Page 1

Warren FREE County Report WarrenCountyVA.com

Volume IX, Issue 3 · Mid February, 2014

FrederickCounty.com

Critically-endangered Micronesian Kingfisher hatches in Front Royal: only 129 left on earth

New Business

Heroin in the Shenandoah Valley

10

Academy Award-winning actor Philip Seymour Hoffman was found in his NY apartment dead of an apparent drug overdose

14

Middletown’s Irish Isle

12

Cover photo “Frozen Shenandoah” by Jay Buckner

2


Page  • Warren & Frederick County Report • Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com • 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com • 540-683-9197

Wildlife

Micronesian Kingfisher Chick hatches at National Zoo’s Conservation Biology Institute Total of 129 Birds in Existence The Smithsonian Conservation Biology Institute rung in 2014 with the hatching of the most endangered species in its collection—a Micronesian kingfisher—Jan. 1. The chick, whose sex is unknown, is the first offspring for its 8-year-old father and 2-year-old mother. This boost brings the total population of Micronesian kingfishers to 129 birds. Micronesian kingfishers are extinct in the wild. This species is extremely difficult to breed due to incompatibility between males and females and the inability of some parents to successfully raise their own chicks. Animal care staff are hand-raising the chick, which involves feeding it at two-hour intervals, seven to eight times per day. Visitors to the Smithsonian’s National Zoo can see these critically endangered birds on exhibit in the Bird House. Micronesian kingfishers flourished in Guam’s limestone forests and co-

conut plantations until the arrival of the brown tree snake, an invasive species that stowed away in military equipment shipped from New Guinea after World War II. Because these reptiles had no natural predators on Guam, their numbers grew and they spread across the island quickly. Within three decades, they hunted Micronesian kingfishers and eight other bird species to the brink of extinction. In 1984, Guam’s Department of Aquatic and Wildlife Resources captured the country’s remaining 29 Micronesian kingfishers and sent them to zoological institutions around the globe—including the National Zoo—as a hedge against extinction. The Association of Zoos and Aquariums created a Species Survival Plan for the birds. The SSP pairs males and females in order to maintain a genetically diverse and self-sustaining population. As the captive population increases, the U.S. Fish and Wildlife Service and Guam’s Department of Aquatic and Wildlife Resources continue to look for suitable release sites in Guam. The availability of re-

lease sites continues to shrink, however, due to deforestation and human expansion. Controlling the brown snake population remains a significant challenge as well. Scientists are hopeful that initiatives for snake control and forest protection signify that the reintroduction of the Micronesian kingfisher may soon become feasible. Additionally, field studies of a different subspecies of wild kingfishers are underway on Pohnpei, another Micronesian island, to secure essential biological information on wild populations and to test various reintroduction techniques for use on Guam. The Smithsonian Conservation Biology Institute plays a key role in the Smithsonian Institution’s global efforts to understand and conserve species and train future generations of conservationists. Headquartered in Front Royal, Va., SCBI facilitates and promotes research programs based at Front Royal, the National Zoo in Washington, D.C. and at field research stations and training sites worldwide. – From a release

Photos courtesy of Victoria Lake, Smithsonian Conservation Biology Institute

BILL LONG IS BACK!!!

WE FIX IT RIGHT!!! New Shop... New Location...

Same fantastic service! Family Owned since 1993

21st year serving our great customers! For all your repair and maintenance needs the Auto Care Clinic provides you with Factory Level Diagnostics from an ASE Certified Master Technician. 0QFO.PO'SJtBNQN

European and Asian Automobile Specialist

8JODIFTUFS3E'SPOU3PZBM

#*-(2455)

www.autocareclinic.biz


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 • Warren & Frederick County Report • Page 

MYSTERY DINNER THEATRE

Due to the great response to this season’s Mystery Dinner Theatre we added two more performances in Front Royal! Wednesday, February 19th & Thursday February 20th! Tickets can be purchased in the restaurant! These shows will sell out, so get yours before it’s too late!


Page  • Warren & Frederick County Report • Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

I do not recall any loud outcry from then Supervisor Tederick against such policies when they were being utilized by the county and the very same EDA now poised to negotiate redevelopment of two vacant commercial spaces INSIDE the Town of Front Royal, rather than on county land.

Front Royal

Downtown merchants overwhelmingly favor building swap Why shouldn’t the town, EDA help facilitate Afton Inn redevelopment? By Roger Bianchini Warren County Report After a Jan. 29 Public Hearing, the Front Royal Town Council tabled action on the proposed swap of old Town Hall for the Afton Inn to the next council meeting, scheduled for Feb. 10. During the public hearing 11 people spoke in favor of the swap, 7 against it. So far, only one councilman, Daryl Funk, has expressed opposition to the plan, though one, if not two more votes seem less than fully committed to the idea. A five-vote “supermajority” of the six-seat council is required to approve the plan.

That plan would utilize the towncounty Economic Development Authority to negotiate the property trade and then market the long-derelict Afton Inn sitting at Front Royal’s main historic downtown intersection, for sale and redevelopment. The plan puts strict covenants on redevelopment of old Town Hall in a timely manner that will preserve its historic façade. If not developed according to those contract guidelines the EDA would be able to re-purchase Town Hall at its then assessed value. EDA Executive Director Jennifer McDonald also said there would be strict parameters about timely redevelopment attached to a contract

on the Afton Inn. If the public hearing indicated anything, it was that neighboring downtown business owners overwhelmingly support the swap designed to put the huge and long-derelict Afton Inn up for sale under parameters that seem to assure movement toward redevelopment of both properties. Among those Front Royal merchants speaking for the proposal were Mike McCool (National Media Services), Rick Novak (Royal Cinemas), Craig Laird (Royal Oak Computers), Christian Failmezger (Vino 124), Herb Malreath (Daily Grind Coffee Shop), Sharon Smith (Main Street Confections), and former Councilman Tom Conkey (Killahevlin Bed & Breakfast). Other public hearing supporters were Linda Allen, Tim Ratigan and Laurie Glasscock. Also at the request of council, EDA

Let’s pretend (Government has a role)

Director McDonald opened the public hearing by outlining the history leading to the proposal and stating her and her board’s positive outlook on the plan and its commercial redevelopment potential for the town. Of the supporters, it was Royal Cinemas’ Novak, himself a past EDA board member (late 1990s-2007), who seemed to best galvanize the consensus for the proposed trade. In stating his support, Novak opened with a playful exchange with swap opponent Matt Tederick, who preceded him to the podium. However, Novak then got serious as he observed he would just have to disagree with Tederick about this proposal. And it was the fundamental disagreements between these two old friends that were, to this observer, at the heart of the debate over the plan.

Tederick opened his comments by telling council, “Let’s pretend you have the right to do what you are proposing to do – and the key word is pretend.” Tederick’s assumption apparently being that government has no right to propel forward commercial business transactions, even indirectly through appointed agencies created to stimulate economic growth within their communities. And despite the fact the town and EDA have been working on this plan for over six months, Tederick insisted the town was moving forward without performing due diligence. Among the “undone details” Tederick called for prior to movement on this real estate deal was a cost assessment for a fire-suppression system

Save now on Bird Feeders and Food! ALL Bird Feeders and Food 20% off

Don’t think we’ll see this again any time soon – the Afton Inn, circa 1920s

Warren County Report

25 lb. Black Oil Sunflower Seed

1399

Alison Duvall Advertising Sales

12 pack High Energy Suet

999

Cell: (540) 551-2072

alisond@warrencountyreport.com

Warren County Report

BERRYVILLE Berryville True Value Hardware

Sale ends Feb. 16, 2014

angie@FredCoReport.com

Find the right tools and supplies for your projects, plus expert,

FRONT ROYAL

Angie Buterakos Advertising Sales

Cell: (540) 683-9197

600 East Main Street • Phone (540) 955-1900 Open Weekdays 7A.M. to 6:30P.M. Saturday, 7:30AM-5PM & Sunday 9AM-4PM

Ramsey True Value Hardware

© 2010 True Value Company. All rights reserved.

703 North Royal Avenue • Phone (540) 635-2547 Open Weekdays 7A.M. to 7 P.M. Saturday, 7:30AM-5:30PM & Sun 9AM-4:30 PM


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 • Warren & Frederick County Report • Page 

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com • 540-683-9197 or Alison at alisond@warrencountyreport.com • 540-551-2072 for the now-gutted Afton Inn and “a plan” for the building. Both points ignore the published parameters of the plan indicating the Afton Inn will NOT be owned by the town for redevelopment, but will be marketed for sale by the EDA to a private-sector owner willing to redevelop either the building or the site. Now I’m just a simple, small-town journalist (scratch, scratch – spit), not a real estate agent or lord of the marketplace, BUT isn’t it at that latter point of commercial transaction one might logically assume such detailed redevelopment dynamics Tederick cited would take place? And perhaps it is not on the front end of an anticipated deal, but on the back end where contractually-mandated redevelopment and the resulting annual tax revenue and commerce

generated from two fully-functioning commercial properties, would be realized by the town government. “In a perfect world this would have been done by the private sector. But we’ve waited 20 years – we’ve waited long enough,” Novak responded to Tederick’s notions that the town government either has no authority to propel such a commercial transaction forward, or has failed to properly do so. (See related story.) Double standard? And if our memory serves us, Tederick should be very familiar with such concepts as financial incentives offered by government to the private sector and deferred benefit from his 1990s tenure on the Warren County Board of Supervisors. During that

time, such economic incentives were a commonplace tool used by the county and the EDA to attract first industrial, then commercial development into the county’s 522 North Corridor (with the help of town central water and sewer extended into the county). And while post-heart attack my memory may not be what it once was, from my tenures at both The Front Royal News and Warren Sentinel during that era, I do not recall any loud outcry from Supervisor or citizen Tederick against such policies and the creation of Enterprise Zones to facilitate them, at least not when they were being utilized by the county and the EDA – the very same EDA now poised to negotiate redevelopment of two vacant commercial spaces INSIDE the Town of Front

TRUTH BE TOLD, YOUR ELECTRICITY COMES FROM PEOPLE POWER. Thankfully, there’s one energy source that Rappahannock Electric Cooperative (REC) members can always depend on – the hard-working dedication and efficiency of your cooperative’s linemen. Learn more about the power of your REC membership at TogetherWeSave.com.

Front Royal Royal. Now if I’m wrong here (scratch, spit), just straighten me out on Feb. 10th, Matt. As for Tederick’s demand the town put the commercial cart (redevelopment detail) before the horse (sale negotiations), Novak pointed out, “It was a long, drawn out process that killed the last effort of Mr. Barros for [redevelopment of ] the Afton Inn … let’s move on a resolution to the Afton Inn eyesore.” And so went the pro/con back and forth. Opposition central There was one exception to the outpouring of downtown business support of the town utilizing the EDA to facilitate positive movement on commercial redevelopment of both old Town Hall and the Afton Inn. That exception was attorneys working at the Pond-Athey law firm and people with some personal or political connection to employees of the firm, a total of 5 of the 7 public hearing opponents. They were: • 1 – local Republican activist Teder-

ick, whose ties to attorneys at the law firm date back to former Front Royal Mayor and 18th District Republican State House Representative, now Judge Clay Athey; • 2, 3 – attorneys at the firm, Kim Athey (Clay’s sis) and Daniel Pond III (aka big, little Danny, whom Athey made a point of noting was not included in the company masthead – sorry I called it Pond-Athey-Pond in my e-mails to Councilman Funk last month); • 4 – Councilman and Pond-Athey attorney Daryl Funk’s father, Homer; Footnote: Daryl, as stated above, is thus far the only stated council opponent of the swap; • 5 – Republican Committee member John Connelly, a Duncan Avenue, Viscose City neighbor of the Funks; What to make of this opposition centering from within a law firm located at 35 North Royal Avenue, a stone’s throw from the Afton Inn at 2 East Main Street and across the street from old Town Hall, in its own grand old building dating to 1912? • Astute legal minds at work in the See X, 

At least they see eye to eye – Homer talks, Daryl listens

EMPLOYMENT Frederick County Report is seeking sales representatives in Winchester and Frederick County. Email: dan@areaguides.com


Page  • Warren & Frederick County Report • Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com • 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com • 540-683-9197

Front Royal AFTON INN, from  best interest of the community in which they practice? • Less astute minds at work, unable to grasp the development parameters and safeguards written into the proposed swap? • Philosophical opposition to government initiatives impacting the private sector? • Potential professional conflicts of interest due to the firm’s 522 North Corridor commercial client base outside the town limits? • Some combination thereof? As for his opposition, Councilman Funk has thus far publicly cited only a “done deal” attitude among council supporters – far from what we have encountered in polling them. During the public hearing, Athey stressed what appeared to be a personal and professional dislike of Afton Inn owner Frank Barros (Afton Inn LLC), citing his past unwillingness to complete his initial development plans or give up ownership of the Afton Inn property. She also noted past zoning violation issues a Barros company had in its commercial base of operations, Manassas Park. Whatever those since-resolved zoning violations were, online research indicates that apparently the Manassas Park government didn’t think them serious enough to stem discussion of future business and real estate deals with Barros and his companies since. Daniel Pond III cited the historical value and appearance of the old Town Hall; and like Athey criticized a deal that would benefit Afton Inn owner Barros – “I think this is a terrible mistake … please think about it before you give it away … for one man’s benefit,” the younger Pond said of the proposed swap. However, the view of supporters, the council majority and the EDA is that the proposed deal would be a benefit to the ENTIRE community, particularly the historic downtown Front Royal business community, not just the man who has owned the Afton Inn since 2005. Other questions The two public hearing opponents with no direct or indirect connection

Opposition headquarters? The Afton Inn roof cupola is visible in distance past Pond-Athey Law sign

Good for the goose but not the gander? Wasn’t Matt Tederick a member of the 1990s Warren County Board of Supervisors that oversaw myriad offerings of financial incentives to attract industrial and commercial development to the county’s 522 N. Corridor? to Pond-Athey-Pond (oops, sorry Kim) were local criminal attorney David Downes and former D.C. attorney and Massachusetts native, local commercial property owner and historic properties advocate Patricia Callahan. As for Downes’ alternative proposal that he, rather than a villainous outside developer, get the swap offer – nice try, Dave, but your buildings aren’t vacant and dilapidated eyesores needing creative means to be brought back into full commercial development and tax value. However, if you have about a decade to a half century to let them go vacant and deteriorate and the current swap proposal falls through – give the town or EDA a call, say sometime between 2025 and 2065. Callahan questioned town efforts to utilize eminent domain to rest the property as derelict or crucial from the current owner. About a year after purchasing the property in 2005, Barros presented fairly detailed redevelopment plans, including addition of a fourth floor, that ran afoul of county building height regulations and the town Board of Zoning Ap-

peals over those restrictions. That dispute led the town council to sue its own BZA to allow Barros’s elaborate redevelopment plan to move forward. But as legal and regulatory battles progressed between 2006 and 2008, the national economy, housing and building markets tanked in the “Great Recession of 2008” leaving the Afton Inn languishing in disrepair since.

Garland T. Williams, Owner

February 9 Classes at Holiday Inn Express 142 Foxridge Ln. Winchester, VA 22601

Feb. 8 to March 15

Drum roll, please …

see if all five councilmen expressing initial support for the swap idea hold to their initial opinions developed over six-plus months of behind closed door planning and negotiating, or fold up to what appear to this old country reporter (you know the routine) to be frivolous, ill-informed, perhaps inconsistent or even somewhat petty arguments against taking a measured shot at reclaiming Historic Downtown Front Royal’s main intersection. Join us at the Warren County Government Center at 7 p.m. on Monday, Feb. 10, for the dramatic conclusion to this municipal adventure story.

Now we’ll just have to wait and

welcomes Xiaoyin (Rachel) Home, MD, F.A.C.O.G.

Board Certified: obstetrics and Gynecology Special Interests: menopause, pelvic fitness, minimally-invasive surgery, general obstetrics

Dr. Home is accepting new patients. 120 N. commerce Ave., suite 230 Front Royal, VA 540-635-0760

24160 old Valley Pike maurertown, VA 540-459-1270

T & Th 5-6:45, Sat 8-11:30am Classes at 153 Narrow Ln.

Mt. View Christian Academy Stephens City, VA

WE HAVE ONLINE DRIVER IMPROVEMENT CLASSES

– rogerb@warrencountyreport.com

Shenandoah Valley OB/GYN

On the Road Driving School, LLC 5336 Water Street, Stephens City, VA 22655 Ph: (540) 869-6105 Cell: (540) 247-3197 www.ontheroaddrivingschool.com Driver Education Class Driver Improvement Clinic

Perhaps unbeknownst to Callahan, the town did file suit against the Afton Inn property in 2010 in an attempt to have it declared a derelict structure, allowing the town leeway in forcing the owner’s hand on release or repair. However, an engineering report filed in response to that lawsuit, while mandating minor repairs, including blocking broken windows and shoring up loose bricks, actually found the Afton Inn, dating to 1867, to be structurally sound in its foundation – I guess they REALLY DON’T build them like they used to.

a

physician practice


Frederick

Read full issues FREE Report on www.WarrenCountyVA.com & www.FrederickCounty.com County

Warren Frederick County

Report County Report

Frederick County

Report

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com • 540-683-9197 or Alison at alisond@warrencountyreport.com • 540-551-2072

‘National School Choice Week’ - what are we really talking about here? phone number listed for the event, I was curious – but my antennae were definitely “up”!!! So, I drafted a reply to the source, NSCW President Andrew Campanella:

122 W 14th Street, PMB 20 Front Royal, VA 22630

Andrew,

Member Virginia Press Association

Readership:

26,000 and growing

Publisher & Editor-in-Chief: Daniel P. McDermott editor@warrencountyreport.com Roger Bianchini Senior Writer (540) 635-4835 rogerb@warrencountyreport.com Reporter: Sue Golden Copy Editor: Laura Biondi editor@warrencountyreport.com Feature Writer: Carol Ballard crawford0905@gmail.com National & Agency Advertising: Alison Duvall: (540) 551-2072 editor@warrencountyreport.com Advertising Sales Representatives: Alison Duvall: (540) 551-2072 alisond@warrencountyreport.com Angie Buterakos: (540) 683-9197 angie@fredcoreport.com Billing Coordinator: Pam Cole: billing@warrencountyreport.com Graphic Design & Layout: Jeff Richmond layout@warrencountyreport.com Contributors: Malcolm Barr Sr. Ryan Koch, Cartoonist Extraordinaire Kevin S. Engle, Humor Columnist Leslie Fiddler, Writer If you are interested in contributing articles to our paper, please e-mail: editor@warrencountyreport.com

This publication is proudly printed on 100% recycled paper with soy-based ink.

Opinion

Another anti-government/public right-wing scam revealed

Warren & Frederick County Report

Press releases should be emailed to: briefs@warrencountyreport.com

Mid February, 2014 • Warren & Frederick County Report • Page 

Don’t be deceived by a wolf in sheep’s clothing, or at least scarf – NSCW means public education no good.

Convention of states Editor, The power of the federal government is out of control! Washington’s abuse of power, instigated by both Republicans and Democrats, must come to an end before it’s too late. Fortunately, when the national government becomes drunk with power, the individual states possess the authority to reorganize the power structure in a manner that preserves liberty. Article V of the U.S. Constitution allows states legislators to call a convention for the purpose of proposing amendments to the Constitution. Through an Article V convention, the states can stop the federal spending spree and correct the self-aggrandizing nature of Congress. We are approaching a crossroads. One path leads to the escalating power of an irresponsible centralized government, ultimately resulting in the financial ruin of generations of Americans. The other path leads to freedom and the chance to once again be proud of these United States. Which will we choose? I choose to preserve liberty through my active support of the Convention of States Project. I urge my fellow Virginians to contact their state legislators, expressing their support for a Convention of States. Sincerely, Leo Carling Bentonville VA 22610

By Roger Bianchini Warren County Report After receiving several messages about a live call-in regarding an event called “National School Choice Week” on Jan. 21, the last message correcting an earlier incorrect call-in

United Way completes campaign Editor, The United Way of Northern Shenandoah Valley recently completed its annual campaign for 2013. We were pleased to report over $1,109,000 raised to support local human care needs and services. This campaign achievement was made possible through the efforts of dedicated volunteers and generous contributors. I want to extend my appreciation to a caring community for your commitment to living united. Thanks to your support, community impact grants will be available to respond to priority needs…support for a growing elderly population…student concerns about drugs and depression…and services for families unable to deal with day to day needs. On behalf of the thousands of area residents who benefit from United Way supported services, I would like to thank all the local employees, businesses and individuals who worked together to Live United. Thank you. David Sovine 2013 Campaign Chair

Excuse my suspicions of this perhaps Orwellian “doublespeak” acronym of NSCW – “national school choice week”, day or month – BUT, do you have any ties to conservative think tanks or funding apparatuses like AFP (Americans For Prosperity), ALEC (American Legislative Exchange Council) & the like? Because this sounds a lot like one of their initiatives to destroy public school funding under the guise of “expanded choice” or “more educational opportunities”, which are, in fact, thinly disguised efforts to defund public education in America; and divert tax money or encourage corporate tax breaks for upper-class or private-agenda schools that teach that ill-conceived and bogus theories like the world being 6000 years old hold as much validity as geologicallybased scientific theories the earth is millions, if not billions of years old. So, could you send me some background on your policy initiatives as to how this “choice” is to be achieved; & a list of your funding sources? Roger Bianchini Editor Emeritus (I didn’t think I could explain “To be determined” in a timely fashion) WC&FC Report newspaper PS Andrew, hope you don’t mind my asking, BUT is this phone # problem the result of the sort of educational opportunities available in this expanded universe of choices you are promoting?

Correction In the “Early February” edition opinion piece by Malcolm Barr Sr., “The Morgan’s Ford Bridge debate continues”, Barr made an error in fact, for which he apologizes. Barr reported that Mary Powers Ryan headed a survey of low-water bridge users “a couple of years ago.” Rather, Ms. Powers Ryan helped with a traffic survey aimed at reducing the speed limit on Rockland area roads. The bridge-user survey was headed by local residents Barbara Frank and Wayne and Susie ChatfieldTaylor.

Never did get a reply – but I went online to research the organization behind the event to see if my stated suspicions were accurate or not. About six categories down in my search result was one titled “An Open Letter To National School Choice Week”. Let’s see what a perhaps nonaffiliated site might tell me, I thought as I went there first. DAMN, I’m getting intuitive at spotting these right-wing, anti-government, anti-public funded anything sites, I thought after reading the “Open Letter to NSCW” from Steve Nelson, head of Manhattan’s private Calhoun School. I contacted Nelson, who authorized us to reprint any portion or all of his “Open Letter” to NSCW that had also linked to my old stomping ground Huffington Post site. I was going to edit it down for space, but heck – it’s so good and I edited so little out, here’s the whole thing: An Open Letter To National School Choice Week By Steve Nelson, head of Calhoun School in Manhattan In the past two days I received emails from three individuals associated with National School Choice Week (NSCW). Here’s my response: Dear Ms. Peek-Brinson, Ms. Weiers and Mr. Campanella: Please stop sending me your cheery emails. I’m not buying what you’re selling and, frankly, I’m wondering how you can engage in such a scheme without some sense of shame. I’m publishing this response because I hope other school administrators, teachers and families won’t fall for this devious marketing ploy. You offered me a complimentary box of supplies to use to “celebrate” National School Choice Week: “Signature yellow scarves, rally signs, event promotion posters, lapel stickers and more -- at no cost...” I don’t even have to pay shipping and handling, you promise. See OPINION, 36

Letters to the Editor are welcome but must include the author’s name and town and should be emailed to: editor@warrencountyreport.com


Page  • Warren & Frederick County Report • Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com • 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com • 540-683-9197

Front Royal

Tederick perspective – the way I see it put the brakes on

‘Mad Matt’ Tederick – I know what you guys are up to. But does he really get it? File Photo By Roger Bianchini Warren County Report Naturally, our old conservative, political protagonist Matt Tederick disagreed with my comparison of mid-late 1990s county-EDA incentives to attract business and industry to the 522 North Corridor, to the current in-town building swap proposal; albeit after I sent my swap story off to our production department for layout. So, we’ll give him his own sub story to make his case.

He began by agreeing the county and EDA had offered such deferred tax and other incentives to industry in created Enterprise Zones, though not to commercial operations, he elaborated. However, from his perspective that county endeavor and the town’s current effort to stimulate commercial development in two now-vacant buildings are not comparable. “This is not only substantially different but fundamentally different to the council’s foolish plan to swap the

Artistically Framed, LLC Custom Framing & Art Specializing in the Usual & Unusual Work of Local Artists, Art Lessons

Afton Inn for Town Hall,â€? Tederick began. “I would have zero issue, matter of fact would support the concept of the council establishing tax incentive zones for businesses in an effort to help businesses grow or improve the façade, etc. I would even support the council buying the Afton Inn for a PUBLIC PURPOSE, such as they did the BB&T building.â€? And while at this point approaching deadline we did not have time for an extended back and forth on specific points, we will wonder here, why Tederick would support only a publicly-driven scenario for the Afton Inn that would NOT accomplish the goal of private-sector commercial redevelopment bringing the property fully into the town’s commercial and real estate tax revenue streams? But Tederick stated he continues to support government incentives to stimulate business development and municipal tax revenue. “I still fully support the concept of government-incentivizing businesses with tax credits or tax deferments as a tool for economic development. Because as I see it, a few less dollars in short term tax revenue from a business is far outweighed by the longterm benefits of job creation and tax revenues collected; plus, tax rates are fully within the role and scope of government.â€?

Damn, and that’s what I thought the town was trying to accomplish here. Au contraire, Tederick says: “The town, through the use of the EDA, is funding the commercial development of a specific property – they have become, in essence commercial developers,� he insists. “I guess if the council thinks it’s within their authority to buy the Afton Inn, remodel it (or tear it down), spend millions of dollars of taxpayer money, find tenants to lease the space(s) – then they must think they have the authority to buy an old house, renovate it and put it up on Craig’s List for rent; or maybe they want to get into the pizza business, or coffee business, or antique business and just start buying up properties, spend money fixing them up and turn around renting them.� Okay, that’s it – one of the two of us is seriously confused!!! AGAIN, Tederick is asserting the swap proposal will lead to town expenditures of millions of taxpayer dollars to buy, renovate, lease, demolish, shoot to the moon – take your pick – the Afton Inn. Mr. T’s assertions were so out of line with our understanding of the plan, we double checked with EDA Executive Director Jennifer McDonald, who verified the following as the plan

for the Afton Inn property IF the swap is accomplished. The TRUTH is that were the swap to be authorized the necessary 5-vote “supermajorityâ€?, the EDA will market and hopefully SELL the Afton Inn AS IS to a private sector entity willing to invest its own money in re-development at a prime downtown location. However, Tederick refuses to accept this scenario, no matter how many times, by how many people, it is repeated. The actual idea – to trade the properties to gain access to the Afton Inn after a somewhat contentious five years of sparring with the current owner, and have both it and the now abandoned and in-need-of work old Town Hall re-developed by the private sector under strict covenants is an idea that seems to be supported by an overwhelming majority of nearby downtown business owners. But then maybe they actually understand it. What was that old propaganda strategy developed by a conservative publicist dating back to the 1930s – keep repeating a BIG LIE long enough and it will become THE TRUTH. I don’t know what made me think of that – but I was watching FOX “newsâ€? last night ‌ (scratch, spit)

Ask about our other Weight Loss programs!

255 Fairfax Pike, Suite 2 4UFQIFOT$JUZt   SAVE 10% WITH THIS AD!

Physician Supervised Weight Loss Center

- Phentermine Program -

First phentermine appointment for $199 Cost includes all bloodwork, ekg, vital signs, office visit with provider to get the prescription, and 4 weekly Lipo-B12 injections and body composite analysis. Total value of this package is approx. $600! Phentermine Patient must mention code (Phent123)

842 N. Shenandoah Ave. Front Royal, VA 22630 540-636-9100

8712 Sudly Rd. Manassas, VA 20110 703-579-0650

www.VaMedWeightLoss.com


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 • Warren & Frederick County Report • Page 

The town government has a responsibility to create an atmosphere of healthy economic activity within the town. Catalyst projects like the redevelopment of a vital corner of our community screams for action. The time is now. We will not get another chance like this.

Opinion

Hrbek: Why I support the Afton Inn-Town Hall trade On Monday night, Feb. 10, the Front Royal Town Council will decide if we should transfer the old Town Hall property to the Economic Development Authority (EDA) for the purpose of swapping the building for the Afton Inn property at the corner of Royal Avenue and Main Street. I believe that this is a good deal for Front Royal – not exclusively or necessarily for the government of the Town of Front Royal, but the people and businesses of the town. There are many arguments that have been made against the move. Many of them have been made in good faith and by people I respect. This is healthy in a democracy. However, there have been some who have disseminated false information and I believe that we need to make sure the facts are available to the public. This is not a “you need to pass it to find out what’s in it” action as one opposed to the action suggested recently. We will vote on a contract that is clear and understandable and, most importantly, enforceable. Why are we doing this?

First, we no longer need the town hall. It is not a building that is suitable for the needs of the town government. It is not an appropriate place for a new police department and the town government does not need the space – nor want it – after moving our offices into the new administrative building on East Main Street. Secondly, this presents an opportunity to finally rejuvenate the crossroads of the town. The number one question visitors ask me about when they visit the town is why we allow the building to look like that. The first question posed to the EDA by prospective businesses is what’s the deal with the Afton Inn. The number one thing you hear from the business community is “why can’t we do something about the Afton Inn?” The answer is because the town does not have the authority to act. We do not have the power to condemn or oversee buildings, that is a county role (another reason that the town should consider its own building inspection department). If we were to invoke our eminent domain

powers we would be required to use the property for a public purpose. And while a park or other open space would be a vast improvement to the current condition it does not fit within the vision of the town’s economic future. We have the opportunity to set down a marker at the most visible intersection in our community by removing or rehabilitating the property. By acting we send a clear message to our citizens, property owners, business community and guests that we are proud of our community and want to improve the quality of life and opportunity for all. But at what expense? None. The covenants on the old Town Hall property will give us legal protections if the new owners do not hold up their end of the bargain. The covenants require the new owner of the town hall to 1) keep the facade protected and keep it’s historical look; 2) act within at least two years to improve the interior; and 3) to seek permission from the Town Council if a prospective tenant does

not fall within a list of pre-approved categories. And what if the new owner doesn’t comply? The town can buy the property back at fair market value, not an unrealistic and absurdly inflated number. The town, the owner and an independent third party will select an appraiser and the purchase value will be the average of the three. But I don’t believe that this will happen. Prudence and due diligence dictate that we put these protections in place. But our EDA has a track record of success in Warren County and has already been working hard to secure a new owner for the Afton Inn property. I believe we will see movement quickly on the property. The EDA has also been working closely with representatives of Afton Inn, LLC and they are excited to move quickly with their plans for the revitalization of the old Town Hall. And let’s be clear, there is not a cash transfer of any kind. The only expenses incurred by the taxpayer will be the maintenance of the four walls of the Afton Inn building until it is sold. If we hold on to the old

Town Hall we will have a tremendous amount of expense to incur to maintain it and market it. The town government has a responsibility to create an atmosphere of healthy economic activity within the town. Catalyst projects like the redevelopment of a vital corner of our community screams for action. The time is now. We will not get another chance like this. One citizen asked the Town Council if this is the legacy that we want to leave. My answer is a definitive yes. If I retire from public service with this as my only success I will be very proud of my time served. Bret W Hrbek Member Front Royal Town Council (2006-2010 and 2012 … )

Send your brief news items to briefs@warrencountyreport.com

Loving Arms Assisted Living presents: Spotlight on Residents

Bob & Marie Sivinski

Well this beautiful couple has been married for 57 years. But let me take you back to how it all began. We’ll start with Marie Rose Davies. She was born on January 13, 1926 in St. Paul, Minnesota. She was the youngest of three children and the only girl. Her brothers Phill and Bob adored her and Marie was the apple of her parent’s eye. Marie was always a petite little girl, weighing barely 90lbs going into high school. They always tell you to watch out for the little ones and Marie was no exception. Marie and her girlfriends were the champs of practical jokes and she has been able to retain those girlfriend relationships even to today. Marie graduated and went immediately into the working world. She started at the Internal Revenue Service and it wasn’t long before she worked her way into management. Bob Eugene Sivinski was the oldest of seven children and born in St. Cloud, Minnesota on April 16, 1926. Bob never let his younger brothers and sisters forget who was boss and always left a legacy difficult for anyone to follow. Bob was a good student and excelled in football and basketball. After graduation Bob attended the U.S. Naval Academy studying engineering and playing football and lacrosse. In 1949 Bob was named All American in Lacrosse. Bob is also in the Lacrosse Hall of Fame. After graduation Bob was an officer in the Korean War and served on both air craft carriers and submarines. Following Bob’s time in the Navy, Bob accepted an engineering position with 3M in St. Paul, Minnesota. Both Bob and Marie were young adults in the working world. Bob enjoyed hunting and bowling in his extra time and Marie lived at home with her parents and always loved playing the piano. As fate would have it, both were members of a Catholic Young Adults Group called the Dominic’s Club. It was there that they met and the rest is history. Bob and Marie were married on June 29, 1957 and proceeded to have six children in eight years. A house filled with three boys and three girls was always full, busy and filled with excitement. As Bob’s position with 3M advanced the family relocated to Virginia. There, in Winchester Bob and Marie were blessed with the opportunity to adopt a sweet little boy that needed a loving home. So now with seven children, Bob and Marie moved to Rochester, New York and life in the suburbs. The house was always full of activities, music and children. After a short time in New York the family headed to the “Great White North.” This time Bob found a beautiful house on Bass Lake in Somerset, Wisconsin. Family life on a lake was wonderful; lots of hunting, fishing, boating, snowmobiling, and swimming. The Sivinski family was fortunate to be members of St. Anne’s Catholic Church. The whole family was active with church activities; teaching CCD, assisting cleaning the altar, lector, and altar servers. Bass Lake was home for the Sivinski’s for eight wonderful years and many fond memories. For Bob’s last relocation 3M asked where he would like to relocate for the last time and they returned to the east and settled in Charles Town, West Virginia. Charles Town saw the three youngest children graduate from high school, three other children graduate from West Virginia University and the marriages of four of their children. It was after one of the weddings that a family charter fishing trip was experienced in Kilmarnock, Virginia on the Chesapeake Bay. Bob and Marie loved the fishing and beautiful views, and knew that life on the bay was where they wanted to retire. In 1985 the empty nesters settled at the Chesapeake Bay. Bob was the Captain and Marie was his first mate. Bob and Marie were parishioners of St. Frances De Sales Catholic Church in Kilmarnock, Virginia. The day always started with mass in the morning and then out on the bay enjoying the day. Life on the Bay was paradise and as the family grew, Bob and Marie’s seven children, 19 grandchildren and 4 great grandchildren returned to enjoy the time together. In December of 2001, right before a Christmas holiday family reunion, Bob suffered a major stroke paralyzing him on his right side. With the assistance of one of their sons they were able to stay in their bay home but it was challenging; so in November of 2010 Bob and Marie were fortunate to find Loving Arms; a new home for Bob and Marie to start the next chapter of their lives. (Written by Bob and Marie’s daughter Laura Csanady) We at Loving Arms are dedicated to providing a nurturing family environment where individuals can continue their life journey with dignity, respect & integrity. Come be a part of our family and remember we are:

“Growing together one life at a time.”

Shelly Cook RN, Owner Administrator

Take a virtual tour at www.lovingarmsva.com For reservations, brochure & to schedule a personal tour, call 540-635-7923

103 Lee Burke Road, Front Royal, VA Directions: From Front Royal take 340 S., turn right onto Rt. 619 (Rivermont Dr.), Go approx. 3 mi., turn left just past Mark’s Automotive onto Rt. 618 (Lee Burke Rd.), Loving Arms is ahead on left.


Page 10 • Warren & Frederick County Report • Mid February, 2014

New business

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com • 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com • 540-683-9197

APEX Performance-Development: training with focus Youth-focused & sport-specific training and a lifelong commitment

Training doesn’t have to be a no-fun proposition – Courtesy Photo Back row, owners Jamal and Beth Parker and Billy Shannon; front row, some of APEX’s youthful membership By Roger Bianchini Warren County Report After a month in business in the old Union Hall building on Chester Street in Front Royal, APEX Performance-Development fitness center brought in the new year with an official Grand Opening on Saturday, Jan. 4. And while martial arts instruction is a key component of training at APEX, I was immediately struck by a sense of camaraderie among both children and adults on the mat or training floor. And perhaps it is this yin-yang balance of competitive training and mutual support that best defines APEX. We spoke with the trio of owners, Beth and Jamal Parker and Billy Shannon about that support and their training philosophy. It is a philosophy reflected in their name, APEX Performance-Development. “Yes, originally we began working

on a program some years ago that we called ‘Pinnacle’,” Beth began. “The idea is to reflect the idea of peak or top performance. Upon relocating a few years ago to Front Royal, APEX and its mountain-scape logo just came naturally to us to tie in the concept and the community. “Our focus is definitely on the kids,” Beth continued after her partners made it clear she was both the face and media relations officer of the company. “Strong, healthy, confident kids generally grow to be healthy adults. And while we’re always looking to help folks of any age achieve their best, it’s best to catch kids when they are young and help them be successful at sports. “The more success they find early, the more likely they are to stay with it. On Saturday afternoons we kind of just have an open facility for our kids to come in and have fun. We currently have Children’s Jiu-Jitsu and Kids’ Yoga classes scheduled. But we

Windows XP & Office 2003 END OF LIFE! NO Security Patches * NO Updates * NO Support

are looking to add Boxing very soon. A lot of these kids know each other from other sports and recreational programs but rarely have time to just play and be kids, so we provide a time and a place for some of the local young athletes to bond and grow together.” And how did the partnership between the Parkers and Shannon develop? “Our daughter was a student in Billy’s class when he instructed at another local Dojo. When that business closed we discussed with Billy the possibility of our daughter continuing her training and from those conversations grew the idea of opening a Center of our own,” Beth explained. “We have been active in coaching our own kids in basketball, football and

soccer and had toyed with the idea of putting together a training program that focuses on specific sports skills, as well as explosive performance. So, when the opportunity came to pursue both it just made good sense.” An introductory look around let us know that Shannon has a background in competitive martial arts, specifically MMA (Mixed Martial Arts). And perhaps it is that background that helps set the bar for personal excellence through physical training at APEX. “This is true, Billy is very accomplished on the international competition circuit and of course brings a wealth of experience and knowledge to the classroom,” Beth said. “This provides a wonderful foundation for the Center, allowing us to offer a va-

Salt & Chemicals corrode...

WASH TODAY!

Next to Lowe’s

Walmart Shopping Center Front Royal, VA 22630

540-636-WASH Call Royal Oak Computers to discuss your options. 203 E. Main St. -- 540.635.7064 info@royaloakcomputers.com

WINTER HOURS:

(9274)

TUNNEL & TOUCH-UP

DETAILING

Monday - Saturday 8am - 6pm Sunday 9am - 6pm

Monday - Saturday 9am - 6pm Sunday 10am - 6pm

Weather Permitting

riety of Martial Arts and self defense sessions. “However, just as important at the Center is the focus on general health, fitness and flexibility. The flexibility and mobility program is managed and instructed By Tammy Battista,” Jamal says, adding, “Tammy has been actively involved in Yoga since 1995, has been teaching Yoga since 2000 and is a member of the Yoga Alliance. Tammy is also a Certified Reiki Master and offers these sessions on request. We are thrilled to have her and Billy at APEX as they bring a solid background and core understanding of the various disciplines that they instruct. “In addition to Yoga classes for all ages and skill levels, our fitness offerings include cardio classes such as Cardio Combat and Hula for Health. APEX Flex; Mastering Mobility is a great program that allows members to move at their own pace to gain or regain a higher level of mobility. X-Fit is a multi-platform workout program that combines weight and strength training with cardio and resistance

WE DO DECKS! We custom build paver patios, walkways, outdoor fire pits & decks to suit your lifestyle! We also do Snow Removal!

Call today to schedule your FREE estimate! 540-636-9002 LAWNCARE SERVICES FRONT ROYAL,VA

A1AHOMEIMPROVEMENT@COMCAST.NET

LICENSED & INSURED Commercial & Residential

Member: Chamber of Commerce


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 • Warren & Frederick County Report • Page 11

“Our focus is definitely on the kids. Strong, healthy, confident kids generally grow to be healthy adults. And while we’re always looking to help folks of any age achieve their best, it’s best to catch kids when they are young and help them be successful at sports.” – Beth Parker to create a full fitness experience. Other specific performance sessions focus on things such as explosive acceleration, vertical jump training and sports-specific focuses, including shooting, dribbling, passing, etc.” Various levels of membership offer specific benefits they are:

• Gold Membership gives Unlimited Access to all Martial Arts & Self Defense Classes; • Silver Membership gives Unlimited Access to All Fitness & Flexibility Classes; • Bronze Memberships are easy Pay as You Go plans for those with tricky

New business

schedules; • Platinum gives All Access to the Center

Mon - Thu: 12 p.m. - 9 p.m. Fri: 10 a.m. - 7 p.m. Sat: 10 a.m. - 3 p.m.

(*special performance sessions not included in the monthly memberships)

SPECIAL VALENTINES DAY EVENT: PARENTS’ NIGHT OUT! Bring the kids by from 6 p.m. – 11 p.m. Friday, February 14, 2014 and we’ll give them an evening of fun and

Standard hours:

excitement while you enjoy your Valentines Day Evening. Only $15 per child, food and snacks included! Apex Performance Development Center is at 219 Chester St., Side Entrance, Front Royal, VA 22630; phone (540) 252-2828; and online at www. ApexPDC.com

DIVERSIFIED SERVICES

NOW LOCATED AT 195 N.Commerce Ave. (Quarles Building)

David Santmyers - Owner david@ddsserviceshvac.com www.ddsserviceshvac.com

COME SEE OUR NEW SHOW ROOM!! 24 HOUR EMERGENCY SERVICE AVAILABLE

888-297-9433


Page 12 • Warren & Frederick County Report • Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

“The Irish Isle has the feel of Irish pubs where the people who frequent them are at the center. We enjoy playing music of course, but we love to play in a place that has such a warm, welcoming atmosphere.� – Doug Enders (mandolin, guitar)

Middletown

An ethnic musical tradition lives on at The Irish Isle

Isle owner Brian Coughlan joins the trio in the pub Fortuitously, I had my camera in my pocket on a night owner Brian Coughlan had the time to venture downstairs and sit in with Doug, Katie and DJ. By Roger Bianchini Warren County Report While the upstairs main dining room of Middletown’s Irish Isle Restaurant is warm, expansive and often features the musical talents of owner Brian Coughlin, among others, Bridget’s Pub downstairs has the intimate feel of some of the pubs I encountered on my 2002 tour of the southwest coast of Ireland from Achill Island to the Ring of Kerry and Kenmare. And besides the camaraderie and “medicinal� Guinness, one thing that keeps drawing me back to the somewhat more compact downstairs of Bridget’s Pub are Friday musical sessions featuring Doug and Katie Enders and D.J. Murphy. As my in-country Irish pub-hopping experience had taught me to expect, the Isle’s Friday afternoon Happy Hour musical trio aren’t sepa-

Ivy Lodge Gift Shop 101 Chester Street Front Royal, VA (540) 636-1446 Open Mon-Fri 9:30 am - 4 pm

Great Gift Ideas, including: Books, Pewter, Brass & Pottery Locally Handcrafted Gift Items & Much More Proceeds benefit the Warren Heritage Society

rated from their audience by a stage, but rather are just another part of the pub crowd at a corner table – albeit, a part of that crowd with musical instruments and a knack for the musical traditions of Ireland. So, how did Irish Isle owner Brian Coughlan, a talented musician in his own right, discover this slice of “Emerald Isle� traditional music now featured in Bridget’s Pub from around 5 p.m. to 7 p.m. on Fridays, we asked during a break. “When we were thinking about moving to the area in 2005, we heard about the Irish Isle as a place we should go,� Doug said of his and wife Katie’s arrival. “We visited, and it helped us decide to move here. Soon after, we asked Brian if we could play, and he welcomed us because he is a musician and understands the im-

portant role that music plays in creating community. “We’ve been playing regularly on Friday nights ever since. The Irish Isle has the feel of Irish pubs where the people who frequent them are at the center. We enjoy playing music of course, but we love to play in a place that has such a warm, welcoming atmosphere. Our group also plays at other venues and private parties as The Whitlocks. “I’ve been playing music with Katie since we met, over 19 years ago. We met D.J. Murphy here a few years ago, when he made it known he wanted to sit in and have a go of it on the bodhrĂĄn. We also play with Keith Salley, a professor in Shenandoah University’s Conservatory, who plays wonderful guitar and keeps us on our toes.â€? The SU connection to Salley is a logical one, we discovered. Doug is an English Professor there. Katie is also a teacher, of language arts and

Mountain Mystic Trading Company

math at Powhatan School in Boyce. And the third member of this ensemble is Murphy, a Front Royal resident by way of Colorado, who is an IT professional. “Currently I am working as a Systems Administrator ‌ for Raytheon and have been with the company for almost 13 years now. Before that, I was a member of the US Air Force for 10 years. I have always loved music and have dabbled with it for quite some time, though I never bothered enough with it to take paid lessons,â€? D.J. told us. “I started out by teaching myself piano. Mostly I play by ear, but I can read music – barely – from being in chorus in high school. I am very adept at picking up patterns and have learned to play several pieces by watching others play, which is how I improved playing piano and learned the bodhrĂĄn, spoons, bones, and most recently, the tin whistle. Because of how I learned and my limited exposure, I really don’t count

myself a true musician.â€? Au contraire, I offered, having been impressed, not only with the variety of traditional instruments Murphy plays with an expertise belying his self-appraisal, but also the voice – an Irish baritone – he occasionally lends to the ensemble. In fact, I added that he might be able to get a “life experience PhDâ€? in musical instruction from his efforts to help this old trap set drummer learn the bodhrĂĄn well enough to sit in without being annoying. So, none are Irish natives, but all are drawn to the music enough to devote a portion of their respective weeks to this ensemble – why? “Irish music is lyrical. I find both the rhythms and melodies enchanting; I don’t tire of them as I’m always interested in finding the essence of the tunes and the subtle ways the rhythms and melodies can be played off one another,â€? Doug told us. “I also enjoy the community of musicians and people who enjoy listening to the music. It’s a social music to be played and listened to together. The one goes hand-in-hand with the other.â€? Murphy agreed about both the lyrical content and socializing aspect of the music. “There is just something about it that speaks to me – Irish music tells wonderful stories and has liveliness to it that draws me in,â€? Murphy says. “There are other genres of music that do the same thing, but the Irish, and to a lesser extent Scottish, music just lifts my spirits and makes me want to sing and play along. Aside from the music itself are the people. I’ve met some amazing musicians and have gained numerous friends through it. I count

3636 Front Royal Pike

Located in Winchester VA, serving the tri-state area

540-869-2004

www.prosperitylandscaping.com

No job too large or too small! Our Mystique Has Grown! Offering a wide variety of sterling silver and gemstone jewelry, chimes, rock and mineral specimens, books, cards, journals, relaxing and meditative music, tapestries, candles, incense, fragrance and essential oils, stickers, and so many more one of a kind items!

4PVUI4USFFUt'SPOU3PZBMt Open everyday from 10-6, except Satruday 10-5 & Sunday from 12-5 Closed on Wednesdays

Some of the services offered by Prosperity Landscaping t-BOETDBQFEFTJHOBOEJOTUBMMBUJPOt0VUEPPS,JUDIFOT t1FSHPMBTBOE1BWJMJPOTt/BUVSBMXBUFSGBMMTBOEQPOET t1BUJPT XBMLXBZT BOEXBMMTPGBMMUZQFT t1MBOUJOHPGUSFFTBOETISVCTt(SBEJOH TPEBOETFFEJOH

Call today! 540-869-2004


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 • Warren & Frederick County Report • Page 13

And Brian points out that St. Patrick’s Day is on the horizon and The Isle will soon be taking reservations for that landmark celebration of all things Irish, but especially its food, drink, music and community. Call Brian at (540) 868-9877 for more information on any and all of these things. myself very blessed for the people I’ve met and the times we’ve shared together. Irish sessions are a great way to meet folks who share a love of the music and to learn more about its history and tradition.� What are their respective musical

roots, we asked. “I began with folk music and played as a touring musician in the bluegrass circuit,� Doug replied. “After meeting my wife, Katie, we needed to find a kind of music to play together. She was a classically trained cellist

100% Financing Available! Sally Spiewak

Home Loan Specialist

112 East 6th Street Front Royal, VA 22630

NMLSR # 214421

Cell 540-660-1333 Fax 800-928-1523

www.cbmmortgage.com sally@cbmmortgage.com $PNQBOZ/.-43tXXXONMTDPOTVNFSBDDFTTPSH

$6RXWK5R\DO$YHQXH )URQW5R\DO9$ ZZZVDPVQHDGUHDOW\FRP‡)D[‡7ROO)UHH

540-635-9808

%52:172:152$'Â&#x2021;)521752<$/9$



One of the best view properties on the market ! Full panoramic views all year round ! Heal away your day with these views from every window of the Massanutten Range , Shenandoah Natâ&#x20AC;&#x2122;l Park and the Valley. Blend of old & new. Historic farmhouse with 2007 addition. 3 bed 2 baths on 2 open Agri acres. Bring your animals. Fronts Browntown Rd for easy access.

MLS#WR8182253

Listing Agent: Sam Snead

and I, a bluegrass mandolinist. We started off playing old-time music and gravitated toward Irish. One side of my family is Scotch-Irish. Katie and I have visited Ireland once and played in pubs in Doolin, County Clare, known as the traditional music capital of Ireland. It was a great experience; it was where we realized we could play with musicians from Ireland. Thereâ&#x20AC;&#x2122;s a picture of one of the pubs we played in, McCannâ&#x20AC;&#x2122;s, on the wall in the Irish Isle.â&#x20AC;? â&#x20AC;&#x153;When I lived in Colorado, my brother â&#x20AC;&#x201C; by choice â&#x20AC;&#x201C; Dave Sexton got me into the Irish music scene,â&#x20AC;? Murphy explained. â&#x20AC;&#x153;We started a tradition, which I still uphold today, where we would take St. Patrickâ&#x20AC;&#x2122;s Day off â&#x20AC;&#x201C; and sometimes the next day off, as well â&#x20AC;&#x201C; and spending it at a local Irish Pub. I first got involved in playing the music with a father and son team calling themselves Mulligan Stew back in 2004. I heard them several times and decided I wanted to be a part of it. So, I got a drum and started sitting in. They were very patient!â&#x20AC;? (as are you, D.J., Doug and Katie). â&#x20AC;&#x153;I continued sitting in with them until I came across another Irish band named Da Tinmen. At first, I just played along from the crowd when they would play. One evening, they started singing a song I knew very well by one of my favorite bands. The song was â&#x20AC;&#x2DC;Captain Kiddâ&#x20AC;&#x2122; and the band Great Big Sea. It was a good night for music and they, seeing how much I was enjoying myself, let me sing it on stage with them. After that night, it became my song and they would always call me up for it. Eventually, I joined the band full time as their drummer and would occasionally sing a song or two.â&#x20AC;? It sounds like an extended love affair with the music and the culture

FIREARMS SALES & FIREARMS TRAINING LOWEST GUN PRICES AROUND! N.R.A., GLOCK, and COMBAT FOCUS CERTIFIED INSTRUCTORS!

$ DISCOUNT COUPON $

Clip this ad and bring it with you to our store and receive 5% off our already low gun prices and $10.00 Off any of our courses! Discount does not apply to sale guns, or on lay-a-way and consignment guns

Virginia Pistol

â&#x20AC;&#x153;Firearm Sales and Training For Lessâ&#x20AC;?! 5223 John Marshall Hwy. Linden, VA 22642

Store: 540-636-9476 GunSmith: 540-631-1144

Linden, VA Store: www.VirginiaPistol.com Online Store: www.FrontRoyalGuns.com Courses: www.CombatPistolConcepts.com Hours: Tues. through Sat. 10AM to 6PM

Middletown behind it. â&#x20AC;&#x153;As for Irish roots, well, my last name is Murphy after all! My fatherâ&#x20AC;&#x2122;s side of the family is where the Irish comes from, although itâ&#x20AC;&#x2122;s a distant connection â&#x20AC;ŚÂ My momâ&#x20AC;&#x2122;s side of the family carries the Scottish lineage. We have two clan ties, to the McLeans and the Furgesons, as I understand it. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve never been to Ireland, although I have traveled to both England and Scotland when I was in the service. At the time, Ireland was having some issues and they restricted us from traveling there. I still plan on traveling there one day, though.â&#x20AC;? Apparently, though from divergent paths, the current pub lineup was meant to be. â&#x20AC;&#x153;Interestingly enough, I met Doug and Katie before I moved to Virginia,â&#x20AC;? Murphy told us. â&#x20AC;&#x153;My mom and sister live around here and my sister had heard of The Irish Isle and wanted to check it out. We came out one Friday evening for dinner and discovered they had a session downstairs. I had brought my drum to Virginia to play for my family, so I asked if I could run to get it and sit in. It was a fun evening and when I eventually moved to Virginia several years later, I hoped they were still holding session on Friday nights â&#x20AC;&#x201C; which they were. â&#x20AC;&#x153;At first, I was kind of part time only once or twice a month with the group. But the music and The Isle called to me and I became a regular. I sat in with Doug, Katie, and a guitar

player named Keith Salley for quite some time before we really started to get to know each other. In fact, March of 2013 was the first time I saw any of them outside Friday night sessions at The Isle,â&#x20AC;? Murphy notes. â&#x20AC;&#x153;Keith had lined up a gig and was nice enough to extend the invitation to me, as well. â&#x20AC;&#x153;More recently, we all played together at the halfway to St. Patrickâ&#x20AC;&#x2122;s Day shindig at The Isle and I sang a few last minute songs. After that, we started talking more about our lives outside. Keith, playing more and more with his jazz group, stopped coming by for sessions as often. This left a hole in our group and opened up an opportunity to switch things up a bit. Doug started playing guitar on a few tunes and I started singing more regularly.â&#x20AC;? (and now Katie is adding guitar to her repertoire). And there you have it â&#x20AC;&#x201C; so, this reporter and lover of good music, drink, food and times advises others of a similar bent to follow those inclinations to Middletownâ&#x20AC;&#x2122;s Bridgetâ&#x20AC;&#x2122;s Pub and the Irish Isle. For if the longterm future ownership of the Isle may be a little uncertain in this 10th anniversary month of February 2014 (see related story), I have a feeling, as Brian, who is planning a move to the Roanoke area believes, things will turn out all right and the traditions of the Irish Isle will live on â&#x20AC;&#x201C; you know what they say, the LUCK of the IRISH â&#x20AC;Ś â&#x20AC;&#x201C; rogerb@warrencountyreport.com

The Irish Isle celebrates a decade and ponders change After a decade a cultural and culinary icon up for sale at $350,000 By Roger Bianchini Warren County Report As Middletownâ&#x20AC;&#x2122;s Irish Isle celebrates is 10th Anniversary this month of February 2014, changes are on the horizon. Personal factors have led owner Brian Coughlan to plan a permanent move to the Roanoke area. So, he has put his business and the building it occupies up for sale. With a history, established reputation, ambience, kitchen and staff in place, Brian is hopeful a potential buyer of the building and business will continue things pretty much as they are. And that is certainly the hope of patrons, staff and musicians, to whom The Isle has become a home away from home (see related entertainment story).

So, if you have a little entrepreneurial spirit, assets seeking opportunity and a bit of the blarney thrown in, more information is available through Susan Conrad at Adams Nelson Realty. Brian told us rather than â&#x20AC;&#x153;retirementâ&#x20AC;?, his pending move may present new venues for his own musical endeavors, and perhaps even the opportunity to open a second Irish pub. But back to the present â&#x20AC;&#x201C; The Isle will celebrate its 10th anniversary throughout the month of February, with a special emphasis this weekend, Friday through Sunday, Feb. 7-8-9, with food specials and live music on Friday and Saturday. And Brian points out that St. Patrickâ&#x20AC;&#x2122;s Day is on the horizon next month and The Isle will soon be taking reservations for that landmark celebration of all things Irish, but especially its food, drink, music and community. Call Brian at (540) 868-9877 for more information on any and all of the above.


Page 14 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Divide those numbers into each of the 241 grams of heroin seized here â&#x20AC;&#x201C; and that equals between 2,410 and 4,000 doses of heroin compared to 444 doses of narcotic-based pills; 83 to 166 doses of powder cocaine; 293 to 586 doses of crack cocaine, and, well, 2 to 4 doses of methamphetamine.

Public safety

SMACK DOWN â&#x20AC;&#x201C; the rise of heroin use in the valley What the numbers really mean as far as drug use here in River City

Philip Seymour Hoffman, 1967-2014, DOA heroin overdose, Feb. 2, 2014

A January 2014 press release from the office of Front Royal Police Chief Norman Shiflett described the result of efforts of the Northwest Regional Drug Task Force specific to Front Royal and Warren County. Prominent among those stats are indications of a continuing rise in the use of heroin locally. â&#x20AC;&#x153;The trend we saw in 2013 was Heroin overtaking Pills as the drug of choice in the Shenandoah Valley. Heroin is taking over throughout the

Commercial property for sale by owner, apartment over store in Middletown. Call 540.532.2982

region,â&#x20AC;? FRPD and Task Force Sgt. Kevin Coffman said. Coffman also told us that a recent and disturbing trend has been toward younger users, with hard drug use reaching down toward teens and school-age children. Long a prevalent urban drug of choice that is among the purist of

Possessions, Possession of a Firearm by Convicted Felons and the Sale of Firearms to a Prohibited Person,â&#x20AC;? the FRPD release on local drug arrests stated. Coffman elaborated that in the county between 2000 and 2007, the task force averaged around 200 cases with charges per year; from 2008 to 2013 that number rose to an average of 300 cases, with last yearâ&#x20AC;&#x2122;s 343 a yearly high (okay, bad pun). In 2013 in Front Royal and Warren County, the task force recorded the following drug and related gun seizures: â&#x20AC;˘ Pills: 444 Dose Units â&#x20AC;˘ Crack Cocaine: 293.6 Grams â&#x20AC;˘ Powder Cocaine: 83.65 Grams â&#x20AC;˘ Heroin: 241.55 Grams â&#x20AC;˘ Marijuana: 6998.6 Grams, 29 Plants â&#x20AC;˘ Ecstasy: 15 Dose Units â&#x20AC;˘ Methamphetamine: 1.9 Grams, 1 Lab â&#x20AC;˘ PCP: 30.5 Grams â&#x20AC;˘ Gun Seizures: 21 A couple of these stats jumped out

at us. Perhaps most notably â&#x20AC;&#x201C; especially having just watched the final season of the landmark dramatic TV series â&#x20AC;&#x153;Breaking Badâ&#x20AC;? about a high school chemistry teacher diagnosed with cancer turning to the soul-sucking option of meth production to insure his familyâ&#x20AC;&#x2122;s future financial security â&#x20AC;&#x201C; was the minimal amount of methamphetamine seized here over the course of 2013. A powerful stimulant, â&#x20AC;&#x153;Methâ&#x20AC;? is generally the polar opposite of narcotics like heroin and many of the prescription pill pain killers enjoying recent popularity. Sometimes called â&#x20AC;&#x153;cowboy cocaineâ&#x20AC;?, methamphetamines saw a spectacular rise in popularity growing out of the southwest nationally over the past several decades. We asked Coffman about the lack of meth seized locally. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve never been a big meth-use town,â&#x20AC;? Coffman said of Front Royal, adding, â&#x20AC;&#x153;Now Shenandoah, Page and Rockingham Counties have had more use comparatively. But for some reason we havenâ&#x20AC;&#x2122;t seen it here.â&#x20AC;? Understanding that different drugs

Donâ&#x20AC;&#x2122;t wait to list - housing inventory is low. It is a great time to sell! mp The Ca by at Mos Station Spacious and well-maintained, 4 bedroom, 2.5 baths on 0.31 acres. Approx. 3128 finished square feet including mostly finished basement. Quartz counter tops in kitchen w/newer appliances. New carpet in 2013. Retractable awning over back deck. New, energy efficient heat pump & furnace installed in the last few years. Mature trees & landscaping with a level back yard!

$339,500

2 - $400 Jackpots $ 75 Guaranteed Payout on Regular Bingo Games

EVERY SATURDAY 5:00 PM EARLY BIRDS 7:00 PM â&#x20AC;˘ DOOR PRIZES! PAYOUT BASED ON ATTENDANCE 50-100 PLAYERS: $75-$400 JACKPOT 101+ PLAYERS: $100-$500 JACKPOT

Sheila Pack 540-247-1438 Cell

â&#x20AC;˘ 2 - 400 Jackpots â&#x20AC;˘ Early Birds guaranteed payout $50 â&#x20AC;˘ Regular games pay $75 â&#x20AC;˘ Progressive Games â&#x20AC;˘ Queen of Hearts Raffle $

RE/MAX Team Realty, 440 W. Jubal Early Drive, #200 :LQFKHVWHU9$Â&#x2021;2IÂżFH (DFK2IÂżFH,QGHSHQGHQWO\2ZQHG$QG2SHUDWHG

WEATHER CANCELLATION: 540.636.1960 No Outside Food â&#x20AC;˘ No Smoking â&#x20AC;˘ Must be 12 to Enter & Play â&#x20AC;˘ Info: 540-622-7506

249616

By Roger Bianchini Warren County Report

narcotics, recent years have seen its increasing prevalence in rural areas with easy interstate access to metropolitan areas, as the I-66 and I-81 corridors present in the Northern Shenandoah Valley. Coffman pointed out that law enforcement is working an increased number of overdoses due to heroin usage â&#x20AC;&#x153;because users never know what they are going to get; the purity of the substance changes from manufacturer to manufacturer.â&#x20AC;? Coincidentally, two days after interviewing Coffman on local drug trends and the fatal volatility of heroin addiction, the death of one of the premier actors of his generation, Philip Seymour Hoffman, was announced from what was believed to have been a heroin overdose. The 46-year-old Hoffman battled drug addiction for much of his life and was reported to have been â&#x20AC;&#x153;cleanâ&#x20AC;? for 20 years before relapsing and going into rehab last year. Hoffman was best known for his 2006 Academy Award-winning Best Actor performance in the title role of â&#x20AC;&#x153;Capoteâ&#x20AC;?; and with the younger generation as chief game-maker Plutarch in the â&#x20AC;&#x153;Hunger Gamesâ&#x20AC;? films. FRPD Chief Shiflett says that he does not see heroin use slowing down in this area any time soon. Shiflett also observed that 2013 was the most productive year for the regional drug task force in total number of arrests in Warren County and Front Royal, which I guess one might say is a mixed blessing, reflecting either more effective police work or simply more opportunity due to increased drug distribution and use, or some combination thereof. â&#x20AC;&#x153;In the past year, the task force generated 343 criminal charges, which included Distributions, Possessions with Intent to Distribute,

www.sheilapack.net Search like the Realtors do!


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Page 15

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com â&#x20AC;˘ 540-683-9197 or Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072

Should we read anything into Super Bowl XLVIII being a match up of Colorado (Denver) versus Washington (Seattle), the two states to legalize recreational marijuana? â&#x20AC;&#x201C; Although only one team played like they were stoned in what might have been marketed as â&#x20AC;&#x153;The Pot Bowlâ&#x20AC;? â&#x20AC;&#x201C; GO 12th man!!! require differing amounts to achieve the desired affect on users, we asked Coffman to help us break down the quantities per dose to get a better understanding of actual drug use in the area. First, he made it clear that prices, quantities, as well as relative strengths of product can very greatly between urban and more rural markets like ours â&#x20AC;&#x201C; adding that discrepancy simply means local users are getting â&#x20AC;&#x153;ripped off â&#x20AC;? comparatively. Then he explained: â&#x20AC;˘ for prescription pills, one pill is generally the usual dosage with price

varying according to the drug; â&#x20AC;˘ with crack and powder cocaine and meth, in â&#x20AC;&#x153;the cityâ&#x20AC;? a gram is a typical purchase dose at $100, with half grams going for $50, while here three-tenths (.3) to three-quarters (.75) of a gram will go for $100 and two-tenths to three-tenths of a gram will go for $50; â&#x20AC;˘ with heroin locally, a $25 to $50 purchase usually buys a dose between .06 (six hundredths) and .1 (one-tenth) of a gram, with city prices being $80 to $140 for a full gram. And THERE, in two parts, lies the

real story in the rise of heroin use here!!! The two subplots of that story are the amount of heroin being dealt here; and the profit motive to deal city-bought drugs in rural markets like Front Royal and Warren County. To elaborate, each gram of heroin equates to between 10 and 16-plus doses of heroin to be turned over in the rural black market. Divide those numbers into each of the 241 grams of heroin seized here â&#x20AC;&#x201C; and that equals between 2,410 and 4,000 doses of heroin seized here; compared to 444 doses of narcotic-based pills; 83 to 166 doses of powder cocaine; 293 to 586 doses of crack cocaine, and just 2 to 4 doses of methamphetamine. THAT is an eye opener â&#x20AC;&#x201C; or closer, as the particular drug at issue might dictate. And on the dealing side, even a street-price purchase of a gram of heroin at $80 to $140 in the city, turned over at local dosage prices means clearing $415 to $825 per gram, a potential 500 to 1000 percent markup for small-time street dealers. Not so fast, cowboy However, Coffman noted the downside to that profit margin locally is Front Royalâ&#x20AC;&#x2122;s reputation as a dangerous town for dealers to work in. The drug task force sergeant pointed out state sentences for dealing heroin can range from 5 to 20 years; and if the feds get involved on conspiracy

Massage Classes for Couples

Do you like giving massage, but wondered if you were doing it â&#x20AC;&#x153;rightâ&#x20AC;?? Hereâ&#x20AC;&#x2122;s an opportunity to learn from a professional!

Thursday, February 13, 6â&#x20AC;&#x201C;8 p.m.

Public safety to distribute charges, of over 100 grams which Coffman observed can be a cumulative total from multiple transactions, federal sentences run from 10 years to life in prison. The specter of client overdoses also hangs heavy over dealerâ&#x20AC;&#x2122;s heads. Sales leading to overdoses, even nonfatal ones, can net federal sentences of 20 to 30 years to life. Just to illustrate he wasnâ&#x20AC;&#x2122;t blowing smoke (oops, perhaps a bad analogy in this context), Coffman concluded his saga of the pitfalls of dealing heroin with the story of a busted dealer who took a plea agreement in federal Western District Court netting him 35 years in the big house with bars. Soft drugs? As for the 6,998 grams of marijuana seized, Coffman estimated that depending on the quality of the product, a typical â&#x20AC;&#x153;potâ&#x20AC;? dose could be 1/2 gram to 1-1/2 grams per â&#x20AC;&#x153;jointâ&#x20AC;? with further variables on the amount of pot an individual user chooses to smoke over the course of a day.

And while those numbers continue to make marijuana the most prevalent illegal drug locally, we noted that the debate over the reclassification and legalization of marijuana continues to rage nationally. It is a debate fueled by long-available science questioning the categorization of marijuana as a Schedule I drug, legally comparable to heroin and other narcotics and chemical stimulants. Studies indicate that marijuana is not physically addictive; and compared to other illegal AND many legal drugs (alcohol and nicotine come to mind) has relatively minimal short and long-term physiological impacts. (The Northwest Regional Drug Task Force is a multi-agency narcotics task force that includes participation from numerous agencies in the Northern Shenandoah Valley. The Front Royal/ Warren County area is represented by Investigators with the Warren County Sheriff â&#x20AC;&#x2122;s Office, Virginia State Police and the Front Royal Police Department.) â&#x20AC;&#x201C; rogerb@warrencountyreport.com

â&#x20AC;&#x153;lf it ainâ&#x20AC;&#x2122;t broke, donâ&#x20AC;&#x2122;t fix itâ&#x20AC;? Thatâ&#x20AC;&#x2122;s good advice for just about anything, including your insurance. If you think your insurance agency and company are doing a good job for you, why change? But if youâ&#x20AC;&#x2122;re looking for something more ...something special...check out what we can offer as an agency of the State Auto Insurance Companies. Â&#x2021;)XOOPXOWLSOHOLQHSURGXFW facilities... business, home, auto Â&#x2021;3UHIHUUHGUDWHVIRUPDWXUHVDIHGULYHUV Â&#x2021;&RPSUHKHQVLYHKRPHRZQHUVSODQV ZLWKEXLOWLQFRYHUDJHÂłH[WUDV´ Â&#x2021;6SHFLDOSULFLQJDGYDQWDJHVLQFOXGLQJ an Auto/Home Discount if you have both policies with State Auto Companies Â&#x2021;$FRPPLWPHQWWRVHUYLFHWKDWÂśVSURPSW concerned and responsive

Warren Memorial Hospital Outpatient Center â&#x20AC;&#x201D; 120 N. Commerce Avenue in Front Royal Instructors: Certified Massage Therapists Kelly Clark & Brandy Carter

Get the right coverage at the right price

You and your significant other, family member, or friend can learn how to massage each otherâ&#x20AC;&#x2122;s hands, neck, shoulders and back for relaxation and stress relief. No disrobing is necessary for the class.

Jim Kenney Insurance Agency

Call

540.635.9007 Representing

$80 per couple â&#x20AC;˘ Pre-registration required â&#x20AC;&#x201D; Call 540-635-0730 for more information or to register


Page 16 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Public safety & health

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com â&#x20AC;˘ 540-683-9197

Burrell 15-year prison sentence plea agreement finalized

Clyde Burrell, Jr. By Roger Bianchini Warren County Report Following a late January 2014 hearing, the plea agreement drafted four months earlier was accepted to resolve the case of a Front Royal man initially accused of attempting to murder a Front Royal Police officer responding to call on the 1400 block of North Shenandoah Avenue on July 28, 2012. According to the terms of that agreement reached after court-ordered psychological evaluations, as we reported in our Nov. 8, 2013 edition, Clyde Burrell Jr., now 35 years old, will serve 15 years in prison with no possibility of parole. Burrell initially faced a life sentence on an

Attempted Murder of a Law Enforcement Officer charge, plus additional charges with potential maximum sentences totaling another 76 years. Per the agreement Burrell pled guilty to two counts of Malicious Wounding of a Law Enforcement Officer (2 to 30 year sentencing range on each count), one charge of Assault and Battery of a Law Enforcement Officer (6 months to 5 years) and one charge of Obstruction of Justice (12 months max). In addition, Burrell admitted to violating the terms of probation he was on at the time of the original attack of FRPD Officer Bryan Courtenay. Those guilty pleas could have netted sentences of anywhere from a maximum of 66 years, to combined minimum sentences of

five years. The July 28, 2012 incident leading to the original charges and consequent plea agreement began with reports of a man exposing himself to passing motorists near motels near the intersection of N. Shenandoah Avenue and 14th Street. FRPD K-9 Officer Courtenay was the first to respond and approached a man fitting the description of the exposure suspect in the parking lot of a medical office at 1420 N. Shenandoah Ave. The then 33-year-old, 5-foot-11, 288-pound Burrell then launched a savage attack on Officer Courtenay as he exited his vehicle. Courtenay testified he soon believed he was in a fight for his life as Burrell punched and then rested the officerâ&#x20AC;&#x2122;s nightstick away to continue the attack. Backup arrived and FRPD Officer Jason Lethcoe was able to get Burrell off Courtenay with the aid of passing citizens. Courtenay was hospitalized for about three days and missed two months of work and spent his first several months back on desk duty while he continued his recuperation. While in Warren County Jail on March 30, 2013, Burrell also attacked Deputy Thomas Ratigan, breaking his nose and jaw. In court Burrell said he felt he had been harassed by police in the past and decided he wasnâ&#x20AC;&#x2122;t going to take it anymore at the time of the attack upon Courtenay. Shortly after his arrest for the July 2012 attack on Officer Courtenay, relatives of Burrell told us they had been frustrated in efforts to get him the type of intensive psychological treatment they believed he needed following an earlier court-ordered

psych evaluation in 1998. Defining mental health As we reported in November the court-ordered psych evaluation was raft with contradictory conclusions about Burrellâ&#x20AC;&#x2122;s mental state and health. The Central State Hospital evaluation received by Judge Hupp on Dec. 14, 2012, â&#x20AC;&#x153;opined that the defendant is competent to stand trial.â&#x20AC;? However, the report also noted that prior to being sent to Central State on Nov. 29, 2012, â&#x20AC;&#x153;While in jail, Mr. Burrell was reportedly diagnosed with Schizoaffective Disorder, Bipolar Type, and Alcohol Abuse. He was prescribed the antidepressant Celexa and the mood stabilizer Depakote. He reportedly refused the antipsychotic medication Risperdal.â&#x20AC;? State evaluator and Clinical Psychologist Angela Torres noted that Burrellâ&#x20AC;&#x2122;s current treating psychiatrist David Albright, MD, â&#x20AC;&#x153;did not diagnose him with a major mental illness but instead diagnosed him with substance and personality disordersâ&#x20AC;? leading to prescription of the drugs cited above, as well as 20 hours of

â&#x20AC;&#x153;psycho-educational programming per weekâ&#x20AC;?. Torres did not address the seeming inconsistency that one psychiatrist had diagnosed Burrell with â&#x20AC;&#x153;no major mental illnessâ&#x20AC;? but that other doctors treating Burrell in jail had, not only diagnosed him as Schizoaffective, Bipolar Type and an alcohol abuser, but also suggested prescription of a variety of antidepressants and mood controlling medications he was on during the later evaluation, not to mention anti-psychotic drugs he had declined. In fact, Torres did report that Burrell told her, â&#x20AC;&#x153;he sees a â&#x20AC;&#x2DC;thousand images of peopleâ&#x20AC;&#x2122;s facesâ&#x20AC;&#x2122; and â&#x20AC;&#x2DC;sees evil facesâ&#x20AC;&#x2122; â&#x20AC;? but denied having visions. She also wrote that Burrell â&#x20AC;&#x153;denied hearing voicesâ&#x20AC;? but â&#x20AC;&#x153;reported that he feels paranoid â&#x20AC;&#x2DC;every dayâ&#x20AC;&#x2122; and feels â&#x20AC;&#x2DC;on edge.â&#x20AC;&#x2122; So, for the next 15 years it will only be other prisoners and prison staff that will have to deal with the fluctuations in Burrellâ&#x20AC;&#x2122;s moods and their consequences, as well as his continued medication to control those diagnosed mental states, mood fluctuations and evil images.

EMPLOYMENT VA Petersburg/ Franklin, WV Community Based Outpatient Clinic VHHNLQJDERDUGFHUWLÂżHG,QWHUQDO0HGLFLQHRU)DPLO\0HGLFLQHSK\VLFLDQPDQDJLQJ 9HWHUDQVKHDOWKWKURXJKGHGLFDWHGSDWLHQWFHQWHUDOLJQHGFDUHIRFXVRQKHDOWK SURPRWLRQDQGVFUHHQLQJ<RXZRXOGKDYHWKHRSSRUWXQLW\WRSURYLGHFDUHEHWZHHQ WZRUXUDOFOLQLFV3HWHUVEXUJDQG)UDQNOLQ9$&RPPXQLW\%DVHG2XWSDWLHQW&OLQLFV RQO\PLOHVDSDUW$OVR\RXKDYHDFFHVVWRTele-Health 0HQWDO+HDOWK3RGLDWU\ 5HWLQDO'HUP*HQRPLFV3KDUPDQGRWKHUV 7KHUHLVDQRSSRUWXQLW\WRDSSO\IRU 2IÂżFHRI5XUDO+HDOWK 25+ JUDQWPRQH\DQGSRVVLEO\ZRUNZLWKVWXGHQWVLIVR GHVLUHG

The VA Physician Work/Life Balance:

We give your pets the

Love, Care & Respect

they deserve...

February is the month of Love!!

This month we are giving FREE Lavendar Aromatherapy upgrade with a FREE Paw Pad conditioning upgrade when you mention this ad!! 918 John Marshall Hwy, Front Royal (in front of UPS)

540-622-8085

www.ShearElegancePetBoutique.com

9$HQVXUHVDQGHQFRXUDJHVDKHDOWK\ZRUNOLIHEDODQFHDQGGRHVVRWKURXJK SUHGLFWDEOHVFKHGXOLQJUHGXFHGSDSHUZRUNWKHHOLPLQDWLRQRIELOOLQJKDVVOHVDQG OLIWLQJWKHEXUGHQRIOLDELOLW\FRYHUDJH,QDGGLWLRQZHDOVRRIIHUJHQHURXVYDFDWLRQ DQGSHUVRQDOOHDYH,W VWKHVHDGYDQWDJHVWKDWRIWHQSURPSWPDQ\H[SHULHQFHG SK\VLFLDQVWROHDYHSULYDWHSUDFWLFHDQGFRPHWRZRUNIRUWKH9$KHDOWKFDUH V\VWHP([SORUHWKHIROORZLQJOLQNVWROHDUQPRUHDERXWWKHEHQHÂżWVRID9$FDUHHU

Requirements: Â&#x2020;86&LWL]HQ Â&#x2020;%RDUGFHUWLÂżHGHOLJLEOH,QWHUQDO0HGLFLQHRU)DPLO\0HGLFLQH Â&#x2020;$EOHWRGR:RPHQÂśVKHDOWK3$3VPHDUVDVZHOODV*HQHUDO0HGLFLQH Â&#x2020;)XOODQGXQUHVWULFWHG0''2OLFHQVH IURPDQ\VWDWH 

%HQHĂ&#x20AC;WV :RUNLQJIRUWKH'HSDUWPHQWRI9HWHUDQV$IIDLUVRIIHUVDFRPSUHKHQVLYHEHQHÂżWV SDFNDJHWKDWLQFOXGHVJUHDWTXDOLW\RIOLIH Â&#x2021;GD\VSDLGYDFDWLRQ Â&#x2021;GD\VRIVLFNOHDYH Â&#x2021;SDLGKROLGD\V Â&#x2021;/LIHLQVXUDQFHKHDOWKEHQHÂżWV Â&#x2021;8SWRPDWFKLQJGROODUVRQ\RXU N 7KULIWV6DYLQJV3ODQDQGSDUWLFLSDWLRQ LQWKH)HGHUDO(PSOR\HHV5HWLUHPHQW6\VWHP /HWPHWHOOPRUHDERXWVHUYLQJRXU1DWLRQÂśV9HWHUDQV,LQYLWH\RXWRVHQG\RXU&9 DQGGLVFXVVWKLVH[FLWLQJRSSRUWXQLW\terrance.anderson@va.gov


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 • Warren & Frederick County Report • Page 17

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com • 540-683-9197 or Alison at alisond@warrencountyreport.com • 540-551-2072

Public safety

Arrest in donation jar thefts - additional suspects may be sought

William “Roy” Jeffries Front Royal Police have arrested a man for allegedly stealing containers containing charity donations from area gas stations in Front Royal. William “Roy” Jeffries, 23, was arrested late Wednesday night, Jan. 29, after police identified him from surveillance footage. The first theft was reported on Sunday, January 26th, by employees of Handy Mart, located at 202 S.

Commerce Avenue. The employee noticed The Children’s Miracle Network collection box was missing from the counter. After reviewing the video, a white male was observed taking the container and leaving the store. The second theft occurred on Monday, January 27th, at the Mobil Gas Station, located at 63 W 14th Street. A white male walked in the

store and distracted the clerk behind the counter. The suspect then picked up a donation jar, set up on behalf of The House of Hope, and walked out the door with the (he may be in the “Big House of No Hope” soon). Then Anthony’s Pizza owner, Frank Amari, called police on Wednesday, Jan. 29, to report that their employee Tip Jar had been taken the night before. Amari advised officers that two males and a female came into the restaurant Tuesday night to eat dinner. On their way out, one of the males grabbed the tip jar and walked out the door. Also on Jan. 29, the 7-11, located at 711 S. Royal Avenue, reported that their Relay for Life donation container had been stolen. A white male is observed removing the donation container from the counter and then walking out the door. William “Roy” Jeffries was charged with four Misdemeanor counts of Petit Larceny. Jeffries was held on a $1500 secured bond at the Warren

County Jail. His court date is set for March 4, 2014 at 10 a.m. Chief Norman Shiflett praised his officers for working diligently throughout Wednesday to identify the suspect(s) in these cases. Police declined to elaborate on the status of any search for those accompany-

ing Jeffries during the Anthony’s incident. Chief Shiflett urges anyone with further information about these cases to contact Sgt. Jason Winner at (540) 635-2111 or jwinner@frontroyalva.com – From a release

Hours: Mon - Fri 5 9:30am to 5pm

Trenum’s Auto Repair

5444 Main St. Stephens City

540-508-0451

trenumsautorepair@gmail.com

Call or stop by Today!!!

Winchester Police warn of fraud

The Winchester Police Department wants your money to stay with you in 2014. The police department has been receiving a number of reports of fraud and wants to educate the public on how to prevent from becoming a victim. On January 30th officers received a report of credit card fraud. The victim had met someone online who told her that if she loaded $400 on a prepaid card she would make more than that amount. The victim added the money to a prepaid card, but now the money is missing and she didn’t receive anything in return. On January 25th officers were contacted regarding mail fraud. The victim signed up for a secret shopper program online and received a money order in the mail with instructions on how to proceed. The victim deposited the money order into his account and was instructed to send a portion of it to France. After he had sent the money by Western Union the bank notified the victim that the check was fraudulent. The victim lost more than $800 in this scam. Typical types of Lottery/Sweepstakes Frauds include: • Victims who are told they have

won a prize in a lottery or sweepstakes • To obtain the promised winnings, victims are told they must pay “taxes” or “fees” • Payments are requested via Bank Wire Transfer, Western Union, Moneygram, or other money service businesses Always keep in mind that if something sounds too good to be true, chances are it is. Also, remember that you shouldn’t have to give money to receive money. To prevent from becoming a victim always know who you are dealing with, don’t fall for scams that promise a large amount of money, and always do your research. We want to remind you to never give your personal information over the phone, through the mail, or on the Internet unless you have initiated the contact or you are sure you know who you are dealing with. If you believe you have been a victim of fraud contact the police department to make a report. This press release was prepared by Lauren Cummings, Police Community Relations/Crime Prevention Specialist. (540) 545-7548 (office) Lauren.Cummings@winchesterva. gov

Limited time offer that could save you $hundreds$ on your repair bill. this ad Mention er your will low e to and we Rat ly ur o H Labor hour. ars per $50 doll

Follow us on FB for weekly special offers!

www.facebook.com/trenumsautorepair

Bentonville drowning believed accidental On January 22, 2014 around 4:52 p.m. a 911 call was received by the Warren County Sheriff ’s Office for a cardiac arrest at the Bentonville low water bridge. A 53-year-old male had been pulled from the water by family and construction workers that were in the area. The male was identified as Jeffery Vaught of Front Royal. Warren County Fire & Rescue along with the Warren County Sheriff ’s Office responded to the scene. It was determined Vaught was filling buckets of water to be used on his farm at the time of the incident. Mr. Vaught was transported to Warren Memorial Hospital where he was pronounced dead. The exact cause of death will be determined by the state medical examiner’s office. The death is being handled as an accident. – From a release

The Inn at Little Washington is growing, and is seeking enthusiastic and eager individuals who desire to be part of an exceptional five-star, five-diamond team. Exceeding our guests’ expectations, flexibility, and commitment are threads that weave our team together in our delivery of service. We are currently interviewing for:

x x x x x x x x x x x x x

Dishwasher Housekeeper Valet Breakfast Server Dinner Server Server Assistant Butcher Cook Expeditor Pastry Cook Gift Shop Salesperson Organic Farm Manager Sous Chef

Please email your resume in.doc or .pdf format only – not zipped -- to hr@theinnatlittlewashington.com. For more information or other ways to apply, please visit our website at www.theinnatlittlewashington.com/careers.php. The Inn at Little Washington Middle and Main Streets, Washington, VA 22747


Page 18 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com â&#x20AC;˘ 540-683-9197

Community

Inaugural Samuels Library â&#x20AC;&#x2DC;Authors Dayâ&#x20AC;&#x2122; a success Hopefuls told about the process of publication by those whoâ&#x20AC;&#x2122;ve been there

Kidâ&#x20AC;&#x2122;s books are always popular What a marketing ploy! Ron Rauss got his childrenâ&#x20AC;&#x2122;s book put in Cheerios boxes. Rauss will be back at the library April 17 at 11 a.m. to read to me on my birthday, I mean to preschoolers. By Roger Bianchini Warren County Report A crowd of approximately 75 people filled the room to hear stories about the dynamics of publication from local authors who have had successful experiences with the phenomena. At least a third of that crowd stayed after an overview and panel discussion headed by Christine Andreae and Ira Chaleff to visit tables with 21 authors and their published books. Whatâ&#x20AC;&#x2122;s the BIG DEAL, I wondered?!!? â&#x20AC;&#x201C; Iâ&#x20AC;&#x2122;m published every two weeks. Oh, you mean: â&#x20AC;˘ works of creative fiction that are even longer than my bi-monthly accounts of the intricacies of the conduct of local government here in River City and Warren County in the declining days of a decaying empire; â&#x20AC;˘ explorations of spirituality or the

lack thereof; â&#x20AC;˘ historical, personal and family memoirs. I see â&#x20AC;&#x201C; but Iâ&#x20AC;&#x2122;m told I cover all those bases in the guise of what I pass off as newspaper reporting. Hmm, maybe I should look into this publication game too â&#x20AC;Ś â&#x20AC;&#x153;I believe it was quite successful and I hope to continue this next year,â&#x20AC;? Samuels Library Director Nicki Lynch later told us, adding, â&#x20AC;&#x153;I apologize if I left out any local authors â&#x20AC;&#x201C; I am sure there are more authors out there I might have missed. I hope they will contact me for our next authorsâ&#x20AC;&#x2122; event.â&#x20AC;? But unmissed in this inaugural event were attending authors: Ben Hatke, Missi Magalis, Lynne Lewis, Regina Domain, Robert Colacurio, Larry Yates, Jose Padua, Heather Davis, Malcolm Barr, Julia Compbell Johnson, Robert Badger, Jake

EXPERT PLUMBING SERVICES

McGuire, Ira Chaleff, Christine Andreae, Jay Buckner, Ron Rauss, Betty Frank, R. Shiftlett, Jerry Holsworth, Claire Schuler and Gail Huntly. And Lynch told us, â&#x20AC;&#x153;Several were unable to attend because of the weather: Preston Pulliam, age 96; Brenda Seabrooke; and Rich Follett, who was in Fairfax judging a contest.â&#x20AC;? Well, we had a big time despite the absentees, saw some old friends (Malcolm Barr, Larry Yates and former local reporting co-conspirator Dennis

Lynch, the latter whoâ&#x20AC;&#x2122;s moved to the brighter horizons of management of the annual Shenandoah Valley Music Festival) and made some new ones (Robert Colacurcio and William Shifflett) and wished weâ&#x20AC;&#x2122;d had time to meet more â&#x20AC;&#x201C; next year, folks, next year â&#x20AC;Ś The event was co-hosted by Samuels Library, Royal Oak Bookshop and Page Master Books. Among the things I learned about were: â&#x20AC;˘ the rising phenomena of publishing

online book, that while leaving you without a copy in your hands, eliminates the overhead costs of printing; â&#x20AC;˘ the role of social media in getting your name and product out there; â&#x20AC;˘ that specialty publishers exist; â&#x20AC;˘ that agents can be helpful in shopping your book â&#x20AC;&#x201C; or not; â&#x20AC;˘ and that you canâ&#x20AC;&#x2122;t be thin-skinned about rejection â&#x20AC;&#x201C; â&#x20AC;&#x153;I got 23 rejections in one year,â&#x20AC;? Andreae said of shopping short stories while working on a longer book; â&#x20AC;˘ and that fiction writing can be the toughest market to break into â&#x20AC;&#x201C; â&#x20AC;&#x153;If youâ&#x20AC;&#x2122;re a fiction writer no oneâ&#x20AC;&#x2122;s interested in you unless youâ&#x20AC;&#x2122;re Stephen King or another established BIG name author with a track record of high sales and making money; â&#x20AC;˘ that while royalties will be larger per sale in self-publication, the marketing provided by commercial publishers can be invaluable in getting your book to the public (so can kidnapping a publisherâ&#x20AC;&#x2122;s family â&#x20AC;&#x201C; just kidding â&#x20AC;&#x201C; WAIT, thereâ&#x20AC;&#x2122;s a BIG $$$ plot IDEA). And despite the pitfalls, one author observed, â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a wonderful age â&#x20AC;&#x201C; thereâ&#x20AC;&#x2122;s so many options.â&#x20AC;? But Iâ&#x20AC;&#x2122;m still not clear if kidnapping is one of them â&#x20AC;Ś â&#x20AC;&#x201C; rogerb@warrencountyreport.com

Winter has arrived! We can offer you peace of mind that your loved one is safe and cared for

For many, winter storms create havoc for accessing basic necessities like groceries and routine medical needs. Now is the time to make sure your loved one is prepared. As the colder weather approaches, youâ&#x20AC;&#x2122;ll feel at ease with our vast amenities.

Mark Manno, Master Plumber

No job too big or too small! OVER 30 YEARS EXPERIENCE 5HDVRQDEOHUDWHVÂ&#x2021;)5(((67,0$7(6Â&#x2021;6HQLRU'LVFRXQWV )DXFHWV6LQNV:DWHU+HDWHUV:HOO3XPSV6KRZHUV $OOZRUNJXDUDQWHHG/LFHQVHG ,QVXUHG EXVLQHVV 540-636-2098 FHOO 540-305-5973

Commonwealth Assisted Living at Front Royal .PVOU7JFX4Ut'SPOU3PZBM 7" $BMMUPEBZGPSBQFSTPOBMUPVSPGPVSCFBVUJGVMDPNNVOJUZ tXXX$PNNPOXFBMUI"-DPN A Commonwealth Assisted Living Community


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Page 19

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com â&#x20AC;˘ 540-683-9197 or Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072

New business

Discovering Warren County: Osteria 510 Fine Dining in Front Royal out their menu and wine list on the Internet at www.Osteria510.com or you can call them at (540) 631-1101 or friend them on facebook. They are open Tuesday â&#x20AC;&#x201C; Sunday 5:00 pm -10:00 pm. They also accept lunch groups by reservation and plan extended summer hours for later this year. So check out Osteria 510, you wonâ&#x20AC;&#x2122;t be disappointed.

â&#x20AC;&#x153;MAKE YOUR NEXT CUTâ&#x20AC;?

THE RIGHT CUT - Fa m i l y S a l o n From left are Alexandra Dunbar-Fernandez and Osteria 510 Chef Vincenzo Belvito By Ken Thurman Warren County Report Osteria 510 located at the corner of Royal Avenue and South Street offers a unique blend of charming surroundings, excellent food, and top notch service in a delightful 60 seat restaurant with additional outdoor seating when the weather allows. I spoke with Chef Vincenzo Belvito and Alexandra Dunbar-Fernandez about the Osteria (Italian for casual restaurant) and their decision to

open in Front Royal. Vincenzo, an Italian native from Bari on the Adriatic coast, has been a chef for over 40 years from Bari, to Milan and Venice, to Dallas, Texas and Washington D.C. with the last 30 years being in the United States. I asked him why he left Connecticut Avenue for Front Royal and he explained that he wanted the small town feeling and inviting atmosphere that Front Royal projected. He was of course, influenced by his friend Kathy Soranzo (Valley Finds in town).

Together with Alex he changed the old Three Brothers restaurant in July of 2013, after two weeks of intense renovation, into a beautiful setting to enjoy Southern Italian specialties. He makes his own gelato (ice cream), sauces, desserts, and dressings and uses local meats and seafood. He prides himself on serving only food he would eat himself and specializes in light lean foods, gilled and sautĂŠed, never fried, using ingredients that he shops for daily. Every day he has new specials and strives to have something for everyone. My wife, a friend, and I tried three different dishes, including two different pizzas and were impressed with

Calvary Episcopal Church

All lines of insurance: Auto â&#x20AC;˘ Health â&#x20AC;˘ Business â&#x20AC;˘ Life â&#x20AC;˘ Home

â&#x20AC;˘

Insure with us with confidence! 11 Water Street Front Royal, VA

(540) 635-8401

132 North Royal Avenue Front Royal, VA 22630 Phone: 540-635-2763

Welcoming All as Neighbors

Sunday Services 8:00 a.m. 10:30 a.m. www.CalvaryEpiscopalChurch.org

FRONT ROYALâ&#x20AC;&#x2122;S BRIDAL HEADQUARTERS Donâ&#x20AC;&#x2122;t just tell her how much you love her... Show her with a gift from Diamond Dealers Exchange!

Valentineâ&#x20AC;&#x2122;s Day Special

With any $75 purchase you are automatically entered to win a fabulous pair of Champagne Diamond Earrings! Retail value $899. Stop by store for details.

Diamond Dealers Exchange Inc. Formerly The Chain Reaction Fine Jewelers

In the K-Mart Shopping Center Next to Radio Shack

540-636-7210

â&#x20AC;&#x153;Bill Tanner / Jeweler / Gemologist / Your Friend In The Jewelry Industryâ&#x20AC;?

540-636-7210 DiamondDealersExchange.com

the quality, presentation, and service. The pizza Salsiccia E Asiago Stagionato with spicy sausage, mozzarella and aged asiago cheese was mouth watering good and vanished before my eyes (it was that good). Of course we had to check out the Torta Di Cioccolato (dark chocolate cake) and a bottle of wine to finish the exquisite meal. Check out his Valentineâ&#x20AC;&#x2122;s Day menu, I know my wife and I plan to be there. You can reach them or just check

1855 SENSENY RD #6

WINCHESTER, VA 22602

540 ¡ 662 ¡ 5992

We Buy Cars, Trucks & Farm Tractors #VTJOFTT )PNF $FMM

40 Years in Business

THARPES GARAGE & TOWING 8&4&--64&%$"341"354t".&3*$"#-&44(0% %FBMFSi1&"/65w

,FOESJDL-Ot'SPOU3PZBM


Page 20 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Weâ&#x20AC;&#x2122;ll Ev Wrap en For Y it ou!

THE FLOWER CENTER 5405 Main Street

tineâ&#x20AC;&#x2122;s n e l a V Day l ia Spec

â&#x20AC;&#x153;On the corner, at the stoplight, in old town Stephens Cityâ&#x20AC;?

540-869-4494 Valentineâ&#x20AC;&#x2122;s Day cards, Gourmet Chocolates, Stuffed Animals and Balloons also available!

Telefloraâ&#x20AC;&#x2122;s Bear your Heart Bouquet

WE DELIVER! Or stop by for our Carry Out Rose Special or Arrangements to go!

Order Online! www.theflowercenter.biz

Hey Guys, Let us help you create your own personal gift!! Â&#x2021;3HUVRQDOL]HG-HZHOU\E\2ULJDPL2ZO RWKHUGHVLJQHUV Â&#x2021;*RXUPHW&KRFRODWHV Â&#x2021;5RPDQWLF7HDV

(DVW0DLQ6WUHHWÂ&#x2021;)URQW5R\DO

703-856-8398

VKHQDQGRDKFRQIHFWLRQV#JPDLOFRP )DFHERRNFRPVKHQDQGRDKFRQIHFWLRQV

Front Royal Diner Family Restaurant *UHDW)RRG*RRG3ULFHV+RPHPDGHVRXSVHYHU\GD\

Open Valentineâ&#x20AC;&#x2122;s Day 6am ~ 9pm Breakfast Special

0)Â&#x2021;DP  Lunch Spec 2eggs homefries ial 0 ) Â&#x2021;DP & toast SP  Soup & sandwich

Dinner Specials 0)Â&#x2021;SP 

Join our loyalty SURJUDP

Valentineâ&#x20AC;&#x2122;s day Special Sweetheart Steak & Seafood Dinner for Two

call 540-636-2270 to Make your Reservations Today!

-RKQ0DUVKDOO+Z\)URQW5R\DOÂ&#x2021; Banquet Facilities Available

6HQLRU&LWL]HQ'LVFÂ&#x2021;3')' 0LOLWDU\LQXQLIRUPRUZ,'RII

HAVE FUN, LEARN TO SWING DANCE!!

'PVSIS-FTTPOTt.POEBZTQN #FHJOOJOH'FCSVBSZUI

QFSQFSTPOPSQFSDPVQMF /PQBSUOFSJTOFDFTTBSZt1SJWBUFMFTTPOT"WBJMBCMF

2VBMUJZ*OOt4$PNNFSDF"WFt'SPOU3PZBM %FBO.VMMFO *OTUSVDUPSt


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Page 21

Michelle Cissel

APEX PERFORMANCE DEVELOPMENT CENTER PRESENTS:

Independent Sales Representative šŜŲÇ?žžŸÇ?ŲŜŝŚǨÇ&#x2026;ǨÄ&#x2030;½ùĭĭĂ&#x2030;Ä Č&#x160;Ĺ&#x201C;Â?ĂŽÄ&#x201D;Ä&#x201D;Ç&#x152;½Ä&#x201D;Ä&#x2030;

eâ&#x20AC;&#x2122;s

valentin day

Ĺ?Ĺ?Ĺ?Ç&#x152;Ä­Ä´Â?ÄŠÄ´Â?Ĺ&#x152;Ä&#x201D;Ä&#x2039;Ç&#x152;½Ä&#x201D;Ä&#x2030;ǨjĂ&#x2030;ĂŁĂ&#x2030;ÄŠĂ&#x2030;Ä&#x2039;½Ă&#x2030;ǨÄ&#x201D;Ă&#x201A;Ă&#x2030;Ç&#x2020;ǨÄ&#x2030;½ùĭĭĂ&#x2030;Ä

Parents Night Out!

valen

tineâ&#x20AC;&#x2122;s day

IULGD\IHEUXDU\WKÂ&#x2021; 6:00pm - 10:00pm IRUILUVWIDPLO\PHPEHUÂ&#x2021;HDFKDGGWOIDPLO\PHPEHU

Ĺ?Ĺ?Ĺ?Ç&#x152;Ĺ&#x201C;Ä&#x201D;ğĊÂ&#x152;VMÇ&#x152;½Ä&#x201D;Ä&#x2030;Ç&#x201C;Ä&#x2030;½ùĭĭĂ&#x2030;Ä

IRUQRQPHPEHUV

3L]]D 6QDFNVÂ&#x2021;.LGV-LX-LWVX/HVVRQÂ&#x2021;.LGV6WULNLQJ%R[LQJ 0RYLH 3RSFRUQÂ&#x2021;)81)81)81

Reserve Your Spot NOW at: www.apexpdc.com

Say

â&#x20AC;&#x2DC;I Love Youâ&#x20AC;&#x2122; with flowers

&KHVWHU6W)URQW5R\DOÂ&#x2021;

KISMET ACRES FARM

Valentine Special!

from

Donahoes Florist 205 South Royal Ave Jean Rudacille, Owner

donahoesflorist.com

540-635-2815 1-800-806-5182

"OZ-JPOFMSPMMJOH TUPDLJOUIFTUPSF "--#PYDBST )PQQFST 5BOL$BST  0QFSBUJOH$BST FUD

 0''

Looking for Love?

6 Choke Cherry Lane Capon Bridge, WV 26711 Open most weekends & by Appt. Â&#x2021; info@kismetacres.com www.kismetacres.com

Come out & meet our adorable alpacas!

Purchase one Alpaca and receive up to 50% off the 2nd one! Plus 20% off store items! Offer good through 2/28/14

540-868-0025

7BMMFZ"WF,FSOTUPXO 7" (JOHFSCSFBE+VODUJPO4FU Ĺ?%PDLTJEFSĹ?TUFBNMPDP$8

461&3 4"-& $

219

1FOTZ'MZFS3FNPUF4FU X3BJM4PVOET3FNPUF

461&3 4"-& $

179

.PO5IVSTQNUPQNĹ&#x201D;'SJQNQNĹ&#x201D;4BUBNQN

XXXNBSJPTUSBJOTDPN


Page 22 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Valentineâ&#x20AC;&#x2122;s Day - Friday, Feb. 14th

Give a Gift from the Heart

2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Andrickâ&#x20AC;&#x2122;s Gifts & Collectables

from your Hometown Florist!

Your one stop shop for your Valentine Gifts!

Front Royalâ&#x20AC;&#x2122;s

Fussell Florist

21 1/2 W 6th St. Front Royal

540-635-9000

ZZZIURQWUR\DOVIXVVHOOĂ RULVWQHWÂ&#x2021;ZZZIXVVHOOĂ RULVWQHW

Â&#x2021;

0RQ6DWÂ&#x2021; 6XQÂ&#x2021;

Commerce Ave. Across from the Front Royal Fire Dept.

Closed Wednesday

202 E. 2nd St. Front Royal, VA

Check out our NEW Fresh Seafood Menu! 4DBMMPQTt4ISJNQ 'MPVOEFSt$MBNT URSDAY! Oysters TH All You Can Eat

Steak and Crablegs w/sides $49.99

Crab Legs! 6 - 9pm

Stonewall Jackson Restaurant 4UFBLt4FBGPPEt1BTUBt$IJDLFO "#$POQSFNJTF

915 N Royal Ave

Front Royal, VA 22630

540-635-1862 WEDNESDAYS!

Open Mic w/ Tim Walls

Come dance the night away! Every weekend w/DJ Mike Bailey

Kids10 Eat FREE EVERYDAY! & under w/ purchase of adult entrĂŠe

XXX4UPOFXBMM+BDLTPO3FTUBVSBOUDPN


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Page 23

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com â&#x20AC;˘ 540-683-9197 or Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072

Public safety

Warren County Fire and Rescue: ice hazards and safety By Richard E. Mabie Warren County Fire Chief

Warren County Fire and Rescue wants to remind people that the recent cold weather has created a danger we

havenâ&#x20AC;&#x2122;t seen in the last four seasons. Although beautiful to look at, the frozen ponds and rivers in our area hold a hidden danger. The temptation to walk and play on the ice can result in tragedy. It requires several days of

below freezing weather before ice is safe to walk or play on. Authorities claim it requires 2â&#x20AC;? of solid ice to support the weight of an average person and at least 3â&#x20AC;? before you should venture onto the ice. Many factors can

Have You Heardâ&#x20AC;Ś

increase or decrease this number. Is the ice new ice or has it gone through temperature changes? Has snow accumulated on the ice which tends to insulate and warm the ice? How large is the body of water that the ice cov-

Pre-Season

&2%% Air Conditioner with the purchase of a high efficient system

With MM coupon. Value not to exceed $2000. Not valid on previous purchase. Not valid for cash. Offer expires 3/31/14

Pre-Season

Advantage Plan Membership

/&& Weâ&#x20AC;&#x2122;re Having a Pre-Season Sale! 703-822-5555 540-227-8243 540-227-8128 !IRE3ERVCOM

1UALITY for Less

With MM coupon. Regular $110 per system, includes 2 seasonal tune-ups and safety inspections, 15% member discount on repairs and priority service. Not valid on previous purchase. Offer expires 3/31/14

Pre-Season

Air Purification Sale

/&& Indoor Air Quality Products

7E3ER VICE!LL"RANDSs&AMILY/WNED/PERATED

With MM coupon. Cannot be combined with any other offer. Expires 3/31/14

Did you know that your air conditioning and heating unit uses as much as half of your energy cost? If your unit is over 10 years old a more efficient unit will often save you money in the long run.

FREE

Wi-Fi Enabled Thermostat

With the Purchase of a NEW System ($629 Value)

703-822-5555 540-227-8128 AireServ.com

24 Months 0% Interest

540-227-8243 540-227-8128

703-822-5555

540-227-8243 540-227-8128

703-822-5555

It is not valid with any other offer, or on a previous purchase. The coupon must be presented to receive the discount. Expires 5/31/13.

It is not valid with any other offer, or on a previous purchase. The coupon must be presented to receive the discount. Expires 5/31/13.

Enjoy Peace of Mind â&#x20AC;&#x201C; GUARANTEED! Guarantees

Our Exclusive Written Guarantees Are Designed To Protect You And Your Home â&#x20AC;&#x201C; Make Sure to Read Guarantee on Certificate for Details. Applies to any heating or cooling components replaced.

Performance Guarantee

We guarantee that your system will heat and cool your home to our design temperatures, or we will correct it at no cost to you.

Satisfaction Guarantee

If you are not completely satisfied with your new system at any time during the first 12 months, we will make any changes necessary or REPLACE it with a system of equal value, at no cost to you.

System Assurance Guarantee

ers? Is the water moving under the ice? Is the ice being supported by water or has the water level dropped leaving an air space under the ice? All of these things are factors which affect the strength and load carrying capacity of the ice. Parents need to educate their children about the dangers of ice, especially in areas like the Shenandoah Valley which go through extreme temperature changes day by day. Ice which may have been safe yesterday may become weak overnight. If someone fails through the ice, hypothermia can set in very quickly. It is very difficult for someone to pull themselves back onto the ice after falling through. If they fall through the ice in a river, chances are they will be pushed downstream and under the ice with no chance of escape. If you see a person or animal that has fallen through the ice, do not attempt to venture onto the ice to rescue them. The ice is even weaker once someone has fallen through and chances of going through the ice increase for the rescuer. Call 911 and await rescuers that have the proper equipment, training and protection to attempt a rescue. Witnesses can attempt rescue from the shoreline using ropes, ladders, etc. to extend their reach to the victim, but at no time should they venture onto the ice. If you find yourself on ice that is weak, you should lie down and spread your weight over a large area. Stay still if possible and await help. If no help is available, gently move back to the shoreline staying in a position to spread your weight over a large area. Warm weather will soon be upon us and ice will no longer be a problem. As tempting as it is, stay off the ice and enjoy the snow and cold weather! For more information, please call Fire Administration at 540-636-3830 for George Lewis, FF/EMT, member Special Operations Team, to request additional information and ice safety tips. .

PASSAGE MANOR FARMS +RUVH%RDUGLQJ Field Board $200 Full Board $450

Â&#x2021;Trails Â&#x2021;5LGLQJ5LQJ Â&#x2021;5RXQG3HQ

Unlike guarantees from other companies, our Full Coverage Guarantee covers EVERY component of the installation, not just the equipment.

No Quibble Guarantee

When we tell you that everything necessary for the correct installation of your system is included, we mean it. AND if we forget a necessary component, we include it at no cost to you. To advertise in your local Money Mailer call 703-565-6870.

Call Susie Poe

540-974-1484


Page 24 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com â&#x20AC;˘ 540-683-9197

Community

Humane Society makes case for county funding increase By Roger Bianchini Warren County Report At a Jan. 28 Warren County Board of Supervisors work session delayed a week by snow and ice, Humane Society of Warren County officials presented their case for additional funding for the societyâ&#x20AC;&#x2122;s Julia Wagner Animal Shelter and related operations. Annual operational statistics presented as part of our PAWgress Report from the shelter were part of the presentation. The short version of what the supervisors heard is that despite operational reorganization, the society, the shelter and its staff remain stretched precariously thin financially for the amount of services required by the stray and abandoned animal problems in Warren County. â&#x20AC;&#x153;Doug, we have done everything we can to make the HSWC operate efficiently, however, we continue to lose money each month. The bottom line is we need the County to step up and fund our operation on an appropriate level. If not, itâ&#x20AC;&#x2122;s only a matter of time where we will have to turn the operation over to the County,â&#x20AC;? HSWC Board President Denise Eastham wrote County Administrator Doug Stanley in a letter included in the work session packet. The county already funds the sheriff departmentâ&#x20AC;&#x2122;s animal control department, which works in close tandem with the shelter and its staff. In 2013, the county spent $522,962 on its in-house Animal Control Budget. And while we consider the animal control budget money well spent, we will note that as far as we understand, WCSO Animal Control is primarily responsible for pick up and drop off of strays and other problem animals, not other variables like long-term care and/or disposal. Stanley observed that county ownership of the shelter would bring its own additional cost variables into play, leading to what amount as â&#x20AC;&#x153;a pushâ&#x20AC;? on county costs â&#x20AC;&#x201C; â&#x20AC;&#x153;Employees do cost one way or the other,â&#x20AC;? he observed. Eastham also noted that shelter staff continued to work without benefits.

PINOCCIOS CLOCK REPAIR Â&#x2039;(\[OVYPaLK:LY]PJL Ĺś$XWKRUL]HG6HUYLFH &HQWHUIRU+RZDUG0LOOHU *LU[LYMVY/V^HYK4PSSLY 6OLJK Â&#x2039;3PJLUZLKHUK0UZ\YLK Ĺś/LFHQVHGDQG,QVXUHG Â&#x2039;/V\ZL*HSSZ(]HPSHISL Ĺś+RXVH&DOOV$YDLODEOH Â&#x2039;(U[PX\LVY4VKLYU Ĺś$QWLTXHRU0RGHUQ Â&#x2039;:LY]PUN[OL=HSSL`MVY Ĺś6HUYLQJWKHYDOOH\IRU V]LY`LHYZ RYHU\HDUV

Warren County budgeted $211,136 to the HSWCâ&#x20AC;&#x2122;s Julia Wagner Animal Shelter last year. In comparison to the local Wagner Shelter with a pet population of 2,035, Frederick County and its shelter pet population of 3,832 has a total county shelter budget of $508,000. Loudoun County with a pet population of 2,094 just 50 more animals annually than the Wagner Shelter had in 2013, has a shelter budget of $1.37 million. The threat of additional county responsibility for the operation, detail of those operations and comparative numbers and funding of surrounding communities seemed to get the

county boardâ&#x20AC;&#x2122;s attention. â&#x20AC;&#x153;With your allâ&#x20AC;&#x2122;s reorganization and tidying up and doing all the right things â&#x20AC;&#x201C; now perhaps, is the time for us to step to the plate and do what we can,â&#x20AC;? Fork District Supervisor Archie Fox commented. Warren Countyâ&#x20AC;&#x2122;s arrangement with the local humane society and its shelter is complicated by the fact it is a private entity with a private trust that also utilizes public fundraising to help finance operations that are contracted by the county. However, as HSWC official have explained in the past, for various reasons tied to previous administration, events and

HU, A Love Song to God A free presentation for the community Singing HU can: Help you experience divine love Offer solace during times of grief Bring peace and calm

For More Information See Our Website www.eckankar.org Virginia Satsang Society, a Chartered Affiliate of Eckankar

YLWHPY'WPUVJJPVZJSVJRYLWHPYUL[ www.pinocciosclockrepair.net

a discount spay/neuter program. County Board Chairman Dan Murray observed that pet ownership was â&#x20AC;&#x153;a personal choiceâ&#x20AC;? with certain assumed responsibilities, and said he didnâ&#x20AC;&#x2122;t believe pet owners would mind a 50-cent to one dollar tag increase. Of course experience in the real world indicates many peopleâ&#x20AC;&#x2122;s â&#x20AC;&#x153;assumed responsibilitiesâ&#x20AC;? of pet ownership are a far cry from what others might considerate minimally adequate or even humane. â&#x20AC;&#x201C; rogerb@warrencountyreport.com

Financial Solutions with a Smile and a Handshake Janet E Davidson, AAMSÂŽ Financial Advisor .

101-2 Hyde Court Stephens City, VA 22655 540-869-1843

www.edwardjones.com

Warren County

Parks and Recreation Department -- Now Accepting Registration --

Get the Best

for Your Money

Service. Value. Trust. We deliver thatâ&#x20AC;&#x201D;and then some. Savings up to 30%* when you place your home, auto and life coverage with us. Benefits like first accident forgiveness and the expert advice of a trusted agent. Joseph McGreevy McGreevy Insurance Agency Inc 986A John Marshall Hwy Front Royal, VA 22630-4518 Fax: 540-635-3291

540-635-3107

 Â&#x2039; 

(540) 636-7369 >:[-YVU[9V`HS

expenditures, revenue from the trust has become somewhat depleted over the years. And, they noted fundraising is increasingly difficult in the ongoing recessionary economy, though they lauded the community for the support they do provide. Happy Creek Supervisor Tony Carter suggested consideration of raising the dog licensing fee by about a dollar. Discussion of implementing a cat licensing fee was also broached. Humane Society staff noted problems with citizens who refuse to spay or neuter pets and repeatedly drop off new litters at the shelter. It was suggested tying a cat licensing fee to

S944c Not all companies are licensed or operate in all states. Not all products are offered in all states. Go to erieinsurance.com for company licensure and territory information. *Savings vary by state and policyholder.

Gymnastics Classes Will be held Saturdays March 22nd through May 10th WC Health & Human Services Complex Gym

Boys & Girls currently 4 years of age and older Various levels and times available 20 participants per class $82/participant includes uniform

Registration deadline: March 7th No registrations will be accepted after March 7, 2014 regardless of class size

Registrations are only being accepted at the Warren County Community Center, 538 Villa Ave. Front Royal, VA

For more information call 540-635-1021


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com • 540-683-9197 or Alison at alisond@warrencountyreport.com • 540-551-2072

Mid February, 2014 • Warren & Frederick County Report • Page 25

Community

Humane Society of Warren County 2013 Annual Report During 2013, the Humane Society of Warren County continued to advance our life saving efforts. We, once again, celebrated record breaking adoptions in both our cat and dog departments. 515 cat adoptions and 423 dog adoptions make 2013 our best adoption year ever. We rely on adoptions to save lives and if you are one of our heroes who adopted in 2013, we thank you. Over 97% of dogs, 55% of cats and 94% of ‘other’ animals were reclaimed, adopted or transferred to rescue. In 2013, we were able to supplement our county funding and raise over $150,000 to support our efforts to become a no kill facility. We established profitable fundraisers, were awarded grants, and founded a large donor campaign in an effort to sustain the good works being done at HSWC. Even with all of that work, we still fell a little short of our financial goals but already in 2014 we are working with Warren County to close that gap. We’ve never let a bleak financial forecast deter us from saving the lives of the animals we love so much. In 2014 we’ve outlined 11 steps that will help us to increase our live release rates:

2014 HSWC Program Goals

1. Make spay/neuter procedures easy and affordable. 2. Increase transfers to rescues 3. Grow foster parent program 4. Make adoption affordable and easy 5. Reduce the number of pets being surrendered 6. Enhance medical/behavioral programs 7. Develop public relations/communication plan 8. Utilize more volunteers 9. Increase reclaims of lost pets 10. Research TNR/Community Cat programs 11. Ensure compassionate leadership We have several action steps outlined under each of these eleven goals and we’ve wasted no time in getting started. We are excited to see where the Humane Society of Warren County is headed in 2014. One thing for sure, we will continue to advocate on behalf of the homeless animals of Warren County. We know we are their voice. Onward & Upward, Lavenda Denney, Executive Director


Page 26 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com â&#x20AC;˘ 540-683-9197

Briefs Curb and gutter installation (weather permitting)

Environmental Services (540)6357819

On Tuesday, February 18, a contractor for the Town of Front Royal will have the westbound lane on John Marshall Highway CLOSED from Richmond Road to Jamestown Road for curb and gutter installation. The same contractor will also be installing curb and gutter on W 16th Street from Hillcrest Street to Hillcrest St. The work will be from 8 am to 5 pm. Motorists are asked to please use caution in these areas. More Information: Department of Environmental Services (540)6357819

Front Royal holiday closing

Sewer line installation (weather permitting) Through the next several weeks a contractor from the Town of Front Royal will be working on Fletcher Street to install a sewer line. The work has begun and will continue Monday â&#x20AC;&#x201C; Friday from 7:00a â&#x20AC;&#x201C; 5:00pm. No services will be interrupted without prior 24-hour notice to the customers. Motorists are asked to use caution in this area. More Information: Department of

The Town of Front Royal Business Offices will be CLOSED on Monday, February 17, 2014 in observance of Presidentâ&#x20AC;&#x2122;s Day. Garbage/Recycling for Monday will be collected on Wednesday, February 19, 2014. More Information: Department of Environmental Services at (540)6357819

Effort to combat nasty stink bugs to continue Watch out stink bugs, Congress has directed the Department of Agriculture (USDA) and the EPA to ramp up its efforts to deal with the nasty pests. Rep. Frank Wolf, who has championed efforts to find a way to deal with stink bugs not only because of their stench but because of the havoc they wreak on crops â&#x20AC;&#x201C; including apples, peaches and grapes â&#x20AC;&#x201C; said there is language in the recently approved 2014 Omnibus spending bill to continue to prioritize stink bug control research at USDA.

Registration Dates:

All signups will be held at the Warren &RXQW\3DUNVDQG5HF2IĂ&#x20AC;FH 538 Villa Ave., Front Royal, VA

District IX

Ages 13-18 Registration fee $75

Warren County Babe Ruth League Front Royal, VA

Tuesdays Feb. 11th, 18th & 25th Wednesdays Feb. 12th, 19th & 26th Tues. March 4th

6:00 â&#x20AC;&#x201C; 8:00

Saturdays Feb. 8th, 15th & 22nd

11:00 â&#x20AC;&#x201C; 2:00

2ULJLQDOELUWKFHUWLĂ&#x20AC;FDWHDQGWZR proofs of residency will be required

Valley Needleworks 0DLQ6WUHHWÂ&#x2021;0LGGOHWRZQ9$ Your LOCAL Cross Stitch Supply Shop

Incredible selection of Threads & Fibers, Embellishments, Stitchables, Felted Wool, Supplies, Exceptional Service

³5LQJLQJLQWKH1HZ<HDU6DOH´ January 21st to February 8th a2))(9(57+,1*a *Frequent Buyer Cards will not be redeemable during the sale. Thank you!*

We look forward to assisting you! ~ Denise, Karen, & Jennifer

Wolf has worked to include similar language in past spending bills. The new language is part of a five-year plan to find a solution to the problem. He said the bill requires USDAâ&#x20AC;&#x2122;s Animal and Plant Health Inspection Service to help states implement biological control technology to minimize the pests once it is developed and directs EPA to quickly approve any recommendation so products can be sold on the open market. â&#x20AC;&#x153;Whether you have a home herb garden or acres of farm land, we can all agree that the pervasive problem of stink bug infestation needs to be tackled head-on,â&#x20AC;? Wolf said. â&#x20AC;&#x153;These pests are an annoyance that not only affect everyday life in peopleâ&#x20AC;&#x2122;s homes, but also vital American industries that have a broader impact on the economy. â&#x20AC;&#x153;The apple industry in the midAtlantic states has lost tens of millions of dollars to these pests. They threaten the vineyards that are an important part of Virginiaâ&#x20AC;&#x2122;s economy. Peaches, soybeans, corn, raspberries, maples and ornamental plants also are affected.â&#x20AC;? Native to China, the stink bug was first discovered in Allentown, Pennsylvania, in 1998. The pest has no natural predator in the United States and is reproducing at an increasingly rapid pace. It has already spread to 40 states, the District of Columbia and Ontario, Canada, which is 15 more states than when the committee first addressed this issue in 2011, Wolf said. USDA estimates that roughly $21 billion of crops could be at risk. In 2010, the last year that data was available, the stink bug caused over $37 million in damage to the apple crop in the mid-Atlantic states of Virginia, West Virginia, Maryland, and Pennsylvania. While many efforts have been made to combat this pest, it is estimated that this yearâ&#x20AC;&#x2122;s bug cycle will be 60 percent stronger than last See BRIEFS, 27

â&#x20AC;&#x153;NA Meetingsâ&#x20AC;? to begin February 8th from 1 - 4pm Visit website or call shop for details

Special â&#x20AC;&#x153;Stitch Nightâ&#x20AC;? )HEUXDU\WKÂ&#x2021;SP Preview New 2014 Nashville Items!

6KRS+RXUV

7XHVGD\6DWXUGD\Â&#x2021;DPSP (YHU\:HGÂł6WLWFK1LJKW´Â&#x2021;SPSP

ZZZYDOOH\QHHGOHZRUNVFRPÂ&#x2021;Â&#x2021;YDOOH\QHHGOHZRUNV#JPDLOFRP

â&#x20AC;&#x153;Always Be Stitchingâ&#x20AC;? ~ Jennifer Cave â&#x20AC;&#x201C; Owner & Needleworker

Engleâ&#x20AC;&#x2122;s Angle: The Key to Happiness

Donâ&#x20AC;&#x2122;t leave home without it :)

By Kevin S. Engle Warren County Report 1:30 Saturday afternoon. Give or take. My wife is gone and wonâ&#x20AC;&#x2122;t be back for an hour or two. Iâ&#x20AC;&#x2122;m in the garage emptying the Shop-VacÂŽ. Iâ&#x20AC;&#x2122;ve been using it to suck up stink bugs. I dump the dead little beasts in the garbage and clean crud off the filter before reassembling it. Iâ&#x20AC;&#x2122;ll wash it out in the laundry tub as well. I grab the door knob, turn and push. The door into the basement opens, but only about a quarter of an inch. I jiggle it back and forth several times and get the same result. Along with a sinking feeling in my gut. Iâ&#x20AC;&#x2122;m locked out. The cleaning crew must have accidentally locked it this morning. Of course I donâ&#x20AC;&#x2122;t have a key. Why would I? I donâ&#x20AC;&#x2122;t carry a house key unless Iâ&#x20AC;&#x2122;m leaving the house. My cell phone? Itâ&#x20AC;&#x2122;s upstairs. I stand there for a minute, considering my options, already knowing theyâ&#x20AC;&#x2122;re not good. I can go outside, but itâ&#x20AC;&#x2122;s winter time, and Iâ&#x20AC;&#x2122;m not dressed for it. I could bust open the door, or try, but that doesnâ&#x20AC;&#x2122;t sound so good. No doubt Iâ&#x20AC;&#x2122;d hurt myself in the process and end up with a broken door, along with an angry wife. Scratch that. I try picking the lock. Letâ&#x20AC;&#x2122;s just say I wouldnâ&#x20AC;&#x2122;t make a good crook. I check the front door to confirm what I already know. Iâ&#x20AC;&#x2122;d feel pretty stupid if I discovered later it was unlocked. Even more stupid than I feel right now. And like a cold winter wind slapping me across the face, reality sets in. Iâ&#x20AC;&#x2122;m trapped. In my garage. Ok, I accept my situation. How can I make the best of it? Isnâ&#x20AC;&#x2122;t that what youâ&#x20AC;&#x2122;re supposed to do in times like these? Since Iâ&#x20AC;&#x2122;m in the garage, I could organize the garage, a chore I always put off for one reason or another. Just like Iâ&#x20AC;&#x2122;m going to today. I crush a few soda cans and drop them in the recycling bin, along with some cardboard. I root around in the old newspaper stack and find something to read. After several minutes of staring at two nearly

identical photos trying to find the 12 differences between them, I give up. I only found one and I have more pressing things on my mind at the moment. Like a full bladder thatâ&#x20AC;&#x2122;s making it hard to focus on anything else. I could take care of that outside, in the woods, but with no leaves on the trees, my neighbors would have a front row seat. Iâ&#x20AC;&#x2122;m a modest guy. Iâ&#x20AC;&#x2122;ll hold it. For now. I open the door to my car and climb in. I recline the seat and shut my eyes. I havenâ&#x20AC;&#x2122;t had my nap yet today. This seems like as good a time as any. I hear the dishwasher running in the kitchen above me and the radio playing in the basement. I check the clock. My wife wonâ&#x20AC;&#x2122;t be here for at least another hour. Iâ&#x20AC;&#x2122;d asked her to stop at the store and pick up some bandages. I hope she forgets. All I want right now is to see her red car in the driveway. As Iâ&#x20AC;&#x2122;m lying there, I think about what I can do to make sure this never happens again, like hiding a key outside. Weâ&#x20AC;&#x2122;ve talked about it for years but havenâ&#x20AC;&#x2122;t done it. That was smart. Another thought crosses my mind. What if Judy doesnâ&#x20AC;&#x2122;t have her house keys with her? Sometimes she doesnâ&#x20AC;&#x2122;t take both sets of car keys. Nah, sheâ&#x20AC;&#x2122;ll have them. I nod off, but wake up every 10 or 15 minutes. My toes are getting cold and so am I. Iâ&#x20AC;&#x2122;m thinking more seriously about a trip to the woods to care of some business. I hear the phone ring and the voice of Caller ID. â&#x20AC;&#x153;Virginia call.â&#x20AC;? Iâ&#x20AC;&#x2122;d bet a pack of toe warmers thatâ&#x20AC;&#x2122;s her telling me sheâ&#x20AC;&#x2122;s on her way. Fifteen minutes later, I see her beautiful red car coming up the driveway. Thank God. Iâ&#x20AC;&#x2122;ve been stuck here for an hour and 45 minutes. A great way to spend my Saturday afternoon. â&#x20AC;&#x153;What are you doing?â&#x20AC;? she asks when she sees me get out of the car. I tell her my predicament, including the part about my pressing matters. â&#x20AC;&#x153;You have your house keys donâ&#x20AC;&#x2122;t you?â&#x20AC;? She hesitated, and I got that sinking feeling again. â&#x20AC;&#x153;Here they are,â&#x20AC;? she said as she pulled them out of her backpack. I almost cried. Iâ&#x20AC;&#x2122;ve never been so happy to see a bathroom. For Mr. Engle, the true key to happiness is just that. A key. â&#x20AC;&#x201C; kevinengle456@comcast.net


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 • Warren & Frederick County Report • Page 27

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com • 540-683-9197 or Alison at alisond@warrencountyreport.com • 540-551-2072 BRIEFS, from 26 year’s. The stink bug has been called the number one economic threat to cotton in Alabama and Georgia, and is now causing significant damage to crops in Oregon and Washington. Earlier this month, U.S. Customs and Board Patrol reported that a new kind of stink bug was discovered on a shipment of Mexican basil at San Francisco International Airport - the first time this species has been found in the Bay Area For more on Wolf ’s efforts on stink bugs, visit http://wolf.house.gov/issues/stink-bugs

Basketball The Warren County Parks and Recreation Department, in conjunction with Skyline High School, will be sponsoring the Hawks Developmental Basketball sessions for boys and girls currently in 1st through 5th grade, at Ressie Jeffries Elementary School gym, Wednesdays, April 2 – April 30, 2014, 3:30pm - 5:00pm. Cost is $10.00 per session or $45.00 for entire program if paid in advance. For more information contact Jim Kenney via email at jkenney@wcps. k12.va.us. Registration forms are available

Office Space for Rent in Bentonville In Post Office Complex Beside Buracker Construction Office

2 Office Rooms, 1 Bathroom, 1 Large Storage Room Rent includes electric, HVAC & High Speed Internet

$600 per month, 1 year lease Available February 1, 2014

Call Martha Buracker @ 636-1879 or email buracker@comcast.net

Middletown residents complain about overnight parking

By Sue Golden Middletown residents are once again complaining about trucks parking overnight near the Liberty gas station in Middletown. In addition to the noise created by the trucks running all night, residents say that syringes, ladies’ underwear and bags of feces are found in the lot. The dirt lot, which is to the east of the gas station, and owned by the Holtzman Corporation, was blocked with barriers that also

were posted with no trespassing signs. Recently, the barriers were removed and the posted signs were not replaced. Since the barriers were removed, trucks have been parking in the lot overnight. According to Middletown Police Chief R. Phillip Breeden, the town government knows of the problem and is working to find a solution. Historically, the Middletown police patrolled the area. There is no overnight parking allowed in Middletown by town ordinance. However, because the lot is not posted, the police department’s hands are tied. Trucks are allowed to park in the lot, so long as they do not spend the night. There is no town ordinance regarding the former barriers, so the corporation was within its rights to remove them. Middletown zoning administrator Fred Wharton agreed with Chief Breeden. He suggested that anyone having complaints regarding activities in the parking lot should contact the Middletown police department. Chief Breeden said he is working with the town council and the Holtzman Corporation to find a remedy. Eventually, the site will most likely be developed. The Holtzman Corporation and Liberty management were contacted in reference to this article. None returned a phone call.

Briefs

at the Warren County Community Center, 538 Villa Ave. Front Royal, and the Warren County Parks and Recreation Department, 200 E. 8th Street, Front Royal.

one unit of blood donated can help support up to three For details and location specifics for the Broadcaster’s for Blood drive, visit www.vablood.org.

Broadcasters join forces to support local lives

Goodlatte launches House App Contest

As the sole provider for Valley Health Systems, UVA Medical Center, and other area hospitals, Virginia Blood Services is partnering with local broadcasters to host a community blood drive on March 3rd from 11 AM to 7 PM that supports area patients in our local hospitals. Virginia Blood Services needs 400 donations a day in order to meet the needs of the hospitals they serve. This event will involve live remotes from Clear Channel Media and Centennial Broadcasting groups, as well as free food and lots of prizes as they rally to bring out the community and help support local lives. This year is exceptionally notable, as it marks Virginia Blood Services 40th year anniversary. “Our broadcaster events are always so exciting,” states Michelle Westbay, Marketing Communications Lead for Virginia Blood Services. “It gives the community the opportunity to meet their favorite radiopersonalities, and enjoy a fun and inviting atmosphere. Our media partners are unbelievable and passionate for our cause.” According to Westbay, many first time donors attend these events because of the inviting nature and free food and prizes. It is important for donors to come to the event hydrated and in good health. The actual blood donation process takes about ten minutes; however, from the time you register to the time you leave takes about an hour. In that one hour, that

Sixth District high school students invited to participate WASHINGTON, D.C. – Congressman Bob Goodlatte released the following statement today inviting all high school students from the Sixth Congressional District of Virginia to participate in the first annual Congressional Science, Technology, Engineering and Math (STEM) Academic Competition, or “The House App Contest.” Congressman Goodlatte is co-chair of the nationwide contest that allows high school students from across the country to compete by creating and exhibiting their software application, or “app,” for mobile, tablet, or computer devices on a platform of their choice. “The demand for students educated in engineering and technology continues to rise in the United States, but part of the challenge is how to engage students in these subjects and further their understanding of these valuable skills. The House App Contest provides students with the opportunity to showcase their technology skills and learn more about STEM fields. Participating students will design and develop a working app, or design and mock up an app, for mobile, tablet, or computer devices. “The House App Contest is a great opportunity to promote the STEM fields that are driving American innovation. I know that we have many students in the Sixth District who excel in these fields, and I look forward to their contest submissions.” For more information on the Sixth District House App Contest, please visit http://goodlatte.house.gov/pages/appcontest Interested students

+21(<%(( Home Décor and More

<PM;]KKM[[aW]¼^MJMMV[MIZKPQVO NWZQ[IXPWVMKITTI_Ia

$20 OFF your first lesson!

when you sign up for one month of lessons (discount applies w/ coupon)

BUZZ on in for one of a kind homespun gifts, art, jewelry, primitive country décor & so much more! Store Hours Tues. - Sat. 10 - 6 Sun. 12 - 5

110 N. Massanutten St., Strasburg

540-465-1414

and educators may also contact Congressman Goodlatte’s Washington, D.C. office at 202-225-5431 with any questions. The contest deadline is April 30, 2014. Students entering the competition must submit a video that features either a demonstration of a working app or an in-depth analysis of the concept/design of the app. This video must also explain their app and what they learned through this competition process. The winning student’s app in each participating congressional district will be featured on the U.S. House of Representatives’ website http://www. house.gov/ as well as on display in a U.S. Capitol exhibit.

February programs at Samuels Public Library in Front Royal Here at SPL we hope you are having a great new year. For our February activities we are particularly looking forward to our program “Called Again: An Afternoon with 2012 National Geographic Adventurer of the Year Jennifer Pharr Davis,” where she will be speaking about her journey through the Appalachian, giving advice, taking questions, as well as signing her books. • English as a Second Language – Tuesdays and Thursdays at 10:00 a.m. – This class is for anyone who wants to learn English. • Wired Wednesday – Wednesdays at 10:00 a.m. - Join us for a computer club where we talk about a new topic every week. Bring your questions! This month’s topics are comprised of: test prep and career tools, blogging, Genealogy, and using Youtube for beginners. • Evening English Class – Class begins on February 6, and continue every Thursday 5:30-7 p.m. a - Samuels Public Library invites you to register for the new evening course of English as a Second Language, taught by Ms. Von Fange! • Crocheting with Plarn – Friday, February 7 at 10:30 a.m. - Try something new! Susan Keel will teach how to crochet using plarn (plastic yarn). See BRIEFS, 31

Tired of Rising Heating Costs? Outdoor Wood Furnace

100% Wood Heat for your home, water, shop

540-722-8005

Arnette Landscapes, Inc. Winchester, VA


Page 28 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com â&#x20AC;˘ 540-683-9197

Virginia

Bolling adds voice to call for Medicaid expansion in VA Former Republican lieutenant governor criticizes House stalling tactics By Roger Bianchini Warren County Report Non-partisan grassroots Virginia Organizing issued a Jan. 30 statement lauding former Lt. Governor Bill Bolling for his support of Medicaid expansion in Virginia. The Virginia Organizing press release was issued on the heels of an â&#x20AC;&#x153;Opinionâ&#x20AC;? piece Bolling wrote for one of the stateâ&#x20AC;&#x2122;s major newspapers, the Tidewater area Virginia-Pilot, earlier that week. In that Op-Ed Bolling urged realism in dealing with new health care

laws and urged his fellow Republicans in the Virginia House of Delegates to stop partisan delaying tactics so that Virginia citizens can join in benefitting from health care coverage made available by the new law. It has been estimated that 400,000 Virginians would become eligible for additional discounts in health care coverage through the Affordable Care Act if Virginia would opt into Medicaid Expansion. In a controversial anti-federal authority decision, the U.S. Supreme Court ruled that states could opt out

A Day at Clemâ&#x20AC;&#x2122;s Garage

of federally-expanded Medicaid coverage, a key aspect in making maximum discounts available through the Affordable Care Act. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m no fan of Obamacare, but it is the law and over the next 10 years Virginia families and businesses will be required to pay $26 billion to finance the Affordable Care Act. Medicaid expansion is the only way we can return any of this money to Virginia,â&#x20AC;? Bolling wrote in his Virginia-Pilot Opinion piece. â&#x20AC;&#x153;While we certainly need to insist on continued reforms to make Medicaid more ef-

By Doug Dellinger

Clemâ&#x20AC;&#x2122;s

ficient and affordable, we must find common ground to enable thousands of uninsured families in Virginia to gain greater access to quality health care.â&#x20AC;? In spite of Bollingâ&#x20AC;&#x2122;s urging, others Republicans in Virginia House of Delegates announced a plan to audit the Medicaid system for two years before even considering adoption of the expanded Medicaid coverage for Virginia. One might ask why those same Republicans donâ&#x20AC;&#x2122;t urge similar caution before offering corporate tax breaks diverting what would be public funds for the benefit of all Virginians into donations to private schools with specific conservative social agendas. â&#x20AC;&#x153;This audit proposal is just a delay tactic by the House Leadership to keep expansion from moving forward,â&#x20AC;? Virginia Organizing State Chairperson Sandra Cook said of the two-year audit plan. â&#x20AC;&#x153;Thousands of Virginia families simply cannot afford to wait another two days, much less two years, for affordable health coverage. We applaud former Lt. Governor Bill Bolling for his stance, and we call on Speaker Howell, Delegate Jones, and Delegate Landes to stop this latest effort to delay expan-

Garage

sion once again.â&#x20AC;? In its press release, Virginia Organizing said that in addition to the expanded health care coverage for 400,000 Virginians, state acceptance of Medicaid Expansion would create 30,000 jobs and as much as $1 billion in revenue savings to the commonwealth over the next nine years.

Come play the best 9 hole course in the Valley! Conveniently located just off I-66 in the beautiful Shenandoah Valley!

New Weekday Afternoon Golf Rate $12 w/o cart â&#x20AC;˘ $22 w/ cart 18 holes including green fees. Monday through Friday after 3:00pm Warren County residents receive a 10% discount on greens and cart fees. Bring your driverâ&#x20AC;&#x2122;s license or other proof of residency for discount.

Call for more information

(540) 636-9061

www.warrencountyva.net

0DLQ6WUHHWÂ&#x2021;)URQW5R\DO9$

Showtimes: 622-9997

www.royal-cinemas.com * Birthday Parties! * Now Showing

5170 Main St. Stephens City 540-869-1595

Downtownâ&#x20AC;&#x2122;s Favorite Live Music Venue

Feb. 7 - Bugsy Cline Feb. 8 - The Men From Nantucket Feb. 10 - Ralph Fortune Feb. 11 - Tim Walls Feb. 12 - Jay Powell Feb. 13 - The Good, The Bad & The Blues Feb. 14 - SOL Circus Feb. 15 - TBA Feb. 17 - Ralph Fortune Feb. 18 - Tim Walls Feb. 19 - Rooster Johnson Feb. 20 - Grass Fed Feb. 21 - Knob Creek

SIC LIVE MUIGHT! EVERY N

LUCKY St r l o u n g e

Check Out Our NEW

WINTER MENU!

Open

Mon. - Fri. at 11am Sat. at 1pm Daily Lunch & Dinner Specials

Mmmm... Comfort Foods Have you tried our homemade desserts? Yum...

Lucky Star voted

INFO@luckystarlounge.us

www.luckystarlounge.us

WE CATER!

www.facebook.com/luckystarlounge

$15 per person Unlimited bowling including shoes. Come out & play in the dark! 'SJEBZ4BUVSEBZtQNoBN

RENT-A-LANE $15

Sun. 10am - Noon 2 HOURS UNLIMITED Bowling Up to 8 people per lane!

Monday Dollar Day $

Best Live Music Venue in the Shenandoah Valley!

The LEGO Movie

1

#

Shop LOCAL! FRIBA IBuyWarren.com

540-635-5297

205-A E. Main Street, Front Royal

1

Games! Shoes! Hot Dogs! Small Drinks! Fries!

Plan Your Party with US!! Lanes available MOST days & times!

Call ahead for details! 430 Remount Rd.

540-636-3113

royalfamilybowl.com

Now Showing The Monuments Men

Coming Soon! ROBOCOP


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Page 29

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com â&#x20AC;˘ 540-683-9197 or Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072

Virginia

John and Mark Warner - more in common than a name John Warner crosses party lines to endorse Mark Warner for Senate By Roger Bianchini Warren County Report

Maybe my prediction the Republican Party will divide on ideological grounds before the 2016 presidential election will come true. After all, the GOP presented four separate voices (Tea Party, libertarian, token ethnic/ right-wing Cuban, and some lady in her living room) to respond to President Obamaâ&#x20AC;&#x2122;s 2014 State of the Union address, rather than the normal one. And in another indicator of the increasing divide between respected,

OPEN FOR TANNING! available NOW ON

DVD

New Releases!

'SFF#JSET &TDBQF1MBO %BMMBT#VZFST $MVC #BHHBHF$MBJN "CPVU5JNF  $BQUBJO1IJMMJQT 5IF#VUMFS  5IF-POF3BOHFS %FTQJDBCMF.F 'BTU'VSJPVT *OTJEJPVT 1SJTPOFST  &MZTJVN ,JDL"TT 1FSDZ+BDLTPO4FB PG.POTUFST 5IF'BNJMZ 4NVSGT .PSUBM*OTUSVNFOUT$JUZPG#POFT  5IF)FBU 8PMWFSJOF (FUBXBZ 1MBOFT  8PSMET&OE (VOT 8FSFUIF.JMMFST  5VSCP 3*1% 3FE .BOPG4UFFM

HUGE DVD

SALE

10 for $29

VHS SALE!

25 for $20

Shenandoah VIDEO & TAN

4PVUI4U'SPOU3PZBMt &,JOH4U4USBTCVSHt 83FTFSWPJS3E8PPETUPDLt

Shenandoahvideo.formovies.com

traditional Republicans willing to work with Democrats for the good of all their constituents and the new breed obstructionist, anti-government lunatic fringe that are increasingly the face of the new Republican Party, former Virginia Republican Senator John Warner has endorsed his successor, Democrat Mark Warner (no relation) in the younger Warnerâ&#x20AC;&#x2122;s run for re-election to the U.S. Senate seat the elder Warner used to hold. And while some may be shocked to hear this news, we werenâ&#x20AC;&#x2122;t. We always found John Warner to be an honest Republican politician with the best interests of his constituents â&#x20AC;&#x201C; all the people of Virginia and the nation â&#x20AC;&#x201C; at heart. And Warner the elder actually made me laugh out loud at an event at county Republican and state Delegate Andy Guestâ&#x20AC;&#x2122;s farm back in my early reporting days (circa early 1990s). In fact, maybe I can get an okay from John to finally repeat that story I overheard him telling Guest about his ex-wife, Liz Taylor â&#x20AC;&#x201C; John, remember the one? Come on, she wouldnâ&#x20AC;&#x2122;t even dispute it, probably, by now â&#x20AC;Ś really, come on â&#x20AC;Ś PLEAZZZ â&#x20AC;Ś But before we get sidetracked into a dissertation on Liz Taylorâ&#x20AC;&#x2122;s transgenerational beauty, talent and, well (it wasnâ&#x20AC;&#x2122;t a bad story, Liz â&#x20AC;&#x201C; REALLY), back to modern Virginia and national politics. â&#x20AC;&#x153;You see him crossing that aisle to try to form teams to solve problems â&#x20AC;&#x201C; thatâ&#x20AC;&#x2122;s so essential,â&#x20AC;? John Warner told The Associated Press in announcing his endorsement of Mark Warner. â&#x20AC;&#x153;There are times you must, I think, recognize that certain individuals are

superior in their talents and in what they have done and can potentially do for your state. Mark Warner, if I may say with a sense of humility, like John Warner crosses the aisle and makes things work. We come from the old school. The Senate works best when thereâ&#x20AC;&#x2122;s collaborative effort between the two parties.â&#x20AC;? Of his Republican predecessor in the Senateâ&#x20AC;&#x2122;s support, Sen. Mark Warner stated, â&#x20AC;&#x153;John Warner has been a role model as Iâ&#x20AC;&#x2122;ve worked across party lines to find common-sense solutions that strengthen Virginia, both during my term as Governor and now as a member of the Senate. I have followed John Warnerâ&#x20AC;&#x2122;s solid example by creating opportunities to reach across the aisle to solve problems. I have worked hard to form personal relationships with other lawmakers from both political parties to win bipartisan support for our efforts to fix the budget and strengthen Virginiaâ&#x20AC;&#x2122;s economy. I am very grateful for John Warnerâ&#x20AC;&#x2122;s public support, and respectful of our working partnership and personal friendship.â&#x20AC;? Former national GOP chairman (2003-05) Ed Gillespie announced earlier in January that he would seek the Republican nomination to challenge Mark Warner in the November 2014 election. Founder of a corporate strategies consulting firm, Gillespie was also a co-founder with Karl Rove of conservative fundraising and policy organization â&#x20AC;&#x153;Crossroads GPSâ&#x20AC;?. Gillespie was a counselor to President George W. Bush and an adviser to Mitt Romneyâ&#x20AC;&#x2122;s 2012 presidential campaign â&#x20AC;&#x201C; you remember â&#x20AC;&#x201C; â&#x20AC;&#x153;corporations are people, my friend.â&#x20AC;?

â&#x20AC;&#x153;Serving The Valley with High-tech Dentistry and Old-fashioned Serviceâ&#x20AC;?

Thomas Family Dentistry, PC

General Dentistry & Orthodontics

NEW LOCATION!

Less than 1 mile from I-81 Dr. Stephen J. Thomas DDS Dr. Kenneth J. Thomas DDS NEW PATIENTS WELCOME!

All Phases of Dentistry Including: â&#x20AC;˘ Cleanings And Exams â&#x20AC;˘ Invisalign â&#x20AC;˘ Orthodontics â&#x20AC;˘ Extractions â&#x20AC;˘ Partials And Dentures â&#x20AC;˘ Implants

Patient Friendly Payment Plans Available

HOURS: Mon. Wed. Thurs. 7am - 5pm Tues. 9 - 7 â&#x20AC;˘ Fri. 7 - 2 (every other)

See Our Website for Monthly Promotions

540-465-3980

The two Virginia Warners actually go back politically â&#x20AC;&#x201C; John defeated Mark in the younger Warnerâ&#x20AC;&#x2122;s first Senate campaign in 1996. At the time Mark Warner, a multi-millionaire cell phone pioneer, had only chairmanship of the Virginia Democratic Party in his political resume. However, during his state party chairmanship L. Douglas Wilder successfully campaigned to become the nationâ&#x20AC;&#x2122;s first black elected governor. (Democratic strategist attention getter # 1) And in that first individual political campaign Mark lost to John by only 5 percentage points. It was a surprisingly competitive first-time run against the popular former Secretary of the Navy and incumbent Republican Senator Warner, (Democratic strategist attention getter # 2) Mark Warner was elected governor of Virginia in 2001. He then thumped another eventual national Republican chairman and former Virginia governor, Jim Gilmore, for the Senate seat after John Warner retired in 2008. Virginia Democrats said of the elder and Republican Warner: â&#x20AC;&#x153;John

Nowâ&#x20AC;&#x2122;s the time to buy! Best Prices! Lowest Interest Rates! Your key to great homes at great prices with great financing

Contact me for availability of homes and land starting under $200,000 100% Financing for qualified first-time buyers

Hardwood Floors; Master Suite with deluxe bath; open floor plan; fireplace; deck.

540-551-2162

conniesmallwood@mris.com www.conniesmallwood.com

Connie Smallwood

Fall Loan Special

Borrow up To $3000

For 30 months at 3.00% and the approximate payment is $103.98 Rate subject to change without notice. Membership required. 4XDOLĂ&#x20AC;FDWLRQVDSSO\ $35 $QQXDO3HUFHQWDJH5DWH

For more information visit:

www.frontroyalfcu.org

540-635-7133

33820 Old Valley Pike (Rt. 11) â&#x20AC;˘ Strasburg, VA 22657

www.thomasfamilydentistry.com

Warner, a moderate, earned a reputation as a party maverick by bucking the conservatives who gradually won control of the GOP during his decades in office. He refused to endorse GOP home-schooling advocate Mike Farris for lieutenant governor and backed an independent candidate over Iran-Contra figure Oliver North in the 1994 race against Democratic Sen. Chuck Robb. But this is the first time he has endorsed a Democrat outright.â&#x20AC;? Way to go, John! Too bad more Republicans â&#x20AC;&#x201C; you know, the kind with personal integrity, common sense and more than their political and financial self interest at heart â&#x20AC;&#x201C; donâ&#x20AC;&#x2122;t step forward and make a similar stand against the â&#x20AC;&#x153;cranks and crazies who have taken over a part of the Republican Partyâ&#x20AC;? (2013 quote from Australian Treasurer Wayne Swan). But then maybe they will; I know theyâ&#x20AC;&#x2122;re out there â&#x20AC;&#x201C; but maybe theyâ&#x20AC;&#x2122;re afraid one of their party hardliners will throw them off the Capitol Rotunda balcony; just sayinâ&#x20AC;&#x2122; â&#x20AC;Ś

Federally insured by NCUA

230 N Royal Avenue, Front Royal 113 South Street, Front Royal


Page 30 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com â&#x20AC;˘ 540-683-9197

Calendar Friday, February 7 Forecast 41° | 27° 10:30am - 11:30am Crocheting with Plarn. Samuels Public Library, East Criser Road, Front Royal. Try something new! Susan Keel will teach how to crochet using plarn (plastic yarn). Un-cut grocery bags will be supplied at the library for those who have no Plarn. Come and enjoy this experience. 10:30am - 11:30am Heart attack signs and symptoms. Samuels Public Library, East Criser Road, Front Royal. This course will discuss the signs and symptoms of a heart attack as well as actions to take while experiencing and vital steps to survival while having a heart attack. 1:30pm - 2:30pm Education Committee. Chamber Office. 5pm - 7pm Chocolate Escape. Old Town, Winchester. Visit participating downtown restaurants to enjoy their $2 chocolate sampling menu. Shop at participating downtown stores to enjoy chocolate, promotions and events. First Friday Chocolate Escape in Winchester is also the perfect opportunity to shop for your Valentine or make your Valentineâ&#x20AC;&#x2122;s Day reservation. Saturday, February 8 Forecast 39° | 34° 10am - 12pm Middleburg Academy Open House. Middleburg Academy 35321 Notre Dame Lane Middleburg. Middleburg Academy invites area families to discover Loudoun Countyâ&#x20AC;&#x2122;s only independent, coeducational, grade 9 - 12 college preparatory school at an Admission Open House. Those who arrive at 10 a.m. will have the added opportunity of witnessing

BS

The Middleburg Hunt set out across the schoolâ&#x20AC;&#x2122;s beautiful and rolling acreage at a meet taking place on the campus that same morning. Questions regarding the Open House, the admissions process, or the school in general should be directed to Doug Goodman, Director of Admission, at dgoodman@middleburgacademy.org; (540) 687-5581. 10:10am - 11:10am Books and Barks. Samuels Library, Front Royal. Come to this extremely popular monthly program that gives developing readers the chance to read and relax with a trained therapy dog. For beginning readers and up. Please register. Sunday, February 9 Forecast 43° | 19° 2pm - 5pm World of Piano Series. Armstrong Concert Hall, Shenandoah University, Winchester. Jeremy Denk has established himself as one of Americaâ&#x20AC;&#x2122;s most thought provoking, multi-faceted, and compelling artists. Known also for his insightful writing on music. This concert will feature works by Beethoven and selected etudes by GyĂśrgy Ligeti, as heard on NPR. Concert at 3pm, pre-concert lecture at 2pm. Tel: (540) 665-4569. A series of 5 performances. 3pm - 5pm Magic Lantern Theater screens â&#x20AC;&#x153;Stories We Tellâ&#x20AC;?. Barns of Rose Hill, Chalmers Court, Berryville. This award-winning film explores the elusive nature of truth & memory in one familyâ&#x20AC;&#x2122;s history; the Washington Post calls it â&#x20AC;&#x153;masterful...a rich, sensitive, densely layered piece of poetic nonfiction.â&#x20AC;? Doors open thirty minutes early at both locations with

BUILDING, REMODELING & HANDYMAN SERVICE

Replacement Windows â&#x20AC;˘ Siding Decks & Porches â&#x20AC;˘ Roof Repair Additions Finished Basements â&#x20AC;˘ Fine Carpentry â&#x20AC;˘ Ceramic Tile Interior & Exterior Painting â&#x20AC;˘ Floor Covering Tree & Yard Work â&#x20AC;˘ Power Washing

Call Buck (540) 551-2673 #1 in Listings Sold for Weichert - VA, Maryland and DC

Beth Medved Waller Lead Agent & Owner Top Office Producer 2007-2013 #1 Agent in Sales & Sold Listings

5FBN8BMMFSQSPWJEFTJUTMPDBMDPNNVOJUZXJUIFEVDBUFE BOEFYQFSJFODFESFBMFTUBUFQSPGFTTJPOBMTXIPGPDVTPO WBMVF FYQFSUJTF BOESFTVMUTXIJMFNBJOUBJOJOH USVFSFMBUJPOTIJQTXJUIUIFJSDMJFOUT

+PJOVTJOEPJOHJUUIFWaller Way!

540-671-6145

824 John Marshall Hwy Front Royal, VA Licensed in Virginia

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

CFUI!UFBNXBMMFSDPNtXXX5FBN8BMMFSDPN Find my video on WarrenCountyVa.com keyword REALTOR

wine, snacks and other refreshments available. Admission is $8 (MLT/ MSV/ Barns Members: $5). For further info, link to www.magiclanterntheater.org, e-mailinfo@magiclanterntheater.org or call (540) 678-0963. Monday, February 10 4:30pm - 5:30pm Valentineâ&#x20AC;&#x2122;s Cupcake Decorating Class. Winchester Parks & Rec. Two classes are available: one for children ages 5-17 from 4:30-5:30 pm and one for adults (18+) from 7-9 pm. Children will have the opportunity to decorate six cupcakes and learn how to make special Valentineâ&#x20AC;&#x2122;s Day decorations and fondant cutouts. The kids get to share their creations with friends and family. Adults will learn how to make perfectly piped swirled cupcakes and 3D fondant hugging-heart charters and cutouts which are sure to impress that special someone. Cupcakes and supplies provided. 7pm - 8pm Council Meeting. County of Warren Government Center. Tonight is a regular Town Council meeting. Tuesday, February 11 10am - 11am English as a Second Language. Samuels Public Library, East Criser Road, Front Royal. This class is for anyone who wants to learn English. 12:30pm - 1pm Tourism Tuesdays. 95.3 - the River radio station. Hear the latest tourism related news and events every Tuesday at 12:30! If you canâ&#x20AC;&#x2122;t listen live check out the podcasts at http://www. theriver953online.com. 3pm - 4:30pm Forever Mine Valentine Grief Workshop. Blue Ridge Hospice Bereavement Department at 312 West Cork St., Winchester. This workshop is designed for those who have lost a loved one. Music and art are utilized and discussion is focused on creative ways to memorialize and express grief throughout the year. Pre-registration is required. Please call (540) 536-5210. 4:30pm - 5:30pm Big Kids Story Time.

Samuels Library, Front Royal. Letâ&#x20AC;&#x2122;s celebrate Valentineâ&#x20AC;&#x2122;s Day together. Enjoy stories of love and make a Valentine for someone special. For Kindergarten and up. 7pm - 7pm BAR Meeting. Town Administration Building, Front Royal. Wednesday, February 12 10am - 11am Wired Wednesday. Samuels Public Library, East Criser Road, Front Royal. Join in for a computer club where talk is about a new topic every week. Bring your questions! This monthâ&#x20AC;&#x2122;s topics are comprised of: test prep and career tools, blogging, Genealogy and using Youtube for beginners. 10:15am - 11:15am Toddler Story Time. Samuels Library, Front Royal. Celebrate the holiday of love and friendship with a Valentineâ&#x20AC;&#x2122;s Day story and craft. Siblings welcome. 11am - 12pm Preschool Story Time. Samuels Library, Front Royal. Celebrate the holiday of love and friendship with a Valentineâ&#x20AC;&#x2122;s Day story and craft. Siblings welcome. 3:30pm - 5pm Chamber Board Meeting. Chamber Office, Front Royal. Thursday, February 13 10am - 11am English as a Second Language. Samuels Public Library, East Criser Road, Front Royal. This class is for anyone who wants to learn English.

10:15am - 11:15am Toddler Story Time. Samuels Library, Front Royal. Celebrate the holiday of love and friendship with a Valentineâ&#x20AC;&#x2122;s Day story and craft. Siblings welcome. 11am - 12pm Preschool Story Time. Samuels Library, Front Royal. Celebrate the holiday of love and friendship with a Valentineâ&#x20AC;&#x2122;s Day story and craft Siblings welcome. 5:30pm - 7pm English as a Second Language. Samuels Public Library, East Criser Road, Front Royal. This class is for anyone who wants to learn English. Class begins tonight and continue every Thursday. Taught by Ms. Von Fange. Please register. Friday, February 14 Valentineâ&#x20AC;&#x2122;s Day 7pm - 10pm Valentines Day History and Hauntings. Valerie Hill Vineyard & Winery, Marlboro Road, Stephens City. $59 per person includes special dinner offering and dessert. SPACE IS LIMITED! Call (540) 869-9567 for reservations. Saturday, February 15 7am - 11am Pancake Breakfast. North Warren Volunteer Fire and Rescue Company #10, 89 Rockland Road, Front Royal. Enjoy pancakes, biscuits, sausage and bacon, sausage gravy, chipped beef gravy,

See CALENDAR, 32

485 South St. 540-636-3400

www.goldsgym.com/frontroyalva

More people begin and end their day with us


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Page 31

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com â&#x20AC;˘ 540-683-9197 or Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072

New business

New real estate team, local office for Weichertâ&#x20AC;&#x2122;s Beth Medved Waller

Itâ&#x20AC;&#x2122;s an exciting new year for the local Warren County real estate market with the introduction of a new real estate team, Team Waller Real Estate, being led by top producing realtor, Beth Medved Waller of Weichert, Realtors. In 2012, Beth recognized a need to form a highly active and engaging real estate team when she began to notice local market improvements and a dramatic increase in buyers looking for homes. To assist her with servicing buyer clients, BRIEFS, from 27 Un-cut grocery bags will be supplied at the library for those who have no Plarn. Come and enjoy this experience. â&#x20AC;˘ Heart Attack Signs and Symptoms - Wednesday, February 13 at 6:30 p.m. â&#x20AC;&#x201C; This course will discuss the signs and symptoms of a heart attack as well as actions to take while experiencing, and vital steps to survival while having a heart attack. â&#x20AC;˘ Making Movie Magic - Tuesday, February 18 at 6:30 p.m. - Meet the minds behind Mirandum Pictures, a group of filmmakers, musicians, and graphic artists from the D.C. area who are in love with what they do. Learn about the film business and see screenings of some of Mirandumâ&#x20AC;&#x2122;s work. â&#x20AC;˘ Books and Beyond â&#x20AC;&#x201C; Wednesday, January 19 at 10:00 a.m. â&#x20AC;&#x201C; New members are always welcome in the library book club. This monthâ&#x20AC;&#x2122;s book is People of the Book by Geraldine Brooks. â&#x20AC;˘ Called Again: An Afternoon with 2012 National Geographic Adventurer of the Year Jennifer Pharr Davis â&#x20AC;&#x201C; Sunday, February 23 at 2:00 p.m. - Join us for an exciting and inspiring presentation from world class athlete and wilderness adventurer Jennifer Pharr Davis, the two-time Appalachian Trail thru-hiker who holds the speed record of 46 days. Jen will also sign copies of her new book, Called Again: A Story of Love

she found Eric Reploeg, a Realtor and pastor for a local church community who closed over $10 million in sales for Team Waller in 2013. As an Accredited Buyer Representative (ABR) and certified Short Sales and Foreclosure Resource (SFR), buyers benefit from Ericâ&#x20AC;&#x2122;s extensive experience involving home buying transactions. He earned the â&#x20AC;&#x153;Rookie of the Yearâ&#x20AC;? designation from Weichert, Realtors in 2011 and the â&#x20AC;&#x153;Directorâ&#x20AC;&#x2122;s Awardâ&#x20AC;? from the Blue Ridge Association of and Triumph. â&#x20AC;˘ The 1959 Integration of Warren County Public Schools â&#x20AC;&#x201C; Thursday, February 27 at 6:00 p.m. - Hear Reverend James M. Kilbyâ&#x20AC;&#x2122;s memories of integration Warren County High School 55 years ago, when he and fellow students ascended the hill with courage and conviction.

Goodlatte announces academy nominations Congressman Bob Goodlatte released the following statement today announcing his nomination of several local students from the Sixth Congressional District of Virginia to our nationâ&#x20AC;&#x2122;s service academies as members of the graduating Class of 2018: â&#x20AC;&#x153;It is my honor to nominate these young men to compete for an appointment to our nationâ&#x20AC;&#x2122;s service academies,â&#x20AC;? said Congressman Goodlatte. â&#x20AC;&#x153;The service academies provide students the opportunity to receive a quality educational experience. Upon appointment, I am confident that they will serve the United States with distinction. Folks in the Sixth District can be proud of these hardworking nominees. I wish them the best and thank them for their willingness to serve our great nation.â&#x20AC;? Sixth District Nominations for the Class of 2018 Eric M. Arnesen, son of Mark and Marie Arnesen, is a senior at Stone-

Realtors in 2012. He has proven to be a huge asset to Team Waller and has assisted in creating a customized and unique buying experience for clients working with Team Waller. As the #1 Listings Sold Associate for the Weichert Capital Region, Beth also recognized a need for a marketing expert on her team to contribute to her selling strategy. She found Jen Avery, a Realtor with over 15 years of professional marketing experience. As a real estate agent with Team Waller, she customizes online marketing plans to optimize listing exposure and creates unique marketing brochures and virtual tours for each home. Her marketing experience allows Team Waller to differentiate its marketing strategy and find unique ways to sell homes for the best value. In 2013, she worked with Beth in closing over $13.5 million in listing sales for Team Waller. â&#x20AC;&#x153;It truly is an exciting time for us. We have a new office space on the second floor of Weichert, Realtors, a new logo, and another new team member, Maggie LaBold, joined us in late January. Itâ&#x20AC;&#x2122;s one of the most exciting times in my career and I

look forward to what 2014 brings for Team Waller Real Estate and how we can contribute to our community. Itâ&#x20AC;&#x2122;s important to keep in mind how our actions affect our local community. Our clients are our friends, family, and neighbors. As a real estate team, what is our promise to our community? We promise to serve our clients with the utmost integrity and abide by the highest standards of service known in the real estate industry. We strive to exceed our clientâ&#x20AC;&#x2122;s expectations and fulfill their wishes through all our interactions and make each experience in real estate unique

wall Jackson High School and a resident of Mt. Jackson. He has been nominated to the United States Naval Academy at Annapolis. Garrison G. Gosney, son of Gary and Beverly Gosney, is a senior at Central High School and a resident of Edinburg. He has been nominated to the United States Air Force Academy at Colorado Springs. Hyun Jin â&#x20AC;&#x153;Seanâ&#x20AC;? Park, son of Daniel and Hea Baker, is a 2012 graduate of Skyline High School and a resident of Front Royal. He has been nominated to the United States Naval Academy at Annapolis. John M. Weiss, son of Johan and Kathy Weiss, is a senior at Harrisonburg High School and a resident of Harrisonburg. He has been nominated to the United States Air Force Academy at Colorado Springs.

amended Code of Virginia 46.21078.1 to make it a primary offense. A violation of this section is a traffic infraction punishable, for the first offense, by a fine of $125 and, for a second or subsequent offense, by a fine of $250. The law applies to the operator of a passenger vehicle in motion and exempts law-enforcement and other first responders. Since the law went into effect, Virginia state troopers have been enforcing it just like any other primary offense. The trooper must observe the illegal conduct of the vehicleâ&#x20AC;&#x2122;s operator, thus providing the trooper with reasonable suspicion to initiate a traffic stop on that vehicle. Further investigation determines what, if any, offense(s) the driver will be cited for by the trooper. Troopers have the discretion to warn, summons or arrest a violator. â&#x20AC;&#x153;Driving distracted puts everybody at risk on a highway,â&#x20AC;? said Colonel W. Steven Flaherty, Virginia State Police Superintendent. â&#x20AC;&#x153;According to preliminary data*, driver distraction accounted for 20 percent of all fatal traffic crashes on Virginiaâ&#x20AC;&#x2122;s roads in 2013. That accounts for 131 lives lost last year because of a driver failing to pay attention while behind the wheel of a vehicle.â&#x20AC;? In addition, state legislators this past session also established Code of Virginia 46.2-341.20.5. The law prohibits anyone from texting while driving a commercial vehicle or a vehicle used to transport between nine

Virginia State Police cite 500-plus drivers for texting while driving RICHMOND â&#x20AC;&#x201C; In the first six months since Virginiaâ&#x20AC;&#x2122;s textingwhile-driving ban became a primary offense, Virginia State Police troopers have issued hundreds of citations for the violation. From July 1, 2013, through December 31, 2013, troopers stopped and charged 567 drivers for violating the stateâ&#x20AC;&#x2122;s â&#x20AC;&#x153;textingwhile-drivingâ&#x20AC;? law. During the 2013 Virginia General Assembly Session, legislators

â&#x20AC;?states Beth Waller, Lead Agent of Team Waller Real Estate.

J & G Upholstery Automobiles and ATVs

10% off all headliners

We Do

Seats Headliners Carpets and more

4FSWJOHUIF'SPOU3PZBMBSFB       and 15 passengers. The law does permit â&#x20AC;&#x153;texting when necessary to communicate with law enforcement or other emergency services.â&#x20AC;? Code of Virginia 46.2-919.1 prohibits the use of any wireless telecommunications devices by persons driving school buses.

RECâ&#x20AC;&#x2122;s LEARN grant program application is available Rappahannock Electric Cooperative (REC) will award $16,000 in grants to emergency service agencies, non-profits and local area teachers in 2014. The grants are made possible through RECâ&#x20AC;&#x2122;s LEARN (Literacy Education and Rural Networking) program. Completed applications must be returned to one of RECâ&#x20AC;&#x2122;s offices or postmarked by February 24, 2014. The Cooperative began the LEARN program in 1996. Since then, the program has awarded grant money to the community in support of more than 100 projects throughout RECâ&#x20AC;&#x2122;s service territory. REC will award 16 grants to organizations in the following categories: â&#x20AC;˘ Education â&#x20AC;&#x201C; Five $500 and three $1,000 grants to individual or groups of teachers, from grades K-12 who See BRIEFS, 33


Page 32 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com â&#x20AC;˘ 540-683-9197

Calendar CALENDAR, from 30 scrambled eggs, baked apples, coffee, juice, and hot tea. Adults $8.00, children 4-12 $4.00, under 3 free! 10am - 4pm MSV Day: Free Admission. Museum of the Shenandoah Valley, Amherst Street, Winchester. Admission to the Museum is FREE to all on this special day! Gallery talks highlighting the history of various objects in the MSV Collection will take place throughout the day. For adults, tours will begin at 10:30 a.m. and take place hourly until 3:30 p.m. For children, talks will take place at 11 a.m., 1 p.m., and 2 p.m. Shenandoah Conservatoryâ&#x20AC;&#x2122;s Saxophone Quartet will play a mix of Ragtime, American folk, and Broadway melodies in the Reception Hall at 11 a.m. and 1 p.m. A free â&#x20AC;&#x153;pop-inâ&#x20AC;? childrenâ&#x20AC;&#x2122;s activity will be offered in the Museumâ&#x20AC;&#x2122;s BB&T Learning Center throughout the day. Plan to have lunch in the Museum CafĂŠ by Bonnie Blue and browse in the Museum Store. Free to all. 11am - 12pm Kooky Chefs Cook Valentineâ&#x20AC;&#x2122;s Day. Samuels Library, Front Royal. Chocolate Dreams. Discover all the wonderful ways you can use chocolate in fabulous edibles. Find out why chocolate is actually good for you. For ages 8 and up. Please register. 12pm - 5pm â&#x20AC;&#x153;Diamonds are a Girlâ&#x20AC;&#x2122;s Best Friendâ&#x20AC;?. Veramar Vineyard, Berryville. Love is in the air! Bring your special someone to this popular, annual Veramar event and you will have the chance to win a diamond! Savor wine and quality time together, listen to live music by Nathaniel Davis and enjoy delectable treats. What better way to spend your afternoon?! $25per person includes a glass of wine and a plate filled with delicious treats. Reservations are required. Call early as this event always sells out! Monday, February 17 Presidentsâ&#x20AC;&#x2122; Day. Presidentâ&#x20AC;&#x2122;s Day - All Town offices will be CLOSED. Trash/Recycling Collection has been rescheduled to Wednesday, February 19. 10am - 11am R-MA Open House. Randolph-Macon Academy, Academy Drive, Front Royal. R-MA is hosting a FREE Open House today, with campus tours beginning at 10:00a and 1:00p. Students interested in the Academy for the summer program or the 2014-15 school year are encouraged to attend with their parents. Attendees will enjoy a student-led tour of the campus and meet with admission counselors. Appointments are required. For more information or to RSVP, please call (540)636-5484, e-mail admission@ rma.edu or register online at www.rma. edu/open-house. 10am - 1pm Free backyard composting class. Exchange Shelter, Jim Barnett Park, Winchester. The Cityâ&#x20AC;&#x2122;s Recycling Coordinator, Michael Neese, is excited to share his knowledge and passion for composting with the community. Learn the howtos, best practices, types of composting and available resources in the Winchester area in order to start and use compost effectively. Space is limited so contact Winchester Parks & Recreation (WPRD) at (540) 662-4946 today to register for the

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

composting class . Tuesday, February 18 10am - 11am English as a Second Language. Samuels Public Library, East Criser Road, Front Royal. This class is for anyone who wants to learn English. 12:30pm - 1pm Tourism Tuesdays. 95.3 - the River radio station. Hear the latest tourism related news and events every Tuesday at 12:30! If you canâ&#x20AC;&#x2122;t listen live check out the podcasts at http://www. theriver953online.com 4:30pm - 5:30pm Big Kids Story Time. Samuels Library, Front Royal. The STEM program this month is all about Optical Illusions. Discover all the ways your eyes can fool you. Explore famous illusions and the inverted color trick. Afterwards make your own optical illusions. For Kindergarten and up. 6:30pm - 7:30pm Making Movie Magic. Samuels Public Library, East Criser Road, Front Royal. Meet the minds behind Mirandum Pictures, a group of filmmakers, musicians and graphic artists from the D.C. area who are in love with what they do. Learn about the film business and see screenings of some of Mirandumâ&#x20AC;&#x2122;s work. 7pm - 8pm Council Work Session. Town Administration Building, 102 E. Main St., Front Royal. Tonight the Town Council will have a Work Session. Wednesday, February 19 10am - 11am Wired Wednesday. Samuels Public Library, East Criser Road, Front Royal. Join in for a computer club where talk is about a new topic every week. Bring your questions! This monthâ&#x20AC;&#x2122;s topics are comprised of: test prep and career tools, blogging, Genealogy and using Youtube for beginners. 10:15am - 11:15am Toddler Story Time. Samuels Public Library, East Criser Road, Front Royal. This monthâ&#x20AC;&#x2122;s STEM program is all about the Money, honey. Learn all about the value of money and the fun of coins. Siblings welcome. 11am - 12pm Preschool Story Time. Samuels Public Library, East Criser Road, Front Royal. See above. 7pm - 8pm Planning Commission Meeting. County of Warren Government Center.

Thursday, February 20 10am - 11am English as a Second Language. Samuels Public Library, East Criser Road, Front Royal. This class is for anyone who wants to learn English. 10:15am - 11:15am Toddler Story Time. Samuels Public Library, East Criser Road, Front Royal. See description from February 19. 11am - 12pm Preschool Story Time. Samuels Public Library, East Criser Road, Front Royal. See description from February 19. 5pm - 8pm Third Thursday ArtWalk. Downtown Front Royal. 5pm - 7:50pm Auditions/Interviews for Christ-filled Theater/Film. Come join a team of emerging artists in bringing to life a great story that will draw people (including you!) nearer to Jesus through a fantasy-style portrayal of His love and power! Auditions for roles (male & female, ages 7-28) and interviews for artistic positions (in the areas of design, construction, & procurement of sets, costumes, props, and make-up; stage management; and stagehand work will take place at Samuelâ&#x20AC;&#x2122;s Public Library in Front Royal. Pre-registration is required for both. Auditioners will present a 3- to 5-minute monologue; interviewees should bring portfolios, etc. Positions are non-salaried. Tentative completion date for the entire production is the end of Summer 2014. Contact Jessie at counting_it_all_joy@yahoo.com or 540-622-6242 to complete the required registration and to obtain more information. 5:30pm - 7pm English as a Second Language. Samuels Public Library, East Criser Road, Front Royal. This class is for anyone who wants to learn English. Taught by Ms. Von Fange. Please register. Friday, February 21 5:30pm - 7:30pm Indoor Circus. Body Renew Fitness & Family Sports Center, Winchester. Walker International Events, Inc. has been entertaining children of all ages for over 20 years. The families that make Walker International Events, Inc. Americaâ&#x20AC;&#x2122;s #1 Favorite Family Circus have been a driving force in the entertainment industry. Eight generations of experience in producing, performing, and business management in the entertainment indus-

DJ SERVICE

try. Kids are FREE with Paying Adult! For details, visit www.walkerinternationalevents.com. 7:30pm - 9:30pm Indoor Circus. See above. 7:30pm - 8:30pm Chorus Concert. Randolph-Macon Academy, Academy Drive, Front Royal. As part of the national Military School Band Festival, R-MA will host the U.S. Army Chorus today in John Campbell Boggs Chapel. The event is FREE and open to the public. Saturday, February 22 10am - 12:40pm Auditions/Interviews for Christ-filled Theater/Film. See information on Thursday, February 20. 11am - 12pm Family Story Time. Samuels Library, Front Royal. Bring the whole family to the cozy play area for an assortment of exciting stories with Miss Tamara. A perfect way to spend an enjoyable Saturday morning. 6:30pm - 10pm Fundraiser Event. Moose Lodge, John Marshall Highway, Front Royal. Travel Softball (Front Royal Fire) for the 10-U and 11-U Division is having a Fundraiser Event tonight. Dinner buffet and drinks provided. Must be 21 to attend as alcohol will be available. Grand Prize of $1,500.00 with other cash prizes awarded throughout the event. Every 25th ticket drawn will be the winner of $25.00. Tickets: $30.00. More Information: Paul Stiltner at (540) 660-5659. Sunday, February 23 2pm - 3pm Adventurer of the Year. Samuels Public Library, East Criser Road, Front Royal. Join in for an exciting and inspiring presentation from world class athlete, wilderness adventurer, and 2012

National Geographic Adventurer of the Year Jennifer Pharr Davis, the two time Appalachian Trail thru-hiker who holds the speed record of 46 days. Jen will also sign copies of her new book, â&#x20AC;&#x153;Called Again: A Story of Love and Triumphâ&#x20AC;?.

Send your brief news items to briefs@warrencountyreport.com

Every Friday night doors open at 5pm Bingo starts @ 7pm Progressive games:

Queen of Hearts = $1,467 Treasure Chest = $200 1st Progressive = $1500 2nd Progressive = $1300 Inst Progressive = $2500 3rd Progressive =$2100

Front Royal VFD Inc.

221 N. Commerce Ave. Front Royal, Va 22630

Finest Selection in the Area

Celebrate Your Day the Dâ&#x20AC;&#x2122;Vine Way &RPSOLPHQWDU\6DPSOHV2IIHUHG(YHU\)ULGD\Â&#x2021;5-7pm Creekside StationÂ&#x2021;9DOOH\$YH:LQFKHVWHU9$ 540-662-WINE (9463) Â&#x2021; www.662WINE.com

Thinking of selling or buying a home? * Mobile DJ and Emcee * 35 Years Experience * * Specializing In Weddings and Corporate Events * * Wide Variety Music Of Your Choice *

703 309-1707

Call Daryl Stout!

540-660-5538 Daryl Stout

CALL

5538

540-660-

Sales Associate C-540-660-5538 daryl@teddystout.com 824 John Marshall Hwy â&#x20AC;˘ Front Royal, VA 22630


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 • Warren & Frederick County Report • Page 33

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com • 540-683-9197 or Alison at alisond@warrencountyreport.com • 540-551-2072 BRIEFS, from 31 demonstrate teaching methods to students of REC members. • Community –One $2,000 and four $1,000 grants will be awarded to nonprofit groups serving REC members, or whose services directly benefit them. • Emergency Service – Three $1,500 grants will be awarded to an emergency response team whose services directly benefit REC members. Applications are available at any REC office, online at http://www.myrec.coop/res/community/grants.cfm or by contacting Justin Cruise, REC’s public relations specialist, at 1-800552-3904, ext. 5905 or community@ myrec.coop.

Virginia population growth slows Population growth in Virginia slowed last year as fewer people moved to the state, but the commonwealth still outpaced the nation, according to the most recent official state population estimates from the University of Virginia’s Weldon Cooper Center for Public Service. Virginia’s population grew between 2012 and 2013 by less than 1 percent, or 74,531 people, to increase the state total population to nearly 8.3 million. While growth last year was the slowest in Virginia since before the recession, the commonwealth still grew faster than the nation, which grew by 0.7 percent. Compared to other states, Virginia posted the 14th-highest growth rate and the seventh-largest numerical population gain. Within Virginia, the large population gains were more than ever concentrated in urban localities particularly in Northern Virginia. While Fredericksburg is the fastest-growing locality since 2010, increasing by more than 15 percent, most urban localities in Virginia also experienced above-average growth, representing a change from the pre-

vious decade. Between 2000 and 2010, urban localities grew much more slowly than suburban localities in Virginia; in contrast, during the past four years, many urban areas are among Virginia’s fastest-growing localities, with Arlington, Fredericksburg, Harrisonburg, Radford and Richmond among the cities growing at a rate faster than the state since 2010. Most localities that lost population or experienced natural decrease were located outside of the so-called “urban crescent,” which stretches from Hampton Roads to Richmond and up the Interstate 95 corridor to Northern Virginia. In Southwest Virginia, all seven coal-producing counties declined in population between 2012 and 2013. The Cooper Center’s population estimates, prepared annually, are the official figures for the commonwealth of Virginia. The estimates are based on changes since 2010 in housing stock, school enrollment, births, deaths and drivers’ license issuances. They are used by state and local government agencies in revenue sharing, funding allocations, planning and budgeting.

Farm custom rate survey underway The Shenandoah Valley is well known for its robust agriculture economy. One aspect of this economy that helps keep this economic engine running smoothly is the interaction among rural landowners. Many farmers are willing to lend their neighbors a helping hand when needed. This helping hand comes in the form of custom work. It is a great way of getting work done while keeping costs low. It benefits everyone. Whether it be landowners who do not farm or small farmers who do not own all the machinery they need; they can get farm work done at a reasonable cost. The farmers who own the machinery get paid for the work they do on their neighbors land. Of-

TOP PRODUCER

Interested in finding out how much your home is worth? Contact me today to give you a FREE Current Market Analysis!

Tana Hoffman

Realtor®, SFR Cell: 540-671-1994 tana@sagerrealestate.com

Sager Real Estate 111 E. King St. Strasburg, VA 22657

ten this helps one farmer justify the cost of purchasing expensive farm equipment which they may not be able to afford otherwise. What is a fair price for custom work? Most people simply want to pay (or charge) a fair price. For many years, Extension Agents in the Shenandoah Valley have hosted the custom rate survey to help answer this question. Results of past years surveys can be found on the VCE – Page County web site at http://offices.ext.vt.edu/page/programs/anr/ index.html. Data contained in the Custom Work Rate Guide is simply the results of the survey. Ultimately, the true cost of doing custom work is dependent on the specific working conditions of the job at hand. And a “fair” price is what both the buyer and seller are mutually willing to accept. Each year, Extension Agents across the Shenandoah Valley get over 500 requests for this survey data. Thus, it is important that the data be up-todate and as accurate as possible. The custom rate for bushogging and combining have changed over an eight year period. One noteworthy factor is the fact that the charges reported for year 2010 are lower than 2008. What caused this downturn? The cost of fuel can be a major factor. Was the fuel cost lower in 2010? Is the difference simply due to who responded to the survey in 2008 compared to 2010 combined with a low number of responses? These are all things that both the buyer and seller need to decide. Farmers who are willing to do custom work must be vigilant to make sure they charge an adequate price for their work. Simply charging what everyone else is charging might be a good way to lose a lot of money. Extension can work with individual farmers to help them assess their true cost of operating specific machinery. This can be a time consuming task. However, it is an important step to assure a profitable enterprise. If you are a farmer or rural landowner who has either done custom work or received custom services and you would like to participate in this survey, please call your local Extension office [Clarke (540) 9555164, Frederick (540) 665-5699, Page (540) 778-5794, Shenandoah (540) 459-6140, or Warren (540) 6354549]. The survey is voluntary and individual responses are confidential. The more responses we get the more accurate the data.

Next generation crop fertilization technology educational meeting Virginia Cooperative Extension is hosting a meeting to provide farmers with new/upcoming technologies associated with crop fertility management. The meeting will take place

Briefs

Hyun Jin “Sean” Park, son of Daniel and Hea Baker, is a 2012 graduate of Skyline High School and a resident of Front Royal. He has been nominated to the United States Naval Academy at Annapolis. at the New Market Fire Hall (9771 South Congress Street, New Market, VA 22844) on Friday, February 28, from 10:00 a.m. until 3:00 p.m. Please register by calling (540) 4596140 by February 25. There are over 100,000 acres of corn, corn silage, small grain, and soybean grown in the Shenandoah Valley. Farmers routinely strive to provide adequate nutrition to achieve optimum yields. For the past several years, Northern Shenandoah Valley farmers have worked closely with Virginia Cooperative Extension to refine their nitrogen management in corn. Specific technologies used include soil nitrate testing, aerial imagery, and cornstalk nitrate tests. During that time, over 1,600 soil nitrate tests were collected to refine nitrogen fertilizer rates to 25,000 acres of corn. These efforts resulted in 250,000 less pounds of nitrogen used on corn. This is both a great financial benefit to the farmer and is good for water quality. However, as with any technology, farmers are beginning to ask “What’s next? Is there newer/better technologies that can help us better refine our management?” This educational meeting is designed to introduce farmers, agribusinesses, and other interested people to a suite of “Next Generation” crop fertility management technologies. This will include at least six technologies that are not routinely used in the Shenandoah Valley. The topics that will be covered during this meeting are listed below: How I Use Yield Monitor Data on My Farm to Improve our Crop Fertilization Program Jay Hundley, Cloverfield Farm and Keith Balderson, Extension Agent, Essex County

Precision Soil Sampling for Crop Nutrient and Lime Application Tim Woodward, Tellus Consulting Using Green Seeker (or Similar) Technology to Improve Nitrogen to Corn and Small Grain Wade Thomason, Extension Grain Specialist, Virginia Cooperative Extension How to Use Nitrogen Stabilizers to Improve Nitrogen Use Efficiency Hunter Frame, Extension Crop Fertility Specialist, Virginia Cooperative Extension Demonstrations of the Veris Machine and Drones to Improve Crop Management Kyle Sturgis, AgrIntelligence Specialist, Helena Chemical Company, and Tim Woodward, Tellus Consulting. A special thank you to the following agribusinesses for sponsoring this meeting: AMVAC, BASF, Bayer CropScience, Binkley & Hurst, CFC Farm & Home Center, Dow AgroSciences LLC, Farm Family Insurance, First Bank & Trust Company, Helena Chemical Company, Hubner Seed, James River Equipment, Mathias Brothers, MidAtlantic Farm Credit, Monsanto Company, Page Cooperative Farm Bureau, Rockingham Cooperative Farm Bureau, Southern States – Front Royal, Southern States – Luray, Southern States – Winchester, Syngenta, Valley Fertilizer & Chemical Company, Wightman Insurance Agency, and Winchester Equipment Company. Virginia Cooperative Extension programs and employment are open to all, regardless of race, color, nationSee BRIEFS, 34


Page 34 • Warren & Frederick County Report • Mid February, 2014

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com • 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com • 540-683-9197

Briefs BRIEFS, from 33 al origin, sex, religion, age, disability, political beliefs, sexual orientation, genetic information, marital, family, or veteran status, or any other basis protected by law. An equal opportunity/affirmative action employer. If you are a person with a disability and desire any assistive devices, services, or other accommodations to participate in these activities, please contact the Shenandoah County Office of Virginia Cooperative Extension at (540) 459-6140 during business hours of 8:00 a.m. and 5:00 p.m. to discuss accommodations five days prior to the event. *TDD number is (800) 828-1120.

Electric bills reflect weather patterns No one likes to be surprised with a higher than expected electric bill. But the fact is that weather can cause energy use to vary significantly throughout the year. Consumers will likely see higher electric bills as a result of the recent extremely cold weather that had Virginia shivering for extended periods of temperatures in the teens and single digits. Paul Gillespie, REC’s energy advisor, says, “The colder the temperature, the more electricity you use. Regardless of the type of heating system in your home, when it’s very cold like it has been recently, a home heating system runs longer to generate heat and circulate warm air through the home. If you use a heat

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

pump, which is very efficient and effective in normal winter weather, it has to use another form of auxiliary heat to maintain comfort when the outside temperature falls below the 20 to 25 degree range. The auxiliary system, whether it runs on fossil fuel or electric resistance heat, can add significantly to your home heating costs. There are also lots of ‘hidden’ users of electricity in weather like this, such as light bulbs or heat tape used to keep pipes from freezing in unheated spaces. Simply put, January’s extreme cold resulted in much more energy use than normal.” The weather can affect energy use in other ways, too. “More people stay inside on cold days, using more electricity than they would if they weren’t home,” notes Gillespie. “For several days in a row children were home due to schools being closed. That means lights, TVs, and computers were on more than normal. And, in weather like this, people tend to cook more, sometimes having a hot meal for lunch as well as dinner. More hot water is used this time of year as well; there’s more laundry due to wearing layers of clothes, more dishes to wash, and more hot showers, all leading to more electricity use than normal.” December 2013 was colder than the previous last two years for the month, and the same is true for January 2014. Preliminary data from the National Weather Service indicates that the average temperature in January was about 4 degrees colder than normal and that heating degree days

(a scientific measurement of the difference between the average temperature and 65 degrees) were about ten percent higher than normal. According to Kris Sieber, REC’s director of member services, recent bills have reflected increased energy use of just over twelve percent higher than last January. “REC has options for members who are experiencing a high electric bill and want to better manage their energy usage and budget,” explains Sieber. “The Cooperative has a billing option called Budget Billing, which helps residential members plan for their monthly bills in an affordable manner. The Budget Billing payment amount is based on the monthly bill average over the previous 12 months, so it helps members avoid unpleasant surprises when usage suddenly increases due to hotter or colder than normal weather.” Fortunately for REC members, on Jan. 1 the Cooperative lowered its power cost charge. That reduction means members are paying about $3.20 per 1,000 kWh less now than they were in December. Weather doesn’t have to play havoc with electricity bills. There are a variety of tools, appliances and resources available to solve all sorts of energy challenges. Gillespie encourages members to utilize the Cooperative’s online Billing Insights tool to gain an in-depth look at their individual energy use. With recommendations for areas of the home to look for improvements, this tool also provides no-cost/low-cost recommendations. Visit www.myrec.coop and look for

the tool under My Account > About Your Bill. Billing Insights is part of REC’s online Home Energy Suite. If a member would like to discuss their energy use or electric bill, the Cooperative’s energy advisors can walk members through their energy usage patterns and help them determine if something, such as faulty equipment within the home, is causing the increase. By contacting REC immediately, members can possibly avoid the same experience in coming months. REC provides electric service to over 158,000 connections in parts of 22 Virginia counties. With its general office in Fredericksburg, Va., Rappahannock operates and maintains more than 16,000 miles of power lines through its service area, which ranges from the Blue Ridge Mountains to the tidal waters of the Chesapeake Bay. For information about REC, please visit us on Facebook, Twitter, YouTube, or our website, www.myrec.coop.

Governor McAuliffe to cohost 6th annual Conference on Agricultural Trade March 6-7 in Richmond RICHMOND – Governor Terry McAuliffe will co-host the 6th Annual Governor’s Conference on Agricultural Trade on March 6 – 7, 2014 at the Richmond Marriot Hotel. The two-day conference, entitled “Connecting the World to Virginia’s Farms and Forests,” is co-hosted by Virginia Tech’s Department of Agricultural and Applied Economics, the Virginia Department of Agriculture and Consumer Services (VDACS),

Call in a tip on a crime and you may Receive a reward of up to $1,000 *You will remain anonymous* www.crimesolvers.us

540-665-TIPS

Virginia Farm Bureau Federation and the Virginia Port Authority (VPA). The event will bring together producers, agribusinesses, exporters, foreign ambassadors, embassy ministers, land-grant university leadership, state and federal government officials, and others to discuss challenges and opportunities for global exports. Workshops and private meetings regarding the international trade of agricultural goods will be held as well. Governor McAuliffe will deliver the keynote address at the conference on Thursday, March 6 at 12:00 PM. The Governor will discuss the importance of agriculture and forestry, the state’s largest two industries, on the Commonwealth’s economy and his plans to make Virginia the East Coast capital for agricultural and forestry exports. The Governor also will also announce total figures for agricultural exports from Virginia for 2013. In 2012, the Commonwealth totaled more than $2.61 billion in agricultural exports, an all-time record. That followed 2011’s $2.35 billion figure, the second largest total in history. Speaking about the conference, Governor McAuliffe said, “The importance of Virginia’s agricultural exports continues to grow for our producers and agribusinesses – as well as our overall economy – and the annual conference is an important gathering place and educational forum for both experienced exporters and those wanting to break into the export market. Send your news to: – briefs@warrencountyreport.com

CRIME OF THE WEEK

Frederick County Crime of the Week - January 27, 2014 This week’s Crime Solver’s Crime has to do with a burglary and grand larceny that occurred in the 6800 block of Valley Pike. The victim reported that on January 13, 2014, when he entered the residence he noticed that the interior had been ransacked and that all of the cabinet doors were open. One of the entry doors had also been forced open. Two firearms were reported missing, a Colt Python revolver and a Browning .380 semi-automatic pistol. No other items were taken from the residence. If you have any information regarding a suspect or suspect vehicle in this incident, please call the Crime Solvers Hotline at (540) 665 TIPS (8477). Information leading to the arrest of a suspect may result in a reward of up to $1,000.


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com • 540-683-9197 or Alison at alisond@warrencountyreport.com • 540-551-2072

Mid February, 2014 • Warren & Frederick County Report • Page 35

Diversions


Page 36 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com â&#x20AC;˘ 540-683-9197

Opinion OPINION, from  Whoopee! I suppose you expect me to drape the scarves around my studentsâ&#x20AC;&#x2122; shoulders, plant rally signs in my schoolâ&#x20AC;&#x2122;s flower beds, place posters throughout the neighborhood and proudly wear a lapel sticker on my jacket. You say you hope â&#x20AC;&#x153;schools that participate find the Week to be an enjoyable, rewarding and celebratory time.â&#x20AC;? Is that really what you hope? Or do you hope that your work, funded by the most conservative, anti-union, anti-progressive and anti-teacher forces in America, will accelerate the demise of public education in America? Iâ&#x20AC;&#x2122;m proud to acknowledge the generosity that supports my progressive school. Are you not proud of your support? Why does your website not have any information about who you really are and who funds the emails, scarves, signs, posters and stickers? My research shows that your support comes from places like the American Legislative Exchange Council (ALEC). ALEC is funded by the Koch brothers, Big Pharma and some of the most rapacious corporations in America. A great deal of your support, according to Media Matters for America, comes from the Gleason Family Foundation, which also paid the discredited lobbyist Dick Morris to shill for them. Your support comes from FreedomWorks, a right wing organization that shares Gro-

ver Norquistâ&#x20AC;&#x2122;s hope to shrink government to a size where it might be drowned in the bathtub. Do you wish the same for public education? Perhaps you felt I would be eager to join the celebration because my school is a private school. Surely I would be supportive of encouraging school choice through vouchers or increased numbers of charter schools. Surely not. I, like many of my private school colleagues, am deeply ambivalent about my own work. Ambivalent, but not embarrassed. My school is among many privileged schools that declare an unambiguous public purpose. We partner with public schools, argue for school funding and stand with many others who imbue a deep sense of social justice in our students. We know that public education is essential to the future of our country. Schools should be equitably funded, teachers should be cherished and unions should be appreciated for their historic role in resisting the drift toward plutocracy. By contrast, â&#x20AC;&#x153;school choiceâ&#x20AC;? means further segregating schools by race and class. â&#x20AC;&#x153;School choiceâ&#x20AC;? diverts critical resources from under-funded public schools to for-profit education management organizations. Courtesy of your efforts, â&#x20AC;&#x153;school choiceâ&#x20AC;? means tax dollars flowing to funda-

There are many places you might consider putting your lapel stickers, but my suit jacket is not among them. I think that pretty much verifies

and nails my suspicions about the anti-public education scam known as NSCW â&#x20AC;&#x201C; whose president canâ&#x20AC;&#x2122;t even transcribe a phone number correctly and whose PR people canâ&#x20AC;&#x2122;t spell â&#x20AC;&#x201C; just sayinâ&#x20AC;&#x2122; â&#x20AC;Ś

Classifieds AUTOS

MISCELLANEOUS (Cont.)

1994 Chevrolet Van, 3/4 ton high top conversion. 350 V8. Runs Great $1000 Call 540-459-1748

Masonic ring with two .4 caret diamonds, ruby with mason emblem. 14k gold. Appraises at over $7,000. Asking $4000.00. Call 540-6629023

For sale by owner: 2003 chevy Silverado pickup. Z71, Ext. cab,shortbed,4x4, auto, 5.3lt., new inspection, pwr w/l/d/m, ac/am,fm, runs great, vgc, tow pkg, 139k, highway miles, good interior. Only $9500. Call 540-551-2072 2004 Nissan Frontier pickup truck. EC, VE, V6, 4WD, AT, PL, PW, New tires, AC, CC, Recent tune-up, One Owner. 110K. Asking $8600.00. Call (540)551-2756 EMPLOYMENT Frederick County Report is seeking sales representatives in Winchester and Frederick County. Email: dan@areaguides.com

Old glass jars, blue & white with glass lids, pints & quarts 4.00 ea. 100 yr old wooden headboard $100.00. Old wicker baby stroller $100.00. Cookie jars, some McCoy, various prices. 540-662-9023 RENTAL FOR RENT In Town Strasburg, 479 N.Massanutten St., 3 BR, 2 bath, nice yard, new appliances, will consider pet $1000 mthly plus security deposit.Log Cabin on 150 ac.farm, 1 BR,1 bath, wood stove, wrap around porch, all yard maintenance included,85 Fort Valley Rd. $1150.00 a month plus security deposit, Call Susie 540-974-1484

MISCELLANEOUS SERVICES

Spay today

Need to get your cat or dog spayed or neutered? Contact Spay Today, our areaâ&#x20AC;&#x2122;s non-profit, reduced-fee spay and neuter program. At the time of surgery, initial shots and tests can also be obtained at lower rates. Choose from many vets over a wide area. NEW vets added! Contact Spay Today at

mentalist religious schools through contrived mechanisms, clearly violating the spirit, if not the letter, of the First Amendment. You demean the profession by claiming that any young college graduate with a few weeks training is a â&#x20AC;&#x153;teacher.â&#x20AC;? Your funders, if they had their way, would privatize Social Security, abolish Medicare, eviscerate public education and leave all but the privileged to fend for themselves in a mythological meritocracy. I suppose I sound rather harsh. I donâ&#x20AC;&#x2122;t mean to personally attack you. But your message and your organization are fundamentally dishonest. You donâ&#x20AC;&#x2122;t want to â&#x20AC;&#x153;celebrateâ&#x20AC;? my school. You want to co-opt us for your lobbying effort. You want to have us identify with your â&#x20AC;&#x153;brandâ&#x20AC;? so as to create the appearance of very broad public support for your very narrow and self-serving agenda. You want this so that even more misguided, misinformed legislatures and politicians will pound nails into the coffin of pubic education. Itâ&#x20AC;&#x2122;s a free country (at least for the time being.) Your activities are probably legal. But be honest about it. I find it deeply offensive that you would obfuscate your true intentions and exploit children and unaware adults to advance your destructive political agenda.

Warren County Local is a newly formed chapter of Special Olympics, providing local sports for people with intellectual disabilities in Front Royal and Warren County. The next planned event will be Bowling

@ Royal Family Bowling Center

8FEOFTEBZTĹ&#x201D;QNQN +BOVBSZ .BSDI  New athletes must submit medical and registration forms before participating. Registration is on-going and valid for three years. For additional information contact:

+BDLJF+FOLJOT!FYU

www.baacs.org or 304-728-8330

TQFDJBMPMZNQJDTXD!HNBJMDPN

EXCELLENT SCENIC RIDES

Front Royal Warren County Airport

Cass Aviation (540) 635-3570 â&#x20AC;˘

CFI WANTED

WARREN COUNTY AIRPORT/FRONT ROYAL

Airplane Rides Year-round!

20 Minute Scenic Flights - $60 Per Person GIFT CERTIFICATE AVAILABLE, Intro Flight Training $99,

See Gliders every weekend!

â&#x20AC;˘ Group Discount â&#x20AC;˘ Flight Training â&#x20AC;˘ Aircraft Rentals â&#x20AC;˘ Photo Flights

â&#x20AC;˘ Glider Club â&#x20AC;˘ Charter Flights â&#x20AC;˘ New Hangers â&#x20AC;˘ Tie Down Avail. â&#x20AC;˘ Gift Certificates â&#x20AC;˘ New Taxiway

Wedding decorations for a fall wedding. 6â&#x20AC;? and 8â&#x20AC;? tall stem glass votive holders and battery operated votives decorated with wine colored flowers. $.40 each. 50 of these for sale. 6 - Yankee Candle 12â&#x20AC;? tall cyclinder glass candle holders with candle insert at top - $7.50 each. Large Fish bowl decorated with wine, green and pink colored flowers - makes nice centerpiece. $15.00 540-869-4872 Outer Banks Beach Condo SeaScape Beach & Golf Villa, Mile Post 2 1/2 Kitty Hawk, NC. April Week 16 or October - Week 412 Bedrooms, 2 Bath Sleeps 6 ( has hide-away bed) Price $1,500.00 540-667-2031 Boys School / Church Clothes Shirts, Sizes 6,7,8,10 & 12, $2.00 each. Excellent ConditionWinchester 540-667-2031 Two Hot Air Ballon ride tickets $250. Looking for a unique gift.Tickets are good through 11/2014 at locations throughout the USA including VA. For more information call Steve at 540-542-0066

Your business listed here. 6 lines only $35.00 for 4 weeks. Ad prepayment required. Email: classifieds@fredcoreport.com or call Angie @540-683-9197 Bookkeeper available. Specializes in small business. Resonable rates. Call Lisa at 540-465-8302 Julieâ&#x20AC;&#x2122;s Cleaning Service. 15+ yrs exp, quality, value & service in Warren County & surrounding areas. Julie Shenk, owner/operator. 540635-3366, 540-671-0983, nogoodcowboys@yahoo.com

Advertise your classified ad for 4 weeks

FREE! Email

classifieds@fredcoreport.com

or call 540-683-9197


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com • 540-683-9197 or Alison at alisond@warrencountyreport.com • 540-551-2072

Death notices

At approximately 5:45p.m., January 29, 2014, Frederick County Fire and Rescue responded to a structure fire located at 1039 Fairfax Pike, White Oak Campground in Stephens City. When crews arrived, they found fire

showing from the rear of the camper. In approximately twenty minutes the fire crews had the fire extinguished. Fire department personnel remained on scene approximately one hour for salvage and overhaul.

Courtney Lee Bridge Courtney Lee Bridge, 29, of Frederick County, Virginia, lost his life on February 1st, in Hagerstown, Maryland. Memorial contributions may be made to Justin Bridge, for Elijah Lowry-Bridge, and sent to Omps Funeral Home, 1600 Amherst St., Winchester, Virginia, 22601.

Pamela Y. Cornwell Pamela Yvonne (Mills) Cornwell, 61, went home to be with the Lord on January 29, 2014 at her home in Middletown, VA. Memorial contributions may be made to the American Cancer Society, 2654 Valley Ave., Suite B, Winchester, VA 22601 Earl W. “Ike” Iser Earl William “Ike” Iser, 81, of Frederick County, Virginia, went to be with the Lord after his courageous battle with cancer on Tuesday, January 28, 2014, in Winchester Medical Center. Memorial contributions may be made to Woodbine Assembly of God, P.O. Box 122, Clear Brook, Virginia, 22624 or Epilepsy Foundation of Virginia, 500 Ray C. Hunt Drive, Charlottesville, Virginia, 22903. Carol A. McFarland Carol Ann DeHaven McFarland, 65, of Frederick County, Virginia, died Tuesday, January 28, 2014, in Winchester Medical Center. In Lieu of flowers, memorial contributions may be made to the American Cancer Society, 2654 Valley Avenue, Suite B, Winchester, Virginia, 22601. Marjorie Copenhaver Marjorie Louise Hunter Copenhaver, 90, of Winchester, died Monday, February 3, 2014, in Front Royal. Memorial contributions may be made to the Winchester-Frederick County Historical Society, 1340 S. Pleasant Valley Rd. , Winchester, VA 22601 or to French and Indian War Foundation, P.O. Box 751, Winchester, VA 22604. Walter O’Bryan Walter Wallace O’Bryan Jr., 84, of Winchester, VA, died Friday January 31, 2014 at the Winchester Medical Center. Memorial contributions may be made to Shenandoah Valley Baptist Church, 4699 Valley Pike, Stephens City, VA 22655.

Stephens Diversions City

Structure fire at White Oak Campground

David L. Ash David Lee “Booster” Ash, 73, of Stephens City, Virginia, died Monday, February 3, 2014 at Winchester Medical Center. Memorial contributions may be made to Stephens City Volunteer Fire and Rescue, 5346 Mulberry Street, Stephens City, Virginia 22655.

Lawrence J. Hayes Lawrence Joseph “Larry” Hayes, age 76, of Winchester, Virginia, died Friday, January 31, 2014, at Winchester Medical Center. In lieu of flowers, contributions in the memory of Mr. Hayes may be made to a church or charity of the donor’s choice or to the HackermanPatz Patient and Family Pavilion at Johns Hopkins, 301 North Broadway, Baltimore, Maryland 21231.

Mid February, 2014 • Warren & Frederick County Report • Page 37

Google Earth image of White Oak Campground

New Beginnings Community Greetings “Introducing Your Business to New Homeowners in our Community”

***

P.O. Box 1025 Front Royal, VA 22630 540 635-8660

The structure was a total loss. Damage estimates are approximately $10,000. No civilian or firefighter injuries reported. One adult was displaced. Red Cross was not needed. The fire started due to a leaking propane tank. The cause of the fire is accidental in nature Fire and Rescue units from Stephens City, Middletown, Millwood, Frederick County Battalion 10 Duty Officer, the Fire Marshal’s office and assistance from Shawnee Fire Department in Winchester City responded to the incident. Frederick County Sheriff ’s Office responded for traffic control.

Julie’s Cleaning Service 15+ years exp, quality, value & service in Warren County & surrounding areas. Julie Shenk, owner/operator. 540-635-3366 • 540-671-0983 nogoodcowboys@yahoo.com

2003 Chevy Silverado PU for sale

For Sale by owner:

Z71, Ext.Cab, Shortbed, 4X4, Auto, 5.3 Lt, New Inspection, Pwr-W/L/D/M, AC/AM/FM, runs great, VGC, few dings, Tow Pkg, 142K Highway miles, interior good.

ONLY $9,000 Call 540-551-2072

Auction Gallery at the Middle of Main (3rd floor)

213 East Main St., Front Royal, VA

Offering full line of auctioning, moving and storage services.

Visit us at Auctionzip.com Auctioneer #4400

for details about our auctions & other services services. Now accepting consignments! SALE TERMS: Cash, Good Check, Visa & MasterCard (add 4% fee to charge cards) Sales subject to 10% Buyers’ Premium – Good Food! Not Responsible for Accidents!

Auctioneer: Tom Eshelman, Va. Lic.# 003365 Announcements day of sale take precedence over printed matters. We are located on Main Street in Downtown Front Royal above the Middle of Main Building. Plenty of parking behind building! Use Jackson Street access. Elevator access available.

For more information/directions, please call

(540) 636-2969 or (540) 631-4988


Page 38 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Mid February, 2014

Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

To advertise in Warren & Frederick County Report, Contact: Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072 or Angie Buterakos at angie@warrencountyreport.com â&#x20AC;˘ 540-683-9197

Community

Harlem Rockets comedy basketball team to perform in Front Royal The Warren Wildcat Athletic Association will be hosting some very special guests on Feb 22, 2014 at 6:00pm at Warren County High School. The Harlem Rockets, a talented group of basketball entertainers who combine incredible showtime basketball skills and family-friendly comedy will face the Warren County All-Stars in a game benefiting the student-athletes of Warren County High School. Having played over 2500 games in 16 years without a single defeat, the Harlem Rockets offer something for everyone to enjoy. Sports enthusiasts will be intrigued by the athleticism and size of the Rockets including. Basketball aficionados will be dazzled by the ball-handling wizardry of Clarence â&#x20AC;&#x153;Mugsyâ&#x20AC;? Leggett. Mugsyâ&#x20AC;&#x2122;s one of the worldâ&#x20AC;&#x2122;s extraordinary dribblers and former Harlem Globetrotter. Satiated by the game of Devon â&#x20AC;&#x153;Super Athleteâ&#x20AC;? Curry and left awestruck by high-flying dunks of Cliff

â&#x20AC;&#x153;Jet Blueâ&#x20AC;? Malone. Whom, just was featured in the Nike commercial released on Super Bowl day. Fans will be awe-struck when they see Curtis â&#x20AC;&#x153;Pee-Weeâ&#x20AC;? Johnson, who stands 7â&#x20AC;&#x2122; 5â&#x20AC;? tall and graduated from St. Johnâ&#x20AC;&#x2122;s University. And since this is comedy basketball, the Harlem Rockets present to you the â&#x20AC;&#x153;Crown Prince Of Laughsâ&#x20AC;? James â&#x20AC;&#x153;Speedyâ&#x20AC;&#x153; Williams. One Of Show Basketballâ&#x20AC;&#x2122;s All Time Greatsâ&#x20AC;?. Speedy was featured in the movie â&#x20AC;&#x153;Above The Rimâ&#x20AC;? and the NIKE Free-Style Commercial. He also, performed with Jay Z at the MTV Music Awards. The Harlem Rockets incorporate the audience, especially children, into the show and are always available to meet the fans and give autographs at halftime and after the game. In this special event to raise money for the student-athletes of Warren County High School, the Warren County All-Stars have graciously

agreed to face the Harlem Rockets. The Warren County All-Stars are comprised of Warren County alumni, staff and members of the community at large.

Tickets for what promises to be a fun-filled evening for the community are available at Warren County HS home sporting events, Parks and Rec basketball games, Warren County

High School front office or by contacting Shannon McMackin at 540539-6827 or via e-mail at smcmackin@gmail.com or at the door. â&#x20AC;&#x201C; briefs@warrencountyreport.com

All Sports... All the time

Front Royal Little League & Washington Nationals Baseball  

Offering:      

Â&#x2021;6WXGHQW&ODVVURRP Â&#x2021;%HKLQGWKH:KHHO Â&#x2021;5H([DPLQDWLRQV

Ask about discounts for siblings and payment in advance!

Now Accepting applications! check out our online scheduling program:

SCHEDULE 2 DRIVE!

(DVW-DFNVRQ6WUHHWÂ&#x2021;)URQW5R\DO9$

540-622-6900

Plus the award-winning News At Noon & Valley Today, local news & sports updates throughout the day and up-to-date weather from local meteorologist Kemp Miller Serving Front Royal and Warren County since 1948

www.facebook.com/SportsRadio1450WFTR


Read full issues FREE on www.WarrenCountyVA.com & www.FrederickCounty.com

Mid February, 2014 â&#x20AC;˘ Warren & Frederick County Report â&#x20AC;˘ Page 39

To advertise in Warren & Frederick County Report, Contact: Angie Buterakos at angie@fredcoreport.com â&#x20AC;˘ 540-683-9197 or Alison at alisond@warrencountyreport.com â&#x20AC;˘ 540-551-2072

Pets Page

AVALONIA

Mystical Awakening

Barney

OPENING TO OUR CONSCIOUSNESS FROM WITHIN AT

MOUNTAIN MYSTIC COMPANY

Hound Mix Adult / Male / Large

6RXWK6WÂ&#x2021;)URQW5R\DO Sat. Feb. 8 @ 10am Sun. Feb. 9 @ 12pm

Experience the stores great atmosphere and gift yourself to Inspiring Wellness Services from Avillion Aura Photography to Astrology, Thai Reflexology, Angel Readings, Tarot Card & Celtic Cross Readings plus Spiritual Consultations. Details at the Store or Call us!

Â&#x2021; IDFHERRNFRPDYDORQLDKHDOLQJÂ&#x2021;ZZZ$YLOOLRQRUJ

540-635-4734

Call Gary

Ad sponsored by:

540-636-9875 and 540-683-1045

7726 Main St. Middletown

Frederick Co. Esther L. Boyd Animal Shelter 161 Fort Collier Rd. Winchester, VA 540-667-9192 To sponsor a pet contact Angie at angie@fredcoreport.com or 540-683-9197

540-508-0678

Humane Society of Warren County

540-635-4734

Monday thru Sunday 10 am to 4 pm - Closed Wednesday â&#x20AC;˘ 1245 Progress Drive, Front Royal, VA â&#x20AC;˘ 540-635-4734 â&#x20AC;˘ humanesocietywc@gmail.com

Please ask about our low cost spay and neuter program. Please be sure your pets at home are spayed/neutered and up to date on vaccinations. Dog adoption available on Sat. 10 -2 at Petco â&#x20AC;˘ Cat adoption available on Sat. 10 - 2 at Southern States â&#x20AC;˘ Dogs and Cats available on Sat. 10 - 2 at Helmuth Builders â&#x20AC;˘ Please make sure your pets have adequate protection from the frigid temperatures!! Kiya - 2 year old female boxer mix. Kiya is a very sweet girl who was found as a stray. She was a little on the shy side when she first came to the shelter, but is very friendly with the staff now. Sheâ&#x20AC;&#x2122;s a affectionate and loving girl looking for that special someone to take her home.

Marley - 3 year old female boxer/lab mix. Marley lived with a 10 year old child and was great with him and also gets along with other dogs. She is house trained and knows sit, lie down, and stop. She is a very sweet girl who just needs someone to love her.

Kiyaâ&#x20AC;&#x2122;s ad sponsored by:

Marleyâ&#x20AC;&#x2122; ad sponsored by:

Hot Tub Heaven Vacation Cabins

Hillbillyâ&#x20AC;&#x2122;s Junkyard

Dog Friendly!

540-636-1522

HotTubHeaven@yahoo.com

http://www.hottubheavencabins.com

Hillbilly has what you NEED! 4381 Stonewall Jackson Hwy Bentonville, VA â&#x20AC;˘ 636-2671 hillbillysjunkyard.com

Cecil - 5 year old male terrier/pekngese mix. Cecil is a very friendly and handsome fellow who gets along well with other dogs.

Cecilâ&#x20AC;&#x2122;s ad sponsored by:

Trevor - 8 month old male beagle mix. Trevor is an adorable beagle pup that came in as stray. He is about 8 months. Trevor is a very playful and sweet fellow and is good with other dogs and cats.

Trevorâ&#x20AC;&#x2122;s ad sponsored by:

Wanda Snead

Property Management

Martins Foods 409 South St. Front Royal

Serving the area for 16 years!

540-635-2249

SamSneadRealty.com

Sam Snead Realty â&#x20AC;˘ 540-635-9753

With your help we have been able to place thousands of animals in good homes. Contact Alison @ 540-551-2072 if you would like to become a pet sponsor too!


RE-INVENTING CUSTOMER SERVICE! CUSTOMER SATISFACTION

is

Factory Recommended Scheduled Maintenance Discount Special

#1

$

t Family owned - so we treat you like family. t Our Technicians have combined over 80 years of technical experience. t Serving The Shenandoah Valley for over 65 Years. t New extended hours to serve you better. t Our Own Exclusive Service Rewards Plan. t Complimentary car wash on most services. t Rental car available on site t Shuttle service available.

Buy 1 Oil Change at $6995 GET THE NEXT 3 OIL CHANGES

FREE

$61.80 $AVINGS!

1994 vehicles and newer up to 5-quarts, Synthetic and some models slightly higher. Excludes Diesels Plus any applicable tax, shop supplies and environmental fees. One coupon per visit. Coupon must be presented prior to service write-up.Offer ends 2/28/14. Not valid in conjunction with any other coupons or in-store specials. Good only at MARLOW MOTOR COMPANY.

10% 12% OFF OFF Discount on labor only,

FREE

AND GET A 4-WHEEL ALIGNMENT

$80 $AVINGS!

Complete Vehicle Detailing

$

99



Truck & SUV

129

$

00

Some models may be slightly higher. Plus any applicable tax, shop supplies and environmental fees. One coupon per visit. Coupon must be presented prior to service write-up. Offer ends 2/28/14. Not valid in conjunction with any other coupons or in-store specials. Good only at MARLOW MOTOR COMPANY.

&KHYUROHW6LOYHUDGR/7 Extended Cab, 5.3L V-8, Auto 51K Miles Stock #14R4153B

$24,577

7 YEARS TAKE

Cabin Air Filter Replacement

15% OFF

JUST

$

NEEDED!

JUST BRIN

G IT IN!

w/any replacement or install

$25 OFF any Fluid System Service Transmission * Brake * Coolant Power Steering * Differential

Plus any applicable tax, shop supplies and environmental fees. One coupon per visit. Coupon must be presented prior to service write-up. Offer ends 2/28/14. Not valid in conjunction with any other coupons or in-store specials. Good only at MARLOW MOTOR COMPANY.

'RGJH$YHQJHU0DLQVWUHHW



$10 OFF

Plus any applicable tax, shop supplies and environmental fees. One coupon per visit. Coupon must be presented prior to service write-up. Offer ends 2/28/14. Not valid in conjunction with any other coupons or in-store specials. Good only at MARLOW MOTOR COMPANY.

Extended Service Hours For Your Convenience

4dr. sedan, 2.4L I-4, Auto. 39K Miles Stock #U310A

39



with Diagnostic Printout

Keep Your Vehicle Properly Maintained!

MONDAY - FRIDAY 7AM-7PM! SATURDAY 8AM-5PM!

$

Battery & Charging System Check

23-POINT INSPECTION Coupon must be presented prior to write-up. Plus any applicable tax, shop supplies and environmental fees. One coupon per visit. Coupon must be presented prior to service write-up. Offer ends 2/28/14. Not valid in conjunction with any other coupons or in-store specials. Good only at MARLOW MOTOR COMPANY.

FOR JUST

FREE

NO APPOIN TMENT

PLUS 15% OFF ANY REPAIRS Noted During Inspection

&KU\VOHU/;

69



ADD A

Engine Air Filter

Some models may be slightly higher Plus any applicable tax, shop supplies and environmental fees. One coupon per visit. Coupon must be presented prior to service write-up. Offer ends 2/28/14. Not valid in conjunction with any other coupons or in-store specials. Good only at MARLOW MOTOR COMPANY.

&YUFOE7FIJDMF-JGF *ODSFBTF3FTBMF7BMVF$POTFSWF(BT8IFO:PV

t Hand wax t Hand wash t Clean interior t Clean engine compartment t Clean trunk

Car

PLUS 1-DAY NO-CHARGE -0"/&37&)*$-& Plus any applicable tax, shop supplies and environmental fees. One coupon per visit. Coupon must be presented prior to service write-up. Offer ends 2/28/14. Not valid in conjunction with any other coupons or in-store specials. Good only at MARLOW MOTOR COMPANY.

not to exceed $150.00 Plus any applicable tax, shop supplies and environmental fees. One coupon per visit. Coupon must be presented prior to service write-up. Offer ends 2/28/14. Not valid in conjunction with any other coupons or in-store specials. Good only at MARLOW MOTOR COMPANY.

Buy 4 Tires FREE!

6 YEARS TAKE

PIT-STOP SPECIAL

Restrictions may apply, ask for details Plus any applicable tax, shop supplies and environmental fees. One coupon per visit. Coupon must be presented prior to service write-up. Offer ends 2/28/14. Not valid in conjunction with any other coupons or in-store specials. Good only at MARLOW MOTOR COMPANY.

Any 30,000 Mile t 60,0000 Mile t Clean interior t 90,000 Mile Maintenance

ELDER AUTO CLUB SPECIAL 5 YEARS OLD TAKE

 OFF 00

4 dr. sedan, 2.4L I-4, Auto., moonroof. 6K Miles Stock #14Q4152N



.LD6SRUWDJH/; 4 dr. SUV, 2.0L I-4, Auto. 116K Miles Stock #U315B

$6,977

TAX, TAGS & TITLE FEES NOT INCLUDED. $289 PROCESSING FEE not included. $OOYHKLFOHVVXEMHFWWRSULRUVDOH$35ÂżQDQFLQJLVVXEMHFWWRDSSURYHGFUHGLWDQGOLPLWHGWRDQGQHZHUPRGHO\HDUYHKLFOHV$35IRUPRQWKVUHVXOWV LQPRQWKO\SD\PHQWHTXDOWRSHUWKRXVDQGÂżQDQFHG=HURGRZQRQDSSURYHGFUHGLW

.PO'SJ".1.t4BU".1.t$MPTFE4VOEBZ

Mid February 2014 Warren and Frederick County Report  

Local news for Front Royal, Linden, Bentonville, Browntown, Middletown, Stephens City, Winchester, Warren County and Frederick County, Virgi...

Read more
Read more
Similar to
Popular now
Just for you