The Guitar Auction - 10th-13th March 2026 by Gardiner Houlgate

10th, 11th, 12th & 13th March 2026

VIEWING

Friday 6th March 2026 - 9:15am - 5pm

Monday 9th March 2026 - 9:15am - 5pm

Tuesday 10th March 2026 - 9:15am - 5pm

Wednesday 11th March 2026 - 9:15am - 5pm

Thursday 12th March 2026 - 9:15am - 5pm

Friday 13th March 2026 - 9:15am - 10am

FREE ONLINE BIDDING

• Bid Live with One-click Bidding

• Leave Auto Bids & Absentee Bids

• FREE Emailed Auction Alerts

• Manage Wish List, Won Lots & Bids Please

Visit www.gardinerhoulgate.co.uk to register

BUYER’S PREMIUM

22% + VAT (26.4% inclusive of VAT @ 20%)

OTHER BIDDING METHODS

Absentee commission bids may be left with us to bid on your behalf

Telephone bids may be possible on lots estimated £300 and above subject to availability

PAYMENT DETAILS

All lots must be paid and cleared within seven days after the sale. Goods will not be released until full payment is received and cleared. We are pleased to accept payment by the following methods: direct bank payment, debit card, credit cards (chip and pin only, see below), cash to a maximum of £8500.

Deposit payments made direct at the bank or via telephone banking will need to be confirmed as 'cleared funds' before any goods are released.

CONDITION GUIDANCE

Comments on condition and originality in descriptions are our opinion only and not necessarily fact. Buyers that cannot view in person are encouraged to ask for a condition report and/or images before placing any kind of bid.

ENQUIRIES

01225 812912 or email: auctions@gardinerhoulgate.co.uk

Guitars Part I, Artist

Instruments & memorabilia

Tuesday 10th March 2026 at 10am

Guitars

Pleasenote:Anydescriptions,statements,orconditionnotesare providedforguidanceonlyandreflectopinionatthetimeofcataloguing. AsperourstandardAuctionTermsandConditions,thesedonot constituterepresentationsorwarrantiesofanykind.

Prospectivepurchasersarestronglyadvisedtosatisfythemselvesasto condition,originality,andfinishpriortobidding.Buyersshouldrely primarilyonpersonalinspectionand/ortheaccompanyingphotographic material.Weare,however,morethanhappytoprovideguidanceand answeranyquestionspriortothesale.

1965 Fender Telecaster electric guitar, made in USA; Body: metallic gold refinish with red 'tan lines' under hardware, fading with red showing to back, buckle blemishes to back, blemishes and dings to sides and other areas; Neck: maple, 3JUN65B date stamp, red finish present to neck butt face, surface wear to length of neck; Fretboard: Brazilian rosewood with pearl dots, minor groove wear to first position; Frets: light wear; Electrics: working, potentiometers dating to 34th week of 1965, replacement switch; Hardware: tarnishing and pitting to control plate and controls, otherwise good; Case: early 60s white tolex Fender hard case; Weight: 3.62kg; Overall condition: good for age

£4000-6000

1966 Fender Telecaster electric guitar, made in USA; Body: candy apple red finish, possible refinish, light checking and dings, a few larger blemishes and finish rubbing to back edges; Neck: maple, April 1966 date stamp, light dings and checking throughout; Fretboard: rosewood; Frets: light wear; Electrics: working, potentiometers dating to 13th week of 1966; Hardware: later installed Bigsby, otherwise good; Case: late 60s Fender hard case; Weight: 3.81kg; Overall condition: good for age

£2500-4000

1967 Fender Telecaster electric guitar, made in USA; Body: candy apple red finish, finish loss/rubbing to most edges, various other chips and large blemishes, finish sanded within neck pocket; Neck: maple, 3SEP67B date stamp, surface wear to length, minor dings; Fretboard: Indian rosewood, light wear to first position; Frets: mild wear; Electrics: working, replacement potentiometers, tone potentiometer dating to 1971, volume potentiometer probably Japanese; Hardware: generally good, some rusting to smaller metal parts and some tarnishing to chrome plating; Case: original hard case; Weight: 3.45kg; Overall condition: fair

£3000-6000

1967 Fender Telecaster electric guitar, made in USA; Body: candy apple red refinish, light finish rubbing to edges, minor dings throughout; Neck: maple, minor dings, 3JUL67B date stamp; Fretboard: maple; Frets: mild wear throughout; Electrics: working, potentiometers dating to 31st week of 1966; Hardware: generally good, minor tarnishing in places; Case: Kramer hard case; Weight: 3.38kg; Overall condition: good for age

£3000-4000

1968 Fender Telecaster Thinline electric guitar, made in USA; Body: candy apple red finished mahogany body, finish loss / rout to neck pickup cavity, light lacquer checking in places, some lacquer cracking to centre front, heavy scuffs to edges, further dings and blemishes throughout; Neck: maple, various minor dings and light checking; Fretboard: maple cap, light wear to first position, light wear to edges; Frets: refret, mild wear throughout; Electrics: working, neck pickup with thin output, replacement capacitor; Hardware: some tarnishing to bridge plate, neck pickup screws with added rubber washers; Case: earlier 60s Fender hard case; Weight: 2.99klg; Overall condition: fair

£3000-5000

1968 Fender Telecaster Custom electric guitar, made in USA; Body: candy apple red refinish, surface buckle scratching to back, various chips and blemishes mainly to the edges, minor dings and marks to back and front, two vacant holes to body end; Neck: maple, 13SEP68B date stamp, light lacquer wear mainly to edges; Fretboard: maple, wear to edges and some lacquer wear spots; Frets: refret, minor wear throughout; Electrics: working, potentiometers dating to 42nd week of 1966, re-soldering to pots; Hardware: generally good, damage to switch tip, small damages to lower corners of pickguard, minor tarnishing; Case: original hard case; Weight: 3.53kg; Overall condition: good for age

£3000-5000

1970 Fender Telecaster Custom electric guitar, made in USA; Body: candy apple red refinish, some finish bleeding into binding, various blemishes and marks throughout; Neck: maple, November 1970 date stamp, refinished, various dings; Fretboard: rosewood, board sanded back with thin veneer remaining; Frets: refret; Electrics: in need of attention, jack intermittence and no output from bridge pickup, neck pickup rewound, replacement potentiometers and switch; Hardware: chrome plating loss to control knobs, some screws not catching within pilot holes, pickguard appears to be replaced; Case: non-original hard case; Weight: 3.39kg; Overall condition: fair

£2000-3000

1973 Fender Telecaster electric guitar, made in USA; Body: candy apple red finish, light checking, heavy buckle blemish and scratching to back, finish loss to edges and arm position to front, further dings and marks; Neck: maple, refinish, various dings throughout, 1973 date stamp; Fretboard: rosewood; Frets: worn with visible indent wear; Electrics: working, potentiometers dating to early 1973, replacement switch; Hardware: gold plated, loss to gold plating and other minor tarnishing; Case: period non-Fender hard case; Weight: 3.62kg; Overall condition: fair

£2000-3000

1975 Fender Telecaster Thinline electric guitar, made in USA; Body: candy apple red finish, light dings throughout, light surface scratches, some lacquer stress marks, some dropfill to minor dings; Neck: maple, 1975 date stamp; Fretboard: maple; Frets: good; Electrics: working, potentiometers dating to 1974, pickups dating to 1975; Hardware: good; Case: Korean made Fender type hard case; Weight: 3.42kg; Overall condition: good for age

£1500-2500

10.

Interesting Esquire electric guitar, an apparent 50s replica comprising Fender parts; Body: candy apple red refinish, various blemishes and dings throughout including light checking and surface scratches; Neck: maple, appears non Fender, soft V profile, decal in incorrect position, refinished, lacquer wear throughout; Fretboard: maple, light groove lacquer wear throughout; Frets: mild wear; Electrics: working, tone pot dating to 1964; Hardware: generally good, some tarnishing, 1956 serial neck plate; Case: 1950s Fender light tweed hard case (damages); Weight: 3.23kg; Overall condition: fair

£1000-2000

11.

Interesting and unusual Fender Stratocaster electric guitar, made in USA, circa 1964; Body: candy apple red finish with 'RR' stamped beneath scratchplate, lacquer checking throughout, various blemishes and dings; Neck: earlier 60s Fender figured birds eye maple Slab Board neck, possibly '61, no date stamp, unusual 'RR=' stamp to neck butt, light surface lacquer wear to edges and minor lacquer wear to middle length, later transitional decal; Fretboard: Brazilian rosewood slab board, groove wear to first position; Frets: good, refret; Electrics: working, volume potentiometer replaced, tone potentiometers dating to 3rd week of 1964, replacement switch (original switch retained including a selection of wiring); Case: late 60s hard case; Weight: 3.52kg; Overall condition: good for age

*BearingRRstampstoboththebodyandneck;thesemarkings,sometimesfoundonvintageFenderinstruments,arethoughttoindicatefactory ‘Restore&Refinish’work.Theneckappearstobeanearlierslabboard,possiblycirca1961.

£4000-8000

12.

1966 Fender Stratocaster electric guitar, made in USA; Body: candy apple red refinish, heavy checking throughout, finish loss to arm contour, various dings and blemishes, finish sanded from neck pocket; Neck: maple, 13SEP66B date stamp, lacquer wear to length of neck, a few dings and other marks, checking throughout; Fretboard: Indian rosewood, groove wear to first position and further up towards ninth fret; Frets: good, refret; Electrics: working, 1966 dated pickups, volume and upper tone control dating to 24th week of 1966, lower tone control dating to 18th week of 1966; Hardware: gold plated, loss and tarnishing to gold plating, pickguard appears possible replacement; Case: original hard case; Weight: 3.49kg; Overall condition: fair

£3000-5000

13.

1966 Fender Stratocaster electric guitar, made in USA; Body: candy apple red refinish, finish rubbing to arm contour, back contour and treble edge, lacquer checking, dings and blemishes throughout, buckle rash to centre back; Neck: maple, worn to length of neck, lacquer checking to back of head, various dings, 13APR66B date stamp, minor loss to decal logo, dowelled holes from previously installed tuners with larger bushing ring impressions visible to head face; Fretboard: Indian rosewood; Frets: refret and new nut, minor wear; Electrics: working, pickups with 66 date inscriptions, possibly rewound, potentiometers dating to 8th week of 1966, pickups rewound/rewired; Hardware: generally good, some tarnishing/rusting to smaller metal parts, D/G string tree added, damages to corners of spring cavity back plate; Case: later Fender tweed hard case; Weight: 3.72kg; Overall condition: fair

£4000-6000

14.

1972 Fender Stratocaster electric guitar, made in USA; Body: candy apple red finish, light checking throughout, various minor dings otherwise good for age; Neck: maple, three bolt neck, 22OCT72B date stamp, a few very minor dings; Fretboard: maple, light wear to edges; Frets: light wear throughout; Electrics: working, 1972 date stamped pickups, 1972 potentiometers, three-way switch; Hardware: good; Case: original hard case; Weight: 3.71kg; Overall condition: good

£2500-3500

15.

1970 Fender Competition Mustang electric guitar, made in USA; Body: candy apple red finish with Competition stripe, light surface scratches and dings, one dropfilled ding to top, one surface lacquer crack running half length of back; Neck: maple, October 1970 date stamp; Fretboard: Indian rosewood; Frets: light wear; Electrics: working, some switch intermittence, 1970 potentiometers and correct pickups; Hardware: good, slight bend to upper E tuner shaft; Case: original Victoria hard case, base end with slight damage; Weight: 3.35kg; Overall condition: good

£1500-2500

16.

1966 Fender Jaguar electric guitar, made in USA; Body: candy apple red finish, various dings and marks as to be expected for age including both impact and finish dings, vacant hole to body end from previously positioned strap button; Neck: maple, August 1966 date stamps, matching candy apple red head face; Fretboard: Indian rosewood with pearl block position markers and bound edges; Frets: mild wear; Electrics: working, potentiometers dating to 34th week of 1966, selector switch on bass horn requires replacement as it does not seat and engage correctly; Hardware: generally good, gold plated, typical loss to gold plating and some tarnishing; Case: original hard case enclosing strap and original tag; Weight: 3.85kg; Overall condition: good for age

£3000-5000

17.

1966 Fender Jaguar electric guitar, made in USA; Body: candy apple red refinish, checking throughout, heavy dings and blemishes to edges and contour, further minor dings and marks; Neck: maple, lacquer wear throughout and various dings and marks, matching candy apple red head with light checking and chips to edges, decal slightly worn, FEB 66 date stamp; Fretboard: Indian rosewood; Frets: light wear throughout with visible indents; Electrics: working, potentiometers dating to 30th week of 1965; Hardware: gold plating with typical loss and tarnishing, neck plate appears repro; Case: original hard case with tape repair edges to tolex; Weight: 3.72kg; Overall condition: fair

£3000-5000

18.

1969 Fender Jaguar electric guitar, made in USA; Body: candy apple red finish, various minor dings; Neck: maple, matching candy apple head, lacquer checking, unusual decal shadow and likely refinished; Fretboard: Indian rosewood; Frets: good; Electrics: working, potentiometers dating to 1966, replaced jack socket; Hardware: generally good, missing bridge mute, corrosion to neck plate; Case: circa 1966 Fender Jaguar hard case; Weight: 3.69kg; Overall condition: good

£2000-4000

19.

1963 Fender Jazzmaster electric guitar, made in USA; Body: old candy apple red refinish (unusual black coat present), checking throughout, buckle marks to back, heavy finish rubbing and blemishes to contours and edges, further dings and marks throughout; Neck: maple, 4DEC63B date stamp, lacquer rubbing and marks to edges and further dings; Fretboard: Brazilian rosewood, light wear to first position; Frets: refret, light wear throughout; Electrics: working, although some intermittence to the slider switch, potentiometers dating to 1962; Hardware: gold hardware, typical loss and tarnishing throughout; Case: original hard case; Weight: 3.72kg; Overall condition: fair £3000-5000

20.

1965 Fender Jazzmaster electric guitar, made in USA; Body: candy apple red finish, finish fading throughout, mainly to the front, large sticker burn marks to back, scuffs and dings throughout; Neck: maple, candy apple headstock - checking and dings to edges, 4JUN65B date stamp; Fretboard: Brazilian rosewood; Frets: good; Electrics: in need of attention (wire requires re-soldering to bridge pickup), potentiometers dating to 1964 and 1965, pickups dating to 1965; Hardware: damage to upper E tuner shaft, some minor tarnishing and minor discolouration to guard, replaced switchtip; Case: 1960s Fender white tolex case (defaced with band name inscriptions); Weight: 3.59kg; Overall condition: good for age

*WithsetlistshadowmarkstobackalongwiththeshadowofaCourtneyLovesticker

£3000-5000

21.

1966 Fender Jazzmaster electric guitar, made in USA; Body: candy apple red finish, some finish fading, various surface scratches and minor dings although generally very good for age; Neck: maple with matching candy apple headstock, chip to head face by lower E tuner, date stamp 13NOV66B; Electrics: working, potentiometers dating to 8th week of 1966; Hardware: good; Case: original hard case, edge of internal compartment missing; Weight: 3.61kg; Overall condition: good for age

£3000-5000

22.

1966 Fender Electric XII twelve string electric guitar, made in USA; Body: candy apple red finish, possible overspray, lacquer checking throughout, some finish rubbing to contour and edges, dings and other marks throughout; Neck: maple, matching head with lacquer checking and various chips, 12AUG66B neck stamp, finish wear to edges of neck, dings throughout, vacant holes visible to back of head from previously installed tuners (current tuners period correct); Fretboard: Indian rosewood; Frets: mild wear; Electrics: working, 1966 potentiometers, some resoldering; Hardware: guard with unusual non-recessed central screws with evidence of new holes under guard suggesting possible replacement with four incorrect screws, otherwise hardware appears good; Case: original hard case; Weight: 3.58kg; Overall condition: fair

£2000-4000

23.

Fender Electric XII twelve string electric guitar, made in USA, circa 1966; Body: candy apple red refinish, lacquer checking, surface scratches and various dings throughout although good for age; Neck: maple, 12NOV65B date stamp, doweled hols to back of head from previously installed tuners; Fretboard: unbound rosewood with pearl dot position markers; Frets: light surface wear; Electrics: working, potentiometers dating to late 1965; Hardware: gold hardware (later plated), generally good, very light tarnishing in places; Case: original hard case; Weight: 3.72kg; Overall condition: good

£2000-4000

24.

1966 Fender Electric XII twelve string electric guitar, made in USA; Body: candy apple red finish, checking throughout and a few minor dings otherwise generally good for age; Neck: maple, refinished, 12JUL66B date stamp, light surface lacquer wear throughout, matching head with light checking and a few other marks; Fretboard: Indian rosewood; Frets: light wear; Electrics: working, potentiometers dating to 17th week of 1966; Hardware: good; Case: fitted period hard case; Weight: 3.90kg; Overall condition: fair

£2000-4000

25.

1967 Fender Coronado XII twelve string semi-hollow body electric guitar, made in USA; Body: candy apple red finish, a few minor dings otherwise generally very good; Neck: maple, 'Special' stamped to back of head, February 67 date stamp, light checking; Fretboard: Indian rosewood with block pearl position markers and bound edging; Frets: good; Electrics: working; Case: original hard case; Weight: 2.90kg; Overall condition: good

£1500-2500

26.

Fender Swinger (Musiclander) electric guitar, made in USA, circa 1970; Body: candy apple red, lacquer checking, dings and blemishes throughout; Neck: maple, 1966 date stamp, various minor dings; Fretboard: rosewood; Frets: good; Electrics: working, potentiometers dating to 42nd week of 1966, pickup appears to date to 1970; Hardware: good; Case: Victoria hard case; Weight: 2.36kg; Overall condition: good

£1000-1500

27.

1972 Fender Mandocaster, made in USA; Body: candy apple red finish, cavity routing and possibly refinished, finish rubbing to edge of lower bout, various minor blemishes; Neck: maple; Fretboard: rosewood; Frets: refret; Electrics: working, volume potentiometer and switch replaced (originals retained), tone potentiometer dating to 1972; Hardware: good; Case: original hard case; Weight: 1.69kg; Overall condition: good

£1000-1500

28.

1965 Fender Precision Bass guitar, made in USA; Body: candy apple red finish, overspray, heavy horizontal checking throughout, heavy finish rubbing and blemishes throughout, vacant holes to bass side of guard from previously repositioned finger rest, light buckle scratching to back; Neck: maple, surface wear to length, various dings, cigarette burn to front of head, April 65 date stamp; Fretboard: Brazilian rosewood; Frets: good, refret; Electrics: working, potentiometers dating to 34th week of 1965; Hardware: generally good, gold plated, typical loss to gold plating; Case: original hard case; Weight: 4.34kg; Overall condition: fair

£4000-6000

29.

Fender Precision Bass guitar, made in USA, circa 1968; Body: candy apple red finish, light checking throughout, many dings and blemishes particularly to the edges and contours; Neck: lacquer wear to length; Fretboard: rosewood; Frets: good, refret; Electrics: working, 1966 potentiometers; Hardware: generally good, small split to pickguard by jacket socket, some discolouration to pickguard, minor tarnishing to metal parts; Case: later fitted hard case; Weight: 4.06kg; Overall condition: fair

£2000-4000

30.

1973 Fender Precision Bass guitar, made in USA; Body: candy apple red finish, buckle rash/blemish and scratching to centre back, further scratches and dings throughout, many blemishes to edges; Neck: maple, 1973 date stamp, very light surface wear; Fretboard: maple; Frets: light surface wear; Electrics: working, pickups dating to 1973, one pot with visible 10th week of 1973 date code; Hardware: good; Case: original hard case, missing latches; Weight: 4.31kg; Overall condition: good for age

£2000-3000

1968 Fender Telecaster Bass guitar, made in USA; Body: candy apple red finish, some finish fading, finish rubbing to edges, various other dings and marks throughout; Neck: maple with skunk stripe, light wear to length of neck, more so to middle positions, minor dings, 23MAY68C date stamp; Electrics: working, potentiometers dating to 42nd week of 1966, minimal control on volume pot (output only when fully engaged); Hardware: replacement scratchplate (original damaged scratchplate included), some tarnishing to other metal parts; Case: original hard case; Weight: 5.10kg; Overall condition: fair

£1500-2500

32.

1975 Fender Telecaster Bass guitar, made in USA; Body: candy apple red finish, modifed control rout, buckle blemishes to back, buckle scratches, dings and finish rubbing to edges, other minor dings and blemishes to front and back - some with dropfill; Neck: maple, 1973 date stamp, minor dings; Fretboard: maple; Frets: mild wear throughout; Electrics: working, potentiometers dating to 1975, replacement cap; Hardware: generally good, minor tarnishing, small split to guard towards neck pickup; Case: late 1960s Fender hard case; Weight: 4.47kg; Overall condition: good for age

£1500-2500

33.

1966 Fender Jazz Bass guitar, made in USA; Body: candy apple red finish, appears oversprayed, large buckle blemish to centre back, checking and dings throughout, larger blemishes and finish rubbing to edges; Neck: maple with matching candy apple red headstock, date stamp 7APR66A, light lacquer wear to edges; Fretboard: Indian rosewood; Frets: light surface wear; Electrics: working, potentiometers dating to 12th week of 1966; Hardware: gold plated, typical loss to gold plating and light tarnishing; Case: 1970 Fender hard case (latches at fault); Weight: 4.19kg; Overall condition: fair

£3000-6000

34.

1966 Fender Jazz Bass guitar, made in USA; Body: candy apple red finish, lacquer checking throughout, finish loss/rubbing to contours and edges, pickup cavities appear to have been slightly sanded out, various dings and blemishes throughout; Neck: maple, lacquer wear to length, 7DEC66A date stamp, matching headstock with light checking and various chips and other marks; Fretboard: Indian rosewood with pearl block position markers; Frets: light wear throughout; Electrics: working, replacement potentiometers dating to 1988; Hardware: good; Case: original hard case, interior compartment missing; Weight: 4.36kg; Overall condition: fair

£3000-6000

35.

1974 Fender Jazz Bass guitar, made in USA; Body: candy apple red finish, various dings and surface scratches, otherwise good for age; Neck: maple, a few minor dings; Fretboard: maple with pearl block position markers; Frets: light wear; Electrics: working, potentiometers dating to 52nd week of 1973, one pickup with 74 date stamp; Hardware: good; Case: original hard case; Weight: 4.17kg; Overall condition: good

£2000-3000

36.

1969 Fender Bass VI six string bass guitar, made in USA; Body: candy apple red refinish, dings and blemishes throughout including light surface checking all over, some cavities enlarged; Neck: maple, refinished, fading to matching head finish, various dings, 1967 date stamp; Fretboard: bound Brazilian rosewood with pearl block position markers; Electrics: in need of some attention (output from bridge pickup only); Hardware: good, some tarnishing to tuner casings; Case: period hard case; Weight: 4.11kg; Overall condition: fair

£1500-2500

37.

1969 Fender Precision Bass guitar, made in USA; Body: sunburst finish, heavily worn throughout with large patches of finish loss, dings and blemishes, extra routing to house reconfigured electrics with extra potentiometer and Jazz Bass type bridge pickup; Neck: maple, 69 date stamp, refinished, dings and marks; Fretboard: Indian rosewood, light wear; Frets: wear throughout; Electrics: working, replacement DiMarzio pickups and replacement potentiometers; Hardware: replacement brass bridge, tarnishing to metal hardware, replacement strap buttons, heavily tarnished neck plate; Case: later hard case; Weight: 3.88kg; Overall condition: fair

£1000-2000

38.

1958 Gibson J-45 acoustic guitar, made in USA; Back and sides: mahogany, light checking; Top: sunburst, light checking and other minor marks; Neck: mahogany; Fretboard: Brazilian rosewood, light wear; Frets: good, light surface wear; Hardware: good; Case: original hard case; Overall condition: very good

£4000-5000

39.

1960s Futurama II electric guitar, made in Czechoslovakia; Body: red finish, various blemishes and dings, otherwise generally good for age; Neck: maple, light lacquer checking throughout; Fretboard: baked maple; Frets: good; Electrics: working, although low output from neck pickup and some intermittence to bridge pickup; Hardware: generally good, some tarnishing; Case: early 60s Selmer hard case; Overall condition: fair

£150-250

40.

2005 Gibson Custom Historic '54 Reissue Les Paul Custom electric guitar, made in USA; Body: black gloss finish, a few very light surface marks to back; Neck: good; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Case: original hard case with certificate of authenticity, tags and papers; Weight: 4.47kg; Overall condition: very good

*Accordingtothevendor,thisguitarwaspurchasedbytheprevious ownerin2006fromacontactassociatedwithTheDarkness.Itwas reportedlyorderedbythebandthroughArtistRelations,underthe mistakenbeliefthattheywerereceivinganR4.

£2500-3000

41 (See page 14)

44 45

41.

1961 Gretsch Chet Atkins 6119 hollow body electric guitar, made in USA; Body: red finish, light buckle markings to back, various surface dings, finish rubbing around switch position; Neck: good, head repair and neck refinishing; Fretboard: rosewood, mild wear to first position; Frets: mild wear throughout; Electrics: working; Hardware: generally good, minor tarnishing in places; Case: original hard case with tape repairs to edges; Weight: 2.91kg; Overall condition: good

*SoldwithUKnon-transferrableCITESA10certificateno. 25GBA10J5G3H9(domesticuseonly)

£1500-2000

42.

1983 Alvarez by Kazuo Yairi DY Dreadnought acoustic guitar, made in Japan; Back and sides: mahogany, various scratches and dings; Top: tobacco sunburst finished spruce, many dings and scratches, hairline to bass side near waist; Neck: mahogany, heavy wear throughout; Fretboard: ebony, surface wear to first position; Frets: light wear; Electrics: working, later fitted Ashworth AJ221 transducer pickup with end pin jack; Case: hard case; Overall condition: fair

£300-500

43.

1992 Taylor 710 acoustic guitar, made in USA; Back and sides: rosewood, nitro stand burn to centre back, various scratches and other marks; Top: natural spruce, various dings and scratches throughout; Neck: mahogany, light wear with dings towards neck heel; Fretboard: ebony; Frets: light wear and tarnishing throughout; Electrics: working, transducer pickup with end pin jack; Case: original hard case; Overall condition: fair

£700-1000

44.

1995 Heritage Eagle hollow body electric guitar, made in USA; Body: antique sunburst finished mahogany back and sides with spruce top, various dings and marks throughout including pick wear; Neck: mahogany, light finish wear to edges, dings to back; Fretboard: rosewood, light wear; frets: light wear; Electrics: working; Hardware: good; Case: original hard case; Overall condition: good

£1500-1800

45.

2012 Beard Guitars R Model Square Neck resonator guitar; Body: sunburst finished solid mahogany; Neck: mahogany; Fretboard: ebony; Case: original hard case; Overall condition: very good

£1500-2000

46.

2003 Ibanez Joe Satriani Signature JS100 electric guitar, made in Korea; Body: trans red finished basswood; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Gear4Music compressed foam case; Weight: 3.55kg; Overall condition: very good

£350-450

47.

2012 Epiphone Dot left-handed semi-hollow body electric guitar; Body: cherry finish, light marks throughout including small scratches to top; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: fitted hard case; Weight: 3.53kg; Overall condition: good

£200-300

48.

ESP LTD H-1007 Deluxe seven string electric guitar, made in Korea; Body: trans black figured maple top, light surface scratching to back; Neck: good; Fretboard: rosewood; Frets: light tarnishing; Electrics: working; Hardware: generally good, missing trem arm, some tarnishing to bridge; Case: hard case; Weight: 3.91kg; Overall condition: good

£300-500

49.

2017 D'Angelico Deluxe EXL-1 Limited Edition left-handed hollow body electric guitar, made in Korea; Body: limited edition powder blue finish; Neck: good; Fretboard: rosewood with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.27kg; Overall condition: very good

£500-800

50.

1999 Fender Jazz Bass V five string bass guitar, made in Mexico; Body: sunburst finish, large blemish to back and other minor marks throughout; Neck: maple, refinish; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: split to pickguard beside neck, one replaced scratchplate screw, upgraded Gotoh tuners; Case: TGI gig bag; Weight: 4.56kg; Overall condition: fair £300-400

51.

2003 Ovation Pinnacle CU247 electro-acoustic guitar, made in Korea; Body: Lyrachord bowl back with red burst top, a few light marks; Neck: mahogany, light dings; Fretboard: rosewood; Frets: light wear and edge sprouting; Electrics: working; Hardware: good; Case: hard case; Overall condition: good £400-600

52.

1978 Ovation Legend 1119-4 acoustic guitar, made in USA; Body: Lyrachord bowl back, light marks; Top: natural spruce, a few lacquer cracks and dings otherwise generally good for age; Neck: five piece mahogany and maple neck, slight veneer imperfection towards bottom of head; Fretboard: ebony, light wear to first position; Frets: good; Hardware: good; Case: original hard case; Overall condition: good for age £600-800

53.

2009 Peerless Tonemaster Player hollow body electric guitar, made in Korea; Body: gloss black finish, light surface scratches to back; Neck: good; Fretboard: rosewood with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.56kg; Overall condition: very good

£400-500

54.

Takamine TB10 fretless acoustic bass guitar, made in Japan, with curved sitka spruce top, curved back and sides, ebony fingerboard, pickup with CoolTube preamp and extendable end pin, within original hard case

£1000-1500

55.

2002 Takamine AN15 acoustic guitar, made in Japan; Back and sides: rosewood, light surface marks and minor dings; Top: natural cedar, minor dings and scratches; Neck: mahogany, a few minor dings; Fretboard: rosewood; Frets: good; Hardware: good; Case: original hard case enclosing papers; Overall condition: good

£300-500

56.

2003 Ibanez S Series S470 electric guitar, made in Korea; Body: flare orange flat finished mahogany; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing accessories; Weight: 3.44kg; Overall condition: very good

£200-300

57.

2011 Fender American Standard Telecaster left-handed electric guitar, made in USA; Body: three-tone sunburst finish; Neck: maple; Fretboard: maple; Frets: light tarnishing; Electrics: working; Hardware: good; Case: Fender hard case; Weight: 3.65kg; Overall condition: good

£600-800

58.

2020 Fender American Acoustasonic Telecaster left-handed electric guitar, made in USA; Body: natural spruce and mahogany; Neck: mahogany; Fretboard: ebony; Frets: good, light tarnishing to upper frets; Electrics: working; Hardware: good; Case: original Fender gig bag with papers; Weight: 2.32kg; Overall condition: good

£750-850

59.

2021 Fender American Ultra Stratocaster left-handed electric guitar, made in USA; Body: Texas Tea finished alder; Neck: maple; Fretboard: maple; Frets: generally good, mild tarnishing to upper frets; Electrics: working; Hardware: good; Case: original hard case with tags and papers; Weight: 3.74kg; Overall condition: very good

£800-1000

60.

2015 Fender Standard Stratocaster left-handed electric guitar, made in Mexico; Body: Arctic white finished alder; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: Thomann gig bag; Weight: 3.60kg; Overall condition: very good

£250-350

61.

2018 Gibson Memphis ES-335 left-handed semi-hollow body electric guitar, made in USA; Body: aquamarine finished figured maple; Neck: mahogany; Fretboard: rosewood with pearl block position markers; Frets: generally good, light tarnishing; Electrics: working; Hardware: good; Case: original hard case enclosing certificate of authenticity and papers; Weight: 3.67kg; Overall condition: very good

£1200-1600

62.

2012 Gibson Les Paul Studio left-handed electric guitar, made in USA; Body: white finish, some discolouration to edges; Neck: good; Fretboard: rosewood with crown pearl position markers; Electrics: working; Hardware: good, robot tuners (power supply not included); Case: original Gibson hard case; Weight: 3.78kg; Overall condition: good

£500-700

63.

2010 Paul Reed Smith (PRS) Lefty Ltd Custom Limited Edition lefthanded electric guitar, made in USA; Body: charcoal finished figured maple 10 Top upon mahogany back, light marks to back; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing papers; Overall condition: very good

*Fromofalimitededitionrunoffiftyguitars

£1500-2000

64.

2018 Fender Kurt Cobain Jaguar left-handed electric guitar, made in Mexico; Body: three-tone sunburst finish; Neck: maple; Fretboard: rosewood; Frets: generally good, minor tarnishing; Electrics: working; Hardware: good; Case: original hard case enclosing book insert tags and other papers; Weight: 3.96kg; Overall condition: very good

£700-900

65.

2008 Michael Kelly Custom Collection Patriot Instinct left-handed electric guitar, made in Korea; Body: partial Eclipse finished quilted maple top with central abalone inlay, upon gloss metallic back; Neck: good; Fretboard: rosewood with pearl position markers; Frets: mild tarnishing; Electrics: working; Hardware: good; Weight: 4.01kg; Overall condition: good

£200-400

66.

2019 Godin Multiac Nylon Encore left-handed electric guitar, made in Canada; Body: chambered silver leaf maple body with natural spruce top; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original gig bag; Weight: 2.15kg; Overall condition: very good

£500-700

67.

2017 Ibanez Prestige RG652AHML left-handed electric guitar, made in Japan; Body: antique white blonde finished ash; Neck: maple; Fretboard: maple; Frets: generally good, light tarnishing; Electrics: working; Hardware: good; Case: original hard case enclosing tags, papers and tools; Weight: 3.45kg; Overall condition: very good

£400-600

68.

2018 Gordon Smith GS1000 Custom left-handed electric guitar, made in England; Body: tobacco sunburst finished mahogany with shell binding; Neck: mahogany; Fretboard: maple with shell binding; Frets: good; Electrics: working; Hardware: good; Case: original hard case with certificate of authenticity; Weight: 3.41kg; Overall condition: very good

£300-500

69.

2006 Blueridge BR-183 acoustic guitar, made in China; Back and sides: rosewood; Top: natural spruce; Neck: mahogany; Fretboard: rosewood; Frets: light tarnishing; Hardware: good; Case: Tribal Planet gig bag; Overall condition: good

£400-600

70.

1950s Rodebald Hoyer archtop guitar, made in Germany; Body: natural finished maple back and sides with solid spruce top, heavy checking throughout and other minor dings; Neck: five piece maple, dowel repair to neck heel, lacquer checking; Fretboard: rosewood with pearl block position markers; Frets: good, refret; Hardware: good, upgraded ResoMax string saver bridge (original retained); Case: original soft bag; Overall condition: good

£300-500

71.

2007 Fender American Deluxe Stratocaster electric guitar, made in USA; Body: Olympic pearl metallic finish; Neck: maple; Fretboard: rosewood; Frets: light wear to first position; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.75kg; Overall condition: very good

£800-1000

72.

Ozark 3515BTE thinline electric resonator guitar, within Ortega hard case

£300-400

73.

2008 ESP LTD George Lynch GL-256 electric guitar, made in Vietnam; Body: two-tone sunburst faux relic finish; Neck: satin maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: generally good, missing trem arm; Case: soft bag; Weight: 3.46kg; Overall condition: good

£200-400

74.

2011 Brook Lyn acoustic guitar, made in Devon, England; Back and sides: walnut; Top: natural spruce; Neck: mahogany; Fretboard: ebony with pearl dot position markers; Frets: good; Hardware: good; Case: hard case; Overall condition: very good

£1500-2000

75.

2015 Fender Classic Player Jaguar Special HH electric guitar, made in Mexico; Body: Olympic white finished alder, small ding to top edge of lower body, Prince sticker applied to top; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working, upgraded Bare Knuckle Nailbomb neck and bridge pickups; Hardware: good, upgraded roller bridge; Weight: 3.91kg; Overall condition: good

£600-700

76.

Modfied 2014 Fender American Special Telecaster electric guitar; Body: see-through blonde finished body, light dings mainly located to the edges; Neck: maple; Fretboard: maple; Frets: good; Electrics: working, upgraded pickups including Mojo 1950 Fender Broadcaster bridge pickup and TK Smith replica 1947 Paul Bigsby cast aluminium neck pickup; Hardware: good, upgraded Callaham Vintage T Model Telecaster bridge assembly with compensated brass saddles, Callaham Vintage black five hole single-ply Bakelite lacquered pickguard and TK Smith lacquered Bakelite Telecaster arm rest; Case: original gig bag and tags; Weight: 3.64kg; Overall condition: good

£600-800

77.

2024 Epiphone Jerry Cantrell "Wino" Les Paul Custom electric guitar; Body: wine red finished mahogany body with maple top; Neck: mahogany; Fretboard: ebony with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case with tags; Weight: 3.91kg; Overall condition: excellent £300-500

78.

2022 Epiphone Jerry Cantrell Les Paul Custom Prophecy electric guitar; Body: bone white finish; Neck: good; Fretboard: ebony with diamond pearl position markers; Electrics: working; Hardware: good; Case: original hard case with papers; Weight: 3.86kg; Overall condition: excellent

£300-500

79.

2023 Epiphone Shinichi Ubukata ES-355 semi-hollow body electric guitar; Body: Pelham blue finish; Neck: good; Fretboard: ebony with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing papers; Weight: 4.28kg; Overall condition: excellent

£500-700

80.

2022 Gibson SG Standard electric guitar, made in USA; Body: TV yellow finished mahogany; Neck: good; Fretboard: rosewood with pearl crown position markers; Electrics: working; Hardware: good; Case: original gig bag; Weight: 2.91kg; Overall condition: excellent £700-900

81.

2016 Ibanez Prestige S5521Q electric guitar, made in Japan; Body: transparent aqua blue quilted maple top upon mahogany body; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 2.80kg; Overall condition: excellent

£600-800 71 74

82.

2016 Ibanez Prestige Roadcore Series RC2720 electric guitar, made in Japan; Body: dark cherry finished alder, small finish chip behind lower bridge stud; Neck: maple; Fretboard: rosewood with acrylic block position markers; Frets: good; Electrics: working; Hardware: generally good, scratch to corner of pickguard; Case: original hard case; Weight: 3.61kg; Overall condition: good

£400-600

83.

2021 Ibanez EKM10T Eric Krasno Signature vibrato semi-hollow body electric guitar, made in Indonesia; Body: trans red figured maple; Neck: good; Fretboard: ebony with pearl and abalone block position markers; Electrics: working; Hardware: good; Case: original hard case enclosing tags and papers; Weight: 3.57kg; Overall condition: excellent

£400-600

84.

2017 Gretsch G6118T-LIV Anniversary Model hollow body electric guitar, made in Japan; Body: lotus ivory/charcoal metallic finish; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case with papers; Weight: 3.43kg; Overall condition: excellent

£1000-1500

85.

2023 Guild Newark St. Collection Starfire IV SF-VI/SPC/DSNG semi-hollow body electric guitar; Body: metallic green finish; Neck: good; Fretboard: ebony with pearl and abalone block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.29kg; Overall condition: excellent

£300-400

86.

2022 D'Angelico Premier Bob Weir Bedford electric guitar, made in Indonesia; Body: Matt Stone finish; Neck: maple; Fretboard: ovangkol with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original gig bag; Weight: 3.13kg; Overall condition: excellent

£300-500

87.

2018 D'Angelico Deluxe Bedford electric guitar, made in Korea; Body: chameleon finish; Neck: maple; Fretboard: rosewood with pearl and abalone block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.46kg; Overall condition: excellent

£300-500

88.

2022 D'Angelico Deluxe DC semi-hollow body electric guitar; Body: natural satin finished maple; Neck: maple; Fretboard: ebony with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.41kg; Overall condition: excellent

£700-1000

89.

1965 Hofner President Thin electric guitar, made in Germany; Body: blonde finish, refinish, minor marks; Neck: maple, neck reset and refinish; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Weight: 2.37kg; Overall condition: good

£300-400

90.

Vox Marauder electric guitar, circa 1966; Body: black finish, lacquer cracking and other surface marks; Neck: maple; Fretboard: rosewood with pearl block position markers; Frets: light wear; Electrics: in need of some attention, some intermittence and repeat function appears dead; Hardware: split to pickguard at treble horn, missing mid boost selector control knob, pickguard screws replaced, battery compartment plate replaced; Weight: 3.31kg; Overall condition: fair

£700-1000

91.

1963 Hofner Senator Thin E1 hollow body electric guitar, made in Germany; Body: brunette finish, minor buckle marks/blemish to back, further minor dings; Neck: good, vacant strap hole button to heel; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good; Weight: 1.95kg; Overall condition: good

£300-400

92.

Mid 1960s WEM Fifth Man electric guitar, made in England; Body: sunburst finish with some dings and marks but generally good for age; Neck: three piece walnut and maple; Fretboard: rosewood; Frets: light wear; Electrics: working although intermittence to some potentiometers; Hardware: generally good, missing three screws from battery cover back plate, some replacement pickguard screws; Weight: 3.72kg; Overall condition: good for age

£1000-2000

93.

1960s Goya Rangemaster semi-hollow body electric guitar, made in Italy; Body: cherry finished mahogany, various light dings and marks - otherwise acceptable for age; Neck: good; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good; Case: original hard case; Weight: 2.62kg; Overall condition: good

£400-600

94.

Baldwin Virginian semi-hollow body electric guitar, made in England, circa 1967; Body: natural finished mahogany back and sides and maple top, light marks; Neck: maple, two long hairline lacquer cracks; Fretboard: rosewood; Frets: good; Electrics: treble pickup working, rhythm pickup in need of attention; Hardware: good; Weight: 3.62kg; Overall condition: good

£600-800

95.

1960s Meazzi-Italy Lovely electric guitar, made in Italy; Body: red burst finish, lacquer cracking and various dings; Neck: ebonised, various minor marks; Fretboard: rosewood; Frets: mild wear; Electrics: in need of attention; Hardware: good; Case: shaped semirigid fibreboard case; Weight: 3.09kg; Overall condition: good for age

£200-300

96.

1960s Vox Consort electric guitar, made in England; Body: powder blue refinish, light marks to back; Neck: maple; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good, missing one control knob; Weight: 3.18kg; Overall condition: good

£200-300

97.

1940s Gretsch Synchromatic hollow body guitar, made in USA; Body: sunburst finish, lacquer checking throughout, various other marks; Neck: lacquer checking, replacement deteriorating binding; Fretboard: rosewood with block position markers; Frets: refret, mild wear; Hardware: replacement repro Grover Imperial tuners, missing pickguard; Case: semi-rigid fibreboard case; Overall condition: fair

£400-600

98.

2018 D'Angelico Premier Ludlow electric guitar, made in Indonesia; Body: white finish; Neck: maple; Fretboard: ebony with pearl block position markers; Frets: good; Electrics: working although low output from bridge pickup; Hardware: good; Case: original gig bag; Weight: 3.84kg; Overall condition: good

£300-400

99.

1960s Vox Ace electric guitar; Body: sunburst finish, lacquer cracking and various dings; Neck: maple, refinish; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good, missing bridge cover; Weight: 3.76kg; Overall condition: good for age

£150-250

100.

1992 Taylor Dan Crary Signature Model DCSM electroacoustic guitar, made in USA; Back and sides: rosewood, a few light marks; Top: natural spruce, minor marks and dings including minor pick wear; Neck: mahogany; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Overall condition: good

*ThismodelwasTaylor'sfirstsignaturemodelguitar,designed inconjunctionwithlegendarybluegrassflatpickerDanCrary.

£1200-1500

101.

2004 Gibson Memphis ES-335 Dot semi-hollow body electric guitar, made in USA; Body: cherry finished maple, stand burn to upper back, vacant bigsby holes to body end, light surface marks, otherwise good; Neck: cherry finished mahogany, light scuffs and dings; Fretboard: rosewood; Frets: generally good although with tarnishing towards upper fret; Electrics: working; Hardware: Stetsbar trem installed (vacant Bigsby holes) to body end; Case: original hard case; Weight: 4.27kg; Overall condition: good

£1200-1500

102.

106 (See page 21)

Aiersi Tricone resonator guitar, within compressed foam case

£300-400

103.

1974 Gibson Les Paul Custom 20th Anniversary electric guitar, made in USA; Body: wine red finished three piece maple top upon pancake mahogany body, light buckle scratching to back, further minor dings and marks otherwise very good for age; Neck: three piece mahogany, minor dings; Fretboard: ebony with block position markers; Frets: mild wear and tarnishing throughout; Electrics: working and original; Hardware: generally good, typical loss to gold plating and minor tarnishing; Case: original hard case; Weight: 4.39kg; Overall condition: good for age

£3000-4000

104.

2015 Icarus GJ-CM Gypsy Jazz acoustic guitar; Back and sides: laminated maple; Top: cedar; Neck: cedar; Fretboard: rosewood; Frets: good; Hardware: good; Case: compressed foam case; Overall condition: very good

£200-300

105.

2006 Trevor Wilkinson Drone acoustic guitar, made in England; Back and sides: American black walnut; Top: sitka spruce; Fretboard: rosewood; Frets: good; Hardware: good; Case: Mojo gig bag; Overall condition: very good

£400-600

106.

2021 Rick Turner Model 1 Custom Deluxe electric guitar, made in USA; Body: cedar; Neck: maple, signed by Rick Turner to the reverse of head; Fretboard: rosewood with abalone dot position markers; Electrics: working with all electric switching options; Hardware: good; Case: original hard case; Weight: 3.29kg; Overall condition: very good *Topofthelinemodelwithallelectricoptions.Signedbythemakerto thebackofthehead.

£4500-5500

107.

Ashdown Lowrider bass guitar, made in China; Body: satin black finish; Neck: roasted maple; Fretboard: roasted maple; Frets: good; Electrics: working; Hardware: good; Case: original shipping box; Weight: 4.18kg; Overall condition: new/ old stock

£400-500

108.

1978 Tokai Les Paul Reborn LS-80 electric guitar, made in Japan; Body: tobacco sunburst finished flame maple top upon dark mahogany back, various surface marks including dings and minor blemishes; Neck: good, slight damage to head veneer around G string tuner due to tuner replacement; Fretboard: rosewood; Frets: good; Electrics: working, upgraded Klein pickups with 50s correct loom (original electrics included); Hardware: missing pickguard, three replacement tuners (originals retained), replacement jack plate surround; Case: original hard case; Weight: 4.19kg; Overall condition: good

*ThisearlyTokaiLesPaulReborndatesto1978,featuringan‘80’ stampattheendofthefretboard.TheLS80modelwasthe penultimateversionavailablein1978,withan18°headstockangle, nitrocellulosefinish,andGotohvintagePAF-stylepickups.Itsneck andbodywerebasedona1958LesPaulStandard,craftedfromsolid one-piecemahoganyandmaple.Thevendorfelttheoriginalpickups andcircuitwiringdidnotprovideanauthentictone,sotheguitarwas senttoCharlieChandler.ChandlerfittedKleinpickupsandbuilta 1950s-correctreplacementwiringloom,replacingalloriginalpots andswitchesandintroducingaswitched'outofphase'optionsimilar totheGreenieBurstusingapushtypetonepotswitch.Healso completedaPleksetupandfaultsurveyaspartofthework.This guitarwasfeaturedinaMarch2006issueofGuitaristmagazineinan articleonlawsuit-eraguitars.

£800-1200

109.

2002 Fender Jaguar DK203 JG-66 K (Kurt Cobain Specification) electric guitar, made in Japan; Body: three tone sunburst finish, a few minor dings and marks; Neck: maple; Fretboard: bound rosewood with dot position markers; Frets: good; Electrics: working; Hardware: generally good, some light tarnishing; Case: Fender hardcase; Weight: 3.94kg; Overall condition: good

£700-900

108

110 (See page 22)

111 (See page 22) 112 (See page 22)

110.

1999 Paul Reed Smith (PRS) McCarty left-handed electric guitar, made in USA; Body: vintage sunburst figured maple top upon cherry mahogany back, a few very minor surface impressions otherwise very good; Neck: mahogany; Fretboard: rosewood with birds in flight abalone position markers; Frets: good; Electrics: working; Hardware: generally good, some tarnishing to bridge and pickup covers; Case: original hard case enclosing tags; Weight: 3.53kg; Overall condition: very good £1200-1500

111.

2005 John Suhr Classic Chambered left-handed electric guitar, made in USA; Body: black gloss finished alder; Neck: one piece maple even C medium profile; Fretboard: maple; Frets: good; Electrics: working, DiMarzio SDS1 bridge pickup, DiMarzio FS1 middle pickup, DiMarzio Class of 55 neck pickup; Hardware: good; Case: original hard case enclosing papers; Weight: 3.13kg; Overall condition: excellent £1500-1800

112.

2003 John Suhr Classic T Chambered left-handed electric guitar, made in USA; Body: honey burst finish quilt maple top upon Swamp Ash back; Neck: one piece birds eye maple with even C slim profile; Frets: good; Electrics: working, Virtual P-90 pickups; Hardware: good; Case: original hard case enclosing papers; Weight: 3.05kg; Overall condition: excellent £1500-1800

113.

2007 John Suhr Classic Chambered left-handed electric guitar, made in USA; Body: aged cherry burst mellow centre finished Swamp Ash; Neck: maple even C profile; Fretboard: African rosewood; Frets: good; Electrics: working, JSTDSV+ humbucker bridge pickup and JSTV60 'S single coil middle and neck pickups; Hardware: good; Case: original hard case enclosing papers; Weight: 3.28kg; Overall condition: excellent £1500-1800

114.

1998 Gibson EC-20 Starburst left-handed electro-acoustic guitar, made in USA; Back and sides: brown finished figured maple; Top: natural spruce; Neck: three piece mahogany; Fretboard: rosewood with star position markers; Frets: light tarnishing; Electrics: working; Hardware: good; Case: original hard case; Overall condition: very good

£800-1200

115.

1996 Gretsch Anniversary 6118LH/T left-handed hollow body electric guitar, made in Japan; Body: two-tone smoke green finish; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.65kg; Overall condition: excellent £800-1200

113

114

115

118 (See page 23)

116.

1990s Tune Bass Maniac bass guitar, made in Japan; Body: wine red finished Senn ash body, minor dings and surface scratches including buckle rash to back; Neck: minor dings; Fretboard: ebony with dot position markers; Frets: light wear; Electrics: working, active circuitry; Hardware: good; Case: generic oblong hard case; Weight: 3.65kg; Overall condition: fair

£300-400

117.

2022 D'Angelico Excel Series Mini DC Tour semi-hollow body electric guitar; Body: slate blue finish; Neck: good; Fretboard: ebony with pearl diamond position markers; Frets: good; Electrics: working; Hardware: good; Case: original gig bag; Weight: 3.03kg; Overall condition: excellent

£300-500

118.

2023 Friedman NoHo AOMMTB-JOF-PY01-C electric guitar, made in USA; Body: pink sparkle finish; Neck: satin maple; Fretboard: maple with dot position markers; Electrics: working; Hardware: good; Case: original hard case with certificate of authenticity; Weight: 3.54kg; Overall condition: excellent

*Friedmanguitarsareanextensionofboutiqueamplifierbrande Friedmanamps.DaveFriedmancollaboratedwithGroverJackson todevelopalineofhighendsolidbodyguitars.

£800-1200

119.

1991 Gibson MIII Standard electric guitar, made in USA; Body: white finish, a few minor dings and some finish discolouring; Neck: good; Fretboard: maple, light wear to third and fourth fret position; Frets: light wear; Electrics: working; Hardware: good, missing spring cavity back plate; Case: original hard case; Weight: 3.52kg; Overall condition: good

£1000-1200

120.

2011 Gibson Les Paul Junior Double Cut electric guitar, made in USA; Body: cherry finished mahogany, two light finish blemishes to back, a few minor dings to top; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working, upgraded pickup (original retained); Hardware: upgraded shell pickguard (original black pickguard retained), upgraded Gibson Deluxe tuners (originals retained); Case: original Gibson hard case; Weight: 3.28kg; Overall condition: good

£900-1100

121.

2005 Oscar Schmidt by Washburn OE-30 Delta King semi-hollow body electric guitar, made in Indonesia; Body: black finish, light surface scratches; Neck: good, bolt-on; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Stagg soft bag; Weight: 4.12kg; Overall condition: good

£200-300

122.

2013 Emerald Guitar Company T25 carbon fibre three-quarter size electro-acoustic guitar, within original gig bag

*Custommadeforthevendorin2013.Thismodelwaseventually replacedbythecurrentX7Model

£600-1000

123.

2000 Wolfgang Gutscher R Model roundback steel string acoustic guitar, made in England; Back and sides: nine piece Indian rosewood round back with boxwood veneer inlay, a few minor dings; Top: sitka spruce, minor dings; Neck: cedar with Indian rosewood reinforcement; Fretboard: ebony; Frets: good; Electrics: EMG acoustic pickup and preamp fitted; Hardware: good; Case: Hiscox hard case; Overall condition: good

*Madeforthevendorbythemakerin2000

£700-1000

124.

Mobius Megatar Touchstyle twelve string fan fret guitar; Body: offset mahogany; Neck: mahogany; Fretboard: rosewood with fan frets; Electrics: working, however some servicing required (Piezo pickup on melody strings in need of attention - wiring issue, battery drains when not in use); Hardware: generally good, missing first fret dampening strip; Case: original gig bag; Weight: 4.40kg; Overall condition: good

£400-800

125.

1960s Futurama II Deluxe electric guitar, made in Sweden; Body: red finish vinyl back and red Perspex front, some splits to Perspex front, some scuffs to vinyl back; Neck: black finish, light surface marks; Fretboard: rosewood, heavy wear; Frets: wear throughout; Electrics: working, some intermittence to switches and potentiometer; Hardware: splits to plastic guard, missing trem arm, replacement tuners; Weight: 2.97kg; Overall condition: fair

£200-400

126.

1974 Guild Starfire 4 semi-hollow body electric guitar, made in USA; Body: cherry finished mahogany, minor scratches and dings throughout, surface buckle rash to back otherwise very good; Neck: mahogany; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good; Case: non-original period hard case; Weight: 4.35kg; Overall condition: very good

£1000-1500

127.

Early 20th century Gerome gypsy jazz acoustic guitar, bearing a Paul Beuscher internal label; Back and sides: black painted back, various repaired cracks, some separation to sides, sides with various scratches; Top: natural spruce, repaired cracks running through table centre; Neck: ebonised; Fretboard: hairline crack through first position, other wear; Frets: good, refret; Case: generic oblong hard case; Overall condition: fair

£200-300

128.

1980s Birket & Blackwell acoustic guitar, made in England; Back and sides: mahogany, small stable hairline to side towards body end, minor hairline to bass edge of lower bout; Top: natural spruce, minor hairline parting to centre top, play wear to upper bout treble side; Neck: mahogany; Fretboard: ebony; Frets: good; Hardware: good; Case: hard case; Overall condition: good for age

*MadebySimonBirkettandLaurenceBlackwell,whohadasmall studiospaceintheformerEelPieMarineCentre.TheEPMC workshopgavethemaccesstothetoolsandmachinerytoenable themtobuildhighquality,had-craftedacousticguitars.

£400-600

129.

2015 Gibson Memphis ES Les Paul semi-hollow body electric guitar, made in USA; Body: sunburst finished figured maple top upon dark brown finished maple back and sides, a few minor light surface marks; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing certificate of authenticity and warranty paper; Weight: 2.84kg; Overall condition: very good

£1800-2200

130.

1998 Paul Reed Smith (PRS) CE24 electric guitar, made in USA; Body: red finished figured maple top upon black gloss back, minor dings to edges and other light marks; Neck: maple, light wear to edges; Fretboard: rosewood; Frets: light wear and tarnishing; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.83kg; Overall condition: good for age

£800-1200

131.

1977 Gibson Les Paul Custom electric guitar, made in USA; Body: wine red finish, buckle finish blemishes to back, buckle scratching throughout back, dings to edges, dings and minor blemishes to top; Neck: three piece maple, heavy wear/finish loss to length of neck, vacant tuner pilot holes to back of head, a few chips to binding at fret positions; Fretboard: ebony; Frets: worn; Electrics: working; Hardware: loss to gold plating at edges of pickup covers and stopbar, replacement jack plate, other minor tarnishing to metal hardware, replacement control knobs; Case: protector hard case; Weight: 4.92kg; Overall condition: fair £2500-3500

132.

1980 Dobro Model 60 resonator acoustic guitar, made in USA; Body: sunburst finish maple; Neck: sunburst finish maple, minor dings; Fretboard: rosewood; Frets: good; Hardware: generally good, minor tarnishing to metalwork; Case: semi-rigid fibreboard case; Overall condition: good £700-1000

133.

1950s Roger Rossmeisl Junior cutaway electric archtop guitar, made in Germany; Body: natural finish spruce top with maple back and sides, glued repair to centre back and centre top, light refinishing; Neck: multi-ply maple neck; Fretboard: rosewood with pearl block position markers; Frets: worn and tarnished; Electrics: working; Hardware: good, later Kluson Deluxe tuners; Weight: 3.11kg; Overall condition: good

£400-600

134.

1966 C.F Martin GT-75 hollow body electric guitar, made in USA; Body: burgundy finish, lacquer checking throughout, some discolouration to back, further minor dings; Neck: bolt-on, minor dings and checking; Fretboard: rosewood, some chip damage from refret; Frets: good, refret; Electrics: working; Hardware: generally good, replacement bridge; Case: modern Martin acoustic hard case; Weight: 2.94kg; Overall condition: good for age

*SoldwithUKnon-transferrableCITESA10certificateno. 25GBA103DB7VN(domesticuseonly)(Pleasenote:International exportwillrequirefurtherCITESpaperworkatbuyercost)

£1000-1500

135.

2017 Fender American Special Stratocaster electric guitar, made in USA; Body: Olympic white finish, a few minor dings; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: Fender ABS hard case (two latches missing); Weight: 3.63kg; Overall condition: very good

£650-750

131

134

136 (See page 26)

140 (See page 26)

136.

1982 Jean Pierre made Jacques Favino labelled D hole gypsy jazz guitar, made in Paris, France; Back and sides: Brazilian rosewood, lacquer checking and clouding; Top: cedar, lacquer checking and other minor dings; Neck: sunburst finish, lacquer checking and a few minor dings; Fretboard: ebony; Frets: light wear; Hardware: mild tarnishing otherwise good; Case: 1960s Selmer hard case; Overall condition: good for age

*SoldwithUKnon-transferrableCITESA10certificateno. 25GBA1029XXKK(domesticuseonly)(Pleasenote:International exportwillrequirefurtherCITESpaperworkatbuyercost)

£1800-2200

137.

Dell'Arte by John Kinnard Jimmy Rosenberg gypsy jazz guitar, made in USA; Back and sides: Indian rosewood; Top: natural spruce; Neck: three piece figured maple; Fretboard: ebony; Frets: light wear and tarnishing; Hardware: good; Case: fitted hard case; Overall condition: very good

£700-900

138.

1964 Hofner Committee E2 electric hollow body guitar, made in Germany; Body: brunette finished figured birds eye maple back and sides and spruce top, light finish dings and minor marks otherwise very good for age; Neck: sunburst finished maple, finish loss behind first position; Fretboard: ebony; Frets: light wear, refret; Electrics: working; Hardware: generally good, repair to tip of pickguard, replacement tuners (some originals retained); Case: original Selmer hard case; Weight: 2.82kg; Overall condition: good

£600-800

139.

2018 Line 6 Limited Edition Variax electric guitar, made in Indonesia; Body: trans black finish, a few light marks; Neck: maple; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Case: soft bag; Weight: 3.46kg; Overall condition: good

£250-350

140.

1991 Fender Stratocaster Plus electric guitar, made in USA; Body: charcoal frost with metallic flake finish, small finish ding to back edges and other minor surface marks; Neck: maple, light lacquer pulling; Fretboard: maple, minor wear to first position; Frets: good; Electrics: working; Hardware: good; Case: later Fender hard case; Weight: 3.78kg; Overall condition: good

£1000-1500

141.

1975 Fender Stratocaster electric guitar, made in USA; Body: threetone sunburst finish, finish fade to front, blemish to body end, various light dings and other marks; Neck: maple, slight V profile, 1975 date stamp; Fretboard: maple; Frets: light wear; Electrics: working, pickups dating to 1975, potentiometers dating to 51st week of 1974; Hardware: good; Case: later Fender ABS hard case; Weight: 3.51kg; Overall condition: good for age

£2000-2500

141

143 (See page 27)

142.

Upgraded 2014 Squier by Fender Vintage Modified Telecaster Deluxe electric guitar, made in Indonesia; Body: Olympic white finish; Neck: maple; Fretboard: maple; Frets: good; Electrics: working, upgraded Creamery wide range pickups with Fender branded covers, upgraded electrics with push-push tone potentiometers; Hardware: good; Case: generic oblong hard case; Weight: 3.83kg; Overall condition: very good £250-350

143.

Gibson Super 400 archtop guitar, made in USA, circa 1938; Body: two-tone sunburst finished maple back and sides and spruce top, light lacquer checking and minor dings throughout; Neck: sunburst finished maple; Fretboard: ebony with pearl split block position markers; Frets: good, refret; Hardware: good; Case: vintage hard case; Overall condition: good

*Thisguitarwasrecentlysoldtothecurrentownerasa1946Super 400;however,theserialnumberisindecipherableduetoan obscuredinternallabel.Theinteriorbackhasbeendarkened beneaththef-holes,apracticeoccasionallyemployedtoprevent glareor“white-out”effectsunderclose-uplightingwithearlyblackand-whitetubecameras.Unfortunately,thishasalsoobscuredthe factorylabelinside.Despitetheabove,thisexamplefeaturesthe smallerupperboutwithlargerf-holes,indicatingthatitisa transitionalmodelfromaround1937–1938,whenthelargerbody sizewasfirstintroduced.

£6000-8000

144.

Early 1970s Gibson ES-175 D hollow body electric guitar, made in USA; Body: natural finished maple, lacquer checking/cracking throughout, light surface scratches to centre back; Neck: light marks and wear, light checking similar to body; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good; Case: Epiphone hard case; Weight: 3.20kg; Overall condition: good for age

£3000-4000

145.

1960 Gretsch Anniversary electric guitar, made in USA; Body: twotone green finish, light surface scratching and dings to back, similar wear and some lacquer checking to top, minor discolouration to top; Neck: wear throughout including complete finish loss to middle treble side; Fretboard: rosewood, surface wear throughout; Frets: light wear; Electrics: working, later installed middle pickup; Hardware: light tarnishing, bend to G tuner shaft, guard slightly cut to sit around middle pickup; Case: non-original period Lifton type hard case; Weight: 3.03kg; Overall condition: good for age

*Soldwithdomesticnon-transferableCITESA10certificate(Please note:InternationalexportwillrequirefurtherCITESpaperworkat buyercost)

£2000-3000

146.

Good quality Cabronita custom build electric guitar comprising John Cruz neck and other Fender parts; Body: light relic see-through blond MJC ash body; Neck: 2001 Fender Custom Shop John Cruz flameed Birdseye maple neck; Fretboard: maple; Frets: good; Electrics: working, TV Jones Power'tron Plus pickup, Custom Shop La Cabronita Especial wiring harness; Hardware: good, Fender American Series chrome hardtail bridge, Fender Cabronita pickguard, Kluson Deluxe tuners and Fender Corona neckplate; Case: Fender soft bag; Weight: 3.04kg; Overall condition: good £800-1200

147.

1997 Fender Custom Shop Waylon Jennings Telecaster electric guitar, made in USA; Body: black finish with leather front insert, light buckle scratching and other marks to back, a few further light marks to sides; Neck: maple, light dings and marks; Fretboard: maple; Frets: light wear throughout including some visible indents; Electrics: working; Hardware: good; Case: original hard case with certificate of authenticity and strap; Weight: 3.82kg; Overall condition: good for age

£3000-4000

148.

2025 Abasi Concepts Emi 6 Legion electric guitar, made in Korea; Body: Charcoal Burl; Neck: wenge bolt-on; Fretboard: ebony; Frets: good; Electrics: working, Fishman Fluence Tosin Abasi signature pickups; Hardware: good; Case: original gig bag; Overall condition: very good

*Inasnewconditionandwithprotectivefilmstillinplace.Recently importedbythevendorfromtheUS(AbasicurrentlyhasnoUK retailoutlet)

£900-1100

149.

Restored Burns Sonic electric guitar, made in England, circa 1960; Body: red refinish, minor surface marks; Neck: refinish, minor marks; Fretboard: maple, refinished; Frets: worn; Electrics: working; Hardware: Vibra Trem vibrato, replacement control knob; Case: original hard case; Weight: 3.09kg; Overall condition: good/restored £300-400

150.

2015 Gretsch G6120T-55GE hollow body electric guitar, made in Japan; Body: orange finished maple with G brand; Neck: good; Fretboard: rosewood with cowboy block position markers; Frets: light wear; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.25kg; Overall condition: very good £1500-1800

151.

2013 Gibson Custom Shop ES-295 Scotty Moore Limited Edition hollow body electric guitar, made in USA; Body: bullion gold finish, hand signed by Scotty Moore to the top; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good, upgraded Bigsby trem; Case: original hard case; Overall condition: very good

*Partofalimitedrunofeighty-oneguitarsproducedincollaborationwiththelegendaryScottyMoore.Eachexamplewashand-signedbytheartist tothetop.TheguitarcomescompletewithsignedCOAandotherrelatedoriginalpapers.Pleasenote:ThishasbeenupgradedwithaBigsbytremolo system,withtheoriginalpartsretainedinthecasepocket.Duetotheinstallationofthetremsystem,thecaseliddoesnotfullyclose.

£4500-5500

152.

1963 Gretsch 6124 Anniversary Model hollow body electric guitar, made in USA; Body: sunburst finish, large buckle rash patch to back, further dings and scratches throughout; Neck: worn with some finish drop fill and various other dings; Fretboard: rosewood; Frets: good, refret; Electrics: working, additional bridge pickup installed with three-way switch; Hardware: generally good, missing pickguard; Case: later hard case; Weight: 2.75kg; Overall condition: fair

*Soldwithdomesticnon-transferableCITESA10certificate(Pleasenote:InternationalexportwillrequirefurtherCITESpaperworkatbuyercost)

£1000-1500

153.

1960 Gretsch 6131 Jet Firebird electric guitar, made in USA; Body: red finished top upon black back, various dings and blemishes, light checking to top; Neck: various dings and scratches; Fretboard: ebony with pearl thumb position markers; Frets: worn and tarnished; Hardware: generally good, bend to E and A tuner shaft, additional strap button installed to back, other tarnishing; Case: oversized Barrington hard case; Weight: 3.36kg; Overall condition: good for age

£2000-4000

154.

1983 Washburn HB35 semi hollow body electric guitar, made in Japan; Body: cherry finished mahogany, buckle scratches and other various minor dings and marks; Neck: finish imperfections around neck graft behind second fret positions; Fretboard: ebony with pearl block position markers, light wear; Frets: good; Electrics: working; Hardware: good; Case: gig Skinz gig bag; Weight: 3.78kg; Overall condition: good

£200-300

155.

Modified 2014 Fender Custom Shop 54 Stratocaster Relic electric guitar, with replacement Custom Guitarbuild UK ultralight hardtail body, made in the USA; Body: two tone sunburst relic finished hardtail body - custom order from Guitarbuild UK; Neck: maple relic; Fretboard: heavy relic maple Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing certificate of authenticity, serial stamped backplate, tags and strap; Weight: 2.98kg; Overall condition: very good

£1200-1800

156.

Guild Jumbo Junior Bass electro-acoustic bass guitar, within Gator hard case

£200-300

157.

2005 Guild GAD-50E ATB electro-acoustic guitar, made in China; Back and sides: rosewood, minor dings; Top: natural spruce, various minor dings and scuffs; Neck: mahogany, a few minor dings; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Fazley hard case; Overall condition: good

£350-450

158.

1980s Squier by Fender Contemporary Series JV Stratocaster SST-314H-55 electric guitar, made in Japan; Body: red finish, discolouration to belly contour, lacquer cracks to bass side, various dings and blemishes; Neck: good; Fretboard: rosewood; Frets: wear throughout including visible indents; Electrics: working; Hardware: tarnishing to saddles and other smaller metal parts, replacement control knobs, missing control cavity back plate; Case: fitted shaped hard case; Weight: 3.31kg; Overall condition: fair

£400-600

159.

1996 Fender 52 Reissue Telecaster TL-52 electric guitar, made in Japan; Body: blonde finish, finish chip to back towards edge, a few other minor dings; Neck: maple, minor ding around serial number; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: generic oblong hard case; Weight: 3.85kg; Overall condition: good

£500-600

160.

1989 Fenix by Young Chang Stratocaster electric guitar, made in Korea; Body: candy apple red finish, light scratches and dings; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working, upgraded Lindy Fralin pickups; Hardware: replaced switch tip, one replaced control knob, missing trem arm; Case: Tiger gig bag; Weight: 4.05kg; Overall condition: good

£200-300

161.

1966 Rickenbacker 365 electric guitar, made in USA; Body: five-way finish, buckle rash patches to back, scratches and other dings; Neck: various dings and marks, washer impressions to face of head indicating another set of tuners have been previousl installed; Fretboard: rosewood, lacquer wear throughout; Frets: minor wear throughout; Electrics: working; Hardware: generally good, splits to pick/control guard; Case: contemporary Rickenbacker hard case; Weight: 3.28kg; Overall condition: fair

£2500-3500

1999 Godin Multiac Synth Access electric guitar, made in Canada; Body: natural spruce top upon mahogany back; Neck: good; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Overall condition: very good *Soldwithanadditionalinterchangableshortscaleneck

£400-500

163.

1963 Fender Bass VI six string bass guitar, made in USA; Body: three-tone sunburst refinish, light marks; Neck: maple, refinish; Fretboard: rosewood; Frets: light wear; Electrics: working, potentiometers dating to 1963; Hardware: good; Case: original relined hard case; Weight: 4.03kg; Overall condition: very good

£2500-3500

164.

2005 Fender Custom Shop '59 Esquire NOS electric guitar, made in USA; Body: two-tone sunburst finish; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: original hard case with certificate of authenticity, tags and accessories; Weight: 3.44kg; Overall condition: very good

£1500-2000

165.

1993 Fender Custom Shop '54 Stratocaster electric guitar, made in USA; Body: two-tone sunburst finish, light surface buckle marks to back and a few other minor dings; Neck: birds eye maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: generally good, small split to pickguard around screw at treble side of bridge, light pick marks to guard; Case: original hard case with certificate of authenticity; Weight: 3.51kg; Overall condition: good

£1500-2000

166.

1972 Fender Telecaster electric guitar, made in USA; Body: natural finished six piece body, various dings and marks although generally good for age; Neck: maple, light dings; Fretboard: rosewood; Frets: mild wear throughout and minor tarnishing; Electrics: working, potentiometers dating to 1966; Hardware: good; Case: original hard case; Weight: 3.80kg; Overall condition: good for age

£2000-3000

170.

167.

1979 Fender Stratocaster electric guitar, made in USA; Body: black finish, a few minor surface marks otherwise very good for age; Neck: maple; Fretboard: maple; Frets: good; Electrics: working, potentiometers and pickups dating to 1978; Hardware: good; Case: original hard case; Weight: 4.34kg; Overall condition: very good

£1000-1200

168.

1983 Fender Dan Smith two knob Stratocaster electric guitar, made in USA; Body: sienna sunburst finish, light surface scratches including light surface buckle marks to back; Neck: maple, dowelled holes to head face; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: Fender period hard case; Weight: 3.53kg; Overall condition: good

£800-1200

169.

1987 G&L Asat electric guitar, made in USA; Body: see-through blonde finish; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case with original purchase receipt, tags and papers; Weight: 3.67kg; Overall condition: very good

£600-800

Squier by Fender SQ Series Stratocaster electric guitar, made in Japan (1983 - 1984); Body: black finish, finish blemishes and surface marks throughout; Neck: maple, minor dings; Fretboard: maple, light wear; Frets: mild wear throughout including visible indents; Electrics: working, some potentiometer noise; Case: Fender gig bag; Weight: 3.72kg; Overall condition: fair

£400-500

171.

2015 Gibson Les Paul Junior electric guitar, made in USA; Body: cherry finished mahogany; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case with papers; Weight: 3.97kg; Overall condition: very good

£500-700

172.

2009 Gibson Custom Shop ES-339 semi-hollow body electric guitar, made in USA; Body: red finished maple, a few light marks; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case with certificate of authenticity; Weight: 3.29kg; Overall condition: very good

£1000-1500

173.

Fender Telecaster Custom CTC-55M electric guitar, made in Japan (1992-1993); Body: black finish, various dings and surface scratches throughout; Neck: maple, a few minor dings; Fretboard: maple, light wear to treble side; Frets: good; Electrics: working; Hardware: good, missing reflector caps from control knobs; Weight: 3.77kg; Overall condition: good for age

£500-600

166 (See page 30)

167

168

175 (See page 32)

174.

1962 Harmony Rocket H59 hollow body electric guitar, made in USA; Body: two-tone sunburst finish, various light dings and marks although good for age; Neck: maple, slight bow, minor marks and blemishes; Fretboard: ebonised, missing third and fifth fret position markers; Electrics: working; Hardware: good; Case: TGI gig bag; Weight: 2.96kg; Overall condition: fair £500-700

175.

Fender Telecaster electric guitar, made in USA, circa 1978; Body: blonde finish, heavy wear to arm position, various large blemishes and marks throughout; Neck: maple, various wear including dings and other marks; Fretboard: maple, worn to edges; Frets: wear throughout, replaced nut; Electrics: all replaced with Seymour Duncan rail to bridge position; Hardware: missing scratchplate, replacement Fender Japan tuners, replacement locking strap buttons, control plate screws replaced, missing switch tip; Case: Line 6 gig bag; Weight: 4.79kg; Overall condition: fair £1000-1200

176.

1959 Hofner 500/5 President bass guitar, made in Germany; Body: brunette finish, buckle scratching and rash to back, further minor dings and marks; Neck: reset with glue residue prominet at heel, black refinish with various marks, minor bow; Fretboard: rosewood; Frets: good, refret; Electrics: working; Hardware: light tarnishing, one replaced tuner; Weight: 2.34kg; Overall condition: fair

£800-1200

177.

Baleno Size 2 small body acoustic guitar, made in USA, dated 7/20/4; Back and sides: rosewood; Top: tobacco sunburst finished Engelmann spruce; Neck: mahogany; Fretboard: ebony; Frets: good; Hardware: good; Case: fitted hard case; Overall condition: excellent

£1000-1500

178.

Paul Hathway small bodied electro-acoustic guitar, made in England; Back and sides: mahogany; Top: spruce; Neck: mahogany; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Case: Gator hard case; Overall condition: very good

£400-600

179.

2008 K. Yairi RAG65G small bodied acoustic guitar, made in Japan; Back and sides: mahogany, a few light marks; Top: natural spruce; Neck: mahogany; Fretboard: rosewood; Frets: good; Hardware: good; Case: Terry Pack hard case; Overall condition: very good

£300-600

180.

Traveler Guitar Escape Mark III electric travel guitar, within original gig bag

£200-300

181.

2018 KoAloha Opio KTO-G6 guitalele, fitted with MiSi transducer pickup, within fitted Kinsman hard case

£300-400

182.

2004 C.F Martin Mini Martin Size 5 Parlour/Terz Limited Edition acoustic guitar, made in USA; Back and sides: rosewood; Top: natural spruce; Neck: mahogany; Fretboard: ebony; Frets: good; Hardware: good; Case: original hard case; Overall condition: very good

£1000-1500

183.

2015 Bourgeois Piccolo Parlor Custom acoustic guitar, made in USA; Back and sides: walnut; Top: Dalmatian spruce; Neck: mahogany; Fretboard: ebony; Frets: generally good, minor tarnishing to upper frets; Hardware: good; Case: fitted hard case; Overall condition: very good

£1500-2500

184.

Yamaha LL-11 acoustic guitar; Back and sides: rosewood, a few minor surface marks; Top: natural spruce, a few minor dings; Neck: mahogany; Fretboard: rosewood; Frets: good; Hardware: good; Overall condition: good

£250-350

185.

2007 Fender American Standard Telecaster electric guitar, made in USA; Body: black finish, a few minor surface marks; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing tags and papers; Weight: 3.53kg; Overall condition: very good

£600-800

186.

1958 Gibson Les Paul Standard electric guitar, made in USA; Body: gold top finish with dark back, refinished by Yuuki McClure, light ageing; Neck: reprofiled and thinned-down, head repair, minor heel work carried out by Yuuki, neck refinished; Fretboard: Brazilian rosewood with pearl crown position markers, rebound; Frets: good, refret; Electrics: working, PAF Patent Applied For pickups, 1957 potentiometers; Hardware: generally good and appear period correct (see footnote), correct single line Kluson Patent Pending tuners with replacement Uncle Lou's tips, incorrect height adjustment screws at second pickup; Case: original Lifton five latch hard case; Weight: 4.14kg; Overall condition: good for age / restored

*Sourcedseveralyearsagobyaguitartraderandfollowingcareful examinationandconsultationwithmultipleindependentspecialists, thisinstrumentwasestablishedtobeanoriginal1958GibsonLes PaulGoldtop.Thelimitedknownprovenanceindicatesthatthe guitarwasacquiredfromthewidowofaprivateguitarcollectorwho passedawayapproximatelyelevenyearsprevious.Itisbelievedthe instrumentmayoriginallyhavecomefromSouthAfrica,although thiscouldnotbeindependentlyverified.

Atthetimeofacquisition,theguitarfeaturedathicksunburst refinish,withtherefinisherhavingtheforesighttomasktheoriginal serialnumber,whichremainsintact.Theneckhadpreviouslybeen reprofiled,withsubstantialmodificationtotheheelarea,smoothed andblendedintothebody.Ahistoricheadstockbreakhadalsobeen repairedusingdowels.Muchoftheoriginalelectronicsand hardwareappearedintact,althoughtheguitarwasfittedwithlater double-lineKlusontuners,creamplastics,newerstrapbuttons, switchtip,andseveralnon-originalscrews.Theinstrumenthadalso beenrefrettedandrebound.Theguitarretaineditsoriginal,albeit well-worn,five-latchLiftonhardcase.

Afterchanginghands,theguitarwasgiggedforseveralyearsinits then-currentconditionbeforebeingentrustedtorespected restorerYuukiMcClureofPlayerGradeVintage.During restoration,theinstrumentreceivedanauthenticagedGoldtop finish,alongsidecorrectiveworktotheheelareatoaddressthe earlierneckreshaping.Correctperiod-appropriatecomponents weresourcedtoreplacethelaterhardware,includingthe pickguard,pickupsurrounds,switchsurroundandtip,andcorrectsingle-lineKlusontuners.Thetunerbuttonsarehigh-qualityreproduction examplessourcedfromUncleLou’s.

Thereprofiledneckmeasuresapproximately20mmindepthatthefirstfret(withoutstrings)and22mmatthetwelfthfret(withoutstrings).The guitarisfittedwithoriginalPAFhumbuckers,withresistancereadingsof7.4kΩattheneckand7.5kΩatthebridge.Potentiometercodes(134731) datetothe31stweekof1957,andthecapacitorsappearcorrectfortheperiod.Allblackplasticsarebelievedcorrect,includingtheswitchtip, switchring,pickuprings,outputjackplate,pickguard,knobs,trussrodcoverandbackplates.Thetunersarecorrectsingle-linePATPendingKluson types,withreproductiontipsasnoted.Thebridgeisthecorrectfoundry-markednon-wireABR-1type,andthetailpieceisthecorrectlightweight castaluminiumexamplewith1.5"studs.Oneofthepickupsheightadjustmentscrewsappearstobealaterreplacements.Theguitarishousedinits correctfive-latchLiftonhardcase.

AccordingtoGibsonshippingtotals,only434LesPaulStandardswereproducedin1958,withthisexample’sserialnumberfallingwithintheearlier Goldtopproductionrange,priortothemodel’stransitiontothenow-iconicsunburstfinish.

SoldwithCITESdomesticnon-transferableA10certificate:26GBA10BVJHDW

£50,000-70,000

187.

1961 Gibson ES-345 TD semi-hollow body electric guitar, made in USA; Body: natural finish, buckle scratching / finish loss to back, light checking in places, various dings and marks otherwise very good for age; Neck: mahogany, large scratch to length of neck with minor hairline visible within in places; Fretboard: rosewood, light wear; Frets: worn throughout with visible indent; Electrics: working, original PAF Patent Applied For pickups; Hardware: general tarnishing and gold plating loss as to be expected, Bigsby Patent vibrato and custom made plaque, tarnishing to smaller metal parts, replacement neck pickup surround screws, slight bend to G & D tuner shafts; Case: later Gibson hard case; Weight: 4.10kg; Overall condition: good for age Soldwithdomesticnon-transferableCITESA10certificateno.26GBA10KECSYP

*Singleownerfromnew.ThevendorwastheleadguitaristwiththeNottingham-basedgroupTheBeatmen,whocollectivelypurchasednewequipmentin 1961.ThisES-345wasoriginallysuppliedbyPapworthsofAlfretonRoad,Nottingham,havingbeenimportedbySelmerofCharingCrossRoad,London,at acostof250guineas,withanadditionalpremiumpaidforthefactory-fittedBigsbyvibrato.

TheBeatmenwereatypicalBritishrockgroupoftheperiod,performingextensivelythroughouttheUKfrom1959untiltheirdisbandmentcirca1967.The bandrecordedthreesinglesforPyeRecordsbetween1965and1966,includingYouCan’tSitDown,NowtheSunHasGoneandPleaseBelieveMe,and alsoheldthreeresidencyengagementsatHamburg’sTopTenClubduring1963and1964.

Theguitarexhibitsalongscratchtothebackoftheneck.Thevendorstatesthatthisoccurredveryearlyinitslife,shortlyafterpurchase,whentheguitar wasleantagainstanamplifierbetweensessions,slippedtothefloorandcaughtamicrophonestand.Withinthisareatherearealsofinehairlinelines,a typicaloccurrenceonearly1960sGibsonnecks,whichwerecarvedwithcomparativelyslimprofiles,leavinglesswoodmassaroundthetrussrodchannel. Thishasnotaffectedthestructuralintegrityorplayabilityoftheinstrument,whichremainedinregularprofessionalusebythevendorforoverfiftyyears withoutissue.

TheGibsonES-345inNaturalfinishisexceptionallyrare.AccordingtoGibsonshippingrecords,only50exampleswereproducedbetween1959and1960 £20,000-30,000

190.

188.

1962 Gibson EB-3 bass guitar, made in USA; Body: cherry finished mahogany, buckle scratching and other dings to back, light checking and further dings throughout; Neck: cherry finished mahogany, light wear throughout, various minor dings including chips to head tip; Fretboard: rosewood; Frets: good, refret; Electrics: working; Hardware: generally good, finger rest added to scratchplate, reflector cap missing from one control knob, pickup surface finish rubbed, minor tarnishing to metal parts; Case: oblong hard case; Weight: 3.52kg; Overall condition: good for age

*Soldonbehalfoftheoriginalowner.

£3000-4000

189.

1967 Gibson ES-335 semi-hollow body electric guitar, made in USA; Body: cherry finish, light checking to bass edge top and other small areas, a few minor dings and marks otherwise very good for age; Neck: cherry finish mahogany, a few small chips to edge of head; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good; Case: non-original contemporary fitted hard case; Weight: 3.71kg; Overall condition: very good

*Purchasedbythevendorcirca1975andusedprimarilyasastudio instrument,withonlyoccasionalliveperformances.Thislimited giggingaccountsforitsexceptionalconditionrelativetoitsage.

£4000-6000

1963 Guild Jet Star S-50 electric guitar, made in USA; Body: cherry finish, dings, scratches and other marks throughout; Neck: cherry finished mahogany, finish wear through centre and various other dings and marks; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.27kg; Overall condition: good for age £2500-3500

191.

2018 Eastman E10OO-M acoustic guitar, made in China; Body: mahogany; Neck: mahogany; Fretboard: rosewood, light wear; Frets: mild wear to first position; Hardware: good; Case: original hard case; Overall condition: good £300-500

192.

1987 Fender Stratocaster Plus electric guitar, made in USA; Body: graffiti yellow finish; Neck: maple; Frets: light wear to first position and minor tarnishing; Hardware: good; Case: original hard case; Weight: 3.53kg; Overall condition: excellent

*Singleownerfromnew.ThisearlyFenderStratocasterPlusfeatures thetype1splitrollernutandararegraffitiyellowfinish £1500-2000

193.

2013 C.F Martin D12X1AE twelve string left-handed electro-acoustic guitar, made in Mexico; Body: HPL mahogany; Top: solid spruce; Neck: HPL; Fretboard: composite; Frets: good; Hardware: good; Case: Gator hard case; Overall condition: good £300-400

182 (See page 32)

183 (See page 32)

188

189

190 (See page 37)

192 (See page 37)

194.

Ozark 3515 single cone left-handed resonator guitar within Stagg hard case

£200-300

195.

Fender Stratocaster STB-67L Reissue left-handed electric guitar, made in Japan (1986-1987); Body: three-tone sunburst finish, some finish clouding, various dings and other marks; Neck: maple; Fretboard: maple; Frets: light wear; Electrics: working, replacement switch; Hardware: good; Case: generic oblong hard case; Weight: 3.76kg; Overall condition: good for age

£700-900

196.

1974 Gibson Twentieth Anniversary Les Paul Custom left-handed electric guitar, made in USA; Body: cherry sunburst finished maple top upon mahogany pancake body, buckle scratching to back and other various dings, light marks to top; Neck: cherry sunburst finished mahogany, surface wear throughout; Fretboard: ebony with pearl block position markers; Frets: good, refret; Electrics: working, replacement Gibson pickups; Hardware: replacement stop bar and bridge, top dowelled around bridge posts; Case: Just In Case hard case; Weight: 4.41kg; Overall condition: good for age

£2500-3500

197.

2003 Epiphone Les Paul Standard electric guitar, made in Korea; Body: two-tone sunburst finished maple top upon dark back, minor dings to back; Neck: good; Fretboard: rosewood with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Case: gig bag; Weight: 3.90kg; Overall condition: good

£200-400

198.

2010 Epiphone Les Paul Custom electric guitar, made in China; Body: white finish; Neck: good; Fretboard: ebony with pearl block position markers; Frets: tarnishing throughout; Electrics: working; Hardware: generally good, some loss to gold plating; Case: original hard case; Weight: 3.17kg; Overall condition: good

£200-400

196

199 (See page 39)

199.

1991 Alembic Essence 4 bass guitar, made in USA; Body: custom colour red; Neck: good, neck through; Fretboard: ebony; Frets: good; Electrics: working; Hardware: Case: gig bag; Weight: 4.00kg; Overall condition: very good

£2000-3000

200.

Jackson Telly electric guitar, made in USA, circa 1987; Body: black finish, various minor dings and surface marks; Neck: maple; Fretboard: rosewood with pearl dot position markers; Frets: good; Electrics: working; Hardware: generally good, some tarnishing to Floyd rose; Case: fitted hard case; Weight: 4.10kg; Overall condition: good for age

£1500-2000

201.

2005 Gretsch Nashville G6120DSW hollow body electric guitar, made in Japan; Body: orange finish with G Brand; Neck: good; Fretboard: rosewood with cowboy block position markers; Frets: good; Electrics: working; Hardware: generally good, some loss to gold plating; Case: original hard case with certificate and tags; Weight: 3.16kg; Overall condition: very good

£1000-1500

202.

2004 Hofner Verythin John Stowell Model electric guitar, made in Germany; Body: natural finished maple back and sides and spruce top; Neck: maple; Fretboard: ebony with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 2.62kg; Overall condition: very good

£800-1200

203.

1977 K. Yairi YW-1000 acoustic guitar, made in Japan; Back and sides: coral rosewood, minor marks; Top: natural spruce, various minor dings and scuffs; Neck: mahogany, minor dings; Fretboard: ebony with hex abalone position markers; Frets: light wear; Hardware: good; Case: original hard case; Overall condition: good for age

£700-1000

204.

Yamaha NX Series NCX900FM electro-acoustic nylon string guitar, made in China; Back and sides: maple; Top: spruce; Neck: nato; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original gig bag; Overall condition: very good

£300-400

205.

2022 Epiphone ES-339 semi-hollow body electric guitar, made in China; Body: cherry red finished maple; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Weight: 3.48kg; Overall condition: very good

£200-300

200

206.

2016 Paul Reed Smith (PRS) SE Custom 24 electric guitar, made in Korea; Body: sunburst finish maple top upon brown mahogany back; Neck: mahogany; Fretboard: rosewood with birds in flight position markers; Frets: good; Electrics: working; Hardware: good, missing trem arm; Case: original gig bag; Weight: 3.68kg; Overall condition: very good

£350-450

207.

2019 Epiphone ES Collection Uptown Kat semi-hollow body electric guitar, made in China; Body: ruby red metallic finished top with gold back; Neck: good; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Weight: 3.35kg; Overall condition: very good

£250-350

208.

2006 Breedlove Atlas Series AC25/SM electro-acoustic guitar; Back and sides: mahogany; Top: natural spruce; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Case: hard case; Overall condition: very good

£250-350

209.

Furch Vintage 1 OOM-SM electro-acoustic guitar, made in Czech Republic; Back and sides: mahogany; Top: natural spruce; Neck: mahogany; Fretboard: ebony; Frets: good; Case: original hard case; Overall condition: as new

£1000-1200

210.

Modern Vintage MVJ4-66 bass guitar, made in Korea; Body: shoreline gold finish; Neck: roasted maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good, missing pickup cover and finger rest; Case: Tiger gig bag; Weight: 4.22kg; Overall condition: very good

£400-600

211.

2012 Ernie Ball Music Man Silhouette electric guitar, made in USA; Body: black finish, minor surface marks; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: original hard case and papers; Weight: 3.32kg; Overall condition: very good

£600-800

212.

2020 Epiphone Firebird electric guitar, made in China; Body: twotone sunburst finish, a few light marks; Neck: good; Fretboard: rosewood with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Case: Stagg hard case; Weight: 3.35kg; Overall condition: very good

£300-400

213.

2021 Epiphone B.B. King Lucille electric guitar, made in China; Body: white finish; Neck: good; Fretboard: ebony with pearl block position markers; Electrics: working; Hardware: good; Case: original gig bag; Weight: 4.04kg; Overall condition: very good

£300-400

216 (See page 41)

217 (See page 41)

218 (See page 41)

219 (See page 41)

214.

2023 Chapman Guitars ML3 Pro Traditional electric guitar, made in Korea; Body: red metallic finish, a few light surface marks to back; Neck: roasted maple; Fretboard: roasted maple; Frets: good; Electrics: working; Hardware: good; Case: original shipping box; Weight: 3.33kg; Overall condition: good £200-300

215.

2016 Shergold Masquerader SM11 electric guitar, made in Indonesia; Body: see-through blonde, large chip to bass edge; Neck: rosewood; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Weight: 3.29kg; Overall condition: good £200-400

216.

1973 C.F Martin D-35 acoustic guitar, made in USA; Back and sides: Indian rosewood, small repaired hairline to bass side lower bout; Top: natural spruce, repair to treble side of lower bout with some refinishing, large patch of wear to treble side of bridge below pickguard, small repair to binding at treble side lower bout; Neck: mahogany, wear to finish to middle centre, vacant strap button hole to treble side of neck heel; Fretboard: ebony; Frets: good, refret; Electrics: working, under-saddle transducer installed and wired through end pin; Hardware: good; Case: Calton hard case; Overall condition: fair £1800-2200

217.

1998 Fender Eric Clapton Signature Blackie Stratocaster electric guitar, made in USA; Body: black finish, light surface marks; Neck: maple; Fretboard: maple, some clouding to lacquer around dot position markers; Frets: light wear; Electrics: working; Hardware: generally good, missing trem arm; Case: Fender light tweed hard case; Weight: 3.74kg; Overall condition: good £800-1200

218.

1975 Fender Stratocaster electric guitar, made in USA; Body: threetone sunburst finish, finish rubbing to contour edge and body end, various minor dings and surface marks; Neck: maple, minor dings; Fretboard: rosewood, surface wear; Frets: worn; Electrics: working, replacement potentiometers, three-way switch, black bottom staggered pickups; Hardware: replacement Schaller tuners, replacement strap locks, missing trem arm; Case: non-original hard case; Weight: 3.44kg; Overall condition: good for age

£2000-3000

219.

Gibson Hummingbird Custom acoustic guitar, made in USA, circa 1974; Back and sides: cherry finished mahogany, surface scratches and dings including minor buckle rash to back; Top: natural spruce, small repaired hairline to lower bout with slight impression, further marks and surface wear; Neck: mahogany, minor dings and light wear to edges; Fretboard: rosewood; Frets: visible surface wear throughout; Hardware: good; Case: original hard case; Overall condition: good for age

£2000-3000

220

220.

223 (See page 42)

1977 Fender Telecaster electric guitar, made in the USA; Body: natural finished single piece ash body, light surface buckle scratching to back, further minor dings and marks; Neck: maple, minor dings; Fretboard: rosewood; Frets: light wear throughout; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.18kg; Overall condition: good

£1200-1800

221.

2020 Gretsch Roots Collection G9201 resonator guitar, handcrafted in China, Body: some scratching on back to lower section and several small dents to lower bout along back edge; Neck: good; Fretboard: rosewood; Frets: generally good, some minor scratching; Hardware: good; Weight: 3.92kg; Overall condition: good

£200-300

222.

2013 Gibson SG Tribute electric guitar, made in USA; Body: cherry finish, scratching and other scuffs throughout; Neck: mahogany, various dings; Fretboard: rosewood with pearl crown position markers; Frets: light wear; Electrics: working; Hardware: later fitted Bigsby vibrato; Case: hard case; Weight: 3.20kg; Overall condition: fair

£400-600

223.

2016 Gibson Pete Townshend 1976 Les Paul Deluxe electric guitar, made in USA; Body: gold top finish upon mahogany body, light checking to treble side top; Neck: mahogany; Fretboard: rosewood with pearl crown position markers; Frets: light tarnishing; Electrics: working; Hardware: good; Case: original hard case with papers; Weight: 4.54kg; Overall condition: very good

*Fromalimitedrunof150guitarsproduced,recreatingthespecof PeteTownshendsiconic1976GibsonLesPaulDeluxe

£2000-3000

224.

2015 Gibson Les Paul Deluxe electric guitar, made in USA; Body: cherry finished maple top upon mahogany body; Neck: mahogany; Fretboard: rosewood with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing papers and robot tuner PSU; Weight: 4.49kg; Overall condition: very good

£900-1100

225.

1980s Daion Mugen Mark I acoustic guitar, made in Japan; Body: Mahogany; Top: Cedar; Neck: Mahogany; Fretboard: Rosewood; Frets: good; Overall condition: good

£200-300

226.

1972 Gibson SG Deluxe electric guitar, made in USA; Body: cherry finished mahogany, a few minor marks; Neck: mahogany; Fretboard: rosewood with pearl block position markers; Frets: lightly tarnished throughout; Electrics: working; Hardware: generally good; Case: original hard case enclosing Gibson tag, original strap and product catalogue; Weight: 3.32kg; Overall condition: very good

£1400-1600

227.

1930 National Triolian resonator guitar, made in USA; Body: walnut burst finish, various minor dings; Neck: sunburst finished maple; Fretboard: ebony with pearl dot position markers; Frets: light wear; Hardware: good; Case: modern National Resophonic hard case; Overall condition: very good

*PurchasedbythevendorintheUSAwiththeguidanceofresonator specialistMarcSchoenberger,whoalsoprofessionallysetuptheguitar priortoshippingtotheUK

£2500-3500

228.

2016 Fender Aerodyne Stratocaster electric guitar, made in Japan; Body: black finish with white bound top, a few light surface marks; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original gig bag; Weight: 3.30kg; Overall condition: very good

£500-700

229.

2020 Gibson L-00 Studio Walnut electro-acoustic guitar, made in USA; Back and sides: walnut; Top: tobacco sunburst finished spruce; Neck: mahogany; Fretboard: walnut; Frets: good; Electrics: working; Case: original hard case; Overall condition: excellent £1000-1500

230.

2002 Gibson ES-135 semi-hollow body electric guitar, made in USA; Body: cherry red finished maple; Neck: maple; Fretboard: rosewood with pearl dot position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.53kg; Overall condition: very good £1000-1500

231.

1961 Wandre Spazial electric guitar, made in Italy; Body: candle smoke blue finish, minor scratching to back, minor scuffs and dings to edges; Neck: generally good, light stress marks to centre; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good, minor tarnishing to metal hardware, one tuner head missing outer ring; Case: soft bag; Weight: 2.58kg; Overall condition: good for age £2000-3000

232.

2011 Fender Player Stratocaster, made in Mexico; Body: Polar White finish, some discolouration around the horns; Neck: Maple, good; Fretboard: Pau Ferro; Frets: Good, some dressing required; Electrics: working; Hardware: good: Weight: 3.51kg; Case: Fender soft bag; Overall condition: Good

£300-400

233.

Framus Strato Deluxe 5/168-54 electric guitar, made in Germany, circa 1965 ; Body: sunburst finish, some marks and dings to edges; Neck: multi-layer plywood, some marks; Fretboard: rosewood; Frets: good; Electrics: working, however would benefit from a clean to reduce noise and jack intermittence; Hardware: good; Case: fitted hardcase; Weight: 3.88kg; Overall condition: Good for age

£400-500

234.

2011 ESP Edwards E-SA-125 LTS semi-hollow body electric guitar, made in Japan; Body: black finish solid maple, light surface marks to back; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.54kg; Overall condition: very good

£500-800

235.

1983 Fender Dan Smith two knob Stratocaster electric guitar, made in USA; Body: Siena sunburst finished alder, a few light marks although generally very good for age; Neck: maple; Fretboard: maple; Frets: light tarnishing; Electrics: working; Hardware: good; Case: Ibanez hard case; Weight: 3.42kg; Overall condition: very good

£800-1200

236.

Custom Build Tele Thinline type electric guitar; Body: natural finish semi-hollow English ash body made by Robin Day 2012, minor dings to edges; Neck: 2011 G&L Asat Classic twenty-two fret maple board neck; Electrics: working, Fender Custom Shop Texas Special pickups with four-way selector; Hardware: good, G&L trem bridge, Gotoh tuners and other miscellaneous hardware; Case: Fender gig bag; Weight: 3.81kg; Overall condition: very good £300-500

237.

Fender Telecaster electric guitar, made in USA, circa 1972; Body: blonde finish, blemishes to edges, further minor dings throughout; Neck: maple, 1972 date stamp; Fretboard: rosewood, mild wear to first position; Frets: wear throughout; Electrics: working, potentiometers dating to 1966; Hardware: good; Case: generic oblong hard case; Weight: 3.89kg; Overall condition: good for age £2500-3000

238.

1991 Gibson MIII Standard, made in USA; Body: Candy Apple Red finish, checking and marks throughout; Neck: Mahogany, good with some marks in first position; Fretboard: Maple, good with minor marks in first position; Frets: good; Electrics: working, however neck switch position appears to be non functional with the mini switch engaged in position 1; Hardware: good; Weight: 3.44kg; Case: Original hardcase; Overall condition: good

£800-1200

239.

1960s Crucianelli Elite 4V, made in Italy; Body: white pearloid upon black back; Neck: twisted; Fretboard: rosewood, some marks: Frets: good; Electrics: working; Hardware: good; Weight: 3.14kg; Overall Condition: good for age

£400-600

240.

2007 Valley Arts T Series Custom Pro electric guitar, made in USA; Body: natural finish; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good, some loss to gold plating and minor tarnishing; Case: original hard case and tags; Weight: 3.90kg; Overall condition: very good

£600-800

241.

2009 Fender American Standard Stratocaster electric guitar, made in USA; Body: Olympic white; Neck: Maple, good; Frets: good; Electrics: working; Hardware: good, replacement pickguard; Weight: 3.39kg; Case: original hardcase; Overall condition: Very good

£600-800

242.

1999 Fender American Deluxe Stratocaster electric guitar, made in USA; Body: natural finish, a few minor dings; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 4.04kg; Overall condition: very good

£800-900

238

243 (See page 45)

244 (See page 45)

245 (See page 45)

243.

1982 Fender Walnut Strat electric guitar, made in USA; Body: natural walnut, various minor surface scratches and dings; Neck: walnut, various minor finish dings; Fretboard: walnut; Frets: generally good, light wear; Electrics: working; Hardware: generally good, a few minor tarnishing spots; Case: original hard case; Weight: 4.27kg; Overall condition: good for age £1500-2000

244.

1979 Fender 25th Anniversary Stratocaster electric guitar, made in USA; Body: Porsche silver metallic finish, some greening to edges otherwise very good; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing original certificate of merit, manual and case candy; Weight: 4.66kg; Overall condition: very good £1000-2000

245.

1979 Fender 25th Anniversary Stratocaster electric guitar, made in USA; Body: discoloured white flake finish, factory finish deterioration with cracking allover and areas of original finish missing; Neck: maple, light wear to edges; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: original hard case with certificate of merit and case candy; Weight: 4.25kg; Overall condition: fair

*The1979Fender25thAnniversaryStratocasteriswellknownfor itssignificantandwell-documentedfinishissuesduringtheinitial productionrunofapproximately500instruments.Theoriginal pearlescent,water-basedwhitefinishprovedunstable,resultingin widespreadproblemsandasubsequentrecall.Whilemanyguitars werereturnedtoFenderforrefinishing,examplessuchasthisone thatwereneverreturnedforcorrectiondoexist.Followingthese earlyissues,Fenderabandonedthewhitefinishinfavourofa metallic‘PorscheSilver’(commonlyreferredtosimplyasSilver)for theremainderofthe10,000-unitproductionrun.

£1000-1500

246.

1979 Fender 25th Anniversary electric guitar, made in USA; Body: white finish with original factory finish flaw, finish cracked with significant loss to edges; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: original hard case with certificate of merit, manual and case candy; Weight: 4.39kg; Overall condition: fair

£1000-1500

247.

2012 Epiphone Custom Shop Allen Woody Signature Limited Edition bass guitar; Body: wine red finished maple top mahogany; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.58kg; Overall condition: very good

£250-350

248.

Custom Build Tele type electric guitar guitar; Body: finished NS Custom Guitars ash body; Neck: Mighty Mite 12" radius neck with twenty-one fret maple fingerboard; Electrics: working, Alnico 3 pickups with three position selector and pull switch tone pot; Hardware: generally good, Wilkinson bridge plate, compensated brass saddles, Wilkinson Deluxe tuners and reverse control plate; Weight: 3.99kg; Overall condition: good

£300-500

249.

Custom Build Thinline Tele style electric guitar; Body: tobacco sunburst finished Thinline style ash body; Neck: Axes R Us 12" radius neck with twenty-one fret maple board; Electrics: working, Tone Rider Hot Classic pickups with four-way selector and push-pull phase switch to tone pot; Hardware: custom made abalone effect pickguard, half bridge plate with compensated brass saddles, Wilkinson Deluxe tuners; Weight: 3.64kg; Overall condition: good

£300-500

246

255 (See page 46)

250.

2009 Epiphone Custom Shop Les Paul Standard Limited Edition electric guitar; Body: worn cherry finished mahogany, a few light marks; Neck: mahogany; Fretboard: rosewood with crown pearl position markers; Frets: good; Electrics: working; Hardware: good; Weight: 4.03kg; Overall condition: very good

£200-300

251.

1930s Len Shevill Patent combination tenor guitar, made in England; Back and sides: mahogany, scratches to back and other minor marks, binding pinned at waist; Top: natural spruce, various cracks, revarnishing; Neck: good; Fretboard: ebony; Frets: light wear; Hardware: good; Case: period hard case; Overall condition: fair

*LenShevillwasabanjotutorandbluegrassplayerbasedinMaida Vale,London.Heoftendesignedinstrumentsandhadthemmade byJ.GAbbottofLondon.Thetailpieceisthesameasfoundon manyWindsorbanjossuchasthePopularM1Modelof1922.An unusualfeatureonthisguitaristhetwoadditionaldronestrings

£300-500

252.

Peavey BXP Grind 5 five string bass guitar, made in Vietnam; Body: hardwood, various dings throughout; Neck: five piece neck with through-neck design; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Tourtech gig bag; Weight: 4.14kg; Overall condition: good

£200-300

253.

1930s Belltone acoustic guitar; Body: two-tone sunburst finished maple back and sides with spruce arched top, repair to top centre seam, scratches and marks throughout; Neck: maple; Fretboard: ebony; Frets: light wear; Hardware: generally good, tarnishing to metal parts, replacement bridge; Case: original hard case; Overall condition: fair

£150-250

254.

1950s Emile Grimshaw electro-acoustic D-hole guitar, made in England; Back and sides: maple, many scratches and marks throughout; Top: natural spruce, repaired cracks and bridge work; Neck: maple; Fretboard: rosewood; Frets: good, refret; Electrics: working; Hardware: replacement tuners; Case: Rockbag by Warwick gig bag; Overall condition: fair

£250-300

255.

Collings 290 electric guitar, made in USA; Body: cherry finished mahogany, light checking and minor marks; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.20kg; Overall condition: very good

£1200-1600

256.

2022 Epiphone SG Special electric guitar, made in China; Body: Pelham blue metallic finish; Neck: good; Fretboard: rosewood with dot position markers; Frets: good; Electrics: working; Hardware: good; Case: fitted hard case; Weight: 3.03kg; Overall condition: very good

£150-250

257.

2001 Rickenbacker 620 twelve string electric guitar, made in USA; Body: Fireglo finished maple; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.74kg; Overall condition: very good

£1000-1500

258.

Alvarez ABT60 baritone acoustic guitar, made in China; Back and sides: mahogany; Top: natural spruce; Neck: mahogany; Fretboard: laurel; Frets: good; Hardware: good; Overall condition: very good

£200-300

259.

2021 Art & Lutherie Roadhouse Q-Discrete parlour size electroacoustic guitar, made in Canada; Body: high gloss indigo burst laminated wild cherry back and sides and solid spruce top; Neck: silver leaf maple; Fretboard: rosewood; Frets: good; Electrics: working, QDiscrete pre-amp with volume and tone on the body ; Hardware: good; Case: fitted gig bag; Overall condition: very good

£300-400

260.

2022 Magneto U-One Series US-2300 electric guitar; Body: red finish with quilted top; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: generic oblong hard case; Weight: 3.59kg; Overall condition: very good

£150-250

261.

Ovation Legend 1867AX electro-acoustic guitar, made in Korea; Body: Lyrachord bowl back with black finished top; Neck: mahogany; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Overall condition: very good

£250-350

262.

2018 Fender Deluxe Telecaster Thinline electric guitar, made in Mexico; Body: three-tone sunburst finish, impact lacquer damage to back edge, various other minor marks; Neck: maple; Fretboard: Pau Ferro; Frets: good; Electrics: working; Hardware: good; Weight: 3.08kg; Overall condition: good

£400-500

263.

Yamaha RBX JM2 John Myung six string bass guitar, made in Taiwan; Body: dark purple metallic, various dings to front and edges; Neck: satin black finish; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: soft bag; Weight: 4.67kg; Overall condition: good

£200-400

264.

2010 Fender Highway One Precision bass guitar, made in USA; Body: honey blonde satin nitrocellulose finished alder, finish rubbing to arm contour and bottom edge; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Fender gig bag; Weight: 4.20kg; Overall condition: good

£500-700

265.

1985 Fender Performer bass guitar, made in Japan; Body: burgundy mist metallic finish, finish loss/blemishing to lower edge around jack socket with lacquer cracking to front, further dings and marks; Neck: maple, visible wear throughout and various minor dings; Fretboard: rosewood; Frets: light wear; Electrics: working although with some scratching to potentiometers; Hardware: missing input jack back panel, two control knobs missing tips; Case: Hiscox hard case enclosing original tag; Weight: 3.69kg; Overall condition: fair

£1000-1500

266.

1991 Gibson Les Paul LPB-2 bass guitar, made in USA; Body: trans red finish, light checking throughout, various scratches, dings to edges; Neck: mahogany; Fretboard: ebony with pearl crown position markers; Electrics: working; Hardware: generally good, lower E with Gotoh drop tuner fitted; Case: Hiscox hard case; Weight: 3.96kg; Overall condition: good for age

£800-1200

267.

1984 Washburn Bantam double neck fretted/fretless bass guitar; Body: matt black finish, various dings and scuffs otherwise good for age; Necks: good; Fretboards: rosewood; Frets: good; Electrics: working, replacement Neutrik jack; Hardware: good; Case: original hard case; Weight: 5.76kg; Overall condition: good for age

£800-1200

268.

1979 Gibson Les Paul Standard electric guitar, made in USA; Body: ebony finish, surface scratches and dings throughout, finish rubbing to upper back edge, buckle scratching to back; Neck: finish wear to edges, minor dings; Fretboard: rosewood with pearl crown position markers; Frets: light wear; Electrics: working; Hardware: good; Case: original protector hard case (back latch missing); Weight: 4.76kg; Overall condition: good for age

£2000-2500

269.

1980 Gibson Firebrand ES-355-S Standard, made in USA; Body: Mahogany, some play wear near bridge pickup and buckle wear to back; Neck: mahogany, good; Fretboard: Rosewood; Frets: good, some wear; Electrics: working, some crackle in pots; Hardware: good; Weight: 4.05kg; Case: Brandoni Custom gig bag

£800-1200

270.

1960s Eko Florentine 360/V2, made in Italy; Body: sunburst finish, dings and marks throughout; Neck: good; Fretboard: rosewood, many across grain scratches; Frets: wear throughout: Electrics: nonfunctional; Hardware: generally good, missing trem arm and pickguard; Weight: 2.41kg

£200-300

271.

2015 Taylor 614CE electro-acoustic guitar, made in USA; Back and sides: figured maple; Top: natural spruce, a few minor marks to treble side; Neck: mahogany; Fretboard: ebony; Frets: light wear to first position; Electrics: working; Hardware: good; Case: original hard case enclosing papers; Overall condition: very good £1000-1500

272.

1973 Fender Hardtail Stratocaster electric guitar, made in USA; Body: three-tone sunburst finish, finish wear to arm contour and back edge, blemishes to edges, buckle rash and other minor dings throughout; Neck: maple, minor dings, 1973 date stamp; Fretboard: rosewood, wear to first position; Frets: worn; Electrics: working, replacement five-way switch and one replacement potentiometer, other potentiometers dating to 1973; Hardware: good; Case: non-original light tweed hard case; Weight: 3.26kg; Overall condition: good for age £1500-2000

273.

1970s Epiphone ET-290 Crestwood electric guitar, made in Japan; Body: sunburst finish, a few dings and marks throughout; Neck: maple, bolt-on; Fretboard: rosewood; Frets: some wear and tarnishing; Electrics: working; Hardware: good; Weight: 3.19; Case: fitted harcase; Overall condition: good for age

£250-350

274.

1999 Kramer Striker Custom FR422 HSS electric guitar, made in Korea; Body: Metallic red; Neck: maple, good, small ding to rear near heel; Fretboard: rosewood, good; Frets: good; Electrics: Working; Hardware: good; Weight: 3.38kg; Case: Gigbag; Overall Condition: very good

£200-300

275.

1962 Welson solid body electric guitar, made in Italy; Body: patterned celluloid wrapped body, minor marks and scuffs; Neck: good, a few minor dings; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: generally good, minor tarnishing to metal parts; Weight: 3.06kg; Overall condition: good

£350-450

276.

1962 Welson solid body electric guitar, made in Italy; Body: patterned celluloid wrapped body, minor scuffs and marks; Neck: generally good, a few minor marks; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: generally good, some tarnishing to metal parts; Weight: 3.13kg; Overall condition: good for age

£350-450

277.

1962 Welson solid body electric guitar, made in Italy; Body: patterned celluloid wrapped body, vacant screw hole to back, further minor scuffs and marks; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good, minor tarnishing to metalwork; Weight: 3.13kg; Overall condition: good for age

£350-450

278.

1962 Welson short scale bass guitar, made in Italy; Body: patterned celluloid wrapped body, some discolouration, marks and other minor imperfections; Neck: good; Fretboard: rosewood; Frets: mild wear; Electrics: working, minor jack intermittence; Hardware: generally good, some tarnishing to metalwork; Weight: 2.82kg; Overall condition: good for age

£400-600

279.

1962 Welson baritone solid body electric guitar, made in Italy; Body: patterned celluloid wrapped body, minor scuffs and marks to back; Neck: good; Fretboard: rosewood; Frets: good, mild wear to first position; Electrics: working; Hardware: generally good, some tarnishing to metalwork; Weight: 3.26kg; Overall condition: good for age

£400-600

280.

2006 SDGR Sound Gear by Ibanez SR905 five string bass guitar, made in Korea; Body: brown finished figured maple, a few minor marks; Neck: five piece maple and bubinga; Fretboard: rosewood with abalone position markers; Frets: good; Electrics: working; Hardware: good; Case: fitted oblong hard case; Weight: 4.13kg; Overall condition: good

£300-400

271

272

281.

2002 Fender American Deluxe Zone Bass guitar, made in USA; Body: quilted maple front and back with alder core; Neck: maple; Fretboard: rosewood with abalone dot position markers; Frets: good; Electrics: assumed working although battery tabs in need of replacement/attention; Hardware: good; Case: original hard case; Weight: 3.89kg; Overall condition: very good

£1000-1200

282.

1965 Levin LM-26 Goliath acoustic guitar, made in Sweden; Back and sides: sunburst finished maple, checking throughout, hairline to bass side waist; Top: sunburst finished spruce, light checking, various scratches and other marks; Neck: mahogany; Fretboard: rosewood, groove wear to first position; Frets: good; Hardware: replacement tuners; Case: original hard case; Overall condition: good for age

£500-700

283.

1997 Lowden F24 acoustic guitar, made in Ireland; Back and sides: figured maple, a few minor dings; Top: natural spruce, minor marks and play wear; Neck: maple; Fretboard: ebony; Frets: generally good, mild groove wear to first position; Hardware: good; Case: original hard case; Overall condition: good for age

£1500-2000

284.

1966 Epiphone Riviera E360TD hollow body electric guitar, made in USA; Body: sunburst finish, light checking and other minor marks; Neck: mahogany, back of head refinished, various minor dings; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: SKB hard case; Weight: 3.63kg; Overall condition: good

£2500-3500

285.

2022 Epiphone Les Paul Special electric guitar, made in China; Body: TV yellow finish; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Tourtech soft bag; Weight: 3.59kg; Overall condition: excellent

£200-300

286.

1990s Gordon Smith Graduate electric guitar, made in England; Body: black finished mahogany, light buckle scratching to back, various dings and scratches to edges; Neck: satin black, light marks; Fretboard: rosewood; Frets: good; Electrics: working, replacement Vanson Alnico II pickups; Hardware: good; Case: hard case; Weight: 4.16kg; Overall condition: good

£400-600

287.

1978 Morris FG-37 acoustic guitar, made in Japan; Back and sides: mahogany, light surface marks; Top: sunburst finished spruce, minor dings; Neck: mahogany; Fretboard: rosewood; Frets: good; Hardware: good; Case: hard case; Overall condition: very good

£200-400

288 (See page 50)

288.

1991 Gibson Chet Atkins CEC electric nylon string guitar, made in USA; Body: deep wine red finished mahogany body with spruce top, light checking, dings and other marks; Neck: mahogany, a few light marks; Fretboard: rosewood; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.46kg; Overall condition: good

£1000-1500

289.

2025 Fender Player II Stratocaster Limited Edition electric guitar, made in Mexico; Body: Moonlight Drive finish, minor blemish to bass hand side; Neck: roasted maple; Fretboard: slab rosewood; Frets: good; Electrics: working; Hardware: good; Weight: 3.59kg; Overall condition: good

£350-450

290.

Casio Guitar Synth PG-380 electric guitar, made in Japan; Body: black with some marks to edges; Neck: Maple, good; Fretboard: Ebony, good; Frets: Good; Electrics: Working (requires 9v power) although no programme card included; Hardware: generally good, missing locking nut clamping blocks; Weight: 3.70kg; Overall Condition: good for age

£300-400

291.

1983 Gibson J25 acoustic guitar, made in USA; Back and sides: synthetic bowl back; Top: sunburst finished spruce, slight lifting at bridge; Neck: mahogany; Fretboard: rosewood; Frets: good; Hardware: good; Overall condition: good

£400-600

292.

1994 National Reso-Phonic Style O resonator guitar, made in USA; Body: polished nickel brass with Hawaiian etching, some rubbing to waist (bass edge); Neck: finished maple, good; Fretboard: Ebony; Frets: good; Hardware: good with some tarnishing, Case: fitted hardcase

£1500-2000

293.

Crafters of Tennessee Tut Taylor Virginian Resophonic single cone resonator guitar, made in USA, Back and sides: Maple; Top: Sunburst finished Maple; Neck: Maple, slight up-bow; Fretboard: Ebony; Hardware: good; Case: fitted hardcase

£1400-1600

294.

2024 Sire Marcus Miller U5 short scale left-handed bass guitar, made in Indonesia; Body: sunburst finish figured maple top upon alder body; Neck: satin maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Weight: 3.69kg; Overall condition: very good

£200-250

295.

2013 Squier by Fender Vintage Modified Bass VI electric guitar, made in Indonesia; Body: sunburst finish, a few light dings; Neck: maple; Fretboard: rosewood with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Weight: 4.56kg; Overall condition: good

£200-400

296.

2004 Epiphone Jack Casady semi-hollow body bass guitar, made in Korea; Body: gold top finish with dark back, many surface marks to back and a few minor marks to top; Neck: good; Fretboard: rosewood with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Weight: 2.78kg; Overall condition: good

£300-400

297.

2015 Guild S-100 electric guitar, made in Korea; Body: cherry finish mahogany; Neck: mahogany; Fretboard: rosewood with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: Guild hard case; Weight: 3.55kg; Overall condition: very good

£200-300

298.

2003 C.F Martin 000-18MC Martin Carthy Signature Limited Edition acoustic guitar, made in USA; Back and sides: mahogany with shell binding; Top: natural spruce; Neck: mahogany with V profile; Fretboard: ebony with abalone dot position markers; Frets: good; Hardware: good; Case: original hard case with papers; Overall condition: very good

*ThesignatureguitarforBritishfolkmusicianMartinCarthy.This limitededitionrunproducedonlyeighty-fourinstrumentsintotal £2000-3000

299.

1996 Gibson ES-175 hollow body electric guitar, made in USA; Body: sunburst finished maple, a few very light surface marks otherwise very good; Neck: mahogany; Fretboard: rosewood with pearl split block position markers; Frets: good; Electrics: working; Hardware: generally good, light tarnishing to metalwork; Case: original hard case; Weight: 3.32kg; Overall condition: very good

£2000-2500

300.

2024 Gretsch Streamliner G2622 left-handed semi-hollow body electric guitar, made in Indonesia; Body: gunmetal metallic top upon brown finished back; Neck: good; Fretboard: rosewood with pearl thumb position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 2.85kg; Overall condition: very good

£250-350

301.

2005 Gretsch White Falcon G7594 hollow body electric guitar, made in Japan; Body: white finish with orange sparkle binding; Neck: good; Fretboard: ebony with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case with papers; Weight: 3.77kg; Overall condition: very good

£1500-2000

302.

1983 Yamaha SG1000 electric guitar, made in Japan; Body: cherry sunburst finished maple top upon mahogany body, lacquer clouding throughout most of finish, various minor marks and surface buckle scratching to back; Neck: mahogany; Fretboard: ebony with pearl position markers; Frets: good; Electrics: working; Hardware: generally good, typical loss to gold plating and minor tarnishing, missing reflector cap to one tone knob; Case: original hard case; Weight: 4.57kg; Overall condition: fair

£800-1200

303.

2018 Ibanez AS93FM-TCD semi-hollow body electric guitar, made in Indonesia; Body: red finish figured maple, a few light marks; Neck: three piece maple; Fretboard: ebony with pearl block position markers; Frets: good; Electrics: working; Hardware: generally good, typical loss to gold plating, missing pickguard; Weight: 3.25kg; Overall condition: good

£200-250

304.

2019 Ibanez Artcore Vintage AFV75-VAL hollow body electric guitar, made in Indonesia; Body: vintage amber burst finished maple, pen marks drawn around bridge position; Neck: good; Fretboard: rosewood with pearl block position markers; Frets: good; Electrics: working; Hardware: good, missing pickguard; Weight: 2.63kg; Overall condition: good

£200-300

305.

1981 Aria Pro II Gerry Cott Signature PE1000GC electric guitar, made in Japan; Body: blue metallic finish, various light dings and other scratches throughout; Neck: good; Fretboard: ebony with pearl split block position markers; Frets: light wear; Electrics: working; Hardware: good; Case: period leather soft bag; Weight: 3.93kg; Overall condition: good for age

£600-800

306.

1989 Yamaha MSG Custom electric guitar, made in Taiwan; Body: cherry red finished mahogany with figured maple top, a few light marks; Neck: good; Fretboard: rosewood with pearl position markers; Frets: good; Electrics: working; Hardware: good, some tarnishing to metal parts; Case: original hard case; Weight: 3.98kg; Overall condition: very good

£700-1000

307.

1978 Ibanez Artist 2622 Steve Miller electric guitar, made in Japan; Body: tobacco sunburst finished mahogany body with maple top, finish imperfections throughout including dings and blemishes, binding gassing and damage; Neck: various small dings; Fretboard: ebony with pearl and abalone block position markers; Frets: good; Electrics: working, replacement bridge pickup; Hardware: typical tarnishing and loss to gold plating; Case: non-original hard case; Weight: 4.25kg; Overall condition: fair

£600-800

308.

1979 Ibanez Musician MC500 electric guitar, made in Japan; Body: natural finish ash and maple, minor surface marks; Neck: maple and walnut; Fretboard: ebony; Frets: good; Electrics: working; Hardware: replacement Schaller tuners, loss to gold plating on bridge and tailpiece; Case: non-original hard case; Weight: 4.80kg; Overall condition: good for age

£800-1000

309.

1979 Ibanez Artist 2622 Steve Miller electric guitar, made in Japan; Body: tobacco sunburst finished maple top upon mahogany body, various dings and scratches throughout; Neck: three piece, minor blemishes; Fretboard: ebony with pearl and abalone block position markers; Frets: generally good, unusual glue residue notches to treble side of some frets; Electrics: working; Hardware: replacement Schaller tuners, typical tarnishing and gold plating loss to metal parts; Weight: 4.11kg; Overall condition: good for age

£600-800

308

311 (See page 53)

(See page 53)

310.

1980 Gordon Smith Custom fretless bass guitar, made in England; Body: rosewood front and back with maple core, vacant strap button holes to body horns; Neck: maple and rosewood through-neck; Fingerboard: ebony; Electrics: working; Hardware: good; Case: soft bag; Weight: 5.83kg; Overall condition: very good

**Aone-offcustomordermadefortheoriginalownerAlecJohnson, whorequestedaGibson335shapedfretlessbassguitar £600-800

311.

1983 Andrew Manson Magpie acoustic guitar, made in Crowborough Sussex; Back and sides: rosewood, surface scratches and minor dings throughout; Top: natural spruce with herringbone banding, minor scuffs, small hairline to bridge plate through pins; Neck: mahogany; Fretboard: ebony; Frets: good; Case: Spider hard case; Overall condition: fair £1000-1500

312.

1980 Aria Pro II PE1000 electric guitar, made in Japan; Body: tobacco finished maple, minor dings and other surface imperfections; Neck: maple, a few minor dings; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Weight: 4.61kg; Overall condition: good £500-700

313.

1994 Paul Reed Smith McCarty Model #1 Test Run electric guitar, made in USA; Body: amber burst finished figured maple top upon cherry finished mahogany back; Neck: mahogany, inscribed 'McCarty Model #1 Test Run' to the back of the neck; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case with tags and papers, also including Dave Burrluck's The PRS Book updated edition; Weight: 3.56kg; Overall condition: very good

*AnearlyTestRunfortheMcCartymodelthatlaunchedin1994. Inscribed'McCartyModel#1TestRun'tothebackofthehead £2000-4000

314.

1980s Gordon Smith Gemini electric guitar, made in England; Body: sunburst finish pancake body; Neck: birds eye maple; Fretboard: birds eye maple; Frets: good; Electrics: working; Hardware: good; Case: old generic oblong hard case; Weight: 3.76kg; Overall condition: good

£600-800

315.

1980s Michael Vanden 335 style semi-hollow body electric guitar, made in UK; Body: tobacco sunburst finished figured maple, light surface dings, blemish/scuff to centre top; Neck: mahogany; Fretboard: ebony; Frets: generally good although some tarnishing to fret edges; Electrics: working; Hardware: good; Case: hard case; Weight: 3.87kg; Overall condition: good for age

£1500-2500

316.

1976 Ibanez Artist 2618 electric guitar, made in Japan; Body: brown sunburst finished maple top upon mahogany, various blemishes and dings; Neck: three-piece maple, minor dings; Fretboard: ebony with abalone dot position markers; Frets: brass refret; Electrics: working, replacement Seymour Duncan humbucker pickups; Hardware: generally good, typical loss to gold plating; Weight: 3.95kg; Case: original hard case; Overall condition: good for age

*Ararefirstyearexamplefeaturingtraditionaltypestopbar £600-800

317.

1977 Ibanez Professional 2671 Randy Scruggs electric guitar, made in Japan; Body: natural ash, light surface buckle markings and other minor dings to back; Neck: maple, a few minor dings; Fretboard: ebony with pearl vine inlay; Frets: light wear; Electrics: working; Hardware: good; Case: modern hard case; Weight: 4.54kg; Overall condition: very good

£800-1200

318.

1979 Ibanez Musician MC-500 electric guitar, made in Japan; Body: dark stain finished ash wings with maple core, minor dings and marks; Neck: five-piece maple and walnut; Fretboard: ebony with abalone dot position markers; Frets: good; Electrics: working; Hardware: generally good, typical tarnishing to gold plating; Case: original hard case; Weight: 4.43kg; Overall condition: good

£800-1200

319.

1988 Ovation 1719 Custom Legend electro-acoustic guitar, made in USA; Body: Lyrachord bowl back with natural spruce top, a few minor dings; Neck: mahogany with maple reinforcement; Fretboard: ebony with abalone position markers; Frets: good; Hardware: good; Case: Ovation hard case; Overall condition: very good

£400-600

320.

1998 Ovation 1869 Custom Legend electro-acoustic guitar, made in USA; Body: Lyrachord bowl back with natural spruce top; Neck: mahogany with maple reinforcement; Fretboard: ebony with abalone position markers; Frets: light wear to first position; Electrics: working; Hardware: good; Case: original hard case; Overall condition: very good

£400-600

321.

1978 Greco Speedway GO-1400 electric guitar, made in Japan; Body: dark stain finished ash top and back with maple core and maple centre, a few very small dings; Neck: maple and walnut; Fretboard: ebony with pearl ring position markers; Frets: good; Electrics: working; Hardware: good, some tarnishing and gold plating loss to metalwork; Weight: 4.62kg; Overall condition: bood

£700-1000

322.

2009 Adamas by Ovation 1781S electro-acoustic guitar, made in USA; Body: Lyrachord bowl back with black carbon top; Neck: mahogany with maple reinforcement; Fretboard: rosewood with boxwood position markers, light surface wear to first position; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Overall condition: very good

£1000-1500

323.

1981 Ibanez Musician MC500 electric guitar, made in Japan; Body: natural finished walnut with ash core, various small blemishes and dings otherwise very good for age; Neck: maple; Fretboard: ebony with pearl dot position markers; Frets: good; Electrics: working; Hardware: generally good, light gold plating loss; Case: original hard case; Weight: 4.51kg; Overall condition: good

£700-1000

324.

2008 Terry Docherty Mistral electro-acoustic guitar, made in Ashington, UK; Back and sides: rosewood, a few small dings; Top: natural cedar, a few minor dings; Neck: mahogany; Fretboard: ebony with pearl dot position markers; Frets: good; Electrics: working, LR Baggs pickups; Hardware: good; Case: Taylor hard case; Overall condition: good

£1000-1500

325.

1980s Yamaha L-20A acoustic guitar, made in Japan; Back and sides: Indian rosewood, many dings and surface scratches; Top: natural spruce, scuffs, dings and general play wear; Neck: mahogany, minor dings throughout; Fretboard: light play wear to first position; Frets: wear to first position including visible indents, minor sprouting throughout; Hardware: good; Case: compressed foam case; Overall condition: fair

£600-800

326.

See next page insert 327.

2005 Fender Custom Shop John Cruz Masterbuilt Limited Edition 1955 Stratocaster Relic electric guitar, made in USA; Body: two-tone sunburst finished ash, light relic; Neck: maple; Fretboard: maple relic; Frets: light wear; Electrics: working; Hardware: good; Case: original hard case with certificate of authenticity and other papers; Weight: 3.12kg; Overall condition: very good

£4500-5500

328.

2005 Paul Reed Smith (PRS) McCarty electric guitar, made in USA; Body: blue figured maple top upon gloss black back, minor scratches to top, a few minor dings to back edges; Neck: good; Fretboard: rosewood with aftermarket pearl and abalone dragon inlay; Frets: good, refret; Electrics: working; Hardware: good, replacement TonePros bridge, several pickup surround screws replaced; Case: original hard case; Weight: 4.16kg; Overall condition: good

£1500-2000

326.

2016 Gibson Custom Shop SJ-200 Gallery Limited Edition acoustic guitar, made in USA; Back and sides: three-piece koa and quilted maple back with abalone and herringbone inlay; Top: tobacco sunburst finished spruce; Neck: maple; Fretboard: ebony with continuous pearl inlay; Hardware: good; Case: original Cedar Creek Thermo hard case enclosing tags and papers; Overall condition: excellent

**OnlysixArtGallerySJ-200sweremadein2016byGibsonsMontanaCustomShop.ThisguitarisfittedwithaCarlosJuanacousticguitarpickup withitsoriginalboxincluded £10,000-20,000

327 (See page 54)

328 (See page 54)

329.

2017 Gibson Les Paul Classic Player Plus electric guitar, made in USA; Body: two-tone sunburst satin finished maple top upon satin mahogany back, a few light marks to back edges; Neck; mahogany, a few minor dings; Fretboard: Richlite with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case with papers; Weight: 4.46kg; Overall condition: very good

£1000-1200

330.

2022 Paul Reed Smith (PRS) SE Tonare P20 electro-acoustic guitar, made in China; Body: sunburst finish; Neck: good; Fretboard: ebony with birds in flight position markers; Frets: good; Electrics: working; Hardware: good; Case: original gig bag; Overall condition: very good

£200-300

331.

2004 Taylor 30th Anniversary 310 L30 acoustic guitar, made in USA; Back and sides: mahogany; Top: natural spruce; Neck: mahogany; Fretboard: ebony with boxwood position markers; Case: original hard case with papers; Overall condition: excellent £600-800

332.

2011 Ibanez Herman Li EGEN8 electric guitar, made in Indonesia; Body: natural finish, dings to front edge, surface scratches and scuffs to back; Neck: maple; Fretboard: rosewood with abalone position markers; Frets: good; Electrics: working; Hardware: generally good, some loss and tarnishing to gold plating; Weight: 3.14kg; Overall condition: good £400-500

333.

1997 Takamine Santa Fe PSF-45C electro-acoustic guitar, made in Japan; Back and sides: rosewood, buckle scratching to back along with other dings and minor imperfections; Top: cedar, various scuffs and blemishes; Neck: mahogany, various minor dings; Fretboard: rosewood; Frets: minor indent wear to first position; Electrics: working; Hardware: good; Overall condition: fair £400-500

334.

1973 Fender Stratocaster Hardtail left-handed electric guitar, made in USA; Body: three-tone sunburst finish, heavy wear throughout including large buckle blemish to back and heavy finish loss to edges; Neck: maple, wear throughout including large blemishes to first position and edges; Fretboard: heavily worn with significant groove wear to first two positions; Frets: heavy wear, replacement nut; Hardware: generally good; Case: oblong hard case; Weight: 3.09kg; Overall condition: poor £1200-1800

335.

2015 Yamaha SA2200 semi-hollow body electric guitar, made in Japan; Body: two-tone sunburst finished maple; Neck: mahogany; Fretboard: ebony with pearl split block position markers; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.90kg; Overall condition: very good

£700-1000

336.

2002 Yamaha AEX-1500 hollow body electric guitar, made in Japan; Body: sunburst finished maple; Neck: maple; Fretboard: ebony with pearl dot position markers; Frets: good; Electrics: working; Hardware: good; Case: hard case; Weight: 3.08kg; Overall condition: very good

£700-800

337.

2016 Yamaha Revstar RS502 electric guitar, made in Indonesia; Body: satin Billet Green top upon brown finished back, light surface marks to back; Neck: good; Fretboard: rosewood with dot position markers; Frets: good; Electrics: working; Hardware: good; Case: original gig bag; Weight: 3.85kg; Overall condition: very good

£250-350

338.

Yamaha SLG130NW nylon string silent guitar, within original gig bag

£200-400

339.

1981 Aria Pro II TA-60 semi-hollow body electric guitar, made in Japan; Body: tobacco sunburst finished maple, light surface scratching and dings otherwise good for age; Neck: three-piece maple, minor dings; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: soft bag; Weight: 3.67kg; Overall condition: good for age

£200-300

340.

2022 Fender American Performer Stratocaster electric guitar, made in USA; Body: honey burst finished alder; Neck: satin maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Fender gig bag; Weight: 3.82kg; Overall condition: very good

£650-750

341.

2018 Ibanez RG Series RGEW521FM electric guitar, made in Indonesia; Body: natural finished figured maple top upon mahogany back; Neck: maple; Fretboard: macassar with dot position markers; Frets: good; Electrics: working; Hardware: good; Case: Tourtech soft bag; Weight: 3.16kg; Overall condition: very good

£200-300

342.

Fenix by Young Chang ST40 electric guitar, circa 1989; Body: purple burst figured top, a few minor marks; Neck: purple finished maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Weight: 3.97kg; Overall condition: very good

£200-400

343.

1980s Hofner S5PA electric guitar, made in Germany; Body: natural mahogany, buckle scratches to back, various dings and other marks; Neck: mahogany, head repair; Fretboard: rosewood with dot position markers; Frets: mild wear throughout; Electrics: working, upgraded Gibson T-top humbucker pickups; Hardware: good; Weight: 3.58kg; Overall condition: fair

*FittedwithGibsonT-toppickups

£200-300

344.

1980s Tokai Jazz Sound bass guitar, made in Japan; Body: Lake Placid blue finish, various dings and scratches throughout; Neck: maple, repair behind lower E tuner, various minor dings throughout; Fretboard: rosewood; Frets: good, light wear to first position; Electrics: working; Hardware: generally good, minor tarnishing to metalwork and minor rusting to smaller metal parts; Case: soft bag; Weight: 4.08kg; Overall condition: good for age

£400-600

345.

Casio PG-380 Guitar Synth, made in Japan; Body: black finish, various minor dings and surface marks, otherwise very good for age; Neck: maple; Fretboard: ebony with dot position markers; Frets: good; Electrics: guitar electrics working, midi untested; Hardware: good; Case: compressed foam case; Weight: 4.32kg; Overall condition: good

£300-400

346.

2024 Fender Player Stratocaster Anniversary electric guitar, made in Mexico; Body: two-tone sunburst finished alder; Neck: satin finished maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: Hiscox hard case; Weight: 3.46kg; Overall condition: very good

£350-450

347.

1980 Ibanez Artist AR100 electric guitar, made in Japan; Body: brown sunburst finish, many dings and blemishes throughout including to the top and back edges, further minor dings and surface buckle scratching to back; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: damage to neck pickup surround, typical loss to gold plating, typical tarnishing to metalwork, strap button relocated to neck heel from body horn; Case: Gibson gig bag; Weight: 3.89kg; Overall condition: fair

£400-600

348.

1969 Gibson Les Paul Custom left-handed electric guitar, made in USA; Body: ebony finish, heavy checking throughout, central buckle rash to back, further minor dings; Neck: similar checking as the rest of the body, various dings; Fretboard: ebony; Frets: worn; Electrics: working, original Patent sticker neck pickup, replacement 70s Patent stamp bridge pickup, pickup covers replaced, one replacement volume potentiometer, other potentiometers original with 1969 date stamps, original Sprague capacitors; Hardware: replacement Grover 105C Imperial tuners, replacement strap buttons, replacement pickguard, replacement Gibson Patent number Tune-o-Matic bridge with replacement slot head posts (original Gibson Patent number bridge included although missing saddles and original posts), replacement lightweight stop bar (original included), replacement truss rod cover screws; Case: contemporary hard case; Weight: 4.69kg; Overall condition: fair

£6500-7500

349.

1983 Andrew Manson 12/6 double neck nylon string electro-acoustic guitar, made in England; Back and sides: bowl back multi-section figured maple back, minor scratches and checking; Top: spruce, minor dings; Necks: mahogany with rosewood friction pegs; Fretboards: rosewood, scalloped to six string side; Frets: good; Hardware: good; Case: fitted heavy duty flight case; Overall condition: very good £1200-1800

350.

1982 Andrew Manson Heron acoustic guitar, made in England; Back and sides: mahogany, a few minor marks and scratches; Top: spruce, minor lift behind bridge, minor hairline to centre join at lower bout, finish wear to treble side of sound hole; Neck: mahogany, surface lacquer wear throughout; Fretboard: ebony; Frets: good; Hardware: good; Case: later Manson branded Hiscox hard case; Overall condition: good for age

*Atthetimeofmanufacture,thisguitarwasknownastheHeronmodel.AndyMansonchangedhismodel designationsin1990,andtheHeronbecameknownastheDove

£1000-1500

351.

2007 Washburn J-3/TS hollow body electric guitar; Body: two-tone sunburst finish, a few minor finish marks; Neck: maple; Fretboard: rosewood with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Weight: 3.15kg; Overall condition: good

£200-300

352.

2008 Blueridge BR-341 acoustic guitar, made in China; Back and sides: mahogany, light surface scratches; Top: natural spruce, light surface marks; Neck: mahogany; Fretboard: ebony; Frets: visible indent wear to first position; Electrics: later fitted Sunrise sound hole pickup (in guitar case); Hardware: good; Case: Hiscox hard case; Overall condition: good

£200-400

353.

1970s Ovation Country Artist 1624 acoustic guitar, made in USA; Body: Lyrachord bowl back with natural spruce top, minor dings to top; Neck: mahogany with maple centre, hairline lacquer stress mark around head/neck join; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Case: original hard case with tags; Overall condition: good for age

£300-500

354.

2024 Gibson SG Standard electric guitar, made in USA; Body: Pelham blue burst finish, a few very minor surface marks; Neck: good; Fretboard: rosewood with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Case: original Gibson gig bag; Weight: 2.77kg; Overall condition: very good £700-900

355.

1987 Yamaha SA800 semi-hollow body electric guitar, made in Taiwan; Body: natural finish maple, a few minor dings to top; Neck: mahogany; Fretboard: rosewood with dot position markers; Frets: light wear; Electrics: working; Hardware: good; Case: original hard case with manual; Weight: 3.72kg; Overall condition: good £400-600

356.

2024 Hils Next HN3 electric guitar, made in Indonesia; Body: satin metallic purple finish; Neck: roasted maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original gig bag; Weight: 2.00kg; Overall condition: very good

£200-300

357.

1974 Guild S100 electric guitar, made in USA; Body: cherry finished mahogany, various minor dings, a few larger blemishes to back edges, buckle scratching to back; Neck: mahogany, refinish to treble edge; Fretboard: rosewood with pearl block position markers; Frets: mild wear; Electrics: working; Hardware: good; Case: generic oblong hard case; Weight: 3.16kg; Overall condition: good for age

£700-800

358.

2021 ESP LTD Deluxe EC-1000 electric guitar, made in Korea; Body: satin black finish with silver top banding; Neck: good; Fretboard: ebony with pearl position markers; Frets: good; Electrics: working; Hardware: good; Case: Ritter soft bag; Weight: 4.26kg; Overall condition: very good

*Evertunebridgerequiressettingup

£500-700

359.

1978 Shergold Custom Masquerader electric guitar, made in England; Body: cherry finish, typical lacquer cracking, scuffs and dings throughout; Neck: maple, minor dings; Fretboard: maple; Frets: light wear; Electrics: working; Hardware: good; Case: Stagg gig bag; Weight: 3.55kg; Overall condition: fair

£300-400

360.

1987 Fender Stratocaster Plus electric guitar, made in USA; Body: graffiti yellow finish, a few very minor dings; Neck: maple, a few light marks; Fretboard: maple; Frets: light wear; Electrics: working; Hardware: good, light tarnishing to metalwork; Case: non-original hard case; Weight: 3.83kg; Overall condition: good for age

*Anearlyexamplewithtype1splitrollernutandrareGraffiti Yellowfinish

£1500-2000

361.

1996 Gibson Les Paul Standard electric guitar, made in USA; Body: cherry sunburst finished maple upon cherry mahogany back, finish blemishes to back edges, further light dings and surface buckle marks; Neck: finish blemish behind fourth fret, further minor scuffs; Fretboard: rosewood, light wear; Frets: light wear; Electrics: working; Hardware: good; Case: original hard case; Weight: 4.66kg; Overall condition: good

£1000-1400

362.

The Indie Guitar Company IRJ765 Dragon electric guitar, made in Korea; Body: black finish with abalone dragon design, a few light surface marks; Neck: maple; Fretboard: rosewood with dragon inlay; Frets: good; Electrics: working; Hardware: good; Case: soft bag; Weight: 3.57kg; Overall condition: good

£200-400

363

363.

373 (See page 61)

1925 Gibson L-1 archtop acoustic guitar, made in USA; Body: sunburst finished maple, slight separation to side/back towards body end, light buckle scratching to back, light play wear and dings to top, light checking throughout; Neck: mahogany, light dings and scuffs throughout; Fretboard: ebony; Frets: light wear; Hardware: good; Case: original hard case; Overall condition: good for age

**Bearingplaquetoheadinscribed'GibsonGuitarMadeforKen Kapua,Birmingham'.KenKapua(KenReese)playedsteelguitarin Englandinthelate20stomid-30s.In1933,hewrotethearticle: "JosephKekuku,TheOriginatoroftheHawaiianGuitar,published inthe"Banjo,MandolinandGuitarMagazine" £1500-2500

364.

Godin Exit 22-S electric guitar, made in Canada; Body: natural mahogany, dings to edges, light surface buckle marks to back; Neck: maple, light wear throughout; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Stagg compressed foam case; Weight: 4.42kg; Overall condition: good

£300-400

365.

Eko BA4 electro-acoustic bass guitar, made in Italy; Back and sides: mahogany, one filled blemish to back, light surface scratches throughout; Top: natural spruce, a few minor imperfections; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Overall condition: good for age

£200-300

366.

2006 Schecter Diamond Series 007 Elite seven string electric guitar, made in Korea; Body: trans black quilted top, light surface buckle marks to back, a few minor dings to edges; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: gig bag; Weight: 3.23kg; Overall condition: good

£300-400

367.

2002 Schecter Diamond Series 006 Elite electric guitar, made in Korea; Body: trans red figured maple top, various minor imperfections including surface buckle scratching to back; Neck: good; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good; Case: Fender gig bag; Weight: 3.05kg; Overall condition: good

£300-400

368.

2002 Schecter Diamond Series Terry Corso Signature electric guitar, made in Korea; Body: natural finished maple top upon brown finished back, light surface marks; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: soft bag; Weight: 3.23kg; Overall condition: good

£250-350

369.

2017 Yamaha A3M electro-acoustic guitar, made in China; Back and sides: mahogany; Top: sunburst finished spruce, minor play marks to treble side; Neck: mahogany; Fretboard: ebony; Frets: light wear; Electrics: working; Hardware: good; Case: hard case; Overall condition: good

£300-400

370.

1989 Epiphone Sheraton semi-hollow body electric guitar, made in Korea; Body: two-tone sunburst finish, a few light marks; Neck: three piece maple, a few minor impact dings; Fretboard: rosewood with pearl and abalone block position markers; Frets: good; Electrics: working; Hardware: generally good, some loss to gold plating; Case: Hiscox hard case; Weight: 4.10kg; Overall condition: good

£300-400

371.

2003 Epiphone Les Paul Custom (SG) electric guitar, made in Korea; Body: ivory finish, impact blemishes to top, various other minor dings and marks; Neck: good; Fretboard: rosewood with pearl block position markers; Frets: good; Electrics: working; Hardware: generally good, some loss to gold plating; Case: fitted hard case; Weight: 3.23kg; Overall condition: good

£250-350

372.

1979 Gibson The Paul electric guitar, made in USA; Body: mahogany finish, a few light scuffs and dings; Neck: three piece mahogany, a few light marks; Fretboard: ebony; Frets: light wear; Electrics: working; Hardware: generally good, missing switch tip; Case: original hard case; Weight: 3.96kg; Overall condition: good

£600-800

373.

1975 Gretsch Broadkaster 7608 semi-hollow body electric guitar, made in USA; Body: sunburst finish, light checking in places and minor marks otherwise good for age; Neck: sunburst finish, checking throughout; Fretboard: rosewood, minor wear to first position; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 4.21kg; Overall condition: good for age £800-1200

374.

2014 Gibson 120th Anniversary SG Special electric guitar, made in USA; Body: yellow finish; Neck: good; Fretboard: rosewood with 120th Anniversary inlay to the twelfth fret; Frets: good; Electrics: working, upgraded Stewart MacDonald Golden Age prewired harness; Hardware: later installed pickguard and non-original control knobs; Case: Spider Cases hard case; Weight: 3.12kg; Overall condition: very good £400-500

375.

1966 Fender Telecaster electric guitar, made in USA; Body: candy apple red refinish, various dings and marks, light finish rubbing to arm edge, dropfill to some blemishes; Neck: maple, surface lacquer wear throughout; Fretboard: Indian rosewood; Frets: light wear, frets dressed; Electrics: working, replacement potentiometers and cap, volume potentiometer dating to 1984 and tone potentiometer dating to 1986, additional earth wire; Hardware: good, very light rusting to smaller metal parts and light tarnishing to other metalware; Case: 1970s Fender hard case; Weight: 3.65kg; Overall condition: good

£4500-5500

376.

Rare autographed Hutchins five neck electric guitar, comprising twelve string neck, three six string fretted necks and a six string fretless neck, with metallic blue finish (imperfections)

*Averyrarefiveneck,autographedbyGaryHutchinsandothers. GaryHutchinsseemstorecalltheguitarbeingsignedbymusicians involvedwithNormanCook'scollaborativeBrightonPortAuthority group.Hutchinsmakeboutiqueandretroguitars,oftencreating instrumentsthat,byGary'sownadmission,"shouldneverhavebeen made"

£1500-2000

377.

Rare Hutchins five neck electric guitar, comprising twelve string neck, three six string fretted necks and a six string fretless neck, with salmon pink finish (imperfections)

*Averyrarefiveneck,signedtothebackbydesignerGaryHutchins withtribute'ToJane'.Hutchinsmakeboutiqueandretroguitars, oftencreatinginstrumentsthat,byGary'sownadmission,"should neverhavebeenmade"

£600-1000

378.

Rare Hutchins triple neck electric guitar comprising twelve string neck (nut and bridge missing), six string neck and five string bass neck, metallic blue finish (imperfections), within original gig bag

*Hutchinsmakeboutiqueandretroguitars,oftencreating instrumentsthat,byGary'sownadmission,"shouldneverhave beenmade"

£600-800

379.

Rare Hutchins double neck Flying V electric guitar comprising twelve and six string necks, black finish (imperfections), within original gig bag

*Thisguitarfeaturedinan'ArtWorks'guitarexhibitionin Brighton.Hutchinsmakeboutiqueandretroguitars,oftencreating instrumentsthat,byGary'sownadmission,"shouldneverhave beenmade"

£400-600

380.

H&S triple neck electric guitar, comprising twelve string neck (missing nut, bridge and stop bar), seven string neck and six string neck, black finish (imperfections)

£300-500

381.

Unbranded triple neck electric guitar, probably by H&S, comprising a twelve string guitar neck, a seven string guitar neck and a six string guitar neck, black finish (imperfections), within hard case

£300-500

375

383 (See page 62)

382.

JHS Vintage Joe Doe Guitars Gas Jockey Limited Edition electric guitar; gold finished lightweight mahogany; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing certificate and custom designed stickers; Overall condition: as new

*Thismodelisfromalimitedrunofonehundredguitarsdesignedby JoeDoeGuitarsandreleasedbyJHSVintage.Offeredforsaleon behalfofthedesigner.

£200-400

383.

Joe Doe Guitars Punkaster bass guitar, made in England - An 80s bass from legendary underground punk bassist Mighty Moe. Lightweight alder body finish in bashed nitro, three A flamed maple neck with rosewood fretboard, 12" radius. Finer details include custom designed punk flyer on the rear, custom designed stickers and smiley inlay at the twelfth fret

*JoeDoeGuitarsarethebrainchildofBenCourt,whodesignsand handbuildsguitarsthateachhaveaninterestingandfunstory attachedtothem.Thesuccessofhisconceptledtohimjoiningup withJHSVintagetoproducelimitedfactoryrunsofhisconceptsand ideas.

£800-1200

384.

Joe Doe Guitars 'Folsom '68' acoustic guitar, made in England - An imaginary build from the Folsom Prison woodworkers following a visit from Johnny Cash in 1968. Mahogany back and sides with a mahogany neck and rosewood fretboard, finished in boot polish black and nicotine nitro. Finer details include flame maple marquetry to the back, barbed wire inlay, mother of pearl headstock inlay, etched binding and custom design tailpiece. Voiced with a Bare Knuckle pickup

£1000-2000

385.

2020 Fender Player Telecaster electric guitar, made in Mexico; Body: butterscotch blonde finished alder; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: soft bag; Weight: 3.45kg; Overall condition: very good

£300-400

386.

2022 Fender Vintera 50s Telecaster electric guitar, made in Mexico; Body: sunburst finish; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: Donner gig bag; Weight: 3.53kg; Overall condition: very good

£350-450

387.

2023 Gretsch Electromatic G5232T Double Jet electric guitar, made in China; Body: Fairlane Blue; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.69kg; Overall condition: very good

£200-300

388.

2017 Gretsch Electromatic G5435TG Pro Jet Limited Edition electric guitar, made in China; Body: metallic red finish; Neck: good; Fretboard: rosewood with thumb pearl position marker; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.80kg; Overall condition: very good £200-300

389.

2021 Rickenbacker 330 electric guitar, made in USA; Body: satin walnut; Neck: satin maple and walnut; Fretboard: maple; Frets: light tarnishing; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.25kg; Overall condition: very good

£1000-1500

390.

2023 Gretsch Chet Atkins Country Gentleman G6122-1962 electric guitar, made in Japan; Body: walnut finish; Neck: good; Fretboard: ebony with thumb position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing papers; Weight: 3.85kg; Overall condition: excellent £1000-1500

391.

1999 Johnny Kinkade Clifton twelve string acoustic guitar, made in Bristol, England; Back and sides: Indian rosewood, a few light surface marks and dings; Top: natural spruce, light dings to treble side, light play wear; Neck: mahogany, a few light marks; Fretboard: ebony; Frets: good; Hardware: good; Case: Hiscox hard case; Overall condition: very good *

*Thisexactguitarisfeaturedonpage24ofVenuemagazine,issue no.448.ThearticlefeaturiesJohnnyKinkadewherehecanbeseen holdingtheguitarwithinhisworkshop.Acopyofthismagazineis includedinthesale

£2000-3000

392.

1960s Contessa hollow body electric guitar, made in Italy; Body: red finish, repair and refinishing to bass side top, various lacquer cracks, laminate cracks to back; Neck: lacquer laminate cracks throughout; Fretboard: rosewood; Frets: worn; Electrics: working; Hardware: generally good, tarnishing, missing two tuner gear covers; Case: Stagg hard case; Weight: 2.50kg; Overall condition: poor

£100-200

393.

Burns Flyte Rhapsody electric guitar, circa 2004; Body: matt black finish, large blemish to body end; Neck: head repair; Fretboard: rosewood with dot position markers; Frets: good; Electrics: working; Hardware: generally good, missing trem arm; Case: shaped ABS hard case; Weight: 3.53kg; Overall condition: fair

£200-300

394.

2000 Fender American Deluxe Sub-Sonic Stratocaster electric baritone guitar, made in USA; Body: black finish, a few light surface scratches and other marks; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Fender gig bag; Weight: 3.45kg; Overall condition: good

£600-800

399 (See page 64)

400 (See page 64)

395.

Sparrow Primitive Pro hollow body electric guitar, made in Canada; Body: blue finished maple with pinstripe accents; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 4.03kg; Overall condition: very good

£200-400

396.

Late 1970s Kramer 450G electric guitar, made in USA; Body: black finish, light surface scratches to back; Neck: aluminium; Neck: ebonol; Frets: good; Electrics: working; Hardware: good; Case: original hard case (split damage to lid); Weight: 4.66kg; Overall condition: good

£700-1000

397.

1990s Hofner Pre-production New President hollow body electric guitar, made in Germany; Back and sides: natural maple; Top: natural arch spruce; Neck: maple; Fretboard: rosewood with dot position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 2.61kg; Overall condition: very good

**Fromasmallpre-productionrun,thoughttocomprisejustsix examples,madepriortothecommencementoffullNewPresident modelproductionin1998.

£800-1000

398.

1990s Dobro by Gibson Dobrolektric electric resonator guitar, made in USA; Body: sunburst finished maple, a few light marks; Neck: sunburst finished figured maple, 'Used' stamp to back of head; Fretboard: rosewood; Frets: light tarnishing; Electrics: working; Hardware: generally good, some minor tarnishing; Case: original hard case; Weight: 2.79kg; Overall condition: good **Currentlysetupwithhighactionforslideplay £700-1000

399.

2007 Gibson Les Paul Classic Antique Artist Series Limited Edition electric guitar, made in USA; Body: custom finish by Tom Morgan, a few light marks to back; Neck: good; Fretboard: rosewood with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case with inspection checklist; Weight: 3.92kg; Overall condition: very good

*Thisguitarispartofthe2007GibsonGuitaroftheweekseries. Thismodelisno.5andisoneofonlyfourhundredmade.Finish designedandsignedbyartistTomMorgan £2000-3000

400.

1992 Lowden 025C acoustic guitar, made in Northern Ireland; Back and sides: Indian rosewood, a few minor dings; Top: natural cedar, play wear to treble side, further light dings and marks; Neck: three piece mahogany; Fretboard: ebony, light wear; Frets: light wear; Electrics: later fitted with controls to shoulder and wired through to end pin; Case: hard case; Overall condition: good

£1500-1800

401.

Ernie McMillen twelve string acoustic guitar, made in Northern Ireland; Back and sides: Indian rosewood, a few light marks; Top: western red cedar, a few minor dings; Neck: five piece laminate mahogany rosewood and sycamore; Fretboard: ebony; Frets: good; Electrics: working, under-saddle transducer pickup; Hardware: good; Case: Hiscox hard case; Overall condition: very good £800-1200

402.

Simon & Patrick Rosewood acoustic guitar, made in Canada; Back and sides: rosewood, light surface scratches and dings throughout; Top: natural spruce, a few minor dings and minor play wear to treble side; Neck: mahogany, light wear; Fretboard: ebony; Frets: indent wear to first position; Hardware: good; Overall condition: good £200-400

403.

Bourne 000 style acoustic guitar; Back and sides: mahogany, scratches and dings, repair to treble shoulder; Top: natural spruce, play wear to treble side of sound hole, further dings and marks; Neck: mahogany, light wear, head repair; Fretboard: ebony; Frets: light wear; Hardware: generally good, Schaller tuners; Case: soft bag; Overall condition: fair

£400-600

404.

2012 Gibson Les Paul Studio Limited electric guitar, made in USA; Body: three-tone sunburst finished maple upon mahogany, a few light surface marks to back; Neck: good; Fretboard: rosewood with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.76kg; Overall condition: very good

£700-800

405.

2016 Tokai LC-142 Les Paul Custom electric guitar, made in Japan; Body: wine red finish, a few light surface marks to back; Neck: mahogany; Fretboard: rosewood with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: Thomann hard case; Weight: 4.59kg; Overall condition: very good

£600-800

406.

2019 Fender American Professional Jaguar electric guitar, made in USA; Body: Candy Apple Red finish, one minor surface ding to top; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 4.12kg; Overall condition: very good

£700-800

401

407 (See page 65)

415

407.

2011 Gibson Custom Shop ES-335 Curly Maple Limited Edition semi-hollow body electric guitar, made in USA; Body: vintage sunburst finished maple; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case with certificate of authenticity and papers; Weight: 3.90kg; Overall condition: very good

*TheGibsonCustomShopES-335CurlyMaplewaslimitedto200 worldwide.Themodelofferedamoderntwistonaclassicdesign, featuringZebraburstbuckerpickupsandcoiltappingpots. £1800-2200

408.

Sanox Sound Creator 780N electric guitar, made in Japan, circa 1980; Body: walnut finished wings with natural maple centre, various scuffs to edges and dings and marks throughout; Neck: five-piece maple and walnut, bolt-on; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: some tarnishing to metalwork, missing G tuner gear cover; Weight: 3.47kg; Overall condition: fair £150-250

409.

Customised 1985 Fender 'Ritchie Blackmore Tribute' Stratocaster electric guitar, made in Japan; Body: Olympic white finish, a few light marks and dings including buckle scratching to back; Neck: maple, Made in Japan stamp removed from neck heel, vacant strap button holes present; Fretboard: rosewood, scalloped; Frets: good; Electrics: working; Hardware: generally good, replacement Sperzel tuners; Case: Hiscox hard case; Weight: 3.64kg; Overall condition: good

**Acustomisedmid80sMIJFenderStratocaster,madeasatribute toRitchieBlackmore'siconicStratocaster

£500-600

410.

1993 Fender Ritchie Blackmore Signature Stratocaster electric guitar, made in Japan; Body: Olympic white finish, various dings and marks, light discolouration in places; Neck: maple; Fretboard: scalloped rosewood; Frets: light wear; Electrics: working, Seymour Duncan bridge and neck pickup with dummy middle pickup; Hardware: generally good; Case: Fender G&G hard case; Weight: 3.50kg; Overall condition: good

£600-800

411.

Customised Fender 'Glenn Tipton Tribute' Stratocaster electric guitar; Body: black finish with light scratches and scuffs; Neck: maple, minor dings; Fretboard: scalloped Fender Japan Yngwie Malmsteen neck; Frets: wear throughout; Electrics: working; Hardware: good; Case: compressed foam case enclosing studded leather strap; Weight: 3.95kg; Overall condition: good

**Acustombuildguitarcomprisingvariouspartsfromotherguitars, madeasaone-offtributetoreplicateGlennTipton's1970sJudas Priest70sStratocaster

£500-700

412.

Custom build Charvel 'Jake E Lee Tribute' electric guitar, made in Japan, circa 1992; Body: Charvel ST1 body with white finish, a few minor surface dings; Neck: Charvel CX291 maple neck with refinished matching head; Fretboard: rosewood; Frets: good; Electrics: working, upgraded pickups qith Seymour Duncan humbucker at bridge position; Hardware: good; Case: hard case; Weight: 3.75kg; Overall condition: good

**AcustomisedCharvelguitarmodifiedwithmatchingheadstock, pickupsandscratchplatetocloselyresembleJakeELee'svintage OzzyOsbourneeraCharvelguitar

£500-700

413.

2011 Charvel Pro Mod San Dimas electric guitar, made in Japan; Body: white finish, a few minor surface dings; Neck: satin maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: Freestyle hard case; Weight: 3.52kg; Overall condition: good

£600-800

414 (See page 66)

(See page 66)

414.

1980s Burny Fernandes FV-105RR Randy Rhoads Tribute Polka Dot V electric guitar, made in Japan; Body: black polka dot finish, a few light scuffs and dings; Neck: polka dot finish; Fretboard: rosewood with bow position markers; Frets: good; Electrics: working; Hardware: good; Case: Gator hard case; Weight: 3.34kg; Overall condition: good

£1200-1800

415.

1972 Fender Stratocaster electric guitar, made in USA; Body: three-tone sunburst finish, lacquer checking throughout, various dings and general wear, control cavity slightly shaved to treble edge, unusual lacquer residue within cavities indicating possible re-lacquer; Neck: maple; Fretboard: rosewood; Frets: worn; Electrics: working; Hardware: good; Overall condition: good for age

£2000-2500

416.

1973 Fender Jazz Bass guitar, made in USA; Body: three-tone sunburst finish, buckle scratching to back, scuffs to edges and various minor dings; Neck: maple; Fretboard: rosewood; Frets: light wear and tarnishing throughout; Electrics: working; Hardware: generally good, missing bridge and pickup covers, D string saddle missing an adjustable screw; Case: period hard case; Weight: 4.43kg; Overall condition: good for age £1800-2200

417.

Fender Telecaster TL-52D electric guitar, made in Japan (1997-1998); Body: two-tone sunburst finish, minor dings to back; Neck: maple; Fretboard: maple; Frets: generally good, light tarnishing spots; Electrics: working; Hardware: good; Case: TKL hard case; Weight: 3.38kg; Overall condition: good

£500-700

418.

2006 Bryant Trenier Magnolia archtop jazz guitar, made in Uzes, France; Back and sides: sunburst finished figured maple; Top: sunburst finished spruce; Neck: maple; Fretboard: ebony with pearl split block position markers; Frets: good; Hardware: good; Case: TKL hard case; Overall condition: very good

£2000-3000

419.

2006 Stefan Sonntag J16X D'Angelo archtop guitar, made in Germany; Back and sides: high figured maple; Top: natural spruce; Neck: figured maple; Fretboard: ebony with pearl block position markers; Frets: good; Hardware: good; Case: Hiscox hard case; Overall condition: very good

£1500-2500

420 (See page 67)

420.

C.F. Martin 1-28 acoustic guitar, made in USA, circa 1890, bearing C.F Martin & Co. New York stamps to the back of head and inner back; Back and sides: rosewood, one repaired hairline to back and to treble waist, binding repairs; Top: natural spruce, refinished, minor play wear; Neck: mahogany, reset; Fretboard: ebony; Frets: good, refret; Hardware: good, strap button installed to neck heel; Case: 1960s Lifton hard case; Overall condition: good/restored

**PurchasedbythevendorinCambridge,Massachusettsin1985andlaterrefurbishedbyrenownedluthierBillPuplett. £5000-6000

421.

1998 Ralph Bown D hole Gypsy Jazz style acoustic guitar, made in York, England; Back and sides: Jaguar Ear mahogany; Top: old growth fine graded red spruce; Neck: rosewood; Fretboard: ebony; Frets: good; Hardware: good, replacement tailpiece (original damaged tailpiece included); Hardware: good; Case: original hard case; Overall condition: very good £1800-2200

422.

Rod Schenk Guitars Killer Koa Collection FE09-05-045 acoustic guitar, made in USA; Back and sides: koa; Top: spruce; Neck: mahogany with rosewood and ebony face plate; Fretboard: ebony; Frets: generally good, minor tarnishing spot; Hardware: good; Case: Cedar Creek hard case; Overall condition: good

*Pleasenotethatthecaselininghascausedalightresiduetobepresentonthesidesofthisguitar.Whilstthiscanbeeasilybecleanedoff,wewould adviseagainstprolongeduseofthiscase £1500-2500

423.

2012 Chasson Guitars Concert acoustic guitar, made in USA; Back and sides: wenge; Top: Engelmann spruce; Neck: Khaya; Fretboard: ebony; Frets: good; Hardware: good, Schaller gold tuners; Case: Ameritage hard case; Overall condition: excellent £2000-3000

(See page 68)

424.

2012 Chasson Guitars Jumbo acoustic guitar, made in USA; Back and sides: natural high figured maple with ebony centre; Top: spruce; Neck: mahogany; Fretboard: ebony; Frets: good; Hardware: good; Case: Ameritage hard case; Overall condition: excellent £2000-3000

425.

2001 David Eichelbaum Grand Auditorium acoustic guitar, made in USA; Back and sides: AAA grade black acacia; Top: master grade Adirondack spruce; Neck: mahogany; Fretboard: ebony with abalone position markers; Frets: good; Hardware: good, Gotoh 510 tuners; Case: Cedar Creek hard case; Overall condition: very good £2000-4000

426.

2008 Charis Acoustic by Bill Wise Small Jumbo acoustic guitar, made in Michigan, USA; Back and sides: rosewood; Top: western red cedar with maple chamfered edge; Neck: curly maple and rosewood; Fretboard: ebony; Frets: good; Hardware: good, Gotoh Delta Series 510 tuners; Case: Cedar Creek hard case; Overall condition: very good

*Pleasenotethatthecaselininghascausedalightresiduetobe presentonthesidesofthisguitar.Whilstthiscanbeeasilybe cleanedoff,wewouldadviseagainstprolongeduseofthiscase £2000-3000

427.

2008 Charis Acoustic by Bill Wise Grand Concert acoustic guitar, made in Michigan, USA; Back and sides: rosewood; Top: western red cedar; Neck: curly maple; Fretboard: ebony; Frets: good; Hardware: good, Gotoh Delta Series tuners; Case: Cedar Creek hard case; Overall condition: very good

*Soldwithoriginalorderformdetailingoptionalspecupgrades **Pleasenotethatthecaselininghascausedalightresiduetobe presentonthesidesofthisguitar.Whilstthiscanbeeasilybe cleanedoff,wewouldadviseagainstprolongeduseofthiscase £2000-3000

428.

2003 Roy Noble Dreadnought acoustic guitar, made in USA; Back and sides: three piece cocobolo curly maple and cocobolo; Top: Adirondack spruce; Neck: mahogany; Fretboard: ebony; Frets: good; Hardware: good, Gotoh gold plated tuners; Case: Hiscox hard case; Overall condition: very good

£2000-3000

429.

2012 Lowden 0-50c Rosewood/Cedar acoustic guitar, made in Northern Ireland; Back and sides: master grade east Indian rosewood; Top: master grade red cedar; Neck: mahogany and rosewood; Fretboard: ebony; Frets: good; Hardware: good, Gotoh 510 tuners; Case: original hard case with papers; Overall condition: excellent £2500-3500

430.

2008 A.J. Lucas Pavilion acoustic guitar, made in England; Back and sides: cocobolo; Top: natural spruce; Neck: mahogany; Fretboard: ebony; Frets: good; Electrics: working, LR Baggs sound hole pickup wired through to end pin; Case: Hiscox hard case; Overall condition: very good

£1000-2000

431.

2012 Gallagher G-50 acoustic guitar, made in USA; Back and sides: mahogany, minor lacquer clouding to edges; Top: natural spruce; Neck: mahogany, minor lacquer clouding to edges; Fretboard: ebony; Frets: light wear; Case: original hard case; Overall condition: good

£1000-1500

432.

2008 Paul Reed Smith (PRS) SC-J Thinline Limited Edition hollow body electric guitar, made in USA; Body: violin sunburst finished figured maple; Neck: mahogany, minor finish dings; Fretboard: rosewood with birds in flight position markers; Electrics: working; Hardware: good; Case: original hard case with papers; Weight: 3.71kg; Overall condition: very good

£2000-3000

433.

2008 National Reso-Phonic Style 1 Tricone resonator guitar, made in USA; Body: polished nickel finished brass body, a few light tarnishing spots; Neck: mahogany, significant lacquer bubbling at neck heel; Fretboard: ebony; Frets: good; Case: original hard case and papers; Overall condition: good

£1500-2000

434.

Atomic Retro Customs Red Rocket electric guitar, made in USA, circa 2010; Body: walnut capped blonde finished ash; Neck: mahogany; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: Fender hard case; Weight: 3.67kg; Overall condition: very good

£800-1200

429 (See page 68)

435.

1993 Gibson Custom Shop Wes Montgomery Custom L-5 Master Model hollow body electric guitar, made in USA; Body: two-tone sunburst finish maple back and sides with spruce top; Neck: maple; Fretboard: ebony with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.37kg; Overall condition: very good

**AGibsonCustomShopMasterModelguitarbearingJames Hutchinsinspectionlabeltothetreblesideinnerback £4000-6000

436.

2004 Epiphone Jack Casady semi-hollow body bass guitar, made in Korea; Body: gold top finish on dark back, minor dings and marks; Neck: good; Fretboard: rosewood with pearl crown position markers; Frets: light tarnishing; Electrics: working; Hardware: good; Case: original hard case; Overall condition: good £350-450

437.

Custom Excalibur Les Paul Custom type electric guitar; Body: brown finish with custom Excalibur pearl inlay, minor dings to back; Neck: Excalibur sword inlay to length of fretboard with cloud and lightning design to head; Frets: good; Electrics: working; Hardware: good; Case: TGI hard case; Overall condition: good £500-600

438.

2018 Gibson SG Standard electric guitar, made in USA; Body: black gloss finish, light surface scratching to back and other minor surface dings; Neck: good, a few minor surface dings; Fretboard: rosewood with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case with papers; Weight: 3.10kg; Overall condition: good £600-800

439.

2022 Gibson ES-339 semi-hollow body electric guitar, made in USA; Body: gloss cherry finish, a few light marks to back; Neck: mahogany, a few minor marks; Fretboard: rosewood with pearl dot position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing papers; Weight: 3.20kg; Overall condition: good £1000-1200

440.

1997 Fender Hank Marvin Stratocaster electric guitar, made in Japan; Body: Fiesta red finish; Neck: maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good, minor rusting to smaller metal screws, minor splits to back plate corners; Case: Studio Logic flight case; Overall condition: very good

**SoldwiththreeHankMarvin/Shadowssouvenirtour programmesandaticketstubforTheShadows2004FinalTour £700-800

433 (See page 69)

439

444 (See page 71)

441.

2022 Chapman ML1 Modern electric guitar, made in Indonesia; Body: midnight blue satin on satin black back; Neck: satin maple; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Case: soft bag; Overall condition: very good

£200-300

442.

1960s Watkins Rapier electric guitar, made in England; Body: red finish, heavy lacquer cracking throughout and other minor dings; Neck: maple, lacquer cracking and peeling; Fretboard: rosewood; Frets: refret, sprouting to edges and wear; Hardware: tarnishing; Case: semi-rigid fibreboard case; Overall condition: fair

£100-200

443.

Recording King RM-999-4 Tricone resonator guitar, with etched polished body and nineteen fret rosewood fingerboard, within Stagg gig bag

£200-400

444.

1971 Fender Stratocaster electric guitar, made in USA; Body: burnt black refinish, tin foil shielding in cavities; Neck: maple, various dings, April 1971 date stamp; Fretboard: rosewood, groove wear to first position; Frets: refret, light wear; Electrics: working although jack intermittent, pickups dating to 1971, replacement potentiometers, five-way switch; Hardware: generally good, rusting to bridge saddles, replacement flat head pickguard and jack plate screws, replacement neck plate, one missing pickguard screw; Case: generic oblong hard case; Weight: 3.41kg; Overall condition: fair

£1500-2000

445.

Custom Build Tele type electric guitar; Body: bound walnut topped ash body, varnished finish; Neck: maple with rosewood skunk stripe and custom head; Fretboard: rosewood with vine inlay; Frets: light wear; Electrics: working; Hardware: good; Case: soft bag; Overall condition: good

£150-250

446.

1980s Pete Back Custom six string acoustic guitar, made in England; Back and sides: black finished maple, refinished; Top: natural spruce, repaired hairline and refinished; Neck: slight back bow, finish chips; Fretboard: rosewood; Frets: light wear; Hardware: replacement Gotoh tuners; Case: hard case; Overall condition: fair

£200-400

447.

1983 Epiphone Riviera semi-hollow body electric guitar, made in Japan; Body: two-tone tobacco sunburst finished maple, a few very minor surface marks; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Overall condition: very good

£700-900

448.

1976 Gibson Les Paul Recording electric guitar, made in USA; Body: three-piece natural maple top upon mahogany; Neck: maple; Fretboard: rosewood with pearl block position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case; Weight: 5.63kg Overall Condition: very good

*ArareexampleoftheLesPaulRecordingmodelfeaturinga naturalmapletopandmapleneck

£2000-2500

449.

2007 Gibson BFG Les Paul electric guitar, made in USA; Body: gold carved top upon satin mahogany back; Neck: mahogany; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: replacement 'BFG Custom' truss rod cover, non-stock bridge pickup surround installed; Case: original hard case; Weight: 3.53kg; Overall condition: very good

£800-1200

450.

Early 2000s Danelectro Longhorn Guitarlin electric guitar; Body: customised sparkle refinish with pinstripe artwork, artist signed 'Caffeine 05'; Neck: good, light wear; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Hiscox hard case; Weight: 2.73kg; Overall condition: very good

£250-350

451.

Godin LR Baggs Model Multiac twelve string electric guitar, made in Canada; Body: black gloss finish, dings and scratches throughout, some dings and imperfections to top binding; Neck: maple, light wear; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good, missing gear cover to one tuner back; Case: fitted hard case; Weight: 3.05kg; Overall condition: good

£400-600

452.

Hohner TWP West-SB electric guitar; Body: red burst finish upon mahogany back, light scratches throughout back; Neck: good; Fretboard: rosewood; Frets: good; Electrics: later fitted Shadow sound hole pickup and Roland GK3 midi pickup; Hardware: good; Case: TGI Extreme gig bag; Overall condition: fair

**SoldwithRolandGR-20guitarsynthesizerpedalboardtoworkwithGK3midipickup

£200-300

453.

2017 Fender Standard Telecaster electric guitar, made in Mexico; Body: butterscotch finished alder; Neck: satin maple; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: Fender hard case enclosing tags; Weight: 3.44kg; Overall condition: very good

£300-400

454.

2021 Gretsch Electromatic G5655TG semi-hollow body electric guitar, made in China; Body: blue metallic finish, a few light surface marks to back; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Weight: 3.23kg; Overall condition: very good

£300-400

455.

Ozark 3515BTE thinline electric resonator guitar, engraved polished body with Hawaiian scene (tarnishing and oxidisation patches), within acoustic guitar hard case

£300-400

The Rod Deas Collection Lots 501-506

RodDeasisanEnglishbassguitaristwhofirstperformedwithTheGoldenHammersbeforebecoming afoundingmemberofShowaddywaddyin1973.FormedinLeicesterthroughthemergeroflocal bandsChoiceandTheGoldenHammers,Showaddywaddyspecialisedinrevivalperformancesof 1950sandearly1960srockandrollalongsidetheirownoriginalmaterial.

Thegroupenjoyedconsiderablecommercialsuccess,spending209weeksontheUKSinglesChartand recordingtenTopTensingles,includingthenumberonehitUndertheMoonofLovein1976.Rod DeasremainedwithShowaddywaddyfromitsformationuntilhisretirementin2019.

GardinerHoulgateispleasedtooffersixbassguitarsfromRodDeas’personalcollection,allofwhich wereusedthroughouthisplayingcareer.

501.

Rod Deas (Showaddywaddy) - Stage and studio used Fender Jazz Bass guitar, made in USA, circa 1960, ser. no. 56618; Body: two-tone sunburst refinish, light checking throughout, various further marks and dings, control cavity enlarged; Neck: maple, refinished, later incorrect decal, light wear throughout, pencil date missing; Fretboard: slab Brazilian rosewood with clay dot position markers; Frets: refret, heavy wear throughout; Electrics: working, pickups rewired, replacement potentiometers; Hardware: replacement control panel, missing finger rest, missing pickup and bridge covers; Weight: 4.06kg; Overall condition: fair

*OneofRodDeas’sprincipalbassguitars,usedextensivelythroughouthisperforming careerand,assuch,subjecttosomemodificationsovertheyears.

£3000-4000

502.

Rod Deas (Showaddywaddy) - Stage and studio used Fender Precision Bass guitar, made in USA, circa 1961; Body: red refinish, heavy blemishes and finish wear throughout; Neck: maple; refinished, 11-61 pencil stamp, later incorrect decal; Fretboard: Brazilian rosewood with clay dot position markers; Frets: worn and heavy tarnishing; Electrics: working, all replaced; Hardware: replacement pickguard, replacement control knobs, replacement strap buttons, replacement tuners, additional string tree, 1961 serial number neck plate; Weight: 4.02kg; Overall condition: fair

*OneofRodDeas’sprincipallivebassguitars,usedextensivelythroughouthisperforming careerand,assuch,subjecttonumerousmodificationsovertheyearstosuithis professionalrequirements.

£1500-2500

503.

Rod Deas (Showaddywaddy) - Stage and studio used Fender Precision Bass fretless bass guitar, made in USA, circa 1977, ser. no. S748009; Body: natural finish, various dings and surface scratches throughout, control cavity slightly enlarged to house a 9 volt battery; Neck: maple, mild wear throughout; Fretboard: maple; Fingerboard: maple; Electrics: working, replacement EMG pickups with 1984 dated potentiometers; Hardware: missing thumb rest, missing one scratchplate screw, missing bridge and pickup covers; Weight: 4.03kg; Overall condition: good for age

*OneofRodDeas’sprincipallivebassguitars,usedthroughouthisperformingcareerand, assuch,subjecttoafewmodificationstosuithisprofessionalrequirements.

£1000-1500

504.

Rod Deas (Showaddywaddy) - Career used 1971 Gibson Les Paul Recording bass guitar, made in USA, ser. no. 690490; Body: natural mahogany, lacquer scuffs to edge, light buckle wear to back and various other dings; Neck: mahogany, minor dings throughout; Fretboard: rosewood; Frets: light wear and tarnishing; Electrics: working; Hardware: generally good, damage to lower tip of control guard, light tarnishing to metal parts; Weight: 4.68kg; Overall condition: good for age

£1200-1800

505.

Rod Deas (Showaddywaddy) - Career used 1964 Hofner Committee hollow body bass guitar, made in Germany, ser. no. 276; Body: brunette finish, heavy lacquer checking throughout, buckle marks to back, further dings and scratches; Neck: light wear and dings throughout, minor bow; Fretboard: ebony with pearl and block position markers, missing pearl to seventh position marker; Frets: mild wear and tarnishing throughout; Hardware: tarnishing to metal parts, missing pickguard, two replacement tuners; Weight: 2.63kg; Overall condition: fair

£600-800

506.

Rod Deas (Showaddywaddy) - Stage used 1980s Washburn Status Design Series 1000 bass guitar; Body: black finish, surface scratches and dings throughout including minor buckle wear to back; Neck: good; Fretboard: ebony; Frets: light wear and tarnishing; Electrics: working; Hardware: light tarnishing; Weight: 4.12kg; Overall condition: good

*OneofRodDeas’sprincipallivebassguitars,usedinthelatterstagesofhisplayingcareer.

£300-500

507.

Horace Panter (The Specials & General Public) - 'The Ghost Town Bass' - a stage and studio used 1971 Fender Precision Bass guitar made in USA, ser. no. 305976; Body: powder blue refinish, wear to arm contour, dings and general use marks throughout; Neck: maple, re-profiled, wear throughout; Fretboard: rosewood; frets: mild wear throughout; Electrics: working, replacement DiMarzio pickups; Hardware: replacement brass bridge, replacement brass nut, replacement brass barrels, replacement brass scratchplate; Case: fitted hard case; Weight: 4.39kg; Overall condition: good

*A1971FenderPrecisionBassguitar,usedbyHoracePanter torecordTheSpecials'era-definingmasterpiece,"GhostTown."

ProvenanceandMusicalLegacy

AcquiredbyHoracePanterinJanuary1981fromamusicstoreinKettering, thisinstrumentbecametheprimarybassforthefinal,definitivemonthsofTheSpecials.ItsmostsignificantcontributiontotheBritishmusicalcanon occurredinMay1981,whenPanterusedittorecordtheband’sseminalsingle,“GhostTown.”Ahauntingreflectionofthesocialandpoliticalunrest oftheera,thetrackremainedatnumberoneforthreeweeksandspent11weeksintheUKTop40.

FollowingthedissolutionofTheSpecialsinlate1981,Pantercarriedtheinstrumentintohisnextventure,theNewWavesupergroupGeneral Public.Thebassisfeaturedonthe1984albumAlltheRage,providingtherhythmicfoundationfortheU.S.hit“Tenderness.”Between1984and 1987,theinstrumentwastouredextensivelyacrosstheUnitedStates.

TechnicalEvolutionandModifications

Originallypurchasedwithametallicbluefinish,thebassfeaturedanotablythinned-downneck,themodificationthatinitiallyattractedPantertothe instrument,alongsideabrassbridge,brassnut,andhigh-outputDiMarziopickups.

Duringthemid-1980s,theinstrumentunderwentfurtheraestheticchanges:

Finish:RefinishedinadistinctivePowderBluebytherenownedBirminghamluthierJohnDiggins(JaydeeCustomGuitars).

Hardware:Panteraddedabrassscratchplateandcontrolknobs.

NoteonComponents:Whilefootagefromthe1980sshowsthebasswithatexturedaluminiumscratchplate,thebrassguardhassincebeen reinstated;thealuminiumplateisincludedinthelot.

The"Prodigal"Return

Inamomentoflater-regrettednecessity,Pantertradedthebassin1988atHotStringsinCoventry.Itremainedseparatedfromitsownerfor twenty-twoyearsuntil2010,whenitsurfacedatNoiseWorksonGosfordStreet,Coventry.Identifyingitimmediatelybyhiscustommodifications, PanterrepurchasedtheinstrumentandintegrateditbackintohisrigfortheremainderofTheSpecials’celebratedreunionera(2008–2022).

CulturalSignificance

FormedinCoventryin1977,TheSpecialswereapioneeringforceintheBritish2Tonemovement,fusingJamaicanskaandrocksteadywiththe urgencyofpunk.FoundedbykeyboardistandprincipalsongwriterJerryDammers,theclassicline-upcomprisedTerryHall(vocals),NevilleStaple (vocals/toasting),LynvalGolding(guitar,vocals),Roddy“Radiation”Byers(guitar),HoracePanter(bass)andJohnBradbury(drums).Theband achievedsignificantcommercialandculturalimpactwithhitsincluding“Gangsters,”“TooMuchTooYoung,”andthechart-topping“GhostTown,”an enduringsoundtracktothesocialunrestofearly1980sBritain.Centraltothe2Tonelabelanditsmessageofracialunity,TheSpecialshelped catalysethelate-1970sskarevivalintheUnitedKingdom.Thisbassstandsasaphysicalartifactofthatmovement,whichsuccessfullychampioned racialunityandcatalysedthelate-70sskarevivalintheUnitedKingdom.

£10,000-20,000

508.

Brian Setzer - 2005 Gretsch 'Grinch no. 1' Spectra Sonic G6144 baritone electric guitar, made in Japan, ser. no. JD05021398; Body: black finish, surface scratches to back, scratches around upper strap button; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: original hard case with certificate of authenticity

*FormerlyownedandusedbyBrianSetzer.Purchasedbythevendor viatheSetzerReverbstoreon26thAugust2020andsoldwiththe originalReverbcertificateofauthenticity,hand-signedbytheartist. Setzernamedthisguitar“TheGrinchNo.1”,asnotedonthecertificate andinscribedontheexteriorofthecase.

£3000-5000

509.

Wendell Richardson (Osibisa & Free) B.B King & Muddy Waters interest - Stage and Studio used 1956 Gibson Les Paul Custom electric guitar, made in USA, ser. no. 6 9251; Body: black finish, heavy checking, dings and marks throughout including buckle scratching to back; Neck: black finish mahogany, heavy wear throughout, vacant tuner holes to back of head; Fretboard: ebony with pearl block position markers, light wear; Frets: light wear; Electrics: working; Hardware: missing pickguard, replacement control knobs, replacement switch tip and surround, sinking to bridge, replacement Schaller tuners, replacement strap lock buttons; Weight: 4.78kg; Overall condition: good

*SoldonbehalfofWendellRichardson,foundingmember,lead guitaristandprincipalvocalistofthepioneeringAfro-rock groupOsibisa,andbrieflytouringleadguitaristwithFreein 1973.

ThisguitarwasacquiredbyRichardsonin1972fromS.I.R. InstrumentRentals,LosAngeles,USA,andhasremainedinhis possessionandprofessionaluseeversince.Richardsonrecalls that,atthetimeofacquisition,hewasinformedthatthe instrumenthadpreviouslybeenownedbyMuddyWaters,who reportedlypasseditonduetoitsweight,afterwhichitissaid tohavebeenownedbyB.B.King,beforeenteringtheS.I.R. rentalinventory.Whilethisearlierprovenanceremains anecdotal,itformspartoftheinstrument’sknownoralhistory asrelayedbyRichardson.

In1973,RichardsonjoinedFreeastouringleadguitaristfor theirfinalU.S.tour,deputisingforPaulKossoff.He subsequentlyresumedhisrolewithOsibisa,contributingto theircontinuedinternationalsuccess.

BorninAntigua,WestIndies,RichardsonrelocatedtoLondon in1959andbecameactiveinthecapital’sthrivinglate-1960s musicscene beforeturningprofessionalin1971.Asa foundingmemberofOsibisa,hewascentraltothecreationof theband’sdistinctivefusionofAfricanhighlife,Caribbean rhythms,rockandjazz.Heperformedextensivelyontheir formativeandmostinfluentialrecordings,includingtheirdebut

albumOsibisa(1971)andWoyaya(1971),andcontributedtotheirinternationaltouringsuccessthroughout the1970s.Thebandachievedglobalrecognitionandchartsuccess,notablywiththehitsingleSunshineDay, andarewidelyregardedasoneofthemostimportantgroupsinestablishingAfro-rockandhelpinglaythefoundations fortheemergenceofworldmusicasaninternationalgenre.

InadditiontohisworkwithOsibisa,RichardsonreleasedhissoloalbumPiecesofaJigsawin1973andledseveral subsequentmusicalprojects,whilecontinuingtoperforminternationally.This1956GibsonLesPaulCustomremainedoneofhisprincipal instrumentsthroughouthiscareer,usedextensivelybothliveandinthestudioovermorethanfivedecades,andstandsasaninstrumentclosely associatedwithhisrecordedoutputandperforminglegacy.

£50,000-80,000

510.

Jet Harris - owned and autographed 1968 Gretsch Anniversary Model 6118 hollow body electric guitar, made in USA, ser. no. 28154; Body: sunburst finish, buckle rash patch to back including finish loss and scratching, light checking and other minor marks, pinhole mark to treble side of bridge; Neck: light wear throughout; Fretboard: rosewood, groove wear to first position; Frets: good, refret; Electrics: working; Hardware: good; Case: original hard case; Weight: 3.40kg; Overall condition: good for age

*ThoughttohavebeenownedfromnewbyEnglishrock‘n’ rollmusicianJetHarris.Harrissoldtheguitarinthe1980s,at whichtimeitwasautographedforitssecondowner.Itisnow beingofferedbyitsthirdowner.Itshistoryhasbeenmaintainedsolelyonaverbalbasis,withnophysical documentationsurviving.

£2000-3000

512.

Billy Gibbons - autographed and pinstriped JHS Vintage Lemon Drop electric guitar, ser. no. 40023773, inscribed with Billy Gibbons typical pinstriping and inscribed 'Peter Green Approved'

*AutographedandinscribedforthevendorwhenhemetBillyGibbons ataPMTeventinJuly2017.

£1000-2000

Hank Marvin - autographed Squier by Fender Hank Marvin signature Stratocaster electric guitar bearing Hank Marvin's autograph to the scratchplate, made in Japan, ser. no. G007203; Finish: Fiesta red, part refinish, with finish loss and stand burn to back; Fretboard: maple, some wear between fourth and sixth frets; Frets: good; Electrics: working; Hardware: customised gold to Hank Marvin spec; Overall condition: good

*Exlot369,GardinerHoulgate,25thJune2020.TheautographwasobtainedfrombyanaquantenceofHank Marvintobesoldforacharitablecause.(Seevideo)

**PleasenotethebookandLPfeaturedinthisvideoarenotincludedinthesale

£800-1200 511.

513.

Coldplay - autographed 2012 Gibson Les Paul Future electric guitar, made in USA, ser. no. 134221458, signed with annotations by members of UK rock band Coldplay, with original gig bag

*SoldonbehalfofformerBritishTouringCarChampionshipdriverandFifthGearpresenterJasonPlato,whowontheguitarinan auctiontobenefitthecharityWOMAC(WomenOnTheMove AgainstCancer)

£2500-3500

514.

Wilko Johnson - Autographed 2011 Fender Standard Telecaster electric guitar, ser. no. MX11235103, Candy Apple Red finish, bearing a signature in gold pen to the top, with gig bag

£300-500

515.

Mick Ralphs (Bad Company - Mott the Hoople) - artist owned 2012 Fender Cabronita Telecaster electric guitar, made in Mexico, ser. no. MX12154325, black finish, within Fender hard case

*PreviouslyownedandusedbyMickRalphsofBadCompanyandMotttheHooplefame.TheguitarfeaturesMickRalphs’preferredelectrical modificationandissignedbytheartistonthepickguardandreverseoftheheadstock.SoldwithaphotographofMickRalphsholdingtheguitar,framed alongsideaBadCompanypick,andaccompaniedbyaMickRalphsBluesBandT-shirt.AcquiredbythevendordirectlyfromMickRalphs.

£4000-5000

516.

Ronnie Wood - autographed 1995 C.F Martin 000-1 acoustic guitar, made in USA, ser. no. 565837, signed in gold pen to the pickguard, within Martin hard case

*Autographobtainedbythevendor,aroadcrewmemberofahighprofilebandwhohadtheguitarsignedbyRonnieWoodwhenperformingatthe 2016DesertTripFestival

£500-100

517.

Gordon Giltrap - owned 1970s Dick Knight twelve string acoustic guitar, made in UK; Back and sides: natural maple with light checking and marks throughout; Top: natural spruce; Neck: five piece maple and walnut, neck reset; Fretboard: ebony with abalone block position markers; Frets: good; Hardware: good; Case: contemporary SKB hard case; Overall condition: good

*FormerlyownedbyrenownedfolkguitaristGordonGiltrap,thisinstrument waspurchasedbyhimfromWunjoGuitars,DenmarkStreet,London.Itisone oftwoDickKnighttwelve-stringguitarsownedbyGiltrapand,accordingto theaccompanyingletterofprovenance,heregardedthisexampleassuperior inbothtoneandplayability.Theguitarisofferedwithahand-signedletterof authenticitydatedMay2014.Overtheyearstheinstrumenthasundergone someprofessionalrepairwork,includinganeckreset.ItissoldwithaJWhite GuitarWorkshopset-upreportdated4thSeptember2025.

£3000-5000

518.

Pete Overend Watts (Mott the Hoople) - 2015 Gibson Les Paul Traditional electric guitar, made in USA, ser. no. 150044118; Body: blue finished figured maple top upon dark back, light surface marks throughout; Neck: mahogany; Fretboard: rosewood with pearl crown position markers; Frets: good; Electrics: working; Hardware: good; Case: original hard case enclosing papers; Weight: 4.24kg; Overall condition: good

**FormerlyownedbyPeteOverendWattsofMotttheHoople.Soldon behalfofhissurvivingfamily

£1000-1500

519.

Gary Moore - 1979 Park 1215 100 watt 2 x 12 combo guitar amplifier, made in England

*PreviouslyownedbyGaryMooreandsoldthroughtheGuitar,Amp&KeyboardCentrein 2009.TheamplifierisaccompaniedbyacertificateofauthenticityfromtheGuitar,Amp& KeyboardCentredated8thMay2009andhand-signedbyGaryMoore.Theamplifier featuresmodificationscarriedoutbyGaryMoore,includingthereconfigurationofthe reverbchanneltofunctionasamastervolumecontrol.

£2000-4000

520.

Joe Bonamassa, Noel Gallagher & Paul Weller - Lazy J J-80 prototype 2x12 combo guitar amplifier, made in England, with integrated reverb and trem, made in England

*AprototypeJ-80amplifier,builtbyJesseHoffforPhilHarrisofHarrisHire.Thisamp formedpartoftheHarrisHirebacklinestockandwasloanedouttovariousartistsoverthe years,includingJoeBonamassa,NoelGallagher,andPaulWeller.Itisbelievedtohavebeen usedacrossmultipleprojectsinbothliveandstudiosettings.Soldwithaletterof provenancefromPhilHarrisconfirmingthesefacts

£2000-3000 521.

The Enemy - stage used 2008 Hiwatt 410115 guitar amplifier speaker cabinet, made in England, ser. no. U11598, white tolex

*CustommadebyHiwattforEnglishIndiebandTheEnemyastheydesiredawhiteand silverbackdropfortheir2008Glastonburyfestivalperformance.Thecabinetcanbeseen behindbassistAndyHopkinsduringtheirsub-headlineperformanceonTheOtherStage £300-400

522.

Ric Grech - Fender Twin Reverb Blackface guitar amplifier, made in USA, ser. no. A04203 (cabinet alterations. 110v with US Plug fitted) *FormerlyownedandusedbyBlindFaithandTrafficbassistRicGrech. FromTheNormanMitchellCollection.Theprovenanceofthisamplifieris anecdotal.

£1500-2500

523.

Steve Marriot (Small Faces) interest - Bigsby B5 vibrato circa 1960, obtained by the vendor during an exchange of guitars at a gig in Italy.

*Thevendorrecallsthatin1966hewasperformingwithThaneRussaland Three,duringwhichtimethegrouptravelledtoRomeand,intermittently overaperiodofapproximatelythreeyears,heldaresidencyatthePiper Club.Duringthisengagement,theysupportedprominentinternational actsincludingPinkFloyd,TheWho,SmallFacesandothers.Hefurther recallsthatin1967,whilesupportingSmallFaces,SteveMarriotttook particularinterestinthevendor’sFenderTelecaster,whichatthetimehad anotablywornappearance,longbeforesuchaestheticsbecame fashionable.Theinstrumentwasespeciallyrecognisablebythepresenceof threeadditionalholesintheheadstock,createdwhenthevendorhad brieflyfittedthreeextratuners.Seevideo-https://www.youtube.com/ watch?v=5NdGbQeTbxU.Accordingtothevendor,SteveMarriott subsequentlyofferedtoexchangehispinkGibsonLesPaulSpecial,which wasunusuallyfittedwithaBigsbyvibrato,fortheTelecaster(seehttps:// www.youtube.com/watch?v=6vWTtx_PxPo).Asanenthusiastof1950s LesPaulmodels,thevendoragreedtotheexchange.Helaterrefinished theguitarfrompinktocream,modifiedthewiring,andremovedtheBigsby vibratounit,whichhehasretainedseparatelyeversince.Whilstno photographicevidenceoftheexchangehasbeenlocated,thevendor’s accounthasbeencorroboratedbyMichael“Mick”BrillandAllenCollins, fellowmembersofThaneRussalandThree.TheBigsbyappearsingood workingorder,althoughthespringisnotoriginaltotheunit. £400-600 524.

Oates

*ThisClavinetwaspartofthetouringrigforHall&Oates,travellinggloballyandperformingonsomeoftheworld’smostrenownedstages.Itlater cameintothevendor’spossessioninthelate1980sduringtheirtenureatS.I.R.(StudioInstrumentRentals),NewYork,atatimewhenanalogue keyboardswerebeingwidelydiscardedinthewakeofdigitalinnovations.Whatmighthavebeenlosttohistorywaspreservedbyachance intervention,ensuringthisinstrumentsurvivedtheera’smassdisposal.TheClavinetsawactiveperformanceacrossNYCvenuesincludingCBGB andCaféWha!,andservedasthehouseinstrumentat208Studios,arecordingfacilityon7thStreetbetweenAvenuesB&C.Thepreampfeaturesa ByerDynamiccapacitorserialised1969,suggestingitisoneoftheearliestClavinetsproduced,precedingtheinstrument’scommercialreleasein 1971.Althoughthereisnoformalpapertrail,theinstrumentcanbedocumentedvisuallyinarchivalfootage,includingperformancesonTheOld GreyWhistleTest(1976),whereitisseenatopaWurlitzerelectricpiano.Notably,theClavinetbearsauniquealuminiumandrubbervolumeknob ontheleftside,neverseenonanotherinstrumentofitstype.Theoriginalknobisincludedwiththesale.ThisClavinethasbeensympathetically restoredtoensureplayabilityandreliabilitywhileretainingitshistoriccharacter.Cosmeticwear,marks,andminorimperfectionshavebeen preserved,reflectingitslifeontheroad.Professionalworkcarriedoutincludes:Replacementofupperpickup(VintageVibes),strings,rubber hammertips,volumeandmuteknobs,tuningcoverplate,thumbscrews,and9vbatterylead.Retentionoforiginalyarn-adetail.UseofVintageVibe SuperFunkystringsforbalancedtoneacrossallkeys.Historicfeaturesthatremainincludeoriginalstagemarkingsandmementos,including:Gaffer tapemarked“19”fromtouringinventory.Fortunecookiefortunetapedbeneaththevolumeknob.FirstNationsstickerontheupperright.Yellow tapemarkingsindicatingspecificsongsettings.TheClavinetpresentsfullyfunctional,honest,road-worncosmeticcondition.Structurallysoundand musicallyexcellent.ThisClavinetisnotintendedforthoseseekingapristine,showroomfinish.Itisaculturallysignificantinstrument,idealfor collectors,analogueenthusiasts,studioormuseum-gradeacquisition,orartistswhovalueprovenance.Comparabletoastage-usedguitar,itsstory enhancesitsvalue:itisbothaplayableinstrumentandahistoricalartefact.Arareopportunity,thisClavinetcombinesexceptionalsound, functionality,andanirreplaceablestagehistory,offeringatangiblelinktotheglobaltouringeraofthe1970sand1980s.

£4000-6000

Hall &

- stage used 1971 Hohner Clavinet D6 keyboard, made in Germany, ser. no. 770884

522

525.

The Beatles - video used 1968 Ludwig Black Oyster 16" floor tom, ser. no. 588679 and 13" rack tom, ser. no. 589294, both cased

*Arackandfloortom,loanedbyHarrisHiretotheproductioncompanyresponsibleforthevideoofTheBeatles’1996single“RealLove.”Thedrums werepartofalargerkit,intendedaspropsinhomagetoRingoStarr’soriginalLudwigBlackOysterdrumkit.Inthevideo,abassdrumandracktom appearamongotherBeatles-styleinstrumentsfloatingthroughthesky.Thedrumswereloanedaspartofalargerkit,withtheracktomandbass drumsubsequentlyshown;thebassdrum,bearingTheBeatleslogo,wasofferedforsalebythevendoratanearlierdate.Soldwithastatementof provenancefromthevendor,wholoanedthedrumstotheproductioncompany.

£1000-2000

526.

Bev Bevan (ELO & Black Sabbath) - pair of stage used vintage Slingerland kick drum pedals

*ThesekickdrumpedalswereusedbyBevBevanin1983forhis appearancewithBlackSabbathduringtheir“BornAgain”tour.The werespecificallyusedtoachieveafasterheaviersound.Purchasedby thevendordirectlyfromBevan

£100-200

527.

Bev Bevan (ELO & Black Sabbath) - pair of stage used vintage Slingerland kick drum pedals

*ThesekickdrumpedalswereusedbyBevBevanin1983forhis appearancewithBlackSabbathduringtheir“BornAgain”tour.The werespecificallyusedtoachieveafasterheaviersound.Purchasedby thevendordirectlyfromBevan

£100-200

528.

Bev Bevan (ELO) - small selection of drum hardware

*PurchasedbythevendordirectlyfromBevBevan

£50-100

523 (See page 85)

The Adrian Utley Collection

Adrian Utley is an English guitarist, multi-instrumentalist and producer, best known as a founding member of Portishead. Formed in Bristol in 1991, Portishead became one of the leading acts of the trip-hop movement, achieving international acclaim with albums including Dummy (1994), Portishead (1997) and Third (2008).

Alongside his work with Portishead, Utley has built a diverse career as a solo artist, composer and collaborator, working across film, television and contemporary music projects. Renowned for his distinctive guitar textures and studio craftsmanship, he remains an influential figure in British alternative music.

Gardiner Houlgate is delighted to offer the following 49 lots from Adrian Utley’s personal collection, all of which have been used throughout his career with Portishead or in his work as a solo artist.

Adrian Utley (Portishead) - 1936 Gibson L-5 archtop guitar, made in USA, ser. no. 94392; Body: figured maple back and sides and spruce top, light checking throughout, minor dings and marks as expected for age; Neck: sunburst finished maple, light wear throughout; Fretboard: ebony with pearl block position markers; Frets: good, refret; Electrics: working, rare 1940s McCarty pickguard installed (missing tone control); Hardware: good; Case: original hard case; Overall condition: good

*Usedforlaterprojects.Fittedwitharare1940sMcCartypickguardpickup.Astandardreissueguardisincludedinthesale £8000-10,000

530.

Adrian Utley (Portishead) - Stage and studio used 1997 Gretsch 9129 Silver Jet electric guitar, made in Japan, ser. no. 975129-1113; Body: top refinished in black, light play wear, brown finished mahogany body, dings and surface scratches throughout; Neck: maple; Fretboard: rosewood with pearl position markers; Frets: light wear; Electrics: working; Hardware: good; Case: original hard case; Overall condition: good

*ThisGretschSparkleJetwasusedextensivelybyAdrianUtleyacross recordingsandliveperformanceswithPortishead,Sparklehorse,John Parish,andotherprojects.Around2001,Utleyresprayedthetopblack.The accompanyingcasebearstheannotation:“PortisheadAdeGretschSparkleJet”.

£2000-4000

531.

Adrian Utley (Portishead) - Eastman DM2/V Gypsy Jazz acoustic guitar, ser. no. 13850640; Body: antique classic aged finished rosewood back and sides and spruce top, a few minor scratches and dings throughout; Neck: walnut; Fretboard: ebony; Frets: good; Hardware: generally good, missing base section of bridge plate; Overall condition: good

£500-800

532.

Adrian Utley (Portishead) - studio used JHS Vintage Metal Axxe electric guitar, ser. no. I03040265; Body: black finish with various marks and dings; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: generally good, missing switch tip and locking nut clamp; Overall condition: fair

*UsedbyAdrianUtleyonvariousprojectsandcommissionsasa'prepared' guitartoacheiveexperimentalsounds.

£80-120

533.

Adrian Utley (Portishead) - 1960s Sound Electronics Model X305R guitar amplifier, made in USA, ser. no. 60706

**UsedbyAdrianUtleyforvariousliveandstudioprojects

£200-400

534.

Adrian Utley (Portishead) - 1964 Ampeg Reverberocket R-12 R-B guitar amplifier, made in USA, fitted with Jensen Special Design speaker (original speaker retained)

£500-800

535.

Adrian Utley (Portishead) - studio used Zenta Solid State guitar amplifier

*UsedbyAdrianUtleyforvariousrecordings.Heslashedthespeakertoprovideabrutalsoundforrecordingguitarsandkeyboards

£80-120

536.

Adrian Utley (Portishead) - studio used 1940s Victor speaker cabinet

£30-60

537.

Adrian Utley (Portishead) - Orange Amplification guitar head cabinet

£30-60

530

531

534

538.

Adrian Utley (Portishead) - studio used Orange Amplification 15 watt guitar amplifier speaker enclosure, fitted with a Goodmans Audiom 15 ohm speaker

£50-100

539.

Adrian Utley (Portishead) - pair of Marshall Celestion Vintage G12 12" guitar amplifier speakers

£50-80

540.

Adrian Utley (Portishead) - studio used WEM Band Mixer PA amplifier head, made in England, ser. no. CW28927

£100-200

541.

Adrian Utley (Portishead) - pair of studio used WEM column speakers, ser. nos. CW49693 and CW05714, each with dust cover

£150-250

542.

Adrian Utley (Portishead) - pair of studio used WEM speaker columns, ser. nos. DW52580 and DW52579, with dust covers

£150-250

543.

1973 Adrian Utley (Portishead) - Rola Celestion G12M Greenback T1511 12" guitar amplifier speaker

£40-80

544.

Adrian Utley (Portishead) - Fane 122/10 12" 16 ohm speaker; together with a pair of 8" speakers

£40-80

545.

Adrian Utley (Portishead) - Studio used Vortexion 5-way 50/70 watt amplifier, with a pair of Ahuja UHC-20 tannoy speakers

£300-500

546.

Adrian Utley (Portishead) - Sovtek Big Muff fuzz guitar pedal

£300-500

547.

Adrian Utley (Portishead) - Pearl AD-08 Analog Delay guitar pedal, boxed

£50-80

548.

Adrian Utley (Portishead) - MXR Script logo Blue Box guitar pedal

£100-200

549.

Adrian Utley (Portishead) - MXR Distortion + guitar pedal

£40-60

550.

Adrian Utley (Portishead) - Foxx Tone Machine guitar pedal

£300-500

551.

Adrian Utley (Portishead) - 1960s Vox Tone Bender guitar pedal

£500-700

552.

Adrian Utley (Portishead) - Hallmark Guitars and Ed Sanner Electronics Nu-Fuzz guitar pedal, with certificate of authenticity

£150-250

553.

Adrian Utley (Portishead) - Electro-Harmonix Frequency Analyzer Ring Modulator EH-5000 guitar pedal

£100-200

554.

Adrian Utley (Portishead) - Late 1960s / early 1970s Maestro Fuzz-Tone FZ-1B guitar pedal

£150-250

555.

Adrian Utley (Portishead) - DOD Gonkulator Ringmod guitar pedal

£80-120

556.

Adrian Utley (Portishead) - Stimer of Paris Gypsy Jazz guitar pickup

£100-150

557.

Adrian Utley (Portishead) - DeArmond 1100 adjustable Rhythm Chief archtop guitar pickup, within original box

£500-600

558.

Adrian Utley (Portishead) - studio used MTI ADL-100 Analogue

String Ensemble rack unit, made in Italy

£200-400

559 (See page 91)

559.

Adrian Utley (Portishead) - Stage and studio used Solina String Ensemble Series 112 keyboard, made in Holland, ser. no. 0173866

*AnimportantpieceofPortisheadhistory,usedonallearly recordingsandtours.AlsousedbyAdrianforlaterprojects.

£1000-2000

560.

Adrian Utley (Portishead) - Murdoch Murdoch & Co Dulcitone keyboard in need of some restoration

£80-120

561.

Adrian Utley (Portishead) - Philips Philicorda organ, made in Holland, ser. no. 890989

£200-400

562.

Adrian Utley (Portishead) - xylophone with stand (unbranded) within a Gear4Music gig bag

£80-120

563.

Adrian Utley (Portishead) - studio used Atari 520STE personal computer, made in Taiwan, ser. no. A10AA3036319, with Atari SM124 monitor, made in Korea, ser. no. N1083045876, the monitor labelled 'Adrian Get a Studio'

*AdrianUtley'sfirstAtariPC.Usedforvariousrecordingincluding veryearlyPortisheadtracks

£200-400

564.

Adrian Utley (Portishead) - Heathkit by Daystrom Model AG-9U

Audio Generator

£30-50

565.

Adrian Utley (Portishead) - pair of Auratone 5C Super Sound Cube speaker monitors, bearing BBC labels to the reverse

£100-200

566.

Arian Utley (Portishead) - Iso-Tech ISR622 Oscilloscope, made in Malaysia, ser. no. 9861866

£80-120

567.

Adrian Utley (Portishead) - 1980s Bel Electronics BD-80S Stereo Delay sampler rack unit, made in England, ser. no. 3369

£200-300

568.

Adrian Utley (Portishead) - Yamaha FM Tone Generator TX81Z rack unit, made in Japan, ser. no. NM02709

£80-120

563

569.

Adrian Utley (Portishead) - HH Electronics V150-L Mos-Fet high performance professional power amplifier rack unit

£40-60

570.

Adrian Utley (Portishead) - Boss Pro SE-50 Stereo Effects processor, ser. no. A013604

£40-80

571.

Adrian Utley (Portishead) - Alice Matchpak IHF Pro Interface unit

£20-40

572.

Adrian Utley (Portishead) - Sochor Kamera Poglosowa K84 delay unit

£80-120

573.

Adrian Utley (Portishead) - SPL Transient Designer rack unit, ser. no. 0460263

£200-300

574.

Adrian Utley (Portishead) - large patch unit comprising both jack and Edac connections, sold with associated cables

£40-80

575.

Adrian Utley (Portishead) - three SKB rack flight cases

£50-100

576.

Adrian Utley (Portishead) - early 1960s Fender Jazzmaster/Jaguar electric guitar hard case

£300-400

577.

Adrian Utley (Portishead) - 1970s Gibson Les Paul electric guitar hard case (at fault)

£80-120

Jim Barr Collection

JimBarrisanEnglishbassistandcomposer,bestknownasamemberofPortishead. Renownedforhisatmosphericandmelodicbassplaying,Barrhasbeencentralto Portishead’sdistinctivesound.Inadditiontohisworkwiththeband,hehasbeeninvolved inarangeofmusicalandcompositionalprojects,furtherdemonstratinghisversatilityasa musician.

578.

Jim Barr (Portishead) - 1960s Baldwin 704 semi-hollow body bass guitar, made in England, ser. no. 71715; Body: red finish, finish checking, dings and marks to back, further dings and checking to front and sides; Neck: good; Fretboard: rosewood; Frets: wear throughout; Electrics: working; Hardware: missing pickguard; Case: original hard case; Weight: 3.12kg; Overall condition: good

**UsedbyJimBarrduringmanylivePortisheadperformances,aswell astherecordingoftheir2008studioalbum'Third'.

£1000-1500

579.

Jim Barr (Portishead) - 1970s WEM Halle Cat tape echo unit, made in England

**Ararecombinedecho/reverberation/4-waymixerunit,thataswellas beinga6-headtapeechounit,alsoincorporatedaHammondspring-activated reverberationunit.Theunitwasmarketedtowardsstudios,aswellaslargebands.

£500-800

580.

Jim Barr (Portishead) - 1970s Vox Tone Bender Mk III guitar pedal

£600-800

581.

Jim Barr (Portishead) - 1970s Sola Sound Colorsound Wah Wah guitar pedal

£100-150

582.

Poli Palmer (Family) - MalletKAT Pro percussion controller, made in USA, ser. no. 000474, within original gig bag, with pedal board and stand

£800-1200

583.

Poli Palmer (Family) - Marshall Model 6040 400 watt power amplifier rack unit, made in England, ser. no. 7685, within an SKB case inscribed 'Poli'

£40-80

584.

Poli Palmer (Family) - pair of Electro-Voice SX200 PA speakers, both inscribed 'Poli' to the back (2)

£30-50

585.

Poli Palmer (Family) - selection of audio stands and cables of various types for studio/live use, including a good quality Pelican type carry case

£30-60

578

579

586.

Johnny Marr - heavy duty Les Paul flight case type electric guitar hard case, with plush fitted interior *GiventoguitaristJamesStevensonbyJohnnyMarr.SoldwithstatementofprovenancefromStevenson £50-100

587.

Chris Rea - tour used guitar amplifier flight case bearing Chris Rea stencil to case lid, 69cm high, 82cm wide, 40cm deep *SoldonbehalfofPhilHarris.ThisflightcasewasformerlypartoftheHarrisHirebacklinestock. £50-100

588.

Andy Fairweather Low - Heavy duy guitar amplifier flight case on wheels, bearing A.F.L stencils to the exterior *SoldonbehalfofPhilHarris.ThisflightcasewasformerlypartoftheHarrisHirebacklinestock £50-100

589.

Style Council - tour used Packhorse flight case bearing Style Council stencils to the front and back, 87cm x 45cm x 24cm

*SoldonbehalfofPhilHarris.ThisflightcasewasformerlypartoftheHarrisHirebacklinestockandwasacquiredbyHarrisdirectlyfromPaulWeller. £100-200

Entertainment Memorabilia

601.

The Beatles - full set of autographs featuring Paul McCartney, John Lennon, George Harrison and Ringo Starr, with tribute 'Lots of love to Felicity from The Beatles...'. Signed within an autograph album also containing autographs of Cliff Richard, Coco the Clown and others, including notes to Felicity from school friends.

*SoldonbehalfofthedaughterofaformerEMIelectronicsengineer,who wasemployedbyEMIfrom1933untilhisretirement.Theautographswere obtainedwhilsthewasworkingatAbbeyRoadStudiosin1963during Beatlesrecordingsessions,enablinghimtosecurethesignaturesforhis daughter.

£4000-6000

602.

Abbey Road - an Abbey Road promotional sweatshirt (size 42)

*SoldonbehalfofthedaughterofaformerEMIelectronicsengineer,whowasemployedbyEMIfrom1933untilretirement,frequently workingatAbbeyRoadStudios.

£20-40

603.

The Beatles - various items to include George Harrison 'Early Takes Volume One' LP vinyl, a NEMS Enterprises George Harrison chewing gum card, The Beatles Book number 3 and five various books

£30-50

604.

The Beatles – Beatles Ltd Deluxe Pictorial Souvenir Booklet, 1964

*AreviewcopysenttoleadingBBCandRadioLuxembourg presenterandDJSamCosta.Inhertiedandsoldonbehalfofhis son,ArtisticDirectorDavidCosta.

Arareoriginalpre-publicationcopyoftheBeatlesLtddeluxe pictorialsouvenirbooklet,published17thFebruary1964, comprisingtwenty-fourpagespluscoversandmeasuring approximately12"x12".Heraldedonpublicationas“Thefirst deluxepictorialsouvenir,”thebookletpresentsaphotographic tributetoTheBeatlesattheheightofBeatlemania,featuringsome ofthemoststrikingandcarefullyproducedcontemporaryimages ofthegroup.

ThisexampleisaccompaniedbyitsoriginalcoveringletterfromTonyBarrow,pressandPRofficerfor NEMSEnterprises,datedMonday3rdFebruary1964.Theletterreadsinpart:“IhavepleasureinsendingyouoneofthefirstcopiesofBEATLES LTDforreviewinyourcolumns.IthinkyouwillbeinclinedtoagreethatthispublicationcontainssomeofthefinestphotographsofTheBeatlesever seen…”Notably,thiscorrespondencepredatestheofficialpublicationbyapproximatelytwoweeks,indicatingthatthisbookletwasamongtheearliest distributedreviewcopies.

Publicationsofthisformat,particularlythoseretainingoriginalpromotionalcorrespondencefromNEMS,arerarelyencountered.Thesurvivalofthe accompanyinglettersignificantlyenhancesthehistoricalandarchivalimportanceofthispiece,offeringdirectassociationwiththegroup’sofficial publicityoperationsduringoneofthemostpivotalmomentsoftheirinternationalrise.

£200-400

605.

Andy Scott (The Sweet) - autographed Stratocaster pickguard; together with a Sweet plectrum and rare 7" vinyl single by The Sweet, a cover of The Beatles Paperback Writer, in original picture sleeve

**AqcuiredbythevendordirectlyfromAndyScottofTheSweet.HavingbumpedintoAndyScottataguitareventseveralyearsago,thepairwould keepintouchandinvariouslettersAndywouldincludeaSweetguitarpick.In2022,healsosignedthisStratocasterpickguardforhim.

£50-100

606.

Eric Clapton - 'I Still Do' limited edition custom vacuum tube USB stick album, within original box

£30-50

607.

Eric Clapton - 'I Still Do' limited edition USB stick and CD denim boxset

£30-50

608.

Eric Clapton - Genesis Publications 'Sunshine of Your Love', Collectors Edition hardback book, within original slip case and bag, within original box packaging

£300-500

609.

Eric Clapton & B.B King - selection of various artist related items to include Eric Clapton's Six String Stories hardback book, a 1991 Eric Clapton at The Royal Albert Hall souvenir T-shirt (large), a 2023 Crossroads Guitar Festival poster and souvenir programme, three other books, two CDs and a DVD; together with five B.B. King related items to include a B.B. King at The Royal Albert Hall hoodie (large), a B.B. King 2011 tour T-shirt (medium), a B.B. King King of the Blues T-shirt (large) and two biographies

£100-200

610.

Three guitar auction catalogues to include Jeff Beck - The Guitar Collection, Christie's, 22nd January 2025, Mark Knopfler - The Guitar Collection, 31st January 2024 and Eric Clapton - Sale of Guitars and Amps in Aid of The Crossroads Centre, Bonhams, 9th March 2011 (3)

£40-60

604

611.

Elton John – Louder Than Concorde Tour, 1976 – Original Artwork by David Costa

*Originalfull-colourairbrushedartworkcreatedbyartisticdirectorDavidCostaforEltonJohn’scelebratedLouderThanConcordetourof1976, executedonCS10FineArtboardandmeasuringapproximately20x14inches.Theartworkdemonstratesaconfidentuseofairbrushtechnique, combiningprecisetonalgradationwithvividcolourapplicationtoproduceastrikingandhighlypolishedfinalimageintendedforofficialtour promotion.

Accompanyingtheprincipalartworkistheoriginalone-colourcopyartwork,preparedseparatelyformonochromepressreproductionandpublicity use,illustratingthepracticalstagesofthedesignprocessandofferinginsightintothetranslationoforiginalartworkintoprintedpromotional material.AlsoincludedisanoriginalLouderThanConcordesouvenirprogramme,showcasingtheartworkonthefrontcover.

ThisartworkwasproducedduringapivotalperiodinEltonJohn’scareer,the1976LouderThanConcordetour,namedafteraremarkbyPrincess Margaret,whotoldthesinger,“You’relouderthanConcordeonstage,”highlightingtheimmensevolumeofhisperformances,whichwereamongthe loudestofthatera.Theyear1976alsomarkedthelaunchintocommercialserviceofConcorde,makingthisartworkparticularlyresonantasthe fiftiethanniversaryofthatlandmarkinaviationhistoryapproaches.

Costa,arespecteddesignerandartdirectoractiveduringthe1970sandensuingdecades,wasresponsiblefornumerousnotablecommissionswithin musicandrelatedfields.Hisoriginalartworksfromthisperiodareincreasinglyrecognisedassignificantartefactsofpopularmusichistoryintheir ownright.

Retainedbytheartistandofferedheredirectlyfromtheauthor,thisrepresentsauniqueandimportantsurvivingexampleoftour-relatedartwork fromoneofEltonJohn’smostfamoustouringperiods.Suchcompletepresentationpieces,incorporatingbothfinishedcolourartworkandassociated productionelements,areexceptionallyrareandoffercollectorsacompellingopportunitytoacquireoriginalmaterialcreatedforalandmarkmoment inpopularmusichistory.

£3000-5000

612.

Frank Zappa - original 1971 Frank Zappa and the Mothers of Invention tour poster, designed by renowned illustrator Gunther Kieser, 47" x 33"

*FamousGermangraphicartistGuntherKieser designedthiselaborate artwork,whichisoneof hismostrecognisedposterdesignsand arguably thebestFrankZappaconcertposter evercreated

£400-600

613.

Led Zeppelin - Knebworth Festival poster, 11th August 1979, featuring headliners Led Zeppelin, along with The New Barbarians, Todd Rundgren, Southside Johnny, Marshall Tucker Band etc, 30" x 20.25"

£100-200

614.

Knebworth Festival - Artists various - a collection of five 1999 Limited Edition Knebworth Festival reissue posters, each limited to 750 reprints and signed by promoter Freddy Bannister; including 20th July 1974 featuring Alman Brothers Band, Van Morrison Show, Doobie Brothers, Mahavishnu Orchestra, Alex Harvey and Tim Buckley; 5th July 1975 All Roads Lead to Knebworth poster featuring Pink Floyd, Steve Miller Band, Captain Beefheart and Roy Harper; 1976 Knebworth Fair featuring Rolling Stones, Hot Tuna, Lynyrd Skynyrd, Todd Rundgren's Utopia; 9th September 1978 Not Another Boring Old Knebworth featuring Frank Zappa, Tubes, Peter Gabriel and The Boomtown Rats; 24th June 1978 Midsummer Night's Dream featuring Genesis, Jefferson Starship, Tom Petty and The Heartbreakers, Atlanta Rhythm Section (5)

£100-200

615.

Jimi Hendrix - Voodoo Soup Limited Edition print, 61/200, published for Alan Douglas’s Jimi Hendrix exhibition 1992, 24" x 24"

£100-200

616.

Peter Green - strap buttons with related fixings from one of Peter Green's personal guitars, mounted and framed with a photograph of Green *Soldonbehalfofthevendor,whopurchasedLot 128fromtheBonhams“ManoftheWorld:The PeterGreenCollection”auctionon28thJune 2023.Bearingalettertothereverse concerningtheprovenanceandacopyofthe auctionlotreceipt.SoldwithabookandthreeCD setofearlyFleetwoodMacrecordings

£80-120

617.

Ronnie Wood - Faces guitar picks, within a framed display

£50-100

618.

Rolling Stones - Steiff Limited Edition Rolling Stones bear, within original box enclosing certificate, packaging and tags

£80-120

619.

Mark Knopfler - autographed Star Cards framed display, 27.5" x 18.5"; together with further Mark Knopfler memorabilia to include a 2008 Kill to Get Crimson souvenir tour programme and zip-up hoodie (large), Mark Knopfler's Guitar Heroes disc, a limited edition Boom Like That 7" 45rpm single and two CDs (7)

£50-80

620.

Joan Armatrading - autographed Star Cards framed display, 18" x 17"

£30-60

621.

Roger Hodgson (Supertramp) - autographed Star Cards framed display, 20.5" x 15.75"

£30-60

635 (See page 97)

622.

Bernie Marsden - 'Tales of Tone and Volume', Rufus Publishing hardback book, within original slip case

£40-60

623.

Sting and The Police - six various items to include an autographed copy of Stewart Copeland's - 'Strange Things Happen', two Sting hardback books and three DVDs

£30-50

624.

Angela Bowie - autographed copy of 'The Recent Years' a collection of twenty-seven original poems by Angela Bowie, 1977

*SoldonbehalfofproducerandwriterMike Shaw.ThisisanearlycopyofAngelaBowie's poetrycollectionbook.Thefrontpage inscribed'DearMike,hereismyrevisedand finalpoetrybook.Hopeyouenjoyit!,Much loveAngie'

£100-200

627 (See page 97)

625.

Shakin' Stevens & Marc Bolan interestselection of contract correspondence sent to Mike Shaw from the late 1970s through to 1980, discussing contracts and royalties for Shakin' Stevens music, sold with a signed black and white promotional photograph, a Shakin' Stevens press pack and an unreleased artwork photograph; together with a selection of contractual letters relating to Marc Bolan's 'The Beginnings of Doves' LP

*MikeShawwasaBritishmusicindustry professional,primarilyknownasaproducer, compilationproducer,andmanagerwho workedwithShakin'Stevensinthelate1970s. Heiscreditedwithproductionand compilationworkonalbumslikeShakin' Stevens(1978)andTheTrackYears!. £100-200

626.

Buzzcocks – Folio of eight original Buzzcocks logo proof artwork designs, likely dating from the 1980s, supplied to John Henry from Krimson/Brockum. Comprising eight 50 × 39 cm cards, each featuring a different design with logo variations. The outer card folio inscribed “From: Satori.”; together with a collection of original original proof artworks, photos and negatives relating to the 1980s rock band Raymonde, the proof artwork relating to their 1988 Destination Breakdown release; also a collection of original proof artworks for early 1990s Techno label Planet Pacific; also three framed displays, one displaying the cover for December 1977 Interview Magazine featuring The Sex Pistols £300-500

627.

Elvis Presley interest - Rare 1960 Elvis Presley “Standee” for the film G.I. Blues

*Originally9fthigh,thisreducedexampleis oneofonlytwoknowntohavesurvived.The othercompleteexamplesoldataUSauctionin 2019for$1,400.See:https:// bid.gwsauctions.com/auction/13/item/elvispresley-gi-blues-1960-9-ft-original-theaterstandee-display-1513/ £200-400

628.

The Who - concert poster reprint for The Who plus The James Gang, Philadelphia Spectrum, Philadelphia, Wednesday June 24 1970, framed, frame measures 33.5" x 24" £40-80

629.

Punk interest - twelve 1970s NME magazines all with punk related cover features, including 6th August 1977 Sex Pistols feature and 21st May 1977 Ramones feature

£80-120

630.

New Musical Express - approximately twenty issues from the late 1970s, each with iconic artist cover features including Pete Townshend, David Bowie, Jimmy Page, Iggy, Marc Bolan, Elvis Costello, Tom Petty, Wilko Johnson, Van Morrison, Bob Geldof, Paul Weller, Sting, Bob Marley, The Who, Rolling Stones, Muddy Waters and Siouxsie

£50-100

631.

The NME - over forty various New Musical Express magazines dating from the mid 1970s through to early 1980s

£50-100

632.

Van Morrison in Concert '85 tour jacket, size large; together with David Bailey's Rock and Roll Heroes hardback book: Tommy at 50, The Mood, The Music, The Look and The Legacy of The Who's Legendary Rock Opera, hardback book; a Classic Rock magazine Kiss special issue 261 May 2019 (sealed) and a Judy Tzuke Full Moon Complete Collection 24 CD box set (5)

£30-50

633.

Blues Unlimited magazine, numbers 45-55, August 1967 to July 1968

£20-40

634.

Iron Maiden - The Sound House Tapes 7" vinyl EP, Hard Rock Records, 1979

£400-600

635.

Def Leppard - autographed The Def Leppard EP 7" vinyl EP, Bludgeon Riffola Records, 1979, within original sleeve enclosing insert, autographed by band members to the reverse

£800-1200

636.

Bleak House - autographed Rainbow Warrior 7" vinyl, Buzzard Records, 1980 autographed by members of the band to front cover, also annotated to the back

£40-80

637.

Marquis de Sade - Somewhere Up in the Mountains/Black Angel 7" vinyl, X-Pose Records, 1981

£30-50

638.

National Gold - I Need Your Time/I'm a Loner 7" vinyl, K & M Records, 1981, within paper sleeve

£50-100

639.

Heavy metal - collection of five heavy metal 7" vinyl singles to include Hellanbach 'Out to Get You EP', Sparta 'Fast Lane/Fighting to be Free', Crucifixion 'The Fox/Death Sentence', Avalanche 'The Preacher/Mean Lady' and Praying Mantis 'Captured City' (5)

£50-100

640.

Blitzkrieg - Buried Alive, 7" vinyl, Neat Records, 1981

£50-80

641.

Radium - Through the Smoke, 7" vinyl, Isotope Records, 1981

£30-60

642.

Overkill - Elemental/On My Own 7" vinyl, Killer Records, 1980

£30-50

643.

Hell Razer - autographed Glam Girl/The Devil's Got the Deeds to Rock n Roll 7" vinyl, Alias Smith & Jones Records, 1981, autographed to the outer paper sleeve

£40-80

644.

Witchfinder General - Burning a Sinner/ Satan's Children 7" vinyl, Heavy Metal Records, 1981

£30-50

645.

Judas Priest - Rock Forever/Hellbent for Leather/Beyond the Realms of Death 7" promo vinyl, CBS Records, 1979

£40-80

646.

Five various heavy metal 7" vinyl singles to include Dragster 'Ambitions/Way to Bring You Back', Heritage 'Strange Place to Be/ Misunderstood', Turbo 'Stallion/Running/ Take My Life', Street Fighter 'Crazy Dream/ Livin' on the Red Line/City Girls/Street Fighter' and Sparta 'Angel of Death/ Tonight' (5)

£40-80

647.

Five heavy metal 7" vinyl records to include Venom 'In League with Satan/Live Like an Angel', Triarchy 'Save the Khan', Dawn Trader four track EP, Buffalo 'Battle Torn Heroes/Woman of the Night' and Night Time Flyer 'Out with a Vengeance/Heavy Metal Rules' (5)

£50-100

648.

Three heavy metal 7" vinyl records to include an autographed copy of Jaguar 'Backstreet Woman', Aragon 'Black Ice/Noon Day', and Metal Mirror 'Rock and Roll Ain't Never Gonna Leave Us/English Booze (3)

£40-80

649.

Lautrec - autographed Mean Gasoline/Shoot Out the Lights 7" vinyl record, Street Tunes Records, 1980, autographed by band members to side A

£30-60

650.

Six heavy metal 7" vinyl records to include Bitches Sin 'Always Ready (For Love)', Rokka 'Come Back/Touch and Go', Steel 'Rock Out/ All Systems Go', Holocaust 'Heavy Metal Mania/Only As Young As You Feel', Weapon 'It's a Mad Mad World/Set the Stage Alight' and Black Axe 'Highway Rider/Red Lights'; also with 38 Special 'Hold on Loosely' 7"(7)

£50-100

651.

Artists various - Show of Hands 'No Secrets A Visual History' hardback book; together with a selection of souvenir and other Tshirts, hoodies and programmes, artists including Chris Rea, Joe Satriani, UB40, Paul Carrick, Elton John, Ali Campbell, Eric Bibb, Joan Armatrading, Simple Minds, Peter Green etc

£50-100

652.

Original 1960s Columbia Records Merry Christmas circular poster, 15"

£20-40

653.

John McCormack - a group of vinyl 45 recordings, including RCA Camden, EMI etc; together with a McDermott Roe complete McCormack discography autographed by John McCormack dated July 1911; also an HMV gramophone recording, three EMI tape cassette box sets and assorted CD recordings

£200-400

654.

Artists various - large selection of music related DVDs including many popular artists within the rock, pop, blues and folk genres

£80-120

655.

Artists various - large collection of CDs including many popular artists from the rock, pop, blues and folk genres, many still sealed; together with a box set of Saturday Night Live DVDs and a set of five Transatlantic Session DVDs

£50-100

656.

Artists various - good collection of music related biographies and other hardback/ paperback books

£40-80

657.

Artists various - selection of Record Store Day limited edition and other LP and 45rpm vinyl records to include Steve Miller Band, Ocean Colour Scene, Joe Bonamassa, Steve Craddock, The Alman Brothers Band, Michael Kiwanuka, Paul Weller, Nile Rogers, Richard Thompson and The Waterboys

£40-80

658.

Selection of limited edition and other CDs to include four autographed CDs (Eric Johnson, Eugene Hideaway Bridges, Elizabeth Cooke and Judy Collins), other CDs to include Mike and the Mechanics, Chris Rea, Foreigner, Roger Waters, David Gilmour, Thea Gilmour and Dave Matthews Band

£40-60

659.

Autographed display of the Kenny & City Express Rock n Roll Night, Saturday 24th October 1979, bearing various autographs to include Kenny, Ginger Rogers, Keith Emerson and others

£20-40

LOTS 660-700 NO LOTS

End of Day one sale

Day two

Guitars Part II & Amplification

Wednesday 11th March 2026 at 10am

Guitars Part II

701.

Vendor made Patrick Eggle inspired custom electric guitar, made in UK; Body: Patrick Eggle style varnished body, natural Tung oil finished Iroko; Neck: Music Craft birds eye maple neck; Frets: good; Electrics: working, Bare Knuckle Pickup Mississippi Queen Alnico IV pickups with Switchcraft electrics; Hardware: Schaller bridge, Gotoh locking tuners, carbonfibre nut, Music Craft knobs; Case: gig bag; Overall condition: good

£100-200

702.

2012 Epiphone Les Paul Custom Pro lefthanded electric guitar, made in China; Body: black finish, a few light surface marks; Neck: good; Fretboard: rosewood; Frets: lightly tarnished with some oxidisation to upper frets; Electrics: working; Hardware: missing nut and truss rod cover, light scratching to pickup covers; Case: hard case; Weight: 4.00kg; Overall condition: good

£100-200

703.

2015 Gretsch Electromatic G5420 lefthanded hollow body electric guitar, made in Korea; Body: orange finish; Neck: good; Fretboard: rosewood with pearl hump position markers; Frets: good; Electrics: working; Hardware: good; Case: Yamaha branded Hiscox hard case; Weight: 3.20kg; Overall condition: very good

*Currentlyset-upright-handed £200-300

704.

2003 Peavey Generation Custom EXP electric guitar, made in Korea; Body: purple quilt maple top upon black gloss back, minor dings and surface marks to back; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: upgraded with Bill Lawrence rail pickup to bridge position, GFS pickup to neck position and Graphtech Piezo saddles to bridge, modified wiring with additional coil switch; Hardware: good; Case: original Peavey hard case; Weight: 3.52kg; Overall condition: good £150-250

705.

2006 Epiphone Dot Studio semi-hollow body electric guitar; Body: white finish, yellow hue, various minor dings; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Gator hard case; Weight: 3.56kg; Overall condition: good

£150-250

706.

2006 Schecter Diamond Series 006 Deluxe electric guitar, made in Korea; Body: satin black finish, minor knocks and blemishes to edges; Neck: maple; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Overall condition: good

£150-250

707.

Marlin Sidewinder electric guitar with later fitted Kahler trem (at fault)

£80-120

708.

1980s Suzuki W-120VSC acoustic guitar, made in Japan, with soft bag

£150-250

709.

Eko Ranger 12 twelve string acoustic guitar, made in Italy, sunburst finish

£80-120

710.

Tanglewood Rebel 4K bass guitar, red finish, within original box

£50-100

711.

Tonewood Square neck resonator guitar, made in China, ebony finish with marks and dings throughout, together with a Feeling AStyle Mandolin in natural finish (2)

£50-100

712.

Modified 1970s Japanese short scale electric guitar

£40-80

713.

1970s Hohner S-Type electric guitar, made in Japan, natural finished ash body (imperfections), maple neck with twenty-one fret maple fretboard

£80-120

714.

1970s Ibanez acoustic guitar in need of some attention, made in Japan, cherry sunburst finish

£80-120

715.

1986 Epiphone S400 electric guitar, made in Korea, black metallic finish, within Gator hard case (finish imperfections, missing trem arm)

£100-200

716.

2007 SDGR Soundgear by Ibanez SR505 bass guitar, made in Korea; Body: brown finish (imperfections), within TGI gig bag

£100-200

717.

2008 Fender Ashbory bass guitar, with original gig bag

£80-120

718.

Futurama T-Type electric guitar, Lake Placid blue finish

£50-100

719.

Tanglewood TW73B NA electro-acoustic guitar

£100-200

720.

Yamaha APX-5A electro-acoustic guitar

£100-150

721.

Jagard six string lap guitar, with Shubb SP3 tone bar

£50-80

722.

2022 Ovation Celebrity CE44LX-1R-G left-handed electro-acoustic bowl back guitar, with gig bag

£150-250

723.

2013 Tanglewood TW145/12 left-handed electro-acoustic guitar, with hard case

£80-120

724.

2018 Crafter SA-12L left-handed hollow body electric guitar, trans black finish, within original hard case

£150-200

725.

C.F Martin Backpacker travel acoustic guitar, with original gig bag

£80-120

726.

Yamaha F-310 acoustic guitar; together with a Yamaha CG-100A classical nylon string guitar (2)

£50-100

727.

SX VTG Series Custom Telecaster electric guitar, blonde finish, within deluxe hard case

£80-120

728.

Pignose PGG travel guitar, with original gig bag

£70-100

729.

Squier by Fender Stratocaster electric guitar, made in Korea, circa 1991; Body: black finish, various minor dings and surface scratches; Neck: maple, dings and marks throughout; Fretboard: rosewood; Frets: mild wear throughout; Electrics: working, some minor switch intermittence; Hardware: upgraded Wilkinson tuners, upgraded bridge, replacement control knobs, missing spring cavity back plate; Overall condition: good

£100-200

730.

Partscaster Strat type electric guitar with yellow finished body, twenty-one fret rosewood board neck, Alnico zebra humbucker pickup and Fender vintage style tuners

£80-120

731.

Epiphone EO-1VS electro-acoustic guitar, sunburst finish

£80-120

732.

Artist ABJ50CEQ electro-acoustic bass guitar, with original gig bag

£40-80

733.

2018 Gretsch Electromatic G5220 Jet electric guitar, made in China, purple sparkle finished top, with gig bag

£150-250

734.

1958 Hofner Senator guitar, blonde finish (fine hairline parting at neck join)

£150-250

735.

1970s Columbus Strat type electric guitar in need of some attention (electrical faults and general maintenance required)

£80-120

736.

1960s Migma violin bass guitar in need of restoration

£80-120

737.

1960s Rosetti Sheerline 7 electric guitar, red burst finish

£80-120

738.

1966 Catania Carmelo 1/ERG hollow body electric guitar

£100-200

739.

1960s Teisco Starway MJ-2L electric guitar, made in Japan; two-tone sunburst finish, a few minor dings; Neck: good; Fretboard: rosewood; Frets: good; Hardware: missing trem arm; Overall condition: good

£80-120

740.

Zenith Model 17 archtop guitar in need of restoration; together with a Western Ranger acoustic guitar (2)

£50-80

741.

1980s Casio DG-20 Digital Guitar

£150-250

742.

James Neligan Lismore LIS-ACFI electroacoustic guitar, with Chord compressed foam case

£80-120

743.

Flying V electric guitar, unbranded, with red finish body and twenty-two fret rosewood board bolt-on neck (finish imperfections)

£80-120

744.

Wesley Warlock style electric guitar (missing trem arm)

£40-60

745.

2018 Epiphone SG electric guitar, made in China, cherry finish with minor imperfections, replacement rail humbucker pickups and white control knobs, within gig bag

£80-120

746.

Ibanez EWP14WB-OPN electro-acoustic travel guitar, within Kinsman hard case

£80-120

747.

Yamaha Pacifica PAC112J electric guitar, blue metallic finish, within Squier gig bag; together with a Crate GT15R guitar amplifier (2)

£80-120

748.

2003 Squier by Fender Bullet Strat electric guitar, sunburst finish, with gig bag; together with a modified Satellite 76/ B electric guitar (2)

£50-100

749.

Two bowl back acoustic guitars to include an Ovation Celebrity Deluxe CC247 and an AXL (2)

£100-200

750.

Fender Gemini II E acoustic guitar, made in Korea; together with an Audition twelve string guitar in need of some attention (2)

£60-100

751.

Five acoustic guitars in various states of repair to include a Fernando WSC-5001, a Hohner MC-05 classical, a Yamaha C-40 classical, a Loredo 80F and a Falcon (5)

£80-120

752.

Fernandes Dragonfly electric guitar, seethrough olive finish, large impact blemish to top and smaller one to upper horn, with Indie Guitars gig bag

£120-180

753.

Columbus hollow body electric guitar, made in Japan, circa 1969; Body: red finish, minor dings and various scratches throughout; Neck: bolt-on, various dings; Fretboard: rosewood; Frets: worn; Electrics: working; Hardware: missing trem arm, missing lower strap button, missing switch tip, missing tuner bushings, tarnishing to bridge and tailpiece; Overall condition: fair

£150-200

754.

Aria Sinsonido nylon string skeleton electric travel guitar, within original gig bag

£100-200

755.

East Coast Strat type electric guitar

£40-60

756.

2021 Squier by Fender Paranormal Cabronita Telecaster Thinline electric guitar, made in China, blue metallic finish

£150-250

757.

Harley Benton Pro Series Fusion III electric guitar, within Tourtech hard case

£80-120

758.

Eko NXT Series DXII twelve string acoustic guitar, made in China; Finish: gloss black with some warping around bridge; Fretboard: rosewood; Frets: tarnished with some sprouting; Electrics: working; Overall condition: fair

£50-100

759.

Harley Benton VT Series HB-35 semi hollow body electric guitar, finish: cherry; fretboard: rosewood; frets: good although slight tarnishing and sharp edges; electrics: working although intermittent; overall condition: good although will benefit from a service

£80-100

760.

Freshman FA1AWR electro acoustic guitar, together with a Tanglewood Nashville Series III TSF8 electro acoustic guitar (some splitting to top); Electrics: working (2)

£80-120

761.

2021 Epiphone SG Special VE electric guitar, made in China, satin ebony finish; Electrics: working

£70-90

762.

1997 Yamaha Pacifica 112X electric guitar, made in Taiwan, Body: Natural finish, some marks and dings to edges, with buckle wear to back; Neck: maple, good; Fretboard; Rosewood; Frets: Good; Electrics: working; Hardware: good; Weight: 3.22kg; Overall condition: good for age

£80-100

763.

Ibanez PF1512 electro acoustic twelve string guitar, made in Indonesia; Top: Natural spruce; Electrics: working; Overall condition: good

£50-80

764.

Epiphone EJ200-CE electro acoustic guitar, black gloss finish with some dings and marks to top; Electrics: working, soft bag

£150-250

765.

2013 Epiphone Wildkat Royale semihollowbody electric guitar, made in China; Body: Pearl white; Neck: good; Fretboard: rosewood; Frets: good: Electrics: working; Hardware: good; Weight: 3.80kg; Overall condition: good

£200-300

766.

Gear4Music Brooklyn double neck electric guitar, cherry finish; Electrics: working; box

£100-200

767.

2015 Epiphone Dove Pro acoustic guitar, made in Indonesia; Body: Violin Burst finished spruce; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: Stagg hardcase; Overall condition: good

£100-200

768.

Applause by Ovation AE 28M electro acoustic guitar, together with a Yamaha C40 nylon string guitar

£80-120

769.

Epiphone Slash Signature "Appetite for Destruction" Les Paul Special II, made in China, soft bag

£80-120

770.

Replica Red Special electric guitar, Gear4Music soft bag

£100-200

771.

1970 Kasuga W-13 acoustic guitar, made in Japan, Back and Sides: Mahogany; Top: Spruce; Neck: Mahogany, some relacquering around the neck/body join ; Fretboard: Rosewood; Frets: Refret, some frets are too short, and fairly low; Overall condition: Good for age

£80-120

772.

1960s Kay Small bodied acoustic guitar, made in USA; Finish: sunburst, marks to edges and back; Fretboard: Maple, good; Frets: wear throughout; Hardware: generall good; Case: soft bag; Overall Condition: good for age

£80-120

773.

1970s Kasuga F-10 acoustic guitar, made in Japan; Body: Natural finish laminated spruce; Back and Side: Mahogany; Neck: Mahogany; Fretboard: rosewood; Frets: wear throughout, some frets too short for the fretboard; Overall condition: good for age

£80-120

774.

Fernandes Retrorocket X electric guitar, made in China, aquamarine finish with many marks to back, electrics: working; together with an unbranded black "S" type electric guitar (2)

£100-200

775.

Vantage 115T-1ABS electric guitar, made in korea, brown burst finish with some surface marks to top and back; electrics: working; gig bag

£50-80

776.

1980s Mustang Precision style bass guitar, black finish (imperfections)

£30-60

777.

Custom Build Telecaster Custom style electric guitar, comprising double bound blue metallic body, Tokai Goldstar Sound Strat neck, single pickup with custom wiring (kill switch/tone/tone bypass), compensated brass bridge saddles, Kluson style tuners and other miscellaneous hardware

£100-200

778.

Custom Build Strat type electric guitar made from new parts, comprising maple topped top bound ash body, twenty-two fret maple board neck, single humbucker pickup and CTS pots

£100-200

779.

Custom Build Strat type electric guitar made from new parts, comprising metallic silver Strat type body, twenty-two fret maple board neck with matching head, zebra humbucker pickup and single volume control

£100-200

780.

1980s Encore Super Strat type electric guitar, pearl metallic finish (imperfections), within SX guitar soft bag (missing trem arm, missing nut clamps)

£40-60

781.

1980s Hondo Les Paul type electric guitar, black finish (imperfections), with gig bag

£40-60

782.

Modified 1980s Hohner Professional ST Victory electric guitar, blue finish (minor imperfections), scalloped rosewood fretboard and later fitted full body faux shell guard, within Fender gig bag (missing trem arm)

£60-100

783.

JHS Vintage Les Paul style electric guitar, black finish (minor imperfections), within Fret King gig bag

£50-100

784.

1980s Hondo Fame Series H760 twelve string electric guitar, made in Korea, metallic red finish (minor imperfections), within old oblong hard case

£40-60

785.

2024 Squier by Fender Telecaster electric guitar, butterscotch finish, within TGI soft case

£70-100

786.

Washburn EA Series twelve string electro-acoustic guitar, with figured birds eye maple back and sides, natural spruce top, within Ritter gig bag

£150-250

787.

Harley Benton SC-450 Plus electric guitar

£80-120

788.

Stagg Twelve String acoustic guitar, together with a Makala Ukulele, a Guvnor three-quarter size nylon string guitar and a Barnes & Mullins five string banjo

£50-100

789.

Three guitars to include: A Yamaha ERG 121, an Encore "S" type and a Columbus "LP" type electric guitar, all requiring some attention

£50-100

790.

Four guitars to include a Squier Bronco Bass, an Encore "S" type, an Eleca 3/4 size "S" type and a Tanglewood "LP" type electric guitar, all requiring some attention

£50-100

791.

Kay KD-28 acoustic guitar together with, an Ashton D25NTM acoustic guitar and an Ozark pear shaped mandolin (3)

£40-80

792.

JHS Vintage hollow body electric guitar, sunburst finish, with Yamaha gig bag

£80-120

793.

Squier by Fender Stratocaster electric guitar, made in Japan; Body: white finish body, various marks and dings; Neck: maple, scuffs and marks; Fretboard: rosewood; Frets: good; Electrics: working, replaced; Hardware: generally good, replacement guard; Overall condition: fair

£100-200

794.

1970s Eko Ranger 6 left-handed acoustic guitar, made in Italy

£50-80

795.

Kiso Suzuki F10 acoustic guitar; together with a Jim Deacon JDX30 acoustic guitar (2)

£80-120

796.

Harley Benton CST-24 Deluxe semi-hollow body electric guitar, dark sunburst finish (minor surface imperfections)

£80-120

797.

2025 Fender California Debut Redondo CE electro-acoustic guitar, made in China, sunburst finish (minor finish imperfections)

£80-120

798.

Modified 1970s Antoria electric guitar, red refinish (old head repair)

£50-100

799.

2003 Samick IHJ-20/GS hollow body electric guitar, two-tone sunburst finish

£100-200

800.

Custom build Tele type electric guitar with blonde finished ash body

£80-120

801.

Custom build Telecaster Custom electric guitar with candy apple red finished bound body (thought to be Tokai)

£150-250

802.

Custom build Strat type electric guitar comprising 1970s Japanese parts

£100-200

803.

Custom build Strat type electric guitar comprising Allen Eden sunburst finished body, Allparts neck, Fender bridge and Alnico pickups

£150-250

804.

Custom build Strat type electric guitar comprising Allen Eden Sienna sunburst finished body, Allparts neck, Fender bridge and Alnico pickups

£150-250

805.

1980s Hohner Professional TWP Classic-N nylon string electric guitar, made in Korea

£50-100

806.

Vester Stage Series Tele type electric guitar, cream finish (imperfections)

£40-80

807.

Craftsman Flying V electric guitar, cherry finish (minor imperfections)

£100-200

808.

2004 Washburn J28SCE DL electroacoustic guitar, made in China, within Freshman hard case

£150-250

809.

1961 Hofner Senator archtop guitar, made in Germany; Body: brunette finished maple back and sides and spruce top, light checking throughout, light scratching to back; Neck: mild bow and separation at heel, resetting required; Fretboard: rosewood; Frets: tarnishing throughout; Electrics: working, later installed Schaller neck pickup wired through to f hole; Hardware: good; Case: hard case; Overall condition: fair

£100-200

810.

JHS Vintage four string bass guitar, natural finish, within RockBag by Warwick gig bag

£50-80

811.

1966 Hofner Senator hollow body guitar, made in Germany; Body: brunette finish, light buckle scratching to back, light checking and other dings throughout; Neck: brunette finish maple; Fretboard: rosewood; Frets: light wear and tarnishing throughout; Electrics: working, Shadow neck pickup installed wired through to body edge; Hardware: generally good, replacement bridge; Case: hard case; Overall condition: good for age

£150-200

812.

2015 Sigma 000ME electro-acoustic guitar, with original gig bag

£100-150

813.

2020 Squier by Fender FSR Classic Vibe 50s Esquire electric guitar, made in Indonesia, blonde finish, missing switch tip

£150-200

814.

2006 Squier by Fender Affinity Series Tele electric guitar, trans orange finish (minor imperfections)

£80-120

815.

Yamaha FG700MS acoustic guitar, made in China (minor imperfections)

£60-100

816.

1960s Harmony Sovereign H1203 acoustic guitar, made in USA; together with another later Harmony Sovereign H6561 acoustic guitar in need of some attention (2)

£150-250

817.

1960s Silvertone small bodied acoustic guitar, two-tone sunburst finish

£80-120

818.

Recording King Justin Townes Earle acoustic guitar fitted with DeArmond sound hole pickup (finish imperfections, stress lacquer crack beside nut)

£80-120

819.

Recording King Justin Townes Earle Model acoustic guitar, made in China (minor finish imperfections)

£80-120

820.

Recording King Dirty 1930s RPH-05 acoustic guitar, made in China, with Deltoluxe sound hole pickup (finish imperfections)

£50-100

821.

Recording King Justin Townes Earle Model acoustic guitar, made in China, sunburst finish (minor finish imperfection, some fret lifting)

£70-100

822.

2011 Epiphone 1963 EJ-45S Limited Edition acoustic guitar, made in Indonesia, black finish (finish imperfections)

£80-120

823.

2016 Recording King Dirty 1930s RPH-07 acoustic guitar, made in China, sunburst finish, fitted with LR Baggs sound hole pickup (finish imperfections)

£60-100

824.

Tanglewood Crossroads TWCR P acoustic guitar, within Stagg hard case

£40-60

825.

Recording King Justin Townes Earle Model acoustic guitar, made in China, sunburst finish, with gig bag (minor finish imperfections)

£80-120

826.

2012 Squier by Fender Affinity Series Tele electric guitar, made in China, blonde finish, with Levy's gig bag (minor finish imperfections)

£80-120

827.

2016 Recording King Dirty 1930s RPH-07 acoustic guitar, made in China, sunburst finish, within Stagg hard case (minor finish imperfections)

£50-100

828.

2015 Recording King Dirty 1930s RPH-07 acoustic guitar, made in China, sunburst finish, within Tourtech hard case (finish imperfections)

£50-100

829.

2015 Loar LO-16 acoustic guitar

£100-200

830.

Encore CEA250FT acoustic guitar, together with a Westfield WF400N Hummingbird type acoustic guitar (2)

£40-80

831.

1989 Epiphone SG electric guitar, body: Cherry finish; Neck: finish crack/chipping to length of back; Fretboard: rosewood; Frets: tarnished but good; Hardware: tarnished but good; Case: 5 Star cases hard case (foam lining deteriorated) with Marshall MS-2C micro amp

£70-100

832.

AXL Les Paul type electric guitar, brown burst finish with soft bag

£40-60

833.

Ibanez GIO electric guitar, made in China, black finish with soft bag

£50-80

834.

Harley Benton VT Series TE-52 electric guitar

£60-100

835.

1990s Framus FD-30 SF electro-acoustic guitar; Back and sides: natural maple; Top: natural spruce; Fretboard: rosewood with pearl and abalone block position markers; Frets: good; Overall condition: very good

£200-400

836.

Vintage Kay twelve string acoustic guitar, fitted with Lawrence sound hole pickup

£80-120

837.

Customised Eddie Vedder Tribute 2020 Squier by Fender Telecaster electric guitar

£100-200

838.

Burns Club Series Marquee electric guitar; Body: black finish, minor dings; Neck: good; Fretboard: maple; Frets: good; Electrics: working; Hardware: good; Case: JHS gig bag; Overall condition: good

£150-250

839.

Texan Rose Morris acoustic guitar, made in Japan, within period hard case

£30-60

840.

1970s Antoria LP type electric guitar, made in Japan; Body: gold top finish upon brown finished back, a few minor marks otherwise very good for age; Neck: bolton, good; Fretboard: rosewood with crown position markers; Frets: light tarnishing and minor wear; Electrics: working; Hardware: good; Case: original hard case; Overall condition: very good

£100-200

841.

1970s Kasuga D-612 acoustic guitar, made in Japan; Back and sides: laminated rosewood, light surface marks; Top: natural spruce, minor dings, slight pulling to top at bridge with bridge plate lift, tape residue stain bottom of body; Neck: mahogany; Fretboard: rosewood with pearl block position markers; Frets: light tarnishing; Hardware: good; Overall condition: good

£80-120

842.

2012 Discovery by Tanglewood Deluxe DBT SFCE electro-acoustic guitar, with Brandoni gig bag

£80-120

843.

1970s Les Paul type electric guitar, probably by Kay; Body: natural finish, many dings and blemishes, vacant strap hole button to shoulder; Neck: bolt-on, maple, lacquer checking and some binding damage; Fretboard: maple with black block position markers; Frets: worn; Hardware: missing upper E tuner casing, splits to pickup surrounds; Overall condition: fair

£80-120

844.

1970s Daion Les Paul Custom style electric guitar, with cherry sunburst finish (finish imperfections), bolt-on neck and Maxon pickups, within TGI hard case

£100-200

845.

Squier by Fender acoustic guitar, within a TKL hard case

£40-60

846.

1970s Maxwin 100-E bowl back acoustic guitar, with hard case

£40-60

847.

1965 Hofner Congress archtop guitar, made in Germany; Body: brunette finish, a few light dings; Neck: maple, light dings to edges; Fretboard: rosewood; Frets: generally good, upper two frets shortened; Hardware: generally good; Case: soft bag; Overall condition: good for age

£100-150

848.

1987 Squier by Fender Jazz Bass guitar, made in Korea; Body: black finish, light surface scratches and minor dings; Neck: maple, minor dings; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: generally good, some rusting to smaller metal parts; Case: generic oblong hard case; Overall condition: fair

£100-200

849.

Yamaha RGXA2 electric guitar, made in Taiwan; Body: white finish top upon pewter back, minor dings to back edges; Neck: good; Fretboard: rosewood; Frets: good; Electrics: working; Hardware: good; Case: TKL gig bag; Weight: 2.82kg; Overall condition: good

£80-120

850.

S. Yairi YW-12 acoustic guitar, made in Japan; Back and sides: Mahogany, some marks and dings throughout; Top: Spruce, some slight sinkage around bridge corners; Neck: Mahogany, refinishing to back of head covering a repaired headstock break; Fretboard: rosewood, good, some minor blemishes; Frets: good; Hardware: good, bridge may require some attention; Case: hard case; Overall condition: Fair

£50-100

851.

Custom Build Thinline Tele electric guitar, cream finish body, maple neck with pearl block position markers, anodised guard, Fender bridge plate, Fender locking tuners and other miscellaneous hardware, within fitted hard case

£150-250

852.

Custom Build Strat type electric guitar; Body: zebrano effect solid Strat type body, light marks; Neck: Squier by Fender Affinity Series Strat neck with twenty-one fret rosewood fingerboard; Electrics: working, Iron Gear pickups; Hardware: Wilkinson trem, Schaller tuners and other miscellaneous parts; Overall condition: good

£150-200

853.

2013 Ibanez SA360QM electric guitar, made in Indonesia; Body: trans red figured maple top upon basswood body, light surface scratches throughout; Neck: good; Fretboard: rosewood; Frets: light wear; Electrics: working; Hardware: good; Case: Ritter gig bag; Weight: 2.91kg; Overall condition: good

£150-250

LOTS 854-900 NO LOTS

Guitar Amplification

901.

Lazy J Projects J-10 prototype 1x12 combo guitar amplifier, made in England, with integrated reverb and tremolo

*AprototypeJ-10amplifier,builtbyJesse HoffforPhilHarrisofHarrisHire

£1000-1500

902.

Lazy J Projects J-40 prototype 2x12 guitar amplifier, made in England, with integrated reverb and tremolo

*AprototypeJ-40amplifier,builtbyJesse HoffforPhilHarrisofHarrisHire

£1500-2000

903.

1976 Hiwatt Mixer Type C mixing desk

*Supplied to the Three Fishes pub in Kingston upon Thames and used alongside two 400 watt slaves and 4 x 12 PA cabinets. The pub was the Hiwatt workshop's local and had a reputation for very loud music, amongst other things!

£700-800

904.

Park 75 guitar amplifier, made in England, circa 1970; together with a matched pair of column speaker cabinets

£1800-2200

905.

1970s Orange OR80 2x12 combo guitar amplifier, made in England

£700-1000

906.

1970s Vox AC30 guitar amplifier, made in England, some modifications and servicing, fitted with Celestion Vintage 30 and Celestion G12H-100 speakers

£300-500

907.

Burns guitar amplifier with replacement linear amplifier installed, made in England, with original dust cover

£40-80

908.

Mid 1970s Vox AC30 Top Boost Reverb guitar amplifier, made in England

£500-800

909.

Carlton Camel Full Valve Series guitar amplifier, made in UK

£120-180

910.

Vox Soundbox Mini guitar amplifier, boxed £50-100

911.

1970s Laney PA 100 watt amplifier

£80-120

912.

Polytone Mini Brute II guitar amplifier, made in USA

£200-300

913.

Early 1970s Ampeg SVT bass guitar amplifier head, made in USA

£1200-1800

914.

1978 Fender PA135 guitar amplifier/PA amplifier head, made in USA

£500-700

915.

Groove Tubes Studio Series Tube Preamp for Guitar rack unit

£400-600

916.

Mesa Boogie Simul 395 Stereo guitar amplifier rack unit

£800-1200

917.

1980s Mesa Boogie Mark 2A guitar amplifier, made in USA, fitted with JBL K130 15" speaker (USA voltage, transformer supplied)

£800-1200

918.

Peavey Artist 240 guitar amplifier, made in USA

£150-250

919.

Blackstar Amplification Venue Series HT Club 50 guitar amplifier head, with an HTV-212 twin speaker extension speaker cabinet

£100-200

920.

1970s Orange Amplification OR80R 50 watt reverb 2x12 combo guitar amplifier, made in England

£700-1000

921.

1970s Music Man Seventy-Five guitar amplifier head, made in USA

£300-400

922.

Mesa Boogie Fifty/Fifty Stereo Tube Power guitar amplifier rack unit

£400-600

923.

Marshall 9000 Series 9001 preamplifier rack unit

£70-100

924.

Hughes & Kettner Attax 40 guitar amplifier; together with a 1988 Marshall Keyboard 12 amplifier (2)

£40-80

925.

1980s Hiwatt Lead 50 L50 guitar amplifier head, made in England

£500-600

926.

Hiwatt 400 DR405 guitar amplifier head, made in England; together with matching SE410 and SE115 speaker cabinets

£2200-2600

927.

1970s Laney Sound LC16 guitar amplifier, made in England, with dust cover

£70-100

917

913

916

928.

AER Domino 2 acoustic guitar amplifier

£300-400

929.

1970s Acoustic 370 bass guitar amplifier head, with original dust cover (USA voltage); together with matching Acoustic 301 speaker cabinet, with original dust cover

£500-700

930.

Roland Cube 30 electric guitar amplifier

£30-50

931.

Marshall Acoustic Soloist AS50R acoustic guitar amplifier, damage to leather carrying handle

£50-100

932.

1978 Fender Vibro Champ electric guitar amplifier, made in USA

£600-700

933.

1970s Cornell Big Wimp 50w Combo electric guitar amplifier, made in England

AraretransistorampbuiltbyDenisCornell inthe1970salongsidethesmaller,15w "Wimp"

£200-300

934.

1988 Marshall Reverb 12 1x10 combo electric guitar amplifier, red tolex, made in England, serial number: W40579, with original dust clear dust cover

£80-120

935.

Carr Rambler 112 1x12 combo electric guitar amplifier, made in USA, dust cover

£700-1000

936.

David Eden 4x10" bass amplifier speaker cabinet

£80-120

937.

Magnatone Model 425 Bass guitar amplifier, made in USA, circa 1961, rehoused into non-original cabinet, with Celestion Eight 15 speakers

£400-600

938.

1988 Marshall Bass 12 1x10 combo electric guitar amplifier, made in England, serial number: W30400, with original clear dust cover

£60-100

939.

Marshall 1931A angled front 1x12 speaker cabinet, modified to open back and fitted with a Celestion G12H greenback speaker

£40-80

940.

Marshall 1931B straight 1x12 speaker cabinet, modified to open back and fitted with a Celestion G12H greenback speaker

£40-80

941.

1982 Marshall JCM 800 4104 2x12 combo guitar amplifier, made in England

£500-800

942.

1993 Marshall Valvestate Bi-Chorus 8200 electric guitar amplifier head, made in England, together with an unbranded 2x12 speaker cabinet fitted with McKenzie speakers

£100-150

943.

1996 Marshall Valvestate Bi-Chorus 200 8280 2x12 combo electric guitar amplifier, made in England, together with a Marshall MG15CDR practice amplifier (2)

£100-150

944.

2012 Marshall JCM 800 Lead Series JCM1H 1 watt guitar amplifier head, made in England

£300-600

945.

2012 Marshall JVM series JVM1H 1 watt amplifier head, made in England

£200-300

946.

2012 Marshall JTM series JTM1H 1 watt electric guitar amplifier, made in England, with original box

£300-600

947.

2015 Marshall JMP series JMP1H 1 watt electric guitar amplifier head, made in England, with original box

£300-500

948.

1990s Marshall SE100 Speaker Emulation system guitar rack unit, made in England, with power supply

£100-200

949.

Marshall series 9000 9005 50+50 watt valve power amp rack unit, made in England

£150-200

950.

1975 Celestion G12 H Blackback T1886 12" guitar amplifier speaker, made in England, together with a 1976 Marshall brand Celestion Blackback G12H T1886 12" guitar amplifier speaker, made in England (2)

£50-100

951.

Fender '65 Custom Princeton Reverb Reissue guitar amplifier

£600-800

952.

1970s Sound City L120 guitar amplifier

£200-400

953.

1970s Laney Klipp 60 watt guitar amplifier head, with cover

£400-500

954.

Laney LA30BL Black Country Custom 30 watt guitar amplifier head

£300-500

955.

1977 Hiwatt Custom Slave 100 STA100 100 watt slave amplifier

£500-600

956.

Vox AC30 Clone guitar amplifier head

£100-200

957.

Fender Super Champ X2 Limited Edition guitar amplifier, fitted with Celestion G10 greenback speaker and Z Amp power attenuator

£150-250

958.

2019 Vox AC30 HWH hand wired guitar amplifier head with matching V212HWX cabinet

£600-900

959.

2014 Marshall Class 5 Roulette guitar amplifier

£150-250

960.

Phil Jones Bass BG-400 suitcase compact bass guitar amplifier, with dust cover

£300-400

961.

Trace Acoustic TA40CR acoustic guitar amplifier

£50-70

962.

Laney Cub 8 guitar amplifier; together with a Line 6 Amplifi 75 guitar amplifier (2)

£80-120

963.

Fender 12" guitar amplifier speaker

£20-30

964.

Marshall Amplification fridge for spares/ repair

£50-100

965.

Bugera BC15 15 watt valve amplifier, with dust cover

£40-60

966.

Kinsman KAA70 70 watt acoustic amplifier, with MJS stand, within gig bag; together with an Aroma AG-15A acoustic guitar amplifier, boxed (2)

£80-120

967.

Hughes & Kettner Nano Series Spirit of Vintage guitar amplifier head

£40-60

968.

Davey Johnstone (Elton John) - Yamaha Model T50C Soldano designed guitar amplifier, made in USA, ser. no. 10079, fitted with Eminence Delta Pro-12A speaker, with later footswitch and transformer (USA voltage)

*FormerlyownedandusedbyDavey Johnstone,guitaristwithEltonJohn's touringband.Duringthe1980s,Elton JohnmovedfromSteinwaytoYamaha, whichledtopressurefortherestofthe bandtouseYamahaequipment.The vendor,whoworkedforEltonJohn's RocketRecords,purchasedthisamplifier fromDaveyJohnstone'stechTonyHillin thelate1990s

£150-250

969.

Sound City 50H Mark 6 electric guitar amplifier head, made in China

£80-120

970.

Hartke HA5500 bass amplifier head, with 4x10" amplifier speaker cabinet

£100-200

971.

Behringer BXL 900 bass guitar amplifier; together with a VOX Pathfinder guitar amplifier (2)

£50-100

972.

Blackstar Amplification Silverline Standard guitar amplifier, boxed

£200-400

973.

Ashdown Perfect Ten 30 watt bass guitar amplifier

£40-60

974.

Mid 1960s Selmer Twin Lead 30 guitar amplifier

£200-300

975.

Vox AC15 HW1 hand wired guitar amplifier, with dust cover

£400-600

976.

Roland Cube 60 guitar amplifier

£40-80

977.

Roland Micro Cube Bass RX, made in China, power supply and soft cover

£50-80

978.

Roland Dual Cube Bass LX, made in China, with power supply and soft cover

£50-80

979.

2016 Fender Blues Junior electric guitar amplifier, made in Mexico, dust cover

£200-300

980.

Marshall AS50R Acoustic Soloist electric guitar amplifer, made in China

£50-100

981.

2009 Marshall JMD-1 50 watt guitar amplifier head, made in China, with footswitch

£200-300

982.

1999 Marshall VS412 Lead 4x12" guitar amplifier speaker cabinet, fitted with Celestion G12L speakers

£70-100

983.

2007 Marshall MG Series MG412A Lead 4x12" guitar amplifier speaker cabinet, made in India, fitted with Celestion G12-412MG speakers

£40-80

984.

Warwick W-CCL Bass amplifier, made in China

£40-80

985.

Magnatone Custom 260 guitar amplifier, made in USA, circa 1959

£1000-1500

986.

Fender Twin Amp guitar amplifier, made in USA

£150-250

987.

Roland Blues Cube guitar amplifier, made in Malaysia

£100-200

988.

Mesa Boogie Lone Star Special electric guitar amplifier, made in USA, dust cover

£700-1000

994.

1969 Marshall Super Bass 100w electric guitar amplifier head, made in England

989.

1997 Vox AC30/6 TB electric guitar amplifier, made in England

£600-800

990.

Hiwatt Custom Studio/Stage MK II, amplifier chassis removed and currently used as a 2x12" speaker cabinet, faceplate with pots, switches and some fittings retained

£200-400

991.

1980s Soundmaster battery/mains powered guitar amplifier

£30-50

992.

1961 Vox AC30 Bass guitar amplifier, made in England, replacement handles, one replacement speaker

£2000-3000

993.

1975 Hiwatt 4x12" guitar amplifier speaker cabinet, enclosing original Fane speakers

£700-900

*Theserialnumberfromthisamphasbeen defacedandisunreadable.Thereisaninspection labelontheamplifierchassisthatisdated2/7/69 or,evenpossibly2/1/69.Pleaseseeadditional imagesforgeneralguidanceoninternals

£1500 £1800

995.

1978 Marshall 2203 Master Model 50w Mark II

Lead guitar amplifier head, made in England

£800-1200

996 (See page 111)

996.

1972 Marshall JMP 1986 Bass 50w amplifier head, made in England

£1200-1500

997.

2009 Hiwatt Custom Studio/Stage Mark II electric guitar amplifier head

£600-700

998.

1970s Carlsbro 60w 5 Channel Mixer PA Amplifier

£150-200

999.

1970s Carlsbro CS 100 TC 100w guitar amplifier head, made in England

£200-300

1000.

1970s Carlsbro CS60PA PA amplifier head, made in England

£150-200

1001.

1970s Carlsbro guitar amplifier head, made in England

£200-250

1002.

Pearce Amplifier Systems G2r guitar amplifier rack unit, within JHS 2U soft bag carry case, with footswitch

£250-350

1003.

Mesa Boogie Dual Rectifier Road King guitar amplifier head, made in USA, with King Kontroller footswitch

£800-1200

1004.

1980s Fender Super 60 electric guitar amplifier, made in USA

£150-200

1005.

Marshall Acoustic Soloist AS50D acoustic guitar amplifier

£50-100

1006.

Fender Blues Junior electric guitar amplifier, made in Mexico; together with a Sound City 30R 30w electric guitar amplifier combo, missing top carry handle (2)

£200-300

1007.

Peavey Studio Pro 112 guitar amplifier

£30-60

1008.

Hughes & Kettner Nano Series Spirit of Metal guitar amplifier, boxed

£40-60

1009.

Blackstar Amplification ID:30 TVP guitar amplifier, with footswitch

£100-150

1010.

Vox AC30 CC2X electric guitar amplifier, made in China

£200-300

1011.

Marshall MG15DFX electric guitar amplifier, together with a Fender Frontman 15G practice amplifier and a Pioneer 30-67 40W 8 ohm 12" speaker (3)

£20-30

1012.

Carlsbro Tower electric guitar amplifier, made in UK

£80-120

1013.

DV Mark DV Little Jazz 2x12 combo guitar amplifier

£200-300

1014.

EBS HD350 350 watt bass guitar amplifier head fitted with a Gator flight case; together with an EBS Evolution Neoline Pro 1 x 15 cabinet and an Evolution Neoline Pro 2 x 10" cabinet (3)

£300-500

1015.

Trace Acoustic TA100R acoustic guitar amplifier, with cover

£50-80

1016.

AER Bass Cube 2 guitar amplifier, with dust cover

£300-500

1017.

Fender Roc Pro 1000 electric guitar amplifier, made in USA

£20-40

1018.

Two Rock Amplification Jet 35 combo guitar amplifier, made in USA, with footswitch £1000-1500

1019.

Two-Rock Amplification Classic Reverb Signature guitar amplifier, made in USA, with footswitch

£2000-2500

1003

1018

1020.

Mesa Boogie Mark III guitar amplifier, hardwood cabinet with basket weave front, within heavy duty flight case on wheels

£1200-1800 1021.

Mesa Boogie Mark I guitar amplifier, made in USA, with hardwood cabinet and basket front, Altec 417-8H 12" speaker, within heavy duty flight case on wheels

£1200-1800 1022.

Lab Series L5 Model 308AX 2 x 12 combo guitar amplifier, made in USA

£100-200 1023.

Line 6 Amplifi 150 guitar amplifier

£100-200 1024.

Cornford Hellcat guitar amplifier head, made in England

£500-600 1025.

Mesa Boogie Mark IV guitar amplifier, made in USA, hardwood cabinet, basket weave grille, with footswitch and dust cover

£1500-2000 1026.

2003 Marshall 1960B 4x12 guitar amplifier speaker cabinet

£200-300

1027.

Fender Champ 12 electric guitar amplifier, made in USA

£100-200

1028.

Fender Champion 600 electric guitar amplifier

£80-120

1029.

Fender Champion 600 electric guitar amplifier

£80-120

1030.

Kemper Profiling guitar amplifier head, with Profiler Remote footswitch

£400-600

1031.

Rocktron Guitar Rack Technology Pro Gap Ultra programmable guitar preamp rack unit

£80-120

1032.

Zvex Amps NAMM 2006 Nano Head guitar amplifier

£200-300

1033.

1999 Marshall JCM 600 2x12 guitar amplifier combo, made in England, footswitch

£200-300

1034.

1975 Hiwatt PA 100 amplifier head, made in England

£700-800

1035.

Rivera M60 guitar amplifier head, made in USA, with FS-7 and FS-2 footswitches

£300-500

1036.

1979 Fender Pro Reverb guitar amplifier, made in USA

£300-500

1037.

1960s Ampeg Reverberocket R-12R 1x12" guitar amplifier combo, made in USA, in flightcase on wheels

£400-600

1038.

1991 Vox AC30 Top Boost Limited Edition 30th Anniversary (1960-1990) guitar amplifier, made in England

£600-800

1039.

1990s Ampeg Reverberocket 2x12" guitar amplifier combo, made in USA, in flight case on wheels

£300-500

1040.

Trace Elliot Series 6 GP7 1x15" bass amplifier combo

£70-100

1041.

SWR Goliath II 4x10" bass amplifier speaker cabinet

£40-80

1042.

Early 1960s Vox AC30 guitar amplifier with added Top Boost, made in England, fawn wrapping

£1500-2500

1025

1043.

Ashdown Evo II 300 2x10" bass guitar amplifier combo, in fitted flight case on wheels

£50-80

1044.

Three footswitches to include a Bright Onion Pedal Sessionette 75, a Session FS3 and a Roland FS3 (3)

£20-40

1045.

Trace Elliot AH1000-12 100W bass guitar amplifier head; together with a Trace Elliot TE1518 1x15" speaker cabinet, a TE1048H 4x10" speaker cabinet and BFC-6 6 function bass foot controller

£100-200

1046.

Selection of amplifier valves to include Mullard, RCA, Groove Tubes, Brimar etc

£100-200

1047.

Trace Elliot AH600SMX bass guitar amplifier head

£80-120

1048.

Hiwatt Custom 100 DR103 guitar amplifier head, made in England, circa 1971

£1000-1500

1049.

1978 Marshall JMP Master Model Mk 2

Lead 50w guitar amplifier head, made in England, housed inside a larger Marshall 100w size headbox

£600-1000

1050.

1972 Fender Twin Reverb 2x12" guitar amplifier combo, made in USA

£400-600

1051.

Vox AC50 guitar amplifier head, made in England, circa 1975

£500-800

1052.

Peavey KB3 keyboard amplifier, made in China

£30-50

1053.

Patrick Eggle Wave Modulator 125 1x12" guitar amplifier, made in England

£100-200

1054.

Ashdown Engineering Acoustic Radiator 2 acoustic guitar amplifier

£80-120

1055.

1960s Dallas Shaftesbury 30 guitar amplifier

£200-400

1056.

Three Fender Acoustasonic guitar amplifiers to include an Acoustasonic Junior, Acoustasonic 90 and Acoustasonic 150 in need of repair (3)

£100-200

1057.

Fender Pro-Junior guitar amplifier, made in Mexico

£200-300

1058.

Fishman Loudbox Mini Charge guitar amplifier

£50-100

1059.

Roland Cube Street guitar amplifier; together with a Roland Micro Cube GX guitar amplifier (2)

£100-200

1060.

Tanglewood T6 acoustic combo guitar amplifier, with gig bag; together with a Tanglewood TXS powered speaker extension cabinet

£150-250

1061.

Trace Elliot AH1000-12 bass guitar amplifier head, with BFC-6 foot controller

£100-150

1062.

Fender Blues Junior III guitar amplifier, made in Mexico, with dust cover

£300-400

1063.

Marshall JMP-1 Valve Midi Pre-amp rack unit, with floor pedal

£200-300

1064.

Marshall JFX-1 Signal Processor rack unit with Korg Tone Works DTR-1 digital tuner rack unit, within a Citronic flight case

£100-200

1065.

Marshall 9100 Dual Monobloc power amplifier rack unit, within rack case

£200-400

1066.

Pair of 1995 Marshall 1912 Lead 1x12 guitar amplifier speaker cabinets; together with a Marshall MG Series 15CDR amplifier built into a later surround

£100-200

1067.

Six original 1960s Vox amplifier handles

£150-250

1068.

1960s Farfisa 8 guitar amplifier, made in Italy; together with a Carlsbro GLX30 guitar amplifier (2)

£100-200

1048

1042

1069.

1960s Selmer Futurama Corvette guitar amplifier

£200-300

1070.

Pair of 1970s Orange Amplification wedge monitor speakers

£300-500

1071.

1959 Watkins Westminster 'Red Star' Tremolo guitar amplifier, made in England

£300-500

1072.

Rivera Quiana Studio guitar amplifier, made in USA, with manual and footswitch

£400-600

1073.

1970s Orange GRO-100 guitar amplifier head, made in England

£900-1200

1074.

Lazy J Projects J-40 prototype 2x12 guitar amplifier speaker cabinet, fitted with Tayden Ace 25 12" speakers

*Aprototypecabinet,builtbyJesseHoff forPhilHarrisofHarrisHire

£200-400

1075.

Lazy J Projects J-80 J-212XT prototype guitar amplifier extension speaker cabinet, fitted with Tayden AC1208 speakers

*Aprototypecabinet,builtbyJesseHoff forPhilHarrisofHarrisHire.Thiscabinet wasoriginallydesignedtobeusedwith theJ-80prototypeofferedearlierinthis sale(Lot605)

£200-400

1076.

2004 Marshall 1960A HW Hand Wired 4x12 guitar amplifier speaker cabinet

£250-350

1077.

1995 Vox AC30/6 TB 2x12" combo guitar amplifier, made in England

£600-800

1078.

Fender '65 Super Reverb reissue 4x10" combo guitar amplifier, made in USA, within flight case on wheels

£500-700

1079.

2004 Marshall 1960B HW Hand Wired 4x12 guitar amplifier speaker cabinet

£250-350

1080.

Pair of 1970s Marshall PA / guitar amplifier twin speaker columns, made in England

£250-350

1081.

Amplifier spares to include three amplifier footswitches, including an Ampeg AFP-3

one Fender and one Marshall; a Bulgin amplifier power cable, a selection of amplifier plastic corners, black fabric for amplifier repair and a large roll of black tolex for guitar amplifiers and speaker covering £50-100

1082.

1960s Selmer Truvoice Constellation 20 croc skin 2x12 amplifier cabinet (cabinet only)

£150-250

1083.

Hughes & Kettner FSM-432 MKIII guitar amplifier footswitch

£20-40

1084.

Hughes & Kettner BR115H 200 watt 8 ohm bass guitar amplifier cabinet

£10-20

1085.

Set of three UK Professional Sound Equipment guitar amplifier speaker cabinets to include a 15" bass cabinet and two 2 x 10 cabinets

£20-40

1086.

Large Electronic Tube Corp Jan-5CP1 electron valve, within original box

1087.

£10-20 1073

Panama 8 ohm single speaker guitar amplifier speaker cabinet

£20-40

1088.

Goodmans Audiom 70 Bass 15 ohm amplifier speaker, boxed

£20-40

1089.

Torres 100W Power Break attenuator

£40-80

1090.

Two pairs of 1977 Celestion Blackback T1632 12" guitar amplifier speakers, made in England, one pair date coded FK23, the other DK26 (4)

£100-200

1091.

Pair of vintage Marshall brand Celestion G12 M Greenback T1221 12" guitar amplifier speaker, made in England, one coded 13MA and the other 12FM (in need of re-coning) (2)

£50-100

1092.

1975 Celestion G12H T1281 12" guitar amplifier speaker, made in England, date code DH 9 X

£40-80

1093.

Rola Celestion G12M Greenback 12" guitar amplifier speaker, made in England, date code missing

£50-100

1094.

Three Celestion speakers, to include a pair of 2003 G12T-75 T3760 12" guitar amplifier speakers and a 10" G10D-25 T3535 mounted on a baffle (3)

£40-80

1095.

NSP Flight Cases guitar amplifier head flight case, internal dimensions 67.5cm x 26.5cm x 27cm

£40-80

1096.

Swan Flight guitar amplifier head flight case, internal dimensions: 65.5cm x 21cm x 24.5cm

£40-80

1097.

Swan Flight guitar amplifier head flight case, internal dimensions: 75cm x 21cm x 27.5cm

£40-80

1098.

Adrenaline Flight Cases guitar amplifier head flight case, internal dimensions: 73.5cm x 21.5cm x 28.5cm

£40-80

1099.

Unbranded flight case suitable for a guitar amplifier head, internal dimensions: 74cm x 21.5cm x 26.5cm

£30-60

1100.

Unbranded flight case on wheels with internal removable tray, internal case dimensions: 81cm x 47.5cm x 64.5cm

£40-80

1101.

1960s Marshall green amplifier head dust cover, cover internal dimensions: 19" x 14" x 8.5"

£20-40

1102.

Pair of vintage Marshall PA amplifier speaker cabinet carcasses, missing front and rear panels and missing tolex to sides, together with two pairs of 15ohm oval speakers

£40-80

1103.

Pair of Park Amplification open weave pattern speaker cabinet front panels, missing Park logos, together with two upright speaker cabinet carcasses, needing recovering, 71cm x 35cm x 25cm

£40-80

1104.

TVM Sound PK200 100 watt PA Amplifier head, for spares/repairs

£40-80

1105.

Empty Marshall 1982B 4x12 straight front amplifier speaker cabinet, made in England, many rips to tolex

£80-120

1106.

Two Marshall Master Lead Combo electric guitar amplifiers, for spares/repairs

£50-100

1107.

Marshall Stereo 100 electric guitar amplifier head; together with a Marshall Bass 100 and an additional empty housing for similar amp, all for spares/repairs (3)

£40-80

1108.

Late 1960s Marshall amplifier head cabinet, recovered in non-original tolex, housing a 1977 Marshall Artiste chassis for spares and repairs

£80-120

1109.

Selection of amplifier parts for spares and repairs to include a 1960s Linear Conchord amplifier, a 50w output transformer, a 50w mains transformer, various valves and amplifier fittings, a back panel for a Marshall PA and a Marshall Reverb 12

£50-100

1110.

1966 Marshall 4x12 PA amplifier speaker cabinet carcass, recovered in non-original tolex, 123cm x 51cm x 28cm

£50-100

1111.

2016 Marshall Amplification dealer plinth, 45" long, 26" wide, 10" high

£80-120

1112.

2013 Marshall Amplification dealer plinth, 45" long, 26" wide, 10" high

£80-120

1113.

Dummy Marshall JCM 800 Lead series

Amplifier head and matching Marshall 1960A angled speaker cabinet, for stage prop or wall mounting

£80-120

1114.

Dummy Marshall 1960B straight front speaker cabinet, with top fixings for dummy amp

£50-100

1115.

Dummy Marshall 1960A angled speaker cabinet

£50-100

1116.

Dummy Marshall 1960B straight front speaker cabinet

£50-100

1117.

Dummy Marshall 1960B straight front speaker cabinet

£50-100

1118.

Dummy Marshall 100 Watt Super Lead amplifier head

£50-100

1119.

Dummy Marshall JCM 900 guitar amplifier head, boxed

£50-100

1120.

Dummy Marshall JCM 800 guitar amplifier head, boxed

£50-100

1121.

Blackstar Amplification Artisan 412A 4x12 guitar amplifier speaker cabinet

£100-150

1122.

Marshall Anniversary series 6912 1x12 guitar amplifier speaker cabinet, fitted with Celestion V30 16 ohm speaker

£80-120

1123.

Marshall Anniversary Series 6912 1x12 guitar amplifier speaker cabinet, fitted with Celestion V30 16 ohm speaker

£80-120

1124.

1x15 guitar amplifier speaker cabinet, fitted with a 15" Eminence speaker

£30-60

1125.

1995 Jim Marshall autographed and framed "The Marshall Legacy" Blues Breaker Beano poster, 60cm x 45cm; together with two A3 framed Marshall prints, a framed 1975 "Go Over Big with Marshall" comic art style double page ad from Sounds magazine, another unsigned Marshall Blues Breaker Beano ad and a Marshall branded techmat (6)

£40-80

1126.

Pair of Celestion Vintage 30 G12 16 ohm guitar amplifier speakers

£40-80

1127.

Pair of Celestion Vintage 30 G12 16 ohm guitar amplifier speakers

£40-80

1128.

Pair of Celestion Vintage 30 G12 16 ohm guitar amplifier speakers

£40-80

1129.

Bulgin mains lead for vintage Marshall and other amplifiers; together with a selection of other various power cables

£50-100

1130.

Marshall Amplification control knobs for JTM, circa 1966; together with a small selection of other Marshall amp associated parts to include switches and sockets

£80-120

1131.

Early 1970s Sound City 4x12 guitar amplifier speaker cabinet, enclosing original Fane speakers

£500-600

1132.

Vox Alnico Blue 16 ohm guitar amplifier speaker; together with three Celestion G12T-75 guitar amplifier speakers (4)

£80-120

1133.

Jim Marshall autographed guitar amplifier head back panel, dated 1995

£30-50

1134.

Heavy duty flight case on wheels suitable for a 2 x 12 Combo type guitar amplifier

£30-50

1135.

Four Celestion G12T-75 16 ohm guitar amplifier speakers (4)

£50-100

1136.

Laney LA212 Black Country Custom 2 x 12 guitar amplifier speaker cabinet

£200-400

1137.

2004 Marshall 1960AX 4x12 guitar amplifier speaker cabinet, with dust cover

£200-300

1138.

2004 Marshall 1960BX 4 x 12 guitar amplifier speaker cabinet, with cover

£200-300

1139.

1975 Marshall Bass 1935B 4x12 guitar amplifier speaker cabinet, fitted with four Celestion T1511 speakers

£500-600

1140.

2000 Hiwatt SE4123 4x12 guitar amplifier speaker cabinet

£250-350

1141.

Pignose 7-100 portable battery guitar amplifier, made in China

£40-60

1142.

Jim Marshall - two framed Jim Marshall autographed Jimi Hendrix Marshall Amplification promotional posters, each 24" x 17"; together with a Jimi Hendrix Experience Live at Woodstock print (3)

£80-120

1143.

Guitar amplifier flight case on wheels, bearing 'MC' stencils to the case lid, external dimensions 75cm high, 82cm wide, 33cm deep

£30-40

1144.

Fender channel select/reverb amplifier footswitch; together with a Vox two channel amplifier footswitch

£5-10

1145.

Two Fane 15" guitar amplifier speakers including a Classic 15/100 and another labelled "Sample"

£20-40

1146.

Two McKenzie 12" guitar amplifier speakers; together with a McKenzie GP15 15" speaker (3)

£20-40

1147.

Pair of Celestion G12N-65 Super 65 16 ohm 12" speakers, made in China, date coded 07JS

£30-50

1148.

Two pairs of Groove Tubes Fender GT6L6B amplifier valves

£40-80

1149.

Selection of valves to include a set of four Harma ECC81-STR, four Groove Tubes GTECC83 and five JJ ECC82

£40-80

1150.

Fender Custom Shop Tone-Master 4 x 12 guitar amplifier speaker cabinet, made in USA, within heavy duty flight case on wheels

£250-350

1151.

Heavy duty guitar amplifier flight case on wheels, suitable for a Mesa Boogie Mark Series amp or similar

£50-100

1152.

Marshall 1936 2x12 guitar amplifier speaker cabinet

£200-300

1153.

Heavy duty flight case on wheels suitable for a 2x12 or similar guitar amplifier, interior foam has deteriorated

£30-50

1154.

Heavy duty guitar amplifier flight case on wheels suitable for a 2 x 12 Combo or similar

£30-50

End of Day two sale

Day Three

Guitar Effects, Spares & Audio Equipment

Thursday 12th March 2026 at 10am

Pedals

1201.

1970s Dharma Sound Phaser guitar pedal

£250-350

1202.

Watkins Copicat Shadow echo unit, made in England, within original box

£350-450

1203.

Ibanez MS10 Metal Charger guitar pedal, made in Japan

£50-80

1204.

1970s Barnes & Mullins Exel Shatterbox guitar pedal

£100-150

1205.

Native Instruments Guitar Rig Kontrol 3 pedal unit

£40-80

1206.

Eko Multitone guitar pedal, made in Italy, circa 1970

£200-400

1207.

Melos Mini Comp compressor guitar pedal

£30-40

1208.

MXR Dyna Comp compressor guitar pedal

£40-60

1209.

NUX NAI-5 Optima Air Acoustic Simulator & IR Loader electric guitar effect pedal

£40-80

1210.

Dunlop GCB-95 Cry Baby Wah guitar effect pedal

£30-50

1211.

Boss BCB-60 guitar effects pedal board

£30-50

1212.

TC Electronic Plethora X3 TonePrint Multi-FX guitar effects pedal

£80-120

1213.

Boss DS-1 Distortion guitar effects pedal, made in Taiwan, together with a Line 6 Tone-Core Otto Filter and a HoTone Trem tremolo pedal (3)

£40-60

1214.

1987 Boss OC-2 Octave guitar effects pedal, product of Roland Japan, black label, together with a Boss SD-1 Super Overdrive, label missing, both with velcro to base plates

£100-200

1215.

Digitech Eric Clapton Crossroads Overdrive guitar effects pedal, made in USA

£40-60

1216.

Lovepedal JMP Eleven Overdrive guitar effects pedal

£80-120

1217.

Lovepedal COT 50/Eternity Stack guitar effects pedal

£70-100

1218.

Boss DD-7 Digital Delay guitar effects pedal, label missing and Velcro to back

£50-80

1219.

Death by Audio Echo Dream 2 advanced echo modulation guitar pedal, made in USA

£80-120

1220.

BBE Free Fuzz Fuzz guitar effects pedal, together with a MOOER Hustle Drive mini pedal (2)

£30-50

1221.

1960s WEM Watkins Copicat tape echo, made in England, with original dust cover

£150-250

1222.

1960s WEM Watkins Copicat tape echo, made in England, with spare tape

£150-250

1223.

1980s Tokai TMD-1 Metal Driver overdrive electric guitar effect pedal, made in Japan

£40-60

1224.

Heavy duty guitar pedal board flight case

£30-50

1225.

Dunlop Cry Baby GCB-95 wah guitar pedal

£30-50

1226.

Three mini guitar pedals to include a Donner chromatic tuner, a Minipedz pedal power supply, a Minipedz chorus and a Minipedz echo (4)

£30-50

1227.

Nux Loop Core guitar pedal, boxed; together with a Billionaire by Danelectro Filthy Rich tremolo guitar pedal (2)

£40-60

1228.

DigiTech Trio Band Creator guitar pedal, boxed with FS300 footswitch, boxed (2)

£80-120

1229.

TC Electronic Mimiq Doubler guitar pedal, boxed; together with a TC Electric Mimiq Mini Doubler guitar pedal, boxed (2)

£80-120

1230.

Vox V847-A Union Jack wah wah guitar pedal, with pouch and box

£80-120

1231.

Blaxx by Stagg guitar effects pedal board, boxed; together with a Stagg pedal board case and a Joyo JP-02 pedal power supply, boxed (3)

£30-50

1232.

Dunlop Uni-Vibe Rotating Speaker Effect guitar pedal, with UV-1FC foot controller

£100-200

1233.

Catalinbread Talisman Plate Reverb guitar effect pedal, made in USA

£50-80

1234.

Keeley DynaTrem tremolo & reverb guitar effect pedal, made in USA

£40-60

1235.

Keeley C4 Compressor guitar effect pedal, made in USA

£60-80

1236.

Keeley Bubble Tron dynamic Flanger Phaser guitar effect pedal, made in USA

£70-90

1237.

Catalinbread Topanga spring reverb guitar effect pedal, made in USA

£60-80

1238.

Fulltone Fat-Boost boost guitar effect pedal, made in USA

£50-80

1239.

Hermida Audio USA Version 1 Reverb guitar effect pedal, made in USA

£70-100

1240.

TC Electronic Ditto Looper mini guitar effect pedal, made in Thailand

£30-50

1241.

1979 Ross Distortion guitar effect pedal

£40-60

1242.

Hudson Electronics Broadcast germanium preamp guitar effect pedal, made in UK

£100-150

1243.

Walrus Audio Monument harmonic tap tremolo guitar effect pedal, made in USA, boxed £80-120

1244.

T Rex Fuel Tank Classic guitar effects pedal power bank

£30-50

1245.

Electro-Harmonix Big Muff guitar pedal, boxed

£40-60

1246.

Flynn Amps Rory Gallagher Hawk booster guitar pedal, boxed

£80-120

1247.

1980s Boss OD-1 Overdrive guitar pedal, made in Japan, black label

£80-120

1248.

1970s Vox Super Phase guitar pedal

£50-100

1249.

Morley Little Alligator volume guitar pedal; together with a Boss BE-5 multiple effects guitar pedal in need of attention (chorus at fault)

£50-100

1250.

Boss BCB-30X guitar pedal board fitted with four mini Donner guitar pedals to include Noise Killer, Golden Tremolo, Yellow Fall and Tutti Love, with Donner PSU

£50-100

1251.

1970s WEM Watkins Copicat Super IC tape delay

£80-120

1252.

Shaftesbury by Shin-ei Squall guitar pedal, with box

£80-120

1253.

Line 6 DL4 MkII delay and looper guitar pedal, boxed

£80-120

1254.

Fender ABY guitar pedal, within original packaging

£20-30

1255.

Dunlop Cry Baby Mini wah guitar pedal, boxed £40-60

1256.

Boss IR-200 Amp & IR Cabinet guitar pedal, boxed £80-120

1257.

Line 6 HX One guitar pedal, boxed

£80-120

1258.

Nux Horseman Mini guitar pedal, boxed

£20-40

1259.

J Rockett Audio Designs Archer Ikon guitar pedal, boxed

£50-80

1260.

Kinsman guitar pedal board

£20-30

1261.

Line 6 POD HD500X multi-effects guitar pedal, within original gig bag

£80-120

1262.

Strymon Compadre dual voice compressor and boost guitar pedal, boxed £120-180

1263.

Universal Audio Teletronix Model LA-2A guitar pedal, boxed

£50-80

1264.

Electro-Harmonix Nano Deluxe Memory Man guitar pedal

£50-80

1265.

DOD 270 A-B box, boxed; together with a Whirlwind Multi-Selector FS four channel selector (2)

£20-40

1266.

Ibanez CP-835 Compressor II guitar pedal, made in Japan, circa 1980

£80-120

1267.

1983 Boss SD-1 Super Overdrive guitar pedal, made in Japan, black label

£70-90

1268.

Boss TU-3 Chromatic Tuner guitar pedal

£40-60

1269.

MXR Dyna Comp compressor guitar pedal

£40-60

1270.

BBE Boosta Grande Clean Boost guitar pedal

£20-40

1271.

DigiTech Metal Master heavy metal distortion guitar pedal; together with an Electro-Harmonix 22 Caliber Power Amp guitar pedal (2)

£40-80

1272.

Ernie Ball VP Jr volume pedal

£40-50

1273.

Ernie Ball Stereo Volume/Pan pedal

£50-80

1274.

Ernie Ball Stereo Volume/Pan pedal

£50-80

1275.

TC Electronic Sky Surfer Reverb guitar pedal, boxed

£20-40

1276.

1970s WEM Watkins IC-500 Analogue Copicat delay unit

*Averyraremid70stape-freeCopicatwith originalpreamp

£200-400

1277.

Genevieve Ranger style Treble boost guitar pedal

£80-120

1278.

JMI Custom Rangemaster Limited Edition guitar pedal, with certificate of authenticity, box and other papers

£150-250

1279.

Way Huge Penny Saver Royale modulation and overdrive guitar pedal, boxed

£50-70

1280.

Lazy J Cruiser overdrive guitar pedal

£80-120

1281.

1970s Jen Cry Baby Super guitar pedal, made in Italy

£100-150

1282.

Williams Audio Mk III Tone Bender fuzz guitar pedal, with original papers

£80-120

1283.

Williams Audio Ranger/Treble Booster guitar pedal, with original papers

£80-120

1284.

Wampler Tumnus overdrive and boost guitar pedal

£70-80

1285.

1293.

Boss DD-3 Digital Delay guitar pedal, boxed

£50-70

1286.

Ibanez Tube Screamer Mini guitar pedal, boxed

£40-60

1287.

DigiTech Whammy pitch shifting guitar pedal, boxed

£80-120

1288.

Boss GE-10 Graphic Equalizer, made in Japan

£80-120

1289.

Boss RE-20 Roland Space Echo RE-201 guitar pedal, boxed

£100-200

1290.

Large heavy duty guitar effects pedal board flight case, with padded interior and removable internal tray

£40-80

1291.

Vertex Steel String Clean Drive guitar effects pedal

£80-120

1292.

Seven mini guitar effects pedals to include: Musiwewe Light Purple delay, Tomsline ADR-3 Dumbler, Tomsline Greenizer vintage overdrive, Tomsline AT-07 tuner, Tomsline Digital Delay, Donner Golden Tremolo and a Donner Vowel volume & wah pedal (7)

£80-120

Unbranded pedal board carry case, fitted foam interior, 27" x 11" x 2" (internal measurements with foam removed)

£20-40

1294.

Boss HM-2 Heavy Metal guitar effect pedal, made in Taiwan

£40-60

1295.

Beat Buddy Mini Personal Drummer guitar effects pedal, together with a Singular Sound dual momentary footswitch

£60-100

1296.

1966 Baldwin Burns Buzzaround guitar pedal, made in England

£1500-2000

1297.

Maxon OD-880 Overdrive soft distortion guitar pedal, made in Japan

£50-80

1298.

Maxon AD999 Analog Delay guitar pedal, made in Japan

£50-80

1299.

Maxon CS-550 Stereo Chorus guitar pedal, made in Japan

£50-80

1300.

Maxon DS-830 Distortion Master guitar pedal, made in Japan

£50-80

1301.

Ibanez FL301-DX flanger guitar pedal

£60-80

1302.

Ibanez TS9 Tube Screamer guitar pedal, made in Japan

£70-100

1303.

Boss DS-1 Distortion guitar pedal

£20-40

1304.

Zvex Effects Union Jack guitar pedal

*ThoughttobeaZvex'SuperHardOn'

£80-120

1305.

Boss CS-3 Compression Sustainer guitar effect pedal, made in Japan, black label

£40-60

1306.

Zvex Effects Fuzz Factory guitar pedal

£80-120

1307.

Fulltone Robin Trower Overdrive guitar pedal, made in USA

£50-80

1308.

1986 Boss DD-2 Digital Delay guitar effect pedal, made in Japan, blue label

£70-90

1309.

Fulltone OCD Obsessive Compulsive Drive guitar pedal, made in USA

£80-120

1310.

MXR Micro Amp guitar pedal

£30-50

1311.

Ibanez CP9 Compressor/Limiter guitar pedal, made in Japan

£50-80

1312.

Ibanez AD9 Analogue Delay guitar pedal, made in Japan

£60-80

1313.

Ibanez FL9 Flanger guitar pedal, made in Japan

£70-90

1314.

Ibanez CS9 Stereo Chorus guitar pedal, made in Japan

£80-120

1315.

Boss DD-6 Digital Delay guitar pedal

£50-60

1316.

Boss BF-2 Flanger guitar pedal

£40-60

1317.

MXR Carbon Copy Analog Delay guitar pedal

£60-80

1318.

Effectrode Tube Drive guitar pedal

£150-250

1319.

DigiTech Vocalist Live 4 effects pedal

£70-90

1320.

TC Helicon VoiceLive 3 vocal and guitar effects looper pedal

£80-120

1321.

Digidesign Eleven rack effects unit

£80-120

1322.

Fractal Audio Systems FX8 Multi-effects Pedal Board Mark II guitar pedal

£200-400

1323.

Line 6 FBV Custom foot controller

£40-60

1324.

TC Helicon Play Acoustic guitar pedal

£80-120

1325.

Boss Waza-Air wireless personal guitar amplification system, boxed

£100-200

1326.

Boss VE-8 Acoustic Singer guitar pedal

£100-200

1327.

Rocktron Midi Mate floor controller unit

£20-40

1328.

Line 6 Firehawk FX guitar pedal board

£80-120

1329.

Line 6 Pod XT Live Pro Guitar Tone on the Floor guitar pedal board

£40-60

1330.

Fractal Audio Systems AX8 amp modeller and multi-effects guitar pedal

£200-400

1331.

Electro-Harmonix The Worm guitar pedal

£50-70

1332.

Electro-Harmonix Deluxe Memory Man guitar pedal

£100-200

1333.

Line 6 Helix Control guitar foot controller

£80-120

1334.

Electro-Harmonix Poly Chorus analogue flange/chorus guitar pedal

£100-200

1335.

Electro-Harmonix Holy Stain multi-effect guitar pedal

£50-80

1336.

Electro-Harmonix Q Tron Envelope control filter guitar pedal

£80-120

1337.

Boss GT-1000 guitar effects processor

£200-300

1338.

Electro-Harmonix Black Finger compressor guitar pedal, boxed

£80-100

1339.

Pro Co Rat guitar pedal (missing battery compartment cover)

£60-100

1340.

Modified Boss BD-2 Blues Driver guitar pedal with IndyGuitarists.com (Brian Wampler) modification

£60-80

1341.

Ibanez DL10 Digital Delay guitar pedal, made in Japan, circa 1990

£50-60

1342.

Origin Effects Cali 76 Compact Deluxe guitar pedal

£100-150

1343.

TC Electronic Hall of Fame Mini Reverb guitar pedal; together with a Korg Pitch Black Mini guitar pedal (2)

£40-60

1344.

Boss DF-2 Super Feedbacker and Distortion guitar pedal, with Gig Rig ACA AOK 9v-12v isolated voltage control

£70-90

1345.

Electro-Harmonix Deluxe Memory Man guitar pedal, with Gig Rig Electro Man 9-24v/DC adaptor

£80-100

1346.

Boo Instruments tremolo guitar pedal; together with a Boo Instruments O/DTS guitar pedal (2)

£40-60

1347.

Electro-Harmonix Small Clone EH4600 Full Chorus guitar pedal

£40-60

1348.

Morley Pro Series II Distortion Wah volume guitar pedal

£30-40

1349.

1980s Boss Chorus Ensemble CE-1 guitar pedal, made in Japan

£350-450

1350.

GigRig Pedal System upon sliding 19" 2U rack shelf including GigRig G2 remote switching unit, Evidence Audio wiring for ten units including Generator 5A power supply, distributor and isolator boxes

£400-600

1351.

Moog Moogerfooger MF-102 Ring Modulator guitar pedal, boxed

£150-250

1352.

Lazy J Cruiser guitar pedal

£80-120

1353.

Electro-Harmonix Nano Deluxe Memory Man guitar pedal, boxed

£60-90

1354.

Soldano SLO Super Lead Overdrive guitar pedal, boxed £80-120

1355.

Walrus Audio Sloer guitar pedal, boxed

£150-250

1356.

Fulltone OCD V2 Overdrive/Distortion guitar pedal, boxed £80-120

1357.

Decibelics Golden Horse guitar pedal, boxed £80-120

1358.

Past FX Chorus Ensemble guitar pedal, made in Australia, boxed £100-150

1359.

Wampler Tumnus guitar pedal, boxed £70-100

1360.

Game Changer Audio Plus Pedal guitar pedal, boxed £150-200

1361.

Chase Tone Fuzz Fella guitar pedal, boxed £60-100

1362.

Chase Tone Secret Preamp guitar pedal, boxed £60-100

1363.

Analogman Beano Boost guitar pedal, boxed £150-250

1364.

Universal Audio Max Preamp/Dual Compressor guitar pedal, boxed £100-150

1365.

Source Audio One Series EQ2 programmable EQ guitar pedal, boxed £100-150

1366.

Universal Audio Astra Modulation guitar pedal, boxed £100-150

1367.

Boss ME-5 Multi-Effects guitar pedal

£20-40

1368.

WEM Watkins Custom Copicat tape echo for spares/repair; together with a delay guitar pedal

£50-100

1369.

Dunlop Jimi Hendrix Fuzz Face mini guitar pedal, boxed

£60-80

1370.

Sound City Stereo Chorus SC-01 guitar pedal; together with a Caline Power 5 pedal power bank, a Korg GA30 tuner and a Korg LMA-120 digital metronome (4)

£30-60

1371.

NUX Masamune booster & Kompressor guitar effect pedal, made in China, boxed £40-80

1372.

TC Electronic G System Integrated Effects + Management guitar pedal board

£80-120

1373.

Boss BCB-60 pedal board with Behringer DC9 Dynamics compressor guitar pedal and a selection of various patch cables

£40-60

1374.

Boss DS-1 Distortion guitar pedal

£20-40

1375.

Boss PH-3 Phase Shifter guitar pedal

£50-70

1376.

Boss CH-1 Super Chorus guitar pedal

£50-60

1377.

DigiTech Digidelay Digital Delay guitar pedal; together with an Electro-Harmonix Nano Memory Toy analogue delay guitar pedal (2)

£50-80

1378.

Pedaltrain Classic 2 guitar effects pedal board; together with a Boss BCB-60 guitar pedal board (missing sectioned internals) (2)

£50-100

1379.

Pedaltrain Novo 18 guitar pedal board with T-Rex Fuel Tank Chameleon power supply

£50-100

1380.

EnRoute Music Porchboard Bass stomp box

£50-100

1381.

Two Ortega Horsekick Pro stomp boxes (one at fault)

£40-80

1382.

Beat-Root stomp box; together with five further stomp boxes (6)

£40-80

1383.

Two DigiTech Vocalist Live 2 guitar pedals, one boxed (one at fault) (2)

£50-100

1384.

Boss DD-20 Digital Delay guitar pedal, boxed

£80-120

1385.

Strymon Big Sky guitar pedal

£200-300

1386.

Orchid Electronics Acoustic Pre-Amp system

£40-80

1387.

Line 6 DL4 Delay Modeller guitar pedal, boxed

£50-100

1388.

Boss DD-20 Digital Delay guitar pedal

£80-120

1389.

Dunlop Echoplex Delay guitar pedal (one knob missing)

£70-100

1390.

Eventide H9 Harmonizer guitar effects processor £100-200

1391.

JHS Pedals The Milkman guitar pedal

£80-120

1392.

1986 Boss DM-3 Delay guitar pedal, made in Japan, green label

£80-120

1393.

Boss RV-5 Digital Reverb guitar pedal

£50-70

1394.

Boss DD-3 Digital Delay guitar pedal

£50-70

1395.

Boss GE-7 Equalizer guitar pedal, boxed £50-70

1396.

Aphex Big Bottom Aural Xciter Acoustic Xciter guitar pedal

£50-80

1397.

Boss DS-1 Distortion guitar pedal; together with a Danelectro Fab Echo guitar pedal, a Spartan Music PT-02 tuner pedal and a Boss TU-80 Tuner & Metronome (4)

£50-100

1398.

1970s B&M Champion Swell pedal

£40-60

1399.

Electro-Harmonix Ravish Sitar guitar pedal, boxed £100-150

1400.

Boss ME-25 Multi Effects guitar pedal

£30-60

1401.

Line 6 POD XT Live Pro guitar floor pedal £40-60

1402.

Boss NS-2 Noise Suppressor guitar pedal, boxed £30-50

1403.

Rebel Effects Royal Albert Hall guitar pedal

£30-60

1404.

Marshall effects display rack featuring the full eight pedal lineup including GV-2 Guvnor Plus, BB-2 Bluesbreaker II, JH-1 The Jack Hammer, ED-1 Edward the Compressor, EH-1 Echo Head delay, RG-1 Regenerator modulation, RF-1 Reflector Reverb and VT-1 Vibratrem £200-300

1405.

Behringer FCB1010 midi foot controller; together with a Pro Sound microphone £30-50

1406.

Set of three Ernie Ball Patch Series 6" patch cables; together with nine packaged Kinsman Pedal Power Daisy Chain cables and ten Kinsman 10' midi cables £30-60

1407.

Three D'Addario Planet Waves DIY solderless pedal board cable kits £50-100

1408.

WEM Watkins Copicat IC400 Belt Drive

Vari Speed tape echo unit, made in England

£100-200

1409.

Boss GT-10B bass guitar effect processor, boxed

£50-100

1410.

1970s WEM Solid State Watkins Copicat tape delay

£80-120

1411.

1970s English wah / expression guitar pedal pedal, possibly Colorsound

£80-120

LOTS 1412-1450 NO LOTS

Guitar Cases

1451.

Calton electric guitar hard case for SG or similar, in need of some attention

£80-120

1452.

Late 1960s Fender bass guitar hard case

£150-250

1453.

Freestyle Case Company generic oblong hard case; together with an older generic oblong hard case (2)

£30-60

1454.

1970s Fender short scale electric guitar hard case

£80-120

1455.

1960s Fender Mustang bass guitar hard case

£100-200

1456.

1960s Fender short scale bass guitar hard case

£80-120

1457.

Late 1960s Fender left-handed bass guitar hard case

£100-200

1458.

1960s Selmer short scale electric guitar hard case

£50-100

1459.

Early 1960s Fender Jaguar/Jazzmaster electric guitar hard case

£200-300

1460.

Fender Stratocaster/Telecaster reissue electric guitar hard case

£50-100

1461.

Mid 1960s Fender Jaguar/Jazzmaster electric guitar hard case

£150-250

1462.

Heavy duty flight case suitable for bass guitars

£20-40

1463.

Glazed guitar display case, 45" x 48" x 5.5"

£50-80

1464.

Freestyle 15" acoustic guitar hard case

£20-40

1465.

Freestyle electric guitar hard case

£20-40

1466.

TKL 15" acoustic guitar hard case

£20-40

1467.

Cedar Creek acoustic guitar case in need of some attention (overall condition good, however sticky residue present to lower bout sides)

£20-40

1468.

15" classical guitar hard case

£20-40

1469.

Taylor 16" acoustic guitar hard case

£30-60

1470.

Collings 14.75" semi-hollow body electric guitar hard case

£40-80

1471.

Kinsman compressed foam acoustic guitar hard case; together with a vintage semirigid fibreboard acoustic guitar case and an old electric guitar hard case (3)

£20-40

1472.

Black Rat light tweed bass guitar hard case

£20-40

1473.

1980s Fender ABS Stratocaster/ Telecaster guitar hard case

£40-60

1474.

Gibson SG electric guitar hard case

£40-80

1475.

Five guitar cases in need of some attention to include two 60s Selmer light tweed and a flight case suitable for electric guitar (5)

£50-100

1476.

Five Star Cases generic oblong electric guitar hard case

£20-40

1477.

Five Star Cases generic oblong electric guitar flight case

£20-40

1478.

Generic oblong bass guitar hard case; together with an acoustic guitar hard case (2)

£30-60

1479.

Thomann light tweed electric guitar hard case

£20-40

1480.

Gator 17" acoustic/archtop guitar hard case

£30-50

1481.

Tenorman large oblong guitar hard case

£20-40

1482.

Stagg compressed foam acoustic guitar case; together with a five position folding guitar rack stand (2)

£20-40

1483.

Charvel compressed foam electric guitar case

£20-30

1484.

1960s Selmer hardcase for Stratocaster or similar

£40-80

1485.

1930s USA resonator guitar hard case

£80-120

1486.

2000 Gibson Custom Shop flight case for the limited edition Pete Townshend signature SG electric guitar

£250-350

1487.

Fender Custom Shop Limited Edition G&G Telecaster/Stratocaster electric guitar hard case

£80-120

1488.

Harvest fine leather double electric guitar gig bag

£40-80

1489.

1960s Selmer shaped electric guitar hard case

£40-60

1490.

Levy's leather electric guitar gig bag

£30-50

1491.

Epiphone Flying V electric guitar hard case

£30-60

1492.

Gator 335 type electric guitar hard case

£40-60

1493.

Gator SG electric guitar hard case

£30-60

1494.

1980s Gibson protector hard case (missing back latch)

£150-250

1495.

1960s Victoria semi-hollow body electric guitar hard case for Coronado 12 or similar (damages, missing handle)

£100-200

1496.

1960s Lifton electric guitar hard case for 335 or similar

£200-400

1497.

1970s Fender Precision Bass guitar hard case

£80-120

1498.

1960s Fender Telecaster/Stratocaster electric guitar hard case (one latch missing)

£100-200

1499.

Fender Stratocaster/Telecaster electric guitar hard case, circa 1964 (one latch missing)

£150-250

1500.

Heavy Duty Flight Case Warehouse

Stratocaster electric guitar flight case

£40-60

1501.

Vintage Fender style Bass guitar hardcase, corrugated wrap with orange interior

£40-80

1502.

Gretsch electric guitar hard case

£80-120

1503.

Fender light tweed Stratocaster/ Telecaster electric guitar hard case

£80-120

1504.

SKB electric guitar hard case suitable for Les Paul type guitars

£50-80

1505.

Late 1960s Fender Stratocaster/ Telecaster electric guitar hard case (replacement latches)

£100-200

1506.

Gibson Protector Les Paul guitar hard case

£100-200

1507.

Hiscox Thinline electric guitar hard case

£30-50

1508.

Hiscox hardcase suitable for SG style body types

£40-60

1509.

Four various guitar gig bags to include a good quality unused Rosetti digital camo pattern padded bag (4)

£20-40

Guitar Miscellaneous

1510.

Good quality leather guitar strap made by boutique maker 'Heavy Leather, NYC'

*HeavyLeatherNYChavemadeguitar strapsforhighprofileartistssuchas Lemmy,JustinTimberlake,Prince,Johnny Winter,TheStoogesandBlackSabbath etc

£50-80

1511.

Quantity of Stagg and other multi-division folding guitar stands

£30-50

1512.

Line 6 Relay G30 wireless guitar system (missing power supply), together with an RFX MP-128 MIDI Buddy MIDI controller (2)

£40-80

1513.

DiMarzio DP-384 "Chopper T" telecaster electric guitar pickup, together with a DiMarzio DP189

£50-80

1514.

Seymour Duncan STK-S2B Hot Stack guitar pickup, together with a Seymour Duncan TB-4 humbucker guitar pickup

£50-80

1515.

Three Seymour Duncan electric guitar pickups to include an SL59-1N "Little 59", a SDBR1N "Duck Bucker" and a Seymour ST59-1 (3)

£80-120

1516.

Six framed vintage Marshall adverts to include a 1960s black and white RoseMorris "GO OVER BIG with Marshall"; "Practice Makes Perfect" featuring Lead 100, JCM 800 and mini stack; another black and white Rose-Morris "STACKS OF POWER",;"Take it from the top" a colour "GO OVER BIG with Marshall" featuring the JCM 800; "Take it from the top" and "The Ultimate Drive" celebrating 20 years of Marshall, all approximately 9" x 12 "

£30-60

1517.

Marshall JCM 800 Full Stack printed vinyl back drop, 170cm x 73cm, together with a Marshall poncho, acrylic Marshall dealer sign and a Marshall branded light up sign

£30-60

1518.

Les Paul guitar themed car number plateLE57 AUL

*Currentlyonretentionreadytobe transferredtoanewowner

£500-600

1519.

1970s Gibson dealer replacement parts catalogue binder

£50-100 1520.

Aspen Pittman - The Tube Amp Book, deluxe revised edition

£20-30 1521.

Three good guitar reference books to include The Steve Howe Guitar Collection, Beatles Gear by Andy Babiuk and Ferrington Guitars; together with Rock n Roll Collectables by Hilary Kay (4)

£30-50

1522.

Twelve various guitar reference books to include Fylde Guitars, Dangerous CurvesThe Art of Guitar, Gretsch Guitars, The Fender Book, The Gretsch Book and others

£40-80

1523.

Selection of guitar spares and accessories to include a Marshall Valvestate 2000 sixway foot controller, guitar straps, guitar cables, tuners, Hercules wall hangers, stands etc; together with a small selection of instruments to include a Hohner Marine Band harmonica, a Hornby tenor 800H recorder and others

£100-200

1524.

Allparts Fender Licensed twenty-one fret maple board Telecaster guitar neck, made in Japan

£40-60

1525.

Selection of guitar accessories to include a Roland Micro Cube guitar amplifier, four guitar stands, a guitar footstool, strings and method books

£40-80

1526.

Quantity of String Swing guitar wall hangers

£30-60

1527.

Seven various guitar stands; together with a QuikLok amplifier stand

£40-80

1528.

Fender guitar stool; together with another stool with embroidered guitar design to padded seat

£30-60

1529.

Seven leather guitar straps to include a Dat-Strap and others; together with two Thalia capos

£20-40

1530.

Precision type bass guitar body fitted with pickguard and electronics; together with another Precision type bass body, a Precision type bass neck and two P-Bass scratchplates (5)

£50-100

1531.

Selection of electric guitar tuners, mostly new - some boxed including Fender, Schaller, Aria Bass etc

£40-80

1532.

Small selection of Fender guitar parts to include a bridge block, screws, control knobs and a pair of Squier P90 pickups

£30-60

1533.

Selection of guitar spares to include scratchguards and pickups including a loaded Strat guard, a Tokai Goldstar loom and pickups, a Chinese wiring loom and pickups, a Tele wiring loom, string retainers, control knobs, pickup covers etc; together with a small selection of tools for guitar repair and set-up

£50-100

1534.

Bare Knuckle Country Boy Tele guitar pickup set

£50-100

1535.

Three guitar necks to include an Antiquity maple Stratocaster neck, a Gould Stratocaster neck and a Harley Benton Tele neck (3)

£30-60

1536.

Approximately twenty-four Ernie Ball strap blocks of various colours; together with five as new black guitar straps

£20-30

1537.

Steam Punk Flying V wall mount guitar display, 45" long approx

£50-100

1538.

Selection of guitar and other stands to include a Hercules three-position stand tree, three Hercules wall hangers, another Hercules single guitar stand, two Ultimate Support stands etc

£40-80

1539.

Quiklok GS471 folding guitar rack suitable for seven acoustic or electric guitars

£50-80

1540.

Quiklok GS471 folding guitar rack suitable for seven acoustic or electric guitars

£50-80

1541.

Large collection of 1950s BMG Banjo, Mandolin and Guitar magazines including the April 1956 edition with Les Paul and Mary Ford cover feature

£30-60

1542.

Large collection of 1960s BMG Banjo, Mandolin and Guitar magazines

£30-60

1543.

Collection of 1940s BMG Banjo, Mandolin and Guitar magazines; together with a December 1936 BMG magazine

£20-40

1544.

Small collection of 1930s Fretted Harmony and other magazines to include the September-October 1938 edition with first page review of Django Reinhart by Len Williams - an in-depth account of his performance and technique

£20-40

1545.

Selection of guitar spares and accessories to include a Morley expression pedal, an Audio Storm MXP-1 expression pedal, an AC/DC 9 volt pedal power bank, a selection of straps, etc

£50-100

1546.

Gravity folding guitar stand to fit up to nine guitars

£20-40

1547.

Gibson branded guitar stool

£40-60

1548.

Tourtech six position folding guitar rack case

£40-80

1549.

Squier by Fender Tele electric guitar body with pickguard

£30-60

1550.

Two vintage Weltron guitar straps, made in Japan, within original boxes; together with a Gibson guitar strap and two guitar bags

£30-50

1551.

Walter Carter - The Guitar Collection (54 Solid Body edition) – a limited edition virtual guitar size book in lavish guitar-style case, including smaller accompanying book of text and stories plus limited edition print, sealed in folder, as new, limited edition no.

#688/1500

£200-400

1552.

Selection of old pickups to include Maxon, Egmond, Fenton Wheel, Burns etc

£50-100

1553.

Good quality Les Paul type Honduras mahogany guitar kit, comprising body and one-piece quarter sawn neck with binding

£50-100

1554.

Three various Strat type guitar bodies for projects, one with hardware/electrics

£50-100

1555.

Set of six three-a-side Sperzel gold plated guitar tuners

£20-30

1556.

Custom made Aluminium and Glass shop display cabinet with separate glass shelves and sliding glass doors, (118cm x77cm x 42cm) on removable plywood wheeled base full unit dimensions: 126cm x 118cm x 47cm

£100-200

1557.

£100-200

1558.

Vintage steel medical cabinet, reconditioned by Turner & Cox, recently used as a display cabinet within a vintage guitar store, with separate glass shelves and locking doors, on wheeled plywood base (180cm x 94cm x 48cm)

£200-400

1559.

Unbranded Telecaster type body and neck with abstract splatter finish, for spares/ repairs

£30-60

1560.

KAM KWM 1935 UHF Single Microphone Multi-Channel wireless system; together with a small box of various length jack to jack cables and a vox dual button footswitch

£30-50

1561.

Fender Player Plus 12" radius guitar neck, within box

£100-150

1562.

LR Baggs Anthem acoustic guitar pickup, boxed

£80-120

1563.

Large Fender neon sign within Perspex glazed case, 20" x 40" approx

£80-120

1564.

Double Eagle model 8200 Custom "S" type guitar neck, together with sealed ESP branded bridge saddles (with screws and springs)

£30-60

1565.

Duesenberg Z Tuners suitable for Les Paul or similar; together with another set of unbranded guitar tuners

£20-40

1566.

Set of Gold Grover Kidney Button guitar tuners; together with a set of Schaller guitar tuners

£20-40

1567.

White finish bound top Tele type guitar body; together with a Strat type scratchplate loaded with electronics, two sets of tuners (one Kluson style) and a small selection of 0.25" jack plugs

£50-100

1568.

Selection of guitar spares to include pickups and hardware including a DiMarzio Bluesbucker DP163BKU humbucker pickup

£80-120

1569.

Good selection of guitar straps to include Fender and other; together with a vintage Japanese tin guitar (boxed) and a small selection of guitar accessories to include clip-on tuners, Line 6 power unit, Ernie Ball Power Peg etc; also a selection of various guitar stands

£80-120

1570.

Bigsby B5 guitar vibrato, together with gold plated Bigsby style vibrato system and a vibramate body plate

£80-120

1571.

A selection of black guitar hardware, to include: three Fender style tremolo systems (with fittings) and two Gibson style stop tails with roller saddle bridges (with fittings)

£40-80

1572.

A selection of gold plated guitar hardware, to include a licensed Floyd Rose tremolo system, four Fender style tremolo systems (with fittings) and four Gibson style tailpieces with roller saddle bridges

£40-80

1573.

A selection of nickel /chrome plated guitar hardware, to include: two Jaguar/ Jazzmaster style tremolos, four Gibson style tailpieces with roller saddle bridges and five Floyd Rose fit tremolo arms

£40-80

1574.

Maison Super Strat body and neck for spares/repairs

£40-80

1575.

Vintage 1960s Futurama III body with replacement pickguard, for spares/repairs

£40-80

1576.

Cherry finished "SG" Style bolt-on body, fitted with working electrics and bridge/ tailpiece fittings, for spares/repairs

£40-80

1577.

Approximately 30 pairs of Fender style guitar control knobs, a fretwire bending tool, two string winders/clippers and a small selection of banjo bridges

£20-40

1578.

NUX C-5RC 5.8G Wireless guitar system, in charging carry case

£40-80

1579.

Telecaster guitar body, probably by Squier, cream finish; together with three guitar body templates to include two Strat and one Tele (4)

£50-100

1580.

Vintage Precision bass body, probably Fender, with additional Jazz bass routings

£80-120

1581.

Three Ash Telecaster guitar body blanks

£100-200

1582.

Unused bass guitar neck; together with a selection of various bass and guitar scratchplates

£40-80

1583.

Fender licensed Allparts twenty-one fret rosewood board Stratocaster guitar neck

£40-80

1584.

Eight various unfinished electric guitar necks for projects

£50-100

1585.

Six various Tele type electric guitar necks for projects/spares

£40-80

1586.

Three sunburst guitar bodies with hardware for spares/projects

£40-80

1587.

Allen Eden Stratocaster guitar body, unfinished, boxed

£30-60

1588.

Allen Eden Tele type guitar body, red finish, boxed

£40-80

1589.

Allen Eden Strat type guitar body, unfinished, boxed

£30-60

1590.

Allen Eden Strat type guitar body, unfinished, boxed

£30-60

1591.

Allen Eden Tele type guitar body, two-tone sunburst finish, boxed

£40-80

1592.

Allen Eden Tele type guitar body, sunburst finish, boxed

£40-80

1593.

Allen Eden Strat style guitar body, blue finish, boxed

£40-80

1594.

Surf blue Jaguar style guitar body for projects/spares

£40-80

1595.

Approximately twenty guitar wall hangers, together two music stands

£20-40

1596.

Fender Acoustic wooden dealer sign, 26.5" x 35"

£30-60

1597.

Mixed selection of guitar accessories, spares and other items to include a Danelectro Corned Beef reverb guitar pedal, a selection of pickups, capos, strings, guitar care products etc; also eight reels of AP38 Emitape, two microphones, guitar stand, music ledge and microphone stand

£100-200

1598.

Four rare vintage guitar tuition books, including Fender Electric Guitar Course Books 1 and 2, Gogo-Gibson and Kay Guitar Sounds Beginner Edition (4)

£30-50

1599.

Four boxes of Bass Centre Elites bass strings singles ranging in gauge from .020 to .135

£50-100

1600.

Approximately thirty XCG adjustable guitar stands

£30-50

1601.

Box of approximately twenty Stagg 10m Jack to Jack instrument cables

£20-40

1602.

Large selection of Ernie Ball single strings, sizing from .008 to .070

£30-60

1603.

Large box of various Stagg cables, mostly in 1m to 1.5m lengths to include: XLR to Mono Jack, XLR to stereo jack and speakon

£30-60

1604.

Ampeg Pro Series neon dealer sign, 30" x 8" x 4.5"

£30-50

1605.

Three D'Addario Planet Waves 20' American Stage instrument cables; together with three D'Addario Planet Waves Classic Series 20' instrument cables

£40-80

1606.

Three D'Addario Planet Waves 20' American stage instrument cables; together with two D'Addario Planet Waves 20' Classic Series instrument cable

£30-60

1607.

Ten sets of Ernie Ball Beefy Slinky 11 to 54 electric guitar strings; together with four packs of three sets of Ernie Ball Power Slinky 11 to 48 guitar strings and an additional set of the same

£50-100

1608.

Twenty-four packs of Ernie Ball Super Slinky 9 to 42 electric guitar strings; together with five additional packs of three

£50-100

1609.

Twenty-eight packs of Martin Lifespan SP 13 to 56 acoustic guitar strings

£80-120

1610.

Approximately twenty-five Ernie Ball Hybrid Slinky 9 to 46 electric guitar strings

£50-100

1611.

Twenty-two packs of Ernie Ball Hybrid Slinky 9 to 46 electric guitar strings; together with six further packs of three

£50-100

1612.

Approximately twenty Elixir Nanoweb 9 to 46 electric guitar strings; together with nine Elixir Nanoweb 9 to 42 electric guitar strings and two packs of Elixir 9 to 42 Optiweb guitar strings

£80-120

1613.

Approximately thirty-five sets of Elixir 9 to 42 Nanoweb electric guitar strings

£80-120

1614.

Thirteen packs of Ernie Ball Slinky Top Heavy Bottom 10 to 52 electric guitar strings

£30-60

1615.

Selection of guitar spares, some appear vintage, to include neck screws, pickguard screws, knobs, plus slides and picks

£40-80

1616.

Selection of Fender guitar bridge covers for Tele, Strat and Jaguar/Jazzmaster

£30-60

1617.

Selection of Fender bass bridge/pickup covers including one set labelled '68 P Bass'; together with two bass guitar bridges

£50-100

1618.

Seven old Kluson Deluxe tuners for Fender guitars

£20-40

1619.

Selection of guitar reference books to include Gibson Electrics; Soul of ToneCelebrating 60 Years of Fender Amps; The Vox Story; Amped - The Illustrated History of The World's Greatest Amplifiers; The Gibson 175; The Gibson 335; The Gretsch Book and others

£50-100

1620.

Original 1970s large format Gibson guitar countertop dealer display catalogue binder

£80-120

1621.

Framed 'Blue Guitars' poster for the Exhibition of Extraordinary Archtop Guitars from the Chinery Collection, 39" x 27"

£50-100

1622.

Selection of bridge covers to include three Strat, one Tele and one bass; also with a chrome pickup cover and an Italia Maranello scratchplate

£20-40

LOTS 1623-1700 NO LOTS

Studio & Audio Equipment

1701.

Peterson Strobo Rack tuner, with manual

£150-250

1702.

Pair of Bose 301 Series IV direct/ reflecting bookshelf speakers

£40-80

1703.

Pair of Wharfedale Force 2080 speakers

£40-80

1704.

Dual 1246 automatic belt drive turntable, with Philips 22RH580/15T mixer and pair of monitor speakers

£40-80

1705.

Furman PL-Plus Power Conditioner and Light Module rack unit (USA voltage); together with a Coutant Electronics power supply; together with a Realistic Stereo Disco mixer, boxed (3)

£40-60

1706.

Furman Surge Power Conditioner; together with a Furman AC Power Conditioner and a Behringer Ultra DI DI100 box (3)

£20-40

1707.

1985 Roland Juno 106 Programmable Polyphonic Synthesizer keyboard, made in Japan, within fitted oblong hard case

£600-800

1708.

1987 Roland S-10 49-Key Digital Sampling Keyboard, made in Japan

£100-200

1709.

Mid 1980s PPG Wave 2.2 synthesizer keyboard

£3000-4000

1710.

Focusrite Scarlett 6i6 2nd gen USB audio interface, with power supply

£40-80

1711.

Pair of Kef Calinda hifi monitor speakers

£50-100

1712.

Phil Jones Bass Big Head HA-1 Headphone amplifier, boxed

£40-80

1713.

Boss BR-900CD 8 track digital recording studio

£40-60

1714.

Stafford Onstage stage prompter wedge screen monitor with footswitch

£80-120

1715.

Rode NT1-A studio microphone outfit with pop shield, shock mount and cable, boxed; together with a Nordell Audio NMS-1 reflection filter, boxed, a Pulse microphone stand, a hi-hat stand, and a dynamic microphone

£80-120

1716.

Marshall Kilburn Bluetooth speaker, boxed

£80-120

1717.

Korg LP-10 Electronic Piano, made in Japan, circa 1980, with S-1 footswitch

£100-200

1718.

Zoom H5 Handy Recorder, with carry case, manual and memory card

£40-80

1719.

Pioneer PL-112D belt drive stereo turntable; together with a Technics SU-V5 stereo integrated DC amplifier (2)

£40-80

1720.

Behringer C-1 condenser microphone, boxed; together with a Sub Zero SZ-V1 vintage microphone, within flight carry-case

£20-40

1709

1721.

Yamaha YPT-255 digital keyboard, with stand and bag; together with a Silver Crest surround sound speaker system and unbranded bongo drums (3)

£20-40

1722.

Demeter Amplification VTHF-300M power amplifier rack unit; together with a Demeter Amplification VTBP-201 Tube Bass pre-amp rack unit

£700-1000

1723.

1960s Truvox Series 50 reel-to-reel tape recorder with teak veneered case for spares and repairs; together with a selection of various EMI and other tapes

£40-80

1724.

Pulse 8 channel XLR cable reel

£40-60

1725.

Headrush FRFR-108 2000 watt full range flat response 1 x 8" powered speaker cabinet

£80-120

1726.

Dubreq 350S Stylophone, within original box

£80-120

1727.

Tascam 488 Portastudio multi-channel cassette recorder, with box and manual

£40-80

1728.

Yamaha PSS Personal Studio System with MT44 cassette recorder and mixer within original rack case

£100-200

1729.

Tascam DA-20 Digital Audio tape recorder

£30-60

1730.

Yamaha R100 Reverb processor

£50-80

1731.

1970s Ekosonic transistor electric organ, with original stand

£100-200

1732.

Three various bluetooth karaoke PA style speakers, with microphones, one speaker boxed

£10-20

1733.

Mackie SRM450 active PA speaker

£80-120

1734.

Gear4Music drum microphones, within original flight case

£40-60

1735.

Five audio rack units fitted within a studio rack trolley to include an Alesis Microverb 4, two Drawmer Dual Auto Compressor DL241, a Lexicon MPX200 and a HHB CDR-850 compact disc recorder

£100-200

1736.

Esoteric Audio Research Limiting Amplifier EAR 660 rack unit

£2000-4000

1737.

Shure Beta 58A dynamic vocal microphone, boxed

£50-80

1738.

Shure Beta 58A dynamic vocal microphone, boxed

£50-80

1739.

Shure Beta 58A dynamic vocal microphone

£50-80

1740.

Shure Beta 58A dynamic vocal microphone, boxed

£50-80

1741.

Lexicon PCM60 Digital Reverberator rack unit

£100-200

1742.

Drawmer 1960 Vacuum Tube Compressor Pre-Amplifier rack unit

£200-400

1743.

Chandler Limited Abbey Road Special Edition EMI TG Channel Mark II rack unit with PSU within original box

£800-1200

1744.

Chandler Limited Abbey Road Limited Edition EMI TG-1 Limiter Compressor rack unit, with PSU, both boxed

£1500-2500

1745.

Universal Audio Volt 476P audio interface, boxed

£100-200

1746.

Korg i5M interactive music module

£50-80

1747.

Korg Kaoss Pad Dynamic Effect/Sampler

£60-100

1748.

Roger Linn Design Adrenalinn III multieffects and amp modelling unit

£80-120

1749.

Shure VP88 Stereo Condenser microphone

£100-200

1750.

Behringer RD-6-BU analog drum machine, boxed

£50-80

1751.

Selection of audio items to include a vintage linear amplifier, Bose monitor speakers, vintage microphones, reel-toreel tape spares, head de-magnetiser etc

£40-80

1752.

Behringer Ultracom Pro MDX4400 rack unit and a DBX 16A Studio Dynamics processor rack unit; together with two keyboard cases and a selection of various cables

£40-80

1753.

Shure SM58 dynamic microphone, with pouch and cable

£50-60

1754.

Yamaha DSP-A2070 Digital Sound Field Processing amplifier

£20-40

1755.

Kurzweil Micro Piano half rack unit, made in Korea, with manual

£80-120

1756.

Roland V-Drums electronic drum kit with TD-11 drum sound module, KD-9 kick trigger, two PDX-8 triggers, two PDX-6 triggers, CY-12C crash trigger, CY-5 hihat trigger and a CY-13R ride trigger, including Gibraltar kick pedal, stool and PM-10 personal monitor with manual

£300-600

1757.

Pair of Bose 301 Series IV direct/ reflecting bookshelf speakers

£40-80

1758.

Mackie Mix 12FX mixer, with box

£40-60

1759.

Yamaha PSR-73 keyboard; together with a Laney HC25 Hardcore Combo amplifier, a Third Avenue BA-15 amplifier and a Gear4Music child's drumkit

£30-60

1760.

Alesis HR-16 high sample rate/16 bit drum machine

£40-60

1761.

Pair of Genelec 1029A monitor speakers

£200-300

1762.

Selection of multi-core cabling to include a Studio Spares eight channel XLR box and others including phono and jack connections

£40-80

1763.

Spider Cases 4U rack flight case

£20-40

1764.

Heavy duty 4U rack flight case; together with another 3U rack flight case (2)

£30-50

1765.

HK Audio Elements Line Array PA system, scalable from 300-2400 watts comprising two E110A 600 watt active subs, two E110 passive subs, two EA600 power amps, six E435 mid/high speaker modules, one EA835 mid/high speaker module and two wireless connecting poles, all including power cons, connecting cables, monitor cables and operating manuals

£300-500

1766.

Soundcraft EFX12 PA mixer, within Thomann flight case

£100-200

1767.

Shure PGD Mk2 drum mic set including clip mounts, K&M kick drum stand and six XLR mic cables

£150-250

1768.

Four 12" floor monitor wedges to include two HK Audio PR:O 12MA 600 watt active floor monitors, Peavey SP112M passive monitor and a JBL JRX 112M passive monitor

£150-250

1769.

Yamaha Clavinova PF P-100 keyboard within heavy duty Freestyle flight case

£200-300

1770.

Gear4Music SDP-2 stage piano

£80-120

1771.

See next page insert 1772.

Selection of various old valves and a selection of old valve amp parts

£30-60

1773.

Bose Solo 5 TV Sound System sound bar

£30-50

1774.

Four Toa PC-1867 ceiling speakers, all boxed

£50-100

1775.

Sony DVP-CX850D CD/DVD player, with manual

£50-80

1776.

Set of four Wharfedale Modus speakers; together with a pair of Select TASC-2 audio splitters and two stereo audio/video selector splitters

£30-60

1777.

Two Sony hifi units to include a TA-AV490 integrated AV amplifier and an STR-DB925 FM stereo/FM-AM receiver; also a Cambridge Audio Topaz CD10 compact disc player (3)

£50-100

1778.

Sony CDP-CX200 compact disc player, with manual

£50-100

1779.

Sony CDP-CX260 compact disc player, with manual

£50-100

1780.

NAD Series 20 3020 amplifier; together with a Peavey CS400X professional stereo amplifier

£30-60

1781.

Two Marantz SR5009 AV surround receivers (2)

£50-100

1782.

Three audio units to include a Sony STRDB930 FM stereo/FM-AM receiver, a Cambridge Audio CD5 compact disc player and a MOSFET TSR-150X amplifier (3)

£40-80

1783.

Advance Paris MyConnect 50 hifi unit

£50-100

1784.

Mixed selection of audio items to include a Sony CD Walkman, a Behringer U Control UCA202, a Shure SFG-2 precision stylus force gauge, an iRig guitar interface, pocket DAB radio, a Casio EV-570 LCD colour television etc

£50-100

1771

RSE Limited – Twenty-Track Modular Mixer, Wareham, England, circa 1970s

*Arareandhistoricallysignificanttwenty-trackmodularmixingconsole manufacturedinthe1970sbyRogersStudioEquipment(RSELimited), Wareham,England.

RSEoperatedinclosecollaborationwithElectronicMusicStudios(EMS),the pioneeringBritishsynthesizermanufacturerresponsibleforthelegendaryVCS3 andSynthiA.AnumberoftheseiconicinstrumentswereconstructedatRSE’s premisesat1WestminsterRoad,Wareham,firmlyestablishingthecompany withinthecentralnarrativeofBritishelectronicinstrumentdesign.

BuiltbyGerryandBrianRodgers,thedesignersbehindtheSynthiA,thismixer representsarareandfascinatingchapterinBritishaudioengineering.Its aestheticandstructurallineageareunmistakable:theoveralllayout,modular philosophy,andtheinstantlyrecognisablecontrolknobscloselyechotheEMS designlanguage,placingthedeskwithinthesameinnovativecreativetradition thatdefinedagenerationofexperimentalandprogressivemusic.

Theconsolecomprisestwentychannelsarrangedinmodularbanksoffive, reflectingthepractical,forward-thinkingengineeringapproachoftheperiod. AccordingtoformerRSEemployeeLesHayward,thecompanymaintainedasmall recordingstudiowithintheWestminsterRoadfactory,andheimmediately recognisedthisunitasanauthenticRSEdesign.

AcloselyrelatedcustommixerwasfamouslycommissionedforRoxyMusicandBrianEno,witharchivalfootageconfirmingitsuse,further underscoringtheprofessionalpedigreeandculturalrelevanceofRSE’soutput.EquipmentproducedbyRSEfounditswayintothehandsofleading artistsandstudiosoftheera,includingYes,PaulMcCartney&Wings,NewYorkDolls,Hawkwind,Hollywood,Blue,ThinLizzy,andBlackSabbath.

Thisparticularconsolehasitsownremarkableprovenance.Discoveredinascrapyardandrescuedfromimminentdestruction,itsurvivestodayas anauthenticandevocativeartefactofBritishrecordinghistory,arareexampleofspecialiststudioequipmentthatnarrowlyescapedbeinglost forever.

Anexceptionalopportunitytoacquireascarceandhistoricallyresonantpieceof1970sBritishstudioengineering. £1500-2500

1785.

Celestion F Centre hifi speaker; together with a Monitor Audio Monitor MR Centre speaker and a Pioneer PD-M603 compact disc player (3)

£40-80

1786.

Good selection of audio cables and adaptors to include: 6pin to 4pin firewire, a Boss PSA-240 ac adaptor, Male - twin female stereo adaptors and mono jack to jack patch cables

£20-40

1787.

Korg Z1 Multi-Oscillator synthesizer keyboard

£200-40

1788.

Roland R-5 Human Rhythm Composer drum machine, boxed

£30-50

1789.

Yamaha TX7 Tone Generator

£30-60

1790.

Yamaha TX7 Tone Generator

£30-60

1791.

Samson Servo-550 amplifier, boxed; together with a Digidesign Digi 002 rack unit; also three further rack units to include a Peavey CS-X2 Crossover, a Jedia JMA-1410 preamplifier and a Soundtech ST300CX (5)

£80-120

1792.

Yamaha RX17 Digital Rhythm programmer

£30-50

1793.

Boss GL-100 Guitar Driver rack unit

£40-60

1794.

Pair of Alto TS308 active PA speakers, both within Gator gig bags

£200-400

1795.

Pair of Alto TS308 active PA speakers, with Gator gig bags

£200-400

1796.

Alto DS308 active PA speaker, with Gator gig bag; together with a pair of Electro Voice PA speakers

£100-200

1797.

Starlet 2i2 USB audio interface, boxed; together with a Neewer 48V Phantom power supply, boxed and an iRig Acoustic with case

£50-100

1798.

DPA Microphones D:Vote 4099G guitar microphone, boxed

£150-200

1799.

MXL 770 condenser microphone, with case; together with further microphones to include a Shure Super 55 dynamic microphone, another similar vintage style microphone, a Shure WH20 head-worn microphone, Shure GLXD1 wireless transmitter; also a Roland EV-5 expression pedal

£80-120

1800.

Soundcraft Signature 10 mixer; together with a Behringer Xenyx 1202 FX mixer (2)

£80-120

1801.

Two Soundcraft Gigrac integrated mixer amplifiers to include a Gigrac 1000 within original surround and Gigrac 600 within SKB flight case (2)

£50-100

1802.

Bose cylindrical PA system comprising T1

Tone Match audio engine, B2 Bass Module, B1 Bass Module, L1 Model II power stand and L1 cylindrical speakers

£400-600

1803.

Bose cylindrical PA system comprising T1

Tone Match audio engine, boxed, two B1 Bass Modules, L1 Model II power stand and L1 cylindrical speakers

£400-600

1804.

Bose T4S Tone Match mixer

£100-200

1805.

Neumann U87 A i P48 microphone with shock mount and locking ring

£1000-1500

1806.

Sennheiser MKH 416 P48 microphone

£250-350

1807.

AKG C480 condenser microphone with CK91 capsule

£250-350

1808.

AKG C480 condenser microphone with CK91 capsule

£250-350

1809.

1805

AKG D190C dynamic microphone, in original case with vintage black/clear clip

£50-100

1810.

AKG D202 microphone, with matching wide clip

£100-150

1811.

Unbranded carbon hand-held microphone

£50-100

1812.

1960s STC 4113 cardioid ribbon microphone, on matching stand

£100-150

1813.

1960s Reslo RBM microphone, T red label, on matching desk stand

£100-150

1814.

1950s RCA MI 12010 aerodynamic bullet microphone, on matching stand

£120-180

1815.

1960s Grampian GR2/L microphone, original case

£100-150

1816.

Lustraphone VR64 microphone (stand at fault)

£100-150

1817.

STC desk top microphone

£30-60

1818.

AKG D109 Lavalier microphone (no label)

£20-40

1819.

STC Lavalier microphone

£20-40

1820.

AKG D109 Lavalier microphone

£20-40

1821.

Sony ECM 50 Lavalier microphone

£30-60

1822.

Grampian DP4 microphone, with original box

£20-30

1823.

1950s Grundig GCM3 Bakelite body microphone

£30-50

1824.

Candlestick telephone style microphone, circa 1890-1930

£50-80

1825.

ACOS MIX X-39 microphone, with matching desk stand

£60-100

1826.

Wohler Broadcast Amp 1A internal stereo speaker audio monitor with LED barograph level (test level 0dB shown)

£60-100

1827.

Audionics Digital Distribution amplifier

£80-120

1828.

Wohler Broadcast Amp 1 A-LP internal stereo speaker audio monitor with LED bargraph level (test level 0dB shown)

£80-120

1829.

Roland JV-2080 64-Voice Synthesizer

Module rack unit, including four expansion cards - Orchestral Special Effects Experience II, Hip Hop

£500-800

1830.

Audionics 4 in 8 out matrix mixer, internal routing dip switches, 1U rack mount

£80-120

1831.

Kurzweil PC2R sound module rack unit (no external PSU)

£150-250

1832.

Audio Distribution amplifier, with four sets of input with loop out and two output with on/off gain control

£80-120

1833.

Tascam DA-20 DAT recorder, including earphones

£50-100

1834.

1990s Evolution Synthesis EVS-1 synthesizer module, including external PSU

£100-200

1835.

NEXT! EQ215H 2x12 1u rack mount equalizer

£40-60

1836.

Behringer Studio DeNoiser rack unit

£50-80

1837.

Drawmer DL 221 Dual Compressor Limiter rack unit

£100-200

1838.

E-Mu Proteus 1XR rack unit

£100-200

1839.

E-Mu Pro Cussion midi rack unit

£100-200

1840.

HHB Burn It 830 CD recorder

£50-80

1841.

E-Mu ESI 32 sampler rack unit, v2.1 with SCSI fitted

£100-150

1842.

Denon DN1100R Minidisc recorder

£20-40

1843.

Crest Audio X Rack X20 RM 12ch mic/ line mixer, 4 band eq per channel, 12 aux out per channel, master out auto, international voltage

£600-800

1844.

AVID Pro Tools HD Native card in antistatic bag

£250-350

1845.

Pair of Genelec 1031 active studio monitors

£800-1200

1846.

Pair of Genelec 1030 active studio monitors

£500-600

1847.

TC Electronic Finalizer Express Studio Mastering 1u rack mount (International voltage)

£300-400

1848.

Two 1m speaker monitor stands, cable way in one upright, top plate 18cm x 15cm, base 30cm x 25cm

£30-50

1849.

Two Mosses & Mitchell B gauge 48-way audio patch bays with isolated front

**MMconfirmedbylogooneachjack socket

£50-150

1850.

Sennheiser MD421 II microphone, black in original box, case with matching manual, info and spec sheet (as new)

£250-300

1851.

BBC Sennheiser KIT MKH40 microphone, dual point suspension, clip, wind shield, in case

**BBCWorldServiceIDWS0121

£900-1100

1852.

Star Wars Interest – Pair of Tannoy Monitor Red Loudspeakers (1950s–1960s), including original crossovers; HF and main LF drivers present and in working order; spiders flat and correct.

*Arareandhighlyevocativepairofmid-20th centuryTannoyMonitorRedstudio loudspeakers,datingfromthe1950s–1960s, retainingtheiroriginalcrossoversandboth high-frequencyandlow-frequencydrivers.The unitsarereportedtobeinworkingorder,with correctandflatdriverspiders,reflecting carefulpreservation.Thesemonitorswere acquireddirectlyfromthefounderfamilyof AnvilStudios,Denham,Buckinghamshire,and wereservicedbyTannoyUKinAugust1989. InstalledatAnvilStudioscirca1970–1980, threeexampleswerepositionedinthecontrol roomofthemusicstage(left,centre,right), withafourthlaterinstalledintheDubbing Theatre,replacinganAltecLansingmonitor. Duringthisperiod,themusicstagehostedthe recordingofnumerouscelebratedfilmscores, includingStarWars(recordedin1976),Alien, Superman,andTheEmpireStrikesBack.The DubbingTheatrewaslikewiseactivein televisionsoundtrackproduction,contributing toseriessuchasMinder,TheProfessionals, Out,andReturnoftheSaint.Provenance providedbyRupertScrivener,anacquaintance ofthevendor,confirmingtheirinstallationand useatAnvilStudiosduringthissignificant periodinBritishfilmandtelevisionsound production.Theseloudspeakersrepresentan exceptionalopportunitytoacquirestudio equipmentdirectlyassociatedwithsomeofthe mosticoniccinematicscoresofthetwentieth century

£2500-3000

1853.

Yamaha PC2002 Studio Reference Grade amplifier rack unit

*FormerBBCMaidaValeMonitorrack, BBCIDonrear,BBCModSpeakon outputs

£500-600

1854.

30u Metal studio 19" equipment rack, 44cm deep, 1.4m tall

£20-50

1855.

Tascam 244 Portastudio, made in Japan, with manual

£100-200

1856.

Vesta Kaza RV-3 Dual Reverberation Device rack unit

£100-200 1857.

Roland Drumatix TR-606 Computer Controlled drum machine, with pouch and manual

£200-400

1858.

1983 Roland Jupiter 6 JP-6 synthesizer keyboard, made in Japan, with manual, within Brandoni gig bag

£3000-4000

1859.

1986 Roland S-50 Digital Sampling keyboard, made in Japan, within Brandoni gig bag and papers

£150-250

1860.

1980s Roland SH-09 Synthesizer 09 keyboard, made in Japan, with manual

£600-900

1861.

1976 Rhodes Mark I Stage 73 stage piano, with legs and pedal (missing lid)

£1000-2000

1862.

Roland S-550 Digital Sampler rack unit, upon a rack stand, with manual

£100-150

1863.

Roland D-110 Multi Timbral Sound Module rack unit, with manual

£40-60

1864.

Kawai K1R digital synthesizer rack unit, with manual and PSU

£40-60

1865.

Emu Systems Proteus/1 16 bit multitimbral digital sound module rack unit, with manual

£50-100

1866.

Roland RD-500 digital piano, made in Japan, ser. no. AJ04613 (three keys dropped)

£80-120

1867.

Fostex D-108 eight track digital recorder rack unit

£30-50

1868.

Yamaha PSR400 keyboard, with Kinsman gig bag, with stool and stand

£30-50

1869.

1870.

Yamaha Tyros 5 Digital Workstation keyboard, made in Japan, boxed, with expansion kit memory card

£400-600

1871.

AKG D190E microphone, boxed

£20-40

1872.

Roland S-550 System sound library discs, within original case

£10-20

1873.

Selection of NOS Yamaha STK and TDA keyboard power amp modules

£10-20

1874.

Good selection of audio multi-core cabling, various makes and lengths, 16 pair and 12 pair individually jacketed

£10-20

1875.

Selection of audio multi-core cabling, various makes and lengths, 16 pair and 8 pair individually jacketed

£10-20

1876.

AKG D190E microphone, boxed

£20-40

1877.

Shure Unidyne 5155A dynamic microphone

£20-40

1878.

AKG D2000E microphone

£20-40

1879.

Four Skytronic Skytec wedge monitor cabinets (without speakers), all boxed

£5-10

1880.

Edirol UA-25 24bit USB Audio interface, with associated cables; together with a Tascam CD-GT1 portable CD Guitar Trainer

£30-50

1881.

£10-20 1858

Yamaha Tyros 4 Digital Workstation keyboard, made in Japan, boxed, with stand and TRS-MS05 speaker system

£400-600

Approximately Twenty Neutrik NL4FX

Speakon Cable Connector

1882.

Approximately Ten bundles of speakon cables terminating in Neutrik connectors £20-40

1883.

Two Sommer instrument/speaker cables, together with a drum of KelseyWeb speaker/power cabling £20-40

1884.

Two folding keyboard stands, one branded Livivo and the other unbranded £20-40 1885.

Selection of microphone stands; together with a large selection of various audio cables and connectors £50-100

End of day three sale

Day four

Antique & Classical Guitars

Friday 13th March 2026 at 10am

Antique & Classical Guitars

1901.

Antique guitar by Guiot, made in London, England, 1847, signed on the neck block; Back and sides: rosewood, repaired hairlines, refinished; Top: natural spruce, repaired cracks and infills, refinished; Neck: mahogany, refinished, replacement head; Fretboard: rosewood, wear to first position; Frets: good, refret; Hardware: good quality engraved brass tuning strips with shaped ivory buttons; Overall condition: good/ restored

*IvoryexemptionsubmissionreferenceWHWSTRGD

*A.Guiot,alsoknownasJ.GuiotorGuyot,wasaFrenchluthierwho workedinLondonduringthemid-19thcentury.Hewasassociated withtherenownedguitarmakerLouisPanormo,havingworkedfor himaround1830beforesettinguphisworkshoparound1840.The Panormoinfluenceisclear,producinghigh-qualityguitarsinthe Spanishstyle.MadameSidneyPrattenalsousedaGuiotguitar.

£800-1200

1902.

Raimundo Model 123 classical guitar; Back and sides: mahogany; Top: natural cedar; Neck: cedar; Fretboard: rosewood; Frets: light tarnishing; Hardware: good; Overall condition: good

£80-120

1903.

Ryoji Matsuoka 20 classical guitar, made in Japan; Back and sides: rosewood, a few light marks; Top: cedar, minor dings and play marks throughout; Neck: cedar with ebony reinforcement; Fretboard: rosewood; Frets: good; Case: period hard case; Overall condition: good

£100-200

1904.

Late 1970s Bjarton Rosita nylon string classical guitar, made in Sweden; Back and sides: mahogany, minor dings; Top: natural spruce, minor dings and play wear, a few surface hairlines; Neck: mahogany; Fretboard: rosewood; Frets: good; Overall condition: good for age

£80-120

1905.

1971 José Luis Romanillos classical guitar, made in Semley, Wilts; Back and sides: Brazilian rosewood, surface hairline to treble side of centre back; Top: natural spruce; Neck: cedar; Fretboard: ebony; Frets: light wear to first position; Hardware: good; Case: fitted Roca Vidal hard case; Nut width: 52mm; Scale length: 650mm; Overall condition: good

*Soldwithnon-transferabledomesticCITESA10certificateno.

26GBA100132C5

£17,000-20,000

1906.

Takamine G Series EG522SC left-handed electro-acoustic classical guitar, with Rok Sak gig bag

£150-250

1907.

1967 Oscar Teller classical guitar, made in West Germany; Back and sides: figured maple, stable hairline to bass side rib and shoulder, lacquer checking throughout; Top: natural spruce, lacquer checking, slight parting to centre, light play wear to treble side; Neck: two piece, various dings and marks; Fretboard: ebony; Frets: good; Hardware: good, upgraded tuners; Case: period semirigid fibreboard case; Overall condition: good for age

£80-120

1908.

2020 Kenny Hill Guitar Company New World Guitar Co Player Series P6505 cutaway classical guitar, made in China; Back and sides: rosewood; Top: natural spruce; Neck: cedar; Fretboard: ebony; Frets: light edge sprouting; Hardware: good; Case: fitted hard case; Overall condition: good

£300-500

1909.

Suzuki nylon string classical guitar, mahogany back and sides, cedar top, cedar neck, rosewood fretboard, with soft bag

£80-120

1910.

19th century French Mirecourt guitar by and labelled Coffe Goguette; Back and sides: Brazilian rosewood, repaired cracks to lower back, further minor marks; Top: fine grained natural spruce top, refinishing with bridge work evident, various expected play marks; Neck: ebonised; Fretboard: rosewood, wear to first position; Frets: good; Hardware: Jerome brass plate tuners with shaped bone buttons; Case: Kinsman gig bag; Scale length: 650mm (635mm to inner nut); Nut width: 46mm; Overall condition: good for age

*Ivoryexemptionsubmissionreferenceno.Q2MCCK6Q £800-1200

1911.

1973 Di Giorgio Amazonia number 30 classical guitar, made in Brazil; Back and sides: maple, heavy checking and marks throughout; Top: various hairlines, slight belly lift and rippling; Neck: cedar, heavy lacquer checking and other marks; Fretboard: rosewood; Frets: minor wear and tarnishing; Hardware: replacement tuners; Overall condition: fair

£80-120

1912.

1860 George Louis Panormo guitar, made in England; Back and sides: coromandel four piece back, many repaired cracks to the sides - some of which are opening, revarnished; Top: fine grain spruce, a few minor cracks, revarnishing, bridge restorations; Neck: cedar, age related wear throughout; Frets: worn, tarnished and in need of some attention; Hardware: Baker engraved brass tuners with shaped buttons; Nut width: 48mm; Scale length: 630mm; Overall condition: fair

*IvoryExemptionreferencenumberX5MBPJ8D

£800-1200

1913.

1975 Francisco Santiago Marin classical guitar, made in Grenada, Spain; Back and sides: rosewood; Top: natural cedar, light play wear and other minor dings; Neck: cedar, light wear and dings; Fretboard: ebony; Frets: light tarnishing with minor oxidisation to upper frets; Hardware: good; Case: fitted hard case; Scale length: 660mm; Nut width: 52mm; Overall condition: very good

*Soldwithdomesticnon-transferableCITESA10certificate(Please note:InternationalexportwillrequirefurtherCITESpaperworkat buyercost)

£1500-2500

1914.

2010 Martinez MCG-40S classical guitar, with compressed foam case

£100-200

1915.

1989 Michael Gee classical guitar, made in England; Back and sides: Indian rosewood, a few light marks; Top: satin finished cedar, a few light marks; Neck: cedar; Fretboard: ebony; Frets: good; Scale length: 650mm; Nut width: 52mm; Case: Hiscox hard case; Overall condition: good

£1000-1500

1916.

Antique French Mirecourt guitar in need of restoration, probably by Parizot, circa 1830; Back and sides: Brazilian rosewood, large open cracks to back and sides; Top: fine grained spruce, hairlines, bridge partially missing; Neck: head/neck join in need of attention, veneer partially missing at neck heel; Fretboard: ebony; Frets: heavily tarnished and require replacing; Hardware: brass tuning strips with oval buttons; Case: period ebonised case; Scale length: 650mm; Nut width: 46mm; Overall condition: in need of restoration

*IvoryexemptionsubmissionreferenceQKWDN6FT

£1000-2000

1917.

Cuenca 40R classical guitar, rosewood back and sides, cedar top, rosewood fretboard, within hard case

£150-200

1918.

Yamaha CGX-101 electro-classical guitar, within Taylor gig bag

£100-200

1919.

1970s Yamaha G-100 classical guitar, made in Japan

£80-120

1920.

1977 Manuel Conde classical guitar, made in Madrid, Spain; Back and sides: solid rosewood; Top: solid spruce; Neck: cedar; Fretboard: ebony; Frets: good; Hardware: good, upgraded tuners; Case: hard case; Scale length: 665mm; Nut width: 54mm; Overall condition: good

£300-500

1921.

Admira Soledad classical guitar, within compressed foam case

£80-120

1922.

Admira Espana EC electro-classical guitar within TGI hard case; together with a Suzuki SCG-30 classical guitar and a JHS Encore

ENC50N classical guitar (3)

£80-120

1923.

Antoria G974 classical guitar, with rosewood back and sides and cedar top, within damaged semi-rigid fibreboard case

£50-100

1924.

Valencia CG190CE electro-classical guitar, with TGI gig bag; together with a Carlsbro Kickstart 25 amplifier stand and tuner; also with harmonica

£50-100

1925.

1987 Vicente Sanchis Model 28 classical guitar

£80-120

1926.

Raimundo y Aparicio Model 112 classical guitar

£80-120

1927.

Casa Sors classical guitar, made in Barcelona, Spain; Back and sides: rosewood; Top: natural cedar, minor dings, larger blemish to bass side upper bout; Neck: cedar; Fretboard: ebony; Frets: light tarnishing; Hardware: good; Case: TGI hard case; Overall condition: good for age

£150-250

1928.

1995 Ricardo Sanchis Carpio 2A classical guitar, made in Valencia, Spain; Back and sides: Indian rosewood; Top: natural cedar; Neck: cedar; Fretboard: ebony; Frets: generally good, a few minor tarnishing spots; Case: hard case; Scale length: 650mm; Nut width: 54mm; Overall condition: very good

£300-400

1929.

Michael P Nalysnyk Parlour guitar, made in England; Back and sides: mahogany; Top: spruce; Neck: mahogany with ebony friction tuning pegs; Fretboard: ebony; Frets: good; Case: fitted Kingham MTM hard case; Scale length: 630mm; Nut width: 48mm; Overall condition: very good

£800-1200

1930.

Asturias Model SB.630 short scale classical guitar, made in Japan; Back and sides: rosewood; Top: natural spruce; Neck: cedar; Fretboard: ebony; Frets: good; Hardware: good; Case: Bam hard case; Scale length: 630mm; Nut width: 50mm; Overall condition: very good

£200-400

1916

1929

1931.

1994 Antonio Sanchez 1010 classical guitar, with mahogany back and sides, cedar top, rosewood fretboard, with hard case

£150-250

1932.

Almansa CS CW SR E2 electro-acoustic nylon string guitar, made in Spain; Back and sides: Indian rosewood; Top: natural spruce; Neck: cedar; Fretboard: ebony; Frets: good; Electrics: working; Hardware: good; Case: Cibeles hard case; Overall condition: excellent

£500-800

1933.

BM Ronda classical guitar, with soft bag

£10-20

1934.

2002 Amalio Burguet 3-M electro-classical guitar, made in Spain; Back and sides: Indian rosewood, a few light marks; Top: natural cedar; Neck: cedar with ebony reinforcement; Fretboard: ebony; Frets: good; Case: Hiscox hard case; Overall condition: very good

£300-500

1935.

Interesting 19th century Stauffer style small body guitar; Back and sides: birds eye maple, light marks; Top: fine grain spruce, light play wear, evidence of bridge work; Neck: ebonised, worn to first position, Stauffer style head with engraved tuning plate; Fretboard: ebonised with pearl position markers, light wear; Frets: light wear; Case: tooled leather case (at fault); Scale length: 620mm; Nut width: 42mm; Overall condition: good

*Ivoryexemptionreferenceno.GCDGRB42

£800-1200

1936.

1970 Masaru Kohno 7 classical guitar, made in Japan; Back and sides: Indian rosewood, minor scratches; Top: natural cedar, light play wear to treble side of table and other minor marks; Neck: cedar; Fretboard: ebony, light wear; Frets: mild wear; Hardware: good; Case: Just In Case fitted hard case; Scale length: 660mm; Nut width: 52mm; Overall condition: good

£800-1200

1937.

Condé Hermanos classical guitar, made in Madrid, Spain; Back and sides: Indian rosewood, a few light marks; Top: natural cedar, light play wear to treble side; Neck: cedar, minor dings; Fretboard: ebony; Frets: good; Hardware: upgraded Rodgers tuners; Case: Freestyle fitted hard case; Scale length: 650mm; Nut width: 52mm; Overall condition: very good

*Singleownerfromnew,purchasedbythevendordirectlyfromthe HermanosWorkshop

£700-1000

1938.

Alhambra 8C classical guitar, made in Spain; Back and sides: Indian rosewood, a few light marks; Top: natural cedar, a few minor dings; Neck: cedar with ebony reinforcement; Fretboard: ebony; Frets: good; Case: fitted hard case; Scale length: 665mm; Nut width: 52mm; Overall condition: very good

£200-400

1939.

Alvarez CC7HCE electro-acoustic nylon string guitar, made in China, with Tourtech gig bag

£100-200

1940.

Alhambra Mengual y Margarit Serie C classical guitar, made in Spain; Back and sides: rosewood; Top: natural cedar, blemish to top behind bridge plate and treble side of centre top; Neck: cedar; Fretboard: ebony; Frets: good; Hardware: good; Case: Thomann hard case; Overall condition: very good

£1000-1500

1941.

Asturias by Masaru Matano John Mills Model classical guitar, made in Japan; Back and sides: rosewood, minor dings to edges; Top: natural spruce, hairline parting to centre seam; Neck: mahogany with ebony reinforcement; Fretboard: ebony; Frets: good; Hardware: good; Case: fitted hard case; Overall condition: good

£250-350

1942.

Asturias by Masaru Matano John Mills Model classical guitar, made in Japan; Back and sides: rosewood, a few minor dings; Top: natural spruce, minor dings and light play wear to treble side; Neck: mahogany with ebony reinforcement, light dings; Fretboard: ebony, light wear to first position; Frets: good; Case: compressed foam case; Overall condition: good for age

£200-400

1943.

Yamaha GC-3D classical guitar, made in Japan, circa 1970; Back and sides: rosewood, minor scratches to centre back; Top: natural cedar, a few minor marks; Neck: cedar; Fretboard: ebony; Frets: good; Hardware: good; Case: compressed foam case; Overall condition: good for age

£400-600

1944.

1973 Masaru Kohno no. 10 classical guitar, made in Japan; Back and sides: Indian rosewood, minor surface scratches and dings; Top: natural cedar, minor dings including string blemishing behind bridge plate and minor play wear to treble side; Neck: cedar with ebony reinforcement; Fretboard: ebony; Frets: good; Hardware: good; Case: compressed foam case; Overall condition: good £1000-1500

1945.

Yamaha GC-3D classical guitar, made in Japan, circa 1970; Back and sides: Indian rosewood, a few light marks; Top: natural cedar, minor dings and scuffs; Neck: cedar; Fretboard: ebony; Frets: good; Hardware: good; Case: compressed foam case; Overall condition: good £400-600

1946.

1980 Yamaha Grand Concert GC-10A classical guitar, made in Taiwan; Back and sides: Indian rosewood; Top: natural cedar, a few minor dings and minor play wear; Neck: cedar; Fretboard: ebony; Frets: good, minor fret sprouting throughout; Hardware: good; Overall condition: good for age

£150-250

1947.

Asturias John Mills Model JM15 classical guitar, made in Japan; Back and sides: rosewood, minor finish clouding; Top: natural cedar; Neck: cedar with ebony reinforcement; Fretboard: ebony; Frets: good; Hardware: good; Overall condition: good

£200-300

1948.

1989 Juan Salvador 6AR classical guitar, made in Spain; Back and sides: rosewood, impact damage to back treble edge, various surface scratches; Top: natural cedar; Neck: cedar with ebony reinforcement; Fretboard: ebony; Frets: good; Case: hard case; Scale length: 645mm; Nut width: 52mm; Overall condition: good

£150-250

1949.

Three classical guitars to include a Vicente Sanchis Model 29, an Admira Clasico and a José Ferrer 5207A (3)

£100-200

1950.

1970 Manuel Condé classical guitar, made in Madrid, Spain; Back and sides: Indian rosewood, light scratches and marks throughout; Top: varnished spruce, refinishing at edges of neck and bass side lower bout; Neck: cedar, minor dings; Fretboard: ebony; Frets: tarnishing throughout; Case: hard case; Scale length: 655mm; Nut width: 54mm; Overall condition: fair

£200-300

1951.

Asturias classical guitar; Back and sides: cypress, various marks and scuffs; Top: natural spruce, play wear to treble side and further dings; Neck: cedar, wear to edges; Fretboard: rosewood, light wear; Frets: good; Case: hard case; Scale length: 650mm; Nut width: 52mm; Overall condition: fair

£200-300

1952.

2015 Granodos Luthier Series 7CE electro-classical guitar, made in Bulgaria, with soft bag

£100-200

1953.

Ricardo Sanchis short scale 530mm scale nylon string guitar, within original hard case

£100-200

1954.

Hermann Schaller classical guitar, made in Germany; Back and sides: maple; Top: natural spruce; Neck: mahogany; Fretboard: rosewood; Frets: good; Case: Yamaha hard case; Overall condition: very good £80-120

1955.

Two classical guitars to include a Santos Martinez SM675CEA and an Admira Artista (2) £100-200

1956.

Esteve classical guitar; together with an old acoustic guitar labelled Soria and one other (3) £50-100

1957.

1960s Besson classical guitar with maple back and sides, spruce top and maple neck £50-80

1958.

Vintage German twin neck harp guitar; Back and sides: figured maple, hairline to centre back, refinish; Top: natural spruce, many restored cracks and refinished; Necks: both refinished; Fretboards: rosewood; Frets: light tarnishing; Hardware: good; Overall condition: fair £300-500

End of sale

The Next Guitar sale will take place on the 9th, 10th, 11th & 12th June

Consignments now invited - Entry deadline 8th May

CONDITIONS OF SALE

The Auctioneer acts only as agent for the Seller (unless otherwise specifically declared). Lots sold are likely to have been subject to wear and tear caused by user or the effects of age and may therefore have faults and imperfections. Buyers are given ample opportunity at viewing times to examine lots to be sold and will be assumed to have done so. They must rely solely on their own skill or judgement as to whether lots are fit for any particular purpose.

1. Bids

All bids made shall be treated as offers made upon these Conditions of Sale and all persons present and approved to bid are admitted to a sale on the basis that they have notice of these Conditions.

1A. Internet Bidding

There are no additional surcharges when bidding via our own bidding platform 'GH Live'

We also use two other online bidding platforms via the-saleroom.com and Easylive which will be subject to additional fees. Please see their respective websites for further details and terms.

‘Pre-Bidding Autobids’

'Pre-Bidding' is a new feature to our own platform and allows bidders to bid against each other prior to the start of a live auction. During the live auction the bidding will start at the current bid reached during the 'Pre-Bidding' and continues until your maximum bid is reached. All bids are anonymous, and your maximum bids are confidential. If you have been outbid, during the ‘Pre-Bidding’ then you will receive an email notifying you that you are no longer the leading bidder, however once the sale is live you will not receive any further notifications. Once bids are placed, they cannot be removed, but can be reduced, if above the current bid.

2. Ascertainment of the Buyer

The Buyer shall be the person making the highest bid which is acceptable to the Auctioneer as signified by the fall of the hammer. No bid may be retracted. In the case of a dispute the Auctioneer may either declare the purchaser or put the lot up again.

3. Auctioneer’s discretion

The Auctioneer has sole discretion, (a) to refuse any bid, (b) to advance the bidding as he may decide, (c) to withdraw or divide any lot or combine one lot with another or others, (d) to exclude any person from the auction rooms, and (e) to require pre-payment in full.

4. Reserves and Seller’s right to bid

Lots put up for sale are subject, (a) to any reserve price imposed by the Seller, (b) the right of the Auctioneer to bid on behalf of the Seller, and (c) where no reserve has been imposed (but in no other case) for the Seller to bid personally or through any one agent. It is the responsibility of the Seller to ensure any reserves are received by the Auctioneer.

5. Buyer’s Duties

The Buyer shall forthwith or as soon as possible after the sale, (a) supply his name and address, (b) supply, if so required, bank or other suitable references, (c) pay the full purchase price in a way acceptable to the Auctioneer, notwithstanding any prior arrangement for advance payment required by the Auctioneer, and (d) on proof of payment clear the lots purchased by the times specified. Lots may not be cleared during the sale except by permission of the Auctioneer.

6. Payments ALL LOTS ARE TO BE PAID & CLEARED WITHIN 7 DAYS OF THE AUCTION

Methods of payment include direct bank transfer, debit card, credit card, cash to a maximum of £8,500, Cheque payments are no longer accepted. For fraud protection we no longer accept payments by credit or debit cards for ‘Customer not Present’ transactions. Card payments at the saleroom will be accepted but must be supported by Chip and PIN. Card payments for live internet bidding will only be accepted if they have been AVS and 3D Secure authorised via our online platform with a maximum transaction limit of £1000 for Watch & Jewellery auctions; £2000 limit for all other auctions unless previous authorisation has been agreed. Deposit payments made direct at the bank or via telephone banking will need to be confirmed as 'cleared funds' before any goods are released.

6A. Anti-Money Laundering Policy

New clients spending over £5000 on an individual transaction must be verified, by supplying a current form of ID confirming their name and address to match the invoice. This must be supplied to complete the transaction before the release of goods

7. Liability of the Auctioneer and Sellers

Subject to Condition 8: (a) faults and imperfections (if any) are not stated in the catalogue and neither the Seller nor the Auctioneer is responsible for any defects whatsoever, (b) no warranty is given or authorised to be given by the Seller or the Auctioneer with regard to any lot other than the Seller’s right to sell it, (c) any express or implied conditions or warranties relating to description or quality, are hereby excluded.

8. Catalogue Descriptions

Descriptive statements contained in the advertisements or catalogues or made up by the Auctioneer or any member of his staff should be taken as matters of opinion only and shall not be taken as statement of fact.

i) Items in the catalogue are sold as seen. Where possible significant damage is mentioned, but this does not include all faults and imperfections. The absence of such reference does not imply that the lot is in good condition or free from restoration or repair. Condition reports are available upon request

ii) ’Inscribed’ or ‘Signed’ does not imply that the lot is wholly or partly by that maker

9. Forgeries

Notwithstanding Conditions 6 and 7, if the Auctioneer receives notice in writing from the Buyer WITHIN 7 DAYS OF THE SALE that in his opinion a lot is a forgery (as defined in Condition 12) and on giving such notification the lot in question is returned to the Auctioneer at his working premises in the same condition as when bought, then if on considering such evidence as the Buyer supplies to prove his assertion, the Auctioneer decides that the lot is a forgery the sale of the lot will be rescinded and the purchase price repaid to the Buyer.

10. Property in lots and risk

The Buyer shall not become the owner of any lot, and the Auctioneer shall have a lien thereon, until the Buyer has discharged the purchase price in full together with any other charges due, but after the fall of the hammer the risk of damage or loss shall nevertheless be the Buyer’s.

11. The Premium

The Buyer shall pay to the Auctioneer a premium of 22% of the hammer price together with VAT. (26.4% inclusive of VAT)

12. Default by Buyer If the Buyer fails to make payment in a way acceptable to the Auctioneer or to remove any lot or lots bought by him within 7 days of the auction or in any other material respect fail to comply with these conditions, the Auctioneer shall have the right, (a) to resell the lot or lots by public auction or otherwise without notice to the Buyer, and if any deficiency arises on such resale, after deducting the Auctioneer’s full costs and expenses, the Buyer shall be responsible to the Auctioneer therefore (but any net surplus to be the Seller’s) or, alternatively, (b) to store the lot at the Auctioneer’s premises or elsewhere and to release the lot to the Buyer only after payment in full of the purchase price together with any other charges due. The Auctioneer reserves the right to charge storage of 50p per lot per day on any lot or lots uncleared by the time specified together with any removal expenses. In addition, interest will be charged at 2.5% per month or part thereof (34.4% APR) on any accounts that remain unpaid in part or full 1 week after the sale. Interest and storage will be charged from the date of sale. In addition, the Buyer shall be liable for all legal and court costs incurred by the Auctioneers in pursuit of payment from the Buyer. The Auctioneer reserves the right to refuse any cheques and will not release lots purchased until evidence has been received that any cheque accepted has been cleared.

13. Release of Goods

Payment and clearance should be made within seven days after the sale. Goods will not be released until full payment has been cleared and a paid invoice produced. For clients arranging courier or third-party collection: written instruction must be received by the purchaser; identification will be requested from the courier and their vehicle’s registration number taken. For security purposes our premises are monitored by 24-hour CCTV

14. Definitions and interpretation

In these conditions: (a) Reference to the ‘the Auctioneer’ shall be taken to mean the firm of Gardiner Houlgate or any director, partner or employee thereof at the time of sale; (b) Buyers shall be deemed to be the principals unless to the prior knowledge of the Auctioneer they are acting as agent on behalf of a named principal; (c) ‘Forgery’ means a lot (i) which is so constituted as deliberately to deceive when considered in the light of its catalogue description, and (ii) whose value as such is materially less that if it had complied with the catalogue description; (d) The Interpretation Act 1978 shall apply to the general construction of terms and expressions used in these Conditions as if contained in a statute.

15. Law and Jurisdiction

These Conditions of sale are subject to English law, which shall apply to their construction as well as their effect. The Seller and Buyer agree to submit to the exclusive jurisdiction of the English courts.

16. What is Temporary Importation?

Temporary Importation is a system that applies to lots which have been imported for sale from outside the EU. It allows the point of importation to be delayed until after the sale at auction. These lots are indicated in catalogues by the use of the following symbol * Only the Hammer Price will be treated as the import price and the Buyer’s Premium will be subject to UK domestic VAT at 20%. So whilst the Hammer Price will continue to be charged with Import VAT at 5% or 20” as appropriate, the Buyer’s Premium will always be charged with domestic VAT at 20% Lots subject to Temporary Importation will be offered under the Auctioneer’s Margin Scheme and will be subject to import VAT of either 5% or 20% on the buyer’s Premium. Anyone who wishes to buy outside the Margin Scheme should notify us immediately. An invoice under the normal VAT rules and charging VAT at 20% on both Hammer and Premium will then be issued

Temporary Importation should affect only private individual buyers who are resident within the EU. Anyone who is registered for VAT in the EU should be able to recover the VAT on the Buyer’s Premium either on their VAT returns or through the 8th Directive Refund Scheme. Any non-EU buyer who exports the lots from the EU will be able to have the VAT refunded provided the appropriate export regulations are complied with

17. Property sold with a * Symbol These items have been imported from outside the EU to be sold at auction under temporary importation. When Gardiner Houlgate releases such property to buyers in the UK, the buyer will become the importer and must pay Gardiner Houlgate import VAT at 5% on the Hammer Price These lots will be invoiced under the Auctioneer’s Margin Scheme. Gardiner Houlgate must bear VAT on the Buyer’s Premium and hence charge an amount in lieu of VAT at 20% on this Premium. This amount will form part of the Buyer’s Premium on our invoice and will not be separately identified VAT registered buyers from the EU should note that the import VAT charged on property released in the UK cannot be cancelled or refunded by Gardiner Houlgate VAT registered buyers from the UK should note that the invoice issued by Gardiner Houlgate for these items is not suitable evidence in respect of import VAT VAT registered buyers from the EU countries may be able to seek repayment of the import VAT paid by applying to HM Revenue and Customs. On request, immediately after the sale, the office can either ask HM Revenue and Customs to generate a C79 certificate (for UK buyers), or obtain a copy of the import C88 (for other EU VAT registered buyers), which may be used to claim recovery of the VAT. Otherwise Gardiner Houlgate may re-invoice the lot and charge VAT at 20% on both the Hammer Price and the Premium and provide a tax invoice to the buyer

18. CITES Restrictions

Any lots containing any amount of Brazilian rosewood and endangered species may be subject to restrictions when exporting outside of the EU. It will be the buyer’s responsibility to make sure that the relevant paperwork is in place before shipping. Some lots are sold with CITES article 10 certificates, allowing the commercial use of an item containing an endangered species. Lots subject to this are marked in the catalogue

Import/Export

It is the buyer’s responsibility to obtain the correct import/export licenses and CITES licenses for items which they have purchased. Gardiner Houlgate take no responsibility for the export of goods.

19. Gemstones

Many gemstones have been treated in various ways to enhance their appearance. For example, sapphires and rubies are routinely heat treated and emerald treated with oils and resins. Some stones may require re-treating or oiling periodically. Enhancement affects market value, and all Gardiner Houlgate estimates assume that gemstones may have been enhanced.

20.Artists Resale Rights (or Droit de Suite)

On certain lots marked in the catalogues and which are sold for a hammer price of £1000 or greater (converted into the currency of the sale using The Design and Artists Copyright Society threshold calculator on the date of the Sale) the Additional Premium will be the percentage of the amount of the Hammer Price calculated as follows:

£0-£50,000 4%

£50,000.01 to £200,000 3%

£200,000.01 to £350,000 1%

£350,000.01 to £500,000 0.5%

Exceeding £500,000 0.25%

* Gardiner Houlgate is a trading name of Bath Auction Rooms Limited, registered in England and Wales No. 5228635.

G ARDINER H OULG ATE

THE SPECIALIST AUCTIONEERS

DIRECTIONS TO OUR CORSHAM HEADQUARTERS

On the A4 from Bath or Chippenham turn off at the mini roundabout by the Hare & Hounds Pub towards Corsham town centre, turn immediately right at the next mini roundabout into Valley Road. After one mile cross narrow railway bridge and round right angle bend. Turn left after 600 yards into Leafield Industrial Estate.

Go straight through the estate and take the last turning on the right beforemeeting the public road again, just past Linpac and opposite Corsham Print. The Bath Auction Rooms are at the end of the road facing you.

Total time from Junction 17 - 10-15 minutes

Total time from central Bath - 15 minutes

Travelling by Train - we recommend Chippenham Station

Gardiner Houlgate, 9 Leafield Way, Corsham, Nr Bath SN13 9SW

Telephone: 01225 812912

Fax: 01225 811777

E-mail: auctions@gardinerhoulgate.co.uk

www.gardinerhoulgate.co.uk

The Guitar Auction - 10th-13th March 2026

VIEWING

FREE ONLINE BIDDING

OTHER BIDDING METHODS

PAYMENT DETAILS

CONDITION GUIDANCE

Guitars Part I, Artist

Instruments & memorabilia

Guitars

The Rod Deas Collection Lots 501-506

CulturalSignificance

The Adrian Utley Collection

Jim Barr Collection

Entertainment Memorabilia

End of Day one sale

Guitars Part II

Guitar Amplification

Guitar Effects, Spares & Audio Equipment

Pedals

Guitar Cases

Guitar Miscellaneous

Studio & Audio Equipment

End of day three sale

Antique & Classical Guitars

Antique & Classical Guitars

End of sale

CONDITIONS OF SALE

G ARDINER H OULG ATE

THE SPECIALIST AUCTIONEERS

DIRECTIONS TO OUR CORSHAM HEADQUARTERS

G ARDINER H OULGATE

THE SPECIALIST AUCTIONEERS