Page 1

Revista do Grupo de Estudos do Cancro do Pulmão

Director Dr. Agostinho Costa Corpo Redactorial Dr. Fernando Barata Dr.ª Teresa Almodôvar Dr.ª Ana Barroso Prof. Dr. Venceslau Hespanhol Dr. Paulo Costa Conselho Científico Dr. Bárbara Parente Pneumologista - Centro Hospitalar de V N Gaia/Espinho

Prof. Dr. António Araújo

Oncologista – Instituto Português de Oncologia , Porto

Prof. Dr. Henrique Queiroga

Pneumologista – Hospital de S. João, Porto

Dr. Hernâni Lencastre Cirurgião Torácico

Dr.ª Cármen Calçada

Radioterapeuta -Centro de Radioterapia do Porto

Dr.ª Ana Fernandes

Pneumologista – Centro Hospitalar Trás-os-Montes e Alto Douro

Dr.ª Ana Figueiredo

Pneumologista – Centro Hospitalar e Universitário de Coimbra

Dr.ª Rosete Nogueira

Anatomopatologista – Centro de Genética Clínica, Porto

Dr. Ulisses Brito

Pneumologista – Hospital Distrital de Faro

Dr.ª Marta Soares

Oncologista – Instituto Português de Oncologia, Porto

Direcção do GECP Dr. Fernando Barata Presidente Dr.ª Teresa Almodôvar Secretária Dr.ª Ana Barroso Tesoureira Prof. Dr. Venceslau Hespanhol Vogal Dr. Paulo Costa Vogal

Revista GECP 10(1) - Miolo.indd 1

27-03-2013 18:18:19


Revista GECP 10(1) - Miolo.indd 2

27-03-2013 18:19:42


Índice Revista do Grupo de Estudos do Cancro do Pulmão Volume 10. Número 1, 2013 Página da Direcção ..................................................................

5

Editorial.....................................................................................

7

Terapêutica personalizada do cancro do pulmão ..................... António Araújo, Ramon de Mello, Ana Coelho

9

Rastreio do cancro do pulmão – “Sim ou não eis a questão!” ... 13 Venceslau Hespanhol Timomas e carcinomas tímicos ................................................ 19 Bárbara Parente Radioterapia Estereotáxica Corporal (SBRT) no tratamento do CPNPC em estadio inicial ................................................... 21 Paulo Costa Discussão dos Posters Seleccionados no 5.º Congresso PO02 – Bronchial-pulmonary adenocarcinomas subtyping is elegible by PET activity and immunohistochemistry: for biopsy diagnosis application ......................................... 28 Teresa Almodôvar PO07 – Papel da translocação EML4-ALK na abordagem terapêutica do CPNPC ...................................................... 31 Venceslau Hespanhol PO14 – Quimiorradioterapia concomitante no carcinoma do pulmão não pequenas células: Tolerância e sobrevivência .................................................................. 33 Paulo Costa Po16 – Timoma – 13 anos de experiência de um Serviço de Pneumologia ................................................................. 35 Ana Barroso Actividades do GECP ............................................................... 36

Propriedade: Grupo de Estudos do Cancro do Pulmão Sede: Avenida Dr. Antunes Guimarães, n.º 554 – 4100-074 Porto Telefone: 351 226 165 450 – gecp@skyros-congressos.com – www.gecp.pt Design, Pré-impressão e impressão: Publicações Ciência e Vida, Lda. – Praça de Alvalade, N.º 9 - 4.º Sala 4.7 Telefone: 214 787 850 Fax: 214 020 750 E-mail: pub@cienciaevida.pt Assinatura anual: 20 € Número avulso: 10 € Distribuição gratuita aos Sócios do Grupo de Estudos do Cancro do Pulmão, Sociedades Científicas afins, Entidades Oficiais e Privadas de âmbito médico Tiragem: 500 exemplares impressos em Acid Free Paper Periodicidade: semestral ISSN 1645-9466 Depósito legal: 208 344/04

Revista GECP 10(1) - Miolo.indd 3

27-03-2013 18:19:42


Revista GECP 10(1) - Miolo.indd 4

27-03-2013 18:19:42


Página da Direcção Passou meio ano desde a eleição da nova Direcção do GECP. Progressivamente e no meio da azáfama da vida de cada um dos 5 elementos, foi criado um plano de acção para o triénio que nos foi destinado. Há múltiplos projectos e vontade de os implementar. Precisamos contudo da colaboração e do ânimo de cada membro do GECP para que se possam tornar realidade. O objectivo de desenvolver a investigação científica, a nível nacional e internacional será sempre a razão do Grupo existir e obviamente a sua área de maior enfoque. Somos um país pequeno, com poucos centros, reunimo-nos várias vezes no ano, o que nos permite ter já uma linguagem comum. Temos deste modo reunidas as condições ideais para, com um esforço conjunto, investigarmos, percebermos a nossa realidade, contribuindo para o avanço da Pneumologia Oncológica em Portugal. É fundamental que a Pneumologia seja dinâmica e interactiva; temos que acompanhar os avanços da era da terapêutica molecular e da imunoterapia e contribuir para o fim comum de tornar o cancro do pulmão (CP) uma doença crónica, privilegiando sempre a qualidade de vida dos nossos doentes. Desafiamos a colaboração dos mais novos. Tratar CP é cada vez mais um desafio e o resolver de um puzzle que deverá estimular a energia própria dos mais jovens. Do mesmo modo, desafiamos os mais experientes a passarem a sua sabedoria adquirida ao longo dos anos e a ajudarem a gerir a actividade clínica de quem dá os primeiros passos. Do desabrochar das flores até que as folhas fiquem douradas e comecem a cair, temos muitos projectos para desenvolver como Grupo de Estudos do Cancro do Pulmão. Abril de 2013 Ana Barroso Direcção do GECP

5

Revista GECP 10(1) - Miolo.indd 5

27-03-2013 18:19:42


Revista GECP 10(1) - Miolo.indd 6

27-03-2013 18:19:42


Editorial

Com este número da Revista GECP, iniciamos o 10.º ano da sua publicação. A parceria que mantemos, desde a primeira hora, com as Publicações Ciência e Vida Lda., empresa responsável pela impressão e distribuição da Revista, permite que esta tenha, desde há cerca de um ano, maior visibilidade uma vez que é possível aceder facilmente ao seu conteúdo em gecp.pt. Tal como foi aprovado na Assembleia Geral de 24 de Março de 2012, este número da Revista é dedicado ao 5.º Congresso Português do Cancro do Pulmão e nele são publicados textos gentilmente disponibilizados por alguns dos prelectores a quem é devido um agradecimento pelo seu esforço, em primeiro lugar, do Director da Revista secundado pelo dos nossos leitores. Foi-lhes exigido um esforço adicional, a somar às suas actividades habituais, que poderá ser minimizado num próximo Congresso se, em simultâneo com o convite para a participação nas sessões, for pedido um texto, com características a definir, para entrega aquando da respectiva apresentação. O 5.º Congresso, que decorreu em Albufeira de 11 a 13 de Outubro de 2012, foi uma demonstração da capacidade do nosso Grupo que, com a eficiente e imprescindível colaboração da Skyros Congressos, promoveu uma reunião de elevada qualidade científica e de organização, como pudemos testemunhar. No nosso sítio, gecp.pt, estão disponíveis informações que nos ajudam a compreender esse êxito. Destaco as palavras da Dr.ª Bárbara Parente: “O balanço é extremamente positivo e até ultrapassou as nossas expectativas. Conseguimos debater desde o carcinoma do pulmão em estadios precoces até às terapêuticas paliativas e, inclusivamente, tivemos a oportunidade de ver aqui debatidos temas mais raros e que habitualmente não são debatidos em congressos científicos, nomeadamente, os timomas e os tumores carcinóides”, recorda a médica, argumentando: “Isto foi uma mais-valia, atendendo a que, em Portugal, habitualmente não há congressos monotemáticos nesta área e conseguimos aqui fazer uma abordagem muito grande, com uma audiência muito interessada e muito participativa”. Um dos pontos altos do Congresso, foi a justa e merecida homenagem ao Dr. João Moura e Sá que foi distinguido com a medalha de

Médico João Moura e Sá distinguido no V Congresso do Cancro do Pulmão.

7

Revista GECP 10(1) - Miolo.indd 7

27-03-2013 18:19:42


Editoral

honra do GECP. Associo-me, de alma e coração, a esta homenagem a um amigo e partilho o seu lema que é também um dos valores do GECP: “O trabalho nunca é individual, mas sempre de um grupo de pessoas, pois só assim as coisas funcionam melhor”. Na Assembleia Geral Extraordinária realizada em 12 de Outubro de 2012, de que damos conta na Revista, foram eleitos os novos Corpos Sociais do GECP com alterações substanciais na composição quer do Conselho Científico quer da Direcção Executiva cujo rejuvenescimento configura um movimento de renovação que permitirá a continuidade do GECP. Além de agradecer a prova de confiança que me foi dada no convite para continuar como Director da Revista, quero publicamente felicitar os membros dos actuais Órgãos Sociais e desejar-lhes as maiores felicidades pessoais, profissionais e no desempenho das funções para que foram eleitos no GECP. Abril de 2013 Agostinho Costa Director da Revista GECP

8

Revista GECP 10(1) - Miolo.indd 8

27-03-2013 18:19:43


Terapêutica personalizada do cancro do pulmão António Araújo1,2,3, Ramon de Mello2, Ana Coelho3 Serviço de Oncologia Médica, Centro Hospitalar de Entre Douro e Vouga, Santa Maria da Feira. Serviço de Oncologia Médica, Instituto Português de Oncologia – Centro do Porto, Porto. 3 Grupo de Oncologia Molecular, Instituto Português de Oncologia – Centro do Porto, Porto. 1

2

1. INTRODUÇÃO Desde o início deste século XXI, que temos vindo a desvendar de forma acelerada a etiopatogenia do cancro do pulmão e com isso a entender melhor a complexidade desta doença e as inúmeras possibilidades de tratamento que esta complexidade propícia. Compreendemos que é necessário conhecer aprofundadamente as características de cada tumor, nomeadamente a nível dos genes potencialmente responsáveis pela carcinogénese e das respectivas vias de sinalização. Mas percebemos, também, a importância do seu meio envolvente, particularmente dos mecanismos de angiogénese e de disseminação, a importância da estrutura da matriz celular onde o cancro se desenvolve, das possíveis interacções com a imunidade do hospedeiro e, por fim mas não de menor relevância, do conhecimento que devemos ter acerca do doente (hospedeiro do seu cancro), especialmente no que concerne às suas co-morbilidades e ao seu genótipo.1

Revista GECP 2013; 1: 9-12

Revista GECP 10(1) - Miolo.indd 9

Assim e com fortes implicações no tratamento dos doentes, da tradicional classificação do cancro do pulmão entre carcinoma de pequenas células e de não pequenas células, englobando este essencialmente os subtipos histológicos de adenocarcinoma, de carcinoma escamoso, de carcinoma de grandes células e os mistos, evoluiu-se para uma perspectiva genómica, em que se desvendou, em cerca de 55 % dos casos, o gene responsável pelo desenvolvimento tumoral. Tornou-se fundamental diagnosticar as alterações em genes como o KRAS, EGFR, EML-4-ALK, HER-2, BRAF, MET, AKT1, MAP-2K1, PI3KCA, para a escolha dos melhores fármacos para cada tumor.2 Este conhecimento permitiu aumentar significativamente a sobrevivência dos nossos doentes, incluindo os mais idosos e os que se apresentam com pior estado geral. Observamos como os doentes com carcinoma do pulmão de não pequenas células (CPNPC) avançado ou metastático passavam dos cerca de 4 meses de sobrevivência global nos anos 70, para os 6 a 8 meses

9

27-03-2013 18:19:43


António Araújo, Ramon de Mello, Ana Coelho

com a utilização da platina em monoterapia nos anos 80,3 para os 8-10 meses quando se utiliza um dupleto baseado na platina 4, 5 e como se atingem os 12 meses com uma quimioterapia baseada na histologia ou com um protocolo de quimioterapia tripla baseada na platina e num anticorpo monoclonal6-9, para se ultrapassarem os 24 meses com a utilização de terapias dirigidas a alvos moleculares do tumor.10-12 Sublinha-se que este aumento da sobrevivência global, com o correspondente aumento do tempo de sobrevivência livre de progressão, se verificou com a melhor caracterização dos tumores, em termos histológicos e moleculares. Para cada característica das células cancerosas, como a sinalização de proliferação sustentada, a activação de invasão e metastização, a inibição da apoptose ou a indução da angiogénese, têm-se descoberto alvos celulares capazes de serem inibidos por medicamentos dirigidos especificamente a esses alvos.13 Para tal, é fundamental obter-se tecido para os necessários estudos patológicos e genéticos, sendo este aspecto tão crítico que inclusivamente nos grandes estudos de fase 3 observa-se que apenas cerca de 25 % dos doentes têm amostras de tecido.

2. A TERAPÊUTICA PERSONALIZADA ACTUAL DO CPNPC AVANÇADO A terapêutica do CPNPC avançado passou conceptualmente do “one size fits all”, dos anos 70 a 80, para um tratamento à medida de cada doente e de cada tumor. A histologia do tumor, os biomarcadores predictivos que o tumor apresenta e a possibilidade de uma terapia de manutenção, são factores a considerar que estão interligados e que não são independentes, condicionando a terapêutica a propor.14

10

Revista GECP 10(1) - Miolo.indd 10

Em Portugal, perante um doente com CPNPC em estadio avançado e com bom estado geral, é fundamental conhecermos se é portador de uma mutação predictiva de resposta do gene EGFR. Se assim acontecer, o doente deverá realizar, em 1.ª linha de tratamento, um inibidor da tirosina cínase do EGFR – erlotinib ou gefitinib.10-12 Por outro lado, se esse tumor apresentar uma translocação ELM4-ALK, dever-se-á considerar o tratamento com crizotinib, após falência de uma linha de quimioterapia.16-17 Se a pesquisa de alterações destes dois genes for negativa e o tumor for de uma histologia não escamosa, o doente deverá ser tratado com um protocolo de quimioterapia contendo um dupleto baseado na platina, particularmente com o pemetrexedo, entre 4 a 6 ciclos.7 Se a pesquisa de alterações daqueles dois genes for negativa e o tumor for de uma histologia escamosa, o doente deverá ser tratado com um protocolo de quimioterapia contendo um dupleto baseado na platina e gemcitabina, paclitaxel ou docetaxel, entre 4 a 6 ciclos.4, 5 Tendo terminado 4 ciclos de quimioterapia e tendo-se obtido doença estável ou resposta parcial pelos critérios de RECIST (“Response Evaluation Criteria in Solid Tumours”), se o doente não teve efeitos adversos significativos e se assim o aceitar, poderá ser de considerar um tratamento de manutenção com pemetrexedo (nos de histologia não escamosa) ou com erlotinib (nos de histologia escamosa e não escamosa).18-20 O tratamento de 2.ª linha, após falência de um dos esquemas acima enunciados, vai depender do estado geral do doente, do tempo que decorreu desde o fim do tratamento até à progressão, do tratamento realizado e dos seus efeitos adversos e da vontade do doente. De notar que, se a situação o exigir, como no caso de tumores de crescimento rápido ou por o

Revista GECP 2013; 1: 9-12

27-03-2013 18:19:43


Terapêutica personalizada do cancro do pulmão

doente estar muito ansioso em iniciar tratamento, poderá ser considerado iniciar um protocolo de quimioterapia e guardar o tratamento com inibidor da tirosina cínase do EGFR para uma manutenção ou para a progressão,15 atendendo ao facto de na prática clínica diária existe alguma dificuldade em obter a pesquisa das alterações genéticas em tempo útil e/ou a obtenção da devida autorização para iniciar um inibidor da tirosina cínase do EGFR em 1.ª linha de tratamento.

3. O FUTURO DA TERAPÊUTICA PERSONALIZADA DO CANCRO DO PULMÃO E quanto ao futuro? O CPNPC de tipo escamoso tem sido uma patologia pouco estudada. Esperam-se avanços na identificação de alvos moleculares responsáveis pela carcinogénese neste tipo de tumor para poderem ser, posteriormente, desenvolvidas drogas a eles dirigidas. Alterações de genes como a amplificação do FGFR1, as mutações do PTEN, do AKT1, do DDR2 ou do PIK3CA parecem prometedoras, mas apenas abrangem cerca de 44 % dos casos deste tipo de tumor e é necessária mais investigação neste campo.21 No que concerne ao CPNPC de tipo não escamoso, as mutações genéticas encontradas compreendem apenas 54 % dos tumores estudados, pelo que muito há ainda para descobrir. Também se discute qual a melhor estratégia para os doentes que adquirem resistência aos inibidores da tirosina cínase do EGFR e do ALK. Estão a ser testados, em várias fases de evolução, uma miríade de medicamentos para o tratamento do CPNPC, tais como: inibidores reversíveis e irreversíveis do EGFR, do VEGF e do VEGFR, do ALK e do BRAF, do BCL-2 e do BCR-

Revista GECP 2013; 1: 9-12

Revista GECP 10(1) - Miolo.indd 11

-ABL; moduladores epigenéticos da expressão de genes; inibidores do proteossoma e do FGFR; antagonistas Hedgehog e terapia hormonal; pró-drogas activadas pela hipóxia; inibidores HIF-1 e imunomodeladores; antagonistas do IAP e inibidores do IGF-1R; integrinas, inibidores do mTOR, da via c-MET/HGFR, do MEK e da mitose; inibidores da via Notch e modificadores da função dos osteoclastos; inibidores do PI-3K/AKT, do PDGFR, PARP, SMAC e da telomerase; survivivinas; agonistas dos receptores TRAIL e agentes de disrupção vascular; vacinas, anticorpos por engenharia e terapêutica com vírus.22 Estamos plenamente convencidos que cada vez mais iremos integrar as características do doente, com as características do tumor e com as características do meio envolvente do tumor, para que realmente se possa personalizar ao máximo a terapêutica a efectuar aos nossos doentes, proporcionando-lhes o máximo benefício com o mínimo de efeitos adversos.

BIBLIOGRAFIA 1. Araújo A, Ribeiro R, Azevedo I, et al. Genetic polymorphisms of the epidermal growth factor and related receptor in non-small cell lung cancer – A review of the literature. The Oncologist 2007; 12: 201-10. 2. Pao W, Girard N. New driver mutations in non-small-cell lung cancer. Lancet Oncol 2011; 12: 175-80. 3. Non-small Cell Lung Cancer Collaborative Group. Chemotherapy in non-small-cell lung cancer: a meta-analysis using updated data on individual patients from 52 randomised clinical trials. BMJ 1995; 311: 899-909. 4. Schiller JH, Harrington D, Belani CP, et al. Comparison of four chemotherapy regimens for advanced non-small-cell lung cancer. N Engl J Med 2002; 346: 92-8. 5. Scagliotti GV, De Marinis F, Rinaldi M, et al. Phase III randomized trial comparing three platinum-based

11

27-03-2013 18:19:43


JR,

09;

83;

Ant贸nio Ara煤jo, Ramon de Mello, Ana Coelho

doublets in advanced non-small-cell lung cancer. J Clin Oncol 2002; 20: 4285-91. 6. Sandler A, Gray R, Perry MC, et al. Paclitaxel-carboplatin alone or with bevacizumab for non-small-cell lung cancer. N Engl J Med 2006; 355: 2542-50. 7. Scagliotti GV, Parikh P, von Pawel J, et al. Phase III study comparing cisplatin plus gemcitabine with cisplatin plus pemetrexed in chemotherapy-naive patients with advanced-stage non-small-cell lung cancer. J Clin Oncol 2008; 26: 3543-51. 8. Reck M, von Pawel J, Zatloukal P, et al. Overall survival with cisplatin-gemcitabine and bevacizumab or placebo as first-line therapy for nonsquamous non-small-cell lung cancer: results from a randomized phase III trial (AVAIL). Ann Oncol 2010; 21: 1804-9. 9. Pirker R, Pereira JR, Szczesna A, et al. Cetuximab plus chemotherapy in patients with advanced non-small-cell lung cancer (FLEX): na open-label randomised phase III trial. Lancet 2009; 373: 1525-31. 10. Mitsudomi T, Morita S, Yatabe Y, et al. Gefitinib versus cisplatin plus docetaxel in patients with non-small-cell lung cancer harbouring mutations of the epidermal growth factor receptor (WJTOG3405): an open label, randomised phase 3 trial. Lancet Oncol 2010; 11: 121-8. 11. Fukuoka M, Wu YL, Thongprasert S, et al. Biomarker analyses and final overall survival results from a phase III, randomised, open-label, first-line study of gefitinib versus carboplatin/paclitaxel in clinically selected patients with advanced non-small-cell lung cancer in Asia (IPASS). J Clin Oncol 2011; 29: 2866-74. 12. Rosell R, Carcereny E, Gervais R, et al. Erlotinib versus standard chemotherapy as first-line treatment for European patients with advanced EGFR mutation-positive non-small-cell lung cancer (EURTAC): a multicentre, open-label, randomized phase 3 trial. Lancet Oncol 2012; 13: 239-46. 13. Hanahan D, Weinberg RA. Hallmarks of cancer: The next generation. Cell 2011; 144: 646-74.

12

Revista GECP 10(1) - Miolo.indd 12

14. Gandara DR, Mack PC, Li T, et al. Evolving treatment algorithms for advanced non-small-cell lung cancer: 2009 looking toward 2012. Clin Lung Cancer 2009; 10: 392-4. 15. Moran T, Sequist LV. Timing of epidermal growth factor receptor tyrosine kinase inhibitor therapy in patients with lung cancer with EGFR mutations. J Clin Oncol 2012; 30: 3330-6. 16. Kwak EL, Bang YJ, Camidge DR, et al. Anaplastic lymphoma kinase inhibition in non-small-cell lung cancer. N Engl J Med 2010; 363: 1693-703. 17. Ou SH, Bartlett CH, Mino-Kenudson M, et al. Crizotinib for the treatment of ALK-rearranged non-small lung cancer: a success story to usher in the second decade of molecular targeted therapy in oncology. Oncologist 2012; 17: 1351-75. 18. Paz-Ares LG, Altug S, Vaury AT, et al. Treatment rationale and study design for a phase III, double-blind placebo-controlled study of maintenance pemetrexed plus best supportive care versus best supportive care immediately following induction treatment with pemetrexed plus cisplatin for advanced non-squamous non-small cell lung cancer. BMC Cancer 2010; 10: 85. 19. Ciuleanu T, Brodowicz T, Zielinski C, et al. Maintenance pemetrexed plus best supportive care versus placebo plus best supportive care for non-small-cell lung cancer: a randomised, double-blind, phase 3 study. Lancet 2009; 374: 1432-40. 20. Cappuzzo F, Ciuleanu T, Stelmakh L, et al. Erlotinib as maintenance treatment in advanced non-small-cell lung cancer: a multicentre, randomised, placebo-controlled phase 3 study. Lancet Oncol 2010; 11: 521-9. 21. Drilon A, Rekhtman N, Ladanyi M, et al. Squamous-cell carcinomas of the lung: emerging biology, controversies, and the promise of targeted therapy. Lancet Oncol 2012; 13: e418-26. 22. Somaiah N, Simon NG, Simon GR. A tabulated summary of targeted and biologic therapies for non-small-cell lung cancer. J Thorac Oncol 2012; 7(Suppl. 5): S342-68.

Revista GECP 2013; 1: 9-12

27-03-2013 18:19:43


Dor no doente oncológico

Rastreio do cancro do pulmão “Sim ou não eis a questão!” Venceslau Hespanhol

O cancro do pulmão é o tumor que maior mortalidade determina, em todo o mundo1. A taxa de sobrevivência aos cinco anos mantém-se inalterada há mais de duas décadas, não ultrapassando os 15 %2. Na esmagadora maioria dos casos a doença é diagnosticada em estadios avançados inviabilizado as hipóteses de cura2. A enorme evolução científica e tecnológica dos últimos vinte anos aliada à maior disponibilidade de meios e acessibilidade das populações aos serviços médicos diferenciados não se tem traduzido num aumento de cancros diagnosticados em estadio precoce. Esta situação é reconhecida em todo o mundo pelo que tem determinado uma procura permanente no sentido de a modificar, melhorando o prognóstico dos doentes. Simultaneamente com as campanhas de informação acerca dos malefícios do tabaco, principal fator de risco conhecido e estudos de profilaxia primária, até agora com pouco sucesso, sempre se acreditou que a identificação da do-

Revista GECP 2013; 1: 13-17

Revista GECP 10(1) - Miolo.indd 13

ença antes que ela se revelasse por qualquer sintoma ou sinal, poderia ser determinante no prognóstico global. Vários rastreios foram realizados nos últimos 40 anos envolvendo várias dezenas de milhar de indivíduos potencialmente em risco de cancro do pulmão3,4,5. A radiografia de tórax anual e nalguns casos, também, a citologia de expectoração, foram os exames de rastreio escolhidos. Infelizmente, após todo o esforço e recursos despendidos, os resultados não permitiram aconselhar estes exames como rastreio eficiente para o cancro do pulmão. Paradoxalmente, num dos estudos, constatou-se que o grupo rastreado teve mortalidade superior ao não rastreado5. Daqui resultou a decisão que, ao contrário do cancro da mama, cólon, próstata, o cancro do pulmão não tinha indicação para ser rastreado. Excluíam-se desta decisão programas de investigação utilizando novas estratégias, uma vez que, as metodologias conhecidas não tinham sido capazes de reduzir a mortalidade, único resultado aceitável para um rastreio.

13

27-03-2013 18:19:44


Venceslau Hespanhol

Apesar de toda esta descrença, a realidade do cancro do pulmão, constituiu um estímulo permanente à procura de soluções para este importante problema de saúde pública, para além de um forte e permanente impulso nas políticas de evicção dos hábitos tabágicos. Desde a 2.ª metade da década de noventa do século do século vinte a ideia de utilizar a TAC torácica, que como se sabia, detetava lesões mais pequenas, como exame de rastreio foi ganhando defensores. Porém, os elevados níveis de radiação da TAC torácica, em relação à radiografia de tórax e o preço, foram dificultando a implantação desta tecnologia no rastreio. Após melhorias tecnológicas consideráveis permitindo obter elevada resolução com doses de radiação muito inferiores às da TAC torácica convencional, foi possível desenhar várias investigações que culminaram num novo rastreio6. Este rastreio, o “National Lung Sreening Trial” (NLST), constituiu, tendo em conta os recursos mobilizados, a mais dispendiosa investigação jamais realizada nos EUA 6. Após todo um esforço metodológico, técnico e científico envolvendo alguns dos maiores Centros Médicos dos EUA foi desenhado um ensaio clínico, o NLST, cujo objetivo pretendia avaliar se a TAC de baixa dosagem poderia reduzir a mortalidade por cancro do pulmão em relação à radiografia do tórax. A discussão metodológica seguiu-se durante meses e deu origem a vários artigos7,8 que foram progressivamente e previamente publicados. Todos os pormenores tecnológicos dos equipamentos e os procedimentos imagiológicos foram rigorosamente estabelecidos. Este ensaio clínico, o NLST, tinha como objetivo principal comparar a mortalidade entre dois grupos de indivíduos com risco elevado de cancro do pulmão, um rastreado com TAC de baixa dosagem (TBD) e outro com radiografia de tórax (RT). Foram incluídos voluntários com 55 a 75 anos de idade fumadores ou ex-

14

Revista GECP 10(1) - Miolo.indd 14

-fumadores até 15 anos antes, com carga tabágica igual ou superior a 30 UMA (unidades maço-ano). Foi considerado que 20 % de redução da taxa de mortalidade por cancro do pulmão no grupo rastreado com TBD em relação ao grupo rastreado com RT, o resultado a atingir pelo rastreio. Foram pré-programadas análises intermédias de forma a avaliar, ao longo do seguimento, em que situação os resultados do ensaio se encontravam no que respeita ao objetivo proposto, impedindo prolongar o ensaio se existissem resultados demasiadamente negativos para os participantes ou manter uma investigação quando os resultados pretendidos fossem atingidos mais precocemente, impedindo a generalização da estratégia de rastreio e o consequente benefício a outras populações em risco. Estes indivíduos foram, de forma aleatória, distribuídos para cada um dos dois grupos a comparar, TBD e RT. O protocolo incluía TBD anual por três anos ou uma RT anual por três anos e um período de seguimento até um máximo de dez anos sendo que durante este período de seguimento não existia nenhuma avaliação imagiológica além dos cuidados de saúde usuais motivados por qualquer ocorrência que entretanto surgisse tal como se previamente o indivíduo não tivessem sido incluídos numa investigação. Ficavam, contudo, referenciados de forma a ser possível conhecer o que entretanto ia acontecendo e desta forma comparar o que, em relação à mortalidade por cancro do pulmão e complementarmente à mortalidade global, ia acontecendo aos dois grupos de indivíduos. Em Outubro de 2010 o ensaio foi parado precocemente, após 6 anos de investigação, como resultado de uma avaliação intermédia. Nessa avaliação foi verificado que o rastreio tinha atingido os seus objetivos e reduzido não só, em 20 %, a mortalidade por cancro do pul-

Revista GECP 2013; 1: 13-17

27-03-2013 18:19:44


Rastreio do cancro do pulmão “Sim ou não eis a questão!”

mão no grupo dos indivíduos rastreados com TBD em relação ao grupo dos rastreados com RT, mas também, a mortalidade global, ainda que em menor extensão. Baseados nestes resultados os investigadores concluíram que o rastreio do cancro do pulmão com TBD reduziu a mortalidade pelo cancro do pulmão. Foi, notavelmente, a primeira vez que em qualquer circunstância uma intervenção pôde de forma sistemática alterar o curso do cancro do pulmão e, utilizando um exame não invasivo, reduzir a mortalidade por esta doença tão letal e tão frequente em todo o mundo. Quando perante os resultados de uma investigação pretendemos utiliza-la para sustentar uma mudança de prática clínica há que avaliar: a validade do estudo e a generalização dos seus resultados para outros locais e outras pessoas, embora obedecendo aos critérios de inclusão da investigação. Quando falamos em validade interna da investigação referimo-nos à correção com que o NLST6 foi desenhado e implementado bem como à consistência entre métodos, resultados e conclusões. Ao avaliarmos nesta perspectiva o NLST trata-se de um ensaio onde os cuidados metodológicos foram tidos em conta de forma irrepreensível, porém houve áreas importantíssimas que não foram protocoladas tendo sido deixadas à livre orientação dos Centros participantes. Refiro-me ao protocolo de diagnóstico invasivo (aliás referido no ensaio) das lesões identificadas pelo rastreio imagiológico que pelas suas características foram consideradas passíveis deste tipo de avaliação. A estratégia invasiva foi determinada por cada Centro donde os critérios de realização de broncoscopia, biopsia aspirativa transtorácica e toracotomia podem não ter sido os mesmos em todos os Centros, com repercussão direta nos resultados e complicações.

Revista GECP 2013; 1: 13-17

Revista GECP 10(1) - Miolo.indd 15

As grandes dúvidas colocadas por esta investigação estão fundamentalmente associadas à validade externa ou, de uma forma mais simples, à aplicabilidade desta estratégia globalmente em todo o mundo de acordo com os critérios de seleção do NLST. As dificuldades de generalização do NLST6,7,8 resumem-se: aos problemas associados à estrutura da amostra, à baixa eficiência diagnóstica, aos custos elevados e, muito provavelmente, à incerteza de ser possível reunir todas as condições dos Centros do NLST em qualquer outro local onde pretenda fazer rastreio do cancro do pulmão. O ensaio incluiu voluntários com os critérios já referidos. Porém, como o recrutamento foi voluntário, difícil seria admitir que, os mais de 55 000 indivíduos incluídos no NLST representassem corretamente a estrutura populacional dos EUA. As diferenças não foram muito importantes, mas existiram. Os indivíduos selecionados para o NLST eram mais jovens, mais ex-fumadores e mais cultos. Isto pode ter influenciado os resultados na medida que as pessoas com estas características têm tendência a ter menos co-morbilidades e serem mais cumpridores donde pode resultar complicações menos graves e em menor número. Ao elaborarem o protocolo do NLST foi definido indivíduo com risco de cancro do pulmão. Contudo, um dos grupos onde o risco de cancro do pulmão é mais relevante, o grupo dos doentes que vivem com VIH, não foi incluído nesta investigação9,10. Nos últimos anos a implementação dos tratamentos de elevada eficiência para o VIH têm alterado o padrão de ocorrência de cancro nestes doentes. Um dos cancros cuja incidência mais tem aumentado é o cancro do pulmão10. Uma das grandes limitações do NLST está associada ao elevado número de falsos positivos,

15

27-03-2013 18:19:44


Venceslau Hespanhol

atingindo 96,4 % dos rastreios positivos por TBD e 94,5 % por RT. Esta situação, além de gerar ansiedade e medo, determina a realização de exames imagiológicos adicionais com consequente exposição a doses crescentes de radiação, mas também, a exames invasivos com morbilidade e mesmo mortalidade relevante, apesar desta ocorrência no NLST, não ter sido considerada importante. Os custos envolvidos na generalização de um rastreio semelhante ao NLST são elevadíssimos. A análise dos custos despendidos para obter um ano de perfeita saúde (QALY) atinge valores que variam entre 38 000 e mais de 100 000 euros de acordo com os pressupostos das avaliações. Este problema foi muito comentado na ASCO de 2012 uma vez que a previsão económica da implementação nos EUA determinaria triplicar os atuais custos com cancro do pulmão. Mesmo ultrapassadas todas estas limitações, é questionável se será possível reunir um tão grande número de meios técnicos e humanos em tantas e diversificadas áreas (imagiologia, pneumologia, anatomia patológica, cirurgia, psicologia,…) de forma a lidar com todas as questões que se poderão colocar num rastreio desta natureza. Finalmente, qual a minha posição perante tudo isto? Penso que devemos colocar-nos numa situação de avaliação prudente, cientes que o que foi conseguido, 20 % de redução da mortalidade do cancro do pulmão, foi enorme. A velocidade com que evoluem os meios tecnológicos e científicos, atualmente, poderá pelo menos parcialmente, permitir ultrapassar algumas das atuais dúvidas e ajudar a implementar o rastreio. Além das limitações comentadas, muitas questões são possíveis e uma das mais pertinentes refere-se à duração do rastreio anual, por quanto tempo? O rastreio permitiu reduzir em 20 %

16

Revista GECP 10(1) - Miolo.indd 16

a mortalidade unicamente com 3 anos consecutivos de avaliação com TBD, qual será o benefício e os riscos de estender esta avaliação por 5, 10 ou 15 anos? Será possível que após três anos de TAC anual o benefício se possa manter, mesmo espaçando as avaliações? Uma das sociedades que mais se dedica ao cancro11 já tomou a sua opção e propõe uma avaliação anual dos 55 aos 75 anos para todos os indivíduos em risco de cancro do pulmão de acordo com os critérios do NLST. Embora não existam certezas, durante os próximos tempos, irão por certo surgir novas observações e investigações que poderão contribuir para uma decisão mais ajustada sobre esta estratégia. Em Portugal e na maior parte dos países não existe uma estratégia ainda definida. Aguardemos… e enquanto aguardamos sempre é bom lembrar que o que há a fazer na prevenção e na detecção precoce do cancro do pulmão, por certo, poderá ser da maior importância na redução da morbilidade e mortalidade desta doença, não esquecendo os custos… REFERÊNCIAS 1. Ferlay J, Shin HR, Bray F, Forman D, Mathers C and Parkin DM. GLOBOCAN 2008 v1.2, Cancer Incidence and Mortality Worldwide: IARC CancerBase No. 10 [Internet].Lyon, France: International Agency for Research on Cancer; 2010. Available from: http:// globocan.iarc.fr, accessed on 12/11/2012. 2. Nils Wilking, Karolinska Institutet Daniel Högberg. i3 Innovus Bengt Jönsson, Karolinska Institutet/i3 Innovus Benchmarking report of lung cancer care in selected European Countries. Stockholm School of Economics 14 May, 2008. 3. Melamed MR, Flehinger BJ, Zaman MB, et al. Screening for early lung cancer. Results of the Memorial Sloan-Kettering study in New York. Chest 1984; 86: 44-53.

Revista GECP 2013; 1: 13-17

27-03-2013 18:19:44


Rastreio do cancro do pulmão “Sim ou não eis a questão!”

4. Markus PM, Bergstralh EJ, Fagerstrom RM, et al. Lung cancer mortality in the Mayo Lung Project: Impact of extended follow-up. J Natl Cancer Inst 2000; 92: 1308-16. 5. Kubik A, Parkin DM, Khlat M, et al. Lack of benefit from semi-annual screening for cancer of the lung: Follow-up report of a randomized controlled trial on a population of high-risk males in Czechoslovakia. Int J Cancer 1990; 45: 26-33. 6. The National Lung Screening Trial Research Team. Reduced lung cancer mortality low-dose computed tomographic screening. N Engl J Med 2011; 365: 395-409. 7. Church TR, National Lung Screening Trial Executive Committee. Chest radiography as the compa-

Revista GECP 2013; 1: 13-17

Revista GECP 10(1) - Miolo.indd 17

rison for spiral CT in the National lung Screening Trial. Acad radiol 2003; 10: 713-5. 8. Gierda DS, Pilgrim TK, Ford M, et al. Lung cancer inter-observer agreement on interpretation of pulmonary findings at low-dose CR screening. Radiology 2008; 246: 265-72. 9. Shields MS, Pfeiffer RM, Engels A. Age at Cancer Diagnosis among persons With Aids in the United States. Ann Intern Med 2010; 153: 452-60. 10. Keith Sigel, Wisnivesky J, Gordan K. HIV as an independent risk factor for incident lung cancer. AIDS 2012; 26: 1017-25. 11. NCCN Clinical Practice Guidelines in Oncology (NCCN Guidelines®) Non-Small Cell Lung Cancer, 2013.

17

27-03-2013 18:19:44


Revista GECP 10(1) - Miolo.indd 18

27-03-2013 18:19:44


Dor no doente oncológico

Timomas e carcinomas tímicos Bárbara Parente

Os timomas e os carcinomas tímicos são tumores pouco frequentes e juntos representam entre 0,2 a 1,5 % de todo as neoplasias malignas. Segundo os dados do National Cancer Institute Surveillance, Epidemiology and End Results (SEER) a incidência geral do timoma é de 0,15 casos por 100 000, sendo os carcinomas tímicos pouco frequentes e constituindo 0,06 % de todas as neoplasias tímicas. Geralmente os timomas apresentam escassa malignidade e têm mais tendência à recidiva local. Os carcinomas tímicos são tipicamente invasores com alto risco de recidiva e morte. A maior parte dos doentes, na altura da apresentação, tem entre 40 a 60 anos. Desconhece-se a etiologia destes tumores. Cerca de 50 % dos timomas e carcinomas tímicos são detectados numa radiografia de tórax de rotina; 95 % encontram-se no mediastino anterior, sendo os tumores mais frequentes desta região do tórax. Os doentes sintomáticos apresentam-se fundamentalmente com tosse, dor torácica e dispneia. Entre as síndromes paraneoplásicas autoimunes que se relacionam com o timoma, destaca-se pela sua frequência a miastenia gravis, que parece condicionar melhor prognóstico. Também são habi-

Revista GECP 2013; 1: 19-20

Revista GECP 10(1) - Miolo.indd 19

tuais polimiosites, tiroidites e síndrome de Sjögren, entre outros. A aplasia pura da série vermelha e a hipogamaglobulinemia afetam aproximadamente 5 a 10 % dos doentes com timomas. Em contraste com o timoma, a relação entre o carcinoma tímico e doenças autoimunes é pouco comum. Os doentes com timomas têm um risco aumentado de desenvolver tumores secundários, o que parece não ter relação com a timectomía, radioterapia ou presença de miastenia gravis. Devido a este risco aumentado de desenvolver tumores secundários e ao facto do timoma poder recidivar após um largo intervalo de tempo, recomenda-se vigilância para toda a vida. Ainda que se diga que o prognóstico de um timoma é mais favorável quando associado à miastenia gravis, estes dados ainda hoje são contraditórios; sabe-se que os doentes com a associação de miastenia grave são diagnosticados mais precocemente e com mais frequência são submetidos a ressecção cirúrgica. O tratamento de eleição para estes doentes continua a ser a cirurgia em bloco para tumores invasores quando possível. Muitas vezes a terapêutica é multidisciplinar de acordo com o estadio do tumor, nomeadamente radioterapia e quimioterapia

19

27-03-2013 18:19:44


Bárbara Parente

A classificação histológica mais usada é a da OMS (Tabela I). Tabela I. Classificação histológica da OMS Classificação

Tipo Celular

Tipo A

Medular; células fusiformes

Tipo AB

Misto

Tipo B1

Rico em linfócitos; linfocítico; predominantemente cortical, organóide

Tipo B2

Cortical

Tipo B3

Epitelial; atípico; escamóide; carcinoma típico bem diferenciado

(Tipo C)

(Carcinoma tímico)

Existem combinações dos tipos histológicos referidos e apesar da importância da classificação histológica do timoma, o estadio do tumor é o factor mais importante para a sobrevida global. O grau de invasão locorregional, a presença ou não de implantes, gânglios linfáticos atingidos ou metástases à distância são um factor prognóstico independente do tipo histológico. Para alem da classificação TNM, o estadiamento proposto por Masaoka em 1981 é uma das que mais se usa (Tabela II). Tabela II. Estadiamento de Masaoka Estadio

O carcinoma tímico tem maior propensão a invadir a cápsula e a metastizar do que o timoma; os doentes surgem aqui habitualmente com estadios mais avançados e com sobrevidas mais curtas aos 5 anos (30-50 %). Pela escassez de casos não se define tratamento óptimo e, tal como no timoma, a cirurgia é o tratamento de eleição, sendo a associação com as outras terapêuticas muito frequente pelo risco de recidiva.

20

Revista GECP 10(1) - Miolo.indd 20

Critério

Estadio I

Macroscopicamente e microscopicamente completamente encapsulado

Estadio II

A – invasão microscópica da cápsula B – invasão macroscópica da gordura adjacente mas não da pleura mediastínica ou do pericárdio (podendo ser aderente)

Estadio III

Invasão macroscópica dos órgãos vizinhos A – Sem invasão dos grandes vasos B – Com invasão dos grandes vasos

Estadio IV

A – Disseminação pleural ou pericárdica B – Metástases linfogénicas ou hematogénicas

Revista GECP 2013; 1: 19-20

27-03-2013 18:19:44


Radioterapia Estereotáxica Corporal (SBRT) no tratamento do CPNPC em estadio inicial Paulo Costa

Na atualidade, aproximadamente 15-20 % dos doentes com carcinoma do pulmão de não pequenas células (CPNPC) apresentam-se com doença em estadio localizado. A terapêutica de eleição para doença em estadio I CPNPC é a ressecção cirúrgica, podendo a mesma consistir em lobectomia ou pneumectomia, apresentando esta estratégia taxas de sobrevida global aos 5 anos que podem variar entre os 50-70 % 1. Uma proporção significativa deste grupo de doentes com CPNPC apresentam função cardiopulmonar comprometida colocando-os nesta perspetiva perante uma situação de risco acrescido quanto ao potencial de complicações pósoperatórias decorrentes da abordagem cirúrgica pulmonar2,3. Historicamente aos doentes sem condições para uma abordagem cirúrgica perante um estadio inicial de CPNPC era proposto tratamento de Radioterapia Externa (RTE) com técnicas convencionais como primeira opção de tratamento, sendo esta contudo inferior em resultados ao obtido com a opção cirúrgica.

Revista GECP 2012; 2: 37-43

Revista GECP 10(1) - Miolo.indd 21

Neste contexto, a dose média debitada ao tumor situava-se pelos 60-70 Gy, obtendo-se desta forma taxas de sobrevida global aos 2 e 5 anos de 39 % e 13 %. No que respeita á sobrevida livre de progressão para o mesmo intervalo temporal os valores atingidos situavam-se respetivamente entre os 48 e os 28 %. Cerca de 49 % de todos os doentes manifestavam recorrência local como parte do seu processo de recidiva, sendo reportado por inúmeros autores a progressão local como o fator mais comum de falência á terapêutica3,4. Os elevados índices de recorrência local com a abordagem clássica de tratamento estimularam a procura de novas soluções terapêuticas nomeadamente através do aumento de dose com fracionamento convencional de radioterapia. Alguns autores conseguiram aumentos das taxas de controlo da doença, embora modestas, e invariavelmente associadas a incrementos da toxicidade pulmonar no parênquima restante que desaconselharam a prossecução desta abordagem de tratamento5. Perante a ausência de outras alternativas válidas surgiu em vários centros a necessidade de

21

27-03-2013 18:19:44


Paulo Costa

desenvolvimento de uma nova técnica de Radioterapia, denominada Radioterapia Estereotáxica Corporal (SBRT), envolvendo a realização de um tratamento de grande precisão e realizado em poucas frações com elevadas doses por sessão de tratamento, em volumes relativamente pequenos e nos quais o movimento do tumor é monitorizado no decurso de todo o tratamento. Para este efeito são utilizadas inúmeras técnicas das quais o “gating” respiratório, o “tracking”, ou a manipulação voluntária do ciclo respiratório do doente representam as formas mais comuns de concretização prática desta modalidade de tratamento. Uma das características mais marcantes desta técnica de tratamento prende-se com os acentuados gradientes dosimétricos atingidos fora do volume de tratamento, situação através da qual é atingida a obtenção de baixos índices de toxicidade no parênquima tecidular são peritumoral6,7. Atualmente vários estudos utilizando a técnica de SBRT, nomeadamente estudos prospetivos randomizados, estabeleceram as bases de segurança e eficácia necessários á realização desta técnica de tratamento para o grupo de doentes com estadios iniciais de CPNPC que não reúnem condições para tratamento cirúrgico de intuito curativo. Estes estudos permitiram concluir das elevadas taxas de controlo local e incremento na sobrevida global, com baixas incidências de toxicidade relacionada com esta terapêutica, fundamentalmente num grupo de doentes já de si muito fragilizados pela sua condição de base. Contudo, na atualidade os estudos principais refletem a experiencia de instituições individuais refletindo alguma heterogeneidade nos esquemas terapêuticos utilizados e técnicas de tratamento escolhidas8,9.Os resultados publicados com 3 anos de seguimento atingem taxas de

22

Revista GECP 10(1) - Miolo.indd 22

controlo local na ordem dos 80 %10. Decorrem atualmente vários estudos randomizados destinados a encontrar não só a dose mais eficaz mas também o esquemas de fracionamento e as doses de tolerância mais adequadas nos órgãos de risco (OAR), no controle tumoral e na minimização dos efeitos tóxicos para os tecidos sãos envolventes, cruciais ao bom desempenho da solução terapêutica de SBRT. Os tratamentos de RTE convencionais envolvem a realização de pequenas doses de irradiação do volume alvo no decurso de várias semanas de tratamento, refletindo esta forma de abordagem os conceitos radiobiológicos de proteção dos tecidos sãos, dividindo a dose total planeada num numero de frações que permitisse a esses tecidos reparar os danos sub-letais produzidos pelas radiações ionizantes de uma forma mais efetiva do que aquela verificada nos tecidos tumorais. Em contraste, a SBRT implica a realização de elevadas doses por fração (doses estas ablativas), conceito este derivado da experiência radiocirúrgica intracraniana com esquemas terapêuticos semelhantes para tumores intracranianos. De um modo genérico a terapêutica ablativa é válida para volumes relativamente pequenos nos quais as limitações de dose dos tecidos sãos circundantes não constituem condição limitante. Assim, dadas as doses e frações utilizadas nesta modalidade terapêutica, bem como o tempo total de tratamento, desaconselham qualquer comparação direta entre esquemas de tratamento de Radioterapia. Desta forma temos de recorrer a modelos radiobiológicos que nos permitam de alguma maneira equiparar o equivalente terapêutico para esta modalidade de tratamento, quando em comparação com os esquemas clássicos de Radioterapia.

Revista GECP 2012; 2: 37-43

27-03-2013 18:19:45


Radioterapia Estereotáxica Corporal (SBRT)...

A validade de um modelo preditivo relativo aos efeitos desta modalidade de tratamento permanece motivo de debate atual considerando alguns autores que o modelo linear-quadrático não acautela de uma forma adequada os efeitos da SBRT, fundamentalmente quando nesta modalidade de tratamento se utilizam frações de tratamento superiores a 8 Gy por sessão. Nestes casos os mesmos autores advogam a utilização de outros modelos que de alguma forma geram valores preditivos mais fidedignos quando pretendemos compara doses entre tratamentos convencionais e de Radioterapia estereotáxica corporal11. Contudo, a maioria dos autores são consensuais em afirmar que para os doentes portadores de CPNPC se encontra uma relação direta entre a eficácia terapêutica da SBRT e a dose equivalente biológica em esquema convencional quando se ultrapassa o limiar dosimétrico de 100 Gy, sendo por este motivo atualmente o valor considerado de “cut-off” para o qual todos os esquemas de tratamento de SBRT apontam tendo em vista a maximização do ratio terapêutico12. A recente introdução em Portugal destas técnicas de tratamento na rotina diária de alguns departamentos de Radioterapia, em muito se deve ao enorme esforço que foi efetuado na atualização tecnológica dos mesmos, dotando-os de uma nova geração de unidades de tratamento, com sofisticações destinadas a permitirem toda uma gama de soluções inovadoras na área da imagem guiada (IGRT), o que por si só veio permitir entre outras a possibilidade de verificação tridimensional dos planos de tratamento em tempo real, que de outra forma não tornaria possível de forma adequada a execução destas modalidades terapêuticas. Também no domínio do cálculo dosimétrico muito se evoluiu, acrescentando poderosos algoritmos de cálculo aos sistemas de planeamento já existentes, tornando-os mais fidedignos na forma de calcular

Revista GECP 2012; 2: 37-43

Revista GECP 10(1) - Miolo.indd 23

as distribuições de dose assim obtidas, condição esta imprescindível a um adequado planeamento no tratamento de SBRT. Tal situação adquire particular importância nas situações de tratamento de lesões intratorácicas, dada a elevada heterogeneidade nas densidades que os feixes de radiação têm de atravessar, e que até há poucos anos atrás geravam incertezas na distribuição das curvas de dose, fruto dos meios utilizados no método de cálculo dosimétrico. Embora a Radioterapia Estereotáxica Corporal se apresente na atualidade como uma solução válida de tratamento no contexto dos estádios iniciais de CPNPC não cirúrgicos, torna-se imperativo validar esta modalidade terapêutica em oposição a outras soluções de tratamento que poderão de alguma forma emergir como alternativas ao tratamento de SBRT, podendo acrescentar opções válidas às limitações impostas quer pela cirurgia ou também pela radioterapia estereotáxica corporal. A solução mais apontada neste enquadramento é a radiofrequência ablativa (RFA), que segundo alguns autores poderá apresentar algumas áreas em que concorre como opção terapêutica alternativa á SBRT, sendo contudo e na atualidade uma modalidade de tratamento que apresenta maior taxa de complicações decorrentes do processo de tratamento e das quais se salienta o pneumotórax como a mais comum neste contexto, situação esta inerente ao carácter invasivo do procedimento de tratamento. De igual forma, são colocadas também para esta modalidade terapêutica restrições á sua utilização diretamente relacionadas com o volume de tratamento e ainda com a localização anatómica das lesões, em particular quando na proximidade de estruturas vasculares. Acresce também a menor quantidade de ensaios clínicos realizados sobre esta modalidade

23

27-03-2013 18:19:45


Paulo Costa

de tratamento no contexto de CPNPC em estadio inicial, colocando maior número de interrogações sobre a eficácia terapêutica da mesma, bem como no que respeita às toxicidades associadas ao tratamento a médio e longo prazo. Finalmente importa ainda validar o ratio eficácia/custo destas modalidades de tratamento, sendo muito demonstrativo para esse efeito o estudo recentemente publicado “Cost-effectiveness analysis of stereotactic body radiotherapy and radiofrequency ablation for medically inoperable, early-stage non-small cell lung cancer”13, comentado no NHS Economic Evaluation Database em 2012 e que claramente conclui da melhor relação custo/eficácia da SBRT quando comparadas as técnicas de RTE convencional -3DCRT, radiofrequência ablativa e a SBRT. Esta última destacava-se como a modalidade de tratamento mais custo efetiva para doentes portadores de CPNPC em estadio I inoperáveis, sendo considerada como a opção de eleição para o tratamento de CPNPC em estadios iniciais. Em conclusão, a SBRT quando utilizada no tratamento do CPNPC é uma modalidade de tratamento que apresenta elevadas taxas de controlo local, associada a diminuta toxicidade aguda ou tardia, pelo que a sua utilização deve ser ponderada como opção válida de tratamento num contexto de estadio inicial não cirúrgico de CPNPC.

BIBLIOGRAFIA 1. Jemal A, Siegel R, Ward E, et al. Cancer statistics 2008. CA Cancer J Clin 2008; 58: 71-96. 2. Zierhut D, Bettscheider C, Schubert K, et al. Radiation therapy of stage I and II non-small cell lung cancer (NSCLC). Lung Cancer 2001; 34(Suppl. 3): S39-43. 3. Qiao X, Tullgren O, Lax I, et al. The role of radiotherapy in treatment of stage I non-small cell lung cancer. Lung Cancer 2003; 41: 1-11.

24

Revista GECP 10(1) - Miolo.indd 24

4. Sibley GS, Jamieson TA, Marks LB, et al. Radiotherapy alone for medically inoperable stage I nonsmall-cell lung cancer: the Duke experience. Int J Radiat Oncol Biol Phys 1998; 40: 149-54. 5. Kong FM, Hayman JA, Griffith KA, et al. Final toxicity results of a radiation-dose escalation study in patients with non-small-cell lung cancer (NSCLC): predictors for radiation pneumonitis and fibrosis. Int J Radiat Oncol Biol Phys 2006; 65: 1075-86. 6. Song DY, Kavanagh BD, Benedict SH, et al. Stereotactic body radiation therapy. Rationale, techniques, applications, and optimization. Oncology 2004; 18: 1419-30. 7. Nagata Y, Negoro Y, Aoki T, et al. Clinical outcomes of 3D conformal hypofractionated single high-dose radiotherapy for one or two lung tumors using a stereotactic body frame. Int J Radiat Oncol Biol Phys 2002; 52: 1041-6. 8. Nagata Y, Takayama K, Matsuo Y, et al. Clinical outcomes of a phase I/II study of 48 Gy of stereotactic body radiotherapy in 4 fractions for primary lung cancer using a stereotactic body frame. Int J Radiat Oncol Biol Phys 2005; 63: 1427-31. 9. Timmerman R, McGarry R, Yiannoutsos C, et al. Excessive toxicity when treating central tumors in a phase II study of stereotactic body radiation therapy for medically inoperable early-stage lung cancer. J Clin Oncol 2006; 24: 4833-9. 10. Timmerman RD, Park C, Kavanagh BD. The North American experience with stereotactic body radiation therapy in non-small cell lung cancer. J Thorac Oncol 2007; 2(7, Suppl. 3): S101-12. 11. Park C, Papiez L, Zhang S, Story M, Timmerman RD. Universal survival curve and single fraction equivalent dose: useful tools in understanding potency of ablative radiotherapy. Int J Radiat Oncol Biol Phys 2008; 70: 847-52. 12. Onishi H, Shirato H, Nagata Y, et al. Hypofractionated stereotactic radiotherapy (HypoFXSRT) for stage I non-small cell lung cancer: Updated results of 257 patients in a Japanese multi-institutional study. J Thorac Oncol 2007; 2(7, Suppl. 3): S94-100. 13. Sher D, Wee J, Punglia R, et al. Cost-effectiveness analysis of stereotactic body radiotherapy and radiofrequency ablation for medically inoperable, early-stage non-small cell lung cancer. Int J Radiation Oncol Biol Phys 2011; 62: 3-11.

Revista GECP 2012; 2: 37-43

27-03-2013 18:19:45


Discussรฃo dos Posters Seleccionados no 5.ยบ Congresso

Revista GECP 10(1) - Miolo.indd 25

27-03-2013 18:19:45


Revista GECP 10(1) - Miolo.indd 26

27-03-2013 18:19:45


Poster PO02 %521&+,$/38/021$5<$'(12&$5&,120$668%7<3,1*,6 (/(*,%/(%<3(7$&7,9,7<$1',00812+,672&+(0,675<)25 %,236<',$*126,6$33/,&$7,21

/,1$&$59$/+2        -26e$/%(572'(&$6752(',$6  $1$),/,3$/$'(,5,1+$  9,7256286$        0$5,$5(,66,/9$      0-2­2'¶$*8,$5  7(5(6$)(55(,5$  $1$$/$5&­2     

  ,167,787(2)3$7+2/2*<)$&8/7<2)0(',&,1(2)7+(81,9(56,7<2)&2,0%5$&2,0%5$32578*$/   &,0$*2±5(6($5&+&(17(5)25(19,5210(17*(1(7,&6$1'21&2%,2/2*<)$&8/7<2)0(',&,1(81,9(56,7<2)&2,0%5$&2,0%5$32578*$/   &(175(2)38/0212/2*<)$&8/7<2)0(',&,1(2)7+(81,9(56,7<2)&2,0%5$32578*$/   6(59,&(2)3$7+2/2*<81,9(56,7<+263,7$/2)&2,0%5$&2,0%5$32578*$/

,QWURGXFWLRQ 7UHDWPHQWRULHQWDWLRQRIEURQFKLDOSXOPRQDU\FDUFLQRPDVLVLQIOXHQFHGE\FOLQLFDOVWDJLQJDQGPRUSKRORJLFDOFODVVLILFDWLRQLQELRSVLHVRIRIWKHFDVHVEHFDXVHWKH \HDUVXUYLYDOUHPDLQVSRRUEHWZHHQDQGIRUPHQDQGWRIRUZRPHQ

0DWHULDO 0HWKRGV $ VHULHV RI  VXUJLFDO VSHFLPHQV ZDV VXEPLWWHG WR LPPXQRKLVWRFKHPLVWU\ XVHG LQ URXWLQH $GHQRFDUFLQRPDV   (SLGHUPRLG &DUFLQRPDV   DQG WKH KHWHURJHQHRXV JURXS RI /DUJH &HOO 1HXURHQGRFULQH &DUFLQRPD   6PDOO &HOO /XQJ &DQFHU   /DUJH &HOO &DUFLQRPD   $GHQRVTXDPRXV &DUFLQRPD   DQG 3OHRPRUSKLF&DUFLQRPDV  SOXV0D[))OXRUGHVR[LJOXFRVH )'* VHDUFKHGDVWKHFOLQLFDOSDUDPHWHUEDVHGLQ3(7WRSUHYLHZGLDJQRVLVDQGSURJQRVLV

5HVXOWV &OHDU GLIIHUHQFH S   EHWZHHQ 77) SRVLWLYH DQG QHJDWLYH $GHQRFDUFLQRPDV ZKHUH WKH ))'* FDSWXUH ZDV ORZHU LQ 77) SRVLWLYH FDVHV LQGLFDWLQJ ORZHUPHWDEROLFDFWLYLW\ZDVWKHPRVWUHOHYDQWUHVXOWWRJHWKHUZLWK77)QHJDWLYH$GHQRFDUFLQRPDVVKRZLQJVLPLODUDQGKLJKHUPHWDEROLFDFWLYLW\DV(SLGHUPRLG &DUFLQRPDV7KHRWKHUKLVWRORJLFDOW\SHVKDG)'*FDSWXUHVLPLODUDQGLQEHWZHHQWKHWZRGHILQHGJURXSV

)LJXUH  ,PPXQRFKHPLVWU\ $  $'& H[SUHVVLQJ 77) ; %  64& QRW H[SUHVVLQJ &.  &  1( FDUFLQRPD FRPELQHG ZLWK $'&

H[SUHVVLQJ&5*5;

;$ 

;% 

; 

)LJXUH  689PD[ LQ $GHQRFDUFLQRPDV DQG

6TXDPRXV&HOO&DUFLQRPDV$GHQRFDUFLQRPDVKDV VLJQLILFDQWO\ ORZHU 689PD[ WKDQ WKH 6TXDPRXV &HOO&DUFLQRPD0DQQ:KLWQH\S 

D

E

)LJXUH  689PD[ LQ $GHQRFDUFLQRPDV 77) DQG $GHQRFDUFLQRPDV 77) $GHQRFDUFLQRPDV 77) KDV VLJQLILFDQWO\ ORZHU 689PD[ WKDQ WKH $GHQRFDUFLQRPDV77)0DQQ:KLWQH\S 

)LJXUH  689PD[ LQ $GHQRFDUFLQRPDV 77)  DQG 6TXDPRXV &HOO &DUFLQRPDV 7KHUH ZHUH QR GLIIHUHQFHV LQ EHWZHHQ 77) QHJDWLYH OXQJ $GHQRFDUFLQRPDV DQG 6TXDPRXV &HOO &DUFLQRPDV FRQFHUQLQJ689PD[0DQQ:KLWQH\S 

)LJXUH689PD[DOOIRXUJURXSV$'&77)$'& 77)64&&%3*&%3*SUHVHQWHGKLJKYDULDQFH DQGLWVYDOXHVDUHQRWVLJQLILFDQWO\GLIIHUHQWFRPSDUHG WR$'&77) S  $'&77) S  64& S 

&RQFOXVLRQ ,PPXQRKLVWRFKHPLVWU\ &.77)&.&'9LPHQWLQDQG.L DQG))'*DQDO\VLVFRUUHODWHGZLWKFOLQLFDOGLIIHUHQFHVEHWZHHQ$GHQRFDUFLQRPDV DQG (SLGHUPRLG &DUFLQRPDV ZKHUH 77) QHJDWLYH $GHQRFDUFLQRPDV DUH ELRORJLFDOO\ VLPLODU WR (SLGHUPRLG &DUFLQRPDV DOORZLQJ WKH FOLQLFDO UHFRJQLWLRQ DQG GLIIHUHQW PHGLFDO DSSURDFK DV ZHOO DV PROHFXODU SDWKRORJ\ SDUWLFXODU LQWHUSUHWDWLRQ 7KHVH UHVXOWV VWUDLQ WKH FODVVLILFDWLRQ RI EURQFKLDO 77) QHJDWLYH $GHQRFDUFLQRPDV EHFDXVH WKH\ DUH GLIIHUHQW IURP WKH WHUPLQDO UHVSLUDWRU\ XQLW 77) SRVLWLYH $GHQRFDUFLQRPDV $OVR 3(7 GLVFULPLQDWHG 77)QHJDWLYH DGHQRFDUFLQRPDVDQG(SLGHUPRLG&DUFLQRPDVDVDSDUWLFXODUJURXSLQGHSHQGHQWIURP77)SRVLWLYHDGHQRFDUFLQRPDVZKLOHWKHRWKHUKLVWRORJLFDOW\SHVRI EURQFKLDOSXOPRQDU\DGHQRFDUFLQRPDVFRPSOHWHWKHVSHFWUXPLQEHWZHHQDQGILOOWKHODUJHUQXPEHURIQRQUHVVHFWDEOHWXPRUV

Revista GECP 10(1) - Miolo.indd 27

27-03-2013 18:19:47


Discussão do Poster PO02

Bronchial-pulmonary adenocarcinomas subtyping is elegible by PET activity and immunohistochemistry: for biopsy diagnosis application Teresa Almodôvar

O trabalho apresentado petende correlacionar os achados na PET com as características histológicas e imunohistoquímicas do tumor. Para tal estudaram 41 doentes operados dos quais 18 Adenocarcinomas, 14 TTF1+ e 4 TTF1–, 12 Carcinomas Pavimento Celulares e 11 de outros tipos histológicos. Nestes doentes foi feita a comparação dos resultados da PET, nomeadamente o valor do SUV máximo (SUVmax) com os resultados histológicos e de imunohistoquímica. Encontram os seguintes resultados: SUVmax da PET é diferente nos Carcinomas pavimento celulares e nos Adenocarcinomas, e dentro destes é diferente conforme a marcação de TTF1. O Cancro do Pulmão mantem mortalidade de 84 % aos 5 anos, apesar de todos os avanços diagnósticos, de estadiamento e terapêuticos recentes. Neste momento é evidente que estamos a desperdiçar armas poderosas que, por vezes, têm mais custos que benefícios. Por custos entenda-se sobretudo custos humanos- doentes submetidos a actos diagnósticos e terapêuticos agressivos para uma sobrevivência global má. Necessitamos de factores de prognóstico e de factores preditivos de resposta à terapêutica para nos orientarem na terapêutica personalizada destes doentes e assim encontrar os tratamentos mais úteis para cada doente.

28

Revista GECP 10(1) - Miolo.indd 28

O presente estudo perfila-se nesta área de procura de exames pouco invasivos com valor prognóstico e preditivo. O valor do SUVmax da PET como prognóstico já foi abordado em vários estudos reunidos numa metanálise e revisão sistemática que, depois de avaliar 13 estudos publicados até 2007, conclui que a actividade metabólica do tumor primitivo refletida no valor de SUV medido com 18F-FDG-PET é um fator de prognóstico no CPNPC mas que são necessários estudos comparando o seu valor prognóstico com os indicadores de prognóstico já conhecidos, o PS e o estádio anatómico para avaliar qual o seu valor acrescentado1. Os mesmos autores replicaram o trabalho em 2010, desta vez analisando 21 estudos, mantendo as mesmas conclusões2. Um trabalho mais recente, em que é feito um estudo retrospetivo de 363 doentes em estádios cirúrgicos com um seguimento mediano de 2,7 anos, concluiu que o SUVmax da PET pré-operatória não é factor prognóstico de sobrevivência quando estratificado para o estádio patológico3. Já outros autores, desta vez avaliando retrospectivamente 62 doentes em estádio avançado sob quimioterapia, notaram que o adenocarcinoma apresentou valores de SUVmax menores que tumores de outras histologias. E aqui o SUVmax de PET antes do tratamento é um factor prognóstico

Revista GECP 2012; 2: 28-29

27-03-2013 18:19:54


Discussão do Poster PO02

de sobrevivência em análise multivariada, considerando os outros factores de prognóstico4. Parece ser uma área de debate que este estudo ajudou a esclarecer. O Adenocarcinoma é o tipo histológico mais frequente de cancro do pulmão e também o que apresenta maior heterogeneidade. Esta heterogeneidade tem importância no prognóstico, sendo que há subtipos histológicos de adenocarcinoma com diferentes valores medianos de SUVmax em PET5. O TTF1 é um marcador das células da unidade respiratória terminal e também de um subtipo de adenocarcinomas ‘‘TRU-type’’ – adenocarcinomas com morfologia específica e expressão de TTF16. Adenocarcinomas TRU-type são EGFR mutados mais frequentemente que adenocarcinomas não–“TRU-type”. No que diz respeito ao marcador TTF1, parece haver uma correlação entre a expressão de TTF1 e a sobrevivência do cancro do pulmão. Doentes com expressão TTF1 forte têm uma sobrevivência mediana superior aos que com expressão fraca (> 57.3 vs 39.4 ± 5.2 meses; p = 0.006 log-rank test). A expressão de TTF1 tem um papel crucial na sobrevivência deste tipo de adenocarcinomas pelo que se deve juntar este regulador do desenvolvimento do pulmão à lista dos genes envolvidos na regulação do cancro.7 BIBLIOGRAFIA 1. Thierry Berghmans M, Dusart M, Paesmans M, Hossein-Foucher C, Buvat I, Castaigne C, et al. Primary Tumor Standardized Uptake Value (SUVmax) Measured on Fluorodeoxyglucose Positron Emission Tomography (FDG-PET) is of Prognostic Value for Survival in Non-small Cell Lung Cancer (NSCLC) A Systematic Review and Meta-Analysis

Revista GECP 2012; 2: 28-29

Revista GECP 10(1) - Miolo.indd 29

(MA) by the European Lung Cancer Party. 2008; 3(1): 6-12. 2. Paesmans M, Berghmans T, Hossein-foucher C, Meert A, Scherpereel A, Munoz VT, et al. Primary Tumor Standardized Uptake Value Measured on Fluorodeoxyglucose Positron Emission Tomography Is of Prognostic Value for Survival in Non-small Cell Lung Cancer. J Thorac Oncol 2010; 5(5): 612-9. 3. Agarwal M, Brahmanday G, Bajaj SK, Ravikrishnan KP, Wong C-YO. Revisiting the prognostic value of preoperative (18)F-fluoro-2-deoxyglucose ((18) F-FDG) positron emission tomography (PET) in early-stage (I & II) non-small cell lung cancers (NSCLC). European journal of nuclear medicine and molecular imaging [Internet]. 2010 Apr [cited 2013 Mar 9];37(4):691-8. Available from: http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=28449 56&tool=pmcentrez&rendertype=abstract. 4. Imamura Y, Azuma K, Kurata S, Hattori S, Sasada T, Kinoshita T, et al. Prognostic value of SUVmax measurements obtained by FDG-PET in patients with non-small cell lung cancer receiving chemotherapy. Lung cancer (Amsterdam, Netherlands) [Internet]. Elsevier Ireland Ltd; 2011 Jan [cited 2013 Mar 9];71(1):49-54. Available from: http://www.ncbi. nlm.nih.gov/pubmed/20430470. 5. Chiu C, Lee Y, Tsai C. Histological Subtypes of Lung Adenocarcinoma Have Differential 18 F-Fluorodeoxyglucose Uptakes on the Positron Emission Tomography / Computed Tomography Scan. J Thorac Oncol 2011; 6(10): 1697-703. 6. Boggaram V. Thyroid transcription factor-1 (TTF-1/ Nkx2.1/TITF1) gene regulation in the lung. Clinical science (London, England : 1979) [Internet]. 2009 Jan [cited 2013 Mar 9];116(1):27-35. Available from: http://www.ncbi.nlm.nih.gov/pubmed/19037882. 7. Tanaka H, Yanagisawa K, Shinjo K, Taguchi A, Maeno K, Tomida S, et al. Lineage-specific dependency of lung adenocarcinomas on the lung development regulator TTF-8. Cancer research [Internet]. 2007 Jul 1 [cited 2013 Mar 9];67(13):6007-11. Available from: http://www.ncbi.nlm.nih.gov/pubmed/17616654.

29

27-03-2013 18:19:54


Poster PO07

PapeldatranslocaçãoEML4ͲALKnaabordagemterapêuticadoCPNPC AntunesA1;CampainhaS1;BarrosoA1;CondeS1;MachadoJC2,ParenteB1. 1Ͳ UnidadedePneumologiaOncológica,ServiçodePneumologia,CentroHospitalarVilaNovadeGaia/Espinho,EPE. 2– InstitutodePatologiaeImunologiadaUniversidadedoPorto

O estudo das características moleculares do CPNPC assume um papel cada vez maior na escolha da melhor terapêutica. A presença de mutações activadoras do EGFR constitui um determinante biológico crítico da melhor terapêutica, dada a associação entre as mutações do EGFR e a resposta aos TKI. Para além do uso dos TKI no tratamentode1ª linhanoCPNPCdoençaavançadaEGFRmutado,surgeagoraousodocrizotinib– inibidordascinasesdoslinfomasanaplásticos(ALK)– emtumorescoma translocaçãoEML4ͲALK.Atranslocaçãoé maisfrequenteempacientesnãoͲfumadores,comhistologianãoͲescamosa,sendomutuamenteexclusivacomoEGFRmutado.A translocaçãoestá tambémassociadaaumaidadeinferioreumestadiomaisavançadoaodiagnóstico,sendoométodoFISH,opreconizadoparaasuadetecção.Oestudo destascaracterísticas,comomelhorbenefícioparaodoente,só é possívelcomumametodologiaestruturadaquepermitaasuarealizaçãosistematizadaeemtempoútil.

Objectivos: Apresentar a metodologia usada entre Janeiro 2011 e Agosto 2012 no nosso serviço para efectuar o estudo molecular (sequenciação do EGFR) e citogenético (pesquisa da translocação ALK)dosCPNPC. Caracterização clínicodemográfica, citogenética e de biologia moleculardapopulaçãoestudada. Metodologia: Em todos os novos casos de CPNPC foi feita sequenciação dos exões 18Ͳ21 do EGFR. Após a sequenciação, os tumores não escamosos,  EGFR nativo, de doentes nãoͲfumadores ou exͲfumadores, foram sujeitos a análise FISH para pesquisa do rearranjo EML4ͲALK a partir de lâminas de citologia, histologia ou blocos de parafina. Análise estatística descritiva das características clinicodemográficas, citogenéticas e de biologia molecular da populaçãoestudada.

Características Sexoƃ/Ƃ Idade(média±DP)

Número(n)

Percentagem(%)

161/65

71/29

64.7±13.01

Sexo

Hábitostabágicos Fumador ExͲfumador NãoͲfumador Histologia

86 78 62

38 35 27

Adenocarcinoma Lepídico Epidermoide CPNPC Estadio

157 3 44 22

69 2 19 10

12/14 6/10 24 30/130

5.3/6.2 2.7/4.4 10.6 13.3/57.5

Idade

Histologia

Estadio

Tabagismo

Masculino

48

Adenocarcinoma

IIB

ExͲfumador

Feminino

65

Adenocarcinoma

IV

NãoͲfumadora

Masculino

51

Adenocarcinoma

IV

ExͲfumador

Feminino

45

Adenocatcinoma

IB

NãoͲfumadora

Discussão:  Este trabalho pretende demonstrar que é possível delinear uma estratégia IA/IB IIA/IIB IIIA IIIB/IV

sistematizada facultando a caracterização molecular atempada dos tumores visando uma corretaorientaçãoterapêutica.Sairealçadooproblemadaadequabilidadedasamostrasno estudo do EML4ͲALK, visto que em 7.5% dos casos a pesquisa não foi exequível. A taxa de translocaçãoencontradafoiconsentâneacomadaliteratura,sendoamédiadasidadesdos doentesmutadoinferiorà dapopulaçãoestudada.

Revista GECP 10(1) - Miolo.indd 30

27-03-2013 18:19:54


Discussão do Poster PO07

Papel da translocação EML4-ALK na abordagem terapêutica do CPNPC Venceslau Hespanhol

O conhecimento do funcionamento biológico celular em geral e da célula neoplásica em particular tem permitido identificar múltiplos mecanismos associados às características inerentes à célula neoplásica: proliferação não regulada, invasão de tecidos/órgãos, angiogénese, metastização e fuga à apoptose. De todos os mecanismos, os actualmente mais conhecidos, estão associados à activação/inibição do EGFR (“epidermal growth factor receptor”) e do EML4-ALK (“echinoderm microtubule-associated protein-like 4/anaplastic limphoma kinase”) mediada por tirosino-kinases (TKis) que tem como consequência a propagação do sinal celular para o núcleo promovendo a síntese de ADN e como consequência a proliferação celular, sucedendo o oposto no caso da inibição. A importância das mutações do EGFR e da translocação EML4-ALK advém da possibilidade da sua identificação molecular e citogenética, respectivamente, condicionar a estratégia terapêutica dos doentes com carcinoma pulmonar não pequenas células avançado. Adicionalmente, a existência de drogas capazes de bloquear os efeitos biológicos associados à existência de mutações activadoras do EGFR ou da translocação do ALK com repercussão significativa no tempo livre de progressão e na sobrevivência global dos doentes tem vindo a alterar a história natural desta doença. Neste contexto, o rastreio

Revista GECP 2012; 2: 31

Revista GECP 10(1) - Miolo.indd 31

das mutações do EGFR e da translocação do ALK são fundamentais para um correcto estabelecimento da estratégia terapêutica dos doentes com carcinoma pulmonar não pequenas células avançado. A implantação e a generalização deste rastreio biológico não têm sido fáceis. Por um lado, o acesso aos meios de detecção tem sido algo lento e difícil, por outro, a necessidade de disponibilizar amostras de tumor em quantidade e qualidade para estudo molecular e citogenético, após já ter sido realizada avaliação histológica/citológica e imunohistoquímica, nem sempre ocorre nas melhores condições. Por último, o tempo necessário para que todas estas respostas possam ser obtidas torna a espera muitas vezes difícil em face da gravidade dos doentes a quem se destinam. Ana Antunes e colaboradores da Unidade de Pneumologia Oncológica do Centro Hospitalar de Vila Nova de Gaia/Espinho, baseados na experiência do seu Centro ao longo de dezoito meses, apresentam uma proposta de metodologia de integração das determinações do EGFR e do ALK. Rastreando inicialmente para as mutações do EGFR e, sequencialmente, nos casos de EGFR nativo (ex-fumadores ou não fumadores), pesquisando a existência de translocação do ALK por FISH, foi possível obter bons resultados mesmo com amostras de tecido tumoral limitadas e em tempo útil para o tratamento dos doentes.

31

27-03-2013 18:20:37


Poster PO14

Quimiorradioterapia concomitante no carcinoma do pulmão de não pequenas células: tolerância e sobrevivência CLÁUDIA LARES DOS SANTOS1, LÍGIA FERNANDES1, INÊS SANCHES1, ANA FIGUEIREDO1, PAULA ALVES2, FERNANDO BARATA1 1Serviço

de Pneumologia (Dir. Dr. Fernando Barata); Centro Hospitalar e Universitário de Coimbra – Hospital Geral 2Serviço de Radioterapia (Dir. Dr.ª Paula Alves); Instituto Português de Oncologia FG - Coimbra

Resultados

Introdução Aproximadamente 1/4 dos doentes com carcinoma do pulmão de não pequenas células (CPNPC) apresenta doença irressecável em estádio IIIA ou IIIB podendo, nestes casos, a quimiorradioterapia (QTRT) ser utilizada com intuito curativo.

Objetivos Caracterizar os doentes submetidos a QTRT com intuito curativo por CPNPC. Determinar os efeitos adversos decorrentes do tratamento. Determinar a sobrevivência livre de progressão (SLP), a sobrevivência global mediana (SG) e a taxa de sobrevivência após 1 e 2 anos. Avaliar a diferença de eficácia de acordo com os regimes terapêuticos.

IDADE

PERFORMANCESTATUS

GÉNERO

(ZUBROD)

HÁBITOSTABÁGICOS

Média±DP:62,4±9,2anos

HISTOLOGIA Tipohistológico

N

ESTADIAMENTOTNM %

Adenocarcinoma

15

38,5

Escamoso

21

53,7

Grandes células Sarcomatóide

1 1

2,6 2,6

CPNPC

1

2,6

TOXICIDADE Toxicidadegrau3/4

N

%

Hematológica

11

28,2

Anemia

7

17,9

Neutropenia Trombocitopenia

7 2

17,9 5,1

Não hematológica

28

71,8

Alopécia

20

51,3

Esofagite

12

30,8

Pneumonite rádica

4

10,3

ESQUEMADETRATAMENTOERESPOSTA

Métodos O estudo foi realizado num Serviço de Pneumologia de um hospital central, com consulta específica de Pneumologia Oncológica. Entre os anos 2000 a 2011, os doentes com CPNPC estádio IIIA irressecável e IIIB sem derrame (de acordo com a 6ª edição do estadiamento TNM), com performance status 0 ou 1 e sem comorbilidades significativas ou perda de peso relevante, foram propostos para realização de QTRT concomitante, num total de 4 ciclos, os 2 iniciais de indução. Os candidatos a QTRT em que se verificou progressão da doença após os ciclos de indução foram excluídos e receberam terapêutica de acordo com o estado da arte. Registaram-se dados demográficos, epidemiológicos, performance status (Zubrod), histologia, esquema terapêutico utilizado, reacções adversas, datas de progressão e de morte. A análise estatística foi realizada com o programa SPSS Vs 17.0 para Windows.

Revista GECP 10(1) - Miolo.indd 32

TC:Avaliaçãopós Indução (N=29;74,4%) QTIndução: 2ciclos

Resposta

N

%

Resposta parcial

12

41,4

Estabilidade

17

58,6

TCindisponível(n=10; 25,6%)

TC:AvaliaçãoFinal Radioterapiastandard fraccionada60Gy/30Fr QTRT concomitante

Platinio+taxano:N=20(51,3%) Platinio+outrofármaco:N=19 (48,7%)

Resposta

N

%

Resposta Objetiva

28

71,7

Estabilidade

7

18,0

Progressão

4

10,3

SOBREVIVÊNCIA Sobrevivênciaaoano

78%

Sobrevivênciaaos2 anos Sobrevivênciaglobal

36%

Sobrevivêncialivrede progressão

22meses 12meses Sobrevivência global (meses)

Sobrevivência livre de progressão (meses)

A SG e a SLP não foram influenciadas pelo esquema terapêutico usado

Conclusões No estádio III não cirúrgico a QTRT é a melhor opção, com valores de eficácia sobreponíveis à literatura. O esquema de QT escolhido não afectou a SLP ou a SG. A realização de QTRT concomitante com intuito curativo associa-se a efeitos adversos hematológicos e não hematológicos não desprezíveis.

27-03-2013 18:21:09


Discussão do Poster PO14

Quimiorradioterapia concomitante no carcinoma do pulmão não pequenas células: Tolerância e sobrevivência Paulo Costa

A maioria dos doentes com carcinoma do pulmão de não pequenas células tem a sua apresentação inicial sob a forma de doença localmente avançada ou irressecável, sendo neste contexto a quimiorradioterapia (QTRT) uma das modalidades de primeira escolha na abordagem terapêutica desta entidade patológica. Os autores efetuam no presente trabalho uma análise sistemática dos parâmetros envolvidos na abordagem conjunta de QTRT, dando ênfase às particularidades inerentes ao desenvolvimento da estratégia terapêutica conjunta, e à experiência dos dois centros quanto à adequada conjugação destas modalidades de tratamento.

Revista GECP 2012; 2: 33

Revista GECP 10(1) - Miolo.indd 33

Os resultados apresentados, refletem a prática de colaboração entre dois centros dedicados ao tratamento desta patologia no período compreendido entre 2000 e 2011, permitindo concluir da validade e adequação das opções terapêuticas efetuadas, identificando ao mesmo tempo os principais fatores que influenciam o sucesso terapêutico perante a heterogeneidade inerente à apresentação desta doença, nomeadamente no que respeita à toxicidade encontrada no decurso da associação destas modalidades de tratamento e às opções efetuadas quanto aos esquemas de quimioterapia utilizados.

33

27-03-2013 18:22:53


Poster PO16

Timoma 13 Anos de Experiência de um Serviço de Pneumologia R Reis (ricardomcreis@gmail.com); A Fernandes Serviço de Pneumologia do Centro Hospitalar de Trás-os-Montes e Alto Douro (CHTMAD)

Introdução

Objetivo

Métodos

• O timoma é uma neoplasia rara sendo as suas características e melhor abordagem diagnóstica e terapêutica alvo de discussão e definição

• Apresentar a experiência do Serviço de Pneumologia do CHTMAD no diagnóstico, tratamento e seguimento de doentes com timoma

• Revisão e análise dos casos de timoma ocorridos de 01/1999 a 06/2012 no CHTMAD • Revisão e discussão com o conhecimento científico atual

Resultados Figura 5 – Classificação Histológica

• 10 casos registados ao longo de 13,5 anos • 70% em homens • Idade média de 67 anos (alcance: 45-77 anos)

50% 40% 30%

Figura 1 – Distribuição Etária

Figura 2 – Distribuição Bianual de Casos

80%

4 60%

60%

20%

10% 3

3

40%

1

10% 10%

0%

0

3

1

A

B1

A/AB

B

C

C

Figura 6 – Estadiamento

1 0

B2

0%

2

2 20%

AB

20%

60% 0 40%

Figura 3 – Apresentação Clínica 0%

80% 60% SVCS Toracalgia Tosse

40% 20%

Sintomas locais

Astenia

Miastenia Gravis

C

A

AB

A

I

II

III

IV

B1

50% 40%

10%

IV

II

20%

Figura 4 – Abordagem Diagnóstica

IV I

II

III

R0

R1

R2

0%

100% 80%

Figura 8 – Análise de Sobrevida

60% 40% 20% 0%

AB B2

Figura 7 – Cirurgia e Qualidade de Resseção (8 doentes)

30%

0%

C

B1

20%

68%

0%

100%

100%

• 5 óbitos (4 por progressão) • Todos estádios III/IV • 3 submetidos a resseção tipo R2 • Sobrevida média: • 25,6 meses (IC 95%: 7,5-43,7) • Sobrevida global média: • 28,6 meses (IC 95%: 14,8-42,5)

Conclusões Esta coorte permite observar diversas características que espelham o conhecimento científico atual, nomeadamente: • Pico na sétima década de vida • Apresentação sobretudo por sintomas locais • Importância das amostras histológicas para o diagnóstico • Maior agressividade dos timomas tipo C, com estádios mais avançados, pior qualidade de ressecção e maior mortalidade

Revista GECP 10(1) - Miolo.indd 34

• Estádio e tipo de ressecção cirúrgica como ferramentas de prognóstico • Aparente aumento no número de casos registados nos últimos anos • Benefício no alargamento da amostra para melhor caracterização e análise dos doentes com timoma em Portugal

27-03-2013 18:24:18


Discussão do Poster PO14

Timoma – 13 anos de experiência de um Serviço de Pneumologia Ana Barroso

Felicito os Colegas pelo tema escolhido, que sendo uma entidade pneumológica pouco frequente é por vezes esquecida, sendo o tema poucas vezes abordado. A casuística apresentada reporta a 13 anos tendo sido revistos os casos clínicos de 10 doentes. Os timomas são a neoplasia mais frequente do mediastino anterior e correspondem a cerca de 20 % de todas as neoplasias mediastínicas do adulto. Apresentam uma taxa incidência de 0.13/100 000/ano (EUA). Têm predomínio no sexo masculino e são mais frequentes em doentes idosos, podendo contudo surgir em qualquer idade. Cerca de 50 % dos timomas são achados radiológicos, sendo os restantes diagnosticados devido à existência de sintomas directamente relacionados com o tumor ou por manifestações paraneoplásicas (ex. miastenia gravis: 1/3 dos casos). A associação com outras neoplasias surge em cerca de 9 % dos doentes com timoma, sendo as neoplasias mais frequentes as digestivas, o linfoma não Hodgkin e os sarcomas de tecidos moles. O diagnóstico é feito por histologia que habitualmente é obtida por biopsia aspirativa transtorácica (BATT).

Revista GECP 2012; 2: 35-36

Revista GECP 10(1) - Miolo.indd 35

A classificação histológica usada é a da OMS revista em 2004, sendo o estadiamento de Masaoka o preconizado actualmente. A literatura correlaciona positivamente o estádio Masaoka com a sobrevida. Detterbeck recolheu os dados de 10 estudos publicados (> 2000 doentes) e calculou taxas de sobrevida aos 5 anos de 92, 82, 68 e 61 % e aos 10 anos de 88, 70, 57 e 38 % para os estádios Masaoka I–IV, respectivamente. A ressecção completa e a taxa de recorrência também mostraram ser importantes factores de prognóstico. O único tratamento curativo é a cirurgia com ressecção total, sendo a taxa de recidivas de 11 a 19 %. Habitualmente os timomas são radiossensíveis, sendo a radioterapia usada em neoadjuvância ou adjuvância da cirurgia. A quimioterapia apresenta diferentes taxas de resposta (30–100 %) que variam de acordo com as combinações de fármacos escolhidas (habitualmente incluindo platínio) como por exemplo o regime PAC (ciclofosfamida, cisplatino, doxorubicina) ou ADOC (ciclofosfamida, adriamicina, vincristina e cisplatino). Para os timomas invasivos a melhor abordagem é multidisciplinar combinando terapêuticas (cirurgia, QT e RT).

35

27-03-2013 18:24:30


Discussão do Poster PO16

No poster em questão, constatou-se, à semelhança de outros estudos, um predomínio franco do sexo masculino, sendo a média de idades alta, apesar de ligeiramente abaixo da descrita na literatura. Há um aparente aumento do número de casos nos anos mais recentes, que poderá ser justificada pelo envelhecimento da população, por uma maior acuidade no diagnóstico ou um registo mais rigoroso. Não seria esperada uma percentagem tão alta de sintomas à data do diagnóstico (na literatura, cerca de 1/2 dos doentes não apresenta sintomas), mas este facto pode ajudar a justificar o estádio avançado à data de diagnóstico em 60 % dos doentes. Os sintomas locais predominaram conforme habitual nesta entidade; da mesma forma se encontraram 20 % de casos de miastenia gravis. O diagnóstico pré-cirúrgico só foi possível em 68 % das situações (BATT), o que realça a importância de uma boa amostra de tecido. Os timomas tipo C apresentaram maior agressividade, com estádios mais avançados, pior

36

Revista GECP 10(1) - Miolo.indd 36

qualidade de ressecção e maior mortalidade, vindo ao encontro dos estudos que dizem que o estádio e o tipo de ressecção são importantes factores prognósticos. Espero que este poster impulsione a recolha dos dados dos timomas a nível nacional, para que se possa caracterizar a nossa população. REFERÊNCIAS Schwartz AM, et al. J Thorac Oncol 2010; 5: 369. Tomaszek S, et al. Ann Thorac Surg 2009; 87(6): 1973-80. Engels E. J Thorac Oncol 2010; 5(10, Suppl. 4): S260-S265 Koppitz H, et al. Cancer Treatm Reviews 2012; 38: 540-8. Kondo K, Monden Y. Ann Thorac Surg 2003; 76: 878-84. Masaoka A. Staging system of thymoma. J Thorac Oncol 2010; 5(10, Suppl. 4): S304–S312. Travis MD, Brambilla E, Muller-Hermelink HK. World Health Organization classification of tumors. Pathology and genetics of tumours of lung, pleura, thymus and heart. Detterbeck FC, Parsons AM. Ann Thorac Surg 2004; 77: 1860-9.

Revista GECP 2012; 2: 35-36

27-03-2013 18:24:32


Actividades do GECP

Destaques REUNIテグ DA PRIMAVERA PENELA, 5 E 6 DE ABRIL DE 2013 ASSEMBLEIA GERAL PENELA, 6 DE ABRIL DE 2013

Revista GECP 10(1) - Miolo.indd 37

27-03-2013 18:24:32


Actividades do GECP

Acta da Assembleia Geral Extraordinária do Grupo de Estudos do Cancro do Pulmão

Aos doze de Outubro do ano de 2012, pelas dezassete horas e vinte minutos, reuniu no Hotel Santa Eulália em Albufeira, a Assembleia Geral extraordinária do Grupo de Estudos do Cancro do Pulmão, em cumprimento da convocatória distribuída a todos os associados, de acordo com as disposições legais e estatutárias, com o único ponto de Ordem de Trabalhos: 1 – Eleição dos Órgãos Sociais do GECP para o triénio 2013-2015 Foi distribuída a lista candidata aos Corpos Sociais e o respetivo programa de ação (em anexo). Com a presença de mais de cinquenta associados, foram apresentados os resultados da eleição. Num total de 37 votos, houve um voto em branco e um voto nulo. Foram admitidos dez novos sócios. A Presidente da Mesa da Assembleia Geral, Dra. Encarnação Teixeira agradeceu a participação de todos os associados presentes e a todos os que expressaram o seu voto, sendo validado o ato eleitoral. Nada mais havendo a acrescentar, a Presidente da Mesa deu por encerrada a sessão da qual foi lavrada acta que será lida e assinada pelos membros desta.

LISTA CANDIDATA AOS CORPOS SOCIAIS DO GRUPO DE ESTUDOS DO CANCRO DO PULMÃO (GECP) TRIÉNIO 2013-2015 Assembleia Geral Presidente: Dr.ª Encarnação Teixeira – Pneumologia Hospital de Santa Maria, Lisboa Vice-Presidente Dr.ª Alice Pego – Pneumologia Centro Hospitalar e Universitário de Coimbra Secretário Dr.ª Margarida Felizardo – Pneumologia Hospital de Loures Vogal Dr. Luís Ferreira – Pneumologia Hospital Sousa Martins, Guarda

Conselho Fiscal Presidente Dr. João Cunha – Pneumologia Hospital de Braga

38

Revista GECP 10(1) - Miolo.indd 38

27-03-2013 18:24:32


Actividades do GECP

1.º Vogal Dr.ª Teresa Cardoso – Pneumologia Hospital de Évora 2.º Vogal Dr.ª Sallete Valente Centro Hospitalar da Cova da Beira

Direcção Executiva Presidente Dr. Fernando Barata Centro Hospitalar e Universitário de Coimbra Secretária: Dr.ª Teresa Almodôvar Instituto Português de Oncologia, Lisboa Tesoureira: Dr.ª Ana Barroso Centro Hospitalar V.N.Gaia/Espinho Vogal: Prof. Dr. Venceslau Hespanhol Hospital de São João, Porto Vogal: Dr. Paulo Costa Clínica de Radioterapia do Porto e Hospital de Braga

Oncologia Médica – Instituto Português de Oncologia, Porto Prof. Dr. Henrique Queiroga Pneumologia – Hospital de S. João, Porto Dr. Hernâni Lencastre Cirurgia – Centro Hospitalar de V N Gaia/ Espinho EPE Dr.ª Cármen Calçada Radioterapia – Centro Radioterapia do Porto Dr.ª Ana Fernandes Pneumologia – Centro Hospitalar Trás-os-Montes e Alto Douro Dr.ª Ana Figueiredo Pneumologia – Centro Hospitalar e Universitário de Coimbra Dr.ª Rosete Nogueira Laboratório Anatomia Patológica e Patologia Fetal, CGC Genetics Porto Dr. Ulisses Brito Pneumologia – Hospital Distrital de Faro Dr.ª Marta Soares Oncologia Médica – Instituto Português de Oncologia, Porto

Director da Revista Conselho Científico do Grupo de Estudos do Cancro do Pulmão Dr. Bárbara Parente Pneumologia – Centro Hospitalar de V N Gaia/ Espinho EPE Prof. Dr. António Araújo

Dr. Agostinho Costa – Pneumologia Centro Hospitalar Lisboa Norte

Responsável Pelo Site Conselho Científico do GECP

39

Revista GECP 10(1) - Miolo.indd 39

27-03-2013 18:24:32


Actividades do GECP

GRUPO DE ESTUDOS DO CANCRO DO PULMÃO PROGRAMA DE ACÇÃO (TRIÉNIO 2013/2015) A lista candidata baseia-se na experiência, credibilidade, responsabilidade, espírito inovador e de equipa dos seus constituintes, numa linha global de continuidade das actividades iniciadas pelas Direcções anteriores, com um programa que propõe e passa pelo cumprimento dos objectivos estatutários do Grupo de Estudos do Cancro do Pulmão (GECP). 1. Estimular, apoiar e desenvolver Estudos Epidemiológicos, Laboratoriais e Clínicos da iniciativa do GECP. 2. Estimular, apoiar e desenvolver a Investigação clínica e experimental, quer participando em ensaios básicos e clínicos da iniciativa de outros grupos cooperativos, quer em estudos da iniciativa de universidades, fundações ou da industria farmacêutica. 3. Dinamizar o desenvolvimento da oncologia com interesse no cancro do pulmão, estabelecendo a Cooperação entre os vários Grupos Cooperativos e Sociedades Científicas promovendo iniciativas conjuntas como reuniões, discussão e aprovação de orientações de diagnóstico e terapêutica, implementação de trabalhos multicêntricos e multidisciplinares. 4. Promover e patrocinar a realização, de dois em dois anos, do Congresso do Grupo de Estudos do Cancro do Pulmão, pugnando pelo seu alto nível de qualidade, pela sua descentralização e pelo envolvimento o mais alargado pos-

5.

6.

7.

8.

9.

10.

sível de todas as especialidades que se dedicam ao diagnóstico e tratamento do Cancro do Pulmão. Promover e patrocinar a realização de duas Reuniões Científicas Anuais de Actualização do saber sobre Pneumologia Oncológica – Primavera e Outono. Incentivar a organização de Cursos Regionais de discussão de casos clínicos associados a acções formativas específicas nas várias vertentes do saber actualizado em Pneumologia Oncológica. Organizar Cursos e Reuniões Locais dirigidas a Médicos de Medicina Geral e Familiar ou outro pessoal de saúde com a finalidade de divulgação, entre outros, dos factores de risco e sinais de alerta para o Cancro do Pulmão. Manter a publicação bi-anual da Revista do Grupo de Estudos do Cancro do Pulmão, estimulando novas participações e rubricas temáticas e multidisciplinares. Aperfeiçoar e dinamizar o Sitio do GECP na internet em tempo real e com maior interactividade. Pensamos fazê-lo através de: actualização de conteúdos e de visual; informação actualizada para doentes e população em geral: disponibilização on-line de actividades como conteúdos de reuniões e congressos; criação de espaços para sugestões e opiniões de internos e especialistas da área oncológica. Criar um modelo e apoios que permitam a atribuição anual de Prémios Científicos e Bolsas, nas vertentes da formação, investigação e/ou de aquisição de novas técnicas, com o patrocínio da indústria farmacêutica.

40

Revista GECP 10(1) - Miolo.indd 40

27-03-2013 18:24:32


Actividades do GECP

11. Estimular e dinamizar os Jovens Médicos, das várias especialidades representadas no GECP, para uma colaboração mais estreita, seja sob a forma de participação em estudos clínicos ou divulgando os seus trabalhos no nosso Sítio da Internet ou na nossa Revista. 12. Será estimulada a interacção com a Sociedade Civil, com as Associações de Doentes e com Associações ou Fundações na área da patologia oncológica, fomentando parcerias e actividades conjuntas que permitam envolver os profissionais, os doentes e a população em geral, na promoção da saúde oncológica pulmonar.

13. Manter com os Responsáveis Políticos para as doenças Oncológicas uma estreita colaboração na definição de uma politica de Saúde, sobretudo no que respeita à área da Pneumologia Oncológica. 14. Reforçar as Relações Internacionais, intensificando aquelas que já existem com os grupos cooperativos espanhol, italiano e com a ETOP (European Thoracic Oncology Platform) e alargando-as a outros grupos, em especial, com iniciativas de colaboração com os países de língua oficial portuguesa. 15. Promover a Revisão dos Estatutos do GECP, nomeadamente, no ponto referente à sede, corpos sociais, novos membros e formas de financiamento.

41

Revista GECP 10(1) - Miolo.indd 41

27-03-2013 18:24:32


Actividades do GECP



352*5$0$5(81,$235,0$9(5$*(&3  'LDVHGH$EULOGH /RFDO3HQHOD 1~PHURGH3DUWLFLSDQWHVD   



%RDVYLQGDV

 

,PXQRWHUDSLDQR&DQFURGR3XOPmR &RODERUDomR%06 







0RGHUDGRU)HUQDQGR%DUDWD







1RYDUHDOLGDGHWHUDSrXWLFD







)HUQDQGR%DUDWD







([SHULrQFLDFRP,SLOLPXPDEQR&DQFURGR3XOPmR







&DUORV&DPSRV 0DGULG 



&RIIHH%UHDN

 

*(&33URSRVWDVGH,QYHVWLJDomR



7HUHVD$OPRGRYDUH9HQFHVODX+HVSDQKRO







$VVHPEOHLD*HUDOGR*(&3



$OPRoR

 

+LSRFRDJXODomRQR&DQFURGR3XOPmR &RODERUDomR/HR 3KDUPD 







0RGHUDGRU$QD%DUURVRH3DXOR&RVWD







3UyVH&RQWUDV









$IDYRUGDKLSRFRDJXODomR±/XUGHV)HUUHLUD %UDJD 









&RQWUDDKLSRFRDJXODomR±%UXQR6DQWRV )DUR 

([SHULrQFLDFRP,QKRKHS WLQ]DSDULQD HP2QFRORJLD 0LJXHO%DUERVD 9LOD5HDO   



)LPGRVWUDEDOKRV



42

Revista GECP 10(1) - Miolo.indd 42

27-03-2013 18:24:32


Actividades do GECP

43

Revista GECP 10(1) - Miolo.indd 43

27-03-2013 18:24:38


Revista GECP 10(1) - Miolo.indd 44

27-03-2013 18:24:43


Critérios de publicação

CRITÉRIOS DE PUBLICAÇÃO DA REVISTA DO GRUPO DE ESTUDOS DO CANCRO DO PULMÃO

O

Quadros e figuras – Os quadros e figuras devem ser apresentados em páginas separadas, em fáceis condições de reprodução. Devem ser acompanhados da respectiva legenda em página à parte, mencionando no verso a lápis o número de ordem. Todos os gráficos deverão ser apresentados através de fotografia do respectivo original. Modificações e revisões – No caso de a aceitação do artigo ser condicionada a modificações, estas devem ser realizadas pelos autores no prazo máximo de vinte dias.

E

V

Apresentação dos trabalhos – Os textos devem ser escritos em português, dactilografados, com margens largas (25 mm) a dois espaços, numa só face do papel e em três exemplares com as páginas numeradas no canto superior direito. Deverão ainda ser acompanhados pela disquete e indicação do programa de computador em que foram exe cutados. Poder-se-ão considerar para publicação artigos redigidos em inglês, francês ou espanhol. Nestes casos, deve incluir-se o resumo, o título e as palavras-chave também em português e em inglês. Deverão ser referenciados pelos próprios autores como artigos originais, de revisão, cartas ao editor, ou outros. Estrutura – Sempre que possível, será adoptado o esquema convencional em que se iniciará cada parte do trabalho numa nova página pela seguinte ordem:

Bibliografia – As referências bibliográficas devem ser numeradas por ordem consecutiva da sua primeira citação no texto. Devem ser identificadas no texto com números árabes. As referências devem conter no caso das revistas o nome do primeiro autor (apelido e nome),seguido dos restantes, do título do artigo, do nome da publicação e da sua identificação (ano, volume e páginas).

Ã

a) aceites sem alterações; h) aceites após as modificações propostas e aceites pelos autores; c) recusados.

e) Agradecimentos f) Bibliografia g) Quadros e Figuras.

IS

A Revista do GECP considera para publicação trabalhos (artigos originais, de revisão, de actualização, casos clínicos, cartas ao editor, resumos críticos a livros, etc.) relacionados directa ou indirectamente com tumores torácicos. As opiniões expressas são da exclusiva responsabilidade dos autores. Os artigos publicados ficarão propriedade da Revista, não podendo ser reproduzidos, no todo ou em parte, sem autorização do editor. A aceitação dos originais enviados para publicação é condicionada à avaliação pelo Conselho Científi co da Revista. Nesta avaliação os artigos poderão ser:

E

M

R

a) Na primeira página: – título do trabalho em português e inglês b) Na segunda página: – nome dos Autores com os respectivos títulos académicos e/ou profissionais; – local de trabalho ou da Instituição onde foi realizado o trabalho. c) Na(s) página(s) seguinte(s): – o resumo em português que não deverá ultrapassar 250 palavras para os trabalhos originais e de 150 para os casos clínicos; – os resumos em inglês com características idênticas ao do inicial em português; – as palavras-chave, em português e inglês (3 a 10), que servirão de base à indexação do artigo, de acordo com a terminologia do lndex Medicus «Medica Subject Headings». d) O texto que, no caso dos artigos originais, terá em geral: Introdução, Material e Métodos, Resultados, Discussão e Conclusões

As provas tipográficas serão realizadas pela Redacção, caso os autores não indiquem o contrário. Neste caso,elas deverão ser feitas no prazo determinado pela Redacção em função das necessidades editoriais da Revista. Separatas – Podem ser fornecidas separatas, a expensas dos autores, quando requisitadas antes da impressão. Cartas ao editor – Devem constituir um comentário crítico a um artigo da Revista ou uma pequena nota sobre um tema ou caso clínico. Não devem exceder as 500 palavras, nem conter mais de um quadro ou figura e um máximo de 6 referências bibliográficas. As respostas do(s) autor(es) devem obedecer às mesmas características. Pedido de publicação – Os trabalhos deverão ser enviados à Redacção, dirigidos ao Director da Revista, para a seguinte morada: Publicações Ciência e Vida, Lda. – Apartado 44 – 2676-901 Odivelas, acompanhados de uma carta com pedido de publicação, subscrito por todos os autores, indicação da cedência do copyright e que não foram publicados ou enviados para publicação em outra revista nacional ou estrangeira. Não serão aceites trabalhos já publicados ou enviados simultaneamente a outras revistas. Nota final – Para um mais completo esclarecimento sobre este assunto, aconselha-se a leitura dos requisitos do International Commitee of Medical Journal Editors, publicados no N Engl J Med 1991; 324: 424-428.

45

Revista GECP 10(1) - Miolo.indd 45

27-03-2013 18:24:43


Em 2012, o Grupo de Estudos do Cancro do Pulm達o teve o apoio de:

Revista GECP 10(1) - Miolo.indd 46

27-03-2013 18:24:43


Enviar para: Dr. Fernando Barata Grupo de Estudos do Cancro do Pulmão Avenida Dr. Antunes Guimarães, n.º 554 4100-074 Porto Telef: 351 226 165 450 gecp@skyros-congressos.com

Revista GECP 10(1) - Miolo.indd 47

27-03-2013 18:24:44


Revista GECP 10(1) - Miolo.indd 48

27-03-2013 18:24:45

Revista 2013, Nº 1  

Revista científica do Grupo de Estudos do Cancro do Pulmão

Read more
Read more
Similar to
Popular now
Just for you