro e aye o. La journé Heure, l’Abb t à Waterlo de l’Eau d’ ou ke ok . er au Kn par Mumm pour termin pagne offert tail au cham ca ic ss la é aux .c par un cock w ww r le march et ho .p tigieuses su w w es w pr © s sionnant re es itu pr vo m L’i s ❷ semble de e dans le fond n Simons ❶ Vue d’en inte Catherin Alliot ❸ Alai ec l’église Sa de Philippe o hes deag el ap ci Poissons av gr ur M auto Lamborghini , signant des illy Braillard arrière de la livia Borlée W O : s ❹ ar ie st gn mpa teur et Diallo et a ❺ Organisa en bonne co ic Be et n, hl At iege da MX5 des , Kristof Vl vant la Maz Enzo Scifo perbe Merce n épouse, Out ❼ La su an ke m ok De l Kn he Allan et so du ic M rée 00 Miglia de asso ❻ L’ent rd Eduardo M iture des 10 Willy Brailla vo ur te la isa de an l’org plique Marc Van nduite par 300 SL, ré co de T T G G ra e Carre La Ford ckaert ❽ La Porsch du Hainaut Thierrt Spee tites routes Daytona de e des ri Vu rra Fe dans les pe ée e arriv La superb le parking d’ en r et fond su ra s le St ne r ns en de da ci ntaine avec odernes et an me de Cer fo Quelques m e apposée ro lly od ra ér du l’a à ue plaq ception binaison Il s’agit de la voitures d’ex uvre es de la com digues à l’œ e aux enchèr nt eten réra Ve St Didier de Ra r ri de u d’une Ferra à Marc Van ea e us gé m ju cock tail le ad r ” du su lors s 1979 aire priseur, kx “ Le Man mpagne la commiss ca s, de Jack y Ic la hu ns at M da r Sabine e 911 vintage compensé pa Une Porsch okke Out Mumm au Kn embrumée

cIde W ion du BM LdddbZcd illeux et fash Waterloo cadre merve

le rd de C’est dans du Bouleva les esrand Store a enflammé p To Brussels B on en sont om se oo es W m e m que la soiré nnant de fe elles s’en rre impressio où rte t pa en n U em ! prits e d’évén cosméemière parti s animations ruées en pr joie avec le et ICI ur Y H cœ C à EN és IV G sont donn partenaires ora s eb le D r r pa pa s té tiques offerte mode présen aux offerts le défilé de de ec ca av , s le XL ab Paris innombr yd ! Un et avec les le David Lo Velasquez Eva Luna et saison, s, el la ss de ru n B itio par BMW première éd tte dirigée ce et ur le po orab franc succès r party mém Miss Luna, ts par une afte en e sid né ré on J ur co r nos D il se doit, de maître pa sé, comme d’une main tout fut arro Martini Le de . ils ou ta Ap ck s co Tang-E et Pommery, le port… es Im t gn Je pa de par les cham de produits la gamme ! r e pa iré e so qu e i us ains bule pour cette fa m - Merci à tous - ww www.wooo

tte om/G.Miclo © blueclic.c

 [„iZ|6cketZgh Z h V  a! Z Onsea, créa i^ c ge Z In hh : sadi &%Vch asion pour Esfandiar Eghtesag s, amis ire na rte pa ents,

cc se, a com10 ans, l’o inviter pres gnie. Tout marque, d’ leur compa en boutas e ie un ug teurs de la que s bo à souffler le banale, pres et familles un feu créa t e rencontre an un m r lu al pa illit, 1999 e dernier, l’étincelle ja br e, mencé en to èr oc op 22 ie is la mag menti. Le atie de… Et pu s’est pas dé ns le Waagn is 10 ans, ne té s réunies da -E ne ps on m rs te pe in tif qui, depu Pr 00 and soir, 12 s collections rc’était LE gr ! Et pour te au défilé de rs r eu te ul sis co as en pour piste de heur et haut se îc à Anvers en fra m de l’im n r ow plei était pris su menses 2010. Un sh ndez-vous ights des im othéose, re us les sunl so Yorkais ! r te la ew miner en ap N éc s’ ub acun a pu dans un cl ch u ou cr e it ra ns da se se cette… On erck x Lapers boules à fa ) et Paul Di Blaise & B. F. / de tu tti ntiel hommes ouk se An Es © Eventa e, ue in tiq ad C ar tis ie ❸ Nicole s (Directeur ren (Guest ) et une am ❶ Marc Bley ue an ch at rs (N Ve n le as Vermeu n, Nicol m Omsk) ❷ Edouard i Verschuere kina (Girls fro ami ❹ Dimitr ria Siniouch le Essentiel Va ❺ ue Robyn et un s tiq an tis r ar Anne Poelm re (Directeu te or a Louys po ar De rb magazine) et s, Ba , Tom Inge Onsea aureen Louy De M ❻ i ❼ am o) Is un od et n ❾ abel f (Belm sa fille Mar yli Tiany Kirilof Onsea et gie Boy) et ge oo femmes) et In (B ch o) ba Paul Am Patricia (Sum et un ami ❽ is ❿ Elias et sentiel) tiel) et des am la marque Es de s ire ta Mazo (Essen ié pr ro (p di sa es ht Esfandiar Eg

]@cdX`dji ^i l c d i^ V X^ d hh V B <:CDB:^c A:HHHDJC9HNHI: = >I 6 ; ih c hZ gZ e :kZcih BdcgdZ même esLVgb"jeWnBVX toujours le

et ourgeoises fêter cet de Folies B église pour Cinq années ieux qu’une tuer cet m nc de po i uo ur Q . ss po prit mystique que Faithle ux -up suie m m ar w de un ?! Qui ut ceci sans to événement é ét comme it t fri ra of ?! Qu’au l’occasion anniversaire roe qui pour sion live de on ffu M di ac re iè M em bliminal de eoises la pr re à laFolies Bourg Minuit, l’heu cadeau aux ubborn ” ?! ystem St “ ds re un tit So u ss uvea glais Faithle an son tout no el au o nn du io e pt lébrissim rmance exce quelle, le cé s de leur un live perfo re ur tit s po in e rta èn té ce entra en sc ont présen ur un dj el ils nous platines po cours duqu ensuite les it axi Jazz pr M re é, ilo m tu m. M me à l’accou nouvel albu om C xelles… . ru m B bler son no us fait trem set digne de e fois de pl un t on s lis et Sister B Ramirez 2/F.Garrido© Objective

Register and surf on powered by

ch^ZjgE^cid d B g V e n Z ière ga V = Z sé sa prem Hd^g‚ ion a organi le Midi Stat y-Davidson

e, Harle Ce 7 octobr d of season cer cetnement” - En de commen e qu soirée “évé al rm no Harley us e pl iré so de i e night. Quo ents par un em lieux, én s év de d’ rie taire te longue sé o, le proprié u ’Antoine Pint n, un men qu io é as nn cc do l’o t ur étan ésentes. ssionné. Po pr pa s d ne an on gr est un x 350 pers a touproposé au et rassembl spécial fut and succès gr soirée un La t fu e virons. Cette soiré xelles et en es ” et le DJ ley ”de Bru an ar Pl H “ e s Th le “ tes ert live avec le conc ine soirée... s’enflamma à la procha us vo zde en ne Fabrice. R ag nf lle tude/A.De Vi © Eventatti

Hd^g‚Z=VuteelensÉhpremiers jeudis

to Organisée restaurant soirée du du mois, la gés cette on pl re a us Happy’s no nées 80, an s de nivers fois dans l’u arlet (DJ H il Ph ré par ez). Le set DJ assu op Tr xelles - St résident Bru ction se terra nt co dé en repas tout ume, dans me de cout mina, com jusqu’aux te fê ce de une ambian . es du matin petites heur lt de / P. Raou tu tti ta © Even

Milan ” la

ssage de ble que “ Au pa irée inoublia E^bbÉheVgineu lieu pour la première foisnenapBérelo,giqu e dire une so frais. Dj aux

es bre à a Dry. U its et légum Ce 29 octo ” by Canad nné égalearché de fru mm’S Party , il vous a do ’S et son m là m s m première “ Pi pa Pi te de rê ssi, vous rs ar s’ au eu ss us ne ai vo ’S nn Si m ! m n pour les co e ! Mister Pi hael Jackso hésitez ic ag n’ M én , m de ue ” iq dé It un Is ça platines et ure de “ This e ambiance ôt un cl ef la ns us à da s d@ e au né -vou de fin d’an Meester (arn ment rendez s de te fê ud s le na miser - Ar désirez dyna w.pimms-pa Car talis contact ww er & Marina pas, prenez x ou ud de Meest br na De lot (VO) Ar ul e ❸ C ! l ud en he tit a Dr y ! ❻ Mic © People At Pimm’S Wom ad er an ist C M by ❷ ! M ’S e de ilan by Pimm ’S O’Clock Pimm’S ! ❺ ’S ! ❽ Passag ❶ It’S Pimm Mister Pimm This is Mister ur ❹ po an n m ila st M & David Lu Passage de jck Meester ❼ s & Mr De Ri & Arnaud de ck Scheeper tri Pa an Je ❾ ’S m m Pi er Mist

%%.Vj&(-%aux ' gZ W d Xi d & ( Z X u’ ZZc ” a duré jusq Hd^g‚Z=Vaadlwee ar “ Le 1380 nquis B co to a es e R iré n au de la so

t Hallo é déroulemen pas prépar La soirée d’ délicieux re du matin. Le un es r ur pa he cé es ant Duclos, men petit is m Pa co a ic Er ut de. To français, sa toute tout le mon ef cuisinier ands avec nouveau ch e les gourm m piste de m la co r par le tout s su et e m vir les gour vu apparaîtr s on stres en av on us qui a su ra m , no ablotins et rte. Ensuite vampires, di t et en dannouvelle ca de an is al iv gu st dé fe rrible jeu en se danse un te de a joué le Tout le mon tout genre. la nuit ! sant toute

gYjGVaanZ hd c d e h h! Z ] iX V L Idbbn=^a[^\Zg %%. mmy Classic, To >ciZgXajW8aVlahhci^Xnq'uième édition de l’Intnerdeclub s de lé -c rs s sponso

n de mme l’u s et d’exÀ l’occasio présenté co s ancienne ches s’est n de voiture io at st Hilfiger Wat ife an ournable m cette incont ❷ Andreas Diffusion Chrono Euro lge de 1960 © n. io pt ce Secours Be une Jaguar g d’ in ur nt la To vo r au ult 4 CV mmy Hilfige To , construces ❶ Une Rena ex nt H d’ ve au recteur des rcs ❹ Le Châte TS G 5 in Schwörer, di 27 jard s et pa rrari agnifiques m 1965 ❸ Fe 98 s 19 de se is E ur pu pe Ty e de tée po ème siècle répu e de Lorrain parcours rite le Cercl le ab tion du 18 i nt qu isa fa oy , au Fond’R pe Dombard de départ ❺ Le Châte Louis-Philip nne, le lieu Blanpain et au Sainte-A te hâ en clôture C , ❻ Béatrice ce Le an ❼ guar type E. ncours d’élég Ja co e Le un llemand, ❽ ns La da es ic 2009 Jean-Jacqu terclub Class ise des prix: s Schwörer m du Rallye In ea re dr La An ❾ et tomobile s Rallyes) du Rallye Au d gagnant de teren (le gran r) ge ilfi H Roland D’Ie y m s ventes Tom (directeur de

ndj^hZ quelques no embres et m c6heg^V6kZcjLoZA s le se sé té e, vi iv uise a in arque exclus

enue elle m dès 19h. L’Aspria Av rir sa nouv tobre 2009 venir découv a, ce 22 oc sophie, ilo Sp ph membres à en e un rts ion, r ses expe t une émot n qui es tio s ira in tionnée pa sp so in de erche, une elle gamme ch ent uv re no em la te nn rs et iro C nte ve s et de l’env ion consta ect des être e de la vie, sp si une orientat re né le fré ns la urce da hèse dans meilleurs trouve sa so . Une parent cœur des nous vivons ensoriel au tis it partie ul fa m e dans lequel st ge ge n à un voya où chaque tio ta tre vi bliable -ê in ou en e in bi un e de e expérienc . Un espace découvrir ept offre un i nc traitements ns co ai u pu ea t Ce nouv s invités on e découd’un rituel. ionnels. Le cktail. Soiré ltats except e soirée co un pieds et d’ s rs et des résu de lo s, omfort Zone sages du do as m Très bel s . de ne la marque C ; s Comfort Zo de surprises in ie so pl m et re ts ui verte x, prod des cadeau sage des mains, rgen Olivier ment ❸ Mas be An © t. e de l’événe bl ville, m ue se événemen ng en d’ Lo de Vue vier “Jack” fort Zone ❷ recteur et lie Taton, Xa Di Ju ❶ Photo Com k, in lle ilm se oi W d ❹ Madem se et Richar ge du dos des mains Avenue Loui ne ❻ Massa Club Aspria Comfort Zo ie porters. ug Re Bo Directeur du de ❺ ax ne rt Zone ❽ M Comfort Zo fo ire ta om C rié ux op Pr Cadea atherine ❼ réalisé par C és vit be et in















1 2 3 4 5 6 7 8 9 10 11 12 Solutions dans le Guest du mois prochain

Solutions du mois passé

8 2 4 5 9 1 6 7 3




2 8 1 6 4 7 3 9 5

4 7 3 9 5 2 8 6 1

5 6 9 3 1 8 4 2 7

9 3 8 1 7 6 5 4 2

6 1 2 4 8 5 7 3 9

7 4 5 2 3 9 1 8 6

1 9 7 8 6 3 2 5 4

3 5 6 7 2 4 9 1 8

8 2 4 5 9 1 6 7 3

9 5 6 1 3 4 2 7 8

7 8 4 2 5 6 1 3 9

3 1 2 7 9 8 4 5 6

1 9 8 4 6 5 3 2 7

2 3 5 9 8 7 6 1 4

6 4 7 3 1 2 8 9 5

8 7 9 6 2 3 5 4 1

4 6 3 5 7 1 9 8 2

5 2 1 8 4 9 7 6 3

8 7 4 5 2 6 3 1 9

2 6 9 7 1 3 4 5 8

5 3 1 9 8 4 6 7 2

7 8 5 3 4 9 1 2 6

1 4 3 6 5 2 8 9 7

9 2 6 8 7 1 5 4 3

4 5 8 2 3 7 9 6 1

6 1 2 4 9 8 7 3 5

3 9 7 1 6 5 2 8 4






1. S’installer en bivouac. Plat du réveillon. 2. En début de journée. 3. Fait partie de l’élite. L’avarice est son vice. Riche, on roule dessus. 4. Rejointes. Blond en été. 5. Noir de fumée. Labourer en surface. 6. Assurent le spectacle. Série catastrophique. 7. Sous-espèce. Fait long. 8. Mais encore. Lumière sur la scène. Sans bavures. 9. En fin de service. On les a dans la poche. Tantale du chimiste. 10. Essayer de nouveau. Relève les plats. 11. Elle travaille pour son propre compte. 12. Obstacle au large. Suite de mots.

A. Peuvent combattre. Récipient utilisé en déplacement. B. On y met tout ce qu’on veut faire revenir. C. Petite distance. Bête fauve. A de solides mâchoires. D. Beaux en surface. Longue période. E. Béquille. Prêt à réparer. F. Marquées par l’âge. Instrument de travail. G. Contester les faits. Sont mortels. H. Attire les cavaliers. Pas écrit. I. Pâques ou Trinité. Il sont toujours fauchés. Conjonction négative. J. Venu au monde. Appeler à siéger. À elle. K. Oeuvre lyrique légère. L. Prendre note. Grande pièce.

Cadeaux : > “AgAmemnon” Au théÂtre de poche: Dans un style loufoque et plein d’humour, Rodrigo Garcia signe une tragédie moderne sous forme de réquisitoire contre notre société de consommation. Du 8 au 26 décembre 2009 à 20h30 (relâche les dimanches et lundis). Cadeau: 5x2 places


> emI offre des cd de rose: “les souvenIrs sous mA frAnge”: la jeune fille n’a pas seulement des chansons, elle a trouvé un son. Elle a finalement partagé ses compositions avec deux garçons Thibault et Jérôme d’un groupe appelé 1973. Tous les trois, ils ont su distiller des arrangements d’une richesse incroyable, de l’épuré "Hanna" au dixieland de "Ma corde au clou", des violons et des cœurs, chaque mélodie donnera envie au public de s’arracher les cheveux pour choisir un morceau (Encore une fois je suggère l’écoute

intégrale du disque). Cadeau: 5 exemplaires du cd > Les restaurants BelgA Queen, ambassadeurs du "Made In Belgium" à Bruxelles et Gand, présentent en collaboration avec les DJ’s JoAQuIn BAIXA et pAtrIck BAlZAt la compilation BelgA Queen " hIs mIstress voIces". Cette compilation regroupe des artistes ayant des liens forts avec la Belgique et les ambiances musicales sont à l’image de la philosophie des lieux. Cadeau: 5 exemplaires du cd. > cAstermAn offre le tome 3 de lA sérIe WAr & dreAms: le repAIre du mIlle-pAttes:

de Maryse et Jean François Charles. 1944, Pas-de-Calais. Entre les 2 caps, à 7 km des côtes, une forteresse dissimulée sous une colline est construite par les Allemands. Elle abrite bientôt la nouvelle arme secrète d’Hitler: "Le Mille-Pattes", un canon à air comprimé, capable d’envoyer sur Londres les fameux V3. Cadeau: un exemplaire de la BD


Il est temps de s’abonner ! Ce moIs-CI, nous offrons à nos premIers abonnés : > Des bougies ILANGA de la collection Aluminium ! Forte d’une longue expérience et d’un goût très affirmé, Valérie Bietlot a su allier tradition et modernité, et créer ses collections de bougies sous le signe de la passion, de la lumière et de la décoration. La bougie délicatement parfumée de la collection ALUMINIUM est proposée dans un conteneur cylindrique en aluminium avec un système de " recharge ", le premier système de recharge disponible pour bougies de grand format ! Ilanga vous offre une bougie dans une des 11 couleurs de la gamme et vous pourrez la " recharger " avec la couleur de votre choix par la suite.

> Une écharpe Frey Wille 100% soie ! Les stylistes de l’orfèvre émailleur Frey Wille ont revisité le sphinx égyptien en le parant de teintes vives et irrésistibles ! Les ailes déployées sont le principal symbole de la collection Sphynx, symbole de créativité spirituelle et sigle de la maison Frey Wille aux racines autrichiennes. 100% soie naturelle cette écharpe d’une valeur de 130 ` est à vous dès votre abonnement !

> Une superbe machine à café Nescafé Dolce Gusto ! Découvrez les nouvelles machines à café et espresso Nescafé Dolce Gusto qui combinent un café moulu 100% arabica, à un design vraiment inédit et innovant ! Ultra-pratiques et compactes, les machines vous permettent de goûter des arômes différents en un clin d’œil. Disponibles en noir, rouge ou ivoire, les machines Nescafé Dolce Gusto vous garantissent un café de qualité et une manipulation facile… Très design !

* Moyennant le paiement des frais de port uniquement (40 E/ an). Compte ING 363-0100711-65


Par l’astrologue Michaël MANDL





Consultations sur rendez-vous: 02. 771 00 88 – 0477. 61 01 11

1 (23/11 – 2 période de votre il u e s Au perspecaire, vos rs e iv n n a vous réde quoi tives ont s devriez avoir ent vou vous n seulem rs écueils qui njouir : no ie rn z e s alle e les d mais vou activités , surmonté in m e h s le c crer à de barraient us consa oints de vue. Le o v ir o v u fin po tous p agiuctives à faire preuve d’im plus prod ité e d ti u a e cré v est ven termes d n moment es e ll e it v o u s o ue ce er de n p p lo e nation, q v té é d vos in sant de otion de m ro e ou s’agis p la ant pas d s utiles à z cepend te rinitiative n o d te n n e o vous vous c ats pour rêts. Ne lt u s ré s bon quelques ! s lauriers o v r u s mir


(21/03 – 20/04) Sur la lancée du mois précédent, votre année s’achève tambour battant : bénéficiant d’une marge de manœuvre amplement suffisante, vous parviendrez à vous faire valoir grâce à autant de dynamisme que de constance. Dans de nombreux cas, des projets de longue haleine trouveront enfin la possibilité de se réaliser et il conviendra donc vous y appliquer avec beaucoup de rigueur.


(21/04 – 20/05) Que ce soit au niveau des moyens que vous mettrez en œuvre pour atteindre vos objectifs ou s’agissant de vos buts proprement dits, il faudra vous atteler à négocier un tournant relativement serré. Ce n’est donc pas le moment le plus opportun pour lancer des initiatives importantes, mais plutôt celui de vous concentrer sur vos priorités sans vous laisser détourner ni déborder.



(21/05 – 21/06) Une belle effervescence vous animera, d’autant plus justifiée que la vie sociale vous réserve des rencontres intéressantes. Veillez toutefois à ne pas trop vous laisser entraîner par le mouvement ambiant car vous pourriez alors sous-estimer certaines opportunités qui se révèleront plus intéressantes que prévu. Quoi qu’il en soit, vous aurez l’occasion de vous rattraper !


(24/08 – 22/09) Des contrariétés risquent de vous faire perdre du temps, vous contraignant à y consacrer plus d’énergie que prévu. Il est probable en effet que vous ne parviendrez pas à mettre un terme une bonne fois pour toutes à quelque affaire en suspens ; dans ce cas, inutile de vous impatienter : reconsidérez le sens de certains combats que vous menez et n’hésitez pas à vous recentrer.


(22/12 – 20/01)


Vous devriez savoir combien le sens de la stratégie et du bon timing sont nécessaires pour parvenir à ses fins et, en ce sens, on n’aura rien à vous reprocher tant vous saurez faire preuve de discrétion et d’efficacité. Il conviendra toutefois aussi de vous limiter strictement à la sphère de vos compétences, ce qui vous évitera de prêter le flanc à toute critique éventuelle.

Décembre 2009


(22/06 – 22/07) Les possibilités de vous épanouir ne manqueront pas, avec même des sollicitations plutôt alléchantes, mais votre recherche d’ancrages profonds n’en sera pas moins réelle, vous incitant certes à saisir les opportunités qui se présenteront, mais aussi à chercher de creuser votre sillon. Aiguisez vos facultés de jugement, votre sens critique et votre faculté de discernement.


(23/09 – 23/10) Poser les jalons de nouvelles créations et vous lancer dans la réalisation de projets d’envergure : voilà les défis qui vous attendent au tournant de ce mois de décembre. Au centre des regards et de l’attention, vous pourrez faire valoir vos qualités dans votre domaine de compétence, mais aussi vous faire apprécier dans d’autres sphères, grâce au feeling et... à la chance !


(21/01 – 19/02) Aux prises avec de nombreux défis à relever, vous aurez certainement raison d’affirmer vos ambitions, mais veillez aussi à ne pas répondre à certaines provocations ni à vous engager sur une voie qui ne vous semble pas suffisamment balisée. Au lieu de fonctionner par coups de tête et de suivre vos impulsions, faites appel à votre expérience et à votre lucidité d’esprit.


(23/07 – 23/08) Vous aurez progressivement l’occasion de vous rendre compte que, comme le veut la fable, ”rien ne sert de courir, il faut partir à point”: inutile dès lors de vous engager dans les premiers défis à votre portée ou de tenter de forcer le cours des événements. Il vaut mieux vous concentrer sur vos objectifs, quitte à affirmer vos intentions sans autre forme d’ambiguïté.


(24/10 – 22/11) Malgré les ressources à tous points de vue dont vous pouvez disposer, il conviendra de ne pas vous laisser littéralement embarquer dans des questions qui ne feraient que vous détourner de vos priorités. Certains engagements plutôt encombrants risquent de vous empêcher d’arriver à bon port, du moins en temps voulu : il ne tiendra qu’à vous de les liquider sans trop tarder.


(20/02 – 20/03) Arrivant au bout d’une période pour le moins mouvementée, le moment semble venu de vous accorder un tant soit peu de répit. Liquidez au plus vite les affaires en suspens, sans rien laisser traîner, et profitez ensuite de la fin de l’automne pour vous ressourcer. L’année 2010 s’annonce très gratifiante, alors autant l’aborder sur un terrain qui soit suffisamment déblayé !

Didden & C° Marchand de tapis, de père en filles

Rue Blaes 66-74 - 1000 Bruxelles Tél. +32 2 512 72 85 Fax +32 2 512 99 66

nous vous invitons Ă venir lâ&#x20AC;&#x2122;essayer en famille

Guest Magazine  
Guest Magazine  

Take it, read it, love it !
