Page 1


2   June  2011  |  Grace&Glory


www.gracenglorymagazine.org  3


JUNE 2011

contents on the cover: Pastor Stephen  M.  Smith

The Mount Moriah Baptist Church 2201 Garrison Boulevard Baltimore, Maryland 21216 410-945-3575 www.tmmbc.org

Q&A Interview 8-9

Q&A Interview  with Pastor  Stephen  M.  Smith

features 13 MAYOR’S  JOURNAL  

20 BOOK  SHELF  

15 GOVERNOR’S  PAGE  

Brandie Manigault

21  GOSPEL  INDUSTRY            NEWS   Erika  J.

19 EDUCATION  DIGEST   Dr.  Tim  Tooten  

Bullying In The Schools

4   June  2011  |  Grace&Glory

23 NUTRITION  &  YOU  

Herline A.  Knights

Exercise:The Post-Workout Meal


25 TO  YOUR  GOOD   HEALTH  

31 TEEN  CONNECT        

Pastors Greg  &  Tonya  Dennis

Peace Out

Carla J.  Debnam,  MS,  LCPC

Dealing With Change

27 BODY  BASICS   Kids & Fitness

37 WORD  OF              ENCOURAGEMENT  

Donna Williams-Ross

In Every Issue 29 A  WOMAN’S   PERSPECTIVE  

Contributors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6

Cassandra Vaughn-Fox

From the Editor . . . . . . . . . . . . . . . . . . . . . . . . . . 7

Don’t Be Afraid To Close The Door

Scripture Page . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Carter’s Comment. . . . . . . . . . . . . . . . . . . . . . . . 38

www.gracenglorymagazine.org 5


For the  LORD  God  is  a  sun  and  shield:  the  LORD  will  give  grace  and  glory:   no  good  thing  will  he  withhold  from  them  that  walk  uprightly.   Psalm  84:11

Advisory Board

Contributors

PUBLISHER

Jackie Epps

EDITOR-IN-CHIEF

Jackie Epps

                       

EDITORIAL                        

PHOTOGRAPHY

 

 

Tyrone Akins/ Tyght  Shots  Photography

 

GRAPHIC ARTIST    

Claire Lesesne     www.JandCDesigns.com

WEB  ADMINISTRATOR    

PRINTING

Dr. Kenneth  O.  Robinson Dr.  Harold  A.  Carter,  Jr. Cassandra  Vaughn-Fox Herline  A.  Knights Charles  ‘Chizel  It’  Harris Pastors  Gregory  and  Tonya  Dennis Carla  J.  Debnam Jamison  ‘Jaye’  Boykin Donna  Williams-Ross Governor  Martin  O’Malley Ericka  Johnson Mayor  Stephanie  Rawlings-Blake Rev.  Tim  Tooten Mark  L.  Dennis

Arts Period Peabody  Press  

Grace &  Glory  Magazine  is  published  monthly  by  JE  Media,  LLC, a  Baltimore  based,  independent  publisher.    Copyright  2011.  All  rights  reserved.    Reproduction  without  expressed  permission  is  prohibited.

Chairman —    Dr.  A.C.  D.  Vaughn Sr.  Pastor,  Sharon  Baptist  Church,  MD Vice-Chairman  —    Dr.  Frank  M.  Reid  III  Sr.  Pastor,  Bethel  A.M.E.  Church,  MD   Dr.  Jerome  A.  Barber   Sixth  Mount  Zion  Baptist  Temple,  Hampton  ,  VA Dr.  Michael  A.  Battle  Sr.     President,  ITC  Seminary,  Atlanta,  GA Dr.  Timothy  Boddie   Friendship  Baptist  Church,  Atlanta,  GA Bishop  John  R.  Bryant     Presiding  Prelate  of  the  5th  Episcopal  District Dr.  Harold  A.  Carter,  Sr. Pastor,  New  Shiloh  Baptist  Church,  MD   Dr.  Suzan  Johnson  Cook Sr.  Pastor,  Believers  Christian  Fellowship,  NY Dr.  WIlliam  H.  Curtis     Mt.  Ararat  Baptist  Church,  Pittsburgh,  PA Bishop  Ralph  L.  Dennis Sr.  Pastor,  Kingdom  Worship  Center,  MD   Wanda  Q.  Draper/Media  Executive Michele  J.K.  Epps/Health  Sciences Cassandra  Vaughn/Out  Foxed  Media  LLC. www.Outfoxedmedia.org Dr.  Donte’  L.  Hickman,  Sr. Pastor,  Southern  Baptist  Church,  MD Pastor  Timothy  V.  Manigault Bishop  Dennis  V.  Proctor     Presiding  Prelate  of  the  Western  Episcopal  Region  AME  Zion  Church Dr.  Kenneth  O.  Robinson Pastor,  Restoring  Life  International  Church,  MD Bishop  Walter  Scott  Thomas,  Sr. Pastor,  New  Psalmist  Baptist  Church,  MD   Dr.  Timothy  Tooten,  Sr.   Pastor,  Harvest  Christian  Ministries,  MD

2011 Specials

Grace & Glory Magazine is the ideal publication for all your advertising needs! -Churches, Minsitries, Christian Schools, Choirs: Inform the community of your services, programs, etc. -Salons, Boutiques, Specialty shops: Advertise your sales. -Businesses, Realtors, Financial Advisors: Educate consumers of your services.

For more information 443-813-6547; 410-370-2636/info@gracenglorymagazine.org

Check out our new website at: www.gracenglorymagazine.org Send us your comments!

6   June  2011  |  Grace&Glory


from the editor

OUR FATHER This is the month we celebrate our fathers. I know for some, Father’s Day can be painful, a sad reminder of growing up without a father present in the home or being active in their lives. The pain of growing up fatherless can sometimes leave a scar that is hard to remove. There may even be some situations or circumstances that warrant the absence of dad, but to a child without a father these things or reasons mean nothing. But, for every situation, circumstance or reason, father is not there, there is someone who is more than able to fill that void. That someone is God, Our Heavenly Father. Though we all may not fall into the category of growing up without a father, the truth be told there are a large number of dads who are present in the lives of their children. But what I would like to say to those who grew up without a father present and to those who did . . . there is one thing we all have in common, we all can claim the same Father. Our  Father which art in heaven. We all share the greatest Father of all, and He has never been an absentee dad. Let me remind you about Our  Father. Our Father is omnipresent, He is with you at the same time He is with me, in fact He is everywhere at all times. Our Father is omniscient, He is the wisest of all, He knows everything about each one of us. Our Father is omnipotent, He is all-powerful, He has the ability to do absolutely anything He wants for us. Here are a few more things about Our  Father. Our Father is a good provider, He supplies all of our needs according to His riches in glory (Philippians 4:19). Our Father is a protector; He is our shield and buckler (Psalm 91). Our Father is a comforter; He mends a broken heart (Matthew 5:4). Our Father is a healer; He will restore our bodies (Psalm 103:3). Our  Father sounds like a pretty great dad to me. He is great and mighty. He is a friend that sticks closer than any brother. He loves each and every one of us unconditionally with the same amount of love. And let us not forget that Our  Father  loved us so much that He gave His only begotten son (Jesus) so that we would be able to live with Him eternally! (John 3:16) I could go on and on but I believe the best thing about Our  Father is He is whatever you need Him to be whenever you need Him. This Father’s Day as we celebrate our earthly fathers, don’t leave out Our  Father which art in Heaven. He is the Greatest!

Peace & Blessings . . .

Jackie Epps Editor-in-Chief

www.gracenglorymagazine.org www.gracenglorymagazine.org   7 7


the p astor   s peaks

Q A Interview &

Pastor Stephen M. Smith The Mt. Moriah Baptist Church Baltimore, MD

G&G: Pastor Smith, we salute you this month as you celebrate your 7th Pastoral Anniversary! I am very excited for this opportunity to talk with you. Most pastors have shared with me that ‘preaching the gospel’ was not necessarily what they had planned to do with their lives. Was it the same for you, did you have other plans for your life before your call to ministry?

Pastor Smith: First I would like to thank you for this opportunity

to share with you and the Grace & Glory audience. We are excited also for the 7 years God has allowed us to be together as Pastor and People. Preaching was definitely not part of my plans. Pastoring was out of the question. Growing up I was always involved in sports and had dreams like most young African American men to play professional sports. After a good college football career and a few unsuccessful attempts at professional football, becoming a State Trooper was also something I always wanted to do. God had other plans. I never became a State Trooper and I had a nineteen year career with Fidelity Engineering. G&G: Was your call to ministry a hard call to accept? Please share with us how it all began for you. Was there anyone who significantly influenced your decision about ministry?

Pastor Smith: I remember as a young boy my grandmother talking

about me following the footsteps of my grandfather who was a Pastor. Out of all of my brothers I was the one who gravitated to him. Like most young boys I strayed away because of sports. Growing up everyone seemed to say I was going to be a preacher. I wanted to prove everyone wrong so I did what I had to do to let them know that I could not be a preacher- if you know what I mean. But God has a way of making sure His will is done in our lives. After coming full circle and accepting Jesus Christ as my Lord and Savior and meeting my wife Wanda, who had invited me to church, is where it all began. Before accepting the call I had to acknowledge the call on my life to ministry. The hardest part was accepting the call to the Pastoral ministry; there are other areas of ministry other than the Pastoral ministry. The one who significantly influenced my decision 8 8       June   June  22011   011  ||    G Grace&Glory race&Glory

about ministry was my Pastor Dr. Haywood Robinson III. G&G: Pastor Smith, as you reflect over the last seven years, what would you say has been your passion in ministry? What is the driving force behind your ministry? What do you believe it takes to be a good pastor in our world today?

Pastor Smith: Over these last seven years my passion in ministry

is to share the word of God and watch people respond not to me but to God and His word. The driving force behind my ministry is knowing that God has chosen me (Isaiah 43:10) and has counted me faithful and trustworthy (1Timothy 1:12). Since He has chosen me and counted me faithful and trustworthy that keeps me humbled and honored to serve Him and His people. To be a good Pastor today one must love the Lord thy God with all your heart, with all your soul and with all your mind (Matt.22:37). Be ready to equip the saints to do the work of the ministry, for the edifying of the body of Christ, until we all come to the unity of the faith and of the knowledge of the Son of God, to a perfect man, to the measure of the stature of the fullness of Christ (Eph. 4:12-13). Be a servant after God’s own heart demonstrating genuine concern, compassion, and care for God’s people. G&G: With the influx of new ministries and hundreds of churches in the Baltimore community, what sets the Mt. Moriah Baptist Church and your ministry apart? How would you best describe the ministry of the Mt. Moriah Baptist Church? If your ministry could be known for one thing, what would that be?

Pastor Smith:There

has been an influx of new churches and ministries. When we look around there are churches on every corner. I believe that Mt. Moriah is strategically placed in the Walbrook Junction community to make a difference. We are


the p astor  speaks

Since He has chosen me and counted me faithful and trustworthy that keeps me humbled and honored to serve Him and His people.

a church that is making an effort of reaching those that are under forty while at the same time holding on to those over sixty. I would want Mt. Moriah to known for being ‘Faithful Followers’ of the Father reaching the world for Christ.

need in the community surrounding the Mt. Moriah Baptist Church?

G&G: Pastor Smith it has been said in today’s society that it is hard to tell the difference between believers and nonbelievers. During your years of pastoring have you found any areas of ministry frustrating or difficult? Has it become more challenging to reach the unsaved? What do you believe the church should be saying and doing?

Pastor Smith: Some of the issues facing the church today are in

Pastor Smith: Galatians 5:19a says, the works of the flesh are

evident, likewise Gal. 5:22-23 says, the fruit of the spirit are evident. Ministry in itself can be frustrating and seem difficult at times. God’s plan for reaching the unsaved has not changed. His message is still the same. What we as the church must do is change our methods on reaching the lost. How do we do it? We should be Exalting Christ through Worship, Edifying the Christian through the Word, and Evangelizing the Community through Witnessing. G&G: For many of our youth they feel that the church is not relevant to their issues and what they face growing up in today’s society; issues that are much more intense than what we faced growing up. Trust is a major issue for them when it comes to church. How do we gain the trust of our youth and how do we meet them at their need to attract them to the church?

Pastor Smith: We can gain the trust of our youth by being and

becoming more transparent. When the youth see us they see us the way we are now and not the way we were. We look down on them like we have been saved all of our lives, instead of sinners saved by God’s grace. When we can become transparent and share our testimony, they will be open and began to trust us. Letting them know we feel their pain and we all have messed up, but that we serve a God of grace and a God of mercy who looks beyond all our faults and supplies our needs. G&G: Pastor Smith, what issues do you see as the most important ones facing the church right now? What is the most pressing

Lady Wanda and Pastor Stephen Smith

direct connection with the issues we are facing in society today. The church is made up of people and the economic, social issues we are facing as a people are affecting the church. There is no secret that it takes money to do ministry. We are faced with unemployed people who are coming to the church for help and I thank God that He has blessed us to help those in need. The needs around Mt. Moriah are for the young people who have nowhere to go after school or during the summer. They are just hanging around in the streets. It is true that an idle mind is the devil’s workshop. This year we are extending our summer enrichment camp through the entire summer and moving to implement a before and after school program in the near future. G&G: Pastor Smith lastly, as you celebrate your 7th Pastoral Anniversary, can you share with us what’s on the horizon for Mt. Moriah Baptist Church that will give you an opportunity to expand your ministry?

Pastor Smith: We are excited about what God is doing with us.

We have just presented a five year vision for the church taking one year at a time. We are branding ourselves in the community so the community will know who we are there. We have just adopted the Walbrook Junction circle letting them know we care and are a part of the community. We believe God gives the vision and He will give the provision. We have just completed our application for our 501c3 (W.O.R.D. Corporation). That will allow us to do so much for our community. We are expanding our ministry outside the walls of the church looking to purchase property for a Community Resource Center and Senior Housing Development. We truly believe, “Eye have not seen nor ears have heard of what great things God has in store for us.” We solicit your prayers as we seek to do the work of the Lord for the expansion of the Kingdom. www.gracenglorymagazine.org www.gracenglorymagazine.org   99


10   June  2011  |  Grace&Glory


scripture page

Matthew 6:9-13

   AFTER  THIS  MANNER  THEREFORE  PRAY  YE:  OUR  FATHER  WHICH   ART  IN  HEAVEN,  HALLOWED  BE  THY  NAME.  

9

THY  KINGDOM  COME,  THY  WILL  BE  DONE  IN  EARTH,  AS  IT  IS  IN   HEAVEN.  

10

11  GIVE  US  THIS  DAY  OUR  DAILY  BREAD.    12  AND  FORGIVE  US  OUR  DEBTS,  AS  WE  FORGIVE  OUR  DEBTORS.    13  AND  LEAD  US  NOT  INTO  TEMPTATION,  BUT  DELIVER  US  FROM   EVIL:  FOR  THINE  IS  THE  KINGDOM,  AND  THE  POWER,  AND  THE   GLORY,  FOR  EVER.  AMEN.   www.gracenglorymagazine.org   11


12   June  2011  |  Grace&Glory


mayor’s journal

www.gracenglorymagazine.org 13


14   June  2011  |  Grace&Glory


governor’s page

STATE  OF  MARYLAND OFFICE  OF  THE  GOVERNOR MARTIN  O’MALLEY GOVERNOR STATE  HOUSE 100  STATE  CIRCLE ANNAPOLIS,  MARYLAND  21401-­1925 (410)  974-­-­3901 (TOLL  FREE)  1-­800-­811-­8336

TTY  USERS  CALL  VIA  MD  RELAY

A  MESSAGE  FROM  GOVERNOR  MARTIN  O’MALLEY Dear  Friends, /DVWPRQWK,ZDVMRLQHGE\WKH'LUHFWRURIWKH:KLWH+RXVH2I¿FHRI1DWLRQDO'UXJ&RQWURO3ROLF\*LO.HUOLNRZVNH DQG'U-RVKXD6KDUIVWHLQ6HFUHWDU\RIWKH0DU\ODQG'HSDUWPHQWRI+HDOWKDQG0HQWDO+\JLHQHWRVLJQ0DU\ODQG¶V QHZ3UHVFULSWLRQ'UXJ0RQLWRULQJ3URJUDPLQWRODZ3UHYHQWLQJWKHDEXVHRISUHVFULSWLRQGUXJVLVDPDMRUSDUWRI RXUSXEOLFVDIHW\VWUDWHJ\WRSURWHFW0DU\ODQGIDPLOLHV (YHU\\HDUWKRXVDQGVRI0DU\ODQGHUVVXIIHUIURPWKHVFRXUJHRIDGGLFWLRQ2XUQHZSURJUDPZLOOOLQNSXEOLF KHDOWKZLWKSXEOLFVDIHW\V\VWHPVDQGHOLPLQDWHWKHEDUULHUVWKDWFXUUHQWO\EORFNLQIRUPDWLRQVKDULQJDQGSURYLGH NQRZOHGJHWKDWLVHVVHQWLDOWRWKHKHDOWKDQGZHOOEHLQJRIWKHSHRSOHRIRXUVWDWH 3UHVFULSWLRQGUXJDEXVHLVWKHIDVWJURZLQJGUXJSUREOHPLQ0DU\ODQG%HWZHHQDQGWUHDWPHQWDGPLVVLRQV UHODWHGWRDEXVHRISUHVFULSWLRQVRSLDWHVLQ0DU\ODQGLQFUHDVHGSHUFHQW'XULQJWKHVDPHWLPHIUDPHSRLVRQ FRQWUROFDOOVUHODWHGR[\FRGRQHLQFUHDVHGSHUFHQW,QSHUFHQWRIDOOLQWR[LFDWLRQGHDWKVLQ0DU\ODQG LQYROYHGDSUHVFULSWLRQRSLDWH 2XU QHZ ODZ FDOOV IRU WKH FUHDWLRQ RI DQ DGYLVRU\ ERDUG WR PDNH UHFRPPHQGDWLRQV RQ SURJUDP GHVLJQ DQG LPSOHPHQWDWLRQ VXSSRUWLQJ OHJLVODWLRQ DQG UHJXODWLRQV DQG IXQGLQJ VRXUFHV :LWK \RXU KHOS DQG VXSSRUW IURP VWDNHKROGHUVLQWKH0DU\ODQGKHDOWKFRPPXQLW\,NQRZZHFDQIDFHDQGRYHUFRPHWKLVDGYHUVDU\ 6LQFHUHO\

0DUWLQ2¶0DOOH\ *RYHUQRU

www.gracenglorymagazine.org  15


16   June  2011  |  Grace&Glory


www.gracenglorymagazine.org  17


18   June  2011  |  Grace&Glory


education digest

Dr. Tim Tooten, Sr.

BULLYING In Our  Schools

/DVW ZHHN 0DU\ODQG *RYHUQRU 0DUWLQ 2¶0DOOH\ DQG 6WDWH 6XSHULQWHQGHQWRI6FKRROV'U1DQF\*UDVPLFNSXWWKHVSRWOLJKWRQ EXOO\LQJ%RWKSXEOLFRI¿FLDOVKHOSHGWROHDGPHDQLQJIXODQGWLPHO\ GLVFXVVLRQVWRKHOSUDLVHWKHDZDUHQHVVRIEXOO\LQJLQRXUVFKRROV ,QWKHEDFNGURSRIDSRVLWLYHDZDUHQHVVFDPSDLJQWKHQXPEHURI EXOO\LQJLQFLGHQWVLQ0DU\ODQGVFKRROVFRQWLQXHVWRLQFUHDVH7KH 0DU\ODQG6WDWH%RDUGRI(GXFDWLRQLQDUHFHQWSXEOLFDWLRQVXEPLWWHG WR WKH 0DU\ODQG *HQHUDO DVVHPEO\ UHSRUWHG   LQFLGHQWV RI EXOO\LQJIRUWKHVFKRRO\HDU7KLVUHSUHVHQWVDVWDWHZLGH LQFUHDVHRIUHSRUWHGLQFLGHQWVIURPWKHSUHYLRXVVFKRRO\HDU $ VXPPDU\ RI WKH UHSRUW VSHFXODWHV WKDW WKH LQFUHDVH LQ UHSRUWHG LQFLGHQWVPD\EHDWWULEXWHGWRDQLQFUHDVHLQDZDUHQHVVRIEXOO\LQJ DQGKDUDVVPHQWRQWKHSDUWRIVWXGHQWVVWDIIDQGSDUHQWV7KHVWDWH¶V UHSRUWIXUWKHUSRLQWVRXWWKDWWKHPDMRULW\RIEXOO\LQJLQFLGHQWVWRRN SODFHRQVFKRROSURSHUW\ZLWKWKHVHFRQGODUJHVWQXPEHURFFXUULQJ RQVFKRROEXVHVDQGWRDQGIURPVFKRRO,WDOVRGLVFRYHUHGWKDW \HDUROGVZHUHWKHPRVWIUHTXHQWYLFWLPVRILQFLGHQWVRIEXOO\LQJDQG harassment. 7KHHIIRUWVGHVLJQHGWRKHOSSUHYHQWEXOO\LQJVKRXOGQRWUHVWRQO\ XSRQ WKH VKRXOGHUV RI HGXFDWLRQDO DQG JRYHUQPHQW OHDGHUV 7KH\ LPSOHPHQW SROLFLHV DQG SDVV ODZV GHVLJQHG WR LGHQWLI\ EXOO\LQJ DQG UHVSRQG DSSURSULDWHO\ , EHOLHYH LW¶V QRZ WLPH IRU FOHUJ\ DQG FRPPXQLW\ WR MRLQ WKH UDQNV RI WKRVH WU\LQJ WR VROYH WKLV VHULRXV SUREOHP,DPUHPLQGHGRIWKHSRSXODUDQGIDPLOLDU$IULFDQVORJDQ which  states:  “It  takes  a  village  to  raise  a  child.”6RPHSHRSOHKDYH VXJJHVWHGWKLVVORJDQZDVRIIHUHGIURPWKHFRQWH[WRIWKHLGHDOJURXS

RISHRSOHVXUURXQGLQJDFKLOGDQGFRQWULEXWLQJWRKLVRUKHUHDUO\ HGXFDWLRQ DQG WUDLQLQJ7KLV JURXS PXVW QRW RQO\ LQFOXGH SDUHQWV JUDQGSDUHQWV IULHQGV DQG WHDFKHUV EXW DOVR PHPEHUV RI WKH IDLWK FRPPXQLW\ , DP FRQYLQFHG WKDW PDQ\ RI WKH VDPH FKLOGUHQ ZKR IDFHEXOOLHVGXULQJWKHLUVFKRROZHHNDUHDOVRVKRZLQJXSIRUFKXUFK RQ6XQGD\PRUQLQJ7KHFKXUFKLVZKHUHDPHDQLQJIXOHQFRXQWHU VKRXOGWDNHSODFH,EHOLHYHLW¶VLQWKHVHW\SHVRIVHWWLQJWKDWZHDVWKH ERG\RI&KULVWVKRXOGEHFRPHHYHQPRUHVHQVLWLYHWRWKHVSLULWXDO DQG HPRWLRQDO QHHGV RI FKLOGUHQ -HVXV GHPRQVWUDWHG KLV KHDUWIHOW FRQFHUQ IRU FKLOGUHQ ZKHQ KH VKDUHG ZLWK +LV GLVFLSOHV LQ /XNH  And  they  brought  unto  him  also  infants,  that  he  would  touch  them:   but  when  his  disciples  saw  it,  they  rebuked  them.  16  But  Jesus  called   them  unto  him,  and  said,  Suffer  little  children  to  come  unto  me,  and   forbid  them  not:  for  of  such  is  the  kingdom  of  God.   15

,EHOLHYHHDFKRIXVFDQVWDUWDVHDUO\DVWKLV6XQGD\E\UHDFKLQJRXW WRD\RXWKLQRXUFRQJUHJDWLRQ7DNHWKHRSSRUWXQLW\WRNQRZWKHP WROLVWHQDVZHOODQGDWWKHULJKWRSSRUWXQLW\DVNWKHPDERXWVFKRRO IULHQGV DQG VDIHW\  %H DPRQJ WKRVH FRPPLWWHG WR HQFRXUDJH DQG RIIHU\RXUSUD\HUIXOVXSSRUW 0DU\ODQG6WDWH'HSDUWPHQWRI(GXFDWLRQ“Bullying, Harassment,  or  Intimidation  in   Maryland  Public  Schools,”  0DUFK 

Ibid.



.LQJ-DPHV9HUVLRQ



www.gracenglorymagazine.org 19


book shelf

Book  Shelf   The Jesus Book Michael Koulianos I have come across a lot of books that talk about Jesus, but none have painted the picture of who Jesus really was and is like The Jesus Book by Michael Koulianos, founder of Jesus Image out of Orlando, FL. The Jesus Book is a night stand book. It’s one of those books that you keep by your bed and before you go to sleep you’ll read a little and uncover another truth about whom Jesus is. It is well written and easy to read; the type of book that you will read once, twice, and go back for more after that. It LV GH¿QLWHO\ D ERRN \RX will want to give to everyone you know. I highly recommend it.

by  Brandie  Manigault

DQ2XWFDVWÄŞMXVWWRQDPHDIHZÄŤ$QGDW the end of each chapter he concludes with a prayer that will push you further into a relationship with that side of Jesus. Michael Koulianos begins this amazing book with a chapter entitled “Loverâ€?. It is an incredible depiction of a love story and Jesus’ hearts cry to love us and to be loved by us. He writes, “He is incredibly passionÄĽ ate about each and every one of us‌ He can hardly wait for you to experiÄĽ ence Him as your One True Loveâ€? ÄŞSJÄŤ+RZPXFK simpler can it be put. The Jesus Book will take you on a journey of discover y and, if you let it, will ultimately change your perspective on the person of Christ. Simply put, The Jesus Book is a book all about Jesus.

In the book, Michael Koulianos, attempts to expose sides of Jesus that the world may have over looked and push us to a place where nothing matters but Him. And in my opinion, He did an incredible job at it. He says, “Jesus does About the author QRWMXVWKHOSXVÂżQGRXUGHVWLQDWLRQ+H Michael  Koulianos   Evangelist,  Author   is the destination.â€? If you’ve never met and   co-­host   of     Him or have known Him all your life, Jesus   Image’s   this book will introduce you to a side of TV   program     Him that you have never seen before. “Living   for   Jesusâ€?,   The Jesus Book puts into perspective was   born   in     the multiple hats that Jesus wears daily. Tarpon   Springs,   Like the rest of us, He doesn’t just take Florida.   He   gave   one role at a time and that’s it. Me‌ his   heart   to     I’m not just a wife, but I’m a mother. Jesus   Christ   at   I’m a sister. I’m a student. I’m a friend. the   age   of   12.   Michael Koulianos points out that Jesus That   same   year   is a Lover. He’s a Seeker. He’s God, a King, the Lord, a Healer, a Friend, and KHSUHDFKHGKLVÂżUVWPHVVDJH 20     June  2011  |  Grace&Glory

At  the  age  of  16,  in  a  school  founded   by   his   parents,   Theo   and   Evelyn     Koulianos,   Michael   started   a   meet-­ ing   with   6   students.   Within   a   few   weeks,   these   services   grew   to     capacity   crowds   as   the   Holy   Spirit     began   to   draw   young   people   from   all   denominations   and   backgrounds   to   Jesus   Christ.   Hundreds   of   lives   were   changed   during   these   amazing     gatherings. Michael   married   his   wife   Jessica   in   2004.   Shortly   thereafter,   he   was     ordained   into   the   ministry.   He   has     assisted   in   some   of   the   largest     evangelistic   meetings   in   history,   with   millions   in   attendance.   In   2005,   he   was   given   the   privilege   of   being   the   lead   Pastor   of   World   Healing   Center   Church  in  Orange  County,  California.   After  a  series  of  supernatural  events,   in  October  of  2007,  Michael’s  life  was   forever  changed  in  a  church  in  West-­ port,  CT.  It  was  here  that  the  power  of   God  overwhelmed  him  like  it  did  when   he  was  a  twelve  year  old.  Now  Michael   has   one   desire   to   love   Jesus   and     introduce   Him   to   as   many   people   as   possible.  His  life’s  call  is  to  be  used  of   God  to  reveal  His  Son  to  the  world  by   the  Power  of  the  Holy  Spirit. This   would   eventually   lead   to   the   founding   of   Jesus   Image,   the     evangelistic   ministry   of   the   Koulianos   family.   Jesus   Image   is   focused   on     winning   cities,   nations   and   the   world   with  the  Gospel  of  Jesus  Christ.   He   is   also   the   author   of   the     life-­changing  book  –  The  Jesus  Book   www.jesusimage.tv www.thejesusbookonline.com


Gospel News

gospel industry news 106th &  Park   7ZRSURPLQHQW*RVSHOYLGHRVGHEXWHGRQ 3DUN&RXQWGRZQ7ULQLWHHVLQ JOH³+HDYHQ+HDU0\+HDUW´.LUN)UDQNOLQSUHPLHUHGKLVYLGHR³,6PLOH´DQGSULRU WRWKHVHPDNLQJWKHLUPDUNRQWKHVKRZZHUH0DU\0DU\¶V³:DONLQ´DQG'HLWULFN +DGGRQ¶V³:HOO'RQH´ZKLFKKDGDOUHDG\LQYDGHGWKHFRXQWGRZQ/HW¶VFRQWLQXHWR VXSSRUWRXUJRVSHODUWLVWVDVWKH\VSUHDGWKHZRUGWKURXJKPXVLFE\YRWLQJWKHVH YLGHRVLQWRFRXQWGRZQ

By Ericka J. Bishop T.D.    Jakes   5LJKW RQ WKH KHHOV RI KLV %R[ 2I¿FH +LW ³-XPSLQJ WKH %URRP´ %LVKRS -DNHV LV SUHSDULQJWRUHOHDVH³6DFUHG/RYH6RQJV´ZKLFKZDVLQVSLUHGE\WKHPRYLHDQG LVWKHVHTXHOWRKLVRULJLQDO³6DFUHG/RYH6RQJV´UHOHDVHGEDFNLQ7KHDOEXP KLWVWRUHVWKHZHHNRI0D\VW7KLVSURMHFWIHDWXUHVVRPH5 %DVZHOODV*RVSHO 6LQJLQJURPDQWLFORYHVRQJVDUH)UHG+DPPRQG/HGLVL-RH.DUHQ&ODUN6KHDUG 0LFDK 6WDPSOH\ &U\VWDO $LNHQ $QD\VKD )LJXHURD .LUN :KDOXP (O 'H%DUJH %LVKRS3DXO0RUWRQDQGPRUH

Vickie Winans  

2011 BET Awards

Ballots are in and people are gearing up for the BET Awards. Nominees for this year’s award “Best Gospel” are: s "YRON #AGE s $EITRICK (ADDON s -ARY -ARY s +AREN #LARK 3HEARD s "E"E  #E#E 7INANS This year’s BET Awards will air live on June 25th at 8pm.

New Stellar Awards Categories

The Stellars will introduce new categories at the 27th Annual Presentation. s 3POKEN 7ORD #$ 2ECORDING OF THE Year. s -USIC 6IDEO OF THE 9EAR HAS BEEN REVAMPED INTO h,ONG &ORM 6IDEO OF THE 9EARv AND h3HORT 4ERM 6IDEO OF the Year”. Nomination submissions are being received now thru June 30, 2011.

*UDPP\QRPLQDWHGVRQJVWUHVV9LFNLH:LQDQVZDVJUDQWHGUHOHDVHIURPKHUORQJWLPH ODEHO9HULW\5HFRUGV6KHKDVGHFLGHGWRFKDUWKHURZQSDWKRQKHURZQWHUPVDQGVWDUW KHURZQ'HWURLWEDVHGODEHO7KHODEHOLVHQWLWOHG'HVWLQ\-R\5HFRUGVZKR¶VQDPH ZDVLQVSLUHGE\WKHGDXJKWHUVKHPLVFDUULHG DWPRQWKVVKRUWO\DIWHUWKHELUWKRIKHUVRQ 0DUYLQ &RFRQXW :LQDQV-U6KHKDVVLJQHG DQ H[FOXVLYH GLVWULEXWLRQ GHDO ZLWK &HQWUDO 6RXWK'LVWULEXWLRQLQ1DVKYLOOH9LFNLHVD\V ³,¶PH[FLWHGDERXWP\QHZGLVWULEXWLRQGHDO ZLWK&HQWUDO6RXWKLW¶VDPHJDGHDODQG,¶P HFVWDWLF´&RQJUDWV/DG\9LFNLH/RRNLQJ IRUZDUGWR%,*7+,1*6IURP'HVWLQ\-R\ 5HFRUGV

Ericka’s June  Music  Picks   ‡.LP%XUUHOO¶V³/29(´ ‡.HOO\3ULFH ‡5LFN\'LOODUG 1HZ*³.HHS/LYLQJ´ ,ZDQWWRZLVK$//IDWKHUVD+$33< )$7+(5¶6'$<8PHDQPRUHWRWKH ZRUOGWKDQ\RXNQRZ:H/29(DQG 1(('8:HFHOHEUDWH\RXIRUDOOX GR ,PXVWSD\KRPDJHWRDQDPD]LQJ PDQWKHODWH5HY%UXFH& Johnson  who  was  the  best  FATHER   (9(5,/29($1'0,668'$''<$OVRWRP\*RGIDWKHU 'HDFRQ5LFKDUG*DOHDQGSDVWRU%LVKRS5LFKDUG-3HQGHU6U /LYHEHFDXVHRILW/LYHLQVSLWHRILW/LYHZLWKLW/LYHEHFDXVHRILW:KDWHYHUyour   ³,7´LV-867/,9( )ROORZPHRQWZLWWHU#0LVV(ULFND-ZZZIDFHERRNFRPHULFNDMRKQVRQRUHPDLO PLVVHULFND#\DKRRFRP www.gracenglorymagazine.org   21


22   June  2011  |  Grace&Glory


EXERCISE:

nutrition & you

The  Post-­ Workout Meal

 Recovering  from  exercise  is  an  important  part  of  the  athleteâ&#x20AC;&#x2122;s  routine.  Post-­workout  foods  and  drinks  can  affect  recovery  by  affecting  fatigue,   repletion  of  glycogen  stores,  and  preparation  for  future  bouts  of  exercise.     For  the  recreational  exerciser,  one  who  exercises  3-­4  days/week,  overall  good  nutrition  is  most  important  for  maintenance  of  glycogen  stores,  and  so   muscles  will  have  enough  time  to  rest  and  recover  between  workouts.    For  the  more  vigorous  exerciser,  one  who  exercises  multiple  times/day,  performs   competitively,  or  is  in  training  for  a  sport,  refueling  muscle  glycogen  stores  and  assisting  the  body  in  recovery  is  of  utmost  importance.  Repletion  of   nutrients  lost  through  dietary  intake  is  an  essential  component  in  maximizing  the  bodyâ&#x20AC;&#x2122;s  performance.

5HSOHWLRQRIĂ&#x20AC;XLGORVV  5HSOHWLRQRIĂ&#x20AC;XLGORVVLVWKHPRVWHVVHQWLDOSDUWRIUHFRYHULQJDIWHUDKDUGERXWRIH[HUFLVH5HSODFHPHQWRIZDWHUORVWWKURXJKVZHDWLQJDQG promotion  of  water  balance  are  best  managed  by  drinking  water  throughout  the  workout,  as  well  as  after  exercise  is  completed.  Good  choices  include: Â&#x2021;:DWHU Â&#x2021;+LJKZDWHUFRQWHQWIUXLW Â&#x2021;-XLFHV   â&#x20AC;&#x201C;  Watermelon      â&#x20AC;&#x201C;  Melon Â&#x2021;+LJKFDUERK\GUDWHVSRUWVGULQNV   â&#x20AC;&#x201C;  Grapes                      â&#x20AC;&#x201C;  Oranges

Repletion  of  muscle  glycogen  stores   To  best  promote  repletion  of  muscle  glycogen  stores,  consume  carbohydrate-­rich  foods  within   15  minutes  after  the  workout  has  ended.  Athletes  should  aim  for  1  gram  (g)  of  carbohydrate  for   every  2  pounds  (lb)  of  body  weight/hour,  taken  at  30-­minute  intervals  over  4-­5  hours.     Example:   A   150-­lb   person   should   have   75g   of   carbohydrate   or   300   carbohydrate   FDORULHV  FDORULHV RI FDUERK\GUDWHVJ  7KH LQGLYLGXDO VKRXOG FRQVXPH WKH ÂżUVW  FDORULHVEHJLQQLQJPLQXWHVDIWHUH[HUFLVLQJGXULQJWKHÂżUVWKRXUDQGFDORULHV each  half  hour  for  the  next  3-­4  hours  to  maximize  glycogen  repletion.    7KHVHFDUERK\GUDWHFDORULHVFDQFRPHIURPIRRGVRUĂ&#x20AC;XLGV7KHIROORZLQJDUHVRPH 300-­calorie  ideas: Â&#x2021;Ă&#x20AC;R]RIRUDQJHMXLFHDQGWZRVOLFHVRIEUHDGÂ&#x2021;&HUHDOZLWKPLONDQGDEDQDQD Â&#x2021;Ă&#x20AC;R]RIMXLFHRUDVSRUWVGULQNDQGDIUXLWHGORZIDW\RJXUW     Protein  repletion  after  a  serious  workout  is  less  of  a  key  player  in  the  recovery  diet,  but  a  little  protein  can  enhance  glycogen  replacement  initially   after  exercise.  The  American  diet  is  ubiquitous  in  protein,  and  added  protein  is  not  essential  in  the  post-­workout  routine.

Repletion  of  sodium,  potassium,  and  electrolytes   Repletion  of  sodium,  potassium  and  electrolytes  (sometimes  lost  through  sweating)  is  easy  to  do  through  foods.  Supplementation  generally  is  not   recommended.  The  following  are  common  recovery  foods,  which  are  high  in  essential  electrolytes: Â&#x2021;3RWDWRHV Â&#x2021;<RJXUW Â&#x2021;2UDQJHMXLFH Â&#x2021;%DQDQDV Â&#x2021;6RXS Â&#x2021;&HUHDOV Â&#x2021;&KHHVH

Â&#x2021;%UHDGV

Proper  cool  down   A  proper  cool  down  period  of  light  exercise  is  essential  in  removing  lactic  acid  buildup  and  promoting  repletion  of  glycogen   VWRUHV7KLVKHOSVWKHDWKOHWHORRNIRUZDUGWRWUDLQLQJDJDLQLQRSWLPDOFRQGLWLRQDQGZLWKRXWSDLQ7KHDWKOHWHDOVRVKRXOGÂżJXUH in  periods  of  rest,  in  order  to  prevent  overtraining  and  assure  best  recovery.    0RVWDWKOHWHVKDYHDURXWLQHRUEDVHRIIRRGVWKDWWKH\WROHUDWHZHOO7KHVHUHFRYHU\PHDOVDQGĂ&#x20AC;XLGVYDU\IRUHDFKLQGLYLGXDO It  often  is  helpful  to  have  a  few  post-­workout  meals  in  each  athleteâ&#x20AC;&#x2122;s  repertoire,  as  variety  is  essential  in  promotion  of  best-­ nutrient  absorption. Reference Clark N. Sports Nutrition Guidebook. 3rd ed. Brookline, MA: Human Kinetics; 2003.

Herline Alison Knights, RD, LD

www.gracenglorymagazine.org  23


24   June  2011  |  Grace&Glory


to your good health

Dealing With Change , KDYH IRXQG WKURXJK SHUVRQDO H[SHULHQFH DQG LQ WDONLQJ ZLWK RWKHUV WKDW FKDQJH DW WLPHV LV GLIILFXOW IRU PRVW RI XV WR DFFHSW 6RPHWLPHV FKDQJHLVWKUXVWXSRQXVOLNHWKHGHDWKRIDORYHG RQHDKHDOWKFULVLVDGLYRUFHRUMREORVV$QGWKHQ WKHUHDUHWKHWLPHVWKDWFKDQJHLVZHOFRPHGOLNH D QHZ MRE QHZ EDE\ RU PDUULDJH ,W GRHV QRW PDWWHUZKDWWKHSLFWXUHRIFKDQJHORRNVOLNH :HDOOKDYHWRPDNHDGMXVWPHQWVWRRXUOLYHV DV D UHVXOW RI WKHP 7KLV DGMXVWPHQW WR WKH HYHQWV DQG FLUFXPVWDQFHV DURXQG XV LV ZKDW WDNHVSODFHQRWMXVWH[WHUQDOO\EXWLQWHUQDOO\0DQ\WLPHVLW LVHDVLHUWRDGMXVWWRWKHH[WHUQDOIDFWRUVWKDWDULVHGXHWRFKDQJH±DQHZKRPH ORQJHUFRPPXWHEHWWHUILQDQFLDOKHDOWKDVORZHUSDFHRIOLYLQJHWF:KDWFDWFK¶V SHUVRQVE\VXUSULVHDUHWKHLQWHUQDOUHDFWLRQVDQGDGMXVWPHQWVWKDWKDYHWREHPDGHDV ZHOO7KRVHSV\FKRORJLFDOPRGLILFDWLRQVWKDWKDYHWREHPDGHFDQWDNHWKHLUWROOLI QRWKDQGOHGWKURXJKWKHOHQVRIIDLWK5RPDQVHQFRXUDJHVXVWREHWUDQVIRUPHG WKURXJKDUHQHZHGPLQG&KDQJHLQVWLJDWHVWUDQVIRUPDWLRQDQGWUDQVLWLRQLQRXUOLYHV,WFDQEHWKHFDWDO\VWWRWKHµQHZWKLQJ¶WKDW*RG KDVSURPLVHGWRGRLQRXUOLYHV,WLVQRWWKHQHZWKLQJWKDWDOZD\VFDXVHVXVDQ[LHW\,WLVWKHWUDQVIRUPDWLRQSURFHVVWKDWPXVWWDNHSODFH LQRUGHUWREHWKHQHZ\RXWRUHFHLYHZKDW*RGKDVSURPLVHG 'HDOLQJZLWKFKDQJHLVLQHYLWDEOHDQGFDQEHPD[LPL]HGZKHQZHPDNHWKHPRVWRIZKDW¶VKDSSHQLQJDURXQGXV:KHWKHUZHZHOFRPH WKHFKDQJHRUQRWGRHVQRWPDWWHU7KHUHKDVWREHDGHFLVLRQWRZRUNWKURXJKWKHFKDQJHVDQGUHPDLQUHDOLVWLFGXULQJ WKH WUDQVLWLRQ SURFHVV $FNQRZOHGJLQJ WKH FKDOOHQJHV DQG MR\V WKH FKDQJHV ZLOO EULQJ KHOSV WR DGMXVW WR WKH SRWHQWLDORXWFRPHVDVDUHVXOWRIWKHP$Q[LHW\LQFUHDVHVZKHQZHKDYHIDLOHGWRFRQVLGHUWKHEOHVVLQJVDQG SRVVLEOHEXUGHQVWKDWPD\DULVH-HVXVZKHQH[SODLQLQJWKHFRVWRIGLVFLSOHVKLSJDYHWKLVH[DPSOHLQ/XNH ³)RUZKLFKRI\RXLQWHQGLQJWREXLOGDWRZHUGRHVQRWVLWGRZQILUVWDQGFRXQWWKHFRVWZKHWKHU KHKDVHQRXJKWRILQLVKLWOHVWDIWHUKHKDVODLGWKHIRXQGDWLRQDQGLVQRWDEOHWRILQLVKDOOZKRVHHLWEHJLQ WRPRFNKLPVD\LQJµ7KLVPDQEHJDQWREXLOGDQGZDVQRWDEOHWRILQLVK¶"´ 1.- :KHQWKUXVWLQWRFKDQJH RUFKRRVLQJFKDQJHZHPXVWGLVFHUQWKHFRVWVSLULWXDOO\SK\VLFDOO\PHQWDOO\DQGHPRWLRQDOO\)DLOLQJ WRFRXQWWKHFRVWFDQOHDYHXVZLWKXQUHDOLVWLFH[SHFWDWLRQVXQIXOILOOHGGHVLUHVDQGXQSODQQHGH[SHQVHV 'HDOLQJZLWKFKDQJHDOVRUHTXLUHVXVWREHIOH[LEOHDQGFRQILGHQWLQWKHRXWFRPH:KHWKHUE\FKRLFHRUE\ IRUFHDGMXVWPHQWVWRRXUGDLO\URXWLQHRUZD\RIEHLQJDQGUHODWLQJZLWKRWKHUVFDQVRPHWLPHVWDNHXVE\ VXUSULVH7KHVHUHTXLUHRXUWUXVWLQ*RGDQG*RG¶VGLYLQHSODQDVDVRXUFHRIVWUHQJWKDQGFRPIRUW7KHUHLV QRZD\WRNQRZKRZWKHFKDQJHVZHJRWKURXJKZLOOXOWLPDWHO\LPSDFWXV:HPXVWOHDQRQ-HVXV¶SURPLVH WRQHYHUOHDYHRUIRUVDNHXV7KRVHZKRGRZHOOZKHQWKHMR\VDQGVRUURZVRIOLIHFRPHDUHFRQILGHQWLQ *RG¶VSURYLVLRQRISHDFHDQGSURWHFWLRQ+DQGOLQJFKDQJHZHOOFDQLQFUHDVHRXUIDLWKDQG FRQILGHQFH LQ *RG DQG RXUVHOYHV 1DYLJDWLQJ OLIH¶V WHVWV DQG WULXPSKV ZLWK IOH[LELOLW\ DQGFRQILGHQFHERRVWVRXUUHVLOLHQFHWRWDFNOHWKHQH[WDVVLJQPHQW7KHQH[WWLPHWKH RSSRUWXQLW\IRUFKDQJHFRPHVLQWR\RXUOLIHNQRZWKDW\RXFDQKDQGOHLWZLWK *RG¶VJUDFHWKH+RO\6SLULW¶VJXLGDQFHDQG-HVXV¶H[DPSOHIRUOLYLQJ

Carla J. Debnam, MS, LCPC Executive Director, Renaissance Christian Counseling Center

www.gracenglorymagazine.org  www.gracenglorymagazine.org   25 25


Maryland General Hospital . . . provides comprehensive health care for seniors. For information about outpatient care, contact the Linden Medical Group Bolton Hill practice at (410) 225-8855. For inpatient care in our ACE Unit contact our referral line at (410) 225-8400. 26   June  2011  |  Grace&Glory


body basics

In

WRGD\¶VZRUOGLWZRXOGVHHPWKDWPRUHDQG PRUHSHRSOHWHQGWRSXWH[HUFLVHRQWKHEDFNEXUQHU LQIDYRURIPRUHIDVWSDFHGUHVXOWVWRRXUGHVLUHV ,Q UHFHQW \HDUV WKHUH KDYH EHHQ D VLJQLILFDQW QXPEHURIGLHWSLOOVFODLPLQJWKH³WUXH´VFLHQWLILF ZD\ WR ORVH ZHLJKW DQG JDLQ PXVFOH GHILQLWLRQ 8QIRUWXQDWHO\ LW ZRXOG VHHP WKDW WKLV NLQG RI PHQWDOLW\KDVEHHQSDVVHGRQWRRXUNLGVDQGWKDW WKH\DUHILQGLQJOHVVPRWLYDWLRQWRH[HUFLVH  ([HUFLVH SURJUDPV IRU NLGV DUH KXJHO\ LPSRUWDQW$PHULFDKROGVWKHQRWVRLOOXVWULRXVWLWOH RIWKHIDWWHVWQDWLRQLQWKHZRUOGDQGWKLVPRPHQW RXU NLGV DUH SRLVHG WR LQKHULW WKDW WLWOH 7KDW LV VRPHWKLQJ WKDW DOO SDUHQWV ZRXOG QRW ILQG DV D SDUWLFXODUO\FRPIRUWLQJWKRXJKW )RU WKRVH RI \RX QRW \HW FRQYLQFHG WKDW DQ H[HUFLVH SURJUDP IRU \RXU NLGV LVQ¶W D SULRULW\ The  American   Obesity   Association   states   the   VLQJOHODUJHVWIDFWRULQFKLOGKRRGREHVLW\LVODFN RI SK\VLFDO DFWLYLW\ DQG H[FHVVLYH VHGHQWDU\ EHKDYLRU²WKDWLVWRVD\ZDWFKLQJWRRPXFK79 DQGSOD\LQJWRRPDQ\YLGHRJDPHV

Why  Start  My  Kid  on  an  Exercise  Program?  2XWVLGHRIWKHVRFLDOSDULDKVWDWXVRIWKHREHVHLQRXUVRFLHW\WKHUHDUHVLJQL¿FDQWHDVLO\DYRLGDEOHKHDOWK ULVNVLQYROYHGZLWKREHVLW\7KH$2$OLVWVFRPPRQKHDOWKFRQGLWLRQVDVVRFLDWHGZLWKFKLOGUHQZKRDUHREHVH EHFDXVHRIODFNRIUHJXODUH[HUFLVH7KHVHFRQGLWLRQVLQFOXGHDVWKPD7\SH'LDEHWHVK\SHUWHQVLRQRUWKRSHGLF SUREOHPVDQGPRVWIULJKWHQLQJVOHHSDSQHD²DFRQGLWLRQLQZKLFKEUHDWKLQJFHDVHVGXULQJVOHHSLQJ2EYLRXVO\ QRWSHUPDQHQWO\EXWWKHHIIHFWVDUHORVVRIIRFXVDQGDVLJQL¿FDQWLQFUHDVHLQWKHORVVRIORJLFDOWKRXJKW  $Q H[HUFLVH SURJUDP IRU \RXU FKLOGUHQ LV VR LPSRUWDQW EHFDXVH RI WKH ODUJH DPRXQW RI KHDOWK SUREOHPV DVVRFLDWHGZLWKWKRVHDUHLQDFWLYH²QDPHO\REHVLW\6LQFHWKHQXPEHURIFKLOGUHQFODVVL¿HGDVREHVHXQGHU WKHDJHRIKDVLQFUHDVHGPRUHWKDQIRXUWLPHVIURPURXJKO\SHUFHQWWRRYHUSHUFHQWLQZLWKWKH VLQJOHODUJHVWFDXVHRIREHVLW\LVODFNRIH[HUFLVH  7RKHOS\RXUFKLOGDYRLGWKHVHKHDOWKULVNVQRWWRPHQWLRQWKHSV\FKRORJLFDOULVNVRIEHLQJRXWFDVWEHFDXVHRI ZHLJKW\RXQHHGWRVHWWKHPXSRQDUHJXODUH[HUFLVHSURJUDP  &KLOGUHQ¶VH[HUFLVHSURJUDPVDUHQRWKDUGWRGR²MXVWJHWWKHPRXWVLGHRUNHHSWKHPLQVLGHEXWIRFXVRQ WKHP JHWWLQJ DFWLYH ,W¶V LPSRUWDQW WR UHDOL]H WKDQ D FKLOGUHQ¶V H[HUFLVH SURJUDP GRHV QRW QHFHVVDULO\ PHDQ SXPSLQJLURQ²UDWKHULWKDVPRUHWRGRZLWKFDUGLRYDVFXODUDFWLYLWLHVWKDWEXUQORWVRIHQHUJ\([DPSOHVRI JUHDWFDUGLRYDVFXODUDFWLYLWLHVDUHUXQQLQJVZLPPLQJURZLQJFDQRHLQJURFNFOLPELQJ²WKHOLVWJRHVRQ,WDOVR GRHVQ¶WQHHGWREHVLPSO\UXQQLQJ²LWFDQEHDJDPHRIWDJFDWFKSOD\LQJVRFFHURXWGRRUVDQ\WKLQJWKDWJHWV \RXUNLGVKHDUWEHDWLQJDQG JHWVWKHPVZHDWLQJDELW  5HVHDUFKKDVDOVRVKRZQWKDWREHVHFKLOGUHQWHQGWREHPRUHGHSUHVVHGWKDQRWKHUFKLOGUHQZKRDUH¿W,Q DGGLWLRQSK\VLFDODFWLYLWLHVHVSHFLDOO\FDUGLRYDVFXODUDFWLYLWLHVFDQDFWXDOO\PDNH\RXIHHOJUHDW7KHVRFDOOHG ³UXQQHU¶VKLJK´LVFDXVHGZKHQVRPHRQHZKRLVHQJDJHGDKLJKDPRXQWRIFDUGLRYDVFXODUDFWLYLW\JHWVDPDVVLYH GXPSRIGRSDPLQHLQWRWKHEUDLQ²DFKHPLFDOWKDWLQVWLOOVDHXSKRULFVWDWHLQWKHSHUVRQGRLQJWKHDFWLYLW\D QDWXUDOKLJK  ,WZRXOGVHHPORJLFDOWKDWJHWWLQJ\RXUFKLOGRQDQH[HUFLVHSURJUDPVKRXOGEHDSDUDPRXQWDVDSDUHQWWR HQVXUHWKHKHDOWKDQGKDSSLQHVVRI\RXUFKLOG%XWDORQJZLWKWKHH[HUFLVHJRHVDJRRGGLHWKHDOWK\UHODWLRQVKLSV VWD\LQJDFWLYHDQGRIFRXUVHODXJKLQJDORW$OORIWKHVHWKLQJVFRQWULEXWHWR\RXUFKLOG¶VOLIHDQGDQH[HUFLVH SURJUDPIRU\RXUFKLOGLVLQUHDOLW\MXVWDSLHFHRIWKHSX]]OH  9LVLWKWWSZZZ¿WQHVVDQGNLGVFRPNLGVVWXIIHTXLSPHQWKWPO IRU FRPPHUFLDO ZHLJKW WUDLQLQJ HTXLSPHQW IRUNLGV This  article  is  an  excert  from  Kids  &  Fitness.Com www.gracenglorymagazine.org   27 27 www.gracenglorymagazine.org  


28   June  2011  |  Grace&Glory


$ONT "E !FRAID I to Close the $OOR

a womanâ&#x20AC;&#x2122;s perspective

     KDYHDTXHVWLRQIRU\RX³'R\RXWKLQNWKDW*RGUHYHDOVDSDWKIRUXVE\ FORVLQJGRRUV"´,PDJLQHWKLV\RXDUHWUDYHOLQJLQRQHGLUHFWLRQEXWWKHUHLVDQRWKHU SRVVLEOH GLUHFWLRQ LQ ZKLFK \RX GRQ W EHOLHYH LV QHFHVVDULO\ WKH PRVW IHDVLEOH KRZHYHUEHFDXVHRIVLWXDWLRQVWKDWKDYHDULVHQ\RXDUHGHWRXUHGIURP\RXUH[LVWLQJ SDWKWRWKLVURDG$WZKDWSRLQWZRXOG\RXVD\WKDWDOONLQGVRIGLI¿FXOWLHVRQSDWK$ DUHVLJQVWKDW*RGLVFORVLQJGRRUVWKHUHDQGWKDW\RXVKRXOGRSHQ\RXUPLQGDQG KHDUWWRSDWK% WKH:LOORI*RG "2UZLOO\RXDOZD\VDVVXPHWKDWGLI¿FXOWLHVDUH WULDOVIRU\RXUSHUVRQDOGHYHORSPHQWDQGVWD\RQWKDWSDWK"$WZKDWSRLQWDUH\RX LQWHUIHULQJZLWKWKH:LOORI*RG" &KRRVLQJ\RXURZQSDWKLVDVDFUHGSULYLOHJHJLYHQWRXVE\*RGXQGHU &DVVDQGUD +LVDOPLJKW\GLUHFWLRQWKHEHVWWKLQJZHFDQGRLVDFFHSWWKHZRUOGWKHZD\ LWLV7KHUHLVDUHDVRQZK\*RGFUHDWHGLWWKHZD\KHGLG'RQ WEHDIUDLGWR Vaughn-­Fox FORVHRQHGRRUEHFDXVH,JXDUDQWHH\RXWHQPRUHZLOORSHQ)ROORZ\RXU*RGFKRVHQSDWK,JXHVV 2XW)R[HG0HGLD WKHELJJHUTXHVWLRQLVKRZGR\RXGHWHUPLQHZKDW\RXU*RGJLYHQSDWKLV" (YHU\\HDUWKDWFRPHVLWLVRXUGXW\WRUHHYDOXDWHRXUSODQVSULRULWLHVDQGSXUSRVH7RKHOSXVXQGHUVWDQGZKDWWKH/RUG GHVLUHVIRUHDFKRIXVZHQHHGWRUHIUHVKDQGUHQHZRXUPLQGVZLWK*RG VSODQ'RQRWKDYHDQ\WKLQJWRGRZLWKJRGOHVV P\WKVDQGIDEOHVRIROGZRPHQ,QVWHDGWUDLQ\RXUVHOIWREHJRGO\7LPRWK\,QWHUQDWLRQDO6WDQGDUG9HUVLRQ3DXO H[SODLQVWRXVWKDWZHDUHWRGLVFLSOLQHRXUZD\VLQWKHGLUHFWLRQRIJRGOLQHVV6RZK\GRZHTXHVWLRQHYHQWVDQGVLWXDWLRQV WKDWKDSSHQLQRXUOLYHV",NQRZ,DPQRWWKHRQO\RQHZKRKDVEHHQDIUDLGWRFORVHDGRRUEHFDXVHRIWKHXQFHUWDLQW\RIZKDW LVLQVWRUHIRUP\OLIH6RKRZGRZHUHPRYHWKHIHDURIZKDWLVEHKLQGGRRUQXPEHUWZR":HPXVWGLVFLSOLQHRXUVHOYHV WRWKHZRUGRI*RGDQGKDYHIDLWKWKHVL]HRIDPXVWDUGVHHG,WLVWKHQWKDWZHVWRSEHLQJDEOHVVLQJEORFNHUDQGEHFRPHD EOHVVLQJUHFHLYHU :KDWGRHV*RGZDQWIURPP\OLIH"$TXHVWLRQWKDWPDQ\RIXVVWUXJJOHZLWKRQDGDLO\EDVLV7KHDQVZHUVOLHLQWKH:RUGRI*RG 7+(%,%/( WKH VFULSWXUHVUHYHDOWKHNH\VWKDWFDQKHOSXVWRJURZ1RPDWWHUZKDWGRRUVRUVLWXDWLRQVDUHFORVHGLQRXUOLYHV*RGDOZD\VSUHSDUHVRWKHUSDWKVWRQXUWXUHRXU QHHGVQRWQHFHVVDULO\RXUZDQWV1RZLVWKHWLPHWKDWZHFORVHRXUPLQGVWRWKHFRQVLVWHQF\RIOLIHDQGRSHQRXU+HDUWVDQG0LQGVWR*RG V:LOOIRU+LVFKLOGUHQ :KHQOLIH VGRRUVFORVHGRQ WIUHW:DLWWRVHHZKDW0,5$&8/286$'9(1785(+HKDVZDLWLQJIRUXV 8QWLOQH[WWLPH 6WD\)RFXVHG6WD\6WURQJ([SHULHQFH/LIHDWLWVIXOOHVWEXWPRVWRIDOO6WD\,Q/RYHZLWK*RG

www.gracenglorymagazine.org  29


30   June  2011  |  Grace&Glory


3($&( 287 7KLQJVLQOLIHPD\QRWDOZD\VEHWKHZD\ ZHZDQWWKHPWREHEXWNQRZLQJZKR*RG LVLQRXUOLIHFDQEULQJJUHDWSHDFH3HDFH RQ WKH RXWVLGH FRPHV IURP NQRZLQJ *RG RQWKHLQVLGH7KH/RUGSURPLVHVWKLVDVD UHVXOWRIEHLQJWDXJKWRI+LP,W¶VWLPHWKDW ZHOLYHRXUOLYHVZLWKRXWFKDRV 7KHUHLVDORWJRLQJRQDURXQGXVEXWZHPXVW PDNHDFRQVFLRXVHIIRUWWROHDUQWKHZD\VRI *RG+RZGR\RXGRWKDW\RXDVN"7UXVWLQ WKH/RUGZLWKDOO\RXUKHDUWDQGGRQRWOHDQ WR\RXURZQXQGHUVWDQGLQJLQ$//RI\RXU ZD\VDFNQRZOHGJH+LPDQG+HZLOOGLUHFW \RXUSDWK 3URYHUEV <RXUEHOLHYLQJ LQ *RG LV D GLUHFW OLQN WR JUHDW SHDFH <RX¶YHVHHQWKHEXPSHUVWLFNHUVWKDWVWDWH ³.QRZ *RG NQRZ SHDFH 1R *RG QR SHDFH´:HOO\RXPD\IHHOWKDWQRRQHUHDOO\ FDUHVRUXQGHUVWDQGV\RX%XW*RGFDUHVIRU UHDO+HNQRZVDOOWKHUHLVWRNQRZDERXW \RX+HNQRZVDERXW\RXUKRSHVGUHDPV

teen connect And  all  thy  children  shall  be  taught  of  the  Lord;;  and  great  shall   be  the  peace  of  thy  children.    Isaiah  54:13 IDLOXUHVDQGIHDUV+HSURPLVHGWKDW+HZRXOG QHYHUOHDYH\RXDQGQHYHUIRUVDNH\RX+HMXVW ZDQWVWREHLQUHODWLRQVKLSDQGLQYROYHGLQ\RXU OLIH'RQ¶WOHDYH+LPKDQJLQJ *RG ORYHV \RX DQG OLNHV \RX  :H KDYH KHDUG SHRSOHVD\³,KDYHWRORYH\RXEXW,GRQ¶WKDYH WROLNH\RX´+RZIRROLVK*RGLVZDLWLQJWR KHDU\RXSUD\+HJHWVDNLFNRXWRI\RXDVNLQJ

TXHVWLRQV DERXW WKH %LEOH +H ORYHV ZKHQ \RX VKDUH \RXU JLIWV DQG WDOHQWV DQG +H ZDQWV \RX WR XQGHUVWDQG WKH UHDOLW\ RI +LV SUHVHQFH 6RDN LQ HYHU\ RSSRUWXQLW\\RXJHWWROHDUQDERXWWKH /RUGDQG\RXDUHJXDUDQWHHGHYHUODVWLQJSHDFH 3KLOLSSLDQV &KDSWHU  YHUVHV  VWDWH ³'RQ¶W ZRUU\ DERXW DQ\WKLQJ LQVWHDG SUD\ DERXW HYHU\WKLQJ7HOO*RGZKDW\RXQHHGDQGWKDQN KLPIRUDOOKHKDVGRQH7KHQ\RXZLOOH[SHULHQFH

*RG¶V SHDFH ZKLFK H[FHHGV DQ\WKLQJ ZH FDQ XQGHUVWDQG  +LV SHDFH ZLOO JXDUG \RXU KHDUWV DQGPLQGVDV\RXOLYHLQ&KULVW-HVXV$QGQRZ GHDUEURWKHUVDQGVLVWHUVRQH¿QDOWKLQJ)L[\RXU WKRXJKWV RQ ZKDW LV WUXH DQG KRQRUDEOH DQG ULJKWDQGSXUHDQGORYHO\DQGDGPLUDEOH7KLQN DERXW WKLQJV WKDW DUH H[FHOOHQW DQG ZRUWK\ RI SUDLVH.HHSSXWWLQJLQWRSUDFWLFHDOO\RXOHDUQHG DQG UHFHLYHG IURP PH *2' ±HYHU\WKLQJ\RX heard  from  me  and  saw   PHGRLQJ7KHQWKH*RG RI SHDFH ZLOO EH ZLWK \RX3($&(287´

Pastors Gregory & Tonya Dennis

Kingdom Worship Center 6419 York Road, ownson, MD 21212

410-377-3500

www.gracenglorymagazine.org  31


32   June  2011  |  Grace&Glory


www.gracenglorymagazine.org  33


34   June  2011  |  Grace&Glory


www.gracenglorymagazine.org  35


36   June  2011  |  Grace&Glory


For  a  child  has  been  bornâ&#x20AC;&#x201D;for  us!  The  

H APPY FATHERâ&#x20AC;&#x2122;S Â

word of encouragement

gift  of  a  sonâ&#x20AC;&#x201D;for  us!    Heâ&#x20AC;&#x2122;ll  take  over  the   running  of  the  world.    His  names  will  be:   Amazing  Counselor,  Strong  God,  Eternal   Father,  and  Prince  of  Wholeness.    His   ruling  authority  will  grow,  and  thereâ&#x20AC;&#x2122;ll   be  no  limits  to  the  wholeness  he  brings.     Heâ&#x20AC;&#x2122;ll  rule  from  the  historic  David  throne   over  that  promised  kingdom.    Heâ&#x20AC;&#x2122;ll  put   that  kingdom  on  a  firm  footing  and  keep   it  going  with  fair  dealing  and  right  living,   beginning  now  and  lasting  always.    The   zeal  of  God-­of-­the-­Angel-­Armies  will  do   all  this.    [Isaiah  9:6  â&#x20AC;&#x201C;  The  Message  Bible]

DAY

.  .  .  to  the  Father  of  ALL  Fathers! :KHQZHUHDG,VDLDKLQDQ\NQRZQYHUVLRQRIWKH%LEOHLWVWLOOUHPDLQVWUXH WKDW*RGLVRXU)DWKHU±$PD]LQJ6WURQJDQG(WHUQDOIXOORIZKROHQHVV+H ZDQWVWRGRJRRGWKLQJVIRU+LVFKLOGUHQ+HWUXO\LVWKH)DWKHURIDOOIDWKHUV -HVXVZDV*RGLQWKHÃ&#x20AC;HVKVHQWGRZQWRHDUWKLQWKHIRUPRIWKHJLIWRID 6RQ±MXVWIRUXVWRVKRZ\RXWKHUROHRIDUHDOIDWKHUKRZ+HIXQFWLRQV DQGORYHV-HVXVZDVVHQWWRVKRZWKHORYH*RGKDVIRUXVDQGWRDOVRVKRZ DQGWHDFKXVWKDWZHGRQ¶WKDYHWRLQGHSHQGHQWO\GRWKLQJVZLWKRXW+LPEXW DOORZ+LPWREHWKH)DWKHUWKDWLVDQH[DPSOHWRHYHU\HDUWKO\IDWKHU:LWK RXULQGHSHQGHQFHLQPLQGZHWKHQDUHDOZD\VWU\LQJWRWDNHRYHUWKHUXQQLQJ RIWKHZRUOGZKHQWKH%LEOHFOHDUO\VD\VLQWKHDERYHUHIHUHQFHGVFULSWXUH WKDW-HVXVZRXOGWDNHRYHUWKHUXQQLQJRIWKHZRUOG±WKH*RYHUQPHQWLVWREH XSRQ+LVVKRXOGHUV±QRW\RXUV$JDLQ-HVXVFDPHWRSODQHWHDUWKVSHFL¿FDOO\ WRVKRZ\RXWKHORYHRIWKH)DWKHU+HZDVVHQWWREHRXU$PD]LQJ&RXQVHORU D6WURQJ*RGRXU(WHUQDO)DWKHUDQGWKH3ULQFHRI:KROHQHVV $VRXU$0$=,1*&2816(/25±+HUHLVZKDWWKHVHWZRZRUGVORRNOLNH WRJHWKHU$PD]LQJPHDQV³WR¿OOZLWKZRQGHU´DQG&RXQVHORUPHDQV³RQH ZKRJLYHVDGYLFHLQODZDQGPDQDJHVFDVHVIRUFOLHQWVLQFRXUW´7KHUHIRUH LI\RXZDQWWRKDYH\RXUOLIH³¿OOHGZLWKZRQGHU´ORRNWRWKH&RXQVHORU ZKRZLOOJLYH\RXDGYLFHDQGPDQDJH\RXUFDVHDJDLQVWWKHDFFXVHURIWKH EUHWKUHQ*RGZDQWVWRUHSUHVHQW\RXLQHYHU\FDVHQDWXUDOO\DQGVSLULWXDOO\ WKDWFRPHVXSDJDLQVW\RX7HFKQLFDOO\*RGZDQWVWR¿JKWWKHEDWWOHVWKDW \RXIDFHGDLO\DQGDOORZ\RXWREHIUHHIURPWKHERQGDJHVDQGVFKHPHVRI WKHGHYLOWKDWLVVKRZQ\RXRQDGDLO\EDVLV $VRXU67521**2'+HUHLVZKDWWKHVHWZRZRUGVORRNOLNHWRJHWKHU ³6WURQJ´PHDQV³KDYLQJRUPDUNHGE\JUHDWSK\VLFDOSRZHUKDYLQJPRUDO RULQWHOOHFWXDOSRZHUDQGKDYLQJJUHDWUHVRXUFHV DVRIZHDOWKRUWDOHQW ´ ³*RG´PHDQV³WKH%HLQJSHUIHFWLQSRZHUZLVGRPDQGJRRGQHVVZKRLV ZRUVKLSHGDV&UHDWRUDQG5XOHURIWKHXQLYHUVH´7KHUHIRUHLI\RXZDQWWRVHH \RXU6WURQJ*RGLQDFWLRQ±WKHQDOORZ+LPWRVKRZ+LVJUHDWSK\VLFDODQG LQWHOOHFWXDOSRZHUPDUNHGRQ\RXUEHKDOIDQGDOORZ\RXWREHDVWHZDUGRYHU WKHJUHDWUHVRXUFHVWKDW+HKDVSODFHGRQHDUWKWREHXVHGE\\RXDQGVKDUHG ZLWKRWKHUV*RGLVWKHRQO\2QHSHUIHFWLQSRZHUZLVGRPDQGJRRGQHVV $V RXU (7(51$/ )$7+(5 ± +HUH LV ZKDW WKHVH WZR ZRUGV ORRN OLNH WRJHWKHU³(WHUQDO´PHDQV³KDYLQJLQ¿QLWHGXUDWLRQ´DQG³FRQWLQXHGZLWKRXW LQWHUPLVVLRQ´)DWKHUPHDQV³WKH¿UVWSHUVRQRIWKH7ULQLW\DQGDPDQZKR KDVEHJRWWHQDFKLOG´*RGKDVEHJRWWHQXV±LQWKDWZHKDYHQRWFKRVHQ +LPEXW+HKDVFKRVHQXV7KLQNRIKRZDZHVRPHWKDWLVIRUVRPHRQHWR

NQRZHYHU\WKLQJDERXW\RX±WKHJRRGWKDWRWKHUVVHH\RXGRDQGWKHVRPHWLPHV VHQVHOHVVDQGLQDSSURSULDWHWKLQJVWKDW\RXGRDQGD*RGZKRVWLOOFKRRVHV\RX LQVSLWHRI\RX7KDWLVH[DFWO\ZKDW*RGWKURXJK-HVXVGLG7KHQZKREHWWHUWR VSHQGHWHUQLW\ZLWKWKDQRXU(WHUQDO)DWKHU6HODK 35,1&(2):+2/(1(66±$V\RXU3ULQFHLWPHDQVWKDW*RGLV\RXU³0RQDUFK .LQJ´³WKHUXOHURIDSULQFLSDOLW\RUVWDWH´:KROHQHVVPHDQV³IUHHRIGHIHFWRU LPSDLUPHQWLQWDFWSK\VLFDOO\VRXQGDQGKHDOWK\IUHHRIGLVHDVHRUGHIRUPLW\DQG PHQWDOO\RUHPRWLRQDOO\VRXQG´:KROHQHVVVKRXOGEH\RXUJUHDWHVWGHVLUH±WRKDYH QRWKLQJEURNHQQRWKLQJPLVVLQJDQGQRWKLQJODFNLQJ'R\RXNQRZDQ\RQHZKR ZRXOGQRWZDQWDIDWKHUZKRLVWKH.LQJRIDOO.LQJVWKH5XOHURIKHDYHQDQG(DUWK" 1RZOHW¶VORRNDWDOOWKHRWKHUWKLQJVWKDW*RGDV\RXU)DWKHULV+LVUXOLQJDXWKRULW\ LQVSLWHRIZKDWLWPD\ORRNOLNHULJKWQRZLVJURZLQJDQGWKHUHLVQROLPLWVWRWKH ZKROHQHVV+HJLYHVWR\RXRQDPRPHQWE\PRPHQWEDVLV+HUXOHVIURPWKH KLVWRULF'DYLGWKURQHRYHU+LVSURPLVHGNLQJGRP7KH.LQJGRPRI*RGLVRQD ¿UPIRRWLQJDQG*RGNHHSVLWJRLQJZLWKIDLUGHDOLQJDQGULJKWOLYLQJEHJLQQLQJ QRZDQGODVWLQJIRUHYHU7KH]HDORI*RGRIWKH$QJHO$UPLHVLVGRLQJDOOWKDW ,QVSLWHRIZKDW\RXVHHKDSSHQLQJLQWKHZRUOGRQDGDLO\EDVLVEHLWHDUWKTXDNHV WRUQDGRHVLQFUHDVLQJJDVSULFHVDZRUOGVHHPLQJO\RXWRIFRQWURONQRZWKDW\RXU )DWKHU*RGLVVWLOOLQFRQWURO+HZDQWVWREH)DWKHUWR\RXEXW+LV3UHFLRXV+RO\ 6SLULWLVVXFKD*HQWOHPDQWKDW+HZRXOGQRWLQWUXGHRQ\RX,I\RXGRQRWNQRZ +LPDV/RUGDQG6DYLRUDOORZPHWROHW\RXLQRQDVHFUHW±*RGLVULJKWQRZ NQRFNLQJRQWKHGRRURI\RXUKHDUW&$87,217RGD\LI\RXZRXOGKHDU+LP FDOOLQJWR\RX,EHJRI\RXQRWWRKDUGHQ\RXUKHDUWEXWWROHW+LPLQ+HLV\RXU &UHDWRUDQGWUXO\ZDQWVWREH\RXU)DWKHU ,HQFRXUDJH\RXWRGD\WRORRNWR*RGWKH)DWKHUDQGNQRZWKDW+HLVJUHDWHUWKDQ PRUHORYLQJWKDQDQ\HDUWKO\IDWKHU,QIDFW\RXFDQVHDUFKKLJKDQGORZORRN HYHU\ZKHUH DQG \RX VWLOO ZLOO QRW ¿QG QRERG\ JUHDWHU QRERG\ ZLVHU QRERG\ JUHDWHUWKDQ*RG,HQFRXUDJH\RXWREROGO\GHFODUHWKDW+HLV\RXUHYHU\WKLQJ 3UD\HU  )DWKHU LQ WKH 1DPH RI -HVXV WKDQN<RX IRU<RXU XQFRQGLWLRQDO DQG VWXEERUQ ORYH WKDW ORYHV PH LQ VSLWH RI PH  7KDQN<RX IRU EHLQJ WKH EHVW )$7+(5 WKDW FUHDWLRQFRXOGHYHUKDYH 367RDOOWKHIDWKHUVRIWKHZRUOG±EHFRPHOLNH*RG DQGEHDJUHDWIDWKHUDQGRQEHKDOIRIHYHU\VRQDQG GDXJKWHUZHVD\³+DSS\)DWKHU¶V'D\´ZLWKORYHIURP DOORI\RXUFKLOGUHQ

DONNA WILLIAMS-ROSS www.gracenglorymagazine.org  37


Carter’s Commentary

“THE MYTH  OF  CLOSURE”  $VDUHVXOWRISUREDEO\WKHELJJHVWQHZVVWRU\VLQFH³´,IHHO FRPSHOOHGWRDWOHDVWVKDUHDIHZZRUGVDERXWWKHGHDWK DVVDVVLQDWLRQ  RI RXU QDWLRQ¶V  0RVW :DQWHG 7HUURULVW 2VDPD %LQ /DGHQ ZKR ZDV³WDNHQRXW´E\DJURXSRI1DY\6HDOVLQDFRPPDQGRUDLGRQD FRPSRXQGLQ3DNLVWDQZKHUHKH¶GEHHQOLYLQJIRUWKHSDVW VL[\HDUV  :KHQWKHQHZVEURNHRQ6XQGD\0D\VWDWDURXQG  SP DOPRVW LPPHGLDWHO\ &11¶V :ROI %OLW]HU DPRQJ RWKHUV EHJDQ XVLQJ D ZRUGWHUP WKDW IRU VRPH WLPH,¶YHKDGSUREOHPVZLWK7KHZRUGWHUPLV³FORVXUH´ ,WZDVSRVWXODWHGLQYDULRXVZD\VE\UHSRUWHUVOLNH%OLW]HU DQGFRXQWOHVVRWKHUVWKDWSHUKDSVQRZJLYHQWKHGHDWK RI%LQ/DGHQWKDWRXUQDWLRQ¶VLQFOXGLQJIDPLO\PHPEHUV RIYLFWLPVRIWHUURULVPDVVRFLDWHGZLWKKLPZRXOG¿QDOO\KDYH ³FORVXUH´  )RUPHWKHLQWHQWRIWKHXVDJHRIWKLVZRUGFRQYH\VPHDQLQJ WKDW LV VHOGRP LI HYHU UHDOL]HG 7KH LQWHQW LV WR FRQYH\ WKDW DVDUHVXOWRIDFHUWDLQDFWLRQVWDWHPHQWHYHQWHWF RUVRPH FRPELQDWLRQ RI WKH DIRUHPHQWLRQHG  WKDW ZKDWHYHU SUHYLRXVO\ WRRN SODFH WKDW SURYHG KXUWIXO WURXEOLQJ RU GHYDVWDWLQJ KDV VRPHKRZEHHQDVVXDJHGE\VDLGDFWLRQVWDWHPHQWHYHQWHWF,QRWKHU ZRUGV UHJDUGOHVV RI WKH GHSWK RI WKH SDLQ RU JULHI WKDW XQWLO KHOS RU KHDOLQJWDNHVSODFHWKHUH¶VDFHUWDLQRSHQQHVVWKDWZLOOQHYHUEHFORVHG XQWLO³FORVXUH´RFFXUV  ,URQLFDOO\ DV PRUH DQG PRUH ³´ YLFWLPV¶ IDPLO\ PHPEHUV ZHUH LQWHUYLHZHG WKH\ ZHUH KHDUG DUWLFXODWLQJ WKH VDPH PHVVDJH LQOLJKWRI%LQ/DGHQ¶VGHDWK,QHVVHQFHWKH\VDLG³7KHQHZVRI %LQ/DGHQ¶VGHDWKDIWHUDOPRVWWHQ\HDUVPD\PHDQWKDWMXVWLFHKDG EHHQVHUYHGDWWKHKDQGVRIRXUFRXQWU\EXWKLVGHDWKZRXOGQRWWDNH DZD\WKHORVVDQGVRUURZWKDWLVVWLOOIHOWDIWHUDOORIWKLVWLPH$QGLW FHUWDLQO\ZRQ¶WEULQJEDFNRXU UHVSHFWLYH ORYHGRQH V ´:KDWRQ WKHVXUIDFHZRXOGVHHPWREHDPHDQVRI³FORVXUH´UHDOO\ZDVQ¶WLVQ¶W ³FORVXUH´DWDOO  ,FRQWHQGWKDW³FORVXUH´LVH[WUHPHO\HOXVLYHDQGUDUHO\LIHYHQ DWWDLQDEOH7KHIDPLO\IULHQGVFODVVPDWHVDQGDOOZKRIROORZHGWKH WUDJLFVWRU\RIWKHGLVDSSHDUDQFHRI\HDUROGKRQRUVVWXGHQW)HOHFLD %DUQHVRYHUDIRXUPRQWKSHULRGZHUHHVVHQWLDOO\LQVHDUFKRI³FORVXUH´ :KHUHZDVVKH":KDWKDSSHQHGWRKHU":KHQWKHKHDUWEUHDNLQJQHZV EURNHWKDWKHUERG\ZDVIRXQGLQWKH6XVTXHKDQQD5LYHUKHUIDPLO\¶V DQG DOO FRQFHUQHG ZRUVW IHDUV ZHUH FRQ¿UPHG  3ULRU WR KHU EHLQJ IRXQGSOHDVKDGJRQHRXWIURPKHUIDPLO\YLDWKHPHGLDLQFOXGLQJD VKRUWVHJPHQWRQ79¶V³$PHULFD¶V0RVW:DQWHG´WKDWDOOWKH\ZDQWHG ZDV³FORVXUH´VRPHERG\WRFRPHIRUZDUGZLWKSHUWLQHQWLQIRUPDWLRQ )HOHFLDWRVKRZXSRUIRUKHUWREHIRXQG«DQ\WKLQJWKDWZRXOGEULQJ ³FORVXUH´  <HW DW WKH WLPH RI WKLV FRPPHQWDU\¶V SXEOLFDWLRQ WKHUH KDYHEHHQWZRPHPRULDOV RQHLQ1RUWK&DUROLQDDQGWKHRWKHUKHUH LQ %DOWLPRUH  DQG WKH IDPLO\ VWLOO KDV PRUH TXHVWLRQV WKDQ DQVZHUV EHFDXVHWKHLQYHVWLJDWLRQLVVWLOORSHQ7KHJXHVVLVWKDWHYHQZKHQ P\KRSHDVRSSRVHGWRLI WKHFDVHLVVROYHGWKDWHYHQWKDWZLOOEHRI OLWWOHFRQVRODWLRQFRPSDUHGWRWKHORVVRIVXFKD\RXQJEHDXWLIXODQG LQWHOOLJHQWOLIH  /HW XV EH PLQGIXO WKDW WKH VFULSWXUHV QHYHU WHDFK DV LV RIWHQ SXUSRUWHG WKDW ZH DUH WR ³IRUJLYH DQG IRUJHW´  $JDLQ WKDW¶V QRW VFULSWXUDO:HDUHWRIRUJLYHEXWWKH%LEOHQHYHUFDOOVXVWRIRUJHWZH FDQ¶W IRUJHW 7LPH DQG WHPSHUDPHQW KHOS XV WR IRUJLYH WKH QHJDWLYH

38   June  2011  |  Grace&Glory

GHHGWKDWZDVGRQHWRXVWDNLQJWKHVWLQJDQGSDLQDZD\DVZHIRUJLYH %XW WZHQW\ \HDUV PD\ SDVV DQG WKH SHUVRQ DQGRU LQFLGHQW PD\ QRW KDYHFURVVHGRXUPLQGVXQWLOZHVHHWKDWSHUVRQRUVRPHWKLQJUHPLQGV XVRIWKDWLQFLGHQWDQGEDPPWKHUHLWLVMXVWDVIUHVKDVWZHQW\\HDUV HDUOLHU$JDLQWKHVWLQJDQGSDLQKDYHGLVVLSDWHGIRUJLYHQHVV KDVWDNHQSODFHWLPHKDVSDVVHGEXWRXUPHPRU\ZLOOOHW XVNQRZWKDWZKHQLW¶VDOOVDLGDQGGRQHZKDWVHHPHGWR KDYHEHHQFORVHGLVVWLOORSHQ7REHVXUHRQO\*RGFDQ IRUJLYHDQGIRUJHW :KDW ZH UHDOO\ ZDQW WKHQ PD\ QRW EH ³FORVXUH´  $VN DQ\RQHRIXVZKRKDVH[SHULHQFHGWKHGHDWKRIDORYHGRQH DQG ZH ZLOO LQ DOO OLNHOLKRRG VKDUH WKDW DOO RI WKH FDUGV YLVLWVDQGHYHQDPHDQLQJIXO+RPHJRLQJ6HUYLFHXOWLPDWHO\ GLGQ¶WEULQJ³FORVXUH´:KDWZHZDQWHGDQGQHHGHGZDVLVSHDFH RIPLQG XQGHUVWDQGLQJ DQG KHDOLQJ  $QG VXFK RQO\ FRPHV IURP*RG+RZPDQ\SHRSOHDUHFDUU\LQJEXUGHQVWKDWVKRXOG KDYH EHHQ SXW GRZQ ERUGHULQJ RQ ³ORVLQJ LW´ RU KDYH QHYHU UHFRYHUHGEHFDXVHWKH\WKRXJKWWKH\QHHGHG³FORVXUH´ZKHQ WKH\ QHHGHG WKH /RUG"  +H JLYHV XV WKH SRZHU WR FRSH  +H FDUULHVWKHEXUGHQ V IRUXV+HKHOSVXVWRPDNHVHQVHRXWRI WKHVHQVHOHVVZLWKRXWHYHUDFKLHYLQJ«FORVXUH7KHVRQJZULWHUZURWH ³+HVDWLV¿HV«RKZRQ¶W\RXOHW+LPLQ\RXUKHDUWDELGH«´  3KLORVRSKLFDOO\RQHPD\DVN³,VOLIHDVHULHVRIHQGLQJVRUQHZ EHJLQQLQJV"´ $UH ZH QRW HYHU JURZLQJ GHYHORSLQJ DQG HPHUJLQJ" 'RQ¶WRXUWULDOVRQO\FRPHWRPDNHXVVWURQJ"'RQ¶WZHHYHQZDQWWR FKHULVKDQGKROGRQWRWKRVHSUHFLRXVPHPRULHV"³&ORVXUH´VXJJHVWV FRPSOHWLRQ WHUPLQXV HQGLQJ DQG WKDW QRWKLQJ ZLOO IROORZ  ,V WKDW ZKDWZHUHDOO\ZDQW"2UGRQ¶WZHZDQWWRKRSHLQDQGIRUWKDWZKLFK LVHWHUQDO":KDWLVWKHUHDOGHWHUPLQLQJIDFWRUIRUVXFFHVVIXOOLYLQJWKH SURFHVV WKHMRXUQH\ RUWKHHQG WKHDFKLHYHPHQW "  :KHQFULVHVRFFXURXUEDVLFLQVWLQFWLVWR¿QGDVTXLFNO\DVSRVVLEOH DZD\RXWPHDQLQJVRPHUHVROXWLRQ<HWRXU&KULVWLDQWHDFKLQJKDV VRPXFKWRVD\DERXWHQGXULQJEHLQJSDWLHQWEHLQJWULHGVWD\LQJLQ WKHUDFHDQGRYHUFRPLQJ7KHUHDOLW\RIHYHQZKDWZHFRQVLGHUWREH DQHQG²LHGHDWK²LVQ¶WDQHQGEXWDPHDQVWRHWHUQDOLW\/LIHLVQ¶W VRPXFKDERXWFORVXUHDVLWLVDERXWH[SHULHQFHV²JRRGDQGEDG²DQG JURZLQJIURPWKHP$UJXDEO\WKHUHLVQRWUXH³FORVXUH´6RZKHQ ZH¶UHORRNLQJKRSLQJDQGZDLWLQJIRULWZH¶UHVHWWLQJRXUVHOYHVXS IRU GLVDSSRLQWPHQW  $JDLQ WKH /RUG SURYLGHV KHDOLQJ SHUVSHFWLYH GHOLYHUDQFHHWFEXWLI³FORVXUH´LVWKHHUDVXUHRIREVWDFOHVDQGEUXLVHV DVLIWRPDNHXVEHOLHYHWKDWVRPHWKLQJQHYHUKDSSHQHGKH\,KDYHD EULGJHWRVHOO\RXLQ%URRNO\Q  (LJKW \HDUV DJR IRUPHU 3UHVLGHQW *HRUJH : %XVK VWRRG RQ WKH DLUFUDIWFDUULHU866$EUDKDP/LQFROQEHIRUHDKXJHEDQQHUGHFODULQJ ³0,66,21 $&&203/,6+('´  2QH PRQWK DJR DIWHU D  \HDU PDQKXQW 2VDPD %LQ /DGHQ ZDV ³WDNHQ RXW´ DQG WKH PDQWUD ZDV LV WKDW MXVWLFH KDG EHHQ VHUYHG  +RZHYHU EDVHG RQ WKH ODWHVW QHZV UHSRUWVDO4DHGDWKHWHUURULVWRUJDQL]DWLRQIRUPHUO\OHGE\%LQ/DGHQ LVVWLOO³RSHQIRUEXVLQHVV´7KHJRRGQHZVLVVR LV*RG+H¶VDOZD\VRSHQ+HQHYHUFORVHV+H QHYHUVOHHSVQRUVOXPEHUV+HLVIURPHYHUODVWLQJ WRHYHUODVWLQJ

Dr. Harold A.Carter, Jr. Pastor, New Shiloh Baptist Church, Baltimore, MD


Bonaparte’s Florist 1200 W. North Avenue, Baltimore, MD Christopher Matthews Christian Bookstore 2239 Old Emmorton Road, Bel Air, MD First Baptist Church of Highland Park 6801 Sheriff Road, Landover, MD Gospel Tabernacle Baptist Church 3100 N. Walbrook Avenue Baltimore, MD Greater Harvest Baptist Church 1617 W. Saratoga Ave., Baltimore, MD Greater Paradise Baptist Church 2900 E. Oliver Street, Baltimore, MD His Way 8450 Baltimore National Pike Ellicott City, MD Jones Tabernacle Baptist Church 2100 W. Baltimore Street Baltimore, MD Joseph H. Brown, Jr. Funeral Home 2140 N. Fulton Avenue Baltimore, MD Kingdom Worship Center 6419 York Road, Baltimore, MD Lifeway Christian Bookstore 7900 Honeygo Blvd White Marsh, MD March Funeral Home 1101 E. North Avenue & 4300 Wabash Avenue Baltimore, MD

New Metropolitan Baptist Church 1501 N. McCulloh Street Baltimore, MD New Psalmist Baptist Church 6020 Marian Road Baltimore, MD New Shiloh Baptist Church 2100 N. Monroe Street Baltimore, MD Pennsylvania Avenue AME Zion Church 1128 W. Pennsylvania Avenue Baltimore, MD Restoring Life Intl Church 401 Reisterstown Road Baltimore, MD Rosie’s Assisted Living 2449 Shirley Avenue Baltimore, MD Safari Hair Studio 5311 Belair Road Baltimore, MD Security Square Mall Woodlawn, MD Sharon Baptist Church 1373 N. Stricker Street Baltimore, MD Southern Baptist Church 1701 N. Chester Street Baltimore, MD Southern Baptist Church 409 Constant Friendship Rd Abingdon, MD

Maryland General Hospital 827 Linden Avenue Baltimore, MD

St. John AME Church 810 N. Carrollton Avenue Baltimore, MD

Morning Star Baptist Church 154 Winters Lane, Baltimore, MD

St. Mary’s Seminary 5400 Roland Avenue Baltimore, MD

Morton & Sons Funeral Home 701 Laurens Street, Baltimore, MD Mt. Olive AME Church 2 Hicks Avenue, Annapolis, MD NAACP 8 West 26th Street, Baltimore, MD

Set The Captives Free Outreach Center 7111 Windsor Blvd Woodlawn, MD Upward Way Christian Supplies 5851 York Road Baltimore, MD

New Fellowship Christian Community Church 5200 Park Heights Avenue Baltimore, MD www.gracenglorymagazine.org 39 39 www.gracenglorymagazine.org  


40   June  2011  |  Grace&Glory

June 2011  

Grace & Glory is the Go To Magazine for your Spiritual, Physical and Emotional needs. It is an up and coming contemporary Faith-Based magazi...

Read more
Read more
Similar to
Popular now
Just for you