Page 1


About Airparts Co, Inc.

Manufacturers Whelen Engineering Company, Inc. Good Year Tires Champion AV-22 Champion AV-14 Consolidated Application Data Donaldson Filtration Solutions Corrosion X RejeX LP Aero Plastics Inc. Barry Controls Aerospace


The Company Behind the nondescript facade of a lowslung building near Fort Lauderdale Airport lies a treasure trove for airplane enthusiasts. Hundreds of plane components are stacked on floor-to-ceiling shelves; the packages and boxes boast such obscure products as “Avex Rivets,” “Valve Cover Gaskets” and “Mouse Milk Lubricant.” Trucks shuttle constantly between the loading bay and the nearby runways. This is the headquarters of Airparts Company Inc., one of the foremost U.S. wholesalers of parts and engines for the general-aviation industry. Upstairs, in an office adorned with wooden models of the jets and planes that make up the company’s market Cessna, Hawker Beechcraft, Learjet, Piper sits Airparts’ unlikely CEO , a bright, vigorous woman named Marta Maxwell. Next to her sits her dapper, convivial husband George, the company’s vice-president. Marta’s children, Andy and Emy, Airparts’ sales manager and general manager respectively, oversee the daily comings and goings; this is the epitome of a family business. Airparts began life in Marta’s garage in Wichita, Kansas, in 1963; 45 years later, Airparts boasts over 50 employees, a network of 1,200 dealers which provides a cozy cushion of 8,500 customers in 70 countries including most of Latin America, Europe and Africa, as well as Pakistan, Israel, and even Papua New Guinea, and revenue of approximately $43 million per year. “It just goes to show what a little determination can do,” says Marta, with justifiable pride. Make that determination spiked with canny business acumen. Marta began Airparts when she and her first husband, a pilot looking for work at Cessna, left their native Argentina for Kansas. “Wichita has always been the air capital of the world, and was a magnet for pilots back then,” says Marta. “Cessna, Learjet, Beechcraft and Boeing are all based in the town, and there was a lot of traffic between there and Latin America. I originally sold things like headphones and sunglasses to the pilots, but then they started asking me if I could get hold of tires, brakes, fuel pumps and such, to help them service their planes. They spoke no English, so I acted as a broker for them. That’s how the business originally got off the ground.” However, there was some initial turbulence to negotiate. Marta divorced in 1969 and was awarded the fledgling company as part of the settlement. She found herself with two young children and banks that were less than enthusiastic about her plans to expand the business. One


manager actually advised her to open a beauty parlor instead. Fortunately the vice president at her local bank, who, as luck would have it was also a woman, granted her the loan she needed. It provided a boost to the cash flow of the business and was the key to its success. “I knew there was a market, and no one was serving it,” says Marta. “I went out and cultivated the personal relationships with the pilots and the air companies.” (Indeed, Marta’s multilingual barbecues became legendary in pilot circles.) “The entire growth of the company has been, predominantly, by word-of-mouth,” she continues. “People know not only that we are reliable, but also that we’ll go the extra mile for customer service we’ll stay open that extra half-hour, we’ll even hop on our own jet on Friday evening to deliver an urgent part to Argentina or Brazil if you need us to.” It’s this attention to detail that’s won Marta the numerous business-leadership awards that vie for space with the model planes on the company’s shelves, including the Small Business Person of the Year (U.S. SBA for Kansas) in 1989 and Exporter of the Year (U.S. SBA) 1988. “We haven’t been 45 years in the business without learning a thing or two,” she opines, a twinkle in her eye. Marta married George Maxwell, an aeronautical engineer who’s also a pilot, in 1982, and they relocated the main part of their business to Fort Lauderdale while still maintaining a subsidiary office in Wichita. The move to Florida was convenient on two counts many of the small jets are now maintained on the East Coast, and the Maxwells had an eye on their eventual retirement. However, Marta and George aren’t about to fly their Citation jet into the sunset just yet. They still assiduously attend the office and play a central role in company decision-making. But their


exit strategy has always been to hand the company on to the next generation. Andy has been taking the company into new territories, Brazil and Mexico this year, possibly Argentina and Panama next. Emy has a degree in business administration and is in charge of Airparts’ finances. “We’re hoping that the kids will take up the mantle,” says George, as Andy and Emy join them at the conference table. “We haven’t actually worked anything out formally yet. But the outlook for the industry is good. More and more people are deserting the major airlines and using the private jets and turboprops whose parts we sell, and, because our business has always been predominantly export, we have some protection from any downturn in the U.S. economy. Our orders are very healthy, thanks to the weak dollar; domestic sales are steady but foreign sales are buoyant. And we’re always looking to venture into new markets; as one market drops, another Russia or China, for example rises.” For these reasons not to mention continuing growth of around 20 percent a year there’s been a lot of outside interest in the Airparts brand. “We’ve had several companies call us, expressing interest in buying us out, but we’re just not interested at the moment” says the pragmatic Emy. “If someone comes along and offers us $200 million, I’m not sure if you’ll find these two working in Airparts any longer,” is George’s wry view of any potential buyout. “But in the meantime, our prospects for international growth are sky-high,” offers Andy, who has inherited Marta’s former role of initiating new connections and business partnerships. “Every time I travel, people ask me, ‘When are you going to open up here?’ Not only are we a one-stop shop for these companies, we also have a cast-iron reputation for honesty and probity. And that’s priceless.” Most of that reputation, as Andy and Emy are quick to acknowledge, rests on Marta and George’s tenacious drive and personal charm. But the family is facing the prospect of the change of Airparts’ principal crew with equanimity. “The most important lesson I have learned in business is that the name of the game is friendship,” says Marta. “You need to get to know the locals and their customs wherever you sell, and oil the business wheels, and Andy is great at that, while Emy keeps a tight rein on our expenses. I know that with these two, the future of the company couldn’t be in safer hands.” Text:Stuart Husband Photography:Mackenzie Stroh


Airparts Co., Inc. - Locations

AIRPARTS CO.,INC. FL (HEADQUARTERS) 2310 NW 55th Court, Ft. Lauderdale, FL 33309 Phone: (954) 739 3575 Fax: (954) 739 9514 Sales: (800) 392 4999

AIRPARTS CO.,INC. KS 1991 Airport Road, Wichita, KS 67209 Phone: (316) 943 2377 Fax: (316) 943 1023 Sales: (800) 333 4221

AIRPARTS CO.,INC. NC 364 Dixon St., Lexington, NC 27292 Phone: (336) 956 7778 Fax: (336) 956 8699 Sales: (800) 245 0291

AIRPARTS DE COLOMBIA S.A. Cra 111 N 23D-38, Bogota D.C. Tel. 418-3023 / 421-6511 Fax. 547-1560

AIRPARTS DEL PERÚ SAC Rep. de Panama # 491 Callao - Lima Peru. Tel. (511) 465-3193 Fax. (511) 429-7133 USA. (954) 338-6795

AIRPARTS DO BRASIL LLC Av. Emilio Antonon, 671 Aeroporto Jundiai/SP CEP: 13212-010 Tel/Fax: +55 11 4582 2065 Phone: (954) 337-2193


INDEX/COMPANY INFORMATION

2

NEW PRODUCTS FOR 2010

3

ANTI-COLLISION LIGHTING SYSTEM

4

INDEX

POWER SUPPLIES LIGHTHEADS

5-7 8-15

SELF-CONTAINED LIGHT ASSEMBLIES

16-22

POSITION LIGHT ASSEMBLIES

23-25

INTERIOR LIGHTING

26-29

EXTERIOR LIGHTING

30-36

MISCELLANEOUS

37

HELICOPTER SIRENS & SPEAKERS

38

WHELEN LED ILLUMINATION

39

APPLICATION PHOTOS

40

STROBE POWER SUPPLY REPLACEMENT LISTING

41

STROBE SYSTEM RECOMMENDATIONS

42-47

WHELEN CROSS REFERENCE LISTS

48-50

ENGINEERING COMPANY, INC.

Makers of Aviation, Automotive and Industrial Safety Lighting since 1953 The Finest Designed...Assembled...Tested... Aviation Warning Products...Manufactured In the U.S.A.

Office:

Jeff,

Carl,

Sharon,

Bob,

Jessica,

Bruce

Greg

Visit Whelen at... www.whelen.com view our products & contact us! We can be e-mailed at aviation@whelen.com

Corporate Manufacturing Facilities in Chester, CT and Charlestown, NH

2

Corporate Pilots: Dennis & Jim


Interior Lighting

Model 71410 Series LED white Anti-Collision Beacons are FAA TSO compliant self-contained LED AntiCollision Lights. See Page 17.

Model 71414 Series is an LED inspection light designed to replace GRIMES A5395-23 on the S76 Helicopter. See Page 29.

71460 Blue LED Flashing Identification Beacon is a blue LED flashing beacon that fits the 5-hole mounting pattern common to rotorcraft. See Page 17.

71375 Series LED Flasher Asssembly, is an electronic light flasher for use with Whelen LED Exterior Lighting products. See Page 32.

Post Light Assemblies

Model 71485 Series Covert IR/Red Combination Beacon (Supplemental Anti-Collision) is a combination Aviation red visible and IR flashing beacon produced as a derivative of our Models 71080 & 90520. See Page 17.

Model 71434, 71440 & 71450 Series The 71434, 71440, & 71450 Series LED (Light Emitting Diode) instrument post light assemblies are designed to illuminate the instrument panel and function as instrument mounting bolts. See Page 26.

71450 71434

90588 LED Wingtip Anti-Collision Light is a drop in replacement for Goodrich GE16846-1 See Page 20. 71430 RED LED Anti-Collision (RO) Series, 71430 is a dual-mode RED Anti-collision Light with a reduced output feature. See Page 17.

Lightheads 71457 Current Source / Flasher (Models 90569 & 71495) our combination flasher and LED current source for 90569 Forward and AFT POS/ACL Assembly. See Page 8.

71495 Wingtip LED Anti-Collision Light Series uses the LED assembly from 90588 and is a surface mount alternative for applications on a wingtip, winglet or tailcone area. See Page 9. Model 90569 Series LED Forward/Aft Position & Anti-Collision Light, the smallest all LED 400 effective POS/ACL assembly in the world! See Page 8.

Model 71379 Series LED Forward Position Light is an LED W1250 wingtip forward position light designed to be located under a fairing, but is suitable for external mounting. See Page 23. 71499 LED Infra-Red Identification Light is a surface mounted LED IR flasher assembly with nearly 30 times the intensity of our Model 70513. See Page 25.

Miscellaneous Model 1062IR Lens, an Infra-Red Strobe light lens only, is designed to replace multiple Whelen remote strobe and self-contained strobe products. See Page 13.

NEW! Model 90615, a drop in replacement for Grimes 30-1-12-5 (Northrup Grumman RC-12/King Air, also found on other military aircraft). See Page 20.

NEW AVIATION PRODUCTS FOR 2010

Self Contained Light Assemblies

PARMETHEUS™ SERIES LED PAR-36 “Drop-In” Replacement Lighthead ad

®

LED lighting is the ideal lighting for aviation applications, with Whelen TIR™ (Total Internal Reflector) technology, which rivals strobe in intensity and effectiveness. Whelen LED lights are time & field-tested for reliability and long-life d performance under the tough conditions required by Fire, Emergency, DOT and Law Enforcement professionals around the world. Parmetheus PAR-36 LED lights are a drop-in replacement lighthead for outdated PAR-36 Halogen and HID lamps. Lightweight, low-current and moisture resistant, they provide stable light output for thousands of trouble-free operating hours. They are the first commercially available PAR-36 LED for Aviation applications and are available in Landing and Taxi versions. Convenient “drop-in” design for or e, ease of installation and includes polycarbonate, replaceable, hard-coated outer lens with a metal, heat dissipating coated housing. As with all Whelen products they are proudly designed and manufactured in the USA. See Page 30.

3


360º

+30º

+75º +30º

-30º

-30º -75º

An approved anti-collision strobe light system must project light + or - 30° above and below the horizontal plane of the aircraft. One or more strobe lights can be used. The + or - 75° projected light is required since July 18, 1977. 0º

RI G

I RD

180º

OB TAIL STR

E

RAG

C

FT

LE

TH

BE

IR QU

ED

O

WI

Tail Position White 70º

TR

Tail Position White 70º

G T IP S

Position Green 110º

W IN

Position Red 110º

OV E

BE

HT

NGT IP ST R O

An approved anti-collision strobe light system must project light 360° around the aircraft’s vertical axis. One or more strobe lights can be used.

IF RE

E

ANTI-COLLISION AND POSITION LIGHT REQUIREMENTS, LOCATIONS, & DISTRIBUTION PATTERNS All aircraft must have an approved anti-collision light and position light system for nighttime operations. The position lights consist of an Aviation Red on the left side, an Aviation Green on the right and an Aviation White taillight (REF. FAR 23.1389). The anti-collision lighting system is required under FAR PART 91.205(c). There are different requirements affecting different aircraft. These aircraft are categorized by the date of application for type certificate. Home built aircraft are determined by the date of issuance of the Experimental Operating Limitations. The different categories are as follows: Aircraft for which type certificate was applied for after April 1, 1957 to August 10, 1971: These anti-collision systems must produce a minimum of 100 effective candela in Aviation Red or White (REF. FAR 23.1397), 360º around the aircraft’s vertical axis, 30º above and below the horizontal plane (REF. FAR 23.1401). Aircraft for which type certificate was applied for after August 11, 1971 to July 18, 1977: These anti-collision systems must produce a minimum of 400 effective candela in Aviation Red or White (REF. FAR 23.1397), 360º around the aircraft’s vertical axis, 30º above and below the horizontal plane (REF. FAR 23.1401). Aircraft for which type certificate was applied for after July 18, 1977: These anti-collision systems must produce a minimum of 400 effective candela in Aviation Red or White (REF. FAR 23.1397), 360º around the aircraft’s vertical axis, 75º above and below the horizontal plane (REF. FAR 23.1401). Note: The position lights must be wired independently of anti-collision lights.

LOCATIONS ON THE AIRCRAFT FOR ANTI-COLLISION STROBE LIGHTS, TO COMPLY TO THE LIGHT PATTERN REQUIREMENTS

VERTICAL FIN

WING TIP

One anti-collision strobe light mounted on the vertical fin will meet the minimum requirements on most aircraft. A half red and half white lens is recommended.

Two wing tip strobe lights that protrude beyond the wing tip.

ENCLOSED WING TIP

In a fuselage mounted anti-collision strobe light system, a minimum of two strobe lights are necessary to get the required vertical coverage. This is an approved anti-collision system.

INSTALLATION LOCATIONS WING TIP: The major difference in systems is the location of the strobe power supplies which can be mounted locally, one in each wing tip, or a single power supply can be mounted in the fuselage. Installation time can be greatly reduced if done in conjunction with an annual or one hundred-hour inspection. Properly installed power supplies and cabling are necessary for the safe operation of Whelen or any light systems. FUSELAGE: Fuselage mounted units can be either self-contained with the power supply and lighthead as one unit, or remote lightheads run off a separate power supply. To meet the field of coverage, one must be on the top of the fuselage and one on the bottom. VERTICAL FIN: Finally, if applicable, a single anti-collision light can be mounted on the vertical stabilizer. It can be either a self-contained or remote lighthead depending on the aircraft.

®

ANTI-COLLISION LIGHTING SYSTEM

POSITION LIGHTS AND ANTI-COLLISION LIGHT DISTRIBUTION PATTERNS REQUIREMENTS

Enclosed wing tip anti-collision strobe lights, require a third strobe light on the tail or vertical fin, to fill in the required light envelope. This is an approved anti-collision system.

4

FUSELAGE

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.


The power supply needed depends on the application, and the mounting location. Model HDACF Series is a fuselage mounted power supply that will power two or three lights. Model A490ATSC Series is designed for installation adjacent to the strobe lighthead and will power one light assy. Model A490TCF Series is the most economical power supply when adding only one light. It mounts adjacent to the strobe lighthead assembly (not legal for light output with red strobe light). Most other Whelen power supplies are application specific, contact factory for details. Unless otherwise noted, all power supplies are CometFlash®. Whelen Engineering is proud to have introduced the CometFlash CF, a major advancement in the field of safety lighting. By pulsing the flash tube four times in rapid succession, the effective “on-time” of the strobe is increased from 2/1000 of a second to 4/10 of a second. This increases your airplane’s visibility. The development of the CometFlash reflects Whelen’s dedication to safety.

MODEL HDACF SERIES (NSN 6210-14456688) HDACF series provides simultaneous flashing, alternate flashing or both. It will operate one, two or three strobe lightheads. Operating the wing tip strobes in the alternating mode will provide an accumulated 42 joules of power to each light. When in the simultaneous mode, the accumulated power to each light is 21 joules. In the three light mode, the wing tips will flash simultaneous at an accumulated 21 joules each, they alternate with a third light operating at an accumulated 42 joules. On the trigger selector outlet, a switch mounted in place of the jumper will allow wing tip outlets 2 & 3 to be turned off, while the tail outlet 1 will remain on. This function is commonly used when the third light is for ground operations. This power supply will operate from 10 to 30 VDC. SPECIFICATIONS: ■ Drawing Number: 70028 ■ ■

Power Consumption: 7.0 amps @ 14 VDC; 3.5 amps @ 28 VDC ■ Weight: 2.1 lbs. (953gm) Length: 5.50” (140mm) ■ Width: 5.0” (127mm) ■ Height: 2.37” (60mm)

Model #

Part #

Description

Approvals

HDACF

01-0770028-05

A413AHDACF power supply

FAA/PMA

POWER SUPPLIES

HOW TO CHOOSE A POWER SUPPLY AND ABOUT COMETFLASH®

MODEL A490ATSC SERIES A490ATSC series operates one strobe lighthead. Its compact size allows mounting in the wing tip and/or the tail, adjacent to the lighthead. It produces an accumulated 34 joules of power and can be equipped to flash simultaneously with up to 5 other like units by connecting an 18 gauge wire between outlet 3 on the input power connector. This power supply will operate from 10 to 30 VDC. SPECIFICATIONS: ■ Drawing Number: 70062 ■ ■

Power Consumption: 4.0 amps @ 14 VDC; 2.0 amps @ 28 VDC ■ Weight: 1.7 lbs. (771gm) Length: 5.0” (127mm) ■ Width: 3.12” (79mm) ■ Height: 3.06” (78mm)

Model #

Part #

Description

Approvals

A490ATSC

01-0770062-03

A490ATSCF power supply

FAA/PMA

MODEL A490TCF SERIES (NSN 6130-10071195) A490TCF series operates one strobe lighthead. It is our most compact unit and can be mounted in the wing tip and/or the tail adjacent to the lighthead. It produces an accumulated 19 joules of power. It will only meet 400 CP when used with the A470A-W. This unit cannot be synchronized. This power supply operates from 10 to 30 VDC (not approved for use with red strobe light). SPECIFICATIONS: ■ Drawing Number: 70006 ■ ■

Power Consumption: 1.7 amps @ 14 VDC; 0.85 amps @ 28 VDC ■ Weight: 1.2 lbs. (544gm) Length: 5.0” (127mm) ■ Width: 3.12” (79mm) ■ Height: 2.38” (60mm)

Model #

Part #

Description

Approvals

A490TCF A490TCFM 7000615

01-0770006-08 01-0770006-14 01-0770006-15

Standard unit, 20” leads, amp connectors 20” leads, Molex connectors 20” leads, no connectors

FAA/PMA — —

MODEL A490TCCF SERIES A490TCCF series is the same as the A490TCF but has a mounting plate with additional holes that directly replaces factory installed systems on single engine Cessnas, Aero Commanders, and Grumman Americans. SPECIFICATIONS: ■ Drawing Number: 70006 ■ ■

Power Consumption: 1.7 amps @ 14 VDC; 0.85 amps @ 28 VDC ■ Weight: 1.2 lbs. (544gm) Length: 5.0” (127mm) ■ Width: 3.12” (79mm) ■ Height: 2.38” (60mm)

Model #

Part #

Description

Approvals

A490TCCF 7000612 7000616 7000617

01-0770006-09 01-0770006-12 01-0770006-16 01-0770006-17

Standard unit, 20” leads, amp connectors 9” output, 7” input, leads (CESSNA 172) 20” leads, ms connector on output lead 3” output, 7” input & 4 pos. amp connector (CESSNA) (182,206)

FAA/PMA — — — ®

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

5


POWER SUPPLIES

MODEL 90101 SERIES 90101 series is similar to the HTCF but has military connectors. It is available in SingleFlash or CometFlash®. Several different configurations are available for application specific installations. SPECIFICATIONS: ■ Drawing Number: 90101 ■ ■

Power Consumption: 4 amps @ 14 VDC; 2 amps @ 28 VDC ■ Weight: 1.7 lbs. (771gm) Length: 5.0” (127mm) ■ Width: 3.12” (79mm) ■ Height: 3.50” (89mm)

Model #

Part #

Description

Approvals

9010100 9010101 9010102 9010104

01-0790101-00 01-0790101-01 01-0790101-02 01-0790101-04

FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a

9010105

01-0790101-05

24 joule, SingleFlash 24 joule, SingleFlash, old style mounting plate 24 joule, SingleFlash, w/add on mounting plate 34 joule, CometFlash, replaces Grimes 602799 when used with mounting brackets 34 joule, CometFlash

FAA TSO-C96a FAA TSO-C96a

MODEL 90079 SERIES 90079 series is similar to the HDACF series, but has military connectors. Connectors 2 & 3 (wing tips) will operate simultaneously and will alternate with connector 1 (tail). When operating two lights, use connectors 1 & 2 to operate in the alternating mode. SPECIFICATIONS: ■ Drawing Number: 90079 ■ ■

Power Consumption: 7 amps @14 VDC; 3.5 amps @28 VDC ■ Weight: 2.3 lbs. (1043gm) Length: 5.50” (140mm) ■ Width: 5.0” (127mm) ■ Height: 2.40” (61mm)

Model #

Part #

Description

9007904

01-0790079-04

9007906

01-0790079-06

42 joule, CometFlash, replaces Grimes 60-1750-1 & 3 42 joule, CometFlash, socket outputs, with add on mounting brackets

Approvals FAA/PMA —

MODEL 90192 SERIES 90192 series produces 34 joules of energy in CometFlash, and can be synchronized with up to 5 other like units by connecting with 18 gauge wire. SPECIFICATIONS: ■ Drawing Number: 90192 ■ ■

Power Consumption: 4 amps @ 14 VDC; 2 amps @ 28 VDC ■ Weight: 2.1 lbs. (953gm) Length: 10.13” (257mm) ■ Width: 3.54” (90mm) ■ Height: 1.9” (48mm)

Model #

Part #

Description

Approvals

9019201

01-0790192-01

Used on JPATS program, replaces Hella #8ES 007 046-01

FAA TSO-C96a

MODEL HDHCF SERIES HDHCF series provides simultaneous flashing, alternate flashing or both (see HDACF for functions). It directly replaces factory installed units on Hughes 500 Series Helicopters. Unit can directly replace 60-1431 -1 & -3 power supplies without wiring or baseplate modifications. This power supply will operate from 10 to 30 VDC. SPECIFICATIONS: ■ Drawing Number: 70117 ■ ■

Power Consumption: 7.0 amps @ 14 VDC; 3.5 amps @ 28 VDC ■ Weight: 2.1 lbs. (953gm) Length: 5.50” (140mm) ■ Width: 5.0” (127mm) ■ Height: 2.37” (60mm)

Model #

Part #

Description

Approvals

HDHCF

01-0770117-01

Power supply A414AHDHCF

FAA/PMA

MODEL HDS SERIES HDS series produces 20 joules of energy, SingleFlash, alternating between two light assemblies. The SingleFlash allows for a low current draw. This power supply will operate from 10 to 30 VDC. SPECIFICATIONS: ■ Drawing Number: 70169

®

■ ■

Power Consumption: 4.0 amps @ 14 VDC; 2 amps @ 28 VDC ■ Weight: 2.0 lbs. (907gm) Length: 5.50” (140mm) ■ Width: 5.0” (127mm) ■ Height: 2.37” (60mm)

Model #

Part #

Description

Approvals

HDS1428

01-0770169-03

Power supply A413AHDS

MODEL C701881 C701881 series produces 15 joules of energy, SingleFlash. It can be synchronized with other like units by connecting with 18 gauge wire. This power supply operates from 10 to 30 VDC. Beech/Raytheon P/N - 100-384118-21. SPECIFICATIONS: ■ Drawing Number: 70188 ■ ■

6

Power Consumption: 1.5 amps @ 14 VDC; 0.75 amps @ 28 VDC ■ Weight: 1.8 lbs. (816gm) Length: 5.0” (127mm) ■ Width: 3.12” (79mm) ■ Height: 3.06” (78mm)

Model #

Part #

Description

Approvals

C701881

01-0770188-00

Power supply

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.


C70178 series produces 20 joules of energy, SingleFlash. This power supply operates from 10 to 30 VDC. SPECIFICATIONS: ■ Drawing Number: 70178 ■ ■

Power Consumption: 1.75 amps @ 14 VDC; 0.8 amps @ 28 VDC ■ Weight: 1.5 lbs. (680gm) Length: 5.0” (127mm) ■ Width: 3.12” (79mm) ■ Height: 3.06” (78mm)

Model #

Part #

Description

Approvals

C701781

01-0770178-00

Power supply

MODEL A1610 SERIES A1610 series produces 22 joules of energy. This wing tip mounted power supply will operate from 10 to 30 VDC. Piper P/N 481-228 SPECIFICATIONS: ■ Drawing Number: 70168 ■ ■

Power Consumption: 4 amps @ 14 VDC; 2 amps @ 28 VDC ■ Weight: 1.5 lbs. (680gm) Length: 5.18” (132mm) ■ Width: 2.18” (55mm) ■ Height: 4.15” (105mm)

Model #

Part #

Description

Approvals

A1610TSC

01-0770168-01

Power supply

FAA/PMA

MODEL 90099 SERIES 90099 series produces 24 joules of energy, SingleFlash, to one light assembly. It flashes simultaneously with up to three other like units by connecting with 18 gauge wire. This power supply operates at 28 VDC. It is used on the DeHavilland Dash 8 aircraft.

POWER SUPPLIES

MODEL C70178 (NSN 6130-13016144)

SPECIFICATIONS: ■ Drawing Number: 90099 ■ ■

Power Consumption: 2.0 amps @ 28 VDC ■ Weight: 1.7 lbs. (771gm) Length: 5.0” (127mm) ■ Width: 3.12” (79mm) ■ Height: 3.12” (79mm)

Model #

Part #

Description

Approvals

9009900

01-0790099-00

Power supply

FAA/PMA

MODEL 70879 SERIES 70879 series operates up to three (3) strobe lightheads at 36 joules each in CometFlash®. This will provide the light intensity required to meet the current FAA requirement of 400 effective candlepower when used in conjunction with the Whelen A612 lens/flashtube configuration. It can also flash two (2) strobe lights in either alternate or simultaneous mode. SPECIFICATIONS: ■ Drawing Number: 70879 ■ Weight: 2.6 lbs. (1179gm) ■ ■

Power Consumption: 2.6 amps avg. ■ Input Voltage: 28 VDC Nominal Length: 5.42" (138mm) ■ Width: 5.03" (128mm) ■ Height: 3.00" (76mm) Model # Part # Description Approvals

7087900

01-0770879-00

Strobe power supply

FAA TSO-C96a Class II, III

MODEL 70899 SERIES 70899 series can operate up to two (2) strobe lightheads at 36 joules each in CometFlash. Lights flash alternately. SPECIFICATIONS: ■ Drawing Number: 70899 ■ ■

Power Consumption: 2.4 amps avg. ■ Input Voltage: 28 VDC Nominal ■ Weight: 1.8 lbs. (816gm) Length: 5.42" (138mm) ■ Width: 5.03" (128mm) ■ Height: 3.00" (76mm) Model # Part # Description Approvals

7089900

01-0770899-00

Strobe power supply

FAA TSO-C96a Class II, III

MODEL 70888 SERIES 70888 series operates one (1) strobe lighthead at 36 joules in CometFlash. It is equipped to flash simultaneously with up to 5 other like units by connecting an 18 gauge wire between outlet 3 on the input connector. SPECIFICATIONS: ■ Drawing Number: 70888 ■ ■

Power Consumption: 1.6 amps avg. ■ Input Voltage: 28 VDC Nominal ■ Weight: 1.3 lbs. (590gm) Length: 5.00" (127mm) ■ Width: 3.12" (79mm) ■ Height: 3.00" (76mm) Model # Part # Description Approvals

7088800

01-0770888-00

Strobe power supply

FAA TSO-C96a Class II, III

®

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

7


LIGHTHEADS

MODEL 90544, LED PATENTED TECHNOLOGY: REDUNDANT LIGHTING AND ONBOARD DIAGNOSTIX™ 90544 series is Whelen's patented “two lights in one” with Diagnostix indication (Wing tip POS/ACL). The most modern inner wing lighting solution on the market today, designed to comply with FAA TSO-C96a Class II (400 ecp) anti-collision light requirements and TSO-C30c forward position light requirements. The LED's provide a significant reduction in current draw over conventional position light bulbs and strobe power supplies. Whelen LED designs virtually eliminate EMI/RFI interference. Model 90544 analyzes circuit condition and can automatically compensate for any given partial circuit failure. Diagnostix indicator is viewable by ground personnel indicating the assembly is operating in redundant mode. Light remains FAA/TSO compliant during operation in a redundant mode! All current source and flasher circuitry is contained within the current source / flasher box located in the wing (see Model 90547, call factory). Item ships with 38999 Series close out connector. 28 VDC Only. SPECIFICATIONS: ■ Current: (Current Source / Flasher) POS: 0.25amps // ACL 0.6 Average, 3.0amps Peak ■ Weight: 0.48 lbs (218gm) ■ Lens: None Dimensions: 4.10" (104mm) Long, 2.10" (53mm) Wide, Overall Height: 3.94" (100mm)

Model #

Part #

Description

Approvals (Pending)

9054401 9054402

01-0790544-01 01-0790544-02

Redundant LED POS/ACL (green) Redundant LED POS/ACL (red)

FAA TSO-C96a / TSO-C30c Type II FAA TSO-C96a / TSO-C30c Type I

MODEL 90541, LED PATENTED TECHNOLOGY: REDUNDANT LIGHTING AND ONBOARD DIAGNOSTIX™ 90541 series is Whelen's patented “two lights in one” with Diagnostix indication (Tail POS/ ACL Light). The most modern inner wing lighting solution on the market today, designed to comply with TSO-C96a Type III (400 ecp) anti-collision light requirements, and TSO-C30c aft position light requirements. The LED's provide a significant reduction in current draw over conventional position light bulbs and strobe power supplies. Whelen LED designs virtually eliminate EMI/RFI interference. Model 90541 analyzes circuit condition and can automatically compensate for any given partial circuit failure. Diagnostix indicator is viewable by ground personnel indicating the assembly is operating in redundant mode. Light remains FAA/TSO compliant during operation in a redundant mode! All current source and flasher circuitry is contained within the lighthead. SPECIFICATIONS: ■ Current: POS: 0.25 amps // ACL: 0.6 amps Avg, 3.20 amps Peak ■

Weight: 1.3 lbs. (590gm) ■ Lens: None ■ Dimensions: 7.17" (182mm) Overall Depth, 1.60" (41mm) Wide, 5.38" (137mm) Overall Height Model #

Part #

Description

Approvals (Pending)

9054100

01-0790541-00

Redundant LED AFT POS/ACL

FAA TSO-C96a / TSO-C30c Type III

MODEL 90569 ALL LED, FORWARD AND AFT POS/ACL ASSEMBLY Model 90569 LED is a Forward and Aft POS/ACL assembly with Integrated red LED Ground recognition lights. 90569 is an LED head assembly only, powered by Whelen Model 71457 LED Flasher / Current source designed to be mounted within 12 inches of the lighthead assembly. Unit complies with TSO-C96a Class II (400 ecp) anti-collision light requirements, and TSO-C30c forward position light requirements. Model 90569 (5.61” Long x 1.77” Wide) is a direct mechanical replacement for A600/90340 (with adapter). 90569 has an overall 2" exposed height. Unit ships with 12” of cable wiring into an amp connector. Available in 28 VDC only. SPECIFICATIONS: ■ Current: See 71457 (0.3 Amps Fwd & Aft Pos), (0.85 Amps Average ACL)

NEW!

Flush Mount

Weight: 0.5 lbs (454gm) ■ Lens: Clear Polycarbonate ■ Dimensions: 5.61” (142.49mm) Long, 1.77" (44.96mm) Wide ■ Exposed Height: 2.01” (50.8mm) Model #

Part #

9056901 01-0790569-01 (APPROVAL PENDING) 9056902 01-0790569-02 (APPROVAL PENDING)

Description

Approvals (Pending)

LED FWD/AFT POS/ACL (Green)

FAA TSO-C96a/TSO-C30c Types II & III

LED FWD/AFT POS/ACL (Red)

FAA TSO-C96a/TSO-C30c Types I & III

®

71457 CURRENT SOURCE / FLASHER (Models 90569 & 71495) Model 71457 is our combination flasher and LED current source for 90569 (and other applications) Forward and Aft POS/ACL assembly with integrated red LED ground recognition lights. Model 71457 LED flasher/current source is designed to be mounted within 12" of the lighthead assembly. Unit complies with TSO-C96a Class II (400 ecp) anti-collision light requirements, and TSO-C30c forward position light requirements. Power Input Connector sold separately, entry level unit (shown) uses CPC 205841-1 connectors. Available in 28 VDC only. SPECIFICATIONS: ■ Current: See 71457 (0.2 Amps Fwd & Aft Pos), (0.8 Amps Average ACL) ■

Weight: 0.58 lbs (263.08gm) ■ Mounting Dimensions: 4.6” (116.84mm) Long, 3.67” (93.22mm) Wide, 1.38” (35.05mm) Height Model #

Part #

Description

7145700 01-0771457-00 LED Flasher/Current Source See Flasher/Current Source Photo Diagram at the top of next page

8

Approvals (Pending) FAA TSO-C96a,TSO-C30c Types II & III

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

NEW!


LIG LIGHTHEAD USED

Model 7123403

powers......... Model 711700

Model 71457

modified for Model 90569

or Model 90482

NEW!

71495 WINGTIP LED ANTI-COLLISION LIGHT SERIES Model 71495 uses the LED assembly from 90588 and is a surface mount alternative for applications on a wingtip, winglet or tailcone area. Using Flasher/Current source model 71457, unit exceeds requirements for 400effCd and covers 180 degrees. Base unit comes with Amp connector 206434-1 found on Whelen 71457. SPECIFICATIONS: ■ Drawing Number: 71495 ■ Voltage: 28VDC (Model 71457) ■ ■ ■

Power Consumption: 0.8 Amps Avg (Model 71457) ■ LED Color: Aviation White Lens: Clear Polycarbonate ■ Weight: 0.4 lbs. (181gm) ■ Exposed Height: 1.39" (35.30mm) Length: 4.17" (105.92mm) ■ Width: 1.76" (44.70mm)

Model #

Part #

Description

Approvals (Pending)

7149500

01-0771495-00

Surface Mount LED ACL

FAA TSO-C96a, Class II

LIGHTHEADS

FLASHER / CURRENT SOURCE

MODEL 71170 SERIES LED ANTI-COLLISION/FORWARD POSITION LIGHT ASSEMBLY...Now with Integrated Ground Recognition Light. 71170 series is upgraded! An all LED forward position and anti-collision light assembly includes a red flashing portion to be used as a ground recognition light. Red "ground recognition light" cannot be activated simultaneously with white ACL light. This light intended for use as a system with 9048200 and 7123403 Series lightheads and flasher/current sources. Unit complies with TSO-C96a Class II (400 ecp) anti-collision light requirements, and TSO-C30c forward position light requirements. Input connector: MIL D38999 attached to a 24 inch harness attached to the rear of the assembly. SPECIFICATIONS: ■ Current: ACL: 0.60 amps average, 3.0a Peak // POS: 0.25a // GND REC: 0.15a, 7.5a Peak ■ Weight: 0.45 lbs. (00gm) ■ Dimensions: 3.86" (98mm) Long, 1.77" (50mm) Wide ■ Exposed Height: 2.33" (59mm) ■ Input connector: MIL D38999 attached to a 24 inch harness attached to the rear of the assembly. Model #

Part #

Description

7117001 7117002

01-0771170-01 01-0771170-02

LED POS (green)/ACL (white), GND REC (red) FAA TSO-C96a, Class II / TSO-C30c LED POS(red)/ACL (white), GND REC (red) FAA TSO-C96a, Class II / TSO-C30c

Approvals

MODEL 71234 SERIES FLASHER/CURRENT SOURCE ASSEMBLY 71234 series is a flasher/current source assembly designed to operate remote mounted LED anti-collision and position lights (7117001/-02 & 9048200). Model 90475 operates with 7123404. Unit complies with TSO-C96a Class II (400 ecp) anti-collision light requirements, and TSO-C30c tail position light requirements. Model 9057803 (P/N 46-0790578-03) is a Power Input Connector for Models 7123403 & -04, assembly comes with 25 inches of wiring with oversleeve protection (for end user installation), D38999/26FB-5S connector for 28 VDC. SPECIFICATIONS: ■ Power Consumption: 0.6 amps avg. 3 amps Peak @ 0.25 sec. 28 VDC ■ ■

Weight: 0.5 lbs. (363gm) ■ Height: 1.38" (35mm) ■ Width: 3.67" (93mm) Overall Depth: 4.60." (117mm) ■ Input connector: MIL D38999/20FB5PN Model # Part # Description Approvals

7123403 7123404 7123406

01-0771234-03 01-0771234-04 01-0771234-06

Flasher current source assembly Flasher current source assembly Flasher current source assembly

FAA TSO-C96a, Class II / TSO-C30c FAA TSO-C96a, Class II / TSO-C30c FAA TSO-C96a, Class II / TSO-C30c

MODEL A600 PG/PR SERIES (NSN 6220-15638384/-85) A600 PG/PR series wing tip anti-collision, forward position and tail position lights, all in one compact unit. Tail position light eliminates the need for a tail mounted position light. Available in 14 or 28 VDC and in a radio-shielded version. The forward position lamp is 26 watts and the taillight lamp is 25 watts. SPECIFICATIONS: ■ Drawing Number: 90006 ■ Weight: 0.8 lbs. (363gm) ■ ■

Position Lamps Power Consumption: 4 amps @ 14 VDC; 2 amps @ 28 VDC Exposed Height: 2.4” (61mm) ■ Length: 5.63” (143mm) ■ Width: 1.7” (43mm) Model # Part # Description Approvals 01-0790006-00 01-0790006-01 01-0790006-02 01-0790006-03 01-0790006-04 01-0790006-05 01-0790006-06 01-0790006-07 01-0790006-12 01-0790006-13

Position green, 14 VDC Position green, 28 VDC NSN (-84) Position red, 14 VDC Position red, 28 VDC NSN (-85) Position green, 14 VDC, radio-shielded Position green, 28 VDC, radio-shielded Position red, 14 VDC, radio-shielded Position red, 28 VDC, radio-shielded Pos. green, 28 VDC, radio-shielded, used Cirrus Design Pos. red, 28 VDC, radio-shielded, used on Cirrus Design

FAA TSO-C30b / FAA/PMA FAA TSO-C30b / FAA/PMA FAA TSO-C30b / FAA/PMA FAA TSO-C30b / FAA/PMA FAA TSO-C30b / FAA/PMA FAA TSO-C30b / FAA/PMA FAA TSO-C30b / FAA/PMA FAA TSO-C30b / FAA/PMA FAA TSO-C30b FAA TSO-C30b

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

®

A600PG14 A600PG28 A600PR14 A600PR28 A600PGD1 A600PGD2 A600PRD1 A600PRD2 9000612 9000613

9


LIGHTHEADS

MODEL 90340 STROBE ANTI-COLLISION/LED POSITION LIGHT ASSY. 90340 series is an all inclusive wing tip mounted strobe anti-collision/position light assembly utilizing LED's for both the forward & tail position lights, eliminating the need for a tail mounted position light. The LED's provide a significant reduction in current draw over conventional position light bulbs. The strobe light lens assembly is radio shielded for maximum EMI/RFI protection. Direct replacement (exact footprint) for the Whelen Model A600PG/PR series without replacing the current strobe power supply. Single set of flying leads operates both forward & tail nav on 28 VDC version, and one set each of flying leads for the forward & tail nav on the 14 VDC version.

MODEL 90375 SERIES STROBE ANTI-COLLISION/LED POSITION LIGHT Same as 90340 series assembly with addition of 3 feet of braided bonded protection. Note: For Composite Wingtip Structure. SPECIFICATIONS: ■ LED Colors: Aviation Red, Aviation Green & Aviation White 1.1 lbs. (499gm) ■ ■ ■

Lens: Clear RFI coated glass: strobe, Clear Polycarbonate: Navigation Lights Weight: 0.60 lbs. (272gm) 14 VDC, 0.65 lbs. (295gm) 28 VDC ■ Exposed Height: 2.70” (69mm) LED Navigation Light Power Consumption: 0.5 amps @ 14 VDC, 0.25 amps @ 28 VDC

Model #

Part #

Description

Approvals

9034001 9034002 9034003 9034004 9037501 9037502

01-0790340-01 01-0790340-02 01-0790340-03 01-0790340-04 01-0790375-01 01-0790375-02

Position green, 14 VDC Position red, 14 VDC Position green, 28 VDC Position red, 28 VDC Position green, 28 VDC Position red, 28 VDC

FAA TSO-C96a / TSO-C30c Types II & III FAA TSO-C96a / TSO-C30c Types I & III FAA TSO-C96a / TSO-C30c Types II & III FAA TSO-C96a / TSO-C30c Types I & III FAA TSO-C96a / TSO-C30c Types II & III FAA TSO-C96a / TSO-C30c Types I & III

MODEL 71110 SERIES STROBE ANTI-COLLISION/LED POSITION LIGHT ASSEMBLY 71110 series is a wing tip mounted strobe anti-collision/position light assembly utilizing LED's for the forward position lights. The LED's provide a significant reduction in current draw over conventional position light bulbs. The strobe light lens assembly is radio shielded for maximum EMI/RFI protection. Direct replacement (exact footprint) for the Whelen Model A650PG/PR series without replacing the current strobe power supply. Navigation light portion is wired with flying leads. SPECIFICATIONS: ■ LED Colors: Aviation Red, Aviation Green ■ ■ ■

LED Navigation Light Power Consumption: 0.25 amps @ 14 VDC or 28 VDC Weight: 0.45 lbs. (204gm) 14 VDC, 0.50 lbs. (227gm) 28 VDC ■ Exposed Height: 2.70” (69mm) Lens: Clear RFI coated glass: strobe, Clear Polycarbonate: Navigation Lights Model # Part # Description Approvals

7111001 7111002 7111003 7111004

01-0771110-01 01-0771110-02 01-0771110-03 01-0771110-04

Position green, 14 VDC Position red, 14 VDC Position green, 28 VDC Position red, 28 VDC

FAA TSO-C96a / TSO-C30c Type II FAA TSO-C96a / TSO-C30c Type I FAA TSO-C96a / TSO-C30c Type II FAA TSO-C96a / TSO-C30c Type I

MODEL A650 PG/PR SERIES (NSN 6210-12908385/-86) A650 PG/PR series wing tip with anti-collision & forward position lights can be used to convert non-Whelen position lights into a position/anti-collision light system. The small size allows for mounting into a wing tip enclosure. Available in 14 or 28 VDC and in a radioshielded version. The forward position lamp is 26 watts. SPECIFICATIONS: ■ Drawing Number: 70054 ■ Weight: 0.6 lbs. (272gm)

®

■ ■

Position Lamp Power Consumption: 2 amps @ 14 VDC; 1 Amp @ 28 VDC Exposed Height: 2.4” (61mm) ■ Length: 4.0” (102mm) ■ Width: 1.7” (43mm)

Model #

Part #

Description

Approvals

A650PG14 A650PG28 A650PR14 A650PR28 A650PGD1 A650PGD2 A650PRD1 A650PRD2

01-0770054-00 01-0770054-01 01-0770054-02 01-0770054-03 01-0770054-04 01-0770054-05 01-0770054-06 01-0770054-07

Position green, 14 VDC Position green, 28 VDC NSN (-85) Position red, 14 VDC Position red, 28 VDC NSN (-86) Position green, 14 VDC, radio-shielded Position green, 28 VDC, radio-shielded Position red, 14 VDC, radio-shielded Position red, 28 VDC, radio-shielded

FAA/PMA FAA/PMA FAA/PMA FAA/PMA FAA/PMA FAA/PMA FAA/PMA FAA/PMA

MODEL A650 SERIES A650 series converts W1285 position lights into a position/anti-collision system by removing the existing retainer & replacing it with the A650 assembly. Radio-shielded version available. SPECIFICATIONS: ■ Drawing No: 70053 ■ Weight: 0.2 lbs. (91gm) ■ Exposed Height: 2.4” (61mm)

10

Model #

Part #

Description

Approvals

A650 A650D

01-0770053-00 01-0770053-13

Standard unit Radio-shielded

FAA/PMA FAA/PMA

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.


A625 series has many different applications. It can be used for aircraft with tip-tanks with enclosed position lights (under a fairing), or as an add-on strobe on the wing or the tail. Available in a radio-shielded version. SPECIFICATIONS: ■ Drawing No: 70058 ■ Weight: 0.2 lbs. (91gm) ■ Exposed Height: 1.7” (43mm) Model #

Part #

Description

Approvals

A625 A625D A625R A625DR 7005815 7005816

01-0770058-03 01-0770058-13 01-0770058-04 01-0770058-14 01-0770058-15 01-0770058-16

Standard unit, clear lens Radio-shielded, clear lens NSN Standard unit, red lens Radio-shielded, red lens Radio-shielded, 3/c cable, 12” ground braid Radio-shielded, 24” 3/c cable, w/MS connector

FAA/PMA FAA/PMA — — — —

MODEL 70821 SERIES 70821 series remote streamlined strobe light assembly. Easily mounted on the wing tip for anti-collision or on the vertical fin for ground recognition. It is recommended for the wing tips on Cessna single engine aircraft 1970-71. Its sleek aerodynamic shape allows it to be mounted where surface area is at a premium, or to simply “clean-up” the look of the airplane. It can be added as a low profile ground recognition light when mounted on the vertical fin or fuselage. A mounting adapter plate facilitates mounting.

LIGHTHEADS

MODEL A625 SERIES (NSN 6220-14835571)

SPECIFICATIONS: ■ Drawing Number: 70821 ■ Weight: 0.3 lbs. (136gm) ■

Exposed Height: 1.8” (46mm) ■ Length: 3.5 (89mm) ■ Width: 1.8” (46mm)

Model #

Part #

Description

Approvals

7082100 7082101 7082102 7082103

01-0770821-00 01-0770821-01 01-0770821-02 01-0770821-03

Standard unit, clear lens Radio-shielded, clear lens Standard unit, red lens Radio-shielded, red lens

— — — —

MODEL 50626 SERIES STROBE TUBE ASSEMBLY 50626 series strobe tube assemblies are used with model numbers listed in chart below: 50626

Model #

Part #

Description

5062600 5062601

36-0050626-00 36-0050626-01

Strobe tube assembly. 6" long Strobe tube assy. 6" long w/grommet

5062602 5062603

36-0050626-02 36-0050626-00

Strobe tube assy. 12.5" long w/grommet Strobe tube assy. 2" long w/grommet

Used on Model 9011102 Model 9034000 thru 07, 20, 21 Model 7111001 thru 04 Model 9034008, 09 Model 9037501, 02

MODELS A610 & A612 (NSN 6210-13555564)

A612

A610 flash tube and A612 glass lens are used for installing wing tip strobes in single engine Cessna’s 1972 and later. The existing position light retainer is modified to accommodate the lens, and the flash tube is mounted directly behind. The A612 lens unique magnifying design increases the horizontal planes light intensity by two to three times. They are used for custom installations or spare parts for existing light assemblies. The A612 lens is available in Aviation Red and an RFI coated version. Lenses meet material requirements of MIL-C-7989B Class B. SPECIFICATIONS: ■ Drawing Number A610: 50276 ■ Drawing Number A612: 90005 ■

A610

A610 Flash Tube Weight: 0.09 lbs. (41gm) ■ A612 Lens Weight: 0.08 lbs. (36gm)

Model #

Part #

Description

Approvals

A610 A610M 5027601 5027602 A612 A612D A612R A612DR

02-0250276-00 02-0250276-03 02-0250276-01 02-0250276-02 68-2290005-30 68-2290005-34 68-2290005-50 68-2290005-54

Standard unit, 6” leads NSN Molex connector, 6” leads 14” leads 12.5” leads Standard clear lens Radio-shielded, clear lens Standard red lens Radio-shielded, red lens

FAA/PMA FAA/PMA FAA/PMA FAA/PMA FAA/PMA — — —

MODEL 90482 SERIES LED ANTI-COLLISION/TAIL POSITION LIGHT ASSEMBLY, INTEGRATED GROUND RECOGNITION LIGHT 90482 series is a compact and feature added version of the 90354 tail assembly (shown in 2008 catalog). Aft position light with white anti-collision light combination to include a red flashing portion used as a ground recognition light red ground recognition and white anticollision lighting can not be activated simultaneously. This light intended for use as a system with 71170( ) and 7123403 Series lightheads and flasher/current sources for complete aircraft coverage. Item does not include interconnect cable for flasher/current source. SPECIFICATIONS: ■ Current (7123403): ACL: 0.53A Average, 2.5 a Peak // POS: 0.25a // Ground Rec. 0.15a ■ Weight: 0.35 lbs. (159gm) ■ Lens: Clear Polycarbonate ■ Dimensions: 1.78" (45mm) Deep, 1.25" (32mm) Wide ■ Exposed Height: 3.60" (91mm) Part #

Description

Approvals

01-0790482-00

Aft POS/ACL (white) with GND REC (red)

FAA TSO C96a / TSO-C30c Type III

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

®

Model # 9048200

11


LIGHTHEADS

MODEL A500A SERIES A500A series combination strobe/tail navigation light used when the wing tip anti-collision lights are mounted in an enclosure and can’t provide 360º of strobe coverage. It is a direct replacement for the standard tail position light. Available in a radio-shielded version. Voltage (14 or 28) and mounting (horizontal or vertical) must be specified when ordering. SPECIFICATIONS: ■ Drawing Number: 70024 ■

Weight: 0.3 lbs. (136gm) ■ Exposed Height: 1.7” (43mm) ■ Diameter: 1.5” (38mm)

Model #

Part #

Description

Approvals

A500AV14

01-0770024-00

Vertical mount, 14 VDC

A500AV28

01-0770024-01

Vertical mount, 28 VDC

A500AH14

01-0770024-02

Horizontal mount, 14 VDC

A500AH28

01-0770024-03

Horizontal mount, 28 VDC

A500AVD1

01-0770024-04

Vertical mount, 14 VDC, radio-shielded

A500AVD2

01-0770024-05

Vertical mount, 28 VDC, radio-shielded

A500AHD1

01-0770024-06

Horizontal mount, 14 VDC, radio-shielded

A500AHD2

01-0770024-07

Horizontal mount, 28 VDC, radio shielded

FAA/PMA, FAA TSO-C30b FAA/PMA, FAA TSO-C30b FAA/PMA, FAA TSO-C30b FAA/PMA, FAA TSO-C30b FAA/PMA, FAA TSO-C30b FAA/PMA, FAA TSO-C30b FAA/PMA, FAA TSO-C30b FAA/PMA, FAA TSO-C30b

A500ASP2

01-0770024-25

A500ABV1 A500ABV2

01-0770024-16 01-0770024-15

Vertical mount, 28 VDC, 50” cables, no connectors Beech Special 14 VDC, MS connector Beech Special 24 VDC, MS connector

VERTICAL MOUNTING

HORIZONTAL MOUNTING

— — —

MODEL A470A SERIES (NSN 6220-14807344*) A470A series remote strobe light assembly is compatible with all Whelen power supplies. It can be installed on the fuselage or the vertical fin. The unique polycarbonate optic lens and reflector design, re-directs stray light rays into the horizontal plane to provide the maximum 360º of uniform light coverage possible. Available in three different lens colors, aviation red, aviation white and split aviation red/white. Available in radio-shielded configurations. All assemblies require either the model H102 or H103 mounting adapter. SPECIFICATIONS: ■ Drawing Number: 70019 ■

Weight: 0.3 lbs. (136gm) ■ Exposed Height: 3.75” (95mm) ■ Diameter: 2.5” (64mm)

Model #

Part #

Description

Approvals

A470AR 01-0770019-18 Standard assembly, red lens NSN (a) FAA/PMA A470AW 01-0770019-19 Standard assembly, white lens NSN (b) FAA/PMA A470AS 01-0770019-20 Standard assembly, split red/white lens NSN (*) FAA/PMA A470ADR 01-0770019-21 Radio-shielded assembly, red lens FAA/PMA A470ADW 01-0770019-22 Radio-shielded assembly, white lens FAA/PMA A470ADS 01-0770019-23 Radio-shielded ass'y, split red/white lens NSN (c) FAA/PMA (a) 6220-14851001, (b) 6340-14331362, (c) 6220-13844609

NEW STYLE RADIO SHIELDED

OLD STYLE RADIO SHIELDED

NOTE * THE A469AD SHIELDED FLASH TUBE ASSEMBLY CAN NOT BE USED WITH: The new A470AD Remote Strobe Head Assembly as shown, the new A402AD Lens, or the new HR,DFA Self Contained Strobe Light Assembly.

A402AD NEW

A402 OLD

A470AD NEW

RADIO SHIELDED GASKET (NEW)

A470D

®

OLD STYLE

Note: 06-190125 is not the part number for the A469B but a mold number, order A469B See Aviation Installation Guide for more information.

A469B NEW

* A469A-D OLD

NSN 6240-13941811 NSN 6240-11021555

12

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.


1062IR is an Infra-Red Strobe light LENS only designed to replace multiple Whelen remote strobe and self-contained strobe products. 1062IR filters visible light from the conventional Xenon strobe making your ACL product covert for video or night vision viewing. Product applications include Whelen HRCFA, 70285 and A470(A). Contact Factory to order.

NEW!

MODELS H102 & H103 (NSN 6220-12099972) Designed for the model A470A or model A450 series remote strobe lighthead assemblies. The model H102 allows flush mounting of the lighthead to the skin of the fuselage or the vertical stabilizer on later model Cessna Single engines. The H103 is designed for strobe assemblies to be installed in the standard 3-3/4” (95mm) dia. rotating beacon mounting hole. SPECIFICATIONS: ■ Drawing Number H102: 30068 ■ Drawing Number H103: 30079 H102 H103

Model #

Part #

Description

Approvals

H102 H103

07-730068-000 11-230079-000

Flush mount adapter NSN Rotating beacon mount adapter

FAA/PMA —

MODEL A450 SERIES

LIGHTHEADS

MODEL 1062IR LENS

A450 series remote strobe light assembly is compatible with all Whelen power supplies. It can be installed on the fuselage or the vertical fin. The Pyrex ® Glass lens (clear only) makes the assembly suitable for use in severe vibration, chemical and moisture conditions (i.e. agricultural aircraft). Requires either the model H102 or model H103 mounting adapter. SPECIFICATIONS: ■ Drawing Number: 70032 ■

Weight: 0.3 lbs. (136gm) ■ Exposed Height: 2.25” (57mm) ■ Diameter: 2.5” (64mm)

Model #

Part #

Description

Approvals

A450

01-0770032-00

Standard assembly, clear lens

FAA/PMA

MODEL 90111 SERIES 90111 series remote strobe light assembly compatible with all Whelen power supplies. Can be installed on the wing tip or the tail. SPECIFICATIONS: ■ Drawing Number: 90111 ■ Weight: 0.5 lbs. (227gm) ■

Exposed Height: 2.08” (53mm) ■ Width: 1.75” (44mm) ■ Length: 2.5” (64mm)

Model #

Part #

Description

Approvals

9011100 9011102

01-0790111-00 01-0790111-02

Shielded, clear lens (BeechJet) Shielded, masked red lens (Piper)

— FAA/PMA

MODEL 90028 SERIES 90028 series wing tip strobe light used on Beech aircraft with commonality wing tip 1974 & later. It is a direct replacement for 30-0467-( ), 30-1331-( ) and the 30-1467-( ) series. SPECIFICATIONS: ■ Drawing Number: 90028 ■ Weight: 0.4 lbs. (181gm) ■

Exposed Height: 1.87” (48mm) ■ Length: 4.37” (111mm) ■ Depth: 2.25” (57mm) Model # Part # Description Approvals

9002800 9002801 D900283 D900285 D900287 D900289

01-0790028-00 01-0790028-01 01-0790028-03 01-0790028-05 01-0790028-07 01-0790028-09

Replacement flash tube assembly, unpainted Replacement flash tube assembly, painted (white) Wing tip light assembly, 45º mounting bracket Taillight assembly, 90º mounting bracket Wing tip light assembly, 45º mtg. bracket, MS connector Taillight assembly, 90º mounting bracket, MS connector

— — — — — —

MODEL 90102 SERIES 90102 series dual radio-shielded wing tip strobe light designed with two lights for wing tip strobe redundancy. It is used on DeHavilland Dash 8 aircraft. SPECIFICATIONS: ■ Drawing Number: 90102 ■

Weight: 1.0 lbs. (454gm) ■ Height: 2.78” (71mm) ■ Length: 5.7” (145mm) ■ Width: 2.4” (61mm)

Model #

Part #

Description

Approvals

9010200

01-0790102-00

Dual radio-shielded wing tip strobe light

FAA/PMA

MODEL 90104 SERIES 90104 series dual radio-shielded tail strobe light designed with two lights for tail strobe redundancy for DeHavilland Dash 8 aircraft. SPECIFICATIONS: ■ Drawing Number: 90104 ■

Weight: 1.0 lbs. (454gm) ■ Height: 2.78” (71mm) ■ Length: 6.7” (170mm) ■ Width: 2.9” (74mm)

Model #

Part #

Description

Approvals

9010400

01-0790104-00

Dual radio-shielded tail strobe light

FAA/PMA ®

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

13


LIGHTHEADS

MODEL 90193 SERIES 90193 series radio-shielded wing tip strobe light used on Raytheon JPATS trainer aircraft. SPECIFICATIONS: ■ ■

Drawing Number: 90193 ■ Weight: 0.57 lbs. (259gm) Height: 2.46” (62mm) ■ Length: 4.74” (120mm) ■ Width: 3.45” (88mm)

Model #

Part #

Description

Approvals

9019300

01-0790193-00

Radio-shielded wing tip strobe light (green)

9019301

01-0790193-01

Radio-shielded wing tip strobe light (red)

FAA TSO-C30b FAA TSO-C96a FAA TSO-C30b FAA TSO-C96a

MODEL 90400 SERIES LED 90400 series is a self-contained, all LED forward & aft position and white anti-collision light (POS/ACL) assembly. Interconnect with standard Amp Mate-N-Lock® connectors (A447 Style). Designed as the smallest, all-LED, fixed wing compliant POS/ACL light in the market. Models -91 & -92 available to fit hole pattern of Cessna Caravan (below). Models available in 14 and 28 VDC. SPECIFICATIONS: ■ Current: ACL: 0.87A Average, 4.0 a Peak // POS: 0.5a ■

Weight: 1.0 lbs. (454gm) ■ Lens: Clear Polycarbonate ■ Lighthead Dimensions: 6.60" (168mm) Long, 1.83 (46mm) Wide, Exposed Height, 2.22" (56mm) ■ Current Source / Flasher Box (Attached) Dimensions: 3.59" (91mm) Long, 1.11" (28mm) Height, 3.50 (89mm) Width Model # Part # Description Approvals

9040011 9040012 9040021 9040022 9040091 9040092

01-0790400-11 01-0790400-12 01-0790400-21 01-0790400-22 01-0790400-91 01-0790400-92

LED Position/Anti-Coll, 14 VDC (green) LED Position/Anti-Coll, 14 VDC (red) LED Position/Anti-Coll, 28 VDC (green) LED Position/Anti-Coll, 28 VDC (red) LED Pos./Anti-Coll, 28 VDC, Cessna Caravan (green) LED Pos./Anti-Coll, 28 VDC, Cessna Caravan (red)

FAA TSO-C30c Types II & III FAA TSO-C30c Types I & III FAA TSO-C30c Types II & III FAA TSO-C30c Types I & III FAA TSO-C30c Types II & III FAA TSO-C30c Types I & III

MODEL 90358 SERIES SELF-CONTAINED LED ANTI-COLLISION/ LED POSITION LIGHT ASSEMBLY (For Fixed Wing, TSO-C96a Class II (400 ecp) 90358 series is a self-contained all LED wing tip mounted anti-collision/position light assembly utilizing LED's for both the anti-collision, forward & tail position lights, eliminating the need for a tail mounted position light. The LED's provide a significant reduction in current draw over conventional position light bulbs, and strobe power supplies. The all inclusive LED design virtually eliminates EMI/RFI interference. All current source and flasher circuitry is contained within the attached flasher box. SPECIFICATIONS: ■ ■ ■ ■ ■

LED Navigation Light Power Consumption: 0.25 amps @ 28 VDC EACH LED Anti-Collision Light Power Consumption: 0.5 amps @ 28 VDC LED Colors: Aviation Red, Aviation Green & Aviation White Weight: 1.3 lbs. (590gm) ■ Exposed Height: 2.80" (71mm) ■ Exposed Width: 2.64" (67mm) Exposed Length: 7.29" (185mm) ■ Depth: 3.00" (76mm) ■ Lens: Clear Hard Coated Polycarbonate Model # Part # Description Approvals

9035801 9035802

01-0790358-01 01-0790358-02

Position green, 28 VDC Position red, 28 VDC

FAA TSO-C96a / TSO-C30c Types II & III FAA TSO-C96a / TSO-C30c Types I & III

MODEL 90325 SERIES LED FORWARD & AFT NAVIGATION & LED ANTI-COLLISION 90325 series and 71120 (current source) are an all LED solution to Cessna Citation wingtip strobe legacy products manufactured by Whelen. A direct replacement for Whelen’s 90206 & 90159 wing tip products. The 90325 will retrofit Models 550, S550, 560 or is able to be modified to fit other wings of similar design. See 90358 for smaller overall footprint. 90358 ships with a 24” (61cm) cable harness that mate to 71120. 28 VDC Only. SPECIFICATIONS: Dimensions: 10.24” (6mm) Long x 3.11” (79mm) Wide ■ Exposed Height: 2.61” (66mm) Current: 0.85a Average, 4.5a Peak ■ Weight: 1.2 lbs (544gm) ■ Lens: Clear Polycarbonate Model # Part # Description Approvals

®

■ ■

14

9032501 9032502

01-0790325-01 01-0790325-02

LED position/anti-coll (red) LED position/anti-coll (green)

FAA TSO-C96a / TSO-C30c Types I & III FAA TSO-C96a / TSO-C30c Types II & III

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

White LED’s with Clear Lens


71120 series (current source) drives lighthead model 90325. 71120 are designed to fit the strobe power supply footprint used in Citation wing tips. 28 VDC Only. SPECIFICATIONS: ■ ■

Weight: 0.95lbs (431gm) ■ Current: 0.85a Average, 4.5a Peak ■ Flashrate: 45+/- 5fpm Dimensions- Deep: 4.63” (118mm) ■ Wide (mounting foot): 5.6 (142mm)■ Height: 2.53” (64mm) Model # Part # Description Approvals

7112000

01-0771120-00

LED flasher/current source

FAA TSO-C96a / TSO-C30c Types II & III

MODEL 90159 SERIES 90159 series wing tip strobe anti-collision & navigation light assembly, STC #ST22BO for Cessna Citation models 550, S550, and 560. Can be installed on other aircraft with minor modifications. Unit will replace 30-1085 assemblies. SPECIFICATIONS: ■ Drawing Number: 90159 ■ Weight: 1.9 lbs. (862gm) ■ ■

Exposed Height: 3.6” (91mm) ■ Length: 11.03” (280mm) ■ Width: 3.06” (78mm) Forward Position lamp: 2 amps @ 28 VDC ■ Tail Position lamp: 2 amps @ 28 VDC

Model #

Part #

Description

Approvals

9015905

01-0790159-05

9015906

01-0790159-06

9015907

01-0790159-07

Left wing tip (red position lens) no tail position light Right wing tip (green position lens) no tail position light Left wing tip with tail position light

9015908

01-0790159-08

Right wing tip with tail position light

FAA TSO-C30c FAA TSO-C96a FAA TSO-C30c FAA TSO-C96a FAA TSO-C30c FAA TSO-C96a FAA TSO-C30c FAA TSO-C96a

LIGHTHEADS

MODEL 71120 SERIES LED CURRENT SOURCE

MODEL 90206 SERIES 90206 series wing tip strobe anti-collision & navigation light assembly, STC #ST00101BO for Cessna Citation model 560, serial numbers 257 & up. Unit will replace 30-1085 assemblies. SPECIFICATIONS: ■ Drawing Number: 90206 ■ Weight: 1.9 lbs. (862gm) ■ ■

Exposed Height: 3.6” (91mm) ■ Length: 11.03” (280mm) ■ Width: 3.06” (78mm) Forward Position lamp: 2 amps @ 28 VDC ■ Tail Position lamp: 2 amps @ 28 VDC

Model #

Part #

Description

Approvals

9020603

01-0790206-03

9020604

01-0790206-04

9020607

01-0790206-07

Left wing tip (red position lens) no tail position light Right wing tip (green position lens) no tail position light Left wing tip with tail position light

9020608

01-0790206-08

Right wing tip with tail position light

FAA TSO-C30c FAA TSO-C96a FAA TSO-C30c FAA TSO-C96a FAA TSO-C30c FAA TSO-C96a FAA/TSO-C30c FAA/TSO-C96a

REPLACEMENT OF GRIMES THREE LIGHT STROBE SYSTEM INSTALLED ON CESSNA 300-400 SERIES WITH TIP TANKS SWITCH FLASHER ASSEMBLY P/N 70-0075-1

INSTALLATION OF A WHELEN TWO OR THREE LIGHT SYSTEM ON A CESSNA 300-400 SERIES WITH TIP TANKS PARALLEL BRACKETS (EXISTING) CUSTOM FABRICATE BRACKETS TO ATTACH TO EXISTING BRACKETS. INSTALL WHELEN P/N A490T-CF-14/28 POWER SUPPLY ASSEMBLY.

TIP TANK STROBE LIGHT ASSEMBLY P/N 30-0515 or 30-1172

STROBE LIGHT ASSEMBLY P/N 30-0515 or 30-1172

ROUTE AN 18 GAUGE WIRE THROUGH THE WINGS & THROUGH THE EXISTING CONDUIT THAT GOES INTO THE TIP TANK. THIS WIRE IS FOR A SWITCH & BREAKER. STROBE POWER SUPPLY P/N 60-1520-( )

3/C CABLE STROBE LIGHT P/N 30-0516-5

EXISTING GRIMES PART NO.

WHELEN REPLACEMENT PART NO.

30-0515 or 30-1172

A490T-CF-14/28

30-0516-5

A500AV-28

REPLACE THE GRIMES PART NUMBERS WITH THE WHELEN PART NUMBERS AS LISTED ABOVE. REMOVE P/N 70-0075-1 AND EXTEND THE WIRES TO THE EXISTING SWITCH.

CUSTOM FABRICATED BRACKETS ATTACH A490T-CF-14/28 TO CUSTOM BRACKETS (BOTH WINGTIPS)

EXISTING BULKHEAD

FUEL TANK

EXISTING BRACKETS

RECOMMENDATION FOR THE WING-TIP STROBE LIGHT EXISTING POSITION LIGHT & BRACKET

CUSTOM BRACKET

CUSTOM FABRICATE A BRACKET THAT CAN ATTACH TO THE EXISTING POSITION LIGHT BRACKET (SEE SKETCH). THE NEW BRACKET SHOULD BE .050î - .062î THICK.

WHELEN A625 STROBE

THIRD LIGHT INSTALLATION IN THE TAIL CONE IF A THIRD LIGHT IS REQUIRED, INSTALL THE WHELEN A490T-CF-14/28 POWER SUPPLY, ADJACENT TO THE WHELEN COMBINATION STROBE /NAV LIGHT ASSEMBLY, P/N A500AV-28

ROTATING BEACON REPLACEMENT TO REPLACE THE ROTATING BEACON ON THE VERTICAL FIN, THE RECOMMENDED LIGHT ASSEMBLY IS A WHELEN HRCFA-RW-14/28

®

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

15


SELF-CONTAINED LIGHT ASSEMBLIES

MODEL 90520 SERIES LED FLASHING BEACON (Red & White LED’s) 90520 series LED beacons are FAA TSO compliant self-contained LED anti-collision lights (Ref. Class III - 100 effective candlepower). They are designed to replace strobe lightheads as small as the A470A with available models to replace HR self-contained beacons (HRCFA) or our legacy 70900 LED beacon. Mounting plate included with assembly. See models below.

9052001, -51

ELECTRICAL: Models: -01, -04, -05, -14, -15, -51, -55: Ship with 12” Flying Leads Models: -07, -17, -08, -18: MS3102R10SL-3P Connector MECHANICAL: Models: -04, -14, -08, -18, -55 are 3-¾” opening designed to fit inside an A440 mounting adapter, mounting designed to replace existing beacons utilizing a 5 Hole mounting pattern on 4.656 diameter bolt circle (Whelen 70285 series / 7090501 series or 70900 with A440 adapter). Models: -05, -15, -07, -17 are 3-¾” opening designed to fit inside an A440 mounting adapter, mounting holes to fit in place of rotating beacons, Whelen model HRCFA, or 7090004, -05 series LED beacons

SPECIFICATIONS: ■ Current: 0.67 amps Avg., 3.0 amps Peak ■ Weight: 0.65 lbs. (295gm) (-01 & -51) ■

Lens: Clear polycarbonate ■ Dimensions: 2.6” (66mm) Dia., Exp. Height, 3.74” (95mm) (-01 & 51)

Model #

Part #

Description

Approvals

9052001 9052051 9052004 9052014 9052005 9052015 9052007 9052017 9052008 9052018 9052055

01-0790520-01 01-0790520-51 01-0790520-04 01-0790520-14 01-0790520-05 01-0790520-15 01-0790520-07 01-0790520-17 01-0790520-08 01-0790520-18 01-0790520-55

LED red/white, 28 VDC, 2.75" mount LED red/white, 14 VDC, 2.75" mount LED red/white, 28 VDC & 5 hole mount Same as -04, lower mount LED red/white, 28 VDC, 3.75” adapter same as -05, lower mount LED red/white, 28 VDC, 3.75” adapter same as -07, lower mount LED red/white, 28 VDC & 5 hole mount same as -08, lower mount LED red/white beacon, 14 VDC (3.75" adapt., flying leads)

FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III

9052005, -15, -55

Red Model number indicates not pictured.

MODEL HRCFA SERIES (NSN 6220-13639713) HRCFA series is a self-contained CometFlash® strobe anti-collision light. The unique polycarbonate optic lens and reflector design re-directs stray light rays into the horizontal plane to provide maximum 360º of uniform light coverage. Available in three different lens colors, aviation red, aviation white and split aviation red/white and in radio-shielded configurations. FAA approved as a direct replacement for any rotating beacon that uses a 3-3/4” (95mm) dia. mounting hole. Can be installed in the vertical fin or the fuselage. Fuselage installation requires the A440 mounting adapter. Operates between 10 to 30 VDC. SPECIFICATIONS: ■ Drawing Number: 70029 ■ Weight: 1.5 lbs. (680gm) ■ Height: 7.25” (184mm) ■

Diameter: 3.7” (94mm) ■ Power Consumption: 3.2 amps @ 14 VDC, 1.6 amps @ 28 VDC

Model #

Part #

Description

Approvals

HRCFAR HRCFAW HRCFAS HRCFADR HRCFADW HRCFADS

01-0770029-29 01-0770029-30 01-0770029-31 01-0770029-32 01-0770029-33 01-0770029-34

Standard assembly, red lens NSN Standard assembly, white lens Standard assembly, split red/white lens Radio-shielded, red lens Radio-shielded, white lens Radio-shielded, split red/white lens

FAA/PMA FAA/PMA FAA/PMA FAA/PMA FAA/PMA FAA/PMA

MODEL 71080 SERIES LED BEACON FOR ROTORCRAFT, 71080 series LED beacons are FAA TSO compliant self-contained LED anti-collision lights (Ref. Class I - 150 effective candlepower). They are designed to replace a range of products. Refer to models and descriptions below. ELECTRICAL Models: -01, -04, -05, -14, -15, -20, -51, -55: Ship with 12” Flying Leads Models: -07, -17, -08, -18: MS3102R10SL-3P Connector MECHANICAL Models: -04, -14, -08, -18: designed to replace existing beacons using 5-Hole mounting pattern on a 4.656 dia. bolt circle (Whelen 70285 series/7090501 series or 70900 with A440 adapter). Models: -05, -15, -07, -17 are 3 ¾” opening designed to fit inside an A440 mounting adapter, mounting holes to fit in place of rotating beacons, Whelen Model HRCFA, or 7090004, -05 series LED beacons

7108001, -51

71080 Series has Red LED’s with Clear Lens

SPECIFICATIONS: ■ 150 eff. Cd ■ 14 VDC & 28 VDC ■ Current: 0.87 amps average, 3.0 amps peak Weight: 0.65 lbs. (295gm) (-01 & -51) ■ Lens: Clear polycarbonate Dimensions: 2.6” (66mm) diameter, exposed height, 3.74” (95mm) (-01 & 51) Model # Part # Description Approvals

®

■ ■

7108001 7108051 7108004 7108014 7108005 7108015 7108007 7108017 7108008 7108018

01-0771080-01 01-0771080-51 01-0771080-04 01-0771080-14 01-0771080-05 01-0771080-15 01-0771080-07 01-0771080-17 01-0771080-08 01-0771080-18

LED red, 28 VDC, 2.75" mount LED red, 14 VDC, 2.75" mount LED red, 28 VDC & 5-Hole mount Same as -04, lower mount LED red, 28 VDC, 3.75” adapter same as -05, lower mount LED red, 28 VDC, 3.75” adapter same as -07, lower mount LED red, 28 VDC & 5 hole mount same as -08, lower mount

FAA TSO-C96a Class I (150 ecp) FAA TSO-C96a Class I (150 ecp) FAA TSO-C96a Class I (150 ecp) FAA TSO-C96a Class I (150 ecp) FAA TSO-C96a Class I (150 ecp) FAA TSO-C96a Class I (150 ecp) FAA TSO-C96a Class I (150 ecp) FAA TSO-C96a Class I (150 ecp) FAA TSO-C96a Class I (150 ecp) FAA TSO-C96a Class I (150 ecp)

7108005, -15

Red model number indicates not pictured.

16

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

7108008, -18


71410 LED White Anti-Collision Beacons are FAA TSO compliant self-contained LED AntiCollision Lights. (Unit meets rotorcraft minimum ACL standards Class I, 150 effective Cd) They are designed to replace 3-3/4" opening found with our HRCFA/SACF style Strobe units and to replace rotating beacons, they also come with a narrow base allowing replacement of A470(A) and similar remote strobes(Contact Factory). 71410 Ships with 12" long flying leads, available in 28vdc Only. (TSO-C96a, CLASS III APPROVED) SPECIFICATIONS: ■ Drawing Number: 71410 ■ Voltage: 28 VDC ■ Power Consumption: 0.32Amps ■ ■

White LED’s with Clear Lens

NEW!

LED Color: Aviation WHITE ■ Lens: Clear Polycarbonate ■ Weight: 0.75lbs (340.19gm) Exposed Height: 3.4" (86.36mm) ■ Diameter: 3.60" (91.44mm)

Model #

Part #

Description

Approvals

7141005 7141015

01-077410-05 01-077410-15

LED Anti-Collision, White Upper Mount LED Anti-Collision, White lower Mount

FAA TSO-C96a Class III FAA TSO-C96a Class III

71460 BLUE LED FLASHING IDENTIFICATION BEACON 71460 is a Blue LED flashing beacon that fits the 5-hole mounting pattern common to rotorcraft. Unit is designed and follows the manufacturing/quality practices of 71080 and 90520 TSO'd avition anti-collision lights. No FAA certifications for Blue beacons. Unit ships with D38999 series connector integrated. SPECIFICATIONS: ■ Drawing Number: 71460 ■ Voltage: 28 VDC ■ Power Consumption: 0.67Amps

Blue LED’s with Clear Lens

■ ■

LED Color: Blue ■ Lens: Clear Polycarbonate ■ Weight: 0.84 lbs (381gm) Exposed Height: 3.74" (95mm) ■ Mounting Diameter: 5.14" (130.56mm)

Model #

Part #

Description

Approvals

7146001

01-0771460-01

Blue LED Indentification Light

Model 71485 SERIES - COVERT IR / RED LED COMBINATION BEACON (Supplemental Anti-Collision) 71485 is a combination Aviation Red visible and IR flashing beacon. Produced as a derivative of our Models 71080 & 90520, there is no TSO available for this product. 71485 can be surface mounted in an area as small as 2.75" or has an adapter to drop into a 3.75" recessed mount commonly found. Nominal IR LEDs at 875nm. Unit ships with 18" flying leads, independent control for Red and IR LED packages. Surface mount unit and additional models are not listed, contact factory. SPECIFICATIONS: ■ Drawing Number: 71485 ■ Voltage: 28VDC ■ ■ ■

NEW!

Power Consumption: 0.3 Amps Avg. Red / 0.12 Amps Average IR ■ LED Color: Aviation Red & IR Lens: Clear Polycarbonate ■ Weight: 0.670 lbs (304gm) (with 3.75" Adapter) Exposed Height: 3.5" (88.9mm) ■ Base Width: 3.66" (92.96mm)

Model #

Part #

Description

Approvals

7148500

01-0771485-00

LED Red & IR Special ACL

71430 RED LED Anti-Collision (RO) SERIES 71430 is a dual-mode RED Anti-collision Light with a reduced output feature. In ‘normal’ mode the beacon produces Class I Helicopter flashing output and functions as just as Model 71080 (>150EffCd), in reduced output power mode the LED flashing is pulse-width modulated to less than 5% aiding with the use and functionality of pilots flying with NVG equipment. 71430 also has a built-in syncronize feature. Syncronize feature commands two like units to flash simultaneously, simple wire interconnection only. Item ships with 18” flying leads. SPECIFICATIONS: ■ Dwg. Number: 71430 ■ Voltage: 28VDC ■ Power Consumption: 0.67Amps Avg ■ ■

LED Color: Aviation Red ■ Lens: Clear Polycarbonate ■ Weight: 0.65lbs (294.83gm) Exposed Height: 3.74” (95mm) ■ Base Diameter: 2.6” (66.04mm)

Model #

Part #

Description

Approvals

7143050

01-0771430-50

LED Red ACL w/Reduced output & Sync

SELF-CONTAINED LIGHT ASSEMBLIES

MODEL 71410 SERIES (15 & 05) WHITE LED ANTI-COLLISION BEACON

MODEL 90368 SERIES SELF-CONTAINED RED LED ANTI-COLLISION/ LED POSITION LIGHT ASSEMBLY (For Rotorcraft TSO-C96a Class I, 150 ecp) 90368 series is a self-contained all LED fuselage mounted anti-collision/position light assembly utilizing RED LED's for the anti-collision portion, and red & green LED's for the forward & tail position lights, eliminating the need for a tail mounted position light. The LED's provide a significant reduction in current draw over conventional position light bulbs and strobe power supplies. The all inclusive LED design virtually eliminates EMI/RFI interference. All current source and flasher circuitry is contained within the attached flasher box. Red LED’s with Clear Lens

SPECIFICATIONS: ■ LED Navigation Light Power Consumption: 0.25 amps @ 28 VDC EACH ■

LED Anti- Collision Light Power Consumption: 0.5 amps @ 28 VDC ■ LED Colors: Aviation Red, Aviation Green & Aviation White ■ Weight: 1.3 lbs. (590gm) ■ Exposed Height: 2.80" (71mm) ■ Exposed Width: 2.64" (67mm) ■ Exposed Length: 7.29" (185mm) ■ Depth: 2.25" (57mm) ■ Lens: Clear Hard coated Polycarbonate Model # Part # Description Approvals ®

9036801 01-0790368-01 Position green, 28 VDC FAA TSO-C96a / TSO-C30c Types II & III 9036802 01-0790368-02 Position red, 28 VDC FAA TSO-C96a / TSO-C30c Types I & III NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

17


SELF-CONTAINED LIGHT ASSEMBLIES

MODEL SACF SERIES SACF series self-contained CometFlash strobe anti-collision light which utilizes the same power supply & housing as the model HRCFA. It uses an aviation white glass lens only, ideal for agricultural applications where chemicals are used. Because the lens has no optics builtin, it produces 300 effective candlepower. It uses a 3-3/4” dia. mounting hole. Fuselage installation requires the A440 mounting adapter. Operates between 10 to 30 VDC. SPECIFICATIONS: ■ ■ ■

Drawing Number: 70030 Weight: 1.5 lbs. (680gm) ■ Height: 5.50” (140mm) ■ Diameter: 3.7” (94mm) Power Consumption: 3.2 amps @ 14 VDC, 1.6 amps @ 28 VDC

Model #

Part #

Description

Approvals

SACF

01-0770030-01

Aviation white lens

FAA/PMA

MODEL A440 MOUNTING ADAPTER A440 mounting adapter is for fuselage installations for the HRCFA series and SACF series. SPECIFICATIONS: ■ Drawing Number: 30074 Model #

Part #

Description

Approvals

A440

19-130074-009

Mounting adapter

FAA/PMA

MODEL 90081 SERIES 90081 series self-contained, 150 Watt, halogen flashing anti-collision light. It uses a 3-3/4” (95mm) diameter rotating beacon mounting hole. -01 and -02 units are supplied with the A440 mounting adapter. 28 VDC Only. SPECIFICATIONS: ■ ■

Drawing Number: 90081 ■ Power Consumption: 5.5 amps @ 28 VDC Weight: 1.3 lbs. (590gm) ■ Height: 4.0” (102mm) ■ Diameter: 3.7” (94mm)

Model #

Part #

Description

Approvals

9008100 9008101 9008102

01-0790081-00 01-0790081-01 01-0790081-02

Vertical fin mount Upper fuselage mount Lower fuselage mount

FAA/PMA FAA/PMA FAA/PMA

MODEL 70509 SERIES 70509 series self-contained halogen flashing anti-collision light with the same mounting pattern as the factory installed beacon on single engine Cessna’s 1967 & later. Available in three different lens colors, Aviation red, aviation white and split aviation red/white. When used in conjunction with the model 50519 mounting adapter, it can replace rotating beacons with the 3-3/4” (95mm) dia. mounting hole. Note: Not recommended for installation on helicopters or twin engine aircraft. SPECIFICATIONS: ■ ■

Drawing Number: 70509 ■ Weight: 0.27 lbs. (122gm) ■ Height: 3.75” (95mm) Diameter: 2.65” (67mm) ■ Power Consumption: 2.7 amps @ 14 VDC, 1.3 amps @ 28 VDC

Model #

Part #

Description

Approvals

7050900 7050901 7050902 7050903 7050904 7050905 7050907

01-0770509-00 01-0770509-01 01-0770509-02 01-0770509-03 01-0770509-04 01-0770509-05 01-0770509-07

FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a

50519001

11-350519-001

14 VDC, red lens 14 VDC, white lens 14 VDC, red/white lens 28 VDC, red lens 28 VDC, white lens 28 VDC, red/white lens 28 VDC, red lens with mask, Cessna single engines Optional mounting adapter

FAA TSO-C96a —

®

MODEL 70980 SERIES (NSN 6210-014143540) SELF-CONTAINED (INFRA-RED) LED LIGHT ASSEMBLY 70980 series is a self-contained IR LED anti-collision light. This light is currently used on several Military aircraft platforms as well as marine use, and can be easily adapted to suit a variety of applications for use in the NVG environment. Product has been tested to DO160 environmental standards. Shipped with flying leads. Lower mount has drain hole in lens. SPECIFICATIONS: ■ ■ ■

18

Power Consumption: 0.1 amps @ 28 VDC ■ LED: Infrared (875 nm) Weight: 1.0 lbs. (454gm) ■ Flash rate: 45 +/- fpm ■ Exposed Height: 4.04" (103mm) Exposed Diameter: 3.66" (93mm) ■ Lens: Clear hard coated polycarbonate

Model #

Part #

Description

Approvals

7098000 7098001

01-0770980-00 01-0770980-01

Upper mount, 28 VDC Lower mount, 28 VDC

— —

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

50519


90350 series is a self-contained all LED ground recognition light assembly. The design is intended to provide a solution to the needs for ground recognition lighting on a wide variety of aircraft. All current source and flasher circuitry is contained within the base plate. Unit is flush mounted to aircraft surface eliminating the need for large cutouts in the aircraft structure. Item ships with flying leads. Red LED’s with Red Lens

SPECIFICATIONS: ■ Power Consumption: 0.28 amps Avg. @ 28 VDC ■ LED Colors: Aviation Red ■ ■

Lens: Aviation Red, Polycarbonate ■ Weight: 0.2 lbs. (91gm) ■ Exposed Height: 1.48" (38mm) Exposed Width: 1.64" (42mm) ■ Exposed Length: 4.61" (117mm)

Model #

Part #

Description

Approvals

9035000

01-0790350-00

Red, 28 VDC

MODEL 71065 SERIES LED ANTI-COLLISION / GROUND RECOGNITION LIGHT ASSEMBLY 71065 series, low profile version of the 90088. A self-contained LED assembly utilizing the same electronic assembly of the 90088 and a unique mounting pattern. 71065 should not be considered an alternative for applications using 90044 or 90088. 71065 is an option for new aircraft or aircraft that wish to add a ground recognition or anti-collision light where one previously did not exist. Contains a single set of flying leads and a shield braid. 28 VDC Only.

NEW! Red LED’s with Red Lens

SPECIFICATIONS: ■ Power Consumption: 0.56 amps Avg, 3 amps Peak @ 28 VDC ■ ■ ■

Flash Rate: 45 fpm / Single Flash ■ LED Color: Aviation Red ■ Lens: Aviation Red, Polycarbonate Weight: 0.6 lbs.(272gm) ■ Exposed Height: 1.81 (46mm) ■ Exposed Width: 2.38" (60mm) Exposed Length: 8.5" (216mm)

Model #

Part #

Description

Approvals

7106511 7106512

01-0771065-11 01-0771065-12

Red anti-collision / ground rec. light, upper Red anti-collision / ground rec. light, lower

— —

MODEL 71055 SERIES LED BEACON 71055 series beacons are FAA TSO compliant self-contained LED anti-collision lights. They are designed to replace existing quartz halogen flasher beacons installed as original equipment on single engine Cessna's from 1967 and later (contact factory for details). They can also replace remote mounted strobe lights (ref. Whelen A470 series) allowing for removal of the strobe power supply. Internal mounting plate provided with choice of mounting holes to retrofit most existing mounting patterns. STC SA615EA approved.

NOW

SPRTOVCED

AP

SPECIFICATIONS: ■ ■ ■

Power Consumption: 01-0771055-00 - 1.2 amps Avg. / 01-0771055-01 - 0.6 amps Avg. LED Color: Aviation RED ■ Lens: Clear Polycarbonate ■ Weight: 0.52 lbs. (236gm) Exposed Height: 3.09" (78mm) ■ Exposed Diameter: 2.60" (66mm) Model # Part # Description Approvals

7105500 7105501

01-0771055-00 01-0771055-01

LED beacon 14 VDC, red LED beacon 28 VDC, red

FAA TSO-C96a Class III FAA TSO-C96a Class III

MODEL 90088 SERIES LED ANTI-COLLISION LIGHT 90088 series is a self-contained LED anti-collision beacon. It's solid-state circuitry and LED light source obsolete the "old style" mechanical oscillating beacons as well as the Whelen 90044 series quartz halogen flashing beacons. Benefits include no moving parts, no EMI/RFI, no inrush current spikes and crisp on/off cycles. There are several models available to provide compatibility with existing mounting patterns and profiles, thus eliminating the need to alter the aircraft.

SELF-CONTAINED LIGHT ASSEMBLIES

MODEL 90350 SERIES SELF-CONTAINED LED GROUND RECOGNITION LIGHT ASSEMBLY

SPECIFICATIONS: ■ Power Consumption: 0.45 amps @ 28 VDC ■ LED Color: Aviation RED Red LED’s with Clear Lens

■ ■

Weight: 1.8 lbs (816gm) (unless otherwise noted) ■ Exposed Height: 2.70" (69mm) Lens Color: Clear glass ■ Replaces: Whelen: 90044 Series and Grimes: G9950-( ), 40-0100-( ), 30-2140-( ), 40-0117-( ), 40-0127-( ), 30-2647-( )

To determine the model required for replacement, the following information is needed: upper or lower mounting, number of mounting holes (5 or 8), weight & position installed. Beacons installed on the rudder. Example: Citations and Barons, require a 2.25lb. assembly. Top replacement on Gulfstream II & III require a 9008812 in conjunction with the optional 16 hole mounting plate, P/N 06-170618-00. Part #

Description

Approvals

9008811 9008812 9008813 9008814 9008815 9008816 9008817 9008818 9008819

01-0790088-11 01-0790088-12 01-0790088-13 01-0790088-14 01-0790088-15 01-0790088-16 01-0790088-17 01-0790088-18 01-0790088-19

Lower, 5 hole, standard assembly, cable pigtail Upper, 5 hole, standard assembly, cable pigtail Upper, 5 hole, 2.25 lbs. rudder mount (Citations) Upper, 5 hole, 2.25 lbs. cable pigtail (Beech Barons) Lower, 5 hole, (MS27508E10A-5P connector) Upper, 5 hole, (MS27508E10A-5P connector) Lower, 5 hole, 2 drain holes (Hawker 800) Upper, 8 hole, 1.9 lbs, cable pigtail Lower, 8 hole, 1.9 lbs, cable pigtail

FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III FAA TSO-C96a Class III

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

®

Model #

19


SELF-CONTAINED LIGHT ASSEMBLIES

MODEL 9008812 SERIES LED ANTI-COLLISION LIGHT GULFSTREAM II & III Order 9008812 series beacon and adapter 06-170618-00 for the upper fuselage, use 90088 matched with appropriate model for the lower beacon.

90588 LED WINGTIP ANTI-COLLISION LIGHT 90588 is a drop in replacement for Goodrich GE16846-1 (Citation 680 & Citation X style) producing 400 Effective Candela and 180 degrees of coverage. Unit recesses into wingtip for a flush mounting. Unit ships with MS27508EA98P Connector integrated into the self-contained assembly. 28 VDC Only. SPECIFICATIONS: ■ ■ ■ ■

Drawing Number: 90588 ■ Voltage: 28 VDC ■ Power Consumption: 0.85 Amps Average LED Color: Aviation White ■ Lens: Clear Polycarbonate ■ Weight: 1.0 lbs (453.6gm) Exposed Height: 1.07" (27.18mm) ■ Recessed Length: 4.41" (112.01mm) Recessed Width: 3.85" (97.79mm) ■ Mounting Face Dimensions: 5.75" x 2.18" (140 x 55mm)

Model #

Part #

Description

Approval

9058800

01-0790588-00

LED Anti-Collision Light

FAA TSO-C96a Class II

NEW!

90615 LED Anti-Collision Light 90615 is a drop in replacement for Grimes 30-1-12-5 (Northrup Grumman RC-12/King Air, also found on other military aircraft), comes standard with 5-1/4 inch round five hole mounting, producing 400 Effective Candela in White and 100 Effective Candela in Red. DUAL MODE with independent controls for Red and White LED packages. Unit ships with MS3112E14-5P Series Connector into the self-contained assembly. 28 VDC Only. ®

SPECIFICATIONS: ■ ■ ■ ■

Drawing Number: 90615 ■ LED Color: Aviation White/Aviation Red ■ Voltage: 28 VDC Power Consumption: 0.9 Amps Average ■ Weight: 1.4 lbs (635gm) Exposed Height: 2.87”(72.90mm) ■ Lens Color: Clear, Hardcoated Polycarbonate Mounting Diameter: 5.14” (130.56mm)

Model #

Part #

Description

Approvals (Pending)

9061500 9061501

01-0790615-00 01-0790615-01

LED Anti-Collision Upper LED Anti-Collision Lower

FAA TSO-C96a Class II FAA TSO-C96a Class II

NEW!

20

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.


90044 series self-contained, 150 watt, quartz halogen flashing anti-collision light. Factory installed on Lear 31, Falcon 900 and Cessna Citation X. It is also a direct replacement for oscillating beacons on most corporate aircraft. 5-HOLE

SPECIFICATIONS: ■ Drawing number: 90044 ■ Weight: 1.6 lbs. (726gm) to 2.5 lbs. (1134gm) ■ ■

Height: 5.5” (140mm) ■ Power Consumption: 3.25 amps @ 28 VDC Replaces: G9950-( ), 40-0100-( ), 30-2140-( ), 40-0117-( ), 40-0127-( ), 30-2647-( )

To determine model required for replacement, the following information is needed: Lens color (red or white), upper or lower mounting location, number of mounting holes (5, 8, or 9), weight and position installed. Beacons installed on the rudder, (example: Citations and Barons) require a 2.25 lb. assembly. Top replacement on GII and GIII require 9004401 or 9004402 in conjunction with the 16 hole mounting plate, P/N 06-170618-00.

8-HOLE

MODEL 90044 SERIES MODEL VERSIONS Model # 9004401 9004402 9004403 9004404 9004409 9004410 9004413 9004415 9004417 9004418 9004419 9004420 9004433 9004434 9004435 9004437 9004439 9004441 9004444 9004453 9004454 9004455 9004456 9004457 9004458

Part # 01-0790044-01 01-0790044-02 01-0790044-03 01-0790044-04 01-0790044-09 01-0790044-10 01-0790044-13 01-0790044-15 01-0790044-17 01-0790044-18 01-0790044-19 01-0790044-20 01-0790044-33 01-0790044-34 01-0790044-35 01-0790044-37 01-0790044-39 01-0790044-41 01-0790044-44 01-0790044-53 01-0790044-54 01-0790044-55 01-0790044-56 01-0790044-57 01-0790044-58

Lens Color red white red white red white red red red white red white red white red red red red white white red red red red white

Mount upper upper lower lower upper upper upper lower upper upper lower lower upper upper upper upper lower lower lower lower lower upper lower upper upper

Base 5 hole 5 hole 5 hole 5 hole 5 hole 5 hole 5 hole 5 hole 8 hole 8 hole 8 hole 8 hole 5 hole 5 hole 8 hole 5 hole 5 hole 9 hole 5 hole 8 hole 5 hole 5 hole 5 hole 5 hole 5 hole

Remarks Standard assembly Standard assembly Standard assembly Standard assembly Capable of synchronizing flash rate with other like unit Capable of synchronizing flash rate with other like unit Slave unit Slave unit Standard assembly Standard assembly Standard assembly Standard assembly 2.25 lbs. Rudder mount (Citations) 2.25 lbs. Rudder mount (Citations) 2.50 lbs. (Westwind) 5 Position input connector (Citation X) 5 Position input connector (Citation X) Special 9 hole mounting plate 5 Position input connector (Citation X) Masked lens (Factory installed on Beech Barons) Lens has 2 drain holes & bottom mounted input connector (Hawker 800) Single input connector (Hawker 800) Lens has 2 drain holes & single input connector (Older Hawkers) 2.25 lbs., cable pigtail (Beech Barons) 2.25 lbs., cable pigtail (Beech Barons)

Approvals FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a

SELF-CONTAINED LIGHT ASSEMBLIES

MODEL 90044 SERIES

®

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

21


90033 series self-contained, 150 watt, quartz halogen flashing anti-collision n light which is factory installed on Beechcraft. It is also a direct replacement for oscillating beacons on most corporate aircraft. SPECIFICATIONS: Drawing Number: 90033 ■ ■

Weight: 0.6 lbs.(272gm) to 0.9 lbs. (408gm) Height: 4.4” (112mm) ■ Power Consumption: 5.5 amps @ 28 VDC 8 HOLE MOUNTING

2 HOLE MOUNTING 5 HOLE MOUNTING

5 HOLE ROUND MOUNTING

Model # 900331 900332 900333 900334 900335 900336 900335D 900336D 900337 900338 900339 9003310 9003311 9003312 9003313 9003314 9003317 9003319 9003323 9003324 9003325 9003326 9003329 9003330 9003332 9003333 9003334 9003338 9003344

Part # 01-0790033-01 01-0790033-02 01-0790033-03 01-0790033-04 01-0790033-05 01-0790033-06 01-0790033-5D 01-0790033-6D 01-0790033-07 01-0790033-08 01-0790033-09 01-0790033-10 01-0790033-11 01-0790033-12 01-0790033-13 01-0790033-14 01-0790033-17 01-0790033-19 01-0790033-23 01-0790033-24 01-0790033-25 01-0790033-26 01-0790033-29 01-0790033-30 01-0790033-32 01-0790033-33 01-0790033-34 01-0790033-38 01-0790033-44

Lens Color red white red white red white red white red white red white red white red white red red red white red white red white white red white white white

Mount lower lower lower lower upper upper lower lower lower lower lower lower upper upper upper upper upper lower lower lower upper upper upper upper lower upper upper upper upper

Base 2 hole 2 hole 8 hole 8 hole 5 hole 5 hole 5 hole 5 hole round round 8 hole 8 hole 5 hole 5 hole 2 hole 2 hole 2 hole 2 hole 8 hole 8 hole 5 hole 5 hole 5 hole 5 hole 2 hole 5 hole 5 hole 2 hole 2 hole

Remarks Standard unit, 18” cable, no connector Standard unit, 18” cable, no connector 18” cable, AMP #207846-1, 2 position connector 18” cable, AMP #207846-1, 2 position connector 18” cable, AMP #207846-1, 2 position connector 18” cable, AMP #207846-1, 2 position connector 18” cable, AMP #207846-1, 2 position connector 18” cable, AMP #207846-1, 2 position connector 5.12” dia. mounting base, MS3102R10SL-3P connector 5.12” dia. mounting base, MS3102R10SL-3P connector 18” cable, AMP #208530-1, 8 position connector 18” cable, AMP #208530-1, 8 position connector AMP #1-480698-0, 2 position connector AMP #1-480698-0, 2 position connector (Beech 1900) No connector, 13” leads (Cessna CJ1, CJ2) No connector, 13” leads AMP #207846-1, 2 position connector with masked lens AMP #207846-1, 2 position connector AMP #207567-1, 3 position connector AMP #207567-1, 3 position connector (Beech 1900) MS3102R10SL-3P connector on mounting bracket (Beech Jet) MS3102R10SL-3P connector on mounting bracket (Beech Jet) Master unit, no connector Master unit, no connector (Fairchild) Slave unit, no connector (Fairchild) 18” cable, no connector 18” cable, no connector Slave unit, masked (Beech Baron) used with 90044-53 master unit AMP #207846-1, 2 position connector

®

SELF-CONTAINED LIGHT ASSEMBLIES

MODEL 90033 SERIES SELF-CONTAINED LIGHT ASSEMBLIES

22

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

Approvals FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a FAA TSO-C96a


70963 series is designed to replace existing incandescent & halogen position lights used on most business and commuter jets. The benefits of LED technology will drastically reduce operating costs and improve reliability over the existing lighting. The 70963 series are warranted to comply with FAA color & light output regulations for 5 years or 10,000 hours. SPECIFICATIONS: ■ ■ ■

Power Consumption: 0.3 amps @ 28 VDC ■ Weight: 0.25 lbs. (113gm) Input Voltage: 22-30 VDC ■ LED Color: Aviation Red, Aviation Green Exposed Height: 1.98" (50mm) ■ Diameter: 2.10" (53mm)

Model #

Part #

Description

Approvals

7096303 7096304

01-0770963-03 01-0770963-04

Green position light Red position light

FAA TSO-C30c Type II FAA TSO-C30c Type I

MODEL 71105 SERIES LED POSITION LIGHT ASSEMBLY 71105 series are fully FAA TSO compliant forward position lights. LED's provide a significant reduction in electrical current draw over conventional light bulbs. The 71105 is our latest design and lowest priced forward position light. Direct replacement for Whelen Model W1285 series (Version STC'd on Learjet Aircraft). SPECIFICATIONS: ■ ■

LED Navigation Light Power Consumption: 0.25 amps @ 14 VDC or 28 VDC LED Colors: Aviation Red, Aviation Green ■ Weight: 0.20 lbs. (91gm) 14 VDC, 0.25 lbs. (113gm) 28 VDC ■ Exposed Height: 2.70” (69mm) ■ Lens: Clear Polycarbonate Model #

Part #

Description

Approvals

7110501 7110502 7110503 7110504

01-0771105-01 01-0771105-02 01-0771105-03 01-0771105-04

Position green, 14 VDC Position red, 14 VDC Position green, 28 VDC Position red, 28 VDC

FAA TSO-C30c Type II FAA TSO-C30c Type I FAA TSO-C30c Type II FAA TSO-C30c Type I

MODEL W1285 SERIES (NSN 6220-13900750/-330) W1285 series wing tip position light which uses a 26-watt incandescent lamp. It is a direct replacement for the brand “G” A1285 series. Specify 14 or 28 VDC. SPECIFICATIONS: ■ ■

Drawing Number: 70001 ■ Weight: 0.2 lbs. (91gm) ■ Height: 1.25” (32mm) Length: 4” (102mm) ■ Power Consumption: 2 amps @ 14 VDC, 1 amp @ 28 VDC

Model #

Part #

Description

Approvals

W1285PG1 W1285PR1 W1285PG2 W1285PR2

01-0770001-41 01-0770001-51 01-0770001-42 01-0770001-52

14 VDC, position green 14 VDC, position red 28 VDC, position green NSN (-750) 28 VDC, position red NSN (-330)

FAA TSO-C30b Type II FAA TSO-C30b Type I FAA TSO-C30b Type II FAA TSO-C30b Type I

POSITION LIGHT ASSEMBLIES

MODEL 70963 SERIES LED FORWARD POSITION LIGHTS

MODEL W1250 SERIES (NSN 6220-14639825/-24) W1250 series wing tip position light is designed for use under a wing tip fairing. It uses a 26 watt incandescent lamp and is a direct replacement for the brand “G” A1815A Series. Specify 14 or 28 VDC. SPECIFICATIONS: ■ ■

Drawing Number: 70082 ■ Weight: 0.3 lbs. (136gm) ■ Height: 1.25” (32mm) Length: 2.75” (70mm) ■ Power Consumption: 2 amps @ 14 VDC, 1 amp @ 28 VDC

Model #

Part #

Description

Approvals

W1250PR1 W1250PR2 W1250PG1 W1250PG2

01-0770082-00 01-0770082-01 01-0770082-02 01-0770082-03

Position red, 14 VDC Position red, 28 VDC NSN (-24) Position green, 14 VDC Position green, 28 VDC NSN (-25)

FAA TSO-C30b Type I FAA TSO-C30b Type I FAA TSO-C30b Type II FAA TSO-C30b Type II

MODEL 71379 SERIES LED FORWARD POSITION LIGHT 71379 is an LED W1250 wingtip forward position light designed to be located under a fairing, but is suitable for external mounting as well. Replaces GRIMES A1815A and Whelen W1250. Product ships with 6” flying leads and is avilable in 28VDC only. SPECIFICATIONS: ■ ■ ■

NEW!

Drawing Number: 71379 ■ Voltage: 28 VDC ■ Power Consumption: 0.3 Amps Weight: 0.5lbs (226.8gm) ■ Length: 2.31” (58.67mm) ■ Exposed Height: 1.25” (31.75mm) Width: 1.75” (44.45mm) Model # Part # Description Approvals (Pending)

7137901 7137902

01-0771379-01 01-0771379-02

LED Forward POS (Green) LED Forward POS (Red)

FAA TSO-C96a, TSO-C30c Types II FAA TSO-C96a, TSO-C30c Types I ®

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

23


POSITION LIGHT ASSEMBLIES

MODEL 71015 SERIES LED FORWARD POSITION LIGHTS 71015 series are FAA TSO compliant forward position lights. They are compatible with the Whelen W1250 position light mounting as well as any other make that uses the same mounting pattern. SPECIFICATIONS: ■ ■ ■

Power Consumption: 0.3 amps @ 28 VDC LED Color: Aviation Red; and Aviation Green ■ Weight: 0.2 lbs. (91gm) Exposed Height: 1.33" (34mm) ■ Length: 2.41" (61mm)

Model #

Part #

Description

Approvals

7101501 7101502

01-0771015-01 01-0771015-02

Green position light, 28 VDC Red position light, 28 VDC

FAA TSO-C30c Type II FAA TSO-C30c Type I

MODEL 90377 SERIES LED POSITION LIGHT ASSEMBLY 90377 series is a wing tip mounted position light assembly utilizing LED's for both the forward & tail position lights, eliminating the need for a tail mounted position light. The LED's provide a significant reduction in current draw over conventional position light bulbs. Direct replacement (exact footprint) for the Whelen Model A675PG/PR series. Single set of flying leads operates both forward & tail nav on 28 VDC version, and one set each of flying leads for the forward & tail nav on the 14 VDC version. SPECIFICATIONS: ■ ■ ■ ■

LED Navigation Lights Power Consumption: 0.5 amps @ 14 VDC, 0.25 amps @ 28 VDC LED Colors: Aviation Red, Aviation Green and Aviation White ■ Weight: 0.35 lbs. (159gm) Exposed Height: 1.08" (27mm) ■ Exposed Width: 1.87" (47mm) Exposed Length: 5.69" (145mm) ■ Lens: Clear Polycarbonate Model # Part # Description Approvals

9037701 9037702 9037703 9037704

01-0790377-01 01-0790377-02 01-0790377-03 01-0790377-04

Position green, 14 VDC Position red, 14 VDC Position green, 28 VDC Position red, 28 VDC

FAA TSO-C30c Types II & III FAA TSO-C30c Types I & III FAA TSO-C30c Types II & III FAA TSO-C30c Types I & III

MODEL A675 SERIES A675 series wing tip position and taillight designed to eliminate the need for a tail mounted position light. It uses a 26 watt incandescent lamp for the forward position light and a 25 watt halogen for the tail position light. Specify 14 or 28 VDC. SPECIFICATIONS: ■ Drawing Number: 90009 ■ Weight: 0.5 lbs. (227gm) ■ Height: 1.25” (32mm) ■

Length: 5.62” (143mm) ■ Power Consumption: 4 amps @ 14 VDC, 2 amps @ 28 VDC Model # Part # Description Approvals

A675PG14 A675PR14 A675PG28 A675PR28

01-0790009-01 01-0790009-02 01-0790009-03 01-0790009-04

Position green, 14 VDC Position red, 14 VDC Position green, 28 VDC Position red, 28 VDC

FAA TSO-C30b Type II & III FAA TSO-C30b Type I & III FAA TSO-C30b Type II & III FAA TSO-C30b Type I & III

MODEL 71011 SERIES LED TAIL POSITION LIGHTS 71011 series are LED tail position lights designed to replace the existing “old style” tail lights typically seen mounted on most general aviation, corporate, and helicopter applications. They have all the advantages associated with using LED’s as a light source, improved reliability, and reduced operating costs. Now offered with a 14 Volt version. SPECIFICATIONS: ■ Power Consumption: 0.5 amps @ 14 VDC; 0.3 amps @ 28 VDC ■ ■

LED Color: Aviation White ■ Weight: 0.2 lbs. (91gm) ■ Exposed Height: 1.36" (35mm) Mounting Hole Pattern: 1.75" (45mm) Model # Part # Description Approvals 01-0771011-02 01-0771011-03 01-0771011-12 01-0771011-13

Vertical mount 28 VDC Horizontal mount 28 VDC Vertical mount 14 VDC Horizontal mount 14 VDC

FAA TSO-C30c Type III FAA TSO-C30c Type III FAA TSO-C30c Type III FAA TSO-C30c Type III

®

7101102 7101103 7101112 7101113

VERTICAL MOUNTING — 02

24

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

HORIZONTAL MOUNTING — 03


A555A series tail mounted position light which uses a 25 watt halogen lamp. The suffix “V” or “H” in the part number designates the aircraft mounting screw locations in respect to the light shield. “V” designates vertical mounting and “H” indicates horizontal mounting on the aircraft. Supplied with a 2 position “AMP” connector. Specify 14 VDC or 28 VDC. Replaces the brand “G” A2064 series. SPECIFICATIONS: ■ Drawing Number: 70034 ■ ■

Exposed Height: 1.4” (36mm) ■ Mounting Diameter: 1.06” (27mm) Power Consumption: 2 amps @ 14 VDC, 1 amp @ 28 VDC ■ Weight: 0.1 lbs. (45gm) Model # Part # Description Approvals

VERTICAL MOUNTING

HORIZONTAL MOUNTING

A555AV14 A555AV28 A555AH14 A555AH28

01-0770034-00 01-0770034-01 01-0770034-02 01-0770034-03

Vertical mounting, 14 VDC Vertical mounting, 28 VDC NSN Horizontal mounting, 14 VDC Horizontal mounting, 28 VDC

FAA TSO-C30b Type III FAA TSO-C30b Type III FAA TSO-C30b Type III FAA TSO-C30b Type III

MODEL 70722 SERIES 70722 series wing tip mounted, tail position light. Uses a 25 watt halogen lamp. It is standard equipment for the Raytheon JPATS military trainer. SPECIFICATIONS: ■ Drawing Number: 70722 ■ ■

Exposed Height: 1.04” (26mm) ■ Length: 2.94” (75mm) ■ Width: 1.48” (38mm) Power Consumption: 2 amps @14 VDC, 1 amp @28 VDC ■ Weight: 0.13 lbs. (59gm) Model # Part # Description Approvals

7072200 7072201 7072202 7072203

01-0770722-00 01-0770722-01 01-0770722-02 01-0770722-03

28 VDC with M39029/1-101 pins 28 VDC 14 VDC with M39029/1-101 pins 14 VDC

FAA TSO-C30b Type III FAA TSO-C30b Type III FAA TSO-C30b Type III FAA TSO-C30b Type III

MODEL 70966 SERIES LED 70966 series LED tail position light, is a high quality, long lasting, modern alternative to incandescent & halogen tail position lights. It offers significant technological upgrades over previous products. Utilizing LED technology, the following advantages are offered: Long Life (approx. 20,000 hours); Reduced Power Consumption (compared to alternative light sources); Shock & Vibration Resistant (no fragile filament to burn out); Light (produces bright white light) and No EMI or RFI Interference. 3 Year Warranty. SPECIFICATIONS: ■ Drawing Number: 70966 ■ ■

Exposed Height: 1.64” (42mm) ■ Length: 2.60” (66mm) ■ Width: 1.74” (44mm) Power Consumption: 0.3 amps @ 28 VDC ■ Weight: 0.3 lbs. (136gm) Model # Part # Description Approvals

7096600

01-0770966-00*

7096601

01-0770966-01*

28 VDC - no connectors *Note - Replaces 01-0770805-00 28 VDC - connectors, case ground used on Beechjet *Note - Replaces 01-0770805-01

FAA TSO-C30c Type III

POSITION LIGHT ASSEMBLIES

MODEL A555A SERIES (NSN 6220-14639826)

FAA TSO-C30c Type III

MODEL 70513 SERIES INFRA-RED LED EMITTER 70513 series is an IR Emitter used to identify aircraft or vehicles in the non visible light spectrum. A good choice when viewing objects with video or light amplification devices. Product produces good visibility through GEN III/GEN IV NVG from 800 - 1000 meters and marginal visibility out to 1500 meters. Models available in a choice of 30 or 2 hertz. Assembly ships with a set of 36" flying leads. SPECIFICATIONS: ■ LED IR Emitter Light Power Consumption: 19ma @ 28 VDC ■ ■

LED Colors: Infra-Red, 890nm Wavelength ■ Weight: 0.2lbs. (91gm) Exposed Height: 1.4" (36mm) ■ Lens: Heat Resistant glass (frosted)

Model #

Part #

Description

Approvals

7051300 7051301 7051302 7051303

01-0770513-00 01-0770513-01 01-0770513-02 01-0770513-03

IR LED emitter (30hz), 28 VDC IR LED emitter (30hz), 14 VDC IR LED emitter (2hz), 28 VDC IR LED emitter (2hz), 14 VDC

— — — —

71499 LED INFRA-RED IDENTIFICATION LIGHT 71499 is a surface mounted LED IR flasher assembly nearly 30 times the intensity of our Model 70513. Product is designed to be easily identified at distances approaching 2km (depending on conditions and equipment). IR signature is optimized along the ‘length’ axis, LED output listed at 875nm. Product ships with 12 inches of teflon flying leads. SPECIFICATIONS:

NEW!

■ ■ ■

Drawing Number: 71499 ■ Voltage: 28 VDC ■ Power Consumption: 50mA Weight: 0.22lbs (99.8gm) ■ Length: 4.61” (117.09mm) ■ Exposed Height: 1.41” (35.81mm) Width: 1.64” (41.65mm) Part #

Description

Approvals

7149900

01-0771499-00

IR LED Flasher

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

®

Model #

25


INTERIOR LIGHTING

71450

MODEL 71434, 71440 & 71450 SERIES The 71434, 71440, & 71450 Series LED (Light Emitting Diode) instrument post light assemblies are designed to illuminate the instrument panel and function as instrument mounting bolts. They are a high quality, long lasting modern alternatives to standard incandescent post lights. Benefits of upgrading to LED technology include: Long Life (approx. 20,000 hours); Reduced Power Consumption (compared to conventional light sources); Shock & Vibration Resistance (no fragile filament to burn out); Light Color & Temperature (produces bright, crisp light); and No EMI or RFI Interference Model 71434 is identical to the 71450 without the connector nut. Both are available in black and grey. 14V version available with White LED, 28V version with White or Red. Made to replace existing A350 and A350CN assemblies. Model 71440 has a #10-32 mounting thread. 28V version available with White or Red LED. Available in black. Made to replace Model 70348.

NEW! 71434

SPECIFICATIONS: ■ Drawing Number: 71434 ■ Drawing Number: 71440 ■ Drawing Number: 71450 ■ ■ ■

Exposed Height: 0.95” (24mm) with spacer, 0.875” (22mm) without spacer Power Consumption: .10 mA @14 VDC & 28 VDC Weight: 0.037 lbs. (17gm)

Model 71434# Part #

Description

Approvals

01-0771434b11 01-0771434b13 01-0771434b20 01-0771434b21 01-0771434b22 01-0771434b23 01-0771434g11 01-0771434g13 01-0771434g20 01-0771434g21 01-0771434g22 01-0771434g23

LED post light, 14 VDC, white long black LED post light, 14 VDC, white short black LED post light, 28 VDC, red long black LED post light, 28 VDC, white long black LED post light, 28 VDC, red short black LED post light, 28 VDC, white short black LED post light, 14 VDC, white long grey LED post light, 14 VDC, white short grey LED post light, 28 VDC, red long grey LED post light, 28 VDC, white long grey LED post light, 28 VDC, red short grey LED post light, 28 VDC, white short grey

— — — — — — — — — — — —

Model 71440# Part #

Description

Approvals

01-0771440-00 01-0771440-01 01-0771440-02

LED post light, 28 VDC, red with spacer LED post light, 28 VDC, white LED post light, 28 VDC, red

— — —

Model 71450# Part #

Description

Approvals

01-0771450b11 01-0771450b13 01-0771450b20 01-0771450b21 01-0771450b22 01-0771450b23 01-0771450g11 01-0771450g13 01-0771450g20 01-0771450g21

LED post with nut, 14 VDC, white long black LED post with nut, 14 VDC, white short black LED post with nut, 28 VDC, red long black LED post with nut, 28 VDC, white long black LED post with nut, 28 VDC, red short black LED post with nut, 28 VDC, white short black LED post with nut, 14 VDC, white long grey LED post with nut, 14 VDC, white short grey LED post with nut, 28 VDC, red long grey LED post with nut, 28 VDC, white long grey

— — — — — — — — — —

71434b11 71434b13 71434b20 71434b21 71434b22 71434b23 71434g11 71434g13 71434g20 71434g21 71434g22 71434g23 7144000 7144001 7144002 71450b11 71450b13 71450b20 71450b21 71450b22 71450b23 71450g11 71450g13 71450g20 71450g21

A350CN

MODEL A350 & A350CN SERIES A350 and A350CN series instrument post light assemblies are designed to illuminate the instrument panel and function as instrument mounting bolts. The A350 is identical to the A350CN, but without the connector nut. SPECIFICATIONS: ■ Drawing Number A350: 70116 ■ Drawing Number A350CN: 70119

®

■ ■ ■

Exposed Height: .875” (22mm) without spacer, 1.00” (25mm) with spacer Power Consumption: 0.2 amps @6 VDC, 0.08 amps @14 VDC, & 0.04 amps @ 28 VDC Weight: 0.037 lbs. (17gm)

Model #

Part #

Description

Approvals

A350 A350CN

01-0770116-( ) 01-0770119-( )

Instrument post light assemblies Instrument post light assemblies

— FAA/PMA-( )

ORDERING OPTIONS: Lens Colors IW = Instrument White CL = Clear RD = Red

26

Post Colors BK = Black GR = Grey

Post Heights SH = Short (1.875”) LG = Long (2.375”)

Voltages 6 = (328 lamp) 14 = (330 lamp) 28 = (327 lamp)

Ordering Code Example:

A350CN - BK - CL - SH - 14

Assy P/N

Lens Color

Post Color

Post Height

Voltage

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

A350


70348 series instrument post light assemblies is designed to illuminate the instrument panel and function as instrument mounting bolts. The unit has a #10-32 mounting thread and uses the #327 lamp. 28 VDC Only. 70348

SPECIFICATIONS: ■ Drawing Number: 70348 ■ Weight: 0.037 lbs. (17gm) ■

Exposed Height: 0.856” (22mm) ■ Power Consumption: 0.04 amps @ 28 VDC

Model #

Part #

Description

Approvals

7034800 7034801 7034802 7034803

01-0770348-00 01-0770348-01 01-0770348-02 01-0770348-03

Instrument white, 28 VDC Red with spacer, 28 VDC Clear, 28 VDC Red, 28 VDC

— — — —

MODEL C70190 SERIES C70190 series Interior gooseneck light assembly featuring a positive off position & rheostat controlled light intensity. Uses the #1495 lamp. 28 VDC Only. SPECIFICATIONS: ■ Drawing Number: 70190 ■ Weight: 0.3 lbs. (136gm) ■ Lamp: 6 watt ■ Power Consumption: 0.3 amps @ 28 VDC Model # 70190(

)

Part #

Description

Approvals

01-0770190( )

As requested (see chart)

FAA/PMA (12” Only)

Ordering Code Example: Model P/N 70190

Lens Color W = Clear R = Red B = Blue (Inst. White)

70190 - B - 12 Arm Length in inches 04 = 4”, 06 = 6”, 08 = 8”, 10 = 10”, 12 = 12”, 14 = 14”, 16 = 16”, 18 = 18”, 20 = 20”, 22 = 22”, 24 = 24”

INTERIOR LIGHTING

MODEL 70348 SERIES

MODEL 71144 'GOOSENECK' LED LIGHT ASSEMBLY 71144 assembly features a positive off position and rheostat controlled light intensity. Models including 'side' mounted intensity control are which is designed for the S76D. 28 VDC Only. SPECIFICATIONS: ■ Power Consumption: 0.06 amps @ 28 VDC ■ LED Colors: Aviation White ■

Weight: 0.46 lbs. (209gm) ■ Black Nylon Hood: fixed in position

Model #

Part #

Description

Approvals

7114416

01-0771144-16

16 inch adjustable map light, 28 VDC

MODEL 70820 SERIES INTERIOR LED MAP/READING LIGHT 70820 series are LED (Light Emitting Diode) interior map/reading light assemblies. They are designed for cabin, or cockpit illumination. It has a 360 º swivel base, allowing for infinite light angle adjustment. Utilizing LED technology, the following advantages are offered: Long Life (approx. 20,000 hours); Reduced Power Consumption (compared to alternative light sources) and Shock & Vibration Resistant. SPECIFICATIONS: ■ Drawing Number: 70820 ■ Weight: 0.19 lbs. (86gm) ■

Power Consumption: 0.02 amps @ 14 VDC, 0.02 amps @ 28 VDC

Model #

Part #

Description

Approvals

7082000 7082001 7082002 7082003 7082004 7082005 7082006 7082007

01-0770820-00 01-0770820-01 01-0770820-02 01-0770820-03 01-0770820-04 01-0770820-05 01-0770820-06 01-0770820-07

White LED, natural aluminum finish, 14 VDC White LED, natural aluminum finish, 28 VDC White LED, black anodized finish, 14 VDC White LED, black anodized finish, 28 VDC Red LED, black anodized finish, 14 VDC Red LED, black anodized finish, 28 VDC Blue LED, black anodized finish, 14 VDC Blue LED, black anodized finish, 28 VDC

— — — — — — — —

MODEL 71140 SERIES LED DOME LIGHT, PRIMARY & EMERGENCY LIGHTING 71140 series is an LED alternative to Grimes 34170 (dome light) used on Bombardier Global Express, Challenger 600, 601, 604; Gulfstream GIII, GIV; Learjet 54, 56, 60 and Sikorsky S76. Primary operating voltage is 28 VDC, an emergency circuit at 5 VDC is provided for long-life lighting on an alternate power source. Spun aluminum assembly 5.5 inches outer diameter, 3.83 inch recessed inner diameter with a 1 inch recessed depth. Item ships with three flying leads, a ground, a 5 VDC line and a 28 VDC line. SPECIFICATIONS: ■ Power Consumption: 125mA @ 28 VDC, 250mA @ 5 VDC ■ ■

LED Color: Aviation White ■ Weight: 0.35 lbs. (159m) Lens: Translucent Polycarbonate

Exposed Height: 0.45 (11mm)

Part #

Description

Approvals

7114000

01-0771140-00

LED interior dome light

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

®

Model #

27


INTERIOR LIGHTING

MODEL A300 SERIES A300 series interior map light assemblies designed for indirect cockpit illumination. Slide switch permits direct chart reading. Available with a red or instrument white lens. Uses a 14 VDC #1414 lamp or a 28 VDC #1495 lamp. SPECIFICATIONS: ■ Drawing Number: 70104 ■ ■

Depth Behind Mounting Flange: 1.06” (27mm) ■ Weight: 0.16 lbs. (73gm) Lamp Wattage: 6 watts ■ Power Consumption: 0.46 amps @ 14 VDC, 0.3 amps @ 28 VDC

Model #

Part #

Description

Approvals

A300W14 A300W28 A300R14 A300R28

01-0770104-30 01-0770104-31 01-0770104-50 01-0770104-51

Instrument white, 14 VDC Instrument white, 28 VDC Red, 14 VDC Red, 14 VDC

— — — —

MODEL 70339 SERIES 70339 series interior dome/compartment light assemblies designed for recessed overhead or wall mounting with minimal depth. An On/Off switch is optional. Uses a 14 VDC #1414 lamp or a 28 VDC #1495 lamp. SPECIFICATIONS: ■ Drawing Number: 70339 ■ ■

Depth Behind Mounting Flange: 1.06” (27mm) ■ Weight: 0.16 lbs. (73gm) Lamp Wattage: 6 watts ■ Power Consumption: 0.46 amps @ 14 VDC, 0.3 amps @ 28 VDC

Model #

Part #

Description

Approvals

7033901 7033902 7033903 7033904

01-0770339-01 01-0770339-02 01-0770339-03 01-0770339-04

14 VDC 28 VDC 14 VDC with switch 28 VDC with switch

— — — —

MODEL 71154 SERIES LED 71154 series is an LED Reading/Cockpit light replacement for Grimes Model 22020 (typically found on S76 and GIV aircraft and others). Item ships as pictured with LED Specific rheostat located ten inches from the lighthead. Rheostat shaft is 0.25 inches in diameter. Steady On / Dimmable. 28 VDC Only. SPECIFICATIONS: ■ Current: 0.125a ■ Weight: 0.16 lbs. (73gm) ■ Lens: None ■

Aluminum housing, Black Anodize ■ Dimensions: 2.25" (57mm) Long, 2.25 (57mm) Wide, Exposed Height, 0.75" (19mm) Model #

Part #

Description

Approvals

7115400

01-0771154-00

LED series flood light

MODEL 70985 SERIES LED 70985 is an LED interior illumination assembly. It's .5 inches wide and is available with a 2.45" or a 1.95" length. Designed to be used in conjunction with customer designed interior aircraft parts. Item ships with 7 inch flying leads. Will function normally from 24-30 Volts. SPECIFICATIONS: ■ Current: 0.06a Average Typ. ■ Dimensions: 2.45" (62mm) Long, 0.5 (13mm) Wide (-01 Version) // 1.95" (50mm) Long, 0.5 (13mm) Wide (-00 Version) Model #

Part #

Description

Approvals

7098501

01-0770985-01

Interior 12 LED light strip

MODEL 70813 SERIES LED 70813 series LED interior cabin light is a high quality, long lasting, dimmer controllable, modern alternative to the A360 series incandescent interior cabin lights. It offers significant technological upgrades over previous products. Utilizing LED (Light Emitting Diode) technology, the following advantages are offered: Long Life (approx. 100,000 hours); Reduced Power Consumption (compared to alternative light sources); Shock & Vibration Resistant (no fragile filament to burn out); Light (produces bright white light); Small Profile (allows for shallow mounting depth) and No EMI or RFI Interference. SPECIFICATIONS: ■ Drawing Number: 70813 ■ Weight: 0.1 lbs. (45gm) Mounting Depth: 0.25” (6mm) ■ Length: 4.0” (101mm) ■ Width: 2.75” (70mm) Model # Part # Voltage Current Candela

®

28

7081300 7081303 7081304 7081307 7081308 7081311 7081312

01-0770813-00 01-0770813-03 01-0770813-04 01-0770813-07 01-0770813-08 01-0770813-11 01-0770813-12

28 VDC 14 VDC 28 VDC 14 VDC 28 VDC 14 VDC 28 VDC

.04 amps .08 amps .08 amps 0.16 amps 0.16 amps 0.24 amps 0.24 amps

7 CD 14 CD 14 CD 28 CD 28 CD 42 CD 42 CD

Approvals — — — — — — —

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.


A360 series interior light assemblies designed for compartment flooding and general lighting. The A360SW is identical to the A360 but includes an On/Off slide switch. Suffix in model number indicates lamp required. Lamp desired determines the voltage. SPECIFICATIONS: ■ Drawing Number A360: 70142 ■ Drawing Number A360SW: 70143 ■ ■

Weight: 0.2 lbs. (91gm) ■ Length: 4.0” (101mm) ■ Width: 2.75” (70mm) Depth Behind Mounting Flange: 1.40” (36mm) Model # Part # Description Approvals A360631 A360303 A3601141 A360307 A360S A360S303 A360SW1 A360S307

01-0770142-00 01-0770142-01 01-0770142-02 01-0770142-03 01-0770143-00 01-0770143-01 01-0770143-02 01-0770143-03

#631 lamp, 9 watt, 14 VDC #303 lamp, 9 watt, 28 VDC #1141 lamp, 18 watt, 14 VDC #307 lamp, 18 watt, 28 VDC #631 lamp, 9 watt, 14 VDC with switch #303 lamp, 9 watt, 28 VDC with switch #1141 lamp, 18 watt, 14 VDC with switch #307 lamp, 18 watt, 28 VDC with switch

— — — — — — — —

MODEL A315-HI SERIES (NSN 6220-13417718) A315-HI series cockpit utility light assembly which rotates for convenience in reading maps and illuminating instrument panels. Furnished with a right angle bracket for ease of mounting. Available with instrument white (blue) lens, red or clear. Uses a 14 VDC #1414 or a 28 VDC #1495 lamp. SPECIFICATIONS: ■ Drawing Number: 70113 ■ ■

Weight: 0.07 lbs. (32gm) ■ Height: 2.2” (56mm) ■ Depth: 0.93” (24mm) ■ Width: 0.87” (22mm) Power Consumption: 0.46 amps @ 14 VDC, 0.3 amps @ 28 VDC Model # Part # Description Approvals A315HIR1 A315HIR2 A315HIW1 A315HIW2 A315HIB1 A315HIB2

01-0770113-00 01-0770113-01 01-0770113-02 01-0770113-03 01-0770113-04 01-0770113-05

Red lens, 14 VDC Red lens, 28 VDC White lens, 14 VDC White lens, 28 VDC Instrument white lens, 14 VDC Instrument white lens, 28 VDC NSN

— — — — — —

INTERIOR LIGHTING

MODEL A360 SERIES

MODEL A315-LO SERIES A315-LO series cockpit utility light assembly which rotates for convenience in reading maps and illuminating instrument panels. Optional right angle bracket available for ease of mounting. Uses a 14 VDC #1893 or a 28 VDC #1864 lamp. SPECIFICATIONS: ■ Drawing Number: 70106 ■ ■

Weight: 0.06 lbs. (27gm) ■ Height: 2.18” (55mm) ■ Depth: 0.81” (21mm) Width: 0.81” (21mm) ■ Power Consumption: 0.33 amps @ 14 VDC, 0.17 amps @ 28 VDC Model # Part # Description Approvals

A315LO14 A315LO28

01-0770106-00 01-0770106-01

14 VDC 28 VDC

— —

71414 LED INSPECTION LIGHT NEW!

Model 71414 is an LED inspection light designed to replace GRIMES A5395-23 on the S76 Helicopter. The product comes standard with a black anodize finish and a clear polycarbonate lense. 71414 also comes with an 'L' Bracket and has a hex head locking assembly to hold the light at the desired angle. 71414 produces more (>13) candela than the GRIMES light it replaces, unit comes with 12" flying leads. SPECIFICATIONS: ■ Drawing Number: 71414 ■ ■

Weight: 0.08 lbs (36.29gm) ■ Height: 1.19" (30.23mm) ■ Width: 0.80" (20.32mm) Voltage: 24 VDC ■ Viewing Angle: Up to 70 Degrees Model # Part # Description Approvals

71414

01-0771414-00

24 VDC

®

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

29


EXTERIOR LIGHTING

PARMETHEUS Series

NEW!

LED PAR36 “Drop-In” Replacement LED lighting is the ideal technology for aviation applications. fe Whelen LED lights are time and field-tested for reliability and long-life performance under the tough conditions required by Fire, Emergency,, DOT and Law Enforcement professionals around the world. Parmetheus PAR-36 LED lights are a drop-in replacement for outdated Halogen or HID lamps. Lightweight, low-current and moisture resistant, they provide stable light output for thousands of operating hours.

Taxi Light PLED2T

FEATURES ■ ■ ■ ■ ■

Direct replacement for outdated PAR-36 Halogen and HID lamps. First commercially available PAR-36 LED for Aviation applications. Stable light output for thousands of trouble-free operating hours. Available in Landing and Taxi versions. Convenient “Drop-In” design for ease of installation: • Power wiring attaches to brass screw terminals. • Weight is virtually identical to previous PAR36 lamps. • Assembly design includes clocking notch. ■ Polycarbonate, replaceable, hard-coated outer lens. ■ Metal, heat dissipating coated housing. ■ Whelen TIR™ (Total Internal Reflector) technology rivals strobe in intensity and effectiveness. ■ Proudly designed and manufactured in the USA. ■ Three year warranty.

Landing g Light PLED2L D2L

PARMETHEUS

PAR-36

Note: Brackets and mounting will vary from aircraft to aircraft; FAA Field Approval (Form 337) may be required to use this product.

Model

Part Number

PLED2L

01-0771424-20

PLED2T

01-0771424-25

PLED1L

01-0771424-10

PLED1T

01-0771424-15

Model Description

Approvals

Power Consumption

®

Type

Taxi (Spreader Optic, 40°) Landing (Spot Light, 10°)

Taxi (Spreader Optic, 40°)

Replacement Outer Lens: 68-3971486A-30

.6 Amps @ 28 VDC

Weight

4.38” Round x 1.75” Face to Screw terminal

1.2 Amps @ 14 VDC Whelen Drawing Number: 71424

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products may require additional FAA approvals.

30

Dimensions

Amps @ Volts

Landing (Spot Light, 10°) PAR-36 LED Drop-In Replacement

Input Voltage


90361 series is a self-contained all LED landing light assembly. The design is intended to provide a solution to the needs for a taxi & landing light on a wide variety of aircraft. All current source and electronic circuitry is contained within the housing. Unit is available in several mounting configurations to retrofit existing typical PAR-36 lighting. Outer lens allows for mounting externally on aircraft, option of diffusion lens available upon request. Item ships with flying leads. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Power Consumption: 1.5 amps @ 28 VDC ■ Weight: 1.3 lbs. (590gm) ■

Exposed Diameter: 4.70" (119mm), Overall ■ Depth: 2.87" (73mm) ■ Lens: Clear Polycarbonate Model # Part # Description Approvals

9036110 9036115 9036120 9036125

01-0790361-10 01-0790361-15 01-0790361-20 01-0790361-25

LED Landing, 14 VDC with "U" bracket LED Taxi, Spreader optic, 14 VDC with "U" bracket LED Landing, 28 VDC with "U" bracket LED Taxi, Spreader optic, 28 VDC with "U" bracket

— — — —

MODEL 71141 SERIES LED LANDING LIGHT (INTERNAL MOUNT) PAR-36 STYLE 71141 series is a self-contained all LED landing light assembly. The design is intended to provide a solution to the needs for a taxi & landing light on a wide variety of aircraft. All current source and electronic circuitry is contained within the housing. Unit is available in several mounting configurations to retrofit existing typical PAR-36 lighting. Unit is designed to be mounted internally behind existing lens. Item ships with flying leads. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Power Consumption: 2.0 amps @ 14 VDC; 1.3 amps @ 28 VDC ■ Weight: 1.0 lbs. (454gm) ■ Exposed Diameter: 4.46" (113mm), Overall ■ Depth: 1.90" (48mm) ■

Lens: Clear Polycarbonate

Model #

Part #

Description

Approvals

7114112 7114122

01-0771141-12 01-0771141-22

LED landing/taxing light internal mount, 14 VDC LED landing/taxing light internal mount, 28 VDC

— —

EXTERIOR LIGHTING

MODEL 90361 SERIES LED LANDING LIGHT (EXTERNAL MOUNT) PAR-36 STYLE

MODEL 90352 SERIES LED LANDING LIGHT (EXTERNAL MOUNT) PAR-46 STYLE 90352 series is a self-contained all LED landing light assembly. The design is intended to provide a solution to the needs for a taxi & landing light on a wide variety of aircraft. All current source and electronic circuitry is contained within the housing. Unit is available in several mounting configurations to retrofit existing typical PAR-46 lighting. Unit is designed to be mounted "externally (in the airstream)". Special models available with MS power input connector vs. flying leads as standard option. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Power Consumption: 3 amps @ 28 VDC ■ Weight: 2.2 lbs. (998gm) ■

Exposed Diameter: 5.90" (150mm), Overall ■ Depth: 3.18" (81mm) ■ Lens: Clear Polycarbonate Model # Part # Description Approvals

9035200 9035220

01-0790352-00 01-0790352-20

LED landing/taxing light (natural finish) LED landing/taxing light (black finish)

— —

MODEL 90433 SERIES INTERIOR LED LANDING LIGHT 90433 series is a 6 inch round, internal (non-weatherized) LED illumination product. It is styled after a PAR-46 lamp & housing internal combination. 90433 cannot 'fit' in place of a 6 inch light bulb, technology considerations require a stand-alone approach requiring a degree of customization to the aircraft. Unit ships with 10" of 18ga flying leads. 28 VDC Only. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Current: 2.00 amps ■ Weight: 1.7 lbs. (771gm) ■ Lens: Clear Polycarbonate ■ Dimensions: 5.75" (146mm) Diameter, 1.11" (28mm) Outer Ring Depth, 2.61" (66mm) Overall Depth Model #

Part #

Description

Approvals

9043300

01-0790433-00

6 Inch LED landing light

MODEL 90465 SERIES, INTERIOR LED LANDING LIGHT 90465 series is a 6 inch round, internal (non-weatherized) LED illumination product. It is designed to fit where a Grimes B-5325A-4-24 housing (PAR-46 lamp) is being used. Modeled after the 90433 internal LED above, the 90465 has an integrated mounting bracket. 28 VDC Only. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Current: 3.0 amps ■ Weight: 1.8 lbs. (816gm) ■ Lens: Clear Polycarbonate ■ Dimensions: 5.75" (146mm) Diameter, 2.65" (67mm) Overall Depth Part #

Description

Approvals

9046500

01-0790465-00

LED landing light

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

®

Model #

31


EXTERIOR LIGHTING

MODEL 71156 SERIES FLASHER ASSEMBLY 71156 series is an electronic 'Pulse' light flasher for use with Whelen taxi & landing LED lightheads (catalog and custom versions). 71156 is being integrated into aircraft model upgrades and new type certified aircraft. Flasher operates four outputs steady-burn or will allow two outputs to be flashed or steady independent of the other. MS Connectors with aluminum housing. Tested in accordance with RTCA/DO-160 Environmental Tests. SPECIFICATIONS: ■ Power Consumption: 20A max (all outputs) @ 28 VDC ■ ■

Weight: 1.1lbs. (499gm) ■ Length: 5.0" (127mm) ■ Exposed Height: 1.8" (46mm) Width: 4.56" (116mm) ■ Flash Rate: 90 fpm (combined)

Model #

Part #

Description

Approvals

7115604

01-0771156-04

Flasher asssembly

MODEL 71375 SERIES LED FLASHER ASSSEMBLY 71375 is an electronic light flasher for use with Whelen LED Exterior Lighting products (catalog and custom versions). Flasher operates two outputs steady on or will flash outputs alternately. D389999 connectors pictured. Aluminum housing. Tested in accordance with RTCA/ DO-160 Environmental standards. SPECIFICATIONS: ■ Drawing Number: 71375 ■ Power Consumption: 5A max (all outputs) @ 28 VDC ■ Weight: 0.5lbs. (226.8gm) ■ Length: 4.5" (114mm) ■ Exposed Height: 1.56" (40mm) ■ Width: 3.5" (89mm) ■ Flash Rate: 90 fpm (combined) Model # Part # Description Approvals

7137500

01-0771375-00

LED Flasher Assembly

QUARTZ HALOGEN PAR LAMPS Whelen’s family of quartz halogen PAR lamps offer two distinct features over standard incandescent PAR lamps; sustained light intensity and 10 times the average life. Tests have shown 250 hours lab life versus 25 for standard off-the-shelf lamps. This dramatically reduces costs associated with replacement labor and parts. Where incandescent lamps decline in intensity (beam candlepower) over time due to filament deterioration, Whelen’s family of lamps maintain their rated intensity throughout their life providing a constant level of visibility. SPECIFICATIONS: Model #

Part #

Drawing # Voltage

Wattage Candela Style

Q5596 Q5587 Q4509 Q4591 Q4566 Q4559XX Q4681

34-0750692-00 34-0750707-00 34-0750748-00 34-0750767-00 34-0750810-00 34-0750820-00 34-0850839-00

50692 50707 50748 50767 50810 50820 50839

250 250 100 100 450 600 450

28 VDC 28 VDC 14 VDC 28 VDC 28 VDC 28 VDC 28 VDC

150,000 40,000 140,000 90,000 150,000 765,000 310,000

Approvals

Par-36 landing Par-36 taxi Par-36 landing Par-36 landing Par-46 landing Par-64 landing Par-46 landing

FAA/PMA FAA/PMA FAA/PMA FAA/PMA FAA/PMA FAA/PMA —

MODEL 90195 SERIES 90195 series are fixtures that can accommodate a standard PAR-36 lamp, available with or without a lamp. SPECIFICATIONS: ■ Drawing Number: 90195 ■ Depth: 3.03” (77mm) ■ Diameter: 4.88” (124mm) ■

Weight w/lamp: 1.0 lbs. (454gm) ■ Weight less lamp: 0.5 lbs. (227gm)

Model #

Part #

Description

Approvals

9019500 9019501 9019502 9019503 9019504

01-0790195-00 01-0790195-01 01-0790195-02 01-0790195-03 01-0790195-04

Housing only, less lamp With #4596 lamp With #Q5596 lamp With #4587 lamp With #Q5587 lamp

— — — — —

MODEL A715-1 SERIES A715-1 series are fixtures that can accommodate a standard PAR-36 lamp assembly, available with or without a lamp. Used on Beechcraft. SPECIFICATIONS: ■ Drawing Number: 70155 ■ Depth: 2.12” (54mm) ■ Diameter: 4.75” (121mm) ®

32

Weight w/lamp: 1.0 lbs. (454gm) ■ Weight less lamp: 0.4 lbs. (181gm)

Model #

Part #

Description

Approvals

A7151 7015502

01-0770155-00 01-0770155-02

Housing only, less lamp Housing with #Q5596 lamp

FAA/PMA —

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.


90095 series are fixtures that can accept a standard PAR-46 lamp, sold with/without a lamp. SPECIFICATIONS: ■ Drawing Number: 90095 ■

Depth: 2.9” (74mm) ■ Diameter: 6.0” (152mm) ■ Weight less lamp: 0.42 lbs. (191gm)

Model #

Part #

Description

Approvals

9009504 9009505 9009507

01-0790095-04 01-0790095-05 01-0790095-07

Right Side mounting w/4580 lamp Left Side mounting w/4580 lamp Housing only, less lamp

— — —

MODEL 70346 SERIES 70346 series recognition/landing light assembly which produces up to 80,000 beam candlepower using only a 35 watt lamp. Available with an optic spreader lens for taxiing, a clear lens for spot or without a lens for custom applications. SPECIFICATIONS: ■ Drawing Number: 70346 ■ Width: 4.25” (108mm) ■ Height: 3.0” (76mm) ■

Depth: 2.9” (74mm) ■ Weight without Lens: 0.16 lbs. (73gm) ■ Weight with Lens: 0.28 lbs. (127gm) ■ Power Consumption: 2.5 amps @ 14 VDC, 1.25 amps @ 28 VDC

Model #

Part #

Description

Approvals

7034600 7034601 7034602 7034603 7034604 7034605

01-0770346-00 01-0770346-01 01-0770346-02 01-0770346-03 01-0770346-04 01-0770346-05

No lens, 14 VDC No lens, 28 VDC Clear lens, 14 VDC Clear lens, 28 VDC Optic lens, 14 VDC Optic lens, 28 VDC

— FAA/PMA FAA/PMA — FAA/PMA —

MODEL 71125 SERIES LED RECOGNITION LIGHT 71125 series LED recognition light is designed to provide supplemental lighting for a wide variety of aircraft applications. Provides all of the advantages of LED's as a light source, no EMI/RFI, low current draw, low heat, long life. Perfect for vibration prone areas. Item ships with flying leads. Several different beam spreads available. Designed to replace the Whelen A775 series. Version with an integrated MS connector also available. Can be used in conjunction with 71115 Flasher control assembly. Contact your OEM for installation information.

EXTERIOR LIGHTING

MODEL 90095 SERIES

SPECIFICATIONS: ■ Drawing Number: 71125 ■ Power Consumption: 0.9 amps @ 14 Volts, 0.45 amps @ 28 Volts ■ Lens: Clear polycarbonate ■ LED Color: Aviation White ■ Weight: 0.3 lbs. (136gm) ■ OVERALL: Width: 3.25" (83mm), Depth: 1.25" (32mm), Height: 1.95" (50mm)

10 *10 *20 *30

*90

Model #

Part #

7112510 7112511 7112512 7112513 7112520 7112521 7112522 7112523

01-0771125-10 10 degree beam pattern, 14 VDC — 01-0771125-11 20 degree beam pattern, 14 VDC — 01-0771125-12 90 degree beam pattern, 14 VDC — 01-0771125-13 30 degree beam pattern, 14 VDC — 01-0771125-20 10 degree beam pattern, 28 VDC — 01-0771125-21 20 degree beam pattern, 28 VDC — 01-0771125-22 90 degree beam pattern, 28 VDC — 01-0771125-23 30 degree beam pattern, 28 VDC — Order RECLENS to obtain a kit of 20, 30 and 90 degree Lens Optic Inserts

Description

Approvals

MODEL 90485, INTERIOR LED ILLUMINATION TAXI/RECOGNITION LT. 90485 series is a split segment, horizontally mounted, LED recognition or taxi light assembly behind an aircraft outer lens. The two segments are independently controlled. LED Segments produce 10 and 30 degree optic spread. Assembly ships with 24 inch, 20 gauge leads (with abrasion protection) and terminates with two A444 style connectors. 28 VDC Only. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Current: 0.8 amps ■ Weight: 0.4 lbs. (181gm) ■ Lens: Clear Polycarbonate ■

Dimensions: 1.26" (32mm) Deep, 4.40 (112mm) Wide, 1.95" (50mm) Height

Model #

Part #

Description

Approvals

9048511

01-0790485-11

LED recognition/taxi light

MODEL 71246, INTERIOR LED ILLUMINATION, (See 71125 output & mount) 71246 series is an interior LED illumination product. It is designed as a stand alone or attached to other Whelen LED lighting, to provide landing / taxi recognition lighting behind an aircraft outer lens. Assembly ships with 10 inch, 18 ga. leads and terminates with an A444 style connector. There are choices of 10, 20 & 30 degree optic lighting spreads for these assemblies. 28 VDC Only. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Current: 0.5a ■ Weight: 0.3 lbs. (136gm) ■ Lens: Clear Polycarbonate Dimensions: 2.05" (52mm) Deep, 1.95 (50mm) Wide, 3.25" (83mm) Height Part #

Description

Approvals

01-0771246-11 01-0771246-33

LED T/R light, 10 degree LED T/R light, 30 degree

— —

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

®

Model # 7124611 7124633

33


EXTERIOR LIGHTING

MODEL 71259, INTERIOR LED ILLUMINATION LANDING / TAXI / RECOGNITION LIGHT (see also 71246) 71259 series is an interior LED illumination product. It is designed as a stand alone or attached to other Whelen LED lighting, to provide landing/taxi or recognition lighting behind an aircraft outer lens. Assembly ships with two sets of 10 inch, 18 ga. leads and terminates with A444 style connectors. There are choices of 10, 20 & 30 degree optic lighting spreads for these assemblies. 28 VDC Only. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Current: 1.25a ■ Weight: 0.65 lbs. (295gm) ■ Lens: Clear Polycarbonate ■

Dimensions: 2.05" (52mm) Deep, 3.90" (131mm) Wide, 3.25" (83mm) Height

Model #

Part #

Description

Approvals

7125900 7125901

01-0771259-00 01-0771259-01

LED landing/taxi light, 20 degee taxi LED landing/taxi light, 30 degee taxi

— —

MODEL 71245, INTERIOR LED ILLUMINATION LANDING / TAXI / RECOGNITION LIGHT 71245 is an interior LED illumination product that is designed provide landing/taxi or recognition lighting behind an aircraft outer lens. Assembly ships with 10 inch, 18 ga. leads and terminates with A444 style connector. There are choices of 10, 20 & 30 degree optic lighting spreads for these assemblies. 28 VDC Only. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Current: 1.5a ■ Weight: 0.7 lbs (316gm) ■ Lens: Clear Polycarbonate ■

Dimensions: 2.05" (52mm) Deep, 5.15" (131mm) Wide, 3.25" (83mm) Height

Model #

Part #

Description

Approvals

7124511

01-0771245-11

LED landing/taxi light, 10 degee

MODEL 71210 INTERIOR LED LANDING TAXI 71210 is designed to replace Model 90131. It utilizes a state-of-the-art LED technology and Whelen's ultra efficient TIR optic design. Light output 45% greater than the Quartz light it will replace and a fraction of the current. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Power Consumption: 1.5A (Landing), .5A (Taxi) @ 28 VDC ■ ■

Weight: 1.33 lbs. (603gm) ■ Length: 7.687" (195mm) ■ Height: 3.250" (83mm) Width: 3.6" (91mm) (on the long side)

Model #

Part #

Description

Approvals

7121000

01-0771210-00

Landing/taxi LED assembly

MODEL 71265, INTERIOR LED ILLUMINATION LANDING / TAXI / RECOGNITION LIGHT 71265 is an LED illumination product designed provide landing/taxi or recognition lighting behind an aircraft outer lens and with the attachment mounting points found in the A109 Sponson. Assembly is 20% brighter (effective Cd) and draws 60% less current than the system originally installed at the factory. Deck angle is not field adjustable. Assembly ships with two 10 inch, 18 ga. leads and terminates with A441 style connectors for direct aircraft replacement. There are choices of 10, 20 and 30 degree optic lighting spreads for these assemblies. 28 VDC Only. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Current: 1.8a ■ Weight: 1.43 lbs (649gm) ■ Lens: Clear Polycarbonate ■

Dimensions: 3.42" (87mm) Deep, 7.10" (180mm) Wide, 3.25" (83mm) Height, Mounting Bracket is 3.87" (98mm) Model #

Part #

Description

Approvals

7126511

01-0771265-11

LED landing/taxi light

®

MODEL 90406, INTERIOR LED ILLUMINATION LANDING / TAXI / RECOGNITION LIGHT 90406 is an LED illumination product designed to provide landing/taxi or recognition lighting behind an aircraft outer lens. Assembly ships with 24 inch, 20 gauge leads (with abrasion protection) and flying leads. There are choices of 10 and 30 degree optic lighting spreads for these assemblies (S76, Contact Sikorsky). 28 VDC Only. Contact your OEM for installation eligibility on your aircraft. SPECIFICATIONS: ■ Current: 2.1a ■ Weight: 1.11 lbs (503gm) ■ Lens: Clear Polycarbonate ■

34

Dimensions: 1.35" (34mm) Deep, 3.15" (80mm) Wide, 8.20" (208mm) Height

Model #

Part #

Description

Approvals

9040600

01-0290406-00

LED landing/recognition light

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.


A775 series recognition light assembly which produces up to 22,000 beam candlepower using only a 35 watt lamp. SPECIFICATIONS: ■ Drawing Number: 70110 ■ ■

Weight: 0.14 lbs. (64gm) ■ Width: 3.25” (83mm) ■ Height: 1.75” (44mm) Depth: 2.25” (57mm) ■ Power Consumption: 2.5 amps @ 14 VDC, 1.25 amps @ 28 VDC

Model #

Part #

Description

Approvals

7011001 7011002 A77514 A77528

01-0770110-01 01-0770110-02 01-0770110-04 01-0770110-05

Molex connector (Piper), 14 VDC Molex connector (Piper), 28 VDC 12” leads, 14 VDC 12” leads, 28 VDC

FAA/PMA FAA/PMA — —

MODEL A775-EXP SERIES A775-EXP series explosion proof version of the A775 recognition light assembly which produces up to 22,000 beam candlepower using only a 35 watt lamp. SPECIFICATIONS: ■ Drawing Number: 70111 ■ ■

Weight: 0.2 lbs. (91gm) ■ Width: 3.3” (84mm) ■ Height: 2.4” (61mm) ■ Depth: 2.4” (61mm) Power Consumption: 2.5 amps @ 14 VDC, 1.25 amps @ 28 VDC

Model #

Part #

Description

Approvals

A775EXP1 A775EXP2

01-0770111-00 01-0770111-01

12” leads, 14 VDC 12” leads, 28 VDC

— —

MODEL 71325 LED RECOGNITION LIGHT 71325 is an LED recognition / exterior illumination product. It is an updated version of Model 71092 recognition light (2008 Catalog). Model 71325 exceeds light output of 71092 three fold. Unit ships with 7 inch wires into A447 style pin connector. Optimized for 28VDC, will

EXTERIOR LIGHTING

MODEL A775 SERIES

operate from 14-28VDC SPECIFICATIONS: ■ Current: 0.25a ■ Weight: 0.17 lbs ■ Lens: Clear Polycarbonate

Dimensions: 2.56" (65mm) Wide, 1.38" (35mm) Deep, 1.45" (37mm) Center to Center Mounting Holes (Height)

Model #

Part #

Description

Approvals

7132500

01-0271325-00

LED recognition light

MODEL 71186 LED ILLUMINATION / DOWNWASH / RECOGNITION 71186 is a compact illumination solution that can be utilized in many lighting upgrade situations (See also 71325). 71186 ships with 6" flying leads. Optimized for 28VDC, will oper-

ate from 14-28VDC. SPECIFICATIONS: ■ Current: 0.25a ■ Weight: 0.2 lbs. (91gm) ■ Lens: Clear Polycarbonate ■ Dimensions: 1.95" (50mm) Inner Diameter, 2.15" (55mm) Outside Face, 1.0" (25mm) Overall Depth

Model #

Part #

Description

Approvals

711860101

01-0771186-01

LED downwash light

MODEL 7111500 LED RECOGNITION LIGHT FLASHER CONTROL 7111500 is designed to flash LED recognition lights. There are 3 switching input modes to control illumination options, Steady On, Alternating Flash, & Synchronized Flash. This unit can control two LED recognition lights, and can operate from 14 to 28 VDC without conversion. Can be used to flash model 71325 or 71125 LED Assembly. SPECIFICATIONS: ■ Flashrate: 45 Flashes Per Minute ■ On Time: 350 ms ■

Length: 4.5" (114mm) ■ Width: 1.9" (48mm) ■ Height: 1.0" (25mm) ■ Weight: 0.3 lbs. (204gm)

Model#

Part #

Description

Approvals

7111500

01-0771115-00

LED recognition light flasher control

MODEL 71280 LED WING INSPECTION LIGHT 71280 utilizes Model 71325 hidden inside the optic housing. Optic lens is intended to be flush mounted to skin of aircraft (white portion of assembly remaining inside aircraft). Assembly deflects light in one direction (off-angle illumination), creating the 'hot' spot 20 degrees behind center viewing. Housing constructed from polycarbonate with an aluminum back plate (see 71325). Optimized for 28VDC, will operate from 14-28VDC. SPECIFICATIONS: ■ Current: 0.25 amps ■ Weight: 0.3 lbs (136gm) ■ Lens: Polycarbonate ■ Dimensions: 4.28" (109mm) Long, 2.7" (69mm) Deep, 2.01" (51mm) Height Model #

Part #

Description

Approvals

7128010 7128020

01-0771280-10 01-0771280-20

LED ice detection (LH) LED ice detection (RH)

— — ®

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

35


EXTERIOR LIGHTING

MODEL 70303 SERIES 70303 series wing tip recognition light assembly using a 25 watt halogen lamp. Used on Mooney Aircraft. SPECIFICATIONS: ■ Drawing Number: 70303 ■ ■

Weight: 0.1 lbs. (45gm) ■ Width: 2.1” (53mm) ■ Height: 1.25” (32mm) ■ Depth: 1.8” (46mm) Power Consumption: 2 amps @ 14 VDC, 1 amp @ 28 VDC

Model #

Part #

Description

Approvals

7030300 7030301

01-0770303-00 01-0770303-01

14 VDC 28 VDC

FAA/PMA —

WHELEN MODEL 71230 ADJUSTABLE TIR LED/LOGO LIGHT 71230 is an LED replacement for Luminator 5200 Series De-Ice Inspection Light. External dimensions are 3.2inch square. Internal LED Assembly can rotate (10 degrees) to illuminate required surface. Item ships with 15" (20ga) flying leads. Optimized for 28VDC, will oper-

ate from 14-28VDC SPECIFICATIONS: ■ Current: 0.25a ■ Weight: 0.55 lbs. (239gm) ■ Lens: Polycarbonate,

Aluminum housing ■ Dimensions: 2.25" (57mm) Long (Housing), 3.20" (81mm) Outside width, Overall Height, 4.00" (102mm) Model #

Part #

Description

Approvals

7123000

01-0771230-00

LED adjustable TIR light

MODEL 90093 SERIES 90093 series ice detection light assembly which uses a 25 watt lamp and is sealed for a pressure differential of 10 psi. SPECIFICATIONS: ■ Drawing Number: 90093 ■ ■

Weight: 0.2 lbs. (91gm) ■ Width: 2.0” (51mm) ■ Height: 2.0” (51mm) ■ Depth: 1.87” (48mm) Power Consumption: 1.8 amps @14 VDC, 0.9 amps @28 VDC

Model #

Part #

Description

Approvals

9009300 9009303

01-0790093-00 01-0790093-03

28 VDC 14 VDC

FAA/PMA —

MODEL 90029 SERIES 90029 series all-inclusive anti-collision/position/recognition light assembly. Used on Beech Barons, King Airs and Super King Airs. Replaces 30-1329-( ) series. SPECIFICATIONS: ■ Drawing Number: 90029 ■ Weight: 2.5 lbs. (113gm) ■ ■

Height: 6.4” (163mm) ■ Length: 10.2” (259mm) ■ Width: 3.1” (79mm) Power Consumption: Position light - 1.0 amps @ 28 VDC Recognition light - 1.25 amps @ 28 VDC Power supply - 1.5 amps @ 28 VDC

Model #

Part #

Description

Approvals

900291 900292 900293 900294

01-0790029-01 01-0790029-02 01-0790029-03 01-0790029-04

Position red Position green Position red, with recognition light Position green, with recognition light

FAA/PMA FAA/PMA FAA/PMA FAA/PMA

MODEL 71100 SERIES LED COLORED IDENTIFICATION LIGHT 71100 series are versions of our 71011 LED taillight. Developed for applications requiring aircraft ground visibility, low light, at oblique angles for ground personnel. Item utilized white LEDs filtered with blue, green, red or amber colored outer lens. SPECIFICATIONS: ■ Power Consumption: 0.3A @ 28 V

®

■ ■

36

Weight: 0.2lbs (91gm) ■ Exposed Height: 1.36" (35mm) ■ Mounting Hole Pattern: 1.75" (44mm) LED Color: White ■ Lens: Blue, Red, Green or Amber polycarbonate

Model #

Part #

Description

Approvals

7110001 7110002 7110004 7110005 7110011 7110012 7110014 7110015

01-0771100-01 01-0771100-02 01-0771100-04 01-0771100-05 01-0771100-11 01-0771100-12 01-0771100-14 01-0771100-15

Vertical mount amber Vertical mount blue Vertical mount green Vertical mount red Horizontal mount amber Horizontal mount blue Horizontal mount green Horizontal mount red

— — — — — — — —

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.


90540 is an infra-red illumination product that an produces a 24 degree beam. Model 90540 has demonstrated effectiveness for helicopters and reciprocating engine airplanes during takeoff, landing and off-airport locations. Enhances the effectiveness of NVG goggles by producing IR Illumination at 875nm nominal. SPECIFICATIONS: ■ On Request

MODEL 7054400 Ground crew call warning horn designed for Boeing. It produces 108db (+10db, -3db) at a frequency of 25-20,000 Hz. SPECIFICATIONS: ■ Drawing Number: 70544 ■ ■

Weight: 0.65 lbs. (295gm) ■ Horn Diameter: 3.56” (90mm) ■ Height: 2.28” (58mm) Power Consumption: 55ma @ 28 VDC (typical) Model # Part # Drawing # Boeing # Approvals 7054400

01-0770544-00

70544

10-62239-1

FAA/PMA

MODEL 7066600 Auxiliary power unit, fire warning horn designed for Boeing. It produces 108db (+10db, -3db) at a frequency of 25-20,000 Hz. SPECIFICATIONS: ■ Drawing Number: 70666 ■ ■

Weight: 1.25 lbs. (567gm) ■ Horn Diameter: 5.12” (130mm) ■ Overall Height: 2.28” (58mm) Mounting Depth: 1.71” (43mm) ■ Power Consumption: 55ma @ 28 VDC (typical) Model # Part # Drawing # Boeing # Approvals 7066600

01-0770666-00

70666

10-62239-2

MISCELLANEOUS

MODEL 90540 (Call Factory)

FAA/PMA

INSTALLATION CABLE KITS (NSN 6080-14330778) Cable kits include all required connectors for hooking up the strobe light to the power supply only. Warning placards and the Installation Service manual is included also. All cable is 16 gauge 3/C shielded. The cable diameter is .275” (7mm). Weight is .050 lbs. per linear foot. (Kits do not include switches or breakers) Model #

Part #

Description

Approvals

HS5 HT10 HS30 HD60 HDT390 HT

01-0750215-00 01-0750218-00 01-0750214-00 01-0750206-00 01-0750205-00 01-0750216-00

5’ Cable kit 10’ Cable kit 30’ Cable kit 60’ Cable kit NSN 90’ Cable kit Install kit only, no cable or connectors

— — — — — —

REPLACEMENT CONNECTORS A441

Replacement connector kits and assemblies for cables.

A444

A442

A446

Model #

Part #

Description

Approvals

A441 A442 A444 A446 A447 A448

01-0430011-00 01-0410823-00 02-0230007-00 02-0230085-00 01-0417808-00 01-0417808-01

3 Position male connector with pins kit 3 Position female connector with sockets kit 2 Position male connector with pins ass’y 2 Position female connector with sockets ass’y 4 Position male connector with pins 4 Position female connector with sockets

— — — — — —

CRIMP TOOL A447

Pin and socket crimping tool. Model #

Part #

Description

Approvals

CRIMPAV

01-0515361-00

Pin/socket crimping tool, MILBAR #25E

A448

®

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

37


HELICOPTER SIRENS & SPEAKER ®

38

MODELS 295SLSA1, 14 VDC AND 295SLSE1, 28 VDC PUBLIC ADDRESS WITH SIREN TONES (NSN 6350-13195597) 295SLSA1 and 295SLSE1 are a 8 function 100/200 watt siren amplifier featuring public address, Hi/Low, yelp and wail siren tones with manual override. Input, output and over-voltage protection. Complete with wired-in noise cancelling microphone, mic clips, and cables. Please specify 14 or 28 VDC when ordering. SPECIFICATIONS: ■ Drawing Number: 82235 ■ Weight: 3.0 lbs. (1361gm) ■

Height: 2.50” (64mm) ■ Width: 6.0” (152mm) ■ Depth: 7.0” (179mm)

Model #

Description

Approvals

295SLSA1 295SLSE1

100/200 watt siren amplifier, 14 VDC 100/200 watt siren amplifier, 28 VDC NSN

— —

MODEL SA-340-STS (NSN 5965-13734715) SA-340-STS is a 100 watt RMS siren amplifier. SPECIFICATIONS: ■ Drawing Number: 61413 ■ Weight: 8 lbs. (3629gm) ■

Height: 5.62” (143mm) ■ Width: 5.62” (143mm) ■ Depth: 6.8” (173mm)

Model #

Description

Approvals

SA340STS

100 watt RMS siren amplifier

MODEL SA-340-TS (NSN 5965-15150589) SA-340-TS is a 100 watt RMS siren amplifier. SPECIFICATIONS: ■ Drawing Number: 81013 ■ Weight: 9 lbs. 3 oz. (4218gm) ■

Height: 7” (179mm) ■ Width: 5.25” (133mm) ■ Depth: 8” (203mm)

Model #

Description

Approvals

SA340TS

100 watt RMS siren amplifier

NOTE: All non-FAA approved parts in this catalog are signified by a (—) in the approval column. Parts without FAA approval may still be purchased, however, installation of these parts on U. S. Type Certificated products will require additional FAA approvals.

Arlington SO, Ried Kasprowicz Juneau, Alaska, Ried Kasprowicz


Landing / Taxi / Recognition Like all the Whelen designed LED products, LED Illumination packages are designed for maximum rugged operation in the most severe environmental conditions. Customers needing packages with identified operational parameters using decreased geometry not shown here, should contact the factory for more information.

INTERIOR LED ASSEMBLIES NON-WEATHERIZED HOUSINGS

71125 Series

71210 Series

EXTERIOR LED ASSEMBLIES WEATHERIZED HOUSINGS 90352 Series 90

90485 Series

90361 Series Landing

90406 Series

71246 Series

WHELEN LED ILLUMINATION

LED ILLUMINATION

90361 Series Taxi

90433 Series

71259 Series

PARMETHEUS

71245 Series 速

71141 Series

39


APPLICATION PHOTOS

90433, 71141 -HBC

90406, 71125 - LED Landing System

71125 - G-IIB

71265, 71080, 71110, A109

71105 - Learjet

71141, 71110 - RMD Wing tip

71170 - Diamond

71011, B206

90352 - S76D

71141, 90349 - Evektor

71110, 71080, B206

LED “Specialized Landing/Taxi”

71125 Fight Design

LED “Wing Leading Edge Landing/Taxi”

90400 - Cessna 162

90358 - Cirrus

70513, 70875, Firescout

®

90361 Series - Call Factory

40


Old Part Number

Old Model Number

Description

A413,HS-41-14

HS,41

Single strobe unit, SingleFlash, 14 VDC, 33 joule

A413,HS-41-28

HS,41

Single strobe unit, SingleFlash, 28 VDC, 33 joule

HD

Dual strobe unit, SingleFlash, 14 VDC, alternating

HD

Dual strobe unit, SingleFlash, 28 VDC, alternating

A413,HD-14 A413,HD-28 A413,HD-42-14

HD,42

Dual strobe unit, SingleFlash, 14 VDC, alternating, 33 joule

A413,HD-42-28

HD,42

Dual strobe unit, SingleFlash, 28 VDC, alternating, 33 joule

A413,T2-14

HD,T2

Dual strobe unit, SingleFlash, 14 VDC, simultaneous, 16 joule

A413,T2-28

HD,T2

Dual strobe unit, SingleFlash, 28 VDC, simultaneous, 16 joule

A413,T2-DF-14

HD,T2,DF

Dual strobe unit, DoubleFlash, 14 VDC, simultaneous, 16 joule

A413,T2-DF-28

HD,T2,DF

Dual strobe unit, DoubleFlash, 28 VDC, simultaneous, 16 joule

A413,T3-14

HD,T3

3 strobe unit, SingleFlash, 14 VDC, w/trigger function

A413,T3-28

HD,T3

3 strobe unit, SingleFlash, 28 VDC, w/trigger function

A413,HD,DF-14

HD,DF

3 strobe unit, DoubleFlash, 14 VDC

A413,HD,DF-28

HD,DF

3 strobe unit, DoubleFlash, 28 VDC

A413,T3-DF-14

HD,T3,DF

3 strobe unit, DoubleFlash, 14 VDC, w/trigger function

A413,T3-DF-28

HD,T3,DF

3 strobe unit, DoubleFlash, 28 VDC, w/trigger function

A413A,HDA-DF-14 A413A,HDA-DF-28

HDA,DF-14 HDA,DF-28

4 strobe unit, DoubleFlash, 28 VDC

HDA,DF-14/28

4 strobe unit, DoubleFlash, 14 or 28 VDC

A413A,HDA-CF-14/28

HDA,CF-14/28

4 strobe unit, CometFlash速, 14 or 28 VDC

A412A,HS-14

HS,14

Single strobe unit, SingleFlash, 14 VDC

A412A,HS-28

HS,28

Single strobe unit, SingleFlash, 28 VDC

A412A,HS,DF-14

HS,DF-14

Single strobe unit, DoubleFlash, 14 VDC

A412A,HS,DF-28

HS,DF-28

Single strobe unit, DoubleFlash, 28 VDC

A490,TS-14

HTS

Single strobe unit, SingleFlash, 14 VDC

A490,TS-28

HTS

Single strobe unit, SingleFlash, 28 VDC

A490A,TS,DF

HTS-DF

Single strobe unit, DoubleFlash, 14 or 28 VDC

A490A,TS,CF-14/28

HTS-CF

Single strobe unit, CometFlash, 14 or 28 VDC

A490,T-28

HT HT

Single strobe unit, SingleFlash, 28 VDC

HT,DF

Single strobe unit, DoubleFlash, 14 VDC

A490,T,DF-28

HT,DF

Single strobe unit, DoubleFlash, 28 VDC

A490,T,DF-14/28

HT,DF

Single strobe unit, DoubleFlash, 14 or 28 VDC

A490,T,CF-14/28

HT,CF

Single strobe unit, CometFlash, 14 or 28 VDC

A490,TC,DF-14

HTC,DF

Single strobe unit, DoubleFlash, 14 VDC with mounting plate

A490,TC,DF-28

HTC,DF

Single strobe unit, DoubleFlash, 28 VDC with mounting plate

A490,TC,DF-14/28

HTC,DF

Single strobe unit, DoubleFlash, 14 or 28 VDC w/mounting plate

A490,TC,CF-14/28

HTC,CF

Single strobe unit, CometFlash, 14 or 28 VDC w/mtg. plate

HR,14

Self-Contained strobe, 14 VDC

HR,28

Self-Contained strobe, 28 VDC

HR,DF,28 HR,DF,14/28 HR,DFA,14/28

Model A490ATSC P/N 01-0770062-03

Single strobe unit, SingleFlash, 14 VDC

A490,T,DF-14

HR,DF,14

Model HDACF P/N 01-0770028-05

4 strobe unit, DoubleFlash, 14 VDC

A413A,HDA-DF-14/28

A490,T-14

Current Replacement

Self-Contained strobe, DoubleFlash 14 VDC Self-Contained strobe, DoubleFlash 28 VDC Self-Contained strobe, DoubleFlash 14 or 28 VDC

Model A490TCF P/N 01-0770006-08

Model A490TCCF P/N 01-0770006-09

Model HRCFA P/N 01-0770029-( ) Specify lens color R=Red, W=White S=Split Red/White

STROBE POWER SUPPLY REPLACEMENT LISTING

STROBE POWER SUPPLY REPLACEMENT LISTING

Self-Contained strobe, DoubleFlash 14 or 28 VDC (A402A lens)

41


STROBE SYSTEM RECOMMENDATIONS

Strobe System Recommendations Whelen does not have specific kits set up (Contact Authorized Whelen Distributor). The following are strobe system recommendations. The basic model/part numbers are given. In some cases the aircraft voltage and mounting location of the light are needed to specify the exact model/part number.

Raytheon/Beech Aircraft Early Model Twin Engine through 1969 – The slanted wing tip requires custom fabricated brackets for mounting the strobe lights. The following is recommended: Quantity 1 each 2 each 1 each

Model HDACF A625 HD60

Part # 01-0770028-05 01-0770058-03 01-0750206-00

Description Power supply Wing tip strobe light assembly Installation package

REF: All Barons (95-55, A55, B55, C55, D55) & All Travel Airs 1957 thru 1969

Early Model Single Engine through 1966 – Excluding any modified wing tip, use position lights at the wing tip extremity. To convert to Whelen strobes, the following is recommended: Quantity 1 each 1 each 1 each 1 each

Model HDACF A650PG14 A650PR14 HD60

Part # Description 01-0770028-05 Power supply 01-0770054-00 Wing tip light 01-0770054-02 Wing tip light 01-0750206-00 Installation package OR Note: Model 7111001 and 7111002 can replace Model A650 for a LED solution

Single Engine 1967 through 1973 – Use position lights installed under clear fairings at the wing tips most forward position. Specify 14 or 28 VDC. To convert to Whelen strobes the following is recommended: Quantity 1 each 2 each 1 each as req. 1 each

Model HDACF A625 A500AV14 or A500AV28 HDT390

Part # 01-0770028-05 01-0770058-03 01-0770024-00 01-0770024-01 01-0750205-00

Description Power supply Wing tip strobe light Tail strobe/position light (lens may be removed to reduce heat build-up) Installation package

Single Engine 1974 and Later – Use a commonality wing tip, that

®

enlarged the clear fairing by approximately six inches. Specify 14 or 28 VDC. To convert to Whelen strobes, the following is recommended:

42

Quantity 1 each 2 each 1 each as req. 1 each

Model HDACF D900283 A500AV14 or A500AV28 HDT390

Part # 01-0770028-05 01-0790028-03 01-0770024-00 01-0770024-01 01-0750205-00

Description Power supply Wing tip strobe light Tail strobe/position light Installation package


(Cont'd)

Baron Rudder Mount Oscillation Beacon Replacement - The mechanical oscillating beacon first appeared in 1970 on the then new E55, until 1982. All model 58's used it from 1970 thru 2000. To convert the existing beacon to an LED flashing beacon: Quantity 1 as req.

Model 9008814

Part # 01-0790088-14

Description Upper mount, 5 hole, 2.25 lbs.

To convert the existing beacon to a Quartz Halogen flashing beacon: Quantity 1 as req.

Model 9004457

Part # 01-0790044-57

Description Upper mount, 5 hole, 2.25 lbs. (red)

.

Duke Oscillation Beacon Replacement - To convert the existing beacon to an LED flashing beacon: Quantity Model 1 as req.* 9008812 1 as req.* 9008818

Part # 01-0790088-12 01-0790088-18

Description Upper mount, 5 hole Upper mount, 8 hole

To convert the existing beacon to a Quartz Halogen flashing beacon: Quantity Model 1 as req.* 9004401 1 as req.* 9004417

Part # 01-0790044-01 01-0790044-17

Description Upper mount, 5 hole Upper mount, 8 hole

*Note - Check existing mounting hole pattern before ordering (5 or 8 hole)

Rotating Beacon Replacement - The round mechanical rotating beacon was used on the vertical fin of all Barons from 1961 thru 1969. Models using this light are 95-55 (1961), A55 (1962-63), B55 (1964-82), C55 (1966-1967), D55 (1968-1969). Note: the B55 Baron continued to use this beacon until production stopped in 1982.

To convert the existing beacon to a self-contained LED flashing beacon: Quantity 1 as req. 1 as req. 1 as req.

Model 7090004 7090005 A440

Part # 01-0770900-04 01-0770900-05 19-130074-009

Description 14 VDC, red 28 VDC, red Mounting adapter (required for fuselage mounting)

STROBE SYSTEM RECOMMENDATIONS

Raytheon/Beech Aircraft

To convert the existing beacon to a self-contained strobe beacon: Quantity 1 as req. 1 as req. 1 as req. 1 as req.

Model HRCFAR HRCFAW HRCFAS A440

Part # 01-0770029-29 01-0770029-30 01-0770029-31 19-130074-009

Description Standard assembly, red lens Standard assembly, clear lens Standard assembly, split red/clear lens Mounting adapter (required for fuselage mounting)

43


STROBE SYSTEM RECOMMENDATIONS

Cessna Aircraft Wing Tip Strobes for Early Model Single Engine through 1961 – Excluding any modified wing tip, use position lights at the wing tip extremity. To convert to Whelen strobes, the following is recommended: Quantity 1 each 1 each 1 each 1 each

Model HDACF A650PG14 A650PR14 HD60

Part # 01-0770028-05 01-0770054-00 01-0770054-02 01-0750206-00

Description Power supply Wing tip light Wing tip light Installation package

Wing Tip Strobes for Single Engine 1962 through 1969 – Requires modification to the factory wing tip to accommodate the light assemblies. To convert to Whelen strobes, the following is recommended: Quantity Model Part # Description 1 each HDACF 01-0770028-05 Power supply 1 each A650PG14 01-0770054-00 Wing tip light 1 each A650PR14 01-0770054-02 Wing tip light 1 each HD60 01-0750206-00 Installation package Note: Model 7111001 and 7111002 can replace Model A650 for a LED solution

Wing Tip Strobes for Single Engine 1970 and 1971 – Excluding any modified wing tip, also use position lights at the wing tip extremity, however, the retainers are too short to accommodate a custom installation. The Model A625 strobe lights are mounted aft of the position light lens retainers. To convert to Whelen strobes, the following is recommended: Quantity 1 each 2 each 1 each

Model HDACF A625 HD60

Part # 01-0770028-05 01-0770058-03 01-0750206-00

Description Power supply Wing tip strobe light assembly Installation package

Wing Tip Strobes for Single Engine 1972 and Later – Excluding any modified wing tip, spare wires were installed at the factory from a switch position on the instrument panel to the farthest rib in each wing tip. This allows mounting of the power supplies adjacent to the strobe light, which reduces installation time significantly. Wing tip strobes were also an option in the early 70’s. We estimate that 40-50% had factory installed systems.

Replacement Parts for Aircraft with Factory Installed Systems: Quantity 2 each 2 each 2 each

Model A490TCCF A427 A428

Part # 01-0770006-09 02-0250274-00 68-4290001-30

Description Wing tip strobe power supply Wing tip strobe tube Wing tip strobe lens

Recommended Parts for Aircraft without Factory Installed Systems: Quantity 2 each 2 each 2 each 1 each

Model A490TCCF A610 A612 HT

Part # 01-0770006-09 02-0250276-00 68-2290005-30 01-0750216-00

Description Wing tip strobe power supply Wing tip strobe tube assembly Wing tip strobe lens Installation package

Note: A small percentage of 1972 and later aircraft used the 1962-1969 wing tip.

®

Rotating Beacon Replacement - The round mechanical rotating beacon was used on early model single engine Cessna's from the late 50's through 1966. Twin Engine Cessna's started using the round mechanical rotating beacon in the 50's. Later model 400 Series used a teardrop beacon. Check existing beacon configuration before ordering. To convert the existing beacon to a self-contained LED flashing beacon: Quantity 1 as req. 1 as req. 1 as req.

44

Model 7090004 7090005 A440

Part # 01-0770900-04 01-0770900-05 19-130074-009

Description 14 VDC, red 28 VDC, red Mounting adapter (required for fuselage mounting)


(Cont'd)

Rotating Beacon Replacement - The round mechanical rotating beacon was used on early model single engine Cessna's from the late 50's through 1966. Twin Engine Cessna's started using the round mechanical rotating beacon in the 50's. Later model 400 Series used a teardrop beacon. Check existing beacon configuration before ordering. To convert the existing beacon to a self-contained strobe beacon: Quantity 1 as req. 1 as req. 1 as req. 1 as req.

Model HRCFAR HRCFAW HRCFAS A440

Part # 01-0770029-29 01-0770029-30 01-0770029-31 19-130074-009

Description Standard assembly, red lens Standard assembly, clear lens Standard assembly, split red/clear lens Mounting adapter (req. for fuselage mount)

Quartz Halogen Flasher Replacement for Single Engine Vertical Fin, 1967

& later – In 1967, Cessna changed from a rotating beacon to a quartz halogen flasher beacon. This has a 150 watt, 28 VDC quartz halogen lamp, or a 125 watt, 14 VDC quartz halogen lamp, operated from a solid-state electronic module. To convert to a Whelen strobe, the following is recommended: Quantity Model Part # Description 1 as req. A470AR 01-0770019-18 Strobe light assembly, red 1 as req. A470AW 01-0770019-19 Strobe light assembly, white 1 as req. A470AS 01-0770019-20 Strobe light assembly, split red/white 1 each A490ATSC 01-0770062-03 Power supply assembly 1 each H102 01-0730068-00 Mounting adapter 1 each HT10 01-0750218-00 Installation package Note: Model 71055 Self Contained LED Beacon can replace Model A470AR for a LED solution

Cessna 300A, B, C & D Twin Engines – The system for these airplanes requires fabricated brackets for affixing the power supplies and for attaching the strobe to a new position light bracket. To convert to Whelen strobes, the following is recommended: Quantity 3 each 2 each 1 each 1 each

Model A490TCF A625 A500AV HT

Part # 01-0770006-08 01-0770058-03 01-0770024-01 01-0750216-00

Description Power supply Wing tip strobe light Tail strobe/position light Installation package

The Remaining Cessna 300-400 Series Twin Engines – The system for these airplanes requires the same hardware as above, however, some had factory installed Grimes assemblies from approximately 1969 and later. To replace the existing system, all parts must be replaced and wiring must be changed. New fabricated brackets are required.

STROBE SYSTEM RECOMMENDATIONS

Cessna Aircraft

Cessna Citation Series – Whelen has an STC compliant system to convert factory installed Grimes wing tip strobes. The initial STC #ST22BO was for Citation 550, S550 & 560, Serial #128 thru 256. The following is recommended. System P/N – 01-0716164-03, (STC #ST22BO) includes: Quantity 2 each 1 each 1 each

Model 9010104 9015905 9015906

Part # 01-0790101-04 01-0790159-05 01-0790159-06

Description Power supply Strobe light assembly Strobe light assembly

Brackets & hardware for Installation The second system, STC #ST0010BO, covers Serial #257 & later, and any aircraft that installed Cessna Service Bulletin #SB560-33-08 from Serial #0001 thru #0256. System P/N – 01-0716164-05, (STC #ST0010BO) includes: Model 9010104 9020603 9020604

Part # 01-0790101-04 01-0790206-03 01-0790206-04

Description Power supply Strobe light assembly Strobe light assembly

®

Quantity 2 each 1 each 1 each

Brackets & hardware for Installation

45


STROBE SYSTEM RECOMMENDATIONS

Cessna Aircraft

(Cont'd)

Cessna Citation Series – Whelen has an STC compliant system to convert factory installed Grimes wing tip strobes. The initial STC #ST22BO was for Citation 550, S550 & 560, Serial #128 thru 256. The following is recommended: Oscillating Beacon Replacement - To convert from the existing mechanical oscillating beacon used on some 400 series as well as the entire family of Citation's (excluding CJ's). *Note: check existing mounting configuration before ordering.

To convert the existing beacon to an LED flashing beacon: Quantity 1 as req.* 1 as req.* 1 as req.*

Model 9008811 9008812 9008813

Part # 01-0790088-11 01-0790088-12 01-0790088-13

Description Lower mount, 5 hole Upper mount, 5 hole Upper mount, 5 hole, 2.25lbs. (rudder mount)

To convert the existing beacon to a Quartz Halogen flashing beacon: Quantity Model 1 as req.* 9004401 1 as req.* 9004433

Part # 01-0790044-01 01-0790044-33

1 as req.* 9004437

01-0790044-37

Description Upper mount, 5 hole (red) Upper mount, Red, 5 hole, 2.25lbs. (rudder mount) Upper mount, red, 5 hole, (Citation X)

Mooney Aircraft Early Model Flat Wing with Exterior Position Light Mounting – To convert to Whelen strobes, the following is recommended: Quantity Model Part # Description 1 each HDACF 01-0770028-05 Power supply 1 each A650PG14 01-0770054-00 Wing tip strobe/position light 1 each A650PR14 01-0770054-02 Wing tip strobe/position light Note: Model 7111001 and 7111002 can replace Model A650 for a LED solution 1 each HD60 01-0750206-00 Installation Package

Enclosed Wing Tip (New Installation) – To convert to Whelen strobes, the following is recommended: Quantity Model Part # Description 1 each HDACF 01-0770028-05 Power supply 1 each A650PG14 01-0770054-00 Wing tip strobe/position light 1 each A650PR14 01-0770054-02 Wing tip strobe/position light Note: Model 7111001 and 7111002 can replace Model A650 for a LED solution 1 each A500AV14 or 01-0770024-00 Tail strobe/position light assembly, 14 VDC as req. A500AV28 01-0770024-01 Tail strobe/position light assembly, 28 VDC 1 each HDT390 01-0750205-00 Installation package

Enclosed Wing Tip (Hoskins/SDI Replacement) – Slight modification required to convert to Whelen strobes, the following is recommended:

®

Quantity 3 each 2 each 1 1 each as req.

Model A490TCF A625 HT A500AV14 or A500AV28

Part # 01-0770006-08 01-0770058-03 01-0750216-00 01-0770024-00 01-0770024-01

Description Power supply Wing tip strobe light assembly Installation package Tail strobe/position light assembly, 14 VDC Tail strobe/position light assembly, 28 VDC

Rotating Beacon Replacement – To convert the existing rotating beacon to a Whelen strobe, the following is recommended: Quantity 1 as req. 1 as req. 1 as req. 1 as req.

46

Model HRCFAR HRCFAW HRCFAS A440

Part # 01-0770029-29 01-0770029-30 01-0770029-31 19-130074-009

Description Standard assembly, red Lens Standard assembly, white Lens Standard assembly, split red/white lens Mounting adapter (required for new fuselage mounting).


Single Engines & Piper Aztec – The same wing tip strobe system can be used on most Piper aircraft models. To convert to strobes, the recommendation is: Quantity Model # Part # Description 1 each HDACF 01-0770028-05 Power supply 1 each A650PG14 01-0770054-00 Wing tip strobe/position light, 14 VDC 1 each A650PR14 01-0770054-02 Wing tip strobe/position light, 14 VDC Note: Model 7111001 and 7111002 can replace Model A650 for a LED solution 1 each HD60 01-0750206-00 Installation package

Piper Navajo – System is as follows: Quantity Model # Part # Description 1 each HDACF 01-0770028-05 Power supply 1 each A650PG28 01-0770054-01 Wing tip strobe/position light, 28 VDC 1 each A650PR28 01-0770054-03 Wing tip strobe/position light, 28 VDC Note: Model 7111003 and 7111004 can replace Model A650 for a LED solution 1 each A500AH28 01-0770024-03 Tail position/strobe light assembly, 28 VDC 1 each HDT390 01-0750205-00 Installation package

Piper Cheyenne I, II, & IIXL – Factory equipped with Whelen strobes. Rotating Beacon Replacement - To convert the existing beacon to a self-contained LED flashing beacon: Quantity 1 as req. 1 as req. 1 as req.

Model # 7090004 7090005 A440

Part # 01-0770900-04 01-0770900-05 19-130074-009

Description 14 VDC, red 28 VDC, red Mounting adapter (req. fuselage mount)

To convert the existing beacon to a self-contained strobe beacon: Quantity 1 as req. 1 as req. 1 as req. 1 as req.

Model # HRCFAR HRCFAW HRCFAS A440

Part # 01-0770029-29 01-0770029-30 01-0770029-31 19-130074-009

Description Standard assembly, red Lens Standard assembly, clear Lens Standard assembly, split red/clear lens Mounting adapter (req. fuselage mount)

Home built & Kit Aircraft For Aircraft with Standard Wing Tips – The most widely used system on the market, this provides all of the components for anti-collision and position lights without the need for a taillight. The power supply is mounted in the fuselage and shielded cable is run to the strobe lights. The following is recommended: Quantity Model # Part # Description 1 each HDACF 01-0770028-05 Power supply 1 each A600PG14 01-0790006-00 Wing tip strobe/position/taillight, 14 VDC 1 each A600PR14 01-0790006-02 Wing tip strobe/position/taillight, 14 VDC Note: Model 9034001 and 9034002 can replace Model A600 for a LED solution 1 each HD60 01-0750206-00 Installation package

For Aircraft with Enclosed Wing Tip Fairings – If the position and strobe lights are mounted under a clear fairing, a third tail strobe is required. The following is recommended:

STROBE SYSTEM RECOMMENDATIONS

Piper Aircraft

Quantity Model # Part # Description 1 each HDACF 01-0770028-05 Power supply 1 each A650PG14 01-0770054-00 Wing tip strobe/position light, 14 VDC 1 each A650PR14 01-0770054-02 Wing tip strobe/position light, 14 VDC Note: Model 7111001 and 7111002 can replace Model A650 for a LED solution 1 each A500AV14 01-0770024-00 Tail position/strobe light assembly 1 each HDT390 01-0750205-00 Installation package

For Aircraft with Enclosed Wing Tip Fairings & Wing Tip Mounted Power Supplies – If position and strobe lights are mounted under a clear fairing, the need for a third tail strobe is required. The following is recommended:

®

Quantity Model # Part # Description 2 each A490ATSC 01-0770062-03 Power supply 1 each A650PG14 01-0770054-00 Wing tip strobe/position/taillight, 14 VDC 1 each A650PR14 01-0770054-02 Wing tip strobe/position/taillight, 14 VDC Note: Model 7111001 and 7111002 can replace Model A650 for a LED solution 1 each A500AV14 01-0770024-00 Tail position/strobe light assembly, 14 VDC 3 each HS5 01-0750215-00 Installation package

47


WHELEN CROSS REFERENCE LIST

WHELEN/AEROFLASH/CESSNA CROSS REFERENCE LIST Whelen Model A427-3 A427 A427 A428 A426 A650PG14 A650PR14 A600PG14 A600PR14 A490TCCF A490TCCF A490TCCF A490TCCF A490TCCF 7050900 7050903 SA406 28 VDC150W 12V125W

Whelen P/N 38-0130106-00 02-0250274-00 02-0250274-00 68-4290001-30 19-1900000-009 01-0770054-00 01-0770054-02 01-0790006-00 01-0790006-02 01-0770006-09 01-0770006-09 01-0770006-09 01-0770006-09 01-0770006-09 01-0770509-00 01-0770509-03 02-0350053-00 34-0226010-91 34-0212010-97

Whelen Model A650 A650 A430 A625 A625 A450 A470AR A470AW A470AR A470AS A500AV14 A500AV28 A500AV14 A500AV14 A500AV28 HRCFAW HRCFAR HRCFAS HRCFAW HRCFAR HRCFAS 7028523 7028525 7028524 A490TCF A490TCF D900287

Whelen P/N 01-0770053-00 01-0770053-00 01-0770031-00 01-0770058-00 01-0770058-00 01-0770032-00 01-0770019-18 01-0770019-19 01-0770019-18 01-0770019-20 01-0770024-00 01-0770024-01 01-0770024-00 01-0770024-00 01-0770024-01 01-0770029-30 01-0770029-29 01-0770029-31 01-0770029-30 01-0770029-29 01-0770029-31 01-0770285-23 01-0770285-25 01-0770285-24 01-0770006-08 01-0770006-08 01-0790028-07

Whelen LED Equivalent Model # 7111001 7111002 9034001 9034002

7105500 7105501

Cessna P/N C622006-0105 C622006-0106 C622006-0108 C622006-0103 C622008-0101 C622007-0101 C622008-0102 C622007-0103 C621001-0106 C621001-0102 C17312-1 C17312-3

Aeroflash P/N 80-0018 073-0270 073-0270 111-0016 101-0084 073-0530G 073-0530R 073-0540G 073-0540R 152-0007 152-0008 152-0009 152-0010 152-0011 151-0001 151-0004 073-0141 040-0003 040-0028

Description Strobe Tube Gasket/Spacer Strobe Flash Tube Assembly Strobe Flash Tube Assembly Wing tip Strobe Lens (Clear) Lens Retainer Strobe/Position Light Assembly 14 VDC, Green Strobe/Position Light Assembly 14 VDC, Red Strobe/Position/Tail Light Assembly 14 VDC, Green Strobe/Position/Tail Light Assembly 14 VDC, Red Strobe Power Supply, 14 VDC Strobe Power Supply, 14 VDC Strobe Power Supply, 28 VDC Strobe Power Supply, 28 VDC Strobe Power Supply, 14 VDC, double flash Flasher Assembly (Red 14 VDC) Flasher Assembly (Red 28 VDC) Strobe Flash Tube Assembly Halogen Lamp, 28 VDC 150W Halogen Lamp, 14 VDC 125W

WHELEN/SDI/HOSKINS CROSS REFERENCE LIST Whelen LED Equivalent Model #

7090004

7090005

7090501

SDI/HOSKINS P/N 701303-1 701303-2 30-0005-1 30-0005-1 30-0005 201803-1 201803-2 201945-1 201945-2 201945-7 701557-1 701557-2 701557-1M 701557-5 701557-6 701620-1 701620-2 701620-3 700801-1 700801-2 700801-7 700801-H-1 700801-H-2 700801-H-7 701295-3 701295-4 701148-7-2

Description Wing tip Strobe Flash Tube Assembly, Left Wing tip Strobe Flash Tube Assembly, Right Wing tip Strobe Flash Tube Assembly (Amp Conn.) Wing tip Strobe Flash Tube Assembly (Amp Conn.) Wing tip Strobe Flash Tube Assembly (MS Conn.) Remote Strobe Light Assembly, White Lens Remote Strobe Light Assembly, Red Lens Remote Strobe Light Assembly, White Lens Remote Strobe Light Assembly, Red Lens Remote Strobe Light Assembly, Red/White Lens Combination Nav/Strobe Tail Light 14 VDC Combination Nav/Strobe Tail Light 28 VDC Combination Nav/Strobe Tail Light 14 VDC (Mooney) Combination Nav/Strobe Tail Light 14 VDC (Beech) Combination Nav/Strobe Tail Light 28 VDC (Beech) Bright Star 14 VDC, Self Contained Strobe (Clear Lens) Bright Star 14 VDC, Self Contained Strobe (Red Lens) Bright Star 14 VDC, Self Contained Strobe (Red/Clear Lens) Silver Star 14-28 VDC, Self Contained Strobe (Clear Lens) Silver Star 14-28 VDC, Self Contained Strobe (Red Lens) Silver Star 14-28 VDC, Self Contained Strobe (Red/Clear Lens) Silver Star 14-28 VDC, Self Contained Strobe (Clear Lens) Helicopter Silver Star 14-28 VDC, Self Contained Strobe (Red Lens) Helicopter Silver Star 14-28 VDC, Self Contained Strobe (Red/Clear Lens) Helicopter Strobe Power Supply (14 VDC) Strobe Power Supply (24V) Remote Strobe Light Fixture W/MS connector

WHELEN/GRIMES CROSS REFERENCE LIST

48

Grimes P/N A1280-1 A1280-2 A1280-3 A1285G-14 A1285G-28 A1285R-14 A1285R-28 A1719 A1815AG-14 A1815AG-28 A1815AR-14 A1815AR-28 A2064-12 or 14 A2064-24 or 28 A4174-24 A5413-1 A5395 A6458 A6532 A6795 A7079B-12

Whelen P/N 68-4230020-30 68-4230020-50 68-4230020-40 01-0770001-41 01-0770001-42 01-0770001-51 01-0770001-52 01-0770106-( ) 01-0770082-02 01-0770082-03 01-0770082-00 01-0770082-01 01-0770034-00 01-0770034-01 34-0070372-01 68-3670390-30 01-0770113-( ) 27-0270382-00 27-0270381-00 01-0770348-( ) 34-0070371-02

Whelen Model W1284C W1284R W1284G W1285PG1 W1285PG2 W1285PR1 W1285PR2 A315LO-( ) W1250PG1 W1250PG2 W1250PR1 W1250PR2 A555AV14 A555AV28 WA4174-24 WA4513-1 A315HI-( ) W6458 W6532 70348( ) WA7079B-12

Whelen LED Equivalent Model #

7101501 7101502 7101112 7101102

Description Position Light Lens, Clear Position Light Lens, Red Position Light Lens, Green Position Light Assembly, Green, 14 VDC Position Light Assembly, Green, 28 VDC Position Light Assembly, Red, 14 VDC Position Light Assembly, Red, 28 VDC Cockpit Utility Light Position Light Assembly, Green, 14 VDC Position Light Assembly, Green, 28 VDC Position Light Assembly, Red, 14 VDC Position Light Assembly, Red, 28 VDC Tail Position Light Assembly, 14 VDC Tail Position Light Assembly, 28 VDC Reflector Lamp, 28 VDC, 40W Lens, Aviation White Cockpit Utility Light Motor, 28 VDC Motor, 28 VDC Post Light Reflector Lamp, 14 VDC, 40W


Whelen P/N 34-0070371-01 34-0414020-65 34-0428020-65 01-0770119-( ) 01-0770119-( ) 01-0770119-( ) 01-0770119-( ) 34-0050315-01 01-0770142-( ) 01-0770142-( ) 01-0770155-01 01-0790095-( ) 01-0770029-( ) 01-0770029-( ) 01-0770029-( ) 01-0790044-( ) 01-0770210-( ) 01-0770061-( ) 01-0770061-( ) 34-0070372-02 01-0770104-( ) 34-0070373-01 34-0070373-03 34-0070371-03 34-0070403-00 01-0770030-01 01-0770029-( ) 01-0770032-00 01-0790028-07 01-0790028-09 01-0770019-19 01-0770019-18 01-0770024-( ) 01-0770058-03 01-0770054-02 01-0770053-00 01-0770054-00 01-0770054-03 01-0770054-01 01-0750139-( ) 01-0790029-( ) 01-0770239-( ) 01-0790028-( ) 01-0790028-( ) 01-0770486-01 / -02 02-0250274-00 01-0770190-( ) 01-0790044-( ) 01-0790044-( ) 01-0790044-( ) 01-0770029-( ) 27-0270383-00 36-0170384-01 36-0170384-02 36-0170386-01 36-0170387-01 36-0170388-01 01-0770028-05 01-0770028-05 01-0770028-05 01-0770028-05 01-0790079-04 01-0790079-04 01-0790080-01 01-0790101-05 01-0770028-05 01-0770028-05 34-0070389-00 34-0070373-02 34-0070375-01 34-0070374-01 34-0070391-01 34-0070392-01 34-0270398-9H

Whelen Model WA7079B-24 W1290-14 W1290-28 A350CNRD-( ) A350CNIW-( ) A350CNCL-( ) A350CNRD-( ) WA9906-7 A360-( ) A360S-( ) A715-1 90095-( ) HRCFA( ) HRCFA( ) HRCFA( ) 90044( ) 70210( ) C702321 A325ML( ) A325FL( ) W11631 A300( ) W1512 W1524 W16870 W1982SP SACF HRCFA( ) A450 D90028-7 D90028-9 A470AW A470AR A500AV( ) A625 A650PR14 A650 A650PG14 A650PR28 A650PG28 A512A( ) 90029( ) 70239( ) D90028( ) D90028( ) 7048601 / 7048602 A427 C70190( ) 90044( ) 90044( ) 90044( ) HRCFA( ) W55-0069-1 W55-0221-1 W55-0221-5 W55-0331-3 W55-0681-7 W55-0723-1 HDACF HDACF HDACF HDACF 90079-04 90079-04 90080-01 90101-05 HDACF HDACF W626 W628 W632 W674 W678 W68424 W692

Whelen LED Equivalent Model #

70813 series

70900 series 70900 series 70900 series 90088 series

70900 series 70900 series

7111002 7111001 7111004 7111003

71144 series 90088 series 90088 series 90088 series 70900 series

Description Reflector Lamp, 28 VDC, 40W Reflector Lamp, 14 VDC, 26W Reflector Lamp, 28 VDC, 26W Post Light Post Light Post Light Post Light Lamp, miniature threaded, 28 VDC Cabin Light Assembly Cabin Light Assembly (w/switch) Landing Light Housing (Par-36) Landing Light Housing (Par-46) Self-Contained Strobe Light Self-Contained Strobe Light Self-Contained Strobe Light Flashing Beacon Threshold Light Assembly Aisle Light Map light Map light Reflector Lamp, 6.2V, 40W Map light Reflector Lamp, 12V, 21W Reflector Lamp, 24V, 21W Lamp Lamp, 28 VDC, 75W Self-Contained Strobe Self-Contained Strobe Remote Strobe Head Assembly Wing tip Strobe Light Tail Strobe Light Remote Strobe Light Assembly, White Remote Strobe Light Assembly, Red Tail Strobe/Position Light Assembly Remote Strobe Light Assembly Strobe/Position Light Assembly, Red, 14 VDC Strobe Assembly, Modification required Strobe/Position Light Assembly, Green, 14 VDC Strobe/Position Light Assembly, Red, 28 VDC Strobe/Position Light Assembly, Green, 28 VDC Strobe Tube & Socket Assembly Strobe/Position Light Assembly Strobe/Position Light Assembly Strobe Lighthead Strobe Lighthead Navigation Light/Position Light used on Fairchild Metros Flash-tube Assembly Goose Neck Light Flasher Beacon Flasher Beacon Flasher Beacon Self-Contained Strobe light Motor, 28 VDC Strobe Tube, Pyrex Strobe Tube, Quartz Strobe Tube, Quartz Strobe Tube, Quartz Strobe Tube, Quartz Power Supply Power Supply Power Supply Power Supply Power Supply, MS Connectors Power Supply, MS Connectors Power Supply Power Supply, Wing-tip mount Power Supply Power Supply Reflector Lamp, 6.2V, 40W Reflector Lamp, 26.5V, 26W Lamp, Tail Light, 28 VDC Lamp, Reading Light, 28 VDC Lamp, Tail Light, 28 VDC Reflector Lamp, 28 VDC, 40W Lamp. D.C. Bayonet, 28 VDC, 25W

Grimes P/N A7079B-24 A7512-12 A7512-24 A8970 A8970B A8970C A8970IR A9906-7 B3550-( ) B3555-( ) B4150B D6490 D7080A-( ) G7740A-( ) G8400-( ) G9950-( ) 10-0031-( ) 10-0035-( ) 10-0644-1 10-0644-3 11631 15-0083-( ) 1512 1524 16870 1982SP 30-0437-1 30-0437-100 30-0465-5 30-0467-( ) 30-0467-( ) 30-0504-1 30-0504-3 30-0516-( ) 30-0531-1 30-0538-1 30-0538-11 30-0538-2 30-0538-3 30-0538-4 30-0815-( ) 30-1329-( ) 30-0863-1 30-1331-( ) 30-1467-( ) 30-1661-( ) 31-2645-1 36170-( ) 40-0100-( ) 40-0117-( ) 40-0127-( ) 40-0129-( ) 55-0069-1 55-0221-1 55-0221-5 55-0331-3 55-0681-7 55-0723-1 60-1431-1 60-1431-3 60-1592-5 60-1592-11 60-1750-1 60-1750-3 60-2471-3 60-2799-( ) 60-2836-1 60-2927-1 626 628 632 674 678 684-24 692

WHELEN CROSS REFERENCE LIST

WHELEN/GRIMES CROSS REFERENCE LIST

49


WHELEN CROSS REFERENCE LIST 速

50

POST LIGHT CROSS REFERENCE CHART Breakdown

Model Number

Part Number

A350CN-IW-BK-LG-6

A350CN00

01-0770119-00

A350CN-RD-BK-LG-6

A350CN01

01-0770119-01

A350CN-CL-BK-LG-6

A350CN02

01-0770119-02

A350CN-IW-BK-SH-6

A350CN03

01-0770119-03

A350CN-RD-BK-SH-6

A350CN04

01-0770119-04

A350CN-CL-BK-SH-6

A350CN05

01-0770119-05

A350CN-IW-BK-LG-14

A350CN06

01-0770119-06

A350CN-RD-BK-LG-14

A350CN07

01-0770119-07

A350CN-CL-BK-LG-14

A350CN08

01-0770119-08

A350CN-IW-BK-SH-14

A350CN09

01-0770119-09

A350CN-RD-BK-SH-14

A350CN10

01-0770119-10

A350CN-CL-BK-SH-14

A350CN11

01-0770119-11

A350CN-IW-BK-LG-28

A350CN12

01-0770119-12

A350CN-RD-BK-LG-28

A350CN13

01-0770119-13

A350CN-CL-BK-LG-28

A350CN14

01-0770119-14

A350CN-IW-BK-SH-28

A350CN15

01-0770119-15

A350CN-RD-BK-SH-28

A350CN16

01-0770119-16

A350CN-CL-BK-SH-28

A350CN17

01-0770119-17

A350CN-IW-GR-LG-6

A350CN18

01-0770119-18

A350CN-RD-GR-LG-6

A350CN19

01-0770119-19

A350CN-CL-GR-LG-6

A350CN20

01-0770119-20

A350CN-IW-GR-SH-6

A350CN21

01-0770119-21

A350CN-RD-GR-SH-6

A350CN22

01-0770119-22

A350CN-CL-GR-SH-6

A350CN23

01-0770119-23

A350CN-IW-GR-LG-14

A350CN24

01-0770119-24

A350CN-RD-GR-LG-14

A350CN25

01-0770119-25

A350CN-CL-GR-LG-14

A350CN26

01-0770119-26

A350CN-IW-GR-SH-14

A350CN27

01-0770119-27

A350CN-RD-GR-SH-14

A350CN28

01-0770119-28

A350CN-CL-GR-SH-14

A350CN29

01-0770119-29

A350CN-IW-GR-LG-28

A350CN30

01-0770119-30

A350CN-RD-GR-LG-28

A350CN31

01-0770119-31

A350CN-CL-GR-LG-28

A350CN32

01-0770119-32

A350CN-IW-GR-SH-28

A350CN33

01-0770119-33

A350CN-RD-GR-SH-28

A350CN34

01-0770119-34

A350CN-CL-GR-SH-28

A350CN35

01-0770119-35


2310 NW 55th Court, Ft. Lauderdale, FL 33309 Phone: (954) 739 3575 Fax: (954) 739 9514 Sales: (800) 392 4999

2010 Whelen Engineering Company, Inc.

11015K-Rev 6-AVCAT10-081610

Printed in the U.S.A.


Airparts Co. Inc. - Locations

AIRPARTS CO.,INC. FL (HEADQUARTERS) 2310 NW 55th Court, Ft. Lauderdale, FL 33309 Phone: (954) 739 3575 Fax: (954) 739 9514 Sales: (800) 392 4999

AIRPARTS CO.,INC. KS 1991 Airport Road, Wichita, KS 67209 Phone: (316) 943 2377 Fax: (316) 943 1023 Sales: (800) 333 4221

AIRPARTS CO.,INC. NC 364 Dixon St., Lexington, NC 27292 Phone: (336) 956 7778 Fax: (336) 956 8699 Sales: (800) 245 0291

AIRPARTS DE COLOMBIA S.A. Cra 111 N 23D-38, Bogota D.C. Tel. 418-3023 / 421-6511 Fax. 547-1560

AIRPARTS DEL PERÚ SAC Rep. de Panama # 491 Callao - Lima Peru. Tel. (511) 465-3193 Fax. (511) 429-7133 USA. (954) 338-6795

AIRPARTS DO BRASIL LLC Av. Emilio Antonon, 671 Aeroporto Jundiai/SP CEP: 13212-010 Tel/Fax: +55 11 4582 2065 Phone: (954) 337-2193


AV-22

EXCITERS

LEADS IGNITERS


Table of Contents Aircraft Applications4 Air Transport4 Corporate & Regional Aircraft9 Helicopters22 Igniters27 APU Igniters33 Leads36 APU Leads45 Exciters47 Service Tools & Equipment49 Index52


Product Support / Technical Services

864-843-1162

ÂŽ

1

PREFACE This catalog is intended to be used as a reference guide for engine products designed and manufactured by Champion Aerospace LLC. Most of the products in this catalog KDYH)$$30$DSSURYDO)RUTXHVWLRQVFRQFHUQLQJ)$$30$DSSURYDOVRUDSSOLFDWLRQYHULÂżFDWLRQVSOHDVHFRQWDFW\RXU&KDPSLRQ$HURVSDFHGLVWULEXWRURUFDOO Champion Product Support/Technical Services at 864-843-1162. All rights reserved. The Champion Aerospace catalog may not be copied without prior permission from Champion Aerospace LLC. 7KHLQIRUPDWLRQDQGGDWDFRQWDLQHGLQWKLVFDWDORJDUHIURPYDULRXVVRXUFHV7KHLQIRUPDWLRQDQGGDWDLVVXEMHFWWRFKDQJH,IWKHRSHUDWRULVLQGRXEW &KDPSLRQ$HURVSDFHUHFRPPHQGVUHIHUULQJWRWKHHQJLQH2(0LQIRUPDWLRQRU)$$30$GRFXPHQWDWLRQIRUDSSURYDOYHULÂżFDWLRQ Champion Aerospace assumes no liability in the result of damage related to the improper use of this catalog for other than informational purposes.


®

4

Product Support / Technical Services

864-843-1162

AIR TRANSPORT

AIRBUS AIRCRAFT TYPE A300-600 A300-600 A300-600 A300-600 A300-B2/B4 A300-B2/B4 A310-200 A310-200 (F) $ $ $ )  A310-300 $

$ (ALT APU) A319 (ALT APU) A319 ALT APU A320 (ALT APU) (ALT APU) A320

ENGINE MODEL CF6-80C2A1/A3 (E) CF6-80C2A5 (E) PW4000 JT9D-7R4 CF6-50C2 (E) CF6-50C2 (E) CF6-80A3/A1 (E) CF6-80A3/A1 (E) -7'5 &)&$ (  &)&$$ (  PW4152/4156 &)0%3 ( 

CHAMPION IGNITER P/N CH31753A (T3) ** CH31904-2 ** AA134S-1 AA134S-1 CH31843 (T3) CH31905 CH31843 (T3) CH31905 $$6 &+$  &+  AA134S-1 &+  CH31965 ** PW6000 N/A &)0$%3 (  &+  CH31965 **

OEM IGNITER P/N 9392M95P05 9387M23P09 709525 709525 9101M37P71 1305M52P09 9101M37P71 1305M52P09  03 03 709525 03 1374M13P11 N/A 03 1374M13P11 (O)

CFM56-5B/2P (E) DAC

CH31900-6 ** CH31965 **

V2500-A5 CFM56-5A/B (E)

CFM56-5B/2P (E) DAC

CHAMPION LEAD P/N

OEM LEAD P/N

CH53566-1 CH53551-1

1346M56P04 (O) 5OU683 (O)

CH53566-1

1346M56P04 (O)

CH53566-1  &+ &+ CH53551-1 &+

1346M56P04 (O)  03 2  03 2  5OU683 (O) 03 2 

&+

1374M13P11 1374M13P11 (O)

CH31964 CH31900-6 ** CH31965 **

CH31900-6 ** CH31965 **

APU MODEL 331-250 331-250 331-250 331-250 TSCP700-5 TSCP700-5 331-250E 331-250E  ( ( 331-250E $36 131-9A (E)

CHAMPION IGNITER P/N CH31769 CH31769 CH31769 CH31769 FS153-1 FS153-1 CH31769 CH31769 &+ &+ &+ CH31769 &+ CH31921

OEM APU IGNITER 305766-1 305766-1 305766-1 305766-1 369964-4 369964-4 305766-1 305766-1    305766-1  305766-4

03 2 

$36

&+



CH53569-3 (DAC)

9387M24P18 (O)

131-9A (E) APS3200

CH31921 CH38013

305766-4 160544-1

JS100A1

CH53564

5U0072 (O)

1374M13P11 1374M13P11 (O)

CH53569-1

9387M24P16 (O)

131-9A (E) APS3200 131-9A (E) APS3200

CH31921 CH38013 CH31921 CH38013

305766-4 160544-1 305766-4 160544-1

9387M24P18 (O)

36-300A 131-9A (E) APS3200

CH31801 CH31921 CH38013

3876131-1 305766-4 160544-1

36-300A 131-9A (E)

CH31801 CH31921

3876131-1 305766-4

1374M13P11 1374M13P11 (O)

CH53569-3

(ALT APU) (ALT APU) * indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

5

AIRBUS (CONTINUED) ENGINE MODEL

CHAMPION IGNITER P/N

OEM IGNITER P/N

CHAMPION LEAD P/N

OEM LEAD P/N

APU MODEL

CHAMPION IGNITER P/N

OEM APU IGNITER

A320 (ALT APU) (ALT APU) A321

V2500-A5

CH31964

JS100A1 (O)

CH53564

5U0072 (O)

CFM56-5B1/2/3 (E)

CH31900-6 ** CH31965 **

1374M13P11 1374M13P11 (O)

CH53569-1

9387M24P16 (O)

APS3200 36-300A 131-9A (E) APS3200

CH38013 CH31801 CH31921 CH38013

160544-1 3876131-1 305766-4 160544-1

9387M24P18 (O)

36-300A 131-9A (E) APS3200

CH31801 CH31921 CH38013

3876131-1 305766-4 160544-1

36-300A 131-9A (E) APS3200 36-300A 131-9A (E) 331-350 331-350 331-350 331-350 331-600 (E) 331-350 331-600 (E)  3:$

CH31801 CH31921 CH38013 CH31801 CH31921 CH34549 CH34549 CH34549 CH34549 CH31921 CH34549 CH31921 &+ &+

3876131-1 305766-4 160544-1 3876131-1 305766-4 304634-2 304634-2 304634-2 304634-2 305766-4 304634-2 305766-4  

(ALT APU) (ALT APU) A321 (ALT APU) (ALT APU) A321 (ALT APU) (ALT APU) A330 A330 A330 A340-200 (ALT APU) A340-300 (ALT APU) $ $)

CFM56-5B/2P (E) DAC

CH31900-6 ** CH31965 **

1374M13P11 1374M13P11 (O)

CH53569-3

V2500-A5

CH31964

JS100A1 (O)

CH53564

5U0072 (O)

CF6-80E1A1/4 (E) PW4168/PW4164 TRENT 772 CFM56-5C (E)

CH31904-2 ** AA134S-1 CH34736 CH31900-6 ** CH31965 CH31900-6 ** CH31965 &+ &+

9387M23P09 709525 L907030 1374M13P11 1374M13P11 (O) 1374M13P11 1374M13P11 (O) / &+

CH53566-3 CH53551-1

1346M56P07 (O) 5OU683 (O)

CH53569-2

9387M24P17 (O)

CH53569-2

9387M24P17 (O)

 &+

 &+

CFM56-5C2/3/4 (E) 75(17 75(17 ( 

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

AIR TRANSPORT

AIRCRAFT TYPE


®

6

Product Support / Technical Services

864-843-1162

AIR TRANSPORT

BOEING (INCLUDING MCDONNELL DOUGLAS) AIRCRAFT TYPE '&

ENGINE MODEL &)0& ( 

CHAMPION IGNITER P/N &+' 7 

OEM IGNITER P/N 03

CHAMPION LEAD P/N &.'

OEM LEAD P/N 

APU MODEL 

'&

&)0& ( 





JT8D SERIES

0''& )  DC10-15 DC10-15 0''& )  DC10-40 0' MD11 0'

&)'' CF6-45A2 (E) CF6-50C2/F (E) &)&&& JT9D-59A &)&$') (  PW4000 -7'

03 1374M13P11 (O) 487238 709525 03 9101M37P71 9101M37P71 03 709525 03 709525  709525

&.'

DC9

&+  CH31965 AA72SA AA134S-1 $$6%  CH31843 (T3) CH31843 (T3) &+ 7  AA134S-1 &+$  AA134S-1 $$6$ AA134S-1

CH31964 CH34760-1 (LONG LIFE) Y242-5 <

JS100A1 (O) CH34760-1 Y242-5 /

85-98D SERIES 







&+ CH53551-1 &+ CH53568-2

03 2  5OU683 (O)  2  5000472-01 (O)

ALT APU) MD90-30 717-200

V2500/2528 BR715 SERIES

 5((1* 

7$<



-7'$5

$$6$ AA134S-1  -7'$ $$6$ AA134S-1  &)0$%& (  &+  CH31965 ** (ALT APU) (ALT APU) * indicates that FAA-PMA is pending

**gasket included

 709525  709525 03 1374M13P11 (O)

76&3 TSCP-700 TSCP-700 76&3 TSCP-700 76&3 TSCP-700 % 36-280D 85-98D SERIES 131-9D APS2100













&+ CH53552-2

03 2  9339M26P14 (O)

(E) indicates exicter available for application

CHAMPION IGNITER P/N &+ CH31824 &+ CH31824 CH31723 CH31824 )6 FS153-1 FS153-1 )6 FS153-1 )6 FS153-1 &+ CH34549 CH31723 CH31824 CH34803 CH38013

&&.

&+ CH31824 &&. &+ CH31824 &&. &+ CH31824 &.&. &+ CH31824 36-280B CH31801 APS2000 CH38013

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

OEM APU IGNITER  3888210-1  3888210-1 369162 3888210-1  369964-4 369964-4  369964-4  369964-4  304634-2 369162 3888210-1 3888267-4 160544-1  3888210-1  3888210-1  3888210-1  3888210-1 3876131-1 160544-1 (T5) Button Style


Product Support / Technical Services

ÂŽ

864-843-1162

7

BOEING (CONTINUED)

 747-100     747-200F $/7$38 

CHAMPION IGNITER P/N &+  CH31965 ** &)0%% (  &+  DAC CH31965 ** -7'$4 $$6 CF6-45A2 (E) CH31905 &)&(&( (  &+ -7'5 $$6 5%6(5,(6 <$ &)&( /(&  (  &+ CF6-50C1/E1/C2/E2 (E) CH31905  

OEM IGNITER P/N 03 1374M13P11 (O) 03 1374M13P11 (O)  1305M52P09 03  / 03 1305M52P09 

747-400 747-400 (F)  747SR 747SR 

CF6-80C2B (E) PW4000/4100 5%*7+7 CF6-45A2 (E) CF6-45A2 (E) 3:

CH31772A ** AA134S-1 &+ CH31843 (T3) CH31905 $$6

9387M23P01 709525 / 9101M37P71 1305M52P09 



5%

<$

 767-100/200

5%((% â&#x20AC;&#x153;PHASE 5â&#x20AC;? CF6-50/80A (E)

767-100/200 767-200/ER



ENGINE MODEL &)0%% ( 

CHAMPION LEAD P/N &+

OEM LEAD P/N 03 2 

APU MODEL % ( 

CHAMPION IGNITER P/N &+

OEM APU IGNITER 

&+ '$& 

03 2 

% ( 

&+



 CH53566-1 &+    CH53566-1 

 1346M56P04 (O) 03 2     1346M56P04 (O) 

5 660-4/4R 5 5 5 5 660-4/4R 

CH53566-1 CH53551-1 

1346M56P04 (O) 5OU683 (O) 

CH53566-1 &+

1346M56P04 (O) % 2 

PW901A PW901A 3:$ 660-4/4D/4R 660-4/4D/4R 

/







&+

/







CH31843 (T3)

9101M37P71

CF6-50/80A (E)

CH31905

1305M52P09

JT9D-7R4

AA134S-1

709525

)6$ FS118-1A )6$ )6$ )6$ )6$ FS118-1A &+& CH31769 CH34511 CH34511 &+ FS118-1A FS118-1A &+& CH31769 &+& CH31769 &+& CH31769 CH31547C CH31769 CH31547C CH31769 CH31547C CH31769

 369949-1     369949-1  305766-1 3900274 3900274  369949-1 369949-1  305766-1  305766-1  305766-1 369949-3 305766-1 369949-3 305766-1 369949-3 305766-1

* indicates that FAA-PMA is pending

**gasket included

331-200 CH53566-1

(E) indicates exicter available for application

1346M56P04 (O)

331-200 331-200

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

AIR TRANSPORT

AIRCRAFT TYPE 


®

8

Product Support / Technical Services

864-843-1162

AIR TRANSPORT

BOEING (CONTINUED) AIRCRAFT TYPE 767-200/300ER

ENGINE MODEL CF6-80A (E)

CHAMPION IGNITER P/N CH31905

OEM IGNITER P/N 1305M52P09

CHAMPION LEAD P/N CH53566-1

OEM LEAD P/N 1346M56P04 (O)

APU MODEL 331-200

331-400 331-400 % % %

CHAMPION IGNITER P/N CH31547C CH31769 CH31547C CH31769 CH31547C CH31769 CH31547C CH31769 CH31547C CH31769 CH31921 CH31921 &+ &+ &+

OEM APU IGNITER 369949-3 305766-1 369949-3 305766-1 369949-3 305766-1 369949-3 305766-1 369949-3 305766-1 305766-4 305766-4   

767-200/300ER

CF6-80C2B (E)

CH31772A **

9387M23P01

CH53566-1

1346M56P04 (O)

331-200

767-200/300ER/F

CF6-80C2B (E)

CH31904-2 **

9387M23P09

CH53566-1

1346M56P04 (O)

331-200

767-200/300ER

PW4050/56/60/62

AA134S-1

709525

CH53551-1

5OU683 (O)

331-200

767-300ER/EM

RB211-524H

YA211-25

L912018

767-400/ER 767-400/ER (5 (5 (5 (5 (ALT APU) 787

PW4060 CF6-80C2B8F (E) *( (  3: 75(17

AA134S-1 CH31772A ** &+  &+ &+

709525 9387M23P01 1$ - /

CH53551-1 CH53566-1  &+ 

5OU683 (O) 1346M56P04 (O)  28 2  

TRENT 1000 (E)

CH34851-1

CH34851-1

CH53571

CH53571

331-200 APS5000

CH31769 N/A

305766-1

331-200

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

AIRCRAFT TYPE CL-215T CL 300

ENGINE MODEL PW123AF HTF7000 (E)

CHAMPION IGNITER P/N CH34817 CH34826-6

OEM IGNITER P/N 3055161-01 3038110-6

CHAMPION LEAD P/N 53335-01 53542-1

OEM LEAD P/N 3117291-01 3038111-1

APU MODEL SAPHIR 20 36-150 (BD)

CL600

ALF502L (E)

CH34452A

2-300-732-05

2-303-025-02

&/$ CL601-3A &/5

&)$$ CF34-3A &)% ( 

)+($ CH34661 &+

73 4048T30P10 73 2 

53282 53283 



&/

&)% ( 

&+

73 2 

&5-

&)$% ( 

&+

73 2 

&5-

&)% ( 

&+

73 2 

&5-

&)&& (  &+

73

&5-

&)&$$ (  &+

73

'$6+ (ALT APU) DASH 8-400 (ALT APU) (ALT APU) DHC-7 LEARJET 30 LEARJET 31A

3:6(5,(6

&+



&+ CH53513-4 &+ CH53513-4 &+ CH53513-4 &+ CH53513-4 &+ CH53513-2 &+ CH53513-5 

73 2  4096T96P04 (O) 73 2  4096T96P04 (O) 73 2  4096T96P04 (O) 73 2  4096T96P04 (O) 73 2  4096T96P08 (O) 73 2  4096T96P011 (O) 

PW150A (E)

CH31918-2 CH31955-1

3122415-03 3056557-02

CH53456-2 CH53536-1

3122414-04 3056566-01

PT6A-50 (E) TFE731-20 TFE731-2 (E)

CH34055 CH31815-2 CH31815-2

3035102 3074541-4 3074541-4

CH53399-05

3119835-01

53142-10 53142-11

3071590-10 3071590-11

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

CHAMPION IGNITER P/N

OEM APU IGNITER

36-100

CH34313 CH34492 CH34249

3888002-2 3888096-2 3888096-1

 36-100 

&+ CH34249 &+

 3888096-1 

 5- 

&+



 5- 

&+



 5- 

&+



5(

&+

:%

5(

&+

:%

$36 36-150 APS 1000 36-150 36-6

&+ CH34313 CH38013 CH34313 FHE159-6

 3888002-2 160544-1 3888002-2 3888002-1

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

CORPORATE & REGIONAL AIRCRAFT

BOMBARDIER

9


®

CORPORATE & REGIONAL AIRCRAFT

10

Product Support / Technical Services

864-843-1162

BOMBARDIER (CONTINUED) AIRCRAFT TYPE LEAR 35/36

ENGINE MODEL TFE731-2-100S (E)

/($5-(7;5 7)($5%5 (  LEARJET 55 TFE731-3D (E) /($5-(7 3:$ */2%$/(;35(66%5$ GLOBAL 5000 BR710A2-20

CHAMPION IGNITER P/N CH31815-2

OEM IGNITER P/N 3074541-4

&+ CH31815-2 &+ < Y242-5

 3074541-4 % < Y242-5

CHAMPION LEAD P/N 53142-10 53142-11 53142-12 53142-13  53142-13  

OEM LEAD P/N 3071590-10 3071590-11 3071590-12 3071590-13  3071590-13  

APU MODEL

CHAMPION IGNITER P/N

OEM APU IGNITER

5(

&+



77*&$ &+ 5( &+ RE220 CH31930

 :% WB3888446-1

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

AIRCRAFT TYPE $9525- $9525-5- $73 JETSTREAM 31

ENGINE MODEL $/)5 (  /)) 3:$ TPE331 (E)

CHAMPION IGNITER P/N &+$ &+$ &+ CH31547C

OEM IGNITER P/N    369949-3

JETSTREAM 41

TPE331-14GR/HR (E)

CH34627-1

3105893-6

HS 748-2A

DART 534-2

FHE19-6L

CR104-2

CHAMPION LEAD P/N    50221-24 50221-25 53338-1

OEM LEAD P/N    369876-24 369876-25 3105901-1 Y209-2

APU MODEL  $36 

CHAMPION IGNITER P/N &+ &+ &+

OEM APU IGNITER   

3105893-4

53339-1

3105902-1

(T3) Pin Style

(T5) Button Style

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

CORPORATE & REGIONAL AIRCRAFT

BAE

11


®

CORPORATE & REGIONAL AIRCRAFT

12

Product Support / Technical Services

864-843-1162

CESSNA AIRCRAFT TYPE

ENGINE MODEL

CHAMPION IGNITER P/N

OEM IGNITER P/N

CHAMPION LEAD P/N

OEM LEAD P/N

APU MODEL

CHAMPION IGNITER P/N

OEM APU IGNITER

&$5$9$1,,, &,7$7,21,,,

37$$ (  -7'$ ( 

&+ &+ 7 

 



JT15D-4B (E)

CH34659-3 (T5)

3119400-01

&,7$7,21,,,,9 (ALT APU) 

7)(%6 (  &+









 T62-T40C7A 77&$&$$

&+ CH34834 &+

 4952382 

CITATION ULTRA

JT15D-5D (E)

CH34659-3 (T5)

3119400-01

CITATION V

JT15D-5A (E)

CH34659-3 (T5)

3119400-01

CITATION VII &,7$7,21;

TFE731-4 (E) $(

CH34549 &+

3888002-2 

3:&% )-$& (  FJ44-4A (E) 37$ (  73( (  250-B17F/2 3:$ PW530A PW535A LTP101-700A-1A

3074541-4  23084762 %  78214   6877518 - 2  31J1552-01 (O) 31J1552-01 (O) 1-300-348-07

36-150 

&,7$7,21629(5(,*1 &-&-&- CJ4 &2148(67,   &2148(67   P210 (TURBINE) (;&(/ BRAVO ENCORE 421

CH31815-2 &+ CH31898-4 * (LONG LIFE) &+ &+ CH31967 &+ &+& YB63-1 &+ CH34804-3 CH34804-3 CH34016-1

  3118347-02 3118347-01 3118347-02  3071590-11  3071590-13 3118347-01 3118347-02 3118347-01 3118347-02 3070873-11  2 



CITATION II/S II

&+  53300-2 53300-1 53300-2  53142-11  53142-13 53300-1 53300-2 53300-1 53300-2 53164-11 &+  

 

5( 

&+ 



&+







5(

&+



(T3) Pin Style

(T5) Button Style

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.


Product Support / Technical Services

®

864-843-1162

AIRCRAFT TYPE FALCON 10 FALCON 100 )$/&21'() $/7$38  FALCON 20-5 (RETROFIT) )$/&21; $/7$38  )$/&21; )$/&21 FALCON 900 FALCON 900B )$/&21(; FALCON 2000 )$/&21(;

ENGINE MODEL TFE731-2 (E) TFE731-2-100S (E) &)  TFE731-5A (E) 7)( (   3:$ (  $7)$ TFE731-5A (E) TFE731-5 (E) 7)( (  CFE738-1 3:& ( 

CHAMPION IGNITER P/N CH31815-2 CH31815-2 )+($  CH31815-2 &+  &+ &+ CH31815-2 CH31815-2 &+ NA &+

OEM IGNITER P/N 3074541-4 3074541-4 &  3074541-4   3  3074541-4 3074541-4  NA &

CHAMPION LEAD P/N 53164-3 53164-3   53142-12   &+  53142-12

OEM LEAD P/N

APU MODEL

CHAMPION IGNITER P/N

OEM APU IGNITER

  3071590-12   3  3071590-12

&+ )+( CH34313 &+ &+ &+

  3888002-2   





&+ CH53483-5

& 30C1133-03

& 77&&& 36-150 (W)  77&$$ *7&3 77& 36-150 36-150  36-150 (F2M)  )0 

CH34313 CH34313 &+ CH34549 &+

3888002-2 3888002-2  304634-2 

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

CORPORATE & REGIONAL AIRCRAFT

DASSAULT

13


®

CORPORATE & REGIONAL AIRCRAFT

14

Product Support / Technical Services

864-843-1162

EMBRAER AIRCRAFT TYPE CARAJA (0% (0%

ENGINE MODEL PT6A-34 (E) 37$ (  3:

CHAMPION IGNITER P/N AGF2-6 $*) &+

OEM IGNITER P/N 3014054  

ERJ 135/140/145

AE3007

CH31898-1 CH31898-4 * (LONG LIFE)

23062672

CHAMPION LEAD P/N 53402-02   50383H 53367-01 CH53557-1 CH53557-2

OEM LEAD P/N 3011871   3033339 3120676-01 23054367 (O) 23054368 (O)

(ALT APU) ERJ 135 LEGACY

AE3007

(5-

&)(( ( 

(5-

&)( ( 

CH31898-1 CH31898-4 * (LONG LIFE) &+

23062672

&+ CH31965 **

1374M13P11 (O) 1374M13P11 (O)

73

CH53557-1 CH53557-2 

23054367 (O) 23054368 (O) 

APU MODEL

CHAMPION IGNITER P/N

OEM APU IGNITER

 $  $$ 

&+



APS 500

CH34834

4952382

T62-T40C11 T62-T40C14 APS 500

FHE159-6 CH38013 CH34834

26519-1 160544-1 4952382

$36 ( 

&+ CH34856 CH34848 CH34856

 4252846 4952647 4252846

APS 2300 (E)

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

AIRCRAFT TYPE 0(5/,1,,,,,,$,9,9$ MERLIN IIB MERLIN IIIB MERLIN IIIC 0(752,,,,,,

ENGINE MODEL 73(8* (  TPE331-1-151G (E) TPE331-10U-511G (E) TPE331-10U-512G (E) 73(8 ( 

CHAMPION IGNITER P/N &+& CH31547C CH31547C CH31547C &+&

OEM IGNITER P/N  369949-3 369949-3 369949-3 

0(752,,,,$,,, 0(752,,,,$ 328TP 328 JET DO228 SEASTAR CD2

73(8* (  73(8* (  PW119A PW306B TPE331-5 (E) PT6A-135 (E)

&+& &+& CH34817 CH34682 CH31547C CH34055

  3055161-01 31B5168-01 369949-3 3035102

CHAMPION LEAD P/N  50221-15 50221-24 50221-28  50221-32  

50221-15 CH53399-04

OEM LEAD P/N  369876-15 369876-24 369876-28  369876-32  

APU MODEL

CHAMPION IGNITER P/N

OEM APU IGNITER

36-150 36-150

CH34313 CH34313

3888002-2 3888002-2

369876-15 3119832-01

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

CORPORATE & REGIONAL AIRCRAFT

FAIRCHILD DORNIER

15


®

CORPORATE & REGIONAL AIRCRAFT

16

Product Support / Technical Services

864-843-1162

FOKKER AIRCRAFT TYPE )

ENGINE MODEL 7$<

CHAMPION IGNITER P/N <

OEM IGNITER P/N /

F100 )) ))$) F27-100 F27-400M )5) F27-600 F27-FH227D ))+%) F27J F28 SERIES ) F70

TAY 650-15 '$57 '$57 DART 7 DART 536-7R '$575 DART 6 DART 532-7L '$57 DART 529 SPEY 555-15/P/H 3:%%% TAY 620-15

Y183-6 )+(/ )+(/ FHE19-6L FHE19-6L )+(/ FHE19-6L FHE19-6L )+(/ FHE19-6L FHE164E &+ Y183-5

L912023 &5 &5 CR104-2 CR104-2 &5 CR104-2 CR104-2 &5 CR104-2 CR114-2  L912019

CHAMPION LEAD P/N 

OEM LEAD P/N 

 

 













APU MODEL  36-150 (RR) 36-150 (RR)   30-54 30-54  30-54 30-54  36-4A 36-4A $36 36-150 (RR)

CHAMPION IGNITER P/N &+ CH34549 CH34549 &+  &+  CH31615 ** CH31615 ** &+  CH31615 ** CH31615 ** &+  CH31615 ** CH31615 ** &+ CH34549

OEM APU IGNITER  304634-2 304634-2   369964-5 369964-5  369964-5 369964-5  369964-5 369964-5  304634-2

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

AIRCRAFT TYPE GI GII (ALT APU) GIII GIV/ GIV-SP *9*963

ENGINE MODEL DART 506 SPEY 511-8

CHAMPION IGNITER P/N FHE19-6L FHE164E

OEM IGNITER P/N CR104-2 CR114-2

SPEY 511-8 TAY 611-8 %5

G100

TFE731-3A (E)

FHE164E Y183-5 < CH34760-1 CH31815-2

G150

TFE731-40AR-200G (E)

CH31815-2

CR114-2 L912019 < CH34760-1 (LONG LIFE) 3074541-4 53142-11 3074541-4 53142-11

(ALT APU) G200 G350 G450 G550

PW306 TAY 611-8C TAY 611-8C BR710

CH34682 Y183-5 Y183-5 Y242-5 CH34760-1

CHAMPION LEAD P/N

OEM LEAD P/N

 53142-10 3071590-11 53142-10 3071590-11

31B5168-01 L912019 L912019 Y242-5 CH34760-1 (LONG LIFE)



APU MODEL 36-100 36-100 APS500 (T62-T40C2) 36-100 36-100 5(

CHAMPION IGNITER P/N CH34313 CH34313 FHE159-6 CH34313 CH34249 &+

OEM APU IGNITER 3888002-2 3888002-2 26519-1 3888002-2 3888096-1 :%

3071590-10

RE100

CH34549

304634-2

3071590-10

36-100

CH34249

3888096-1

RE100 GTCP 36 GTCP 36 GTCP 36 RE 220

CH34549 CH34249 CH34249 CH34249 CH34730

304634-2 3888096-1 3888096-1 3888096-1 WB3888401-1

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

CORPORATE & REGIONAL AIRCRAFT

GULFSTREAM

17


®

CORPORATE & REGIONAL AIRCRAFT

18

Product Support / Technical Services

864-843-1162

HAWKER BEECHCRAFT AIRCRAFT TYPE

ENGINE MODEL

CHAMPION IGNITER P/N

OEM IGNITER P/N

CHAMPION LEAD P/N

OEM LEAD P/N

BEECH 1900D BEECH 1300/1900 BEECH 99 BEECH C12F BEECH C99 AIRLINER BEECH JET 400A

PT6A-67D (E) PT6A-42 (E) PT6A-20 (E) PT6A-42 (E) PT6A-36 JT15D-5 (E)

CH34055 CH34055 CH34055 CH34055 CH34055 CH34659-3 (T5)

3035102 3035102 3035102 3035102 3035102 3119400-01

BEECH T-1A JAYHAWK BEECH T-44A %((&+7&;

JT15D-5B (E)

CH34659-3 (T5)

3119400-01

PT6A-34B -7') ( 

CH34055 &+ 7 

3035102 

CH53399-09 CH53399-06 CH53399-04 CH53399-06 CH53399-06 53300-1 53300-2 53300-1 53300-2 CH53399-04  53300-2

3119832-02 3119836-01 3119832-01 3119836-01 3119836-01 3118347-01 3118347-02 3118347-01 3118347-02 3119832-01  3118347-02

BONANZA (TURBOPROP) +$:.(5

250-B17F/2 7)( ( 

YB63-1 &+

1017565 

 53142-11 53142-12 53142-13

 3071590-11 3071590-12 3071590-13

(ALT APU) +$:.(5;3

7)(5+ ( 

&+



 53142-11

 3071590-11

(ALT APU) +$:.(5 HAWKER HORIZON/4000 KING AIR A100 KING AIR B100 KING AIR B200 KING AIR C90 KING AIR E90 35(0,(5, SUPER KING AIR 350 SUPER KING AIR B200

3:% PW308A (E) PT6A-28 (E) TPE331-6 (E) PT6A-42 (E) PT6A-21 (E) PT6A-28 (E) )-$ (  PT6A-60A (E) PT6A-42 (E)

&+ CH31929-4 CH34055 CH31547C CH34055 CH34055 CH34055 &+ CH34055 CH34055

% 30C1356-04 3035102 369949-3 3035102 3035102 3035102  3035102 3035102

 CH53483-7 CH53399-04 50221-12 CH53399-06 CH53399-04 CH53399-04  CH53399-06 CH53399-06

 30C2172-04 3119832-01 369876-12 3119836-01 3119832-01 3119832-01  3119836-01 3119836-01

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

APU MODEL

CHAMPION IGNITER P/N

OEM APU IGNITER



&+ 



36-150 *7&377&&'

CH34313 &+

3888002-2 

APS 500 *7&377& GTCP36

CH38013 &+ CH34313

160544-1  3888002-2

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

AIRCRAFT TYPE ADAM AIRCRAFT A700 AEROSPATIALE CORVETTE

ENGINE MODEL FJ33 (E) JT15D-4 (E)

CHAMPION IGNITER P/N CH34812-2 CH34659-3 (T5)

OEM IGNITER P/N 67906 3119400-01

$,575$&725 $% ANTONOV-38 ANTONOV-38-100 ASTRA 1125 $675$63; ATR42 $75 AVIANTI P180 BN-2T SPECIAL MISSION BN-2T SPECIAL MISSION BERNDT IVERSEN II CASA 101EB CASA-212 CASA-212P &10 &1 &1 &219$,5

37$$*$* (  $*$* TPE331-14GR (E) TPE331-14 (E) TFE731-3A (E) 7)( (  PW120 3:%) PT6A-66 (E) 250-B17C

&+



CH34627-1 CH31701A CH31815-2 &+ CH34817 &+ CH34055 CH34269

315893-6 3105547-1 3074541-4  3055161-01  3035102 23006266

250-B17F

YB63-1

1017565

PT6A-34 (E) TFE731-2 (E) TPE331-5 (E) PT6A-65B (E) &7$$ &7%& &7& '

CH34055 CH31815-2 CH31547C CH34055 &+ &+ &+ )6'

3035102 3074541-4 369949-3 3035102 73 73 73 

CONVAIR 600 CONVAIR 640

DART 542-4 DART 10-1

FHE19-6L FHE19-6L

CR104-2 CR104-2

DASA FAN RANGER

JT15D (E)

CH34659-3 (T5)

3119400-01

DC3 (TURBINE)

PT6A-65R (E)

CH34055

3035102

* indicates that FAA-PMA is pending

**gasket included

CHAMPION LEAD P/N

OEM LEAD P/N

53300-1 53300-2 &+

3118347-01 3118347-02 

53338-1 53133-5 53164-4  53335-01  CH53399-07

3105901-1 3105589-5 3070873-4  3117291-01  3119833-01

CH53399-04 53142-11 50221-12 CH53399-06

3119832-01 3071590-11 369876-12 3119836-01





APU MODEL

CHAMPION IGNITER P/N

OEM APU IGNITER

36-150 

CH34313 &+

3888002-2 



&+ CH31824 CH31615 ** CH31615 **

 3888210-1 369964-5 369964-5

(T3) Pin Style

(T5) Button Style

30-141 (E) 30-141 (E) 53300-1 53300-2 CH53399-06

(E) indicates exicter available for application

3118347-01 3118347-02 3119836-01

(O) equivalent OEM P/N. PMA by test and computation.

CORPORATE & REGIONAL AIRCRAFT

VARIOUS AIRCRAFT MODELS

19


®

CORPORATE & REGIONAL AIRCRAFT

20

Product Support / Technical Services

864-843-1162

VARIOUS AIRCRAFT MODELS (CONTINUED) AIRCRAFT TYPE DIAMOND IA

ENGINE MODEL JT15D-4D (E)

CHAMPION IGNITER P/N CH34659-3 (T5)

OEM IGNITER P/N 3119400-01

(;75$ FUJI T-5/T-7/KN-D2 GROB 140 GUMMAN/SCHWEIZER G164D AGCAT HERMAN TRAITOR 250 JAFFE-SWEARINGEN SA-32T JAVELIN -(73523'/; L-139 L188 ELECTRA LOCKHEED JETSTAR (ALT APU) MALLARD 0$8/(070;0;7 PACIFICAERO CRESCO 750 PAMPA 200 PEGASUS UCAV-N

%) 225-B17D 250-B17F/2 PT6A-41AG (E)

<% YB63-1 YB63-1 CH34055

 1017565 1017565 3035102

250-B17F 225-B17D FJ33 (E) 37$ (  TFE731-5 (E) 501-D22 TFE731-3 (E)

YB63-1 YB63-1 CH34812-2 &+ CH31815-2 FS89-1D CH31815-2

1017565 1017565 67906  3074541-4 6805734 3074541-4

PT6A-34 (E) %& PT6A-34AG (E) TFE731-2B (E) JT15D-5C (E)

CH34055 <% CH34055 CH31815-2 CH34659-3 (T5)

3035102  3035102 3074541-4 3119400-01

3,/$7863& PILATUS PC-6 PILATUS PC-7 PIPER CHEYENNE 400LS PIPER CHEYENNE IA PIPER CHEYENNE IIIA PIPER MALIBU MERIDIAN ROCKWELL 40/60 SAAB 2000 SABERLINER

37$%3 (  PT6A-27 (E) PT6A-25A (E) TPE331-14A (E) PT6A-11 (E) PT6A-61 (E) PT6A-42 (E) JT12A-8 AE2100A TFE731-3R-1D (E)

&+ CH34055 CH34055 CH31701A CH34055 CH34055 CH34055 FHE151C CH31898-4 CH31815-2

 3035102 3035102 3105547-1 3035102 3035102 3035102 424815 23084762 3074541-4

* indicates that FAA-PMA is pending

**gasket included

CHAMPION LEAD P/N 53300-1 53300-2 

OEM LEAD P/N 3118347-01 3118347-02 

APU MODEL

CHAMPION IGNITER P/N





&+







85 30-100 (E) T62T-39/40C

FS47-11 CH31615 ** FHE159-6





APS 1000

CH38013

160544-1

(T3) Pin Style

(T5) Button Style

53164-3 CH53399-04  CH53399-04

3119832-01

53300-1 53300-2 &+ CH53399-04 CH53399-07 53133-5 CH53399-04 CH53399-06 CH53399-06

3118347-01 3118347-02  3119832-01 3119833-01 3105589-5 3119832-01 3119836-01 3119836-01

(E) indicates exicter available for application

OEM APU IGNITER

75153 369964-5 26519-1

3119832-01

(O) equivalent OEM P/N. PMA by test and computation.


Product Support / Technical Services

®

864-843-1162

AIRCRAFT TYPE SF340A/B SHORTS 330 SHORTS 360 SHORTS C-23A SHERPA SIAI-MARCHETTI S.211

ENGINE MODEL CT7-5A/9B PT6A-45A (E) PT6A-65AR (E) PT6A-45R (E) JT15D-41

CHAMPION IGNITER P/N CH34419 CH34055 CH34055 CH34055 CH34659-3 (T5)

OEM IGNITER P/N 5044T67P07 3035102 3035102 3035102 3119400-01

SIAI-MARCHETTI SF 260TP SIAI-MARCHETTI SF 600A 6,*0$-(70$*$1$-(7 6,126:($5,1*(16- SOCATA TBM700 TURBOCOMMANDER (FLEETWOOD) VALMET L-90TP

250-B17F 250-B17F )-$ (  )-$ (  PT6A-64 (E) TPE 331-5-251K (E)

YB63-1 YB63-1 &+ &+ CH34055 CH31547C

1017565 1017565   3035102 369949-3

250-B17F

YB63-1

1017565

CHAMPION LEAD P/N

OEM LEAD P/N

CH53399-06 CH53399-06 CH53399-06 53300-1 53300-2

3119836-01 3119836-01 3119836-01 3118347-01 3118347-02

  CH53399-06

  3119836-01

APU MODEL 36-150

CHAMPION IGNITER P/N CH34313





OEM APU IGNITER 3888002-2

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

CORPORATE & REGIONAL AIRCRAFT

VARIOUS AIRCRAFT MODELS (CONTINUED)

21


®

22

864-843-1162

$*867$$*867$%(// HELLICOPTER 7<3( AGUSTA 190A

ENGINE 02'(/ 250-C20B

CHAMPION ,*1,7(531 YB63-1

OEM ,*1,7(531 1017565

CHAMPION /($'31

OEM /($'31

CHAMPION (;&,7(5

CHAMPION ,*1,7(531

AGUSTA 109C

250-C20R/1

YB63-1

1017565

AGUSTA A109

ARRIUS 2K1

CH34745 *

9550175400

AGUSTA A109 LUH

ARRIUS 2K2

CH34745 *

9550175400

AGUSTA A109 POWER

PW206C (E)

CH34723

3120880-01

CH53442-4

312144-02

CH92015

3043937-03

AGUSTA A109E

PW206B (E)

CH34723

3120880-01

CH53442-3

3122957-01

CH92015

3043937-03

$*867$$(

3:&( ( 

&+



&+



&+



AGUSTA A109K/K2

ARRIEL 1K1

CH34745

9550175400

AGUSTA EOA

250-C20R/1

YB63-1

1017565

AGUSTA MK II+

250-C20R/1

YB63-1

1017565

AGUSTA A119 KOALA

PT6B-37A (E)

CH34055

3035102

CH53399-01

3119829-01

AGUSTA-BELL 212

PT6T-3 (E)

CH34055

3035102

CH53399-01

3119829-01

AGUSTA-BELL 412

PT6T-3B (E)

CH34055

3035102

CH53399-01

3119829-01

AGUSTA-BELL 412/SP/HP/EP

PT6T-3DE (E)

CH34055

3035102

CH53399-01

3119829-01

AGUSTA-BELL AB139

PT6C-67C (E)

CH34758-2

3050627-03

CH53490

3050604-01

CH92015-1

3043937-04

OEM (;&,7(5

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

CORPORATE & REGIONAL AIRCRAFT

CORPORATE & REGIONAL AIRCRAFT

HELICOPTER

Product Support / Technical Services


Product Support / Technical Services

®

864-843-1162

23

BELL ENGINE 02'(/ /76&$

CHAMPION ,*1,7(531 &+

OEM ,*1,7(531 

BELL 230

250-C30G/2

CH34187A

6899084

BELL 407

250-C47B

CH34187A

6899084

BELL 412

PT6T-3D (E)

CH34055

3035102

CH53399-01

3119829-01

BELL 427

PW206E

CH34723

3120880-01

CH53530

3056743-01

%(///,,,,9

&3

&+$



CH34304 (LONG LIFE)

23006267

BELL 206L-1

250-C20B

YB63-1

1017565

BELL 206B-3

250-C20J

YB63-1

1017565

BELL 214ST

CT7-2A

CH34158

4053T22P01

BELL 430 CORPORATE

250-C40B

CH34187A

6899084

CH34304 (LONG LIFE)

23006267

CH34187A

6899084 CH53490

3050604-01

BELL OH-58D BELL UH-1H (HUEY)

250-C30R PT6C-67D (E)

CH34304 (LONG LIFE)

23006267

CH34758-2

3050627-03

CHAMPION /($'31 

OEM /($'31 

CHAMPION (;&,7(5 

CHAMPION ,*1,7(531

CH92015

3043937-03

OEM (;&,7(5

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

HELICOPTER

HELLICOPTER 7<3( %(//


®

24

Product Support / Technical Services

864-843-1162

HELICOPTER

EUROCOPTER HELLICOPTER 7<3( $6$6'

ENGINE 02'(/ /76$$

CHAMPION ,*1,7(531 &+

OEM ,*1,7(531 

CHAMPION /($'31 

OEM /($'31 

CHAMPION (;&,7(5 

$6%%$67$5

$55,(/'

&+









AS350B3

ARRIEL 2B1

CH34595

9550168770

AS350BA

ARRIEL 1B

CH34745

9550175400

53317-3

9550166530

AS350D

LTS-101-600A3

CH34016-1

AS350G

250-C30M

CH34187A

6899084

CH34304 (LONG LIFE)

23006267

CH53442-3

3121144-02

CH53442-4

3121144-03

AS355

250-C20F

YB63-1

1017565

AS365N3

ARRIEL 2C

CH34595

9550168770

BK117C1

ARRIEL 1E2

CH34745

9550175400

BO 108

PW206B (E)

CH34723

3120880-01

CH92015

CHAMPION ,*1,7(531

3043937-03

BO-105

250-C20B

YB63-1

1017565

EC 130

ARRIEL 2B1

CH34595

9550168770

EC 135 P2

PW206B2 (E)

CH34723

3120880-01

CH53442-3 *

3122957-01

CH92015

3043937-03

EC 135

PW206E (E)

CH34723

3120880-01

CH53442-4

3121144-02

CH92015

3043937-03 3043937-03

EC 635

PW206B2 (E)

CH34723

3120880-01

CH53442-3 *

3122957-01

CH92015

(&%&2/,%5,

$55,86)

&+









EC135

ARRIUS 2B1/2B1A-1

CH34593

9550168770

EC135

PW206B (E)

CH34723

3120880-01

CH53442-3

3122957-01

CH92015

3043937-03

EC 145

ARRIEL 1E2

CH34745

9550175400

EC155

ARRIEL 2C2

CH34745 *

9550175400

EC155B

ARRIEL 2C1

CH34745 *

9550175400

EC635

PW206B (E)

CH34723

3120880-01

CH53442-3

3122957-01

CH92015

3043937-03

HH-65A SRR

LTP101-750B-2

CH34016-1

1-300-348-07

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

OEM (;&,7(5

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

25

VARIOUS HELICOPTER MODELS ENGINE 02'(/ LTS101-650B-1

CHAMPION ,*1,7(531 CH34016

OEM ,*1,7(531 1-300-348-06

KHI BK-117B

LTP101-750B-1

CH34016-1

1-300-348-07

BK-117B-1

LTS-101-750B1

CH34016-1

1-300-348-07

SCHWEIZER 330

RR 250-C20W

YB63-1

1017565

SCHWEIZER 333

RR 250-C20W

YB63-1

1017565

SIKORSKY H-76

PT6B-36 (E)

CH34055

3035102

SIKORSKY S-58T

PT6T-6 (E)

CH34055

3035102

SIKORSKY S-76 MARK II

250-C30S

CHAMPION /($'31

OEM /($'31

CH53463

3123061-01

CH34187A

6899084

6,.256.<6$6& $55,(/6

&+







SIKORSKY S-76B

PT6B-36 (E)

CH34055

3035102

CH53463

3123061-01

&+



SIKORSKY S-76C+

ARRIEL 2S1

CH34745*

9550175400

SIKORSKY S-92

CT7-8A

CH34419*

5044T67P07

EH INDUSTRIES EH 101

CT7-6A

CH34419

5044T67P07

0'(;3/25(5

3:( ( 

&+



MD 500E

RR 250-C20R+

CH34168

6877518

CH34269 (LONG LIFE)

23006266

MD 520N

RR 250-C20R+

CH34168

6877518

CH34269 (LONG LIFE)

23006266

MD 600N

RR 250-C47M

CH34187A

6899084

CH34304 (LONG LIFE)

23006267

CH34168

6877518

ENSTROM 480B PZL SWIDNIK PZL SW-4

RR250-C20W AII 250-C2R/2

* indicates that FAA-PMA is pending

**gasket included

CH34269 (LONG LIFE)

23006266

YB63-1

1017565

(E) indicates exicter available for application

CHAMPION (;&,7(5

CHAMPION ,*1,7(531

OEM (;&,7(5



&+

(O) equivalent OEM P/N. PMA by test and computation.



(T3) Pin Style

(T5) Button Style

HELICOPTER

HELLICOPTER 7<3( KHI BK-117A


26

IGNITERS

NOTES:

Product Support / Technical Services

864-843-1162


Product Support / Technical Services

ÂŽ

864-843-1162

27

IGNITERS IGNITION SYSTEM RECOMMENDATIONS 1.

Do not use anti-seize material on silver plated threads.

2. 

Some igniters have JUDSKLWHJUHDVHWRKHOSLJQLWHUVÂżUVW spark. Do not remove the grease before installation.

3.

Coated Bushing Bushing coated to prevent lead stickLQJDOORZLQJIRUHDVLHUUHPRYDODQG installation. Tungsten Contact Provides increased resistance to arcing with mating lead.

Leakage Protection Dual seals for protection against gas leakage under high temperature conditions.

Positive Insulator Retention Upper insulator shaped to provide positive component retention.

Shaped Insulator Lower insulator shaped to provide positive component retention. Protective Coating Special coating prevents H[FHVVLYHFKDÂżQJRIVKHOO extending igniter service life.

Patented Iridium Pin Design Provides maximum resistance to spark erosion and increased service life.

IGNITERS

Do not bend or twist the leads. This will damage the leads and connectors over time.

Corrosion Protection Silver-plated shell for protection against corrosion and seizing.


®

28

Product Support / Technical Services

864-843-1162

IGNITERS

IGNITERS ENGINE MANUFACTURER CFM INTERNATIONAL CFM INTERNATIONAL CFM INTERNATIONAL CFM INTERNATIONAL CFM INTERNATIONAL CFM INTERNATIONAL GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC *(1(5$/(/(&75,& GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC HONEYWELL HONEYWELL +21(<:(// +21(<:(// +21(<:(// HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL +21(<:(// * indicates that FAA-PMA is pending

ENGINE MODEL CFM56-3 SERIES CFM56-5 (DAC) CFM56-5A & 5B SERIES CFM56-5C SERIES CFM56-7 SERIES (DAC) CFM56-7 SERIES (SAC) CF34-10E CF34-1A CF34-3A &)$%% CF34-8 SERIES CF6-45 & 50 SERIES CF6-80C SERIES CF6-80E SERIES CF700 CJ610 CT58 SERIES CT7 SERIES GE90 SERIES ALF502 SERIES LF507 SERIES $7)$(LOWER POSITION)

CHAMPION IGNITER P/N CH31900-6 ** CH31900-6 ** CH31900-6 ** CH31900-6 ** CH31900-6 ** CH31900-6 ** CH31900-6 ** FHE256-10A CH34661 &+ CH31926 CH31905 CH31904-2 ** CH31904-2 ** FHE146-7A FHE146-7A CH34095 CH34419 CH31919 * CH34452A CH34452A CH31767

OEM IGNITER P/N 1374M13P11 1374M13P11 1374M13P11 1374M13P11 1374M13P11 1374M13P11 1374M13P11 (O) 4048T30P06 4048T30P10 73 2  4096T33P07 1305M52P09 9387M23P09 9387M23P09 37C311124P101 37C311124P101 37B200275P102 5044T67P07 N/A 2-300-732-05 2-300-732-05 3003119-1

+7)+7) LTP101 SERIES T53 SERIES T53-13A-13B TFE731 SERIES TPE331 SERIES 73($%

CH31768 &+ CH34016-1 CH34016 FHE211-2 CH31815-2 CH31547C &+$

3003119-2  1-300-348-07 1-300-348-06 1-300-348-03 3074541-4 369949-3 

**gasket included

(E) indicates exicter available for application

%27+,*1,7(565(48,5(' $7)$(UPPER POSITION)

ALT CHAMPION IGNITER P/N CH31965 ** CH31965 ** CH31965 ** CH31965 ** CH31965 ** CH31965 ** CH31965 **

ALT OEM IGNITER P/N 1374M13P11 (O) 1374M13P11 (O) 1374M13P11 (O) 1374M13P11 (O) 1374M13P11 (O) 1374M13P11 (O) 1374M13P11 (O)

FHE256-10B &+

4048T30P07 3 2

CH31843 (T3) CH31772A ** CH31772A **

9101M37P71 9387M23P01 9387M23P01

CH34158

4053T22P01

 FHE113-10

1-300-197-03

CH31621A

3070967-1



(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

29

IGNITERS ENGINE MANUFACTURER HONEYWELL INTERNATIONAL AERO PRATT & WHITNEY PRATT & WHITNEY PRATT & WHITNEY PRATT & WHITNEY PRATT & WHITNEY PRATT & WHITNEY PRATT & WHITNEY 35$77 :+,71(<  PRATT & WHITNEY CANADA

ENGINE MODEL TPE331-14GR-HR V2500 SERIES J60-P-5B JT12A SERIES JT8D SERIES JT9D SERIES JTF2A-6A PW2000 PW4000 3:3:'3: 3:3: JT15D SERIES

CHAMPION IGNITER P/N CH34627-1 CH31964 AA33SD FHE151C AA72SA AA134S-1 FHE151C AA134S-1 AA134S-1

OEM IGNITER P/N 3105893-6 JS100A 424848 424815 487238 709525 424815 709525 709525

&+ CH34659-3 (T5) (LONG LIFE)

- 3119400-01

35$77 :+,71(<&$1$'$    35$77 :+,71(<&$1$'$  35$77 :+,71(<&$1$'$ PRATT & WHITNEY CANADA PRATT & WHITNEY CANADA 35$77 :+,71(<&$1$'$   PRATT & WHITNEY CANADA 35$77 :+,71(<&$1$'$ 35$77 :+,71(<&$1$'$ 35$77 :+,71(<&$1$'$

37$$%$* $*$%$ $%  37$6(5,(6 %6(5,(676(5,(6 37&'& PT6T SERIES PW100 SERIES 3:3:3:3: 3:3:3:3: 3:3: PW150A 3:$%%&( 3:&'''( 3:$%

$*)(LOW-VOLTAGE GLOW

3014054

**gasket included

ALT OEM IGNITER P/N 3015893-4

FHE151C

424815

AA134S-1

709525

FHE246-4 (T3) CH34668-1 (T5)

3039828 3117463-01

PLUG COIL ELEMENT)

&+



&+



&+ CH34055 CH34817 &+

 3035102 3055161-01 

CH34406 CH34406 &+

3035882 3035882 

CH31918-2 &+ &+ &+

3122415-03   %

CH31955-1 &+

3056557-01 

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

IGNITERS

* indicates that FAA-PMA is pending

ALT CHAMPION IGNITER P/N Y209-2

(T5) Button Style


ÂŽ

30

Product Support / Technical Services

864-843-1162

IGNITERS

IGNITERS

ENGINE MANUFACTURER 35$77 :+,71(<&$1$'$ PRATT & WHITNEY CANADA 35$77 :+,71(<&$1$'$ 35$77 :+,71(<&$1$'$ 35$77 :+,71(<&$1$'$ ROLLS ROYCE ROLLS ROYCE ROLLS ROYCE ROLLS ROYCE ROLLS ROYCE ROLLS ROYCE 52//652<&(  52//652<&(

ROLLS ROYCE ROLLS ROYCE ROLLS ROYCE ROLLS-ROYCE ALLISON ROLLS-ROYCE ALLISON 52//652<&($//,621 52//652<&($//,621

ENGINE MODEL 3:$%& PW307A 3:$3:& 3:3:3: 67/67/ AVON 200 & 500 SERIES BR710 SERIES BR715 SERIES DART 500 SERIES MK.501 RB211 SERIES 5%*7*7 +7+7 5%&( E4-B-37 â&#x20AC;&#x153;PHASE 5â&#x20AC;? SPEY 500 SERIES 7$< 7$< TRENT 500 SERIES 75(17 % % 895-17 TRENT 900 SERIES VIPER MK.500 SERIES VIPER MK.601-22 225-B17C 225-B17D &&$ &&$

* indicates that FAA-PMA is pending

**gasket included

ROLLS ROYCE 52//652<&( 52//652<&( ROLLS ROYCE 52//652<&(  

CHAMPION IGNITER P/N &+ CH31958-3 &+ &+ &+ FHE176A Y242-5 CH34760-1 FHE19-6L CH34126 YA211-25

OEM IGNITER P/N % 30P0606-03 & - 2

 CR103 Y242-5 CH34760-1 CR104-2 CBS113-2 L912018

&+

/

CH34743 FHE164E < < CH34761 &+

L907031 CR114-2 / / L907032 /

CH34829 FHE205B FHE267-2A CH34269 CH34269 &+ &+

CH34829 CBS116 CBS111-2 23006266 23006266  

(E) indicates exicter available for application

ALT CHAMPION IGNITER P/N

ALT OEM IGNITER P/N

&+

&

Y242-5

Y242-5

YW90

L912017

YB63-1 <% &+

6877518  

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

31

IGNITERS ENGINE MODEL

52//652<&($//,621    52//652<&($//,621   52//652<&($//,621  52//652<&($//,621    52//652<&($//,621      ROLLS-ROYCE ALLISON 52//652<&($//,621  52//652<&($//,621 52//652<&($//,621 52//652<&($//,621

%$%(%*%' <% %(%)%)%)& &&&-&5&5&5 &5&6&: &%&'&$ <% &%&&&%&&&) %%%%& &&%%$%( &+ %*%6(5,(6&6(5,(6 &%&'&&$&% &+ &&&%&&&)&- &5&5&5&5 &6&: %$%(%*% &+ %%%&%'%(%) %)&&%&'& &$&%&&&&&% &&&)&-&6&5&5 &5&5&: 250-C30R/3M CH34187A &*&*5&5 &+ &50&8&%&%&0 '$'''('+' )6' '$&* )6$ $($&' &+ CH31898-4 * (LONG LIFE) AE3007 CH31898-4 CH31898-4 * (LONG LIFE) $55,(/$$$% &+ &&&'' (..66

ROLLS-ROYCE ALLISON 785%20(&$   * indicates that FAA-PMA is pending

**gasket included

CHAMPION IGNITER P/N

(E) indicates exicter available for application

OEM IGNITER P/N

ALT CHAMPION IGNITER P/N

ALT OEM IGNITER P/N





 



IGNITERS

ENGINE MANUFACTURER

6899084     23084762 23062672 

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


®

32

Product Support / Technical Services

864-843-1162

IGNITERS ENGINE MANUFACTURER

ENGINE MODEL

CHAMPION IGNITER P/N

OEM IGNITER P/N

785%20(&$  785%20(&$ WALTER WALTER WILLIAMS INTERNATIONAL :,//,$06,17(51$7,21$/

$55,(/$$$% ''66%& $55,86)%% M601E-11 M601F FJ33 )-$$3$&$ -3A-24 FJ44-4A

&+



&+ CH34630 CH34630 CH34812-2  CH31956 CH31967

 CH34630 CH34630 67906  68032 78214

WILLIAMS INTERNATIONAL

ALT CHAMPION IGNITER P/N

ALT OEM IGNITER P/N











IGNITERS

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

33

APU IGNITERS ENGINE MODEL APS 500R (T62T-40C14) $36 77&  APS 2000 APS 2100 APS 2300

HAMILTON SUNDSTRAND APIC HAMILTON SUNDSTRAND APIC HAMILTON SUNDSTRAND APIC +$0,/721681'675$1'$3,& HONEYWELL HONEYWELL +21(<:(// HONEYWELL +21(<:(// HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL

APS 3200 T62T-40C14 (APS 500 R/C14) T20G GEMINI 77& TSCP700 RE100 5( *;   5-  RE220 (GV) *73 GTCP30-92 GTCP85-99 GTCP85-98DHF GTCP85-98DCK GTCP85-98D GTCP85-98CK GTCP85-98C GTCP85-98 GTCP85-91C GTCP85-90F GTCP85-90E/F GTCP85-90 GTCP85-37 GTCP85-291C GTCP85-291 GTCP85-291

* indicates that FAA-PMA is pending

**gasket included

CHAMPION IGNITER P/N CH34834 &+ CH38013 CH38013 CH34856 CH34865* CH38013 CH34834 CH38013 )+( FS153-1 ** CH34549 &+ CH34730 &+ CH31615 CH31723 CH31723 CH31723 CH31723 CH31723 CH31723 CH31723 CH31723 FS47-11 FS47-11 FS47-11 FS47-11 FS47-11 CH31824 CH31723

(E) indicates exicter available for application

OEM IGNITER P/N 4952382  160544-1 160544-1 4952846 TBD 160544-1 4952382 160544-1  369964-4 304634-2 :% WB3888401-1  369964-5 369162 369162 369162 369162 369162 369162 369162 369162 75153 75153 75153 75153 75153 3888210-1 369162

ALT CHAMPION IGNITER P/N CH38013

ALT OEM IGNITER P/N 160544-1

CH34848

4952647



CH31824 CH31824

3888210-1 3888210-1

CH31824

3888210-1

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

APU IGNITERS

ENGINE MANUFACTURER HAMILTON SUNDSTRAND APIC +$0,/721681'675$1'$3,& HAMILTON SUNDSTRAND APIC HAMILTON SUNDSTRAND APIC HAMILTON SUNDSTRAND APIC

(T5) Button Style


®

34

Product Support / Technical Services

864-843-1162

APU IGNITERS

APU IGNITERS ENGINE MANUFACTURER HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL +21(<:(// HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL

ENGINE MODEL GTCP85-185L GTCP85-184 GTCP85-163CK GTCP85-139H GTCP85-129E/F/G GTCP85-129CK GTCP85-129A/B/C GTCP85-129 GTCP85-115H-129 GTCP85-115CK GTCP85-115C GTCP660-4R GTCP660-4 GTCP36-300 (A) GTCP36-280 (D) GTCP36-280 (B) *7&3 $  $$  GTCP36-150F2M GTCP36-150 SERIES GTCP36-150 (RR) GTCP36-150 (RJ) GTCP36-100W GTCP36-100M GTCP36-100H GTCP36-100G GTCP36-100E GTCP36-100A GTCP36-100K GTCP331-600 GTCP331-500 (B) GTCP331-400

* indicates that FAA-PMA is pending

**gasket included

CHAMPION IGNITER P/N CH31723 CH31824 CH31723 CH31723 CH31723 CH31723 CH31723 CH31723 CH31723 CH31723 CH31723 FS118-1A FS118-1A CH31801 CH34549 CH31801 &+ CH34706 CH34313 CH34549 CH34549 CH34249 CH34249 CH34249 CH34249 CH34249 CH34249 CH34713 CH31921 CH34731 CH31921

(E) indicates exicter available for application

OEM IGNITER P/N 369162 3888210-1 369162 369162 369162 369162 369162 369162 369162 369162 369162 369949-1 369949-1 3876131-1 304634-2 3876131-1  3888002-5 3888002-2 304634-2 304634-2 3888096-1 3888096-1 3888096-1 3888096-1 3888096-1 3888096-1 3888366-1 305766-4 3888267-7 305766-4

ALT CHAMPION IGNITER P/N

ALT OEM IGNITER P/N

CH31824 CH31824 CH31824

3888210-1 3888210-1 3888210-1

CH31824 CH31824 CH31824 CH31824 CH31824

3888210-1 3888210-1 3888210-1 3888210-1 3888210-1

CH34585 CH34713 CH34713 CH34713 CH34713 CH34249

3888096-4 3888366-1 3888366-1 3888366-1 3888366-1 3888096-1

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

35

APU IGNITERS ENGINE MANUFACTURER

ENGINE MODEL

CHAMPION IGNITER P/N

OEM IGNITER P/N

HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL +21(<:(// PRATT & WHITNEY CANADA 35$77 :+,71(<&$1$'$ PRATT & WHITNEY CANADA

GTCP331-350 (C) GTCP331-250 (F) GTCP331-200 (A) GTCP331-200 GTCP131-9D GTCP131-9B GTCP131-9A GTCP36-100 SERIES *7&3(0 PW901A 67/67/ PW980A

CH34549 CH31769 (LONG LIFE) CH31547C CH31769 CH34803 CH31769 CH31921 CH34492 &+ CH34511 &+ CH34511

304634-2 305766-1 369949-3 305766-1 3888267-4 305766-1 3057664 3888096-2  3900274  3900274

ALT CHAMPION IGNITER P/N

ALT OEM IGNITER P/N

CH31547C

369949-3

CHAMPION P/N

OEM P/N

APPLICABLE IGNITERS

     6860319 N/A

  0 03  ST-3477-17 31B3211-01

&+&+)+( 3:&-7' &+$*)&+&+ 3:&373: &+&+&+&&+&+ +21(<:(//*7&373( &+$&+&+&+    &+&+&+ *(&)&)1& CH31955-1 PWC/PW150 CH34682

OEM ENGINES













NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

APU IGNITERS

IGNITER GASKETS


LEADS

36

Product Support / Technical Services

864-843-1162


Product Support / Technical Services

864-843-1162

®

37

PRODUCT NEWS RELEASE Champion Aerospace - an industry leader in ignition system technology for over 100 years is the preferred OEM and supplier to the worldâ&#x20AC;&#x2122;s military and civilian aviation marketplace. Todayâ&#x20AC;&#x2122;s high performance aircraft turbine engines require products which incorporate advanced technology that complement and enhance their operation. 0HHWLQJWKHDLUOLQHV¶QHHGIRUTXDOLW\DQGUHOLDELOLW\LQWRGD\¶VGHPDQGLQJRSHUDWLQJHQYLURQPHQW&KDPSLRQ$HURVSDFHLQWURGXFHVDFRPSOHWHOLQHRIKLJK performance ignition leads and components. Â&#x2021;

$OO&KDPSLRQDLUFRROHGOHDGVVXSSRUWHGE\DVXSHULRUPDQXIDFWXUHU¶VZDUUDQW\DWDORZHULQLWLDOFRVW

Â&#x2021;

8QLTXHOHDGGHVLJQ *UHDWHUFRROLQJDLUÃ&#x20AC;RZ 5HGXFHGRSHUDWLQJFRVW

Â&#x2021;

)$$$SSURYHG0HHWVRUH[FHHGVRULJLQDOHQJLQHPDQXIDFWXUHUV¶VSHFL¿FDWLRQV

Â&#x2021;

:RUOGZLGH3URGXFW 6DOHV6XSSRUW

LEADS


38

Product Support / Technical Services

LEADS

LEADS

BUTTON STYLE CONNECTOR (T5)

PIN STYLE CONNECTOR (T3)

864-843-1162


Product Support / Technical Services

®

864-843-1162

39

LEADS ENGINE MODEL

LEFT OR PRIMARY LEAD P/N

LEFT OR PRIMARY OEM P/N

RIGHT OR ALT LEAD P/N

RIGHT OR ALT OEM P/N

CFM INTERNATIONAL CFM INTERNATIONAL CFM INTERNATIONAL CFM INTERNATIONAL CFM INTERNATIONAL CFM INTERNATIONAL GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC *(1(5$/(/(&75,& *(1(5$/(/(&75,&

CFM56-3 SERIES CFM56-5 (DAC) CFM56-5A & 5B SERIES CFM56-5C SERIES CFM56-7 SERIES (DAC) CFM56-7 SERIES (SAC) CF34-10E CF34-1A CF34-3A &)$%% &)&& CF34-8C5A1/A3 CF6-45 & 50 SERIES CF6-80C SERIES CF6-80E SERIES CFE738-1-1B ALF502 SERIES LF507 SERIES $/)6(5,(6/)6(5,(6 HTF7000 TFE731 SERIES 7)($$5 %%55$ 7)($$5 %%55$

CH53552-1 CH53569-3 CH53569-1 CH53569-2 CH53440-1 CH53440

9339M26P13 (O) 9387M24P18 (O) 9387M24P16 (O) 9387M24P17 (O) 1853M13P04 (O) 1853M13P01 (O)

CH53552-2 CH53569-3 CH53569-1 CH53569-2 CH53440-1 CH53440

9339M26P14 (O) 9387M24P18 (O) 9387M24P16 (O) 9387M24P17 (O) 1853M13P04 (O) 1853M13P01 (O)

&+ &+ CH53515-1 CH53566-1 CH53566-1 CH53566-3 53323-4 53282 53214  CH53542-3 53142-10     53142-13   

73 2  73 2  4096T96P07 (O) 1346M56P04 (O) 1346M56P04 (O) 1346M56P07 (O) 3051406-4 2-303-025-02 2-303-766-02  3038111-3 3071590-10

&+ &+ CH53515-5 CH53566-1 CH53566-1 CH53566-1

73 2

73 2

4096T96P11 (O) 1346M56P04 (O) 1346M56P04 (O) 1346M56P04 (O)

53283 53215 

2-303-079-02 2-303-767-02 

GENERAL ELECTRIC GENERAL ELECTRIC GENERAL ELECTRIC HONEYWELL/GE HONEYWELL HONEYWELL +21(<:(// HONEYWELL HONEYWELL +21(<:(//  +21(<:(//  HONEYWELL +21(<:(//  +21(<:(//  

73( 73( 73( 73( 73(85

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

   3071590-13   

LEADS

ENGINE MANUFACTURER



(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


®

40

Product Support / Technical Services

864-843-1162

LEADS ENGINE MANUFACTURER +21(<:(// +21(<:(// 

LEADS

+21(<:(// +21(<:(// +21(<:(// +21(<:(// HONEYWELL +21(<:(// +21(<:(//  +21(<:(// +21(<:(//   HONEYWELL +21(<:(//  +21(<:(//   +21(<:(//   HONEYWELL

ENGINE MODEL 73( TPE/TSE331-3 73(8$ 73( TPE331-10/-10U 73(8$ TPE/TSE331-3 73( 73( 73( TPE331-SR1 73(65,65,, 73(65,65,, 73( 73(65,65,, 73( 73( 73(85 TPE/TSE331-3 73(65,65,, 73( TPE/TSE331-3 73( 73( 73(85 73( 73(85 73(65,65,, TPE KITS

* indicates that FAA-PMA is pending

**gasket included

LEFT OR PRIMARY LEAD P/N 

LEFT OR PRIMARY OEM P/N 









   50221-17     

   369876-17     

 50221-6 

 369876-6 





 

 

 50221-10

 369876-10

(E) indicates exicter available for application

RIGHT OR ALT LEAD P/N

(O) equivalent OEM P/N. PMA by test and computation.

RIGHT OR ALT OEM P/N

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

41

LEADS ENGINE MANUFACTURER

ENGINE MODEL

LEFT OR PRIMARY LEAD P/N

LEFT OR PRIMARY OEM P/N

+21(<:(//   +21(<:(// HONEYWELL

73( 73( 73(65,65,, 73($% TPE331-14GR/HR





INTERNATIONAL AERO 35$77 :+,71(< PRATT & WHITNEY PRATT & WHITNEY 35$77 :+,71(< 

V2500-A5 -7' PW2000 PW4000 3:3:' 3:3:3:

  53338-1 53339-1 CH53564 &+ CH53556 CH53551-1 &+ 

  3105901-1 3105902-1 5U00072 (O)  2  1B7426 (O) 5OU683 (O) 28 2  

35$77 :+,71(<&$1$'$

-7'%%

 7 



* indicates that FAA-PMA is pending

**gasket included

RIGHT OR ALT LEAD P/N

RIGHT OR ALT OEM P/N

 

&+ CH53556 CH53551-1 &+

 2

1B7426 (O) 5OU683 (O) 28 2

NOTES:

LEADS

(E) indicates exicter available for application

 7 

(O) equivalent OEM P/N. PMA by test and computation.

 (T3) Pin Style

(T5) Button Style


®

42

Product Support / Technical Services

864-843-1162

LEADS

LEADS

ENGINE MANUFACTURER  35$77 :+,71(<&$1$'$  35$77 :+,71(<&$1$'$  35$77 :+,71(<&$1$'$  35$77 :+,71(<&$1$'$     PRATT & WHITNEY CANADA 35$77 :+,71(<&$1$'$      35$77 :+,71(<&$1$'$   35$77 :+,71(<&$1$'$  35$77 :+,71(<&$1$'$ 35$77 :+,71(<&$1$'$ PRATT & WHITNEY CANADA

ENGINE LEFT OR PRIMARY MODEL LEAD P/N '$' -7'$%  7  %&'  377%%(' &+ %%)%*'(')  37$3 &+ %$)  37$$% &+ $*$*$ % $*% $ -135A PT6A-50 CH53399-05 37$$$ &+ %5$$* $*$5% 5$%' $$)$*%' )57 37$$$ &+ $& 37%) 7&37:9 &+ 677677 37%$ - 37&&' &+ ST6L-73 CH53399-08

  3119834-01

35$77 :+,71(<&$1$'$

3:$%$ 



* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

LEFT OR PRIMARY OEM P/N

RIGHT OR ALT LEAD P/N

RIGHT OR ALT OEM P/N



 7 



    

3119835-01 

 



50383-C

3029107





(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

43

LEADS ENGINE MODEL

     

PRATT & WHITNEY CANADA

%&$ $$) %&'( %%$ $%& '()* -127M 3:3:3: 3:3:3: 3:3:3: PW127 PW150A

PRATT & WHITNEY CANADA 35$77 :+,71(<&$1$'$ 35$77 :+,71(<&$1$'$ 35$77 :+,71(<&$1$'$ PRATT & WHITNEY CANADA PRATT & WHITNEY CANADA PRATT & WHITNEY CANADA

PW206B 3:$&( 3:&'''( 3:$% PW307A PW308A PW308C

35$77 :+,71(<&$1$'$  

LEFT OR PRIMARY LEAD P/N

LEFT OR PRIMARY OEM P/N

RIGHT OR ALT LEAD P/N

RIGHT OR ALT OEM P/N









.



CH53536-1 CH53456-2 CH53442-3 &+ &+ &+ CH53544-1 CH53483-5 CH53483-5

3056566-02 3122414-04 3122957-01   % 30P0605-02 30C1133-03 30C1133-03

CH53483-7 CH53483-7

30C2172-04 30C2172-04

CH53538-4

CH53538-4







LEADS

ENGINE MANUFACTURER

NOTES:

ROLLS ROYCE

TRENT 900 SERIES

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


®

44

Product Support / Technical Services

864-843-1162

LEADS ENGINE MANUFACTURER ROLLS ROYCE 52//652<&($//,621 

LEADS

52//652<&($//,621  52//652<&($//,621    52//652<&($//,621 52//652<&($//,621 ROLLS-ROYCE ALLISON 785%20(&$   785%20(&$  TURBOMECA WILLIAMS INTERNATIONAL :,//,$06,17(51$7,21$/  NOTES:

* indicates that FAA-PMA is pending

ENGINE MODEL TRENT 1000 SERIES %& $// %' $//  %(%)%)%) C20S & $// &* &*&0&6 -C40B &:& $//  &*&/&0&3 &5&5&6 &8&%&0 &%&& &)&5 $//  AE3007 $55,(/$$$% &&&'' (..66 $55,(/$$$% ''66% ARRIUS 2F FJ33 )-$3$&$ $$

**gasket included

LEFT OR PRIMARY LEAD P/N CH53571 &+

LEFT OR PRIMARY OEM P/N CH53571 









  CH53557-1 

  23054367 





53317-3 CH53543-2 

9550166530 67787 

(E) indicates exicter available for application

RIGHT OR ALT LEAD P/N

RIGHT OR ALT OEM P/N

CH53543-1 

67788 

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style





(T5) Button Style


Product Support / Technical Services

®

864-843-1162

45

APU LEADS ENGINE MODEL APS 2000 APS 2100 APS 2300 APS 3200 131-9A 131-9B 131-9D GTCP331-200

LEFT OR PRIMARY LEAD P/N 53267-3 53267-4 CH53539-3 CH53379-2 53179-13 53179-12 53368-1 53109-1

LEFT OR PRIMARY OEM P/N 179505-3 179505-4 4951693-3 4950581-2 3876132-13 3876132-12 3888316-1 3888076-1

HONEYWELL

GTCP331-250

53109-1

3888076-1

HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL +21(<:(// HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL

GTCP331-350 (C) GTCP331-500B GTCP36-100 (M) GTCP36-100E GTCP36-150 (A) GTCP36-150 (AA) *7&3 &;  GTCP36-150 (J) GTCP36-150 (M) GTCP36-150 (R) GTCP36-150 (RJ) GTCP36-150 (RR) GTCP36-150 (W) GTCP36-280 (B) GTCP36-300 GTCP85-129 GTCP85-129CK GTCP85-98 GTCP85-98C GTCP85-98CK

53179-6 53331-2 53359-3 50160-61 53359-6 53359-6  53359-6 53359-3 53359-9 53359-15 53359-18 53359-6 53236-5 53179-1 50160-7 50160-7 50160-7 50160-7 50160-7

3876132-6 3888283-2 3888302-3 369259-61 3888302-6 3888302-6  3888302-6 3888302-3 3888302-9 3888302-15 3888302-18 3888302-6 304269-5 3876132-1 369259-7 369259-7 369259-7 369259-7 369259-7

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

RIGHT OR ALT LEAD P/N 53267-4

RIGHT OR ALT OEM P/N 179505-4

CH53539-4

4951693-4

53109-2 53109-3 53109-2 53109-3 53179-7 53331-4

3888076-2 3888076-3 3888076-2 3888076-3 3876132-7 3888283-4

53359-16

3888302-16

53179-8 50160-32

3876132-8 369259-32

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

APU LEADS

ENGINE MANUFACTURER HAMILTON SUNDSTRAND APIC HAMILTON SUNDSTRAND APIC HAMILTON SUNDSTRAND APIC HAMILTON SUNDSTRAND APIC HONEYWELL HONEYWELL HONEYWELL HONEYWELL

(T5) Button Style


46

Product Support / Technical Services

864-843-1162

APU LEADS ENGINE MANUFACTURER HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL HONEYWELL PRATT & WHITNEY CANADA PRATT & WHITNEY CANADA PRATT & WHITNEY CANADA PRATT & WHITNEY CANADA

ENGINE MODEL GTCP85-98D GTCP85-98DC (A) GTCP85-98DC (B) GTCP85-98DC (C) GTCP85-98DCK GTCP85-98DHF GTCP85-98DHF (A) RE220 (GV) TSCP700 PW901A ST6L-73 ST6L-77 PW980A

LEFT OR PRIMARY LEAD P/N 50160-20 50160-20 50160-20 50160-20 50160-20 50160-20 50160-20 53348-3 50160-47 50383-L CH53399-08 CH53399-08 CH53567

LEFT OR PRIMARY OEM P/N 369259-20 369259-20 369259-20 369259-20 369259-20 369259-20 369259-20 WB3888353-3 369259-47 3910351-01 3119834-01 3119834-01 3901208-01

RIGHT OR ALT LEAD P/N

RIGHT OR ALT OEM P/N

53348-4 50160-48

WB3888353-4 369259-48

APU LEADS

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

47

$,5&5$)7(;&,7(56 ENGINE MANUFACTURER

CHAMPION P/N

OEM P/N

ENGINE MODEL

CONNECTORS

+$0,/721681'675$1' 

&+ CH92073-2 * &+   CH92074-2 CH92074-6 *     

 4952961    3038100-5 3038100-6     

$36 $38 

6,1*/(,1387'8$/287387

$% $/)5$$/)/ //$/&//))+ HTF7000

6,1*/(,13876,1*/(287387 6,1*/(,13876,1*/(287387

6,1*/(,1387'8$/287387

&+  &+ CH92043-2 CH92043-3 CH92051-3 CH92051-4 CH92083-5 CH92083-6 &+ &+ &+ &+ 

03 0303  3122413-07 3122413-08 30C1132-04 30C1132-05 30P0604-06 30P0604-07     

7)(&%73(&( 73()*73($%* 73($5*73(%6 7)(5'7)(%56 73(2873(73( TPE331-14A/14B &)06(5,(6&)6(5,(6&)6(5,(6 *(6(5,(6 -7'$%%'$ PW150 PW308C

SINGLE INPUT/DUAL OUTPUT

PW307A

SINGLE INPUT/DUAL OUTPUT 6,1*/(,1387'8$/287387    

CH92090-1 CH92090-2 CH92077 CH92095-3 * &+ CH92070-1

30C4946-02 30C4946-03 CH92077 CH92095-3  71294

3:$%%&(3:&'''( 37&&' 37$$*% $%%'3$ $37&&377%%(%) -3BG PW308A TRENT 900 TRENT 1000 )-$3$$$ FJ33

SINGLE INPUT/SINGLE OUTPUT SINGLE INPUT/SINGLE OUTPUT 6,1*/(,13876,1*/(287387 SINGLE INPUT/DUAL OUTPUT

+21(<:(// +21(<:(//  HONEYWELL +21(<:(//    +21(<:(// *(1(5$/(/(&75,&  35$77 :+,71(<&$1$'$ PRATT & WHITNEY CANADA PRATT & WHITNEY CANADA PRATT & WHITNEY CANADA

PRATT & WHITNEY CANADA ROLLS ROYCE ROLLS ROYCE :,//,$06,17¶/ WILLIAMS INTâ&#x20AC;&#x2122;L * indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application



















SINGLE INPUT/DUAL OUTPUT

6,1*/(,1387'8$/287387    6,1*/(,13876,1*/(287387 6,1*/(,13876,1*/(287387 SINGLE INPUT/DUAL OUTPUT

   SINGLE INPUT/DUAL OUTPUT SINGLE INPUT/DUAL OUTPUT

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style

(;&,7(56

35$77 :+,71(<&$1$'$  35$77 :+,71(<&$1$'$  




48

Product Support / Technical Services

864-843-1162

(;&,7(56

NOTES:

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

ÂŽ

864-843-1162

CT-496

CT-497

Igniter Lead Connector Wear Gauge

Igniter Lead Wear Gauge

Igniter lead connector wear gauge for ARP670 Type 2M ÂżWWLQJVFRPPRQWR373:*7&3OHDGVDQG others. Features a calibrated pin to measure connector wear. Opposite end sized to measure neoprene grommet expansion.

Igniter lead connector wear gauge for ARP670 Type 3M ÂżWWLQJVFRPPRQWR73(7)(OHDGVDQGRWKHUV Features a spring weighted pin for an accurate â&#x20AC;&#x153;pull testâ&#x20AC;? of connectors. Size:

15/16â&#x20AC;? (3.33 cm)

Carton Size:

Note:

1 oz. (311 g) 3-1/2â&#x20AC;? x 1-1/4â&#x20AC;? x 1-1/4â&#x20AC;? (8.89 x 3.18 x 3.18 cm)

CT-456A

Spark Plug/Igniter Viewer Permits close examination of fuel deposits over the entire length of the insulator nose revealing incomplete or uneven abrasive cleaning. Detects cracked or chipped insulators. Checks condition of electrode sparking surfaces and dramatizes the need for replacement of worn-out spark plugs. Size:

New

Replacement Bulb:

Many leads incorporate type 2M & 3M connectors at opposite ends. Both CT-496 & CT-497 gauges are recommended.

LICENSE ARRANGEMENT:&KDPSLRQVHUYLFHWRROVDUHGLVWULEXWHGXQGHUOLFHQVHE\,GHDO$YLDWLRQ,QF(-XDQLWD$YH0HVD$=

P/N: 2300-350-000

6(59,&(722/6 (48,30(17

Shipping Weight:

49


ÂŽ

50

Product Support / Technical Services

CT-494

CT-922

NO. 52243

Erosion Gauge

Crimping Tool

The CT-494 accurately determines wear on 10 of our most popular surface gap igniters. insuring maximum igniter life without exceeding safe wear limitations. For use with following igniters:

The CT-922 is a go/no go erosion gauge for the CF34 igniter part numbers CH31858-2 and CH31926. Drop Measurement: 0.190â&#x20AC;? (4.83 mm)

A special tool used to crimp turbine ignition lead contacts to the unshielded center wire.

Igniter Erosion Gauge

6(59,&(722/6 (48,30(17

864-843-1162

&+&+&+&+&+ &+&+&+)+()+( &+&+&+&+&+ &+DQG< Heavy duty protective sleeve included. Shipping Weight:

Shipping Weight:

CT-923

Erosion Gauge The CT-923 is a go/no go erosion gauge for the CFM56 igniter part numbers CH31900-6. Drop Measurement: 0.210â&#x20AC;? (5.334 mm)

1 oz. (28 g)

LICENSE ARRANGEMENT:&KDPSLRQVHUYLFHWRROVDUHGLVWULEXWHGXQGHUOLFHQVHE\,GHDO$YLDWLRQ,QF(-XDQLWD$YH0HVD$=

14.4 oz. (408 g)


Product Support / Technical Services

ÂŽ

864-843-1162

CT-498

CT-492

CT-5300

$VSHFLDOWRROGHVLJQHGVSHFLÂżFDOO\WRPHDVXUHWKHÂżULQJHQG erosion wear of Champion CFM56 series igniters. Calibrated to determine the extent of erosion of the undercut area of the steel not easily visible to the eye. The measuring tip is VKDSHGWRUHDFKLQWRWKHXQGHUFXWWUXHZHDUDUHD)RUXVH with Champion CH31806 and CH31900 igniters only.

$VSHFLDOWRROGHVLJQHGVSHFLÂżFDOO\WRPHDVXUHWKHHURVLRQ wear of Champion AA series igniters. Calibrated in color scale segments to determine the extent of erosion of the XQGHUFXWDUHDRIWKHVWHHOVKHOOQRWHDVLO\YLVLEOHWRWKHH\H 0HDVXULQJWLSVVKDSHGWRUHDFKLQWRWKHXQGHUFXWWUXHZHDU area. Instructions for use included in special plastic box.

8VHGWRPHDVXUHWKHDLUĂ&#x20AC;RZWKURXJKWKHLJQLWLRQOHDG DQGWRSUHYHQWDLUĂ&#x20AC;RZWKURXJKHLWKHUWKHLJQLWHURUH[FLWHU HQGWHUPLQDWLRQV,WDOVRPHDVXUHVGLHOHFWULFUHVLVWDQFH conductor path resistance and return path resistance. The XQLWPHDVXUHVOHDGVIRU&)&)03:3: V2500 and CF34. Please contact Champion Aerospace for a CT-5300 quote.

Igniter Erosion Gauge

Igniter Erosion Guage (Formerly CT-468)

Size: 6-1/4â&#x20AC;? x 4-1/4â&#x20AC;? x 1-1/2â&#x20AC;? (15.8 x 10.7 x 3.8 cm)

NOTE: The tool is not interchangeable with the CT492 which is similar.

Shipping Weight:

Ignition Lead Test Bench

10 oz. (238 g)

LICENSE ARRANGEMENT:&KDPSLRQVHUYLFHWRROVDUHGLVWULEXWHGXQGHUOLFHQVHE\,GHDO$YLDWLRQ,QF(-XDQLWD$YH0HVD$=

6(59,&(722/6 (48,30(17

Size: 6-1/4â&#x20AC;? x 4-1/4â&#x20AC;? x 1-1/2â&#x20AC;? (15.8 x 10.7 x 3.8 cm)

51


®

PART NUMBER CROSS-REFERENCE

52

Product Support / Technical Services

864-843-1162

PART NUMBER CROSS-REFERENCE CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

53057 53153 53158 53159 53214 53215 53221 53247 53270 53279 53282 53283 53302 305050 305012-2 305088-2 305115-1 50160-7 50160-20 50160-47 50160-48 50160-61 50221-12 50221-15 50221-16 50221-17 50221-18 50221-19 50221-21 50221-22 50221-24

3108407-01 22306817 23060815 23060816 2-303-766-02 2-303-767-02 50853 23060814 23060818 50852 2-303-025-02 2-303-079-02 3038915 2-303-026-02 3070378-2 179420-2 50846 369259-7 369259-20 369259-47 369259-48 369259-61 369876-12 369876-15 369876-16 369876-17 369876-18 369876-19 369876-21 369876-22 369876-24

50221-25 50221-28 50221-29 50221-31 50221-32 50221-33 50221-6 50221-7 50221-8 50221-9 50383-K 50383-L 53067-21 53067-38.5 53109-1 53109-2 53109-3 53133-5 53133-6 53133-7 53142-10 53142-11 53142-12 53142-13 53164-11 53164-3 53164-4 53179-1 53179-12 53179-6 53179-7

369876-25 369876-28 369876-29 369876-31 369876-32 369876-33 369876-6 369876-7 369876-8 369876-9 3035333 3910351-01 3107371-01 3107371-02 388076-1 388706-2 3888076-3 3105589-5 3105589-6 3105589-7 3071590-10 3071590-11 3071590-12 3071590-13 3070873-11 3070873-3 3070873-4 3876132-1 3876132-12 3876132-6 3876132-7

53179-8 53216-1 53217-1 53236-5 53267-3 53267-4 53280-1 53281-1 53300-1 53300-2 53317-3 53335-01 53331-2 53331-4 53338-1 53339-1 53348-3 53348-4 53359-15 53359-16 53359-18 53359-3 53359-6 53359-9 53367-01 53368-1 53402-02 53542-1 6800087 6860326 6860337

3876132-8 2-303-768-03 2-303-769-03 304269-5 179505-3 179505-4 2-303-742-03 2-303-743-03 3118347-01 3118347-02 9550166530 3117291-01 38888283-2 38888283-4 3105901-1 3105902-1 WB3888353-3 WB3888353-4 3888302-15 3888302-16 3888302-18 3888302-3 3888302-6 3888302-9 3120676-01 3888316-1 3011871 3038111-1 M677 3017452 3010880

6800948 6860319 N/A AA134S-1 AA138S-4B AA30S-9A AA33SD AA63SA AA72SA AGF2-6 CH31547C CH31615 CH31621A CH31641 CH31642 CH31967 CH31701A CH31706D CH31713 CH31723 CH31753A CH31767 CH31768 CH31769 CH31772A CH31801 CH31815 CH31815-1 CH31815-2 CH31824 CH31832

1337M46P01 ST-3477-18 31B3211-01 709525 9101M37P36 5007M32P2 424848 487238 487238 3014054 369949-3 369964-5 3070967-1 3001430-1 3001430-2 78214 3105547-1 9276M36P05 369964-6 369162 9392M95P05 3003119-1 3003119-2 305766-1 9387M23P01 3876131-1 3074541-1 3074541-3 3074541-4 3888210-1 23036808

CH31843 CH31858-1 CH31858-2 CH31876-6 CH31898-1 CH31900-6 CH31904-2 CH31905 CH31918-2 CH31921 CH31923-5 CH31925-5 CH31926 CH31929-3 CH31929-4 CH31930 CH31955-1 CH31956 CH31958-3 CH31964 CH31965 CH91967 CH34016 CH34016-1 CH34055 CH34095 &+ CH34135 CH34158 CH34168 CH34177

9101M37P71 4096T38P10 4096T38P10 57846 23062672 1374M13P11 9387M23P09 1305M52P09 3122415-03 305766-4 51J015 30C1356-05 4096T33P07 30C1356-03 30C1356-04 WB3888446-1 3056557-02 68032 30P0606-03 JS100A1 1374M13P11 78214 1-300-348-06 1-300-348-07 3035102 37B200275P102 &%6 2-300-821-01 4053T22P01 6877518 CBS112/4

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N. PMA by test and computation.

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

864-843-1162

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

CH34187-A CH34249 CH34269 CH34304 CH34313 CH34406 CH34419 CH34439 CH34452 CH34492 CH34511 CH34549 CH34553 CH34585 CH34593 CH34595 CH34627 CH34627-1 CH34630 CH34643-1 CH34659-3 (T5) CH34661 CH34668-1 (T5) CH34682 CH34706 CH34723 CH34730 CH34731 CH34736 CH34743 CH34745

6899084 3888096-1 23006266 23006267 3888002-2 3035882 5044T67P07 4053T22P06 A2-300-732-05 3888096-2 3900274 304634-2 3888096-3 3888096-4 9550166660 9550168770 3105893-5 3105893-5 N/A 3120953-01 3119400-01 4048T30P10 3117463-01 31B5168-01 3888002-5 3120880-01 WB3888401-1 3888267-7 L907030 L907031 9550175400

CH34758-2 CH34760-1 CH34761 CH34803 CH34804-3 CH34812-2 CH34817 CH34826-6 CH34829 CH34834 CH34848 CH34856 CH38013 CH53238-1 CH53351 CH53399-01 CH53399-04 CH53399-05 CH53399-06 CH53399-07 CH53399-08 CH53399-08 CH53399-09 CH53399-10 CH53440 CH53440-1 CH53442-2 CH53442-3 CH53442-4 CH53450 CH53456-2

3050627-03 CH34760-1 L907032 3888267-4 31J1552-01 67906 3055161-01 3038110-6 CH34829 4952382 4952647 4952846 160544-1 31B3615-02 23060813 3119829-01 3119832-01 3119835-01 3119836-01 3119833-01 3119834-01 3119834-01 3119832-02 3119835-02 1853M13P01 1853M13P04 3121147-01 3122957-01 3121144-02 3121914-01 3122414-04

CH53463 CH53483-5 CH53483-6 CH53483-7 CH53490 CH53515-1 CH53515-2 CH53515-3 CH53515-4 CH53515-5 CH53530 CH53536 CH53536-1 CH53538-4 CH53539-3 CH53539-4 CH53544-1 CH53551-1 CH53552-1 CH53552-2 CH53556 CH53557-1 CH53557-2 CH53564 CH53566-1 CH53566-3 CH53568-1 CH53568-2 CH53569-1 CH53569-2 CH53569-3

3123061-01 30C1133-03 30C2172-03 30C2172-04 3050604-01 4096T96P07 4096T96P08 4096T96P03 4096T96P04 4096T96P11 3056743-01 3056566-01 3056566-02 CH53538-4 4951693-3 4951693-4 30P0605-02 5OU683 9339M26P13 9339M26P14 1B7426 23054367 23054368 5U0072 1346M56P04 1346M56P07 500471-01 500472-01 9387M24P16 9387M24P17 9387M24P18

CH92007 CH92007-1 CH92015 CH92015-1 CH92028 CH92036 CH92043-2 CH92043-3 CH92051-2 CH92051-4 CH92070-1 CH92073-1 CH92073-2 CH92074-2 CH92074-6 CH92077 CH92083-3 CH92083-6 CH92083-4 CH92090-1 CH92090-2 CH92100 CH92100 CH92100 CH92106 CH92106-1 FHE111-3 FHE113-1 FHE146-7 FHE151 FHE151

56635 68145 3043937-03 3043937-04 3041996-01 3888058-7 3122413-07 3122413-08 30C1132-03 30C1132-05 71274 4952793 495296 3038100-5 3038100-6 CH92077 30P0604-04 30P0604-07 30P0604-05 30C4946-02 30C4946-03 9238M66P05 9238M66P07 9238M66P08 3043937-05 3043937-06 04026T27P01 01-300-197-03 A37C311124 424815 C424815

FHE159-6 FHE159-6 FHE164 FHE176A FHE19-6L FHE205B FHE246-4 (T3) FHE256-10A FHE256-10B FHE267-2A FS109-1A FS118-1A FS118-1A FS153-1 FS153-1 ** FS47-11 FS47-11 FS89-1 Y183-5 Y183-6 Y209-2 Y242-5 YA211-25 YB63-1 YW90

3888002-1 26519-1 ECR114-2 CR103 CR104-2 CBS116 3039828 4048T30P06 4048T30P07 CBS111-2 6847727 369949-1T 369949-1 369964-4 369964-4 75153R 75153 6805734 L912019 L912023 3105893-4 272143 L912018 6877518 L912017

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N

(T3) Pin Style

(T5) Button Style

PART NUMBER CROSS-REFERENCE

PART NUMBER CROSS-REFERENCE

53


PART NUMBER CROSS-REFERENCE

54

Product Support / Technical Services

864-843-1162

PART NUMBER CROSS-REFERENCE OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

50846 50852 50853 56635 57846 67906 68032 68145 71274 75153 78214 272143 369162 424815 424815 424848 487238 487238 709525 3010880 3011871 3014054 3017452 3035102 3035333 3035882 3038915 3039828 3900274 4952793 4952382

305115-1 53279 53221 CH92007 CH31876-6 CH34812-2 CH31956 CH92007-1 CH92070-1 FS47-11 CH31967 Y242-5 CH31723 FHE151 FHE151C AA33SD AA63SA AA72SA AA134S-1 6860337 53402-02 AGF2-6 6860326 CH34055 50383-K CH34406 53302 FHE246-4 CH34511 CH92073-1 CH34834

4952647 6847727 6877518 6877518 6899084 22306817 23006266 23006267 23036808 23054367 23054368 23060814 23060815 23060816 23060818 23062672 9550166530 9550166660 9550168770 9550175400 5007M32P2 3105893-5 N/A 5000471-01 5000472-01 6805734 1-300-197-03 1-300-348-06 1-300-348-07 1305M52P09 1337M46P01

CH34848 FS109-1A CH34168 YB63-1 CH34187-A 53153 CH34269 CH34304 CH31832 CH53557-1 CH53557-2 53247 53158 53159 53270 CH31898-1 53317-3 CH34593 CH34595 CH34745 AA30S-9A CH34627 CH34630 CH53568-1 CH53568-2 FS89-1 FHE113-10 CH34016 CH34016-1 CH31905 6800948

1346M56P04 1346M56P07 1374M13P11 160544-1 179420-2 179505-3 179505-4 1853M13P01 1853M13P04 1B7426 2-300-732-05 2-300-821-01 2-303-025-02 2-303-026-02 2-303-079-02 2-303-742-03 2-303-743-03 2-303-766-02 2-303-767-02 2-303-768-03 2-303-769-03 26519-1 3001430-1 3001430-2 3003119-1 3003119-2 3038100-5 3038100-6 3038110-6 3038111-1 3041996-01

CH53566-1 CH53566-3 CH31900-6 CH38013 305088-2 53267-3 53267-4 CH53440 CH53440-1 CH53556 CH34452A CH34135 53282 305050 53283 53280-1 53281-1 53214 53215 53216-1 53217-1 FHE159-6 CH31641 CH31642 CH31767 CH31768 CH92074-2 CH92074-6 CH34826-6 53542-1 CH92028

304269-5 3043937-03 3043937-04 3043937-05 3043937-06 304634-2 3050604-01 3050627-03 3055161-01 3056557-02 3056566-01 3056566-02 3056743-01 305766-1 305766-4 3070378-2 3070873-11 3070873-3 3070873-4 3070967-1 3071590-10 3071590-11 3071590-12 3071590-13 3074541-1 3074541-3 3074541-4 30C1132-03 30C1132-05 30C1133-03 30C1356-03

53236-5 CH92015 CH92015-1 CH92106 CH92106-1 CH34549 CH53490 CH34758-2 CH34817 CH31955-1 CH53536 CH53536-1 CH53530 CH31769 CH31921 305012-2 53164-11 53164-3 53164-4 CH31621A 53142-10 53142-11 53142-12 53142-13 CH31815 CH31815-1 CH31815-2 CH92051-2 CH92051-4 CH53483-5 CH31929-3

30C1356-04 30C1356-05 30C1356-05 30C2172-03 30C2172-04 30C4946-02 30C4946-03 30P0604-04 30P0604-05 30P0604-07 30P0605-02 30P0606-03 3105547-1 3105589-5 3105589-6 3105589-7 3105893-4 3105893-5 3105901-1 3105902-1 3107371-01 3107371-02 3108407-01 3117291-01 3117463-01 3118347-01 3118347-02 3119400-01 3119829-01 3119832-01 3119832-02

CH31929-4 CH31965 CH31929-5 CH53483-6 CH53483-7 CH92090-1 CH92090-2 CH92083-3 CH92083-4 CH92083-6 CH53544-1 CH31958-3 CH31701A 53133-5 53133-6 53133-7 Y209-2 CH34627-1 53338-1 53339-1 53067-21 53067-38.5 53057 53335-01 CH34668-1 53300-1 53300-2 CH34659-3 CH53399-01 CH53399-04 CH53399-09

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N

(T3) Pin Style

(T5) Button Style


Product Support / Technical Services

®

864-843-1162

OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

CHAMPION P/N

OEM P/N

CHAMPION P/N

OEM P/N

3119833-01 3119834-01 3119834-01 3119835-01 3119835-02 3119836-01 3120676-01 3120880-01 3120953-01 3121144-02 3121147-01 3121914-01 3122413-07 3122413-08 3122414-04 3122415-03 3122957-01 3123061-01 31B3615-02 31B5168-01 31J1552-01 369259-7 369259-20 369259-47 369259-48 369259-61 369876-12 369876-15 369876-16 369876-17 369876-18

CH53399-07 CH53399-08 CH53399-08 CH53399-05 CH53399-10 CH53399-06 53367-01 CH34723 CH34643-1 CH53442-4 CH53442-2 CH53450 CH92043-2 CH92043-3 CH53456-2 CH31918-2 CH53442-3 CH53463 CH53238-1 CH34682 CH34804-3 50160-7 50160-20 50160-47 50160-48 50160-61 50221-12 50221-15 50221-16 50221-17 50221-18

369876-19 369876-21 369876-22 369876-24 369876-25 369876-28 369876-29 369876-31 369876-32 369876-33 369876-6 369876-7 369876-8 369876-9 369949-1 369949-1T 369949-3 369964-4 369964-4 369964-5 369964-6 37B200275P102 37C311124 3876131-1 3876132-1 3876132-12 3876132-6 3876132-7 3876132-8 388076-1 388706-2

50221-19 50221-21 50221-22 50221-24 50221-25 50221-28 50221-29 50221-31 50221-32 50221-33 50221-6 50221-7 50221-8 50221-9 FS118-1A FS118-1A CH31547C FS153-1 FS153-1** CH31615 CH31713 CH34095 FHE146-7A CH31801 53179-1 53179-12 53179-6 53179-7 53179-8 53109-1 53109-2

3888002-1 3888002-2 3888002-5 3888058-7 3888076-3 3888096-1 3888096-2 3888096-3 3888096-4 3888210-1 3888267-4 3888267-7 3888302-15 3888302-16 3888302-18 3888302-3 3888302-6 3888302-9 3888316-1 38888283-2 38888283-4 3910351-01 4026T27P01 4048T30P06 4048T30P07 4048T30P10 4053T22P01 4053T22P06 4096T38P10 4096T38P10 4096T33P07

FHE159-6 CH34313 CH34706 CH92036 53109-3 CH34249 CH34492 CH34553 CH34585 CH31824 CH34803 CH34731 53359-15 53359-16 53359-18 53359-3 53359-6 53359-9 53368-1 53331-2 53331-4 50383-L FHE111-30 FHE256-10A FHE256-10B CH34661 CH34158 CH34439 CH31858-1 CH31858-2 CH31926

4096T96P03 4096T96P04 4096T96P07 4096T96P08 4096T96P11 4951693-3 4951693-4 4952846 495296 500471-01 500472-01 5044T67P07 51J015 5OU683 5U0072 75153R 78214 9101M37P36 9101M37P71 9238M66P05 9238M66P07 9238M66P08 9276M36P05 9339M26P13 9339M26P14 9387M23P01 9387M23P09 9387M24P16 9387M24P17 9387M24P18 9392M95P05

CH53515-3 CH53515-4 CH53515-1 CH53515-2 CH53515-5 CH53539-3 CH53539-4 CH34856 CH92073-2 CH53568-1 CH53568-2 CH34419 CH31923-5 CH53551-1 CH53564 FS47-11 CH31967 AA138S-4B CH31843 CH92100 CH92100 CH92100 CH31706D CH53552-1 CH53552-2 CH31772A CH31904-2 CH53569-1 CH53569-2 CH53569-3 CH31753A

CBS111-2 CBS112/4 &%6 CBS116 CH34760-1 CH34829 CH53538-4 CH92077 CR103 CR104-2 CR114-2 JS100A1 L907030 L907031 L907032 L912017 L912018 L912019 L912023 M677 WB3888353-3 WB3888353-4 WB3888401-1 WB3888446-1

FHE267-2A CH34177 &+ FHE205B CH34760-1 CH34829 CH53538-4 CH92077 FHE176A FHE19-6L FHE164E CH31964 CH34736 CH34743 CH34761 YW90 YA211-25 Y183-5 Y183-6 6800087 53348-3 53348-4 CH34730 CH31930

* indicates that FAA-PMA is pending

**gasket included

(E) indicates exicter available for application

(O) equivalent OEM P/N

(T3) Pin Style

(T5) Button Style

PART NUMBER CROSS-REFERENCE

PART NUMBER CROSS-REFERENCE

55


&+$03,21$(5263$&(352'8&76:$55$17< SPARK PLUGS, IGNITERS, OIL FILTERS, LEADS & EXCITERS &KDPSLRQ$HURVSDFH//& ³&KDPSLRQ´ ZDUUDQWVWKDWVSDUNSOXJVKDUQHVVHVRLO¿OWHUH[FLWHUVOHDGVDQGLJQLWHUV sold by it are, at the time of delivery, free from defects in material and workmanship, provided that no warranty is made with respect to: (a) (b) (c)   

any product that has been subject to negligence, accident or improper storage; any product that has been improperly installed or maintained; or any product that has been operated beyond normal or recommended UHSODFHPHQWLQWHUYDOVRUZHDUOLPLWV

Championâ&#x20AC;&#x2122;s obligation under this warranty is limited to the replacement of, or at Championâ&#x20AC;&#x2122;s option, the return of the purchase price of any product which is returned to Champion or its designated representative (at customerâ&#x20AC;&#x2122;s expense) within one (1) year from the date of purchase and which, upon inspection by Champion, is found by Champion to be GHIHFWLYHLQPDWHULDORUZRUNPDQVKLS&KDPSLRQVKDOOQRWEHUHVSRQVLEOHIRUWKHFRVWRIODERUUHPRYLQJDQ\GHIHFWLYH SURGXFWRULQVWDOOLQJDQ\UHSODFHPHQWSURGXFW 7+($)25(6$,' :$55$17< ,6 (;&/86,9($1' ,1 /,(8 2)$// 27+(5 :$55$17,(6 :+(7+(5 (;35(66(',03/,('2567$78725<,1&/8',1*%87127%<:$<2)/,0,7$7,21$1<:$55$17<2) 0(5&+$17$%,/,7<25),71(66)25$1<3$57,&8/$5385326( NOTE: All service tools and test equipment bearing the Champion logo are distributed by Kell-Strom Tool Company, ,QFXQGHUOLFHQVHIURP&KDPSLRQ$HURVSDFH//&DQGDUHVXEMHFWWRWKHWHUPVRIDVHSDUDWHZDUUDQW\SURYLGHGE\ .HOO6WURP7RRO&RPSDQ\,QF$OOFODLPVLQFRQQHFWLRQZLWKVXFKSURGXFWVVKRXOGEHUHIHUUHGWR.HOO6WURP7RRO &RPSDQ\,QF&KXUFK6WUHHW:HWKHUVÂżHOG&7 CHAMPION AEROSPACE LLC LIMITATION OF LIABILITY If Champion Aerospace LLC (â&#x20AC;&#x153;Championâ&#x20AC;?) breaches any of its obligations to Distributor in connection with the sale of any products to Distributor, whether the breach is one of the warranty or for any cause whatsoever, whether in contract or in tort including negligence, Champion may request the return of the products and tender to Distributor the purchase price theretofore paid by Distributor and, in such event, Champion shall have no further redelivery of the SURGXFWV,I&KDPSLRQVRUHTXHVWVWKHUHWXUQRIWKHSURGXFWV'LVWULEXWRUVKDOOUHGHOLYHUWKHSURGXFWVWR&KDPSLRQLQ DFFRUGDQFHZLWK&KDPSLRQÂśVLQVWUXFWLRQVDW&KDPSLRQÂśVH[SHQVH7+(5(0(',(63529,'('+(5(,1$1',1 &+$03,21Âś6:$55$17<6+$//&2167,787(7+(62/(5(&2856(2)',675,%8725$*$,167&+$03,21 )25%5($&+2)$1<2)&+$03,21Âś62%/,*$7,216,1&211(&7,21:,7+7+(6$/(2)$1<352'8&76 72',675,%8725:+(7+(57+(&/$,0,60$'(,1725725,1&2175$&7,1&/8',1*&/$,06%$6('21 :$55$17<1(*/,*(1&(675,&7/,$%,/,7<'(&(,7)5$8'0,65(35(6(17$7,212527+(5:,6( IN NO EVENT SHALL CHAMPION BE LIABLE FOR SPECIAL, INDIRECT, INCIDENTAL OR CONSEQUENTIAL '$0$*(6 5(*$5'/(662)7+()2502)$&7,21:+(7+(5,1&2175$&725,17257,1&/8',1* NEGLIGENCE) NOR LOST PROFITS, NOR SHALL CHAMPIONâ&#x20AC;&#x2122;S LIABILITY FOR ANY CLAIMS OR DAMAGE $5,6,1*2872)25&211(&7(':,7+7+(0$18)$&785(6$/('(/,9(5<2586(2)$1<352'8&76 (;&(('7+(385&+$6(35,&(2)7+(352'8&76 :DUUDQW\7HUPLQRORJ\ 7KHIROORZLQJVHUYHVDVDEDVLFH[SODQDWLRQRIVRPHRIWKHWHUPVXVHGLQWKH&KDPSLRQZDUUDQW\,QQRHYHQWGRHV WKHIROORZLQJDPHQGRUH[SDQG&KDPSLRQÂśVZDUUDQW\)XUWKHUPRUHSDUDJUDSKWKURXJKOLVWVVHYHUDOH[DPSOHV ZKLFKDUHLQQRZD\H[FOXVLYHWRDQ\RWKHUVFHQDULR

                  

'HIHFW LQ 0DWHULDO  'HIHFW LQ WKH PDWHULDOV XVHG LQ WKH SURGXFW  ([DPSOHV D GHIHFW LQ WKH PHWDO XVHG LQWKLVSURGXFW 'HIHFWLQ:RUNPDQVKLS'HIHFWLQWKHZRUNPDQVKLSLQYROYHGLQWKHGLUHFWPDQXIDFWXUHRIWKHSURGXFW 1HJOLJHQFH  $Q\ W\SH RI PLVKDQGOLQJ RU XQUHDVRQDEOH KDQGOLQJ RI WKH SURGXFW RU KDQGOLQJ RI WKH SURGXFWZKLFKUHVXOWVLQGDPDJH $FFLGHQW$QHYHQWEH\RQGWKHUHDVRQDEOHFRQWURORIWKHSHUVRQLQYROYHG ,PSURSHU 6WRUDJH 6WRUDJH LQ DQ\ HQYLURQPHQW RU ORFDWLRQ ZKLFK PD\ FDXVH GDPDJH  ([DPSOH VWRUDJHRIWKHSURGXFWRXWVLGHRIWKHSURWHFWLYHSRO\WXEHV ,PSURSHUO\ ,QVWDOOHG  ,QVWDOODWLRQ QRW LQ VWULFW DFFRUGDQFH ZLWK &KDPSLRQÂśV VSHFLILFDWLRQV  ([DPSOH WKH XVH RI SOLHUV LQVWHDG RI DQ DSSURYHG ZUHQFK WR WLJKWHQ WKH SURGXFW  ([DPSOH WKH LQVWDOODWLRQ RI WKHSURGXFWRIDQXQDSSURYHGDSSOLFDWLRQ ,PSURSHUO\ 0DLQWDLQHG  0DLQWHQDQFH QRW LQ VWULFW DFFRUGDQFH ZLWK &KDPSLRQÂśV VSHFLILFDWLRQV ([DPSOHWKHIDLOXUHWRLQVSHFWRUUHSODFHDWWKHVSHFLÂżHGRUSURSHUWLPH KRXUVRUF\FOHV  2SHUDWHG %H\RQG 1RUPDO RU 5HFRPPHQGHG 5HSODFHPHQW ,QWHUYDOV 2SHUDWLRQ EH\RQG QRUPDO UHSODFHPHQW OHYHOV  ([DPSOH  WKH FRQWLQXHG RSHUDWLRQ RI DQ LJQLWHU DW  F\FOHV LI LW UHTXLUHV E\ XVHRUVSHFLÂżFDWLRQUHSODFHPHQWDWF\FOHV 2SHUDWHG %H\RQG 1RUPDO RU 5HFRPPHQGHG :HDU /LPLWV  2SHUDWLRQ EH\RQG QRUPDO ZHDU RU UHFRPPHQGHG OLPLWV  ([DPSOH  WKH FRQWLQXHG RSHUDWLRQ RI DQ LJQLWHU  PP  LI E\ XVH RU VSHFLÂżFDWLRQLWKDVDPD[LPXPJURXQGHOHFWURGH VKHOO HURVLRQOLPLWRIPP LQ 

Any igniter that has been subjected to: Negligence Improper Maintenance Accident Operated Beyond Replacement Interval  ,PSURSHU6WRUDJH   2SHUDWHG%H\RQG:HDU/LPLWV FROOHFWLYHO\WKH³)DFWRUV´

Improper Installation   LV EH\RQG ZDUUDQW\ FRYHUDJH &KDPSLRQ LV LQ QR ZD\ UHVSRQVLEOH IRU DVFHUWDLQLQJ WKH SUHVHQFH of any of the above factors; instead, the party to whom Champion extends the warranty is responsible  WRLQVXUHWKDWWKHDERYHIDFWRUVGRQRWH[LVW ,IDQLJQLWHULVUHSODFHGGXULQJWURXEOHVKRRWLQJDQG&KDPSLRQÂżQGVWKHLJQLWHUWREHVHUYLFHDEOHSHUWKHDSSURYHG Component Maintenance Manual or Igniter Technical Notice and Champion notes no material or workmanship defect during the investigation, or notes or discovers the existence of one or more of the Factors, Champion will not allow ZDUUDQW\UHSODFHPHQWRUFUHGLW If Champion notes a material or workmanship defect at the warranty investigation and notes that no Factors exist, a UHSODFHPHQWRUFUHGLWZLOOEHLVVXHGLQDFFRUGDQFHZLWKWKH&KDPSLRQ$HURVSDFH//&:DUUDQW\6WDWHPHQW

For Technical Assistance Contact: Champion Aerospace LLC Product Support/Technical Services 1230 Old Norris Road Liberty, SC 29657 864-843-1162 (PDLOVXSSRUW#FKDPSDHURFRP


CHAMPION AEROSPACE LLC AVIATION CATALOG AV-14

REVISED JANUARY 2010

Spark Plugs Oil Filters Slick by Champion Exciters Leads Igniters


SECTION

Table of Contents PAGE

Spark Plugs............................................................................................................................................ 1 Product Features........................................................................................................................................ 1 Spark Plug Type Designation System.............................................................................................................. 2 Spark Plug Types and Specifications.............................................................................................................. 3 Spark Plug by Popular Aircraft and Engines................................................................................................. 4-12 Spark Plug Application by Engine Manufacturer..........................................................................................13-16 Other U. S. Aircraft and Piston Engines.....................................................................................................17-18 U. S. Helicopter and Piston Engines.........................................................................................................18-19 International Aircraft Using U. S. Piston Engines......................................................................................... 19-22 Slick by Champion............................................................................................................................... 23 Oil Filters.............................................................................................................................................. 29 Product Features...................................................................................................................................... 29 Full-Flow Spin-On Filters............................................................................................................................ 30 Typical Spin-On Filters............................................................................................................................... 31 Aircraft and Engine Applications.............................................................................................................. 32-34 Dimensional Data...................................................................................................................................... 34 Turbine Exciters................................................................................................................................... 35 Product Features...................................................................................................................................... 35 Aircraft Engine Applications........................................................................................................................ 36 Turbine Ignition Leads......................................................................................................................... 37 Product Features...................................................................................................................................... 37 Aircraft Engine Applications................................................................................................................... 38-41 Turbine Engine Applications (APU).......................................................................................................... 41-42 Turbine Igniters.................................................................................................................................... 43 Product Features...................................................................................................................................... 43 Design Features....................................................................................................................................... 43 Basic Igniter Types.................................................................................................................................... 44 Aircraft Engine Applications................................................................................................................... 45-48 Turbine Engine Applications (APU).......................................................................................................... 48-50 Turbine Engine Applications (GPU)............................................................................................................... 50 Service Tools & Equipment.................................................................................................................. 51 Index...................................................................................................................................................... 51 Special Tools and Equipment................................................................................................................. 52-56 Current/Discontinued Aviation Spark Plugs................................................................................................... 56 Champion Aerospace LLC Products Warranty................................................................................................ 57

TOC


Plated threads prevent seizing.

Two Layers of Corrosion Protection.

Spark Plugs

Product Design

REM37BY Silicon carbide resistor prevents wear from voltage drain for prolonged plug life. Fired glass seal provides positive retention of center wire and prevents gas leakage. Copper core assures efficient heat transfer and maximum electrical conductivity. Aluminum oxide insulator has excellent thermal properties to resist cracking. Plated threads prevent seizing. Nickel alloy electrodes provide excellent resistance to spark and heat erosion. Advanced-engineered Champion Aerospace spark plugs are designed for the critical difference in performance, far beyond the ordinary. Champion Aerospace spark plugs stand up to high temperatures, pressures, and lead deposits, with a performance second to none. When you’re up in the air, count on quality Champion spark plugs. The #1 Choice Worldwide - OEM for all U. S. Piston Engines. Champion spark plugs are a product of Champion’scommitment to quality and advanced technology, a commitment that has made Champion spark plugs the #1 choice of engine manufacturers, maintenance technicians and pilots around the world.

Choose Iridium “S” spark plugs for high-performance engines. Longer-lasting than platinum spark plugs, Iridium “S” plugs resist lead attack and provide better scavenging than standard platinum plug designs. For exceptional performance, even under the most demanding conditions.

®

1


®

Spark Plugs

Spark Plug Type Designation System

All Champion Aerospace spark plugs are identified by type designations as indicated on the following spark plug number and symbol chart. The symbol is composed of a rating position number, together with prefix and suffix numbers to indicate major plug design characteristics.

Typical Spark Plug Number with Symbol Explanation

R H B 37 E Resistor

Electrode Design

None - No Resistor R - Mil-Spec. Resistor Erosion Protection

None - Conventional Single E - Two Electrode Massive N - Four Electrode Massive S - Single Electrode (Iridium) B - Twin Electrodes(Nickel) R - Push-wire - 90° to Center Y - Projected Core Nose P - Two Electrode (Platinum) W - Two Electrode (Iridium)

Barrel Style

None - Unshielded E - Shielded 5/8” - 24 Thread H - Shielded 3/4” - 20 Thread (All-Weather Plug) V - M18X1 - Metric

Heat Rating Position

High Number - Hot (50) Low Number - Cold (26)

Mounting Thread Reach Hex Size B - M - J - L - U - N -

18 mm 13/16” (2.06 cm) 7/8” (2.22 cm) 18 mm 1/2” (1.27 cm) 7/8” (2.22 cm) 14 mm 3/8” (.095 cm) 13/16” (2.06 cm) 14 mm 1/2” (1.27 cm) 13/16” (2.06 cm) 18 mm 1-1/8” (2.85 cm) 7/8” (2.22 cm) 14 mm 3/4” (1.90 cm) 13/16” (2.06 cm)

Shielded Aviation Spark Plug

Shielded Aviation Spark Plugs are manufactured under military specification MIL-S-7886B.

2

Outside Gaskets

Champion Military Part No. Size Specification M-674 18 mm Solid Copper AN4027-1 N-673 14 mm Solid Copper AN4027-2


Spark Plugs

Types and Specifications

Fine Wire

.016”-.021”/0.41-0.53mm

Electrode

.016”-.021”/0.41-0.53mm

3/4” - 20

.016”-.021”/0.41-0.53mm

Two Prong

Single

Iridium

Fine Wire

.016”-.021”/0.41-0.53mm

3/4” - 20

Iridium

Two Prong

.016”-.021”/0.41-0.53mm

1.474 kg

RHB37E

.016”-.021”/0.41-0.53mm

Twin

13/16”/2.06cm 5/8” - 24

18mm

.016”-.021”/0.41-0.53mm

Single

REB32E

3 lbs. - 4 oz.

.016”-.021”/0.41-0.53mm

Two Prong

5/8” - 24

1/2”/1.27cm

Iridium

Two Prong

REB37E

1.503 kg

18mm

Electrode Fine Wire

5/8” - 24

1/2”/1.27cm

18mm

1.503 kg

3 lbs. - 5 oz. 3 lbs. - 5. oz.

RHM38S

13/16”/2.06cm 3/4” - 20

18mm

Iridium

.016”-.021”/0.41-0.53mm

Fine Wire

Single

Iridium

.016”-.021”/0.41-0.53mm

Fine Wire

3 lbs. - 6 oz.

RHB27S

.016”-.021”/0.41-0.53mm

Single

1.531 kg

RHB32S

13/16”/2.06cm 5/8” - 24

18mm

RHB36S

1.474 kg

Two Prong

3 lbs. - 4 oz.

REB36S

13/16”/2.06cm 3/4” - 20

18mm

3 lbs. - 6 oz. 1.531 kg

RHB32E RHB29E

14 mm

1/2”/1.27cm

1.276kg

PAINT CODE COLOR: All Standard Electrode - Silver

Fine Wire Two Prong Single

.016”-.021”/0.41-0.53mm

M18 x 1

.016”-.021”/0.41-0.53mm

Iridium

Finewire

.016”-.021”/0.41-0.53mm

2 lbs. - 13 oz.

1-1/8”/2.85cm 3/4” - 20

1.531 kg

18mm

3 lbs. - 6 oz.

Iridium

Single

RHU32E

1.531 kg

1-1/8”/2.85cm 3/4” - 20

18mm

3 lbs. - 6 oz.

RHU32S

1.474 kg

.016”-.021”/0.41-0.53mm

Single

5/8” - 24

1/2”/1.27cm

RHM38E

18mm

RHM40E

3 lbs. - 4 oz.

REM37BY

1.474 kg

.018”-.023”/0.46-0.58mm

Twin

None

1/2”/1.27cm

.018”-.023”/0.46-0.58mm

Single

5/8” - 24

1/2”/1.27cm

18mm

Push Wire

5/8” - 24

1/2”/1.27cm

18mm

3 lbs. - 4 oz.

REM38S

3 lbs. - 4 oz. 1.474 kg

5/8” - 24

REM38E

3/8”/0.95cm

3/4”/1.90cm

18mm

REM40E

RHU27E

2 lbs. - 6 oz. 1.077 kg

None

1.077 kg

1/2”/1.27cm

1/2”/1.27cm

14mm

2 lbs. - 6 oz.

M41E

1.276 kg

REN30S

RVL38S

14mm

2 lb. - 13 oz.

REL37B

14mm

1.276 kg

2 lb. - 13 oz.

REJ38

822kg

14mm

Shielding Standard Fine Wire Thread Electrode Electrode Plug Gap

1 lb. - 13 oz.

L34R

12 Pack Thread Shipping Wt. Size Reach

Plug Type

®

All Iridium “S” Electrode - Gold

3


Popular Aircraft and Engines

Plugs Massive Fine Wire Per Shielded U.S. Aircraft/Engine Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications

U.S. Aircraft/Engine Specifications

Spark Plugs

®

Plugs Massive Fine Wire Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24

AERONCA

Thrush S2R, S2D REM37BY 7BC REM37BY P&W R-1340 (600 hp) 18 RHM40E REM40E RHM38S REM38S Cont C85-12 (85 hp) 8 RHM40E REM40E RHM38S REM38S Thrush S2R-800 Wright R-1300 (800 hp) 14 RHB37E REB37E RHB36S REB36S 7CC REM37BY Cont C90-12F (95 hp) 8 RHM40E REM40E RHM38S REM38S Schweizer AG-Cat G164 15AC REM37BY Cont C145 (145 hp) 12 RHM40E REM40E RHM38S REM38S Cont W-670 (230 hp) Jacobs R755 (275 hp) 14 RHM40E REM40E RHM38S REM38S S15AC Schweizer Super Frank 6A4-165-B (165 hp) 12 REJ38 AG-Cat G164 A thru C 11AC Chief REM37BY P&W R-985 (450 hp) REM37BY Cont A-65-8 (65 hp) 8 RHM40E REM40E P&W R 1340 (600 hp) 18 RHM40E REM40E RHM38S REM38S REM37BY 11CC Super Chief REM40E Cont C85-12 (85 hp) 8 RHM40E REM40E RHM38S REM38S Weatherly 620 P&W R-985 (450 hp) 18 RHM40E REM37BY RHM38S REM38S AEROSPATIALE (Socata) REM37BY AMERICAN GENERAL TB9 Tampico RHM40E REM40E REM37BY AIRCRAFT CORP. Lyco O-320-D2A (160 hp) 8 RHM38E REM38E RHM38S REM38S AG5B RHM40E REM40E TB10 Tobago REM37BY Lyco O-360-A4K (180 hp) 8 RHM38E REM38E RHM38S REM38S Lyco O-360-A1AD RHM40E REM40E ARCTIC (180 hp) 8 RHM38E REM38E RHM38S REM38S Tern S1B2 REM40E TB20 Trinidad RHM40E REM40E Lyco O-320-A2B (150 hp) 8 RHM40E REM37BY RHM38S REM38S Lyco IO-540-C4D5D 12 RHM38E REM38E RHM38S REM38S BEECH (200 hp) D-17S REM37BY TB21 Trinidad TC RHB37E RHB36S P&W R-985-AN (450 hp) 18 RHM40E REM40E RHM38S REM38S Lyco TIO-540-ABIAD 12 RHB32E RHB32S D18S, E18S, G18S, H18S, (250 hp) AT11 REM37BY 2/P&W R-985-AN (450 hp) 18 RHM40E REM40E RHM38S REM38S TB30 Lyco AEIO-540-L1B5D 12 RHM38E REM38E RHM38S REM38S Bonanza E33 Cont IO-470-K (225 hp) 12 RHM40E REM40E RHM38S REM38S (300 hp) E33A, F33A, F33B, F33C RHB36S AG AIRCRAFT (Misc) Cont IO-520-B (285 hp) 12 RHB32E RHB32S AG Commander A-9 Bonanza A35, B35 Sparrow 12 RHM40E REM40E RHM38S REM38S Lyco O-540-B2B5 (235 hp) 12 RHM40E REM40E RHM38S REM38S Cont E-185 (185 hp) D35, E35, F35 C35, Air Tractor AT-301/ Cont E-185-11 (205 hp) 12 RHM40E REM40E RHM38S REM38S AT301A/AT401/AT501 RHM40E REM40E G35 P&W R-1340 (600 hp) 18 RHM40E REM37BY RHM38S REM38S Cont E-225-8 (225 hp) 12 RHM40E REM40E RHM38S REM38S Bull Thrush S2R-R1820 H35 RHM40E REM40E Wright R 1820 (1200 hp) 18 RHB37E REB37E RHB36S REB36S Cont O-470-G (240 hp) 12 RHM38E REM38E RHM38S REM38S Eagle 220 J35, K35, M35 RHM40E REM40E Cont W-670 (220 hp) 14 RHM40E REM40E RHM38S REM38S Cont IO-470-C (250 hp) 12 RHM38E REM38E RHM38S REM38S Eagle 300 N35, P35, G33 RHB36S Lyco IO-540-M1B5D RHB32E REB32E RHB32S Cont IO-470-N (260 hp) 12 RHB32E RHB32S (300 hp) 18 RHB37E REB37E RHB36S REB36S S-35, V-35, V35A, V35B RHB36S Pezetel PZLM-18A Cont IO-520-B (285 hp) 12 RHB32E RHB32S Dromader V35TC, V35A-TC, RHB36S PZL-ASZ-621R (1000 hp) 18 RHB37E REB37E RHB36S REB36S V35B-TC Pezetel M-21 Cont TSIO-520-D (285 hp) 12 RHB32E RHB32S Dromader Mini 36, A36 RHB36S PZL-3S (600 hp) 14 RHB37E REB37E RHB36S REB36S Cont IO-520-B (285 hp) 12 RHB32E RHB32S B36TC RHB36S Super A9 Quail 12 RHB32E RHB32S Lyco IO-540 (290 hp) 12 RHM38E REM38E RHM38S REM38S Cont TSIO-520-UB (300 hp) 36B, 550 RHB36S B1A Snipe REM37BY 12 RHB32E RHB32S P&W R985 (450 hp) 18 RHM40E REM40E RHM38S REM38S Cont IO-550-B (300 hp) Twin Bonanza B50 RHM40E REM40E B1A Snipe 12 RHM38E REM38E RHM38S REM38S Lyco IO-720 (400 hp) 16 RHM38E REM38E RHM38S REM38S 2/Lyco GO-435-C (260 hp) C50 RHM40E REM40E S2A 12 RHM38E REM38E RHM38S REM38S Cont W-670 (220 hp) 14 RHM40E REM40E RHM38S REM38S 2/Lyco GO-480-F (275 hp) D50, D50A S2B, S2C, 600-S2C 1/2” Rch. Cyl. 2/Lyco P&W R985 (450 hp) REM37BY GO-480-C, G (295 hp) 12 RHM38E REM38E RHM38S REM38S R-1340 (600 hp) 18 RHM40E REM40E RHM38S REM38S D50, D50A 13/16” Rch. Cyl. 2/Lyco GO-480-G (295 hp) 12 RHB37E RHB36S Most generally used plugs shown in red type. For Unshielded Spark Plugs - see pgs. 13-16. Plug Listings taken from FAA Approved Data. Please consult your aviation distributor for availability on these items.

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs. 4

C


s.

Spark Plugs

Popular Aircraft and Engines

®

Plugs Massive Fine Wire Plugs Massive Fine Wire Per Shielded U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Musketeer A23, 23 BEECH (Cont’d) E50, F50 Custom III A23A RHM40E 1/2” Rch. Cyl. Cont IO-346-A (165 hp) 8 RHM38E RHM38S 2/Lyco GSO-480-A, -B 24 Super III, A24, A24R, (340 hp) 12 RHM38E REM38E RHM38S REM38S B24R, C-24R Sierra E50, F50 Lyco IO-360 (200 hp) 8 RHM38E REM38E RHM38S REM38S 13/16” Rch. Cyl. Duchess 76 2/Lyco GSO-480-A, -B 2/Lyco. IO-360-E1A6D & RHM40E REM40E (340 hp) 12 RHB37E RHB36S O-360-E1A6D (180 hp) 8 RHM38E REM38E RHM38S REM38S G50, H50, J50 Skipper 77 REM37BY 1/2” Rch. Cyl. Lyco RHM40E REM40E O-235-L2C 2/Lyco IGSO-480-A (340 hp) 12 RHM38E REM38E RHM38S REM38S (115 hp) 8 RHM38E REM38E RHM38S REM38S G50, H50, J50 3/16” Rch. Cyl. RHB37E RHB36S BELL 2/Lyco IGSO-480-A (340 hp) 12 RHB32E RHB32S Utility 47G, 47H, 47H-1 Travel Air 95, B95 RHM40E REM40E Frank 6V4-200 (200 hp) 12 REL37B 2/Lyco O-360-A (180 hp) 8 RHM38E REM38E RHM38S REM38S 47G-2, 47G-2A, 47G-5, Travel Air B95A, D95A, 47J, 47K E95 RHM40E REM40E 1/2” Rch. Cyl. RHM40E REM40E 2/Lyco IO-360-B (180 hp) 8 RHM38E REM38E RHM38S REM38S Lyco VO-435 (260 hp) 12 RHM38E REM38E RHM38S REM38S Debonair B33, A33 Cont IO-470-J (225 hp) 12 RHM40E REM40E RHM38S REM38S 47G-2, 47G-2A, 47G-5, 47J, 47K Debonair B33, C33, D33, 13/16” Rch. Cyl. E33B 12 RHB37E RHB36S Cont IO-470-K (225 hp) 12 RHM40E REM40E RHM38S REM38S Lyco VO-435 (260 hp) Ranger 47J-2, 47J-2A Debonair C33A, E33A, E33C RHB36S Lyco VO-540-B (305 hp) 12 RHM38E REM38E RHM38S REM38S Cont IO-520-B (285 hp) 12 RHB32E RHB32S Bellarus 47H, 47H-1 Baron 55, A55, B55, B55B RHB36S Frank 6V4-200-C32 2/Cont IO-470-L (260 hp) 12 RHB32E RHB32S (200 hp) 12 REL37B Baron 55, A55, B55, E55 RHB36S Utility 47G-3B 2/Cont IO-520-C (285 hp) 12 RHB32E RHB32S 1/2” Rch. Cyl. Baron 56TC Lyco TVO-435-A (260 hp) 12 RHM38E REM38E RHM38S REM38S 2/Lyco TIO-541-E1B4 RHB37E RHB36S Utility 47G-3B (380 hp) 12 RHB32E RHB32S 13/16” Rch. Cyl. RHB37E RHB36S Baron 58, 58A Lyco TVO-435-A (260 hp) 12 RHB32E RHB32S 2/Cont IO-520-C, -CB RHB36S Utility 47G-3B1, -3B2 (285 hp) 12 RHB32E RHB32S Lyco TVO-435-B, -C RHB37E RHB36S Baron 58P, 58TC (270/280 hp) 12 RHB32E RHB32S 2/Cont TSIO-520-L, -WB RHB36S 12 RHB32E RHB32S (310/325 hp) Utility 47G-3 RHB37E Baron 58C RHB36S Frank 6VS-335 (225 hp) 12 RHB32E REB37E RHB36S REB36S 2/Cont IO-550C (300 hp) 12 RHB32E RHB32S Utility 47G-4, 47G-4A Duke 60, A60, B60 Lyco VO-540-B1B (305 hp) 12 RHM38E REM38E RHM38S REM38S 2/Lyco TIO-541-E1A4 RHB37E RHB36S Utility 47G-5, 47G-5A (380 hp) 12 RHB32E RHB32S 13/16” Rch. Cyl. Queen Air 65, 70 Lyco VO-435-B1A (265 hp) 12 RHB37E RHB36S 1/2” Rch. Cyl. BELLANCA 2/Lyco IGSO-480-A (340 hp) 12 RHM38E REM38E RHM38S 14-13 Series Queen Air 65, 70 Frank 6A4-A150 (150 hp) 13/16” Rch. Cyl. RHB37E RHB36S 2/Lyco IGSO-480-A (340 hp) 12 RHB32E RHB32S Frank 6A4-165 (165 hp) 12 REJ38 Queen Air 80, 88, B80 RHB37E RHB36S 14-19 2/Lyco IGSO-540-A (380 hp) 12 RHB32E RHB32S Lyco O-435-A (190 hp) 12 RHM40E REM40E RHM38S REM38S Musketeer, Sport III, 14-19-3, 3A, 260B RHB36S B19 Sport REM37BY Cont IO-470-F (260 hp) 12 RHB32E RHB32S Lyco O-320-A, -E (150 hp) 8 RHM40E REM40E RHM38S REM38S 17-30, 17-30A RHB36S Musketeer 23 REM37BY Cont IO-520-D, -K (300 hp) 12 RHB32E RHB32S Lyco O-320-D2B (160 hp) 8 RHM40E REM40E RHM38S REM38S 17-31, 17-31A RHB37E RHB36S Musketeer A23-19A REM37BY Lyco IO-540-G, K Series RHB32E REM38E RHM32S C23 Sundowner RHM40E REM40E 12 RHM38E RHM38S REM38S Lyco O-360-A (180 hp) 8 RHM38E REM38E RHM38S REM38S (290/300 hp) U.S. Aircraft/Engine Specifications

Most generally used plugs shown in red type. For Unshielded Spark Plugs - see pgs. 13-16. Plug Listings taken from FAA Approved Data. Please consult your aviation distributor for availability on these items.

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

5


Plugs Massive Fine Wire U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications BELLANCA (Cont’d) 17-31TC, 17-31ATC Lyco IO-540-G Series, K1E5 RHB37E RHB36S (290/300 hp) 12 RHB32E RHB32S 17-31TC RHB37E RHB36S Lyco IO-540-K (300 hp) 12 RHB32E RHB32S BELLANCA (Champion) REM37BY 7AC-S7AC 8 RHM40E REM40E REM38S Cont A65-8 (65 hp) 7DC, S7DC REM37BY Cont C-85-8 (85 hp) 8 RHM40E REM40E REM38S S7CCM, 7EC, S7EC, 7FC, REM37BY 7JC Cont C-90-12 (90 hp) 8 RHM40E REM40E RHM38S REM38S 7GC, 7HC Lyco O-290-D (135 hp) 8 RHM40E REM40E RHM38S REM38S 7GCA, 7GCB, 7GCBA, 7GCAA, 7GCBC, 7KC REM37BY Lyco O-320-A (150 hp) 8 RHM40E REM40E RHM38S REM38S 7ACA 4 RHB32E RHB36S Frank 2A-120-B (50 hp) 7ECA REM37BY Lyco O-235 (108 hp) Cont O-200-A (100 hp) 8 RHM40E REM40E RHM38S REM38S REM37BY 7ECA Lyco O-235-K (118 hp) 8 RHM38E REM38E RHM38S REM38S 7KCAB REM37BY Lyco IO-320-E (150 hp) AEIO-320-E (150 hp) 8 RHM40E REM40E RHM38S REM38S 8KCAB Lyco IO-320-E (150 hp) REM37BY 8 RHM40E REM40E RHM38S REM38S AEIO-320-E (150 hp) REM37BY 8GCBC Super Scout RHM40E REM40E Lyco O-360-C Series 8 RHM38E REM38E RHM38S REM38S (180 hp) 8KCAB RHM40E REM40E Lyco AEIO-360-H1A (180 hp) 8 RHM38E REM38E RHM38S REM38S

BRANTLY

B2 Lyco VO-360 (180 hp) RHM40E REM40E IVO-360 (180 hp) 8 RHM38E REM38E RHM38S REM38S B2B IVO-360A (180 hp) 8 RHB37E RHB36S 305 Lyco IVO-540-A1A (305 hp) 12 RHB37E RHB36S

CALL-AIR

A, A-2, A-4 Lyco O-235 (115 hp) Lyco O-290 (140 hp) 8 RHM40E A-5 Lyco O-320-A (150 hp) 8 RHM40E A-6 RHM40E Lyco O-360-A (180 hp) 8 RHM38E A-7, A7T Cont W-670 (240 hp) 14 RHM40E

Popular Aircraft and Engines

Spark Plugs

®

REM40E RHM38S REM38S REM37BY REM40E RHM38S REM38S REM37BY REM40E REM38E RHM38S REM38S REM40E RHM38S REM38S

U.S. Aircraft/Engine Specifications

Plugs Massive Fine Wire Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24

CESSNA 120, 140 Cont C-85 (85 hp) REM37BY Cont C-90 (95 hp) 8 RHM40E REM40E RHM38S REM38S 150, A thru M REM37BY Cont O-200A (100 hp) 8 RHM40E REM40E RHM38S REM38S 152, F152 REM37BY Lyco O-235-L2C, N2C RHM40E REM40E (110 hp) 8 RHM38E REM38E RHM38S REM38S 162 REM37BY TCM 0-200-D 8 RHM40E REM40E RHM38S REM38S 170, 170A, B Cont C-145 (145 hp) REM37BY O-300 (145 hp) 12 RHM40E REM40E RHM38S REM38S 172, A-H, Skyhawk REM37BY Cont O-300 (145 hp) 12 RHM40E REM40E RHM38S REM38S 172 I-M Skyhawk REM37BY Lyco O-320-E (150 hp) 8 RHM40E REM40E RHM38S REM38S 172N, F172N REM37BY Skyhawk/100 RHM40E REM40E Lyco O-320-H2AD (160 hp) 8 RHM38E REM38E RHM38S REM38S 172P Skyhawk REM37BY Lyco O-320-D2J RHM40E REM40E (160 hp) 8 RHM38E REM38E RHM38S REM38S P172, Powermatic RHM40E REM40E Cont GO-300-E (175 hp) 12 RHM38E REM38E RHM38S REM38S R172K, FR172K Hawk XP Cont IO-360-K (195 hp) 12 RHM38E REM38E RHM38S REM38S R172R & S Lyco IO-360-L2A RHM38E REM38E (160/180 hp) 8 RHM40E REM40E RHM38S REM38S 172RG Cutlass RG REM37BY Lyco O-360-F1A6 RHM40E REM40E (180 hp) 8 RHM38E REM38E RHM38S REM38S 172G Cutlass II REM37BY Lyco O-360-A4H RHM40E REM40E (180 hp) 8 RHM38E REM38E RHM38S REM38S 175A, B, C, Skylark REM37BY Cont GO-300-A thru E RHM40E REM40E (175 hp) 12 RHM38E REM38E RHM38S REM38S 175 Frank 6A-335-B (180 hp) 12 RHB32E RHB36S 177, Cardinal REM37BY Lyco O-320-E (150 hp) 8 RHM40E REM40E RHM38S REM38S 177A, 177B, Cardinal REM37BY Lyco O-360-A1F6D RHM40E REM40E (180 hp) 8 RHM38E REM38E RHM38S REM38S Cardinal RG Lyco IO-360-A1B6D (200 hp) 8 RHM38E REM38E RHM38S REM38S 180 Cont O-470-A, -J (225 hp) 12 RHM40E REM40E RHM38S REM38S 180A thru D Cont O-470-K, -L (230 hp) 12 RHM40E REM40E RHM38S REM38S 180E, F, G, H, J Cont O-470-R, -S (230 hp) 12 RHM40E REM40E RHM38S REM38S 180K RHB36S Cont O-470-U (230 hp) 12 RHB32E RHB32S

Most generally used plugs shown in red type. For Unshielded Spark Plugs - see pgs. 13-16. Plug Listings taken from FAA Approved Data. Please consult your aviation distributor for availability on these items.

6

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

C


s.

Spark Plugs

Popular Aircraft and Engines

Plugs Massive Fine Wire U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications CESSNA (Cont’d) 182A thru D, Skylane Cont O-470-L (230 hp) 12 RHM40E REM40E RHM38S REM38S 182E thru P, Skylane Cont O-470-R, -S (230 hp) 12 RHM40E REM40E RHM38S REM38S 182Q, R, F182Q, R, Skylane RHB36S Cont O-470-U (230 hp) 12 RHB32E RHB32S R182, FR182 Skylane RG RHM40E REM40E Lyco O-540-J3C5D (235 hp) 12 RHM38E REM38E RHM38S REM38S RHB37E RHB36S T182 Turbo Skylane Lyco O-540-L3C5D (235 hp) 12 RHB32E RHB32S C-182 IO-540-AB1A5 (230 hp) 12 RHM38E REM38E RHM38S REM38S T-182 RHB37E RHB36S TIO-540-AJ1A 12 RHB32E RHB32S TR182, FTR182-Turbo Skylane RG RHB37E RHB36S Lyco O-540-L3C5D (235 hp) 12 RHB32E RHB32S 185, A thru E Skywagon RHB36S 12 RHB32E RHB32S Cont IO-470-F (260 hp) 185F, A185E/F Skywagon & AG Carry (All) RHB36S 12 RHB32E RHB32S Cont IO-520-D (300 hp) 188 Agwagon Cont O-470-R (230 hp) 12 RHM40E REM40E RHM38S REM38S 188 Agpickup Cont O-470-S (230 hp) 12 RHM40E REM40E RHM38S REM38S 188, A188B Agwagon RHB36S Cont IO-520-D (300 hp) 12 RHB32E RHB32S 188 Agtruck RHB36S Cont IO-520-D (300 hp) 12 RHB32E RHB32S T188C Aghusky RHB36S 12 RHB32E RHB32S Cont TSIO-520-T (310 hp) 190 Cont W-670 (240 hp) 14 RHM40E REM40E RHM38S REM38S 195 Jacobs R-755 (245/275/300 hp) 14 RHM40E REM40E RHM38S REM38S 205, 205A RHB36S Cont IO-470-S (260 hp) 12 RHB32E RHB32S C-206-H IO-540-AC1A5 (300 hp) 12 RHB37E RHB36S T-206-H RHB32E RHB32S TIO-540-AJ1A (310 hp) 12 RHB37E RHB36S P206 Super Skylane RHB36S Cont IO-520-A (285 hp) 12 RHB32E RHB32S RHB36S TP206 Super Skylane Cont TSIO-520-C (285 hp) 12 RHB32E RHB32S U206 Super Skywagon U206D RHB36S Cont IO-520-A (285 hp) Cont IO-520-F (300 hp) 12 RHB32E RHB32S U206E, U206G Stationair, U206F RHB36S Cont IO-520-F (300 hp) 12 RHB32E RHB32S TU206 Super Skywagon RHB36S Cont TSIO-520-C (285 hp) 12 RHB32E RHB32S TU206E, TU206G, TU206F G Stationair Cont TSIO-520-C, M RHB36S (285/310 hp) 12 RHB32E RHB32S

®

Plugs Massive Fine Wire U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications 207, A Cont IO-520-F (300 hp) 12 RHB32E RHB32S T207, A Cont TSIO-520-G, -M RHB36S (285 hp) 12 RHB32E RHB32S 210, 210A, 210B, 210C RHB36S Cont IO-470-E, -S (260 hp) 12 RHB32E RHB32S 210 Centurion, 210K, L, M, N, R Cont IO-520-A, -J, -L RHB36S (285/300 hp) 12 RHB32E RHB32S T210 Centurion, T210K, L, M, N Cont TSIO-520-C, -H, -R RHB36S (285 hp) 12 RHB32E RHB32S P210N, Pressurized Centurion Cont TSIO-520-P, PA, AF, CE RHB36S (310 hp) 12 RHB32E RHB32S T303, Crusader 2/Cont TSIO-520-AE & RHB36S LTSIO-520-AE (250 hp) 12 RHB32E RHB32S 310 2/Cont O-470-B (240 hp) 12 RHM40E REM40E RHM38S REM38S 310A 2/Cont O-470-M (240 hp) 12 RHM40E REM40E RHM38S 310C, D, F thru M, P, Q 2/Cont IO-470-D, -U, -V, -VO RHB36S (260 hp) 12 RHB32E RHB32S 310R RHB36S 2/Cont IO-520-M (285 hp) 12 RHB32E RHB32S T310P, T310Q, T310R RHB36S 2/Cont TSIO-520-B (285 hp) 12 RHB32E RHB32S 320A, B, C, Skynight 2/Cont TSIO-470-B, -C, -D RHB36S (260 hp) 12 RHB32E RHB32S 320D, E, F, Executive Skynight RHB36S 2/Cont TSIO-520-B (285 hp) 12 RHB32E RHB32S 335 2/Cont TSIO-520-EB RHB36S (300 hp) 12 RHB32E RHB32S 336, 337 Skymaster 2/Cont IO-360-G (210 hp) 12 RHM38E RHM38S 337 Super Skymaster 2/Cont TSIO-360 (210 hp) 12 RHM38E RHM38S P337G/H Pressurized Skymaster 2/Cont TSIO-360-C (225 hp) 12 RHM38E RHM38S T337H Turbo Skymaster 2/Cont TSIO-360-H (210 hp) 12 RHM38E RHM38S 340 RHB36S 2/Cont TSIO-520-K (285 hp) 12 RHB32E RHB32S 340A RHB36S 2/Cont TSIO-520-N (310 hp) 12 RHB32E RHB32S 350 Corvalis TCM 10-550-N 12 RHB32E RHB32S 400 Corvalis TT TCM TS10-550-C 12 RHB32E RHB32S

Most generally used plugs shown in red type. For Unshielded Spark Plugs - see pgs. 13-16. Plug Listings taken from FAA Approved Data. Please consult your aviation distributor for availability on these items.

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs. 7


Popular Aircraft and Engines

Spark Plugs

®

Plugs Plugs Massive Massive Fine Wire Plugs Massive Fine Wire U.S. Aircraft/Engine Aircraft/Engine Per Per Shielded U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 Eng. 3/4”-20 5/8”-24 5/8”-24 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications Specifications CESSNA (Cont’d) GRUMMAN (Cont’d) 401, 402A, B RHB36S Widgeon G44 2/Ranger 6-440-C5 (200 hp) 12 RHM40E REM40E RHM38S REM38S 2/Cont TSIO-520-E 12 RHB32E RHB32S Modified G44 RHB36S 402C 2/Cont IO-470-M (260 hp) 12 RHB32E RHB32S 2/Cont TSIO-520-VB RHB36S Modified G44 RHM40E REM40E (325 hp) 12 RHB32E RHB32S 2/Lyco GO-480-B (270 hp) 12 RHM38E REM38E RHM38S REM38S 404 Titan Mallard G-73 REM37BY 2/Cont GTSIO-520-M RHB36S 2/P & W R-1340 (600 hp) 18 RHM40E REM40E RHM38S REM38S (375 hp) 12 RHB32E RHB32S 411, 411A Avenger TBM 2/Cont GTSIO-520-C RHB36S Wright R-2600 (1900 hp) 28 RHB37E REB37E RHB36S REB36S (340 hp) 12 RHB32E RHB32S GULFSTREAM 414, 414A AMERICAN 2/Cont TSIO-520-J, -N RHB36S AA-1 Yankee REM37BY (310 hp) 12 RHB32E RHB32S Lyco O-235 (108 hp) 8 RHM40E REM40E RHM38S REM38S 421A, B, C AA-1A, AA-1B Trainer REM37BY 2/Cont GTSIO-520-D, -H, -L RHB36S -N (375 hp) 12 RHB32E RHB32S Lyco O-235 (108 hp) 8 RHM40E REM40E RHM38S REM38S AA-1B, TR2 REM37BY CHAMPION (See Bellanca) Lyco O-235 (108 hp) 8 RHM40E REM40E RHM38S REM38S CHRISTEN REM37BY S-1T Pitts Special REM38E Lyco AEIO-360-A1E AA1C Lynx, T-Cat RHM40E REM40E 8 RHM38E REM37BY RHM38S REM38S (200 hp) Lyco O-235-L (115 hp) 8 RHM38E REM38E RHM38S REM38S S-2B, S-2S Pitts Special AA-5 Traveler REM37BY Lyco AEIO-540-D4A5 RHM40E REM40E Lyco O-320-E (150 hp) 8 RHM40E REM40E RHM38S REM38S 12 RHM38E REM38E RHM38S REM38S (260 hp) AA5A Cheetah REM37BY Cirrus Lyco O-320-E (150 hp) 8 RHM40E REM40E RHM38S REM38S SRV, SR20 AA-5B Tiger REM37BY Cont. IO360-ES (200 hp) 8 RHM38E REM38E RHM38S REM38S Lyco O-360-A4K RHM40E REM40E SR22 RHB36S (180 hp) 8 RHM38E REM38E RHM38S REM38S Cont. IO550-N (310 hp) 12 RHB32E RHB32S Cougar REM37BY COLUMBIA/LANCAIR RHB32S Columbia 300, 350 12 RHB32E 2/Lyco O-320-D RHM40E REM40E Cont IO550N (310 hp) RHB36S (160 hp) 8 RHM38E REM38E RHM38S REM38S Columbia 400 RHB32S COMMANDER RHB36S Cont TSIO550 (310 hp) 12 RHB32E Commander 200D COMMANDER Cont IO-520-A (285 hp) 12 RHB32E RHB32S AIRCRAFT COMPANY 500 RHM40E REM40E Commander 114B RHM40E REM40E Lyco IO-540-T4B5 (260 hp) 12 RHM38E REM38E RHM38S REM38S 2/Lyco O-540-A (250 hp) 12 RHM38E REM38E RHM38S REM38S Commander 114TCL 500A TSIOL-550B 12 RHU32E RHU32S 2/Cont IO-470-M (260 hp) 12 RHB32E RHB32S DIAMOND 500B, 500U, 500S Eclipse Evolution 2/Lyco IO-540-B, -E DA 20-1C 12 RHM38E REM38E RHM38S REM38S Cont. IO240B3B (125 hp) 8 RHM38E REM38E RHM38S REM38S 1/2” Rch. Cyl. (290 hp) DA 40-180 REM37BY 500U 8 Lyco IO360-MIA REM40E RHM38S REM38S 2/Lyco IO-540-E1B5 RHB37E REB37E RHB36S (180 hp) RHM38E REM38E 13/16” Rch. Cyl. (290 hp) 12 RHB32E REB32E RHB32S REB36S ENSTROM 520 RHM40E REM40E F28, F28A, 280 2/Lyco 12 RHM38E REM38E RHM38S REM38S GO-435-C (260 hp) Lyco HIO-360-C (205 hp) 8 RHM38E REM38E RHM38S REM38S BY560 F28B RHM40E REM40E Lyco TIO-360-B2A (200 hp) 8 RHB37E REB37E RHB36S REB36S 2/Lyco GO-480-B (270 hp) F28C, 280C GO-480-D (275 hp) 12 RHM38E REM38E RHM38S REM38S Lyco HIO-360-E1AD 560A, E (205 hp) 8 RHB32E RHB32S 1/2” Rch. Cyl. F28E, F28F Lyco IO-360-F1AD (225 hp) 8 RHB32E RHB32S 2/Lyco GO-480-C, -G (295 hp) 12 RHM38E REM38E RHM38S REM38S ERCOUPE 560A, E Club-Air 415-C REM37BY Cont C-75 (75 hp) 8 RHM40E REM40E 13/16” Rch. Cyl. Club-Air 415E, F, G, H REM37BY 2/Lyco GO-480-G (295 hp) 12 RHB37E RHB36S Cont C-85 (85 hp) 8 RHM40E REM40E 560F GRUMMAN 1/2” Rch. Cyl. Goose 21 12 RHM38E RHM36S 2/P & W R-985 (450 hp) 18 RHM40E REM40E RHM38S REM38S 2/Lyco IGO-540 (350 hp) Most generally used plugs shown in red type. For Unshielded Spark Plugs - see pgs. 13-16. Plug Listings taken from FAA Approved Data. Please consult your aviation distributor for availability on these items.

8 Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

C


s.

Spark Plugs

Popular Aircraft and Engines

Courier Lyco GO-435-C (260 hp) 12 Super Courier 1/2” Rch. Cyl. Lyco GO-480-G (295 hp) 12 Strato Courier 1/2” Rch. Cyl. Lyco GSO-480-A (340 hp) 12 Strato Courier 13/16” Rch. Cyl. Lyco GSO-480-A (340 hp) 12 Caballero Lyco O-540-A (250 hp) 12 Helio 700 Lyco TIO-540-J2BD (350 hp) 12 Helio 800 Lyco IO-720-A1B (400 hp) (Long Reach) 16 Helio 800 Lyco IO-720-A1B (400 hp) (Short Reach) 16 Helio Twin 2/Lyco O-540-A (250 hp) 12 Twin Courier 2/Lyco O-540-A (250 hp) 12

HILLER

UH-12B Frank 6V4-200 (200 hp) UH-12C Frank 6V-335 (210 hp)

RHM40E RHM38E RHM38E RHM38E

Plugs Massive Fine Wire U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications COMMANDER (Cont’d) 560F 13/16” Rch. Cyl. 2/Lyco IGO-540 (350 hp) 12 RHB37E RHB36S 680, 680E 1/2” Rch. Cyl. 12 RHM38E REM38E RHM38S REM38S 2/Lyco GSO-480-A (340 hp) 680, 680E 13/16” Rch. Cyl. 12 RHB37E RHB36S 2/Lyco GSO-480-A (340 hp) 680F, 680FP, 680FL, 680FLP 1/2” Rch. Cyl. 2/Lyco IGSO-540-B (380 hp) 12 RHM38E RHM38S 680F, 680FP, 680FL, 680FLP 13/16” Rch. Cyl. 2/Lyco RHB37E RHB36S IGSO-540-B (380 hp) 12 RHB32E RHB32S 112, 112A 8 RHM38E REM38E RHM38S REM38S Lyco IO-360-C (200 hp) 112TC, 112TCA Lyco TO-360-C1A6D (210 hp) 8 RHB32E RHB32S 114, 114A RHM40E REM40E Lyco IO-540-T4A5D (260 hp) 12 RHM38E REM38E RHM38S REM38S Commander 685 2/Cont GTSIO-520-F, -K (435 hp) 12 RHB32E RHB32S Model 700 2/Lyco TIO-540-R2AD RHB37E REB37E RHB36S (340/350 hp) 12 RHB32E REB32E RHB32S REB36S

HELIO

Plugs Massive Fine Wire U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications UH-12D RHM40E REM40E Lyco VO-435 (260 hp) 12 RHM38E REM38E RHM38S REM38S UH-12E 1/2” Rch. Cyl. Lyco VO-540 (305 hp) 12 RHM38E REM38E RHM38S REM38S UH-12E, L 13/16” Rch. Cyl. Lyco VO-540-C (305 hp) 12 RHB37E RHB36S HUSKY A-1B-160 REM38E Lyc. 0-320-D2A 8 RHM38E REM37BY RHM38S REM38S A-1B-180 REM38E Lyc. 0-360-A1P 8 RHM38E REM37BY RHM38S REM38S A-1B-200 REM38E Lyc. 10-360-A1D6 8 RHM38E REM37BY RHM38S REM38S

LAKE

200EP Lyco IO-360-A1B6 (200 hp) 8 RHM38E REM38E RHM38S REM38S LA-250 RHM40E REM40E Lyco IO-540-C4B5 (250 hp) 12 RHM38E REM38E RHM38S Skimmer C-1 Lyco O-320-A (150 hp) 8 RHM40E REM40E RHM38S REM38S Skimmer C-2, LA-4, LA-4A RHM40E REM40E Lyco O-360-A (180 hp) 8 RHM38E REM38E RHM38S REM38S Skimmer LA-4-200 Lyco IO-360-A1B6 (200 hp) 8 RHM38E REM38E RHM38S REM38S LUSCOMBE Silvaire 8A REM37BY Cont A-65 (65 hp) 8 RHM40E REM40E Silvaire 8C, D REM37BY Cont A-75 (75 hp) 8 RHM40E REM40E RHM38S REM38S REM40E Silvaire 8E, F REM38E RHM38S REM38S Cont C-85 (85 hp) REM37BY Cont C-90 (95 hp) 8 RHM40E REM40E RHM38S REM38S Sedan 1A 12 RHM40E REM40E RHM38S REM38S REM38E RHM38S REM38S Cont E-165 (165 hp) McCULLOCH REM37BY J-2 RHM40E REM40E 8 RHM38E REM38E RHM38S REM38S REM38E RHM38S REM38S Lyco O-360-A (180 hp)

MAULE

RHB37E RHM40E REM40E RHM38E REM38E RHB37E RHB32E

RHB36S RHM38S REM38S RHB36S RHB32S

RHB37E REB37E RHB36S RHB32E REB32E RHB32S REB36S RHM38E RHM40E RHM38E RHM40E RHM38E

®

REM38E RHM38S REM38S REM40E REM38E RHM38S REM38S REM40E REM38E RHM38S REM38S

12

REL37B

12

REL37B

M4 Astro Rocket Frank 6A-335B (180 hp) 12 RHB32E RHB32S M4 Jetasen RHM40E REM40E Cont O-300A (145 hp) 12 RHM38E REM38E RHM38S REM38S M4 Rocket Cont IO-360-A (210 hp) 12 RHM38E REM38E RHM38S REM38S M4 Strata Rocket Frank 6A-350C (220 hp) 12 RHB32E RHB32S M5-180C, MX7-180 Lyco O-360-C, O-360-C1F RHM40E REM40E (180 hp) 8 RHM38E REM38E RHM38S REM38S M5-210C Cont IO-360D (210 hp) 12 RHM38E REM38E RHM38S REM38S M5-210TC Lyco TO-360-C1A6D RHB37E REB37E (210 hp) 8 RHB32E REB32E RHB36S REB36S M5-235C, M6-235, M7-235 RHM40E REM40E Lyco O-540-J1A5D (235 hp) 12 RHM38E REM38E RHM38S REM38S MX-7-235 Lyco O-540-W1A5D RHM40E REM40E (235 hp) 12 RHM38E REM38E RHM38S REM38S

Most generally used plugs shown in red type. For Unshielded Spark Plugs - see pgs. 13-16. Plug Listings taken from FAA Approved Data. Please consult your aviation distributor for availability on these items.

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

9


Popular Aircraft and Engines

Spark Plugs

®

Plugs Massive Fine Wire Plugs Massive Fine Wire Per Shielded U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 H RHB32S MEYERS Cont IO-520 (285 hp) 12 RHB32E RHB32S MAC-145 REM37BY Cont C-145 (145 hp) 12 RHM40E REM40E RHM38S REM38S PIPER Cub J3, J4, J5, PA-11, 200 RHM40E REM40E Cont O-470-M (240 hp) 12 RHM38E RHM38S REM38S PA-17 200A, B, C Cont A-65 (65 hp) REM37BY Cont IO-470-D (260 hp) 12 RHB32E RHB32S C-75 (75 hp) 8 RHM40E REM40E MOONEY J3, J4, J5, PA-15 M18C, M18L Lyco O-145 (65 hp) 8 RHM40E REM40E Cont A-65 (65 hp) REM37BY PA-12, PA-14, PA-16 8 RHM40E REM40E Lyco O-145 (65 hp) Lyco O-235 (115 hp) 8 RHM40E REM40E RHM38S REM38S Cadet REM37BY Super Cub PA-18 “95” REM37BY Cont C-90 (95 hp) 8 RHM40E REM40E RHM38S REM38S Cont C-90 (95 hp) 8 RHM40E REM40E RHM38S REM38S Encore PA-18 “105” TSIO-360 (220 hp) RHM38E REM38E RHM38S REM38S Lyco O-235 (105 hp) 8 RHM40E REM40E RHM38S REM38S M20 REM37BY PA-18 “125” Lyco O-320-A (150 hp) 8 RHM40E REM40E RHM38S REM38S Lyco O-235 (105 hp) 8 RHM40E REM40E RHM38S REM38S M20A REM37BY PA-18 “135” Lyco O-360-A RHM40E REM40E 8 RHM40E REM40E RHM38S REM38S Lyco O-360-A1D (180 hp) 8 RHM38E REM38E RHM38S REM38S Lyco O-290-D2 (135 hp) PA-18 “150” REM37BY M20B Mark 21 REM37BY Lyco O-320-A (150 hp) 8 RHM40E REM40E RHM38S REM38S Lyco O-360-A RHM40E REM40E RHM38S Lyco O-360-A1D (180 hp) 8 RHM38E REM38E RHM38S REM38S Pacer PA-20 “115” M20C Ranger Mark 21 REM37BY Lyco O-235-C (115 hp) 8 RHM40E REM40E RHM38S REM38S Lyco O-360-A1D RHM40E REM40E PA-20 “125” (180 hp) 8 RHM38E REM38E RHM38S REM38S Lyco O-290-D (125 hp) 8 RHM40E REM40E RHM38S REM38S REM37BY M20D Master PA-20 “135” Lyco O-360-A RHM40E REM40E Lyco O-290-D2 (135 hp) 8 RHM40E REM40E RHM38S REM38S Lyco O-360-A2D (180 hp) 8 RHM38E REM38E RHM38S REM38S PA-22 “108” Colt M20E Chaparral Lyco O-235-C (108 hp) 8 RHM40E REM40E RHM38S REM38S Super 21 Tri-Pacer PA-22 “135” Lyco IO-360-A1D (200 hp) 8 RHM38E REM38E RHM38S REM38S Lyco O-290-D2 (135 hp) 8 RHM40E REM40E RHM38S REM38S RHM38E REM38E RHM38S REM38S M20F Executive PA-22 “150” REM37BY Lyco IO-360-A1A (200 hp) 8 RHM40E REM37BY Lyco O-320-A (150 hp) 8 RHM40E REM40E RHM38S REM38S REM40E M20G Statesman REM40E Lyco O-360-A (180 hp) 8 RHM38E REM38E RHM38S REM38S PA-22 “160” RHM40E REM38E M20J-201, 205-MSE 8 RHM38E REM37BY RHM38S REM38S 8 RHM38E REM38E RHM38S REM38S Lyco O-320-B (160 hp) Lyco IO-360-A3B6D (200 hp) M20K-231 Apache PA-23 “150” REM37BY Cont TSIO-360-B, GB1,-GB3, 2/Lyco O-320-A (150 hp) 8 RHM40E REM40E RHM38S REM38S -GB4, LB1 (210 hp) 12 RHM38E REM38E RHM38S REM38S PA-23 “160” RHM40E REM38E M20K-252, TSE Lyco O-320-B (160 hp) 8 RHM38E REM37BY RHM38S REM38S 12 RHM38E RHM38S Cont TSIO-360-MB1 (210 hp) PA-23 “235” M20M-TLS Bravo RHB36S 2/Lyco O-540-B (235 hp) 12 RHM40E REM40E RHM38S REM38S Lyco TIO-540-AF1A (270 hp) 12 RHB37E RHB32S Aztec PA-23 “250” RHM40E REM40E M-20R Ovation 2/Lyco O-540-A (250 hp) 12 RHM38E REM38E RHM38S REM38S TCM-IO-550G (5) 12 RHB32E RHB32S Aztec C, D, E, F, PA-23 M20S Eagle RHB36S “250” IO-550G (244 hp) RHB32E RHB32S 2/Lyco IO-540-C RHM40E REM40E M22 Mustang RHB37E RHB36S (250 hp) (Short Reach) 12 RHM38E REM38E RHM38S REM38S Lyco TIO-541-A1A (310 hp) 12 RHB32E RHB32S Aztec - Turbo-Blown NAVION 2/Lyco IO-540-J (250 hp) 12 RHB32E REB37E RHB32S REB36S A Cont E-185 (205 hp) 12 RHM40E REM40E RHM38S REM38S Aztec C,D, E, F, PA-23 “250” B Lyco GO-435C (260 hp) 12 RHM38E REM40E RHM38S REM38S 2/Lyco TIO-540-C RHB37E REB37E RHB36S (250 hp) (Long Reach) 12 RHB32E REB32E RHB32S REB36S D RHM40E REM40E Cont O-470-P (240 hp) 12 RHM40E REM40E RHM38S REM38S Comanche PA-24 “180” Lyco O-360-A (180 hp) 8 RHM38E REM38E RHM38S REM38S E RHM40E REM40E Cont IO-470-C (250 hp) 12 RHM38E REM38E RHM38S REM38S PA-24 “250” Lyco O-540-A (250 hp) RHM40E REM40E F, G IO-540-C (250 hp) 12 RHM38E REM38E RHM38S REM38S Cont IO-470-H (260 hp) 12 RHB32E RHB36S U.S. Aircraft/Engine Specifications

Most generally used plugs shown in red type. For Unshielded Spark Plugs - see pgs. 13-16. Plug Listings taken from FAA Approved Data. Please consult your aviation distributor for availability on these items.

10 Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

C


s.

Spark Plugs

Popular Aircraft and Engines

Plugs Massive Fine Wire U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications PIPER (Cont’d) PA-24 “260”, PA24B, PA24C Lyco IO-540-B, -D, -N RHM40E REM40E (260 hp) 12 RHM38E REM38E RHM38S REM38S PA-24 “260” Turbo RHB32E REB32E RHB32S Lyco IO-540-R1A5 (260 hp) 12 RHB37E REB37E RHB36S REB36S PA-24 “400” 16 RHM38E RHM38S Lyco IO-720-A (400 hp) Pawnee PA-25 “150” REM37BY Lyco O-320-A (150 hp) 8 RHM40E REM40E RHM38S REM38S PA-25 “235” Lyco O-540-B (235 hp) 12 RHM40E REM40E RHM38S REM38S RHM40E REM40E PA-25 “260” Lyco O-540-G (260 hp) 12 RHM38E REM38E RHM38S REM38S Cherokee PA-28 “140” REM37BY Lyco O-320-E (140 hp) 8 RHM40E REM40E RHM38S REM38S PA-28 “150” Flight Liner 2+2 Cruiser, Warrior “151” REM37BY O-320-A, -E (150 hp) 8 RHM40E REM40E RHM38S REM38S PA-28 Warrior II “161” REM37BY Cadet RHM40E REM40E Lyco O-320-B, -D (160 hp) 8 RHM38E REM38E RHM38S REM38S PA-28 “180” Challenger, REM37BY RHM40E REM40E Archer Lyco O-360-A (180 hp) 8 RHM38E REM38E RHM38S REM38S REM37BY RHM40E REM40E PA-28 “181” Archer II Lyco O-360-A (180 hp) 8 RHM38E REM38E RHM38S REM38S RHM40E REM40E PA-28R “180” Arrow Lyco IO-360-B (180 hp) 8 RHM38E REM38E RHM38S REM38S PA-28R Arrow II, III, IV “200” 8 RHM38E REM38E RHM38S REM38S Lyco IO-360-C (200 hp) PA-28R Turbo Arrow III, IV 12 RHM38E REM38E RHM38S REM38S Cont TSIO-360F, FB (200 hp) PA-28 “235” Charger, Pathfinder 12 RHM40E REM40E RHM38S REM38S Lyco O-540-B (235 hp) PA-28 “236” Dakota RHM40E REM40E Lyco O-540-J3A5D (235 hp) 12 RHM38E REM38E RHM38S REM38S PA-28-201T Turbo Dakota 12 RHM38E RHM38S Cont TSIO-360-FB (200 hp) Twin Comanche PA-30 REM37BY RHM40E REM40E “160” 2/Lyco IO-320-B (160 hp) 8 RHM38E REM38E RHM38S REM38S Navajo PA-31 “300” 12 RHB37E REB37E RHB36S REB36S 2/Lyco IO-540-M (300 hp) Navajo PA-31 RHB37E RHB36S 2/Lyco TIO-540-A1A, A2C (310 hp) 12 RHB32E RHB32S Navajo PA-31-325C/R RHB37E RHB36S 2/Lyco TIO-540-F2BD & LTIO-540-F2BD (325 hp) 12 RHB32E RHB32S Navajo PA-31 Chieftain RHB37E RHB36S 2/Lyco TIO-540-J & 12 RHB32E RHB32S LTIO-540-J (350 hp) PAT-1020 RHB37E RHB36S Lyco TIO-540-J2B (350 hp) 12 RHB32E RHB32S Navajo PA-31P 2/Lyco TIGO-541-E1A RHB37E RHB36S (425 hp) 12 RHB32E RHB32S

®

Plugs Massive Fine Wire U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications Mojave (PA-31P-350) 2/Lyco TIO & RHB37E RHB36S LTIO-540-V2AD (360 hp) 12 RHB32E RHB32S Cherokee Six PA-32 “260” RHM40E REM40E Lyco O-540-E4B5 (260 hp) 12 RHM38E REM38E RHM38S REM38S Cherokee Six PA-32 “300” Lyco IO-540-K1A5 (300 hp) 12 RHM38E REM38E RHM38S REM38S Cherokee Lance PA-32 “300” Lyco IO-540-K1A5D (300 hp) 12 RHM38E REM38E RHM38S REM38S Cherokee Lance II PA-32 “300” R Lyco IO-540-K1G5D (300 hp) 12 RHM38E REM38E RHM38S REM38S PA-32RT-300T Turbo Lance RHB37E RHB36S Lyco TIO-540-S1AD (300 hp) 12 RHB32E RHB32S Saratoga PA-32-301 Lyco IO-540-K1G5 (300 hp) 12 RHM38E REM38E RHM38S REM38S Turbo-Saratoga PA-32-301T Lyco TIO-540-S1AD RHB37E REB37E RHB36S (300 hp) 12 RHB32E REB32E RHB32S REB36S Saratoga SP PA-32R-301 Lyco IO-540-K1G5 (300 hp) 12 RHM38E REM38E RHM38S REM38S Turbo-Saratoga SP PA-32R-301T RHB37E REB32E RHB36S Lyco TIO-540-S1AD (300 hp) 12 RHB32E REB37E RHB32S REB36S Seneca PA-34 2/Lyco LIO-360-C & IO-360-C (200 hp) 8 RHM38E REM38E RHM38S REM38S Seneca II PA-34-200T 2/Cont TSIO-360-E, EB & LTSIO-360-E (200 hp) 12 RHM38E RHM38S Seneca III PA-34-220T 2/Cont TSIO-360-KB & LTSIO-360-KB (220 hp) 12 RHM38E RHM38S Pawnee Brave PA-36 Cont 6-285-B (285 hp) 12 RHU27E Tierra Engine Pawnee Brave PA-36 Lyco IO-540-K1G5 (300 hp) 12 RHM38E REM38E RHM38S REM38S Pawnee Brave PA-36 RHB32E RHB32S Lyco IO-720-D1CD (375 hp) 16 RHB37E REB37E RHB36S REB36S Twin Comanche PA-39 2/Lyco IO-320-B & RHM40E REM40E LIO-320-B (160 hp) 8 RHM38E REM38E RHM38S REM38S Twin Comanche PA-39 Turbo 2/Lyco LIO-320-C & IO-320-C (160 hp) 8 RHB37E REB37E RHB36S REB36S PA-40 REM37BY 2/Lyco IO-320-B & RHM40E REM40E LIO-320B (160 hp) 8 RHM38E REM38E RHM38S REM38S Tomahawk-Trainer REM37BY PA-38 RHM40E REM40E Lyco O-235-L2C (112 hp) 8 RHM38E REM38E RHM38S REM38S Seminole PA-44-180 2/Lyco LO-360-E1A6D & RHM40E REM40E O-360-E1A6D (180 hp) 8 RHM38E REM38E RHM38S REM38S

Most generally used plugs shown in red type. For Unshielded Spark Plugs - see pgs. 13-16. Plug Listings taken from FAA Approved Data. Please consult your aviation distributor for availability on these items.

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs. 11


Plugs Massive Fine Wire U.S. Aircraft/Engine Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24 Specifications PIPER (Cont’d) Turbo-Seminole PA-44-180T 2/Lyco TO-360-E1A6D & RHB37E REB37E RHB36S LTO-360-E1A6D (180 hp) 8 RHB32E REB32E RHB32S REB36S Malibu PA-46-301-P RHB36S Cont TSIO-520-BE (310 hp) 12 RHB32E RHB32S Malibu Mirage PA-46-350-P Lyco TIO-540-AE2A RHB37E RHB36S (350 hp) 12 RHB32E RHB32S PA-60-600, 600A Aerostar 2/Lyco IO-540-G1B5, K1J5 (290 hp) 12 RHM38E RHM38S PA-60-601, 601B Aerostar RHB37E RHB36S 2/Lyco IO-540-P1A5,S1A5 12 RHB32E RHB32S (290 hp) PA-60-601P Aerostar 2/Lyco IO-540-S1A5 RHB37E RHB36S (290 hp) 12 RHB32E RHB32S PA-60-602P Aerostar 2/Lyco IO-540-AA1A5 RHB32E RHB36S (290 hp) 12 RHB37E RHB32S PA-60-700P 2/Lyco TIO-540-UJ2A & RHB37E RHB36S LTIO-540-U2B (350 hp) 12 RHB32E RHB32S

REPUBLIC

Seabee RC-3 Frank 6A8-215-B (215 hp)

ROBINSON

12

R22 8 Lyco O-320-B (160 hp) R22 Lyco O-320-A (150 hp) 8 R44 Lyco O-540 (205 hp) 12

SCHEUTZON

B Lyco IVO-360-A (180 hp)

SCHWEIZER

8

Popular Aircraft and Engines

Spark Plugs

®

U.S. Aircraft/Engine Specifications

SIKORSKY

Plugs Massive Fine Wire Per Shielded Eng. 3/4”-20 5/8”-24 3/4”-20 5/8”-24

S-51 P & W R-985 (450 hp)

REM37BY

18

RHM38E REM40E RHM38S REM38S

14

RHB37E REB37E RHB36S REB36S

S-55A Wright R-1300 (800 hp)

S-55C P & W R-1340 (600 hp)

18

REM37BY

RHM40E REM40E RHM38S REM38S

S-56 2/P & W R-2800-50 (1800 hp)

RHB32E REB32E RHB32S

36 RHB37E REB37E RHB36S REB36S

S-58 Wright R-1820-84 (1525 hp)

STINSON

18 RHB32E

RHB32S

Reliant V-77 Lyco R-680-13 (300 hp) 18 RHM40E REM40E RHM38S REM38S Vigilant V-74 Lyco R-680-13 (300 hp)

18

RHM40E REM40E RHM38S REM38S

12

RHM40E REM40E RHM38S REM38S

Sentinel V-76 Lyco O-435-1 (190 hp) 105 Frank 4AC-199-E2 (90 hp)

8

REJ38

Voyager 108 Frank 6A4-150 (150 hp)

12

REJ38

12

REJ38

Voyager 108

REJ38

Frank 6A4-165 (165 hp) Voyager 108-5

RHM40E REM38E RHM38E REM40E RHM38S REM38S Frank 6A335-B (180 hp) TAYLORCRAFT

12 RHB32E

RHM40E REM40E RHM38S REM38S Deluxe BC12D

RHB37E

RHB36S

269A Lyco O-360 (180 hp) RHM40E REM40E HO-360-B (180 hp) 8 RHM38E REM38E RHM38S REM38S 200 RHM40E REM40E Lyco HIO-360-B (180 hp) 8 RHM38E REM38E 300 Lyco HIO-360-A (200 hp) 8 RHM38E REM38E RHM38S REM38S 300C Lyco HIO-360-DIA (190 hp) 8 RHM38E REM38E RHM38S REM38S

REM37BY

Cont A-65-8 (65 hp)

8

RHM40E REM40E

Cont C-85-8 (85 hp)

8

RHM40E REM40E

RHM38E REM38E RHM38S REM38S Sportsman 19 F19 Cont O-200-A (100 hp)

8

RHB36S

REM37BY REM37BY

RHM40E REM40E RHM38S

F21B, F22

REM37BY

Lyco O-235-L2C

RHM40E REM38E

(118 hp)

RHM38E REM40E RHM38S REM38S

8

Workhorse 44 Wright R-1820-103 977C9HD1

18 RHB37E REB37E RHB36S REB36S

Most generally used plugs shown in red type. For Unshielded Spark Plugs - see pgs. 13-16. Plug Listings taken from FAA Approved Data. Please consult your aviation distributor for availability on these items.

12 Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

C


s.

Spark Plugs

Spark Plug Application By Engine Manufacturer

Engine Model

ALLISON V1710

Standard Massive Electrode Shielded 5/8” - 24 3/4” - 20 REB37E

FRANKLIN ENGINE CO. 2A4 Series

REJ38 2A-120-A, -B 4A4 Series REJ38 4AC Series REJ38 4A-235-B, B3 Sport 4, 4A, 4A1, 4B, 4R 6AC, 6AL, 6AG, 6A4, 6V4 Series REJ38 6A4-200, 6V4-200 REL37B 6V6-245 REL37B 6A8-215 REJ38 6A-335-A, B, 6V335-A, -B REL37B 6AS-335-A, B, 6AS-350-A, -A1 6V335-A1A, A1B REB37E REB37E REB32E 6VS-335-A, -B 6A-350-C1,-C1A, -C2, -C2A, -D, -D1 6V-350-A, -B

GROB

Unshielded

RHB37E

L-4, L-5 & L-6 Series R-755 R-755S, R-755SM

Fine Wire Electrode Shielded 5/8” - 24 3/4” - 20 REB36S

RHB32E

RHB36S

RHB32E REB36S RHB32E

RHB36S RHB36S

RHB32E RHB37E RHB37E RHB32E RHB32E RHB32E

2500 D1/E1 Gypsy Major REL37B

JACOBS AIRCRAFT ENGINE CO.

®

REB36S REB36S REB36S

RHB36S RHB36S

REB36S REB36S REB36S

RHB36S RHB36S RHB36S

REN30S

REM40E RHM40E REM38S REM38E KENROYCE-REARWIN All models REM40E RHM40E M41E KINNER All models M41E LAMBERT All models M41E LEBLOND All models M41E MENASCO All models except D4 M41E ORENDA All models PRATT & WHITNEY REM37BY* R-985 (Wasp Jr.), R-1340 (Wasp) REM40E RHM40E M41E REM38S R-1830 (Twin Wasp C) REB37E RHB37E REB36S + For Severe Service REB32E+ RHB32E+ R-2000 (Twin Wasp D) REB37E RHB37E REB36S R-2800 (Double Wasp) R-2800-97 REB37E RHB37E CA3, CA5, CA15, CA17, CA18, CA19 REB32E RHB32E REB36S ++ Rear position front row only RHB29E++ R-4360 (Wasp Major) REB37E RHB37E REB36S PEZETEL (WSK) ASZ-621R, (1000 h. p.), P2L-3S (600 h. p.) REB37E RHB37E REB36S RANGER All 18 mm Short Reach REM40E RHM40E M41E REM38S ROLLS-ROYCE - Merlin, Griffon RUSSIAN ENGINES M14 Most Series REL37B RVL38S** TELEDYNE CONTINENTAL MOTORS REM37BY* A-65, A-75 REM40E RHM40E M41E REM38S C75, C-85, C-90, C-115, C-125 REM37BY* REM40E RHM40E M41E REM38S E-165, E-185, E-225 REM40E RHM40E M41E REM38S E-165, E-185, E-225 (14mm Bushing) REJ38 * Use REM37BY when encountering lead fouling. ** Uses M18x1 barrel thread instead of 5/8”-24

RHM38S

RHB27S RHM38S RHB36S RHB32S+ RHB36S RHB36S RHB32S RHB36S RHB36S RHM38S RHL27S RHL28S

RHM38S RHM38S RHM38S

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs. 13


®

Spark Plugs

Engine Model

TELEDYNE CONTINENTAL MOTORS (Cont’d)

Spark Plug Application By Engine Manufacturer

Standard Massive Electrode Shielded 5/8” - 24 3/4” - 20

Unshielded

Fine Wire Electrode Shielded 5/8” - 24 3/4” - 20

REM37BY* REM40E RHM40E M41E REM38S REM38E RHM38E REM38S REM37BY* REM40E RHM40E REM38E RHM38E M41E REM38S REM40E RHM40E REM38E RHM38E REM38S REM38E RHM38E REM38S REM40E RHM40E REM38S

O-200-A, -B, -C, -D IO-240 GO-300-A, -B, -C, -D, -E, -F O-300-A, -B, -C, -D, -E, C-145 IO-346-A, -B IO-360-A, -AB, -C, -CB, -D, -E, -G, -GB, -H, -HB, -J, -JB, -K, -KB IO-360-B TSIO-360-A, -AB, -B, -C, -CB, -D, -DB, -E, -EB, -F, -FB, -G, -GB, REM38E RHM38E REM38S -H, -HB, -JG, -K, -KB, -LB, -MB, LTSIO-360-E, -EB, -K, -KB O-470-2 REM38E RHM38E REM38S O-470-4, -11, -13, -13A, -15 REM40E RHM40E REM38S O-470-A, -E, -J, -K, -L, -R, -S REM40E RHM40E REM38S REM40E RHM40E O-470-B, -G, -H, -M, -N, -P REM38E RHM38E REM38S RHB32E O-470-T, -U REM40E RHM40E REM38E RHM38E REM38S IO-470-C, -G, -P, -R, -T IO-470-J, -K REM40E RHM40E REM38S RHB32E IO-470-D, -E, -F, -H, -L, -M, -N, -S, -U, -V, -VO, -LO RHB32E GIO-470-A REM40E RHM40E LIO-470-A REM38E RHM38E REM38S RHB32E TSIO-470-B, -C, -D RHB32E RHB32S IO-520-A, -B, -BA, -BB, -C, -CB, -D, -E, -F, -J, -K, -L, -M, -MB, -N, -NB TSIO-520-A, -B, -BB, -BE, -C, -CE, -D, -DB, -E, -EB -F, -G, -H, -J, -JB, -K, -KB, -L, -M, -N, -NB, -P, -R, -T, -U, -UB, -V, -VB, -WB, -AE, -AF LTSIO-520-AE RHB32E GTSIO-520-C, -D, -E, -F, -G, -H, -K, -L, -M, -N RHB32E TSIO-550-A, -B, -C, RHB32E RHB32E IO-550-A, -B, -C, -D, -E, -F,-G, -L, -N, -P, -R TSIOL-550-A, -B RHU32E 6-285-B, -BA, -C, -CA, 6-320-A, -B RHU27E W-670 REM40E RHM40E M41E REM38S R9A REB37E RHB37E REB36S

TEXTRON LYCOMING

O-145, GO-145 M41E REM40E REM38E O-235-C, -E, -H REM37BY* RHM40E M41E O-235-F, -G, -J REM40E REM38E RHM40E O-235-K, -L, -M, -N, -P REM37BY* RHM38E O-290 Series REM40E REM38E REM37BY* RHM40E M41E O-320-A, -C, -E REM37BY* RHM40E M41E O-320-B, -D, -H REM40E AIO-320, LIO-320-B, IO-320-B, -C, -D, AEIO-320-A, -B, -C, -D REM38E RHM40E * Use REM37BY when encountering lead fouling.

RHB36S RHM38S RHM38S

RHM38S RHM38S RHM38S RHM38S RHM38S RHM38S RHM38S RHM38S RHM38S RHB32S RHM38S RHM38S RHB36S RHB32S RHB36S RHB32S RHM38S RHB36S RHB32S RHB36S

RHB32S RHB36S RHB32S RHB36S RHB32S RHB36S RHB32S RHU32S RHM38S RHB36S

REM38S REM38S

RHM38S

REM38S

RHM38S

REM38S REM38S

RHM38S RHM38S

14 Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

C


s.

Spark Plug Application By Engine Manufacturer

Engine Model

TEXTRON LYCOMING (Cont’d)

Spark Plugs

Standard Massive Electrode Shielded 5/8” - 24 3/4” - 20

REM37BY* IO-320-A, -B, -D, -E REM40E AEIO-320-E REM37BY* IO-320-C, -F, LIO-320-C (Long Reach) REB37E REM40E REM38E O-340-A O-340-B REM40E O-360-A, -C, -E, -F IO-360-B, -E, -F, -H, -L REM38E AEIO-360-B, -C, -H, HO-360-A REM37BY* REM40E O-360-B, -D REM37BY* REM38E IO-360-A, -C, -D, -J, LIO-360-E REM37BY* LO-360-A1G6D, O-360-E1A6D REM40E LO-360-E1A6D REM38E LO-360-C REM37BY* IO-360-A, IO-360-C1F IO-360-F (Long Reach) IVO-360 REB37E AIO-360-A, REM38E LIO-360-C, AEIO-360-A REM37BY* REM38E HIO-360-A, -D REM40E HO-360-B, HIO-360-A, -B REM38E TIO-360-A, -B, AEIO-360-A (Long Reach) REB37E HIO-360-E1AD, -E1BD, -F1AD REB32E LHIO-360-F1AD, IVO-360-A TO-360-A1A6D, TO-360-C1A6D, TO-360-E TO-360-F1A6D, LTO-360-A1A6D, LTO-360-E REB37E

REM40E VO-360-A, -B REM38E REM40E O-435-A, -C REM38E REM40E O-435-K, K1 REM38E GO-435-C, -D Series REM38E REM38E VO-435-A, TVO-435-A (Short Reach) VO-435-A, -B (Long Reach) TVO-435-A, -B, -C, -D, -E, -F, -G (Long Reach) REB37E O-435-23-25 REB32E REM40E GO-480-B, -D, -F REM38E GO-480-C, -G (Short Reach) REM38E GO-480-G1, G2 (Long Reach) REB37E GSO-480-A, -B (Short Reach) REM38E GSO-480-A, -B (Long Reach) REB37E IGSO-480-A (Short Reach) REM38E IGSO-480-A (Long Reach) IGO-480-A REB37E O-480-1-3 REB32E

Unshielded

®

Fine Wire Electrode Shielded 5/8” - 24 3/4” - 20

RHM38E

REM38S

RHM38S

RHM40E RHB37E RHM40E RHM38E RHM40E

REM38S REB36S

RHM38S RHB36S

REM38S REM38S

RHM38S RHM38S

RHM40E RHM38E

REM38S

RHM38S

RHM40E

REM38S

RHM38S

RHM38E

REM38S

RHM38S

RHM40E RHM38E

REM38S

RHM38S

RHB37E

REB36S

RHB36S

RHM38E RHM38E RHM40E RHM38E RHB37E

REM38S REM38S

RHM38S RHM38S

REM38S REB36S

RHM38S RHB36S

RHB32E RHB37E RHB32E REB36S

RHB32S RHB36S RHB32S

RHM40E RHM38E

REM38S

RHM38S

REM38S

RHM38S

REM38S REM38S REM38S

RHM38S RHM38S RHM38S

RHB37E RHB32E REB36S RHM40E RHM38E REM38S RHM38E REM38S RHB37E RHB32E REB36S RHM38E REM38S RHB37E REB36S RHM38E REM38E

RHB36S RHB32S

RHB37E RHB32E REB36S

RHB36S RHB32S

RHM40E RHM40E RHM38E RHM38E RHM38E

RHM38S RHM38S RHB36S RHB32S RHM38S RHB36S RHM38S

* Use REM37BY when encountering lead fouling.

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs. 15


®

Spark Plugs

Engine Model

TEXTRON LYCOMING (Cont’d)

Spark Plug Application By Engine Manufacturer

Standard Massive Electrode Shielded 5/8” - 24 3/4” - 20 REM40E RHM40E

Unshielded

Fine Wire Electrode Shielded 5/8” - 24 3/4” - 20

O-540-A, -D, -E, -F, -G, -H, -J, -J3A5

REM38E

RHM38E

REM38S

RHM38S

O-540-B

REM40E

RHM40E

REM38S

RHM38S

IO-540-A, -B, -E, -G, -K, -L, -M, -P, -S, -U (Short Reach)

REM38E

RHM38E

REM38S

RHM38S

IO-540-C, -D, -J, -N, -T, -V

REM40E

RHM40E

AEIO-540-D, -L

REM38E

RHM38E

REM38S

RHM38S

IO-540-AA, -E, -G, -J, -K, -M, -P, -R, -S, -U

REB37E

RHB37E

RHB36S

O-540-L3C5D, M1B5D (Long Reach)

REB32E

RHB32E

REB36S

RHB32S

VO-540-A, -B, -C (Short Reach)

REM38E

RHM38E

REM38S

RHM38S

IVO-540 Series (Long Reach)

REB37E

RHB37E

REB36S

RHB36S

IGO-540-A, -B (Short Reach)

REM38E

RHM38E

REM38S

RHM38S

IGO-540-A, -B (Long Reach)

REB37E

RHB37E

REB36S

RHB36S

TIO-540-A, -C, -E, -F, -G, -H, -J, -K, -N, -R, -S, -T

REB37E

RHB37E

RHB36S

TIVO-540-A

REB32E

RHB32E

REB36S

RHB32S

IGSO-540-B (Short Reach)

REM38E

RHM38E

REM38S

RHM38S

IGO-540-A, -B

REB37E

RHB37E

RHB36S

IGSO-540-A, -B (Long Reach)

REB32E

RHB32E

RHB32S

M41E

O-540-9 VO-540-Series

REB36S

REB37E

RHB37E

RHB36S

LTIO-540-F, -J, -N, -R

REB32E

RHB32E

RHB32S

REB37E

RHB37E

RHB36S

TIO-541-A, -E

REB32E

RHB32E

RHB32S

REB37E

RHB37E

RHB36S

TIGO-541-A, -E

REB32E

RHB32E

REB36S

RHB32S

REB36S REB36S

IO-580-A

RHB37E

R-680

REM40E

RHM40E

REM38S

RHM38S

REM38S

RHM38S

IO-720-A, -B, -C, -D (Short Reach)

REM38E

RHM38E

REB37E

RHB37E

RHB36S

IO-720-A, -B, -C, -D (Long Reach)

REB32E

RHB32E

REB36S

RHB32S

REM40E

RHM40E

M41E

REM38S

RHM38S

WARNER (All Models) WRIGHT AERONAUTICAL R-540

REM40E

RHM40E

Whirlwind R-760, R-975 (1/2” Rch.)

REM40E

RHM40E

M41E

REM38S

RHM38S

Cyclone 9N with 1/2” insert depth (R-1820)

REM40E

RHM40E

M41E

REM38S

RHM38S

Whirlwind R-760, R-975 (18mm 13/16” Rch.)

REB37E

RHB37E

REB36S

RHB36S

Cyclone R-1300

REB37E

RHB37E

REB36S

RHB36S

Cyclone R-1820 Series (Except F & HE)

REB37E

RHB37E

REB36S

RHB36S

Cyclone R-2600 Series

REB37E

RHB37E

REB36S

RHB36S

Cyclone R-1820-84 (C9HE Series)

RHB32E

RHB32S

Cyclone R-3350, C18BA, C18BD

RHB37E

RHB36S

REB37E

Cyclone R-3350-C18CB1

RHB29E

Cyclone R-3350-DA1, -2, -3, -4, EA1, -2, -3

RHB29E

Cyclone R-3350-EA4, -5, -6

RHB29E

REB36S

Additional R-3350 plugs Available for Racing Applications only - Contact Champion Aerospace LLC Regarding this Application.

16 Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

C


s.

Spark Plugs

Other U.S. Aircraft and Piston Aircraft

Make & Model Engine

AERONCA

LA, LB LC KC 50-C 50-F 59-L 60-TF 65-LA O-58B Champion L-16B

LeBlond (70 hp), (85 hp) Warner Scarab Jr. 50 Cont A-40 Cont A-50 Franklin 4AC-150 Lyco O-145 Cont A-65 Lyco O-145 Cont O-170-3 (Equiv. A65) Cont A-65-8

Texas Bullet 205

Cont E-185-1

A-2 A-4

Cont C-90-16F Lyco O-320-A

AG-5

Cont C-90

Brigadier B-290 Deluxe Brigadier B-360 Super Brigadier B-480

Cont C-145-2 2/Lyco O-360 2/Cont O-470-B

Honey Bee Queen Bee

Cont A-65 Lyco O-320

247D Stratoliner 307B Fortress B-17G Stearman 75, PT-17 Stearman 75, PT-13 Stearman 75 (Modified) Stratocruiser B377

2/P & W R-1340, R985 Wright R-1820-G105A, G205A 4/Wright R-1820-97 Cont W-670 Lyco R-680 P & W R-985 4/P & W R-4360

480

2/Cont O-470-B

Air Tractor L-101

P & W R-985

Liberator C-87 Catalina PBY-5A (Modified Version) 240, 340, 440

4/P & W R-1830-43 2/P & W R-1830-92 2/Wright R-2600-29 2/P & W R-2800 C Series

Cadet LCA V

Cont A-75 Cont C-85

Falcon CW-22, SNC-1 Commando C-46 (Modified Version) Satellite LFA

Wright R-975-E3 2/P & W R-2800-51, -75, -79 2/P & W R-2800-CB16 Cont C-90 Franklin 4AC-176-D2

DA-1

Lyco O-360-A1A

Bolo B-18A Dragon B-23 Invader B-26 Dolphin D-117

2/Wright R-1820 2/Wright R-2600-29 2/P & W R-2800-27 W R-985

AIRCRAFT MFG. COMPANY ALON, INC.

ANDERSON-GREENWOOD BAUMANN

BEE AVIATION BOEING

CAMAIR

CENTRAL-LAMSON CONVAIR

CULVER (Superior) CURTISS-WRIGHT

DAVIS AIRCRAFT DOUGLAS

Plugs Plugs Per Per Eng. Make & Model Engine Eng. Havoc A20G 2/Wright R-2600-23 28 Wright SGR-1820, F3, F52, 25 18 10 DC-2 2/Wright R-1820-G102, G202A 18 10 Skytrain DC-3, C49 2/P & W R-1830-90, -92, -94 28 8 DC-3A, C47, C53, C112 4/P & W R-2000 28 8 Skymaster DC-4 Liftmaster DC-6 4/P & W R-2800-CB16, -17 36 8 DC-7 4/Wright R-3350 Compound 36 8 DOWNER 8 14-19 Lyco O-435-A 12 8 Cont O-470-K 12 8 14-19-2 14-19-3 Cont IO-470-F 12 8 260B Cont IO-470-F 12 Viking 300 Cont IO-520-D 12 12

DOYN AIRCRAFT

Cessna 150 Modified Lyco O-320 8 Cessna 177 Modified Lyco O-360 8 FLETCHER Utility FU-24 Cont O-470-E, N 12 8 FU-24A Cont IO-470-D 12 FU-24B Cont GIO-470-A 12 12 FORD 8 4-AT-E Trimotor 3/Wright R-975 18 12 5-AT-B Trimotor 3/P & W R-985 18 FORNAIRE 8 Aircoupe E, G Cont C-75, C-85 8 8 Aircoupe F-1, F1A Cont C-90 8 HOWARD 18 DGA-8 Wright R-760-E2 14 18 DGA-9 Jacobs L-5 14 18 DGA-11 P & W R-985 18 14 DGA-12 Jacobs L-6 14 P & W R-985-AN-12 18 18 DGA-15P 18 HOWARD AERO 56 Super Ventura 237 (Converted) 2/P & W R-2800-CB 36 12 LANE AIRCRAFT Riviera Cont IO-470-P 12 18 LARK AVIATION Lark 95 Cont C-90 8 28 LEAR 28 Learstar 2/Wright R-1820, C-9HD 18 28 LOCKHEED 36 Electra 10, 10A 2/P & W R-985-SB2 18 Electra 10B 2/Wright R-975-E3 18 2/P & W R-1340, S3H-1 18 8 Electra 10C 2/P & W R-985-SB2 18 8 Electra 12A Super Electra 14-H-2 2/P & W R-1690 18 2/Wright GR-1820, -F62 18 18 Super Electra 14-F62 2/Wright GR-1820, -G3B 18 36 Super Electra 14-G3B Lodestar 18-56 2/Wright R-1820, G-202A, G205A 18 36 2/P & W R-1830-92, S1C3G 28 8 Lodestar 18-08 2/Wright R-1820, G205A 18 8 Hudson 414 Ventura 237 2/P & W R-2800, S1A4G 36 Constellation 049 4/Wright R-3350, -BA3 36 8 Constellation 649, 749 4/Wright R-3350, BD1 36 Constellation 1049 4/Wright R-3350, CB1 36 18 Super Constellation 1049C,G,H 4/Wright R-3350-DA 36 28 Starliner 1649 4/Wright R-3350-EA 36 36 402-2 Cont IO-470-R, TSIO-470-B 12 18 8 8

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs. 17


Spark Plugs

Make & Model Engine

MARTIN

Plugs Plugs Per Per Eng. Make & Model Engine Eng.

202, 404 Marauder B26

2/P & W R-2800-CA, -CB 2/P & W R-2800-83AM8

36 36

90A 90AF 90AL-115 90AL-125 Meteor 2

Warner Scarab 125 & 145 Franklin 4AC-199-E3 Lyco O-235-C Lyco O-290-A 2/Lyco O-320

14 8 8 8 8

2000C 2150

Cont C-90-14F Lyco O-320-A2A

N3N-3 N3N-3 (Modified)

Wright R-760-8 P & W R-985

14 18

Mitchell B-25 Texan T-6 T28A

2/Wright R-2600-29 P & W R-1340-AN1 Wright R-1300

28 18 14

Super V

2/Lyco. O-360-A1A

8

Ambassador

Cont O-200-A

8

Marksman B26K

2/P & W R-2800

36

Twin Navion Riley Navion Temco Model 58 310R Riley Rocket Turbo Executive 400 (Converted DeHaviland Dove) Turbo Skyliner (Converted Heron)

2/Lyco O-320-A2A 2/Lyco O-340-A1A 2/GSO-480-A1A6 2/Cont IO-470-D 2/Lyco IO-540-A1A5 2/Lyco IO-720-A

8 8 12 12 12 16

4/Lyco IO-540

12

Cessna 180 Modified

Cont. TSIO-520-C

12

S-2A S-2B

Cont W-670, Jacobs R-755 P & W R-985, R-1340

14 18

MONOCOUPE

MORRISEY (Shinn) NAVAL AIRCRAFT FACTORY NORTH AMERICAN

OAKLAND AIRMOTIVE (Fleet) OLSON AIRCRAFT ON MARK ENGINEERING CO. RILEY & TEMCO

ROBERTSON AIRCRAFT SNOW AERONAUTICAL

Other U.S. Aircraft and Piston Engines

8 8

SPACE ENTERPRISES Spacecoupe AG-14 SPARTON Executive 7-W STITS Skycoupe SA9A Skycoupe SA9B TEMCO Swift GC-1A Swift GC-1B Swift GC-1B (Modified) Swift GC-1B (Modified) TRANSLAND AG-2 TRECKER Royal Gull L-1 Super Gull L-2 VARGA Kachina 2150A VECTO MFG. Geronimo VULTEE Valiant 54, BT-13, SNV WACO ZVN-7 ZVN-8 YMF-5

WACO AIRCRAFT DIVISION

Cont C-90 P & W R-985

8 18

Cont C-90-12F Cont O-200-A

8 8

Cont C-85 Cont C-125 Cont C-145 Lyco O-320-A

8 12 12 8

P & W R-985, R-1340

18

2/Lyco GO-480-B1B 2/Lyco GSO-480-A1A6

12 12

Lyco O-320-A

8

2/Lyco O-360-A1A

8

P & W R-985-AN1

18

Jacobs L-5 Jacobs L-6 Jacobs R755B2

14 14 14

S-220 Vela Frank 6A-350-C1 12 TS-250-5 Vega Frank 6A-350 12 M220-4 Minerva Frank 6A-350-C1 12 SF-260-3 Meteor Mk. I Lyco O-540-E TS-250-3F Meteor Mk. II Frank 6A-350-C1 12

WEATHERLY AVIATION Model 201A

P & W R-985

18

Eagle I

Cont IO-520

12

Derringer

2/Lyco IO-320-B

Wren 460

Cont O-470-R

WINDECKER RESEARCH WING AIRCRAFT WREN AIRCRAFT

8 12

U.S. Helicopter and Piston Engines

Make & Model Engine BELL Utility 47G Frank 6V4-200-C32 Utility 47G-2 Lyco VO-435-A1B Utility 47G-3B Lyco TVO-435A Utility 47G-3B1, 47G-3B2 Lyco TVO-435-B1A Utility 47G-3 Frank 6VS-335 Utility 47G-4, 47G-4A Lyco VO-540-B1B3 Bellarus 47H, 47H-1 Frank 6V4-200-C32 Ranger 47J, 47G-5, 47G-5A Lyco VO-435-A1B, B1A Ranger 47J2 Lyco VO-540-B

BRANTLY B-2 B-2 B2B 305 305A

Lyco VO-360-A1A Lyco HO-360-B1B Lyco IVO-360 Lyco VO-540-B Lyco IVO-540-A1A

Plugs Plugs Per Per Eng. Make & Model Engine Eng. DOMAN 12 LZ-5-1, -2 Lyco SO-580-A1B 16 12 D-11 Lyco SO-580-A1B 16 12 ENSTROM 12 F28A, C, F280C, Lyco HIO-360-E 8 12 F28BF, 28F, 280F, Lyco TIO-360-B2A 8 12 Lyco HIO-360-F1AD 8 12 Shark, 280FX, 280L 12 HILLER 12 UH-12B Frank 6V4-200-C33 12 UH-12C Frank 6V-335-B 12 8 UH-12D Lyco VO-435-A1C 12 8 UH-12E, 12E4 Lyco VO-540-C2A 12 8 UH-12L Lyco VO-540-C 12 12 Lyco TIVO-540-A 12 12 SL 3/4

18 Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

C


s.

Spark Plugs

U.S. Helicopter and Piston Engines

Make & Model Engine

HYNES H-2 H-5

Lyco IVO-360-A1A Lyco IVO-540-A1A

4E Sedan

Frank 6V-335

K-240

Lyco O-435-4

BS-12SR/BS-12SC BS-12A

2/Frank 6A-335-A 2/Lyco O-540-F

R22 Alpha

Lyco O-320-B2C

Model B

Lyco IVO-360-A

JOVAIR CORP. KAMAN

OMEGA

ROBINSON

SCHEUTZON

Plugs Plugs Per Per Eng. Make & Model Engine Eng. 8 8

SCHWEIZER

200 269-A 300 12 300-C SIKORSKY 12 S-51 12 S-55A 12 S-55C S-56 8 S-58 VERTOL 8 Workhorse 44

Lyco HIO-360-B Lyco O-360-C2B Lyco HIO-360-A Lyco HIO-360-D1A

8 8 8 8

P & W R-985-B4 Wright R-1300-3 P & W R-1340-57 2/P & W R-2800-50 Wright R-1820-84

18 14 18 36 18

Wright R-1820-103-977C9HD1

18

International Aircraft Using U.S. Piston Engines

Make & Model Engine

ARGENTINA AERO BOREO

Model 95 Cont C-90-12F Model 115 Lyco O-235-C2A Model 150 Lyco O-320 Lyco O-360-A Model 180 Model 260 Lyco O-540 AVIONES LOCKHEED-KAISER CL-402 Cont IO-470-R & TSIO -470 I.A.E. Calquin 24 2/P & W R-1830-SC-G Model 45 2/Lyco O-320-A Model 46 Ranquel Lyco O-320-A Model IA-46 180 Ranquel Lyco O-360-A1A PETROLINI El Boyero Cont A-65

AUSTRALIA

COMMONWEALTH Ceres CA-28 Transavia Wackett Winjeel CA-25 Wirraway 3 DE HAVILLAND Drover DHA-3 VICTA AVIATION LTD. Airtourer 100 Airtourer 115 YOEMAN AVIATION YA-1 Cropmaster

AUSTRIA

P & W R-1340, S3H1 PL 12/T-300 & PL 12/T-400 Warner Super Scarab P & W R-985-SB3 P & W R-1340, S1H1 3/Lyco O-360-A Cont O-200-A Lyco O-235-C1 Lyco 540-A1A5

GRAZ-PAUKER Flamingo M-222 Flamingo SPG222

2/Lyco O-320-A 2/Lyco IO-360

AVIONS FAIREY Typsy Junior

Cont A-65

AEROTEC Uirapuru T-23

Lyco O-320-B2B

BELGIUM BRAZIL

Plugs Plugs Per Per Eng. Make & Model Engine Eng. EMBRAER Cont TSIO-360-FB1 12 8 Corisco EMB-711ST Lyco O-540-H2B5D 12 8 Ipanema EMB-200 Lyco O-540-H1B5D 12 8 Ipanema EMB-200A Lyco O-540-K1J5D 12 8 Ipanema EMB-201 Lyco IO-540-K1G5 12 12 Minuano EMB-720D Seneca EMB-810D Cont L/TSIO-360 12 Lyco IO-540-K1G5D 12 12 Sertanejo EMB-721 Tupi EMB-712 Lyco O-360-A4M 8 FABRICA DO GALLEAO 28 Niess Maranhao Cont C-85 8 8 FOKKER 8 S-11 Lyco O-435 12 8 NEIVA IPD 5802 Lyco O-320-A 8 8 Paulistinha Frank 4AC-176-B2 8 Paulistinha 56 Cont C-90-8F 8 Regente Lyco O-360-A 8 18 Universal T-25 Lyco IO-540-K1D5 12 12 OMAREAL 2/Cont E-185-11 12 14 Casmuniz 52 18 CANADA 18 AVRO (Federal) Anson 5 P & W R-985-AN-12B 18 8 C.C.F. Norsman V P & W R-1340, S3H1 18 8 CANADAIR 8 CL215 2/P & W R-2800-CA-3 36 DE HAVILLAND P & W R-985 18 12 Beaver DHC-2 Otter DHC-3 P & W R-1340, S3H1 18 Caribou DHC-4 2/P & W R-2000-D5 28 8 FAIRCHILD P & W R-985-SB3 18 8 Husky F11 FLEET Canuch 80 Cont C-85-12J 8 FOUND BROS. AVIATION 8 FBA-2A, FBA-2C Lyco O-540-A1D 12 100 Centennial Lyco IO-540-G 12 NORTHWEST INDUSTRIES 8 Ranger Lyco IO-720-A 16

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs. 19


Spark Plugs

International Aircraft Using U.S. Piston Engines

Plugs Plugs Per Per Eng. Make & Model Engine Eng. JODEL D-112 Cont A-65 8 Cont C-90 8 Cont O-470-11 12 D-120 D-140 Lyco O-360 8 JURCA M.J. 2 Tempete Cont A-65 8 LATECOERE Lyco O-320-E2A 8 631 6/Wright R-2600-20 28 LEGRAND-SIMON Lyco AEIO-540-L1B5D 12 LS-50 Cont C-90 8 MATRA AIRCRAFT Magnet Jupiter 2/Lyco IO-360-A 12 Cont C-145 12 MAX HOLSTE P & W R-985 18 Cont O-300 12 Broussard M.H. 1521 Super Broussard MH-250 2/P & W R-1340 18 Major Broussard MH-350 2/Cont GIO-470-A 12 MORANE-SAULNIER Cont A-65 8 RALLYE MS-880 Cont C-90, O-200 8 Lyco AEIO-360-A1B6 8 MS-885 Lyco O-320-A 8 Cont A-65-8 8 MS-890 Lyco O-360 8 Lyco IO-360 8 Lyco O-360-A4M 8 MS-893 Cont O-470-A 12 PIEL Emeraude C.P. 301 Cont C-90-12F 8 POTEZ-SEEMS MS-885 Super Rallye Cont O-300 12 Cont A-65-8 8 REIMS AVIATION Cont C-75 8 F150, FA150 Cont O-200-A 8 FRA150L, M RR/Cont O-240 8 Lyco O-320-D2A 8 F172D thru K RR/Cont O-300-A 12 Lyco O-360-A1AD 8 F172L, M Lyco O-320-E 8 Lyco IO-540-C4D5D 12 FR172 Rocket RR/Cont IO-360-D 12 Lyco TIO-540-ABIAD 12 F177RG Cardinal Lyco IO-360-A 8 Cont O-470-R 12 Lyco AEIO-540-L1B5D 12 A182J thru N F337 2/RR/Cont IO-360-C & D 12 2/Cont TSIO-360-C 12 Lyco O-320 8 FT337 Super Skymaster ROBIN (CEA) Lyco O-360 8 2 + 2 Tricycle Lyco O-235-C 8 Cadet, Petit Prince Lyco O-235-C 8 Lyco O-235-L2A 8 Chevalier Lyco O-320-D 8 Lyco O-320-D2A 8 Major 160 Lyco O-320-E 8 Lyco O-360-A3A Prince Lyco O-360-D 8 Lyco O-320-D2A 8 Regent Lyco O-360-A 8 HR-100 Lyco IO-360 8 Lyco O-540-B 12 Lyco O-435-1 12 HR-100 Cont 6A-285 12 Cont E-165-4 12 HR-100 Lyco O-320 8 SCINTEX ML .250 Rubis Lyco O-540-A 12 SIPA 4/P & W R-2800-CA18 36 S-91 Cont C-85-12F 8 S-94 Cont C-90-8-F 8 Cont C-90 8 Coccinelle S-1000 Cont C-90-12F 8 S-1100 2/P & W R-1340 18 Cont A-65-8 8 S.N.C.A.N 2/P & W R-2800-CB17 36 Cont C-90 8 Nord 2503 SOCATA Lyco O-540-B4B5 12 Cont C-90 8 Gabier R235F Lyco IO-360-C 8 Cont O-200 8 Diplomate, Provence ST-10 Rallye Club RR/Cont O-200-A 8 Rallye Minerva Franklin 6A-350-C1 12 Cont A-65 8 Rallye Commodore Lyco O-360-A 8 Cont C-90 8 Rallye 7 Lyco IO-540-K 12 Tampico TB9 Lyco O-320-D2A 8 Lyco O-320-A 8 Tobago TB10 Lyco O-360-A1AD 8 Trinidad TB20 Lyco IO-540-C4D5D 12 2/Wright R-1820 18 Trinidad TB21 Lyco TIO-540-AB1AD 12

Make & Model Engine

CHILE

FANAERO Chincol

CHINA, REPUBLIC OF (Taiwan) A.I.D.C. PL1B

CZECHOSLOVAKIA ZLIN 50LS

EGYPT

HELIOPOLIS AIRWORKS Gomhouria MK-2 MK-6

FINLAND

HEINONEN HK-1 VALMET L-70 PIK-11 PIK-23 Tuuli TL-111

FRANCE

ADAM Loisers R.A. 14 Major R.A. 15 SOCATA TB9 Tampico TB10 Tobago TB20 Trinidad TB21 Trinidad TC TB30 AUBERT Cigale PA-204L Super Cigale AVIONS PIERRE ROBIN Dauphin Major Regent, Remorqueur 8R2160, R3000 BOISAVIA Mercurey B-601 (Equiv. O-435-K, -K1) Mercurey B-602, B-60 BREQUET Provence 763 BROCHET M.B. 120 C.A.B. Minicab GY-20 Supercab GY-30 CENTRE-EST DR-100 Ambassadeur DR-1050 DRUINE Condor DO-61 Condor DO-62 GARDAN Horizon GY-80 HUREL-DUBIOS H.D. 34, 321

20 Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.

C


s.

International Aircraft Using U.S. Piston Engines

Make & Model Engine

FRANCE (Cont’d) SUD-EST Languedoc S.E. 161 Bretagne S.O. 30P WASSMER D-120 Super 4 Sancy Super 4/21-235 Super 4/21-250 Super 4 Baladou WA-41 Super 4 Sancy WA-40A Pacific WA51 GERMANY

BOELKOW/MBB BO-207 BO-208 A/C BO-209 BO-209C BUECKER BU-181B1 131 Lerche DORNIER DO-27A, -27B-2/3, -27Q-1/4/5 DO-27B-1 DO-27H-2 DO-28A-1 DO-28B-1 DO-28D-1/D-2 EQUATOR AIRCRAFT GMBH P-300, 350 P-400 P-420 P-450 GROB G115 / G115A G115B G115C G115C2 G115D G115D2 G115T KLEMM KL 107 B/C RHEIN-FLUGZEUGBAU GMBH X114 SCHEIBE SF 23/A/A1/B SF 23-C SPORTAVIA-PUETZER Elster B Elster C

GREAT BRITAIN

BEAGLE-AUSTER Atlantic Alpha J5 & 5A Arrow J/2 Agricola B-8 Pup 150 Workmaster, Airdale A109 B121 B206S BEAGLE-MILES Caravan HDM-106 Martlet M 117

4/P & W R-1830-92 2/P & W R-2800-CA18 Cont C-90 Lyco O-360-A Lyco O-540-B2B Lyco O-540-A Lyco O-360-A Lyco O-360-A Lyco O-320-E Lyco O-360-A1A Cont O-200-A Lyco 320-E2F Cont O-240-A Lyco O-235-C Lyco IO-360-B1B Lyco GO-480-B1A6 Lyco IO-540-A1D Lyco GSO-480-B1A6 Lyco O-540-A1D Lyco IO-540-A1A5 Lyco IGSO-540-A1E Lyco TIO-540 Lyco IO-720 2/Lyco TO-360 Lyco TIGO-540 Lyco O-235-H2 Lyco O-320-D1A, -D2A, -D3G Lyco O-320-DIA Lyco O-360-A1F6 Lyco AEI0-360-B1F Lyco AEI0-320-D1B Lyco AEI0-540-D4A5 Lyco O-320-A2A Lyco IO-360 Cont C-90-12F Lyco O-235-C1 Cont C-90-12F Lyco O-320-A2B Cont E-185 Lyco O-290 Cont C-75-12 Cont O-470-M Lyco IO-320 Lyco O-360-A RR/Cont O-200 2/RR/Cont GTSIO-520-C 2/Lyco GSO-480-B Cont O-200

Spark Plugs

®

Plugs Plugs Per Per Eng. Make & Model Engine Eng. BRITTEN-NORMAN BN-2B-21 Islander 2/Lyco IO-540-KIB5 12 28 BN-2 Islander 2/Lyco O-540-E 12 36 BN-2A-2 Islander 2/Lyco IO-540 12 BN-2A Trislander 3/Lyco O-540-E 12 8 BROOKLANDS 8 Lyco IO-540 12 12 DA-7 Optica Scout NORMAN 12 8 NAC-1 Freelance Lyco O-360 8 8 PERCIVAL 8 E.P. 9 Lyco GO-480-B 12 Prospector Lyco GO-480-G1A6 12 8 SCOTTISH-AVIATION 2/P & W R-1340 18 8 Twin Pioneer 8 SHORT 8 Sandringham 4/P & W R-1830-90C 28 INDIA 8 8 HINDUSTAN Basant HA-31 Lyco IO-720-C 16 12 Pushpak Cont C-90 8 12 INDONESIA 12 ANGKATAN 12 Cont C-85, C-90 8 12 NU-85 Grasshopper Cont O-470-J 12 12 NU-225 Sikumbag ITALY 12 AGUSTA 16 P.111 (Equiv. O-435-K, -K1) Lyco O-435-1 12 8 47G Franklin 6V4-200 12 12 47G-2, 47J Lyco VO-435 12 8 Model 102 P & W R-1340 18 8 ALAPARMA 8 Montelli AM-10 Cont A-65 8 8 AMBROSINI 8 Cont C-90 8 8 Rondone Lyco O-290-D2 8 12 Rondone AVIMILANO 8 Falco F-8 Lyco O-290-D2 8 Falco F-8L Lyco O-320 8 8 Nibbio F-14 Lyco O-360 8 Cont C-90-12F 8 8 Scricciolo P-19 8 FIAT G-49-2 P & W R-1340 18 8 LUALDI 8 L-55 Lyco O-360 8 MACCHI 12 M.B. 308 Cont C-85, C-90 8 8 M.B. 320 2/Cont E-185, E-225 12 8 M.B. 323 P & W R-1340 18 12 M.B. 420 Cont TSIO-470-B 12 8 METEOR 8 Cont C-85 8 8 F.L. 3 Cont A-65 8 12 F.L. 53 F.L. 54 Cont C-90 8 12 F.L. 55 Lyco O-320 8 8

Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs. 21


®

Spark Plugs

Make & Model Engine

ITALY (Cont’d) NARDI FN-333 PARTENAVIA P48B P52 P59 P55, P57 P57-1 P57-11 P64B Oscar 180 P64B Oscar 200 P66B Oscar 100 KANPUR HA-31 Mk.2 PIAGGIO P66B Oscar 150 P66C P68, P68B, P68C, P68R P68TC P70 Alpha P-149 P-136 P-136-L P-136-L1 P-136-L2 P-148 P-166 P-155-SAM-1 P-150 P-166-B/C PROCAER PICCHIO F-15 F-15A SIAI-MARCHETTI Riviera S206 S-205-18R S-205-20/F, 205-20/R S-205-22R S-208, SF-260, F-260, F-260B S-F260C JAPAN

FUJI Nikko LM-1, Mentor B-45 KM-11 Aero-Subaru FA-200-160 FA-200-180 TL-1 T3 KAWASAKI KAL-1, -2, KAT-1 TACHIKAWA R-HM

MEXICO

AZCARATE LA-60

Cont O-470-H Cont A-65 Cont C-90 Cont O-200 Lyco O-320 Lyco O-340 Lyco O-360-B Lyco O-360-A Lyco IO-360-A Lyco O-235-C Lyco IO-720-C1B Lyco O-320-A Lyco O-320 2/Lyco IO-360-A Lyco TO-360-C RR/Cont O-200-A Lyco GO-435-C2 GSO-480-B1A6 2/Frank 6A8-215-B9F 2/Lyco GO-435-C2 2/Lyco GO-480-B 2/Lyco GSO-480-A1A 2/Lyco O-435-A 2/Lyco GSO-480-A1A 2/P & W R-2800 P & W R-1340 Lyco IGSO-540 Lyco O-320-B Lyco O-360-A Cont IO-470-P Franklin 6A-350-C1 Lyco O-360-A Lyco IO-360-A Franklin 6A-350-C1 Lyco O-540-E Lyco AEIO-540-D4A5 Cont O-470-13 Lyco GSO-480-A1A Lyco O-320-B Lyco O-320-D Lyco. O-360-B Lyco IGSO-480-A1A6 Lyco IGSO-480 Lyco GO-435-C2B Cont C-90 Cont IO-470-R Cont TSIO-470-A

International Aircraft Using U.S. Piston Engines

Plugs Plugs Per Per Eng. Make & Model Engine Eng. VEST AIRCRAFT Super Heron (Modified) 4/Lyco GSO-480-B1A6 12 12 NETHERLANDS HOLLANDAIR 8 H. A. -001 Libel Lyco O-290-D2 8 8 P HILIPPINE REPUBLIC 8 BUREAU OF SCIENCE 8 L-21S Vinta Cont O-470-B 12 8 POLAND 8 L.W.D. 8 ZAK-2 Cont A-65 8 8 Polskie Zaklady Cont TSIO-360 12 8 PzL-M20 Cont TSIO-360-KB 12 SPAIN 16 AISA Cont C-90-12F 8 8 Peque I-11B Cont O-470-A 12 8 AVD-12C 8 C.A.S.A 8 Halcon CASA 202B 2/Wright R-1820-56 18 8 DORNIER 12 C-127A Lyco GO-480-B 12 HISPANO 12 HA-100-F1 Wright R-1300 14 12 SCOTLAND 12 SCOTTISH AVIATION 12 Lyco AEIO-360-A 8 12 Bullfinch 12 SWEDEN 36 ANDEREASSON Cont A-65, C-85 8 18 BA-6 12 GOTAVERKEN GV-38 LeBlond (90 hp) 10 8 A.B. MALMO 8 MFI Junior Cont O-200 8 MFI-10 Vipan Lyco O-320-A 8 12 MFI-10C Vipan Lyco O-360 8 12 SAAB 8 90-A-2 2/P & W R-1820 28 8 91-B, -C Safir Lyco O-435-A 12 12 91-D Lyco O-360-A1A 8 12 Lyco IO-360 8 12 Safari SWITZERLAND FFA FLUG-UND 12 FAHRZEUGWERKE 12 AS 202/15 Lyco O-320-E2A 8 8 AS 202/18A Lyco AEIO-360 8 8 AS202/26A Lyco AEIO-540-D4B5 12 8 PILATUS 12 P-3 Lyco GO-435-C2A 12 12 PC-6 Lyco GSO-480-B1A6 12 YUGOSLAVIA 12 IKARUS P & W R-1340 18 8 Type 214, 522 UTVA AIRCRAFT FACTORY Lyco IGO-360-B1F 8 12 UTVA-75, -75V Lyco AEIO-540 12 12 UTVA Lasta

22 Contact your preferred distributor for Champion factory FAA certified servicing of your spark plugs.


s.

SLICK by Champion

SLICK by Champion

Consult Slick by Champion L-1318 for complete application. Available free at www.championaerospacepubs.com 23


®

SLICK by Champion

One Powerful Kit • One Proven Source • Total Energy Delivered

Announcing a complete piston ignition system from the leader in aviation Champion spark plugs Slick by Champion™ harnesses and magnetos

Consult Slick by Champion L-1318 for complete application. Available free at www.championaerospacepubs.com 24


SLICK by Champion

Soaring to new heights with innovative performance technology solutions

SlickHarnesses by Champion

Consult Slick by Champion L-1318 for complete application. Available free at www.championaerospacepubs.com 25


®

SLICK by Champion

“World record flights are nerve-wracking enough without having to worry about starting on time. All 28 records we hold with the Exxon Flyin’ Tiger have started with SlickSTART.” - BRUCE BOHANNON

Cold start. Hot start. Any start.

Also From Champion... LASAR

Slick Magnetos

Champion Aviation Spark Plugs

Slick Harnesses

SlickSTART

Improve your engine starting — hot or cold. SlickSTART™ unleashes a firestorm of ignition energy to get your engine started and get you off the ground. SlickSTART is so effective, even sub-optimal fuel mixtures and seriously fouled plugs won’t stop the capacitive discharge output from providing the ignition boost your engine needs for reliable starts every time.

SlickSTART’s sure starting power... • Delivers up to 340% more spark energy to your plugs. • Overcomes poor engine priming. • Reduces costly electrical stress to your battery and starter. • Requires no maintenance. • Is approved for use with Slick magnetos. Plus, it’s inexpensive and easy to install. Just add SlickSTART to your impulse coupled magnetos or replace your antiquated starting vibrator. For more information, call Champion Aerospace today. Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina U.S.A. 29657 Email: slicksupport@champaero.com www.championaerospace.com © 2009 Champion Aerospace LLC Slick and LASAR® are registered trademarks of Champion Aerospace LLC

Consult Slick by Champion $L2-96 for complete application. Available free at www.championaerospacepubs.com 26


SLICK by Champion

®

4300/6300 Series Magneto

Now

Take a close look at Slick’s 4300/6300 Series and you’ll see what we are doing to make magnetos better. At Champion Aerospace, we’re always looking for ways to make our magnetos better. So we asked experienced mechanics for their ideas on the ideal magneto. The result is Slick 4300/6300 Series magnetos that make timing, installation, inspection, and maintenance simpler and more convenient than ever before. We also incorporated mechanicendorsed features to improve performance and service life.

• • • • •

Lift-off housing – Internal timing is not disturbed during inspections. Simplified internal timing – Improved internal markings and unique Slick E-gap tool make timing easier and more accurate. Fully sealed bearings – Keeps contaminants out and grease in for smoother operation, less maintenance. Lower EMI Levels – Redesigned housing improves sealing and results in less radio noise. OEM Approved – Models are available for more than 225,000 engines – all compatible with existing Slick Ignition Harnesses.

Get the ignition system that meets your needs for simple maintenance and quality performance. Contact your Slick Distributor for application information.

Slick Technical Support: slicksupport@champaero.com 27


®

Harnesses

Aircraft Engine Applications

Slick® Rebate Program

Program Details 1.

Return competitive magneto cores and harnesses to the distributor where Slick units were purchased.

2.

Magnetos must be complete and in “as removed” condition. (Remove drive gears.)

3.

Champion Aerospace reserves the right to reject incomplete magneto cores, including Slick 4000/4100 series magnetos.

4.

Champion Aerospace piston products distributors will return cores to Champion Aerospace for processing, and all rebate and core credits will be issued by your authorized Slick distributor.

Eligible products and rebates Products

Champion Aerospace Cash Rebate

Two (2) TCM/Bendix magnetos and any complete ignition harness (not SLICK or Champion)

$250

One (1) TCM/Bendix magneto

$100

Two (2) Competitive magnetos (not TCM/Bendix) and any complete ignition harness (not Champion)

$150

One (1) Competitive magneto (not TCM/Bendix)

$30

One (1) Competitive ignition harness (not Champion)

$35

For more information, contact your Champion Aerospace ignition products distributor or email slicksupport@champaero.com.

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, USA 29657 www.championaerospace.com Form L-1470F

March 1, 1009

ConsultChampion Slick by and Champion for trademarks complete application. Available LLC free at www.championaerospacepubs.com Slick areL-1318 registered of Champion Aerospace © 2009 Champion Aerospace LLC

28


Introducing a New, Improved Shorter Oil Filter Customers told us the height of a standard oil filter can make it difficult for them to install the filter in certain engine applications.

So, operating on the premise that size really does matter, we made our Champion oil filter can 1/2” shorter and, in the process, added design improvements that now make our filters stronger and more effective than ever before.

Oil Filters

Shorter Installed Height Shortened can height by approximately 1/2”, with no impact to the filter media’s performance.

By-Pass Valve Meets TCM Specifications

Improved Spring Replaced old “leaf” spring with an improved coil spring design. Thicker-Walled Can Increased wall thickness for improved structural integrity. Stronger Center Tube Redesigned center tube for added strength, with collapse pressures more than double the current design. New Inlet Design Changed four-hole design to an eight-hole design for approximately 30% greater inlet flow area. Increased Lid Thickness Increased thickness of seaming lid by approximately 35%, which subsequently provided for higher burst and impulse testing. Improved Baseplate Thread Replaced cut thread with an improved rolled thread, without affecting tolerances on the thread dimensions. New Zinc-Plated Stud Incorporated new zinc-plated stud for increased protection against rust and corrosion (applicable to Champion part numbers CH48110-1 and CH48111-1).

See what a sizeable difference 1/2” can make in your life. For more information, call, fax, or log onto www.championaerospace.com

®

Champion Aerospace’s full-pleat, resin-impregnated micronic filter media traps all harmful particles, including metallic chips which result from abnormal engine wear. Because the oil flows through many layers of locked-in fibers, there is no migration of fiber material to clog engine oil passages or affect bearing surfaces. According to industry-approved tests, the Champion oil filter traps and holds more dirt and harmful particles during its normal operating time than any other similar filter.

29


Oil Filters

Full-Flow Spin-On Filters Champion Replacement Filter Elements CFO-100-1 Short Element CFO-101-1 Long Element

CH48103-1

CH48104-1

CFO-205 Element Gasket Kit

Oil Filter Packaging Information Lycoming CH48103-1 CH48104-1 (Interchangeable)

Champion Aerospace spin-on oil filters are packaged in individual boxes, with part numbers displayed prominently. All are equipped with an attached installation gasket. Those with male threaded studs have thread protectors to avoid damage. All sizes of spin-on filters are packed 12 per case of a single part number, in heavy, reshippable corrugated-board cartons. Champion oil filter elements are individually boxed, each with a plastic bag containing installation gaskets and instructions. This provides ample protection for these elements in storage and assures availability of necessary items for correct installation.

CH48108-1

CH48109-1

All sizes of replacement elements are packed12 per case of a single part number in heavy, reshippable corrugated-board cartons.

Spin-On Oil Filters for Teledyne Continental Motors (TCM) Engines Continental CH48108-1* (TCM No. 649922) CH48109-1* (TCM No. 649923) (Interchangeable)

CH48111-1 CH48110-1

Lycoming and Continental CH48110-1 CH48111-1 (Interchangeable)

Champion CH48108-1 and CH48109-1 oil filters have been assigned TCM part numbers 649922 and 649923. Many TCM engines have been modified per TCM service bulletins M74-2, M86-6 (Rev.1), Cessna conversion kits or through local field approval. These modifications may require a different filter part number than the one listed in our application data. Following is a list of filter adapters used on TCM engines with the recommended Champion filter.

Manufacturer

Adapter

Filter

Cessna Cessna Cessna Cessna Cessna Cessna Cessna Cessna TCM 633324

1250403-2 1250922-1 1250922-2 1250922-3 1250922-4 1250922-5 0556010-1 0450404-2 CH48110-1

CH48110-1 CH48110-1 CH48110-1 CH48110-1 CH48109-1 CH48108-1 CH48110-1 CH48110-1

The airframe or engine manufacturer should be consulted for filter application data on field modified engines.

* These filters are equipped with an internal bypass valve. They can be used on any TCM engine equipped with or without a bypass valve in the oil filter engine adapter.

30


Oil Filters

Full-Flow Spin-On Filters

For Lycoming and Continental Engines

CH48103-1

CH48110-1 CH48110-1

CH48212 Converter Stud CH48210 Converter Plate CH48211 Converter Gasket CH48922 (54E23093) Spin-On Oil Filter Converter Kit

Textron Lycoming now supplies the converter kit, formerly sold under Champion P/N: CH48922. This kit is now available from your Lycoming distributor under P/N: 54E23093.

31


Oil Filters Champion Spin-On Champion Filter Element Model

CH48108-1 CH48108-1 CH48110-1 CH48108-1 CH48108-1 CH48108-1 CH48103-1 CH48103-1 CH48103-1 CH48108-1 CH48108-1 CH48108-1 CH48108-1 CH48109-1 CH48109-1 CH48108-1 CH48110-1 CH48108-1 CH48110-1 CH48109-1 CH48109-1 CH48108-1 CH48110-1 CH48108-1 CH48108-1 CH48108-1 CH48108-1 CH48109-1 CH48109-1 CH48108-1 CH48108-1 CH48109-1 CH48108-1 CH48108-1 CH48108-1

CFO-100-1 CFO-100-1 – CFO-100-1 – – CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 – CFO-100-1 – – CFO-100-1 CFO-100-1 CFO-100-1 – – – CFO-100-1 – CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 – – CFO-100-1 CFO-100-1 – – – CFO-100-1

CFO-100-1 CFO-100-1 – CFO-101-1 CFO-100-1 CFO-100-1 – – CFO-100-1 – CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 –

  

CH48108-1 CH48110-1 CH48103-1 CH48111-1 CH48108-1 CH48108-1 CH48108-1 CH48110-1 CH48110-1 CH48110-1 CH48110-1 CH48103-1 CH48103-1 CH48108-1 CH48108-1 CH48108-1

  

  

CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 – –

CH48108-1 CH48108-1 CH48108-1 CH48108-1 CH48110-1 CH48108-1

  

  

  

  

  

        

CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1

IO-540-K CH48110-1 IO-540-K CH48110-1 IO-520-D – TIO-540 CH48110-1

BELLANCA

17-31A, 17-31ATC 17-31A Viking 17-31A Viking 17-31ATC Turbo

DUCHESS

76

O-360 CH48110-1 CFO-100-1 IO-360, L2A CH48110-1 CFO-100-1 LO-360-A1G6D & O-360-A1G6D CH48103-1

95, B95 B95A, D95A, E95

TRAVEL AIR

IGSO-480 CH48111-1 CFO-101-1 IGSO-540 CH48111-1 CFO-101-1

65, 70 80, 88, B80

TIO-541 CH48104-1 CFO-101-1

QUEEN AIR

60, A60, B60

DUKE

IO-520 – CFO-100-1 IO-520C CH48109-1 – TIO-541-E CH48104-1 CFO-101-1 TSIO-520-L++ – CFO-100-1 TSIO-520-L, -W, -B CH48108-1 – IO-550 CH48109-1 –

C55, D55, E55, 58 C55, D55, E55, 58 56TC, A56TC Baron 58P Baron 58P, 58TC Baron 58C, 550

O-235-L2C CH48110-1 –

BEECH BARON

O-470 O-470-U++ IO-540-AB1A5 O-470 O-470-U++ O-470-U++ O-540-J3C5D O-540-L3C5D O-540-L3C5D IO-470, IO-520 IO-470, IO-520 IO-520 O-470, IO-520 IO-520D TSIO-520 IO-470 IO-540 IO-520 IO-540-AC1A5 IO-520 TSIO-520 IO-520 TI0540-AJ1A TSIO-520 IO-520 TSIO-520 IO-520 IO-520 TSIO-520 TSIO-520 IO-470, IO-520 IO-520 TSIO-520 TSIO-520 TSIO-520++

77

O-300 O-320 O-320-H2AD O-320-D2J O-300 IO-360 IO-360-K IO-360-L2A O-360-F1A6 IO-360-L2A O-320 O-360-A1F6D IO-360-A1B6D O-470 O-470-U++ 1111O-470-U++

IO-360, -L2A CH48110-1 CFO-100-1

SKIPPER

O-200 O-200 O-200 O-200 O-235-L2C, H2C 0-200-D

24, A-24, A-24R, B-24R, C-24R

SIERRA

O-320 CH48110-1 CFO-100-1 O-320 CH48110-1 CFO-100-1 O-320 CH48110-1 CFO-100-1 IO-346 – CFO-100-1 IO-346A CH48109-1 – O-360 CH48110-1 CFO-100-1 O-360A4JD CH48103-1 CFO-100-1

Sport III 23 A23-19, 19A, B19 Sport A23, 23, A23A A23, A23A B23, C23 Sundowner B23

MUSKETEER

CESSNA

150 A thru M F150 F thru M A150L FA150 152 162 C-172 172 A thru H 172 I thru M 172N 172P F172 D thru H FR172 E thru K R172K 172R and S 172RG 172S 177 177A, B 177RG 180 A thru J 180Q 180-S/N 53087 & Up C-182 182 A Thru P 182Q, R 182S A182 K thru N 182-S/N 67042 & Up F182-S/N 00130 & Up R182 T182 TR182, FTR182 185 A thru D A185E, F 185-S/N 03852 & Up 188 188-S/N 03474 & Up T188-S/N 03474 & Up 205A C-206 206 A thru G 206H 206-S/N 05030 & Up 206-S/N 05030 & Up U206 T-206H TU-206 P206 TP206 207 207-S/N 05227 & Up T207-S/N 05227 & Up T207 210 210-S/N 63373-63375 & Up T210-S/N 63373-63375 & Up P210-S/N 278 &Up T210, P210-S/N 1-277

IO-520 – CFO-100-1 IO-520B CH48109-1 –

NOTE: All Cessna aircraft modified under Cessna Service Bulletin SEB-93-1 or MEB 93-1, require Champion Oil Filter CH48108-1. The CH48109-1 may also be used if clearance permits installation.

C33A, E33A, E33C C33A, E33A, F33C

Champion Spin-On Champion Filter Element

Engine Model

IO-520 – CFO-100-1 IO-520B CH48109-1 – IO-470N CH48108-1 O-470 CH48108-1 – IO 470-C CH48108-1 IO-470-N CH48108-1 IO-520 – CFO-100-1 IO-520B CH48109-1 – TSIO-520 – CFO-100-1 TSIO-520D CH48109-1 – IO-520B CH48109-1 – IO-520B CH48109-1 – TSIO-520-UB CH48109-1 – IO-550 CH48109-1 –

DEBONAIR/BONANZA

CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1

E33A, F33A, F33B, F33C E33A, F33A, F33B, F33C G-33 H-35 J, K, M-35 N, P-35 S35, V35, V35A, V35B S35 V35TC, V35A-TC, V35B-TC V35TC, V35A-TC, -V35B-TC V35, V35A, V35B 36, A36 A36TC, B36TC B36-550

BEECH BONANZA

CH48110-1 CH48110-1 CH48103-1 CH48103-1 CH48103-1

O-320-D2A O-360-A1AD IO-540-C4D5D TIO-540-AB1AD AEIO-540-L1B5D

TB9 Tampico TB10 Tobago TB20 Trinidad TB21 Trinidad TC TB30 AEROSTAR (See Piper)

AEROSPATIABLE (Socata

Engine Model

Model

Aircraft Engine Applications

®

Aircraft engines not listed, but equipped with oil filters at overhaul, may accept Champion filters. Contact Aviation Service Department for further information. Please include description of your engine. ++ Reference page 25-26 for other TCM application data. * Requires Lyco (54E23093)

32


Oil Filters

Aircraft Engine Applications

Model

CESSNA T303 310 C thru Q 310 R T310P, Q, R 320-A 320-B, C 320-D 320-D, E, F 335 336 337 P337, P337H T337H 340 340A 401/402 402C 404 411-S/N 000 thru 0126 411-S/N 0127 and up 414, 414A 421A, B 421C-S/N 1017 thru 1404 CIRRUS AIRCRAFT SRV, SR20 SR22 COLUMBIA/LANCAIR COLUMBIA 300, 350 COLUMBIA 400 DIAMOND AIRCRAFT DA20-1C DA40-180 GULFSTREAM AMERICAN (Single Engine Models) AA-1, 1A, 1B, 1B Trainer, TR A1C Lynx, T-Cat AA-5 Traveler AA-5A Cheetah AA-5B Tiger Cougar COMMANDER 112, 112A 112TC 114 500B, 500U 700

Engine Model

Champion Spin-On Champion Filter Element Model

LTSIO-520-AE & TSIO-520-AE CH48109-1   – IO-470 CH48108-1 CFO-100-1 IO-520-M CH48108-1   – TSIO-520-B CH48108-1 CFO-100-1 TSIO-470 CH48104-1   – TSIO-470 CH48109-1 CFO-101-1 TSIO-520    – CFO-100-1 TSIO-520-B CH48108-1   – TSIO-520-EB CH48109-1   – IO-360 CH48108-1 CFO-100-1 IO-360 CH48108-1 CFO-100-1 TSIO-360 CH48108-1 CFO-100-1 TSIO-360-H CH48108-1 CFO-100-1 TSIO-520-K CH48108-1   – TSIO-520-N, -NB CH48109-1 CFO-100-1 TSIO-520-E CH48108-1 CFO-100-1 TSIO-520-VB CH48109-1 CFO-100-1 GTSIO-520-M CH48111-1 CFO-101-1 GTSIO-520-C CH48104-1 – GTSIO-520-C CH48111-1 CFO-101-1 TSIO-520-J, -N CH48108-1   – GTSIO-520-D, -H, CH48111-1 CFO-101-1 -L, -N, ++ CH48111-1 CFO-101-1 I0-360ES CH48108-1 I0-550N CH48109-1 I0-550N CH48109-1 CFO-100-1 TS10-550 CH48109-1 CFO-100-1 I0-240 CH48108-1 CFO-100-1 I0-360 CH48110-1 CFO-100-1

2/Lyco O-235 CH48110-1 Lyco O-235-L CH48110-1 Lyco O-320-E CH48110-1 Lyco O-320-E CH48110-1 Lyco O-360-A4K CH48110-1 2/Lyco O-320-D CH48110-1

CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1

IO-360-C, -L2A CH48110-1 TO-360-C1A6D CH48103-1 IO-540-T4A5D CH48103-1 IO-540 CH48110-1 TIO-540-R2AD CH48103-1

CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1

Engine Model

®

Champion Spin-On Champion Filter Element

MAULE M5-180C, MX7-180 O-360-C, -C1F CH48110-1 M5-210C IO-360D, -L2A M5-210TC TO-360-C1A6D CH48103-1 M5-235C, M6-235, M7-235 O-540-J1A5D CH48103-1 MX-7-235 O-540-W1A5D CH48103-1 MOONEY AIRCRAFT M20A, B, Mark21 O-360 CH48110-1 M20D Master O-360 CH48110-1 CFO-100-1 M20C Ranger O-360 CH48110-1 M20G Statesman O-360 CH48110-1 CFO-100-1 M20E Chaparral IO-360, -L2A CH48110-1 CFO-100-1 M20F Executive IO-360, -L2A CH48110-1 CFO-100-1 M20J-201 IO-360-A3B6D, -L2A CH48103-1     – M20K-231 TSIO-360-G, LB CH48108-1 M20M-TLS TIO-540-AFIA, B CH48110-1 M20R IO-550 CH48108-1     – M22 Mustang TIO-541 CH48110-1 CFO-100-1 M20K-252 TSE TSIO-360-MB1 CH48108-1    – PIPER CUB PA-18 “150” O-320 CH48110-1 CFO-100-1 TRI-PACER PA-22 “150” O-320 CH48110-1 CFO-100-1 PA-22 “160” O-320 CH48110-1 CFO-100-1 COMANCHE PA-24 “180” O-360 CH48110-1 CFO-100-1 PA-24 “250” O-540 or IO-540 CH48110-1 CFO-100-1 PA-24B, PA-24C “260” O-540 or IO-540 CH48110-1 CFO-100-1 PA-24 Turbo “260” IO-540 CH48110-1 CFO-100-1 PAWNEE PA-25 “150” O-320 CH48110-1 CFO-100-1 A25 “260” O-540 CH48110-1 CFO-100-1 PA-36 Brave 6-285B CH48109-1   – PA-36-375 Brave IO-720-D1C CH48110-1 CFO-100-1 PA-36-400 Brave IO-720D1CD CH48104-1 CFO-101-1 CHEROKEE, CADET PA-28 “140” O-320 CH48110-1 CFO-100-1 PA-28 “150” O-320 CH48110-1 CFO-100-1 PA-28 “160”, “161” O-320 CH48110-1 CFO-100-1 PA-28 “180” O-360 CH48110-1 CFO-100-1 PA-28 “180”, “181” O-360-A4M CH48110-1 CFO-100-1 PA-28 “235” O-540 CH48110-1 CFO-100-1 PA-28 “151” O-320 CH48110-1 CFO-100-1 ARROW PA-28R “180” IO-360, L2A CH48110-1 CFO-100-1 PA-28R “180 IO-360-C1CD, L2A CH48103-1 CFO-100-1 PA-28R “200” Arrow II IO-360, L2A CH48110-1 CFO-100-1 PA-284 “200” Turbo Arrow III TSIO-360 CH48108-1     – PA-28-R-201T TSIO-360-F1 CH48108-1

Aircraft engines not listed, but equipped with oil filters at overhaul, may accept Champion filters. Contact Aviation Service Department for further information. Please include description of your engine. ++ Reference page 25-26 for other TCM application data. * Requires Lyco (54E23093)

33


®

Oil Filters

Engine Model Model

DAKOTA

PA-28-235 PA-28-201T

CHEROKEE SIX PA-32 “260” PA-32 “300” PA-32R “300” PA-32R “300” PA-32RT-300T PA-32-301 PA-32-301 PA-32R-301 PA-32R-301

TOMAHAWK

Trainer PA-38-112 MALIBU PA-46-301P

MALIBU MIRAGE PA-46-350-P

APACHE

PA-23 “150” PA-23 “160” PA-23 “235”

AZTEC

PA-23 “250” “C” PA-23 PA-23 Turbo “250” “C”, “D”, “E”, “F” PA-23 Turbo “250”

Champion Spin-On Filter

Aircraft Engine Applications

Champion Element Model

Engine Model

TWIN COMMANCHE

O-540-J3A5D CH48103-1* CFO-100-1 PA-30 “160” Turbo PA-39 “160” TSIO-360-FB CH48108-1    – O-540 CH48110-1 CFO-100-1 PA-39 “160” Turbo IO-540 CH48110-1 CFO-100-1 IO-540-K1AD CH48103-1* CFO-100-1 NAVAJO TIO-540-S1AD CH48103-1* CFO-100-1 PA-31 “300” PA-31 “310” Turbo TIO-540-S1AD CH48103-1* CFO-100-1 PA-31 “325” IO-540-K1G5D CH48103-1* CFO-100-1 TIO-540-S1AD CH48103-1* CFO-100-1 PA-31 “350” Chieftain IO-540-K1G5D CH48103-1* CFO-100-1 TIO-540-S1AD CH48103-1* CFO-100-1 PA-31P “425” PA-31P “350” Mojave O-235-L2C CH48103-1* CFO-100-1 SENECA PA-34 Cont TSIO-520-BE CH48109-1 PA-34 Lyco TIO-540-AE2A CH48103-1 Seneca II O-320 CH48110-1 CFO-100-1 Seneca III O-320 CH48110-1 CFO-100-1 PA-34-220T O-540 CH48110-1 CFO-100-1 PIPER AEROSTAR PA-60-600, -600A O-540 CH48110-1 CFO-100-1 PA-60-604, -601B IO-540 CH48110-1 CFO-100-1 PA-60-601P IO-540 CH48110-1 CFO-100-1 PA-60-602P SEMINOLE TIO-540 CH48110-1 CFO-100-1 PA-44-180 PA-44-180T

Champion Spin-On Filter

Champion Element

IO-320 CH48110-1 IO-320 CH48110-1 LIO-320 CH48110-1 IO-320 CH48110-1 LIO-320 CH48110-1

CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1

IO-540 CH48110-1 TIO-540 CH48110-1 IO-540-F2BD CH48103-1 LTIO-540-F2BD CH48103-1 TIO-540-J2BD CH48103-1 LTIO-540-J2BD CH48103-1 TIGO-541 CH48104-1 TIO/LIO-540-V2AD CH48104-1

CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1 CFO-101-1

IO-360C CH48110-1 CFO-100-1 LIO-360C CH48110-1 CFO-100-1 IO-360-C1E6D CH48103-1 CFO-100-1 LIO-360-C1E6D CH48103-1 CFO-100-1 LTSIO-360-E CH48108-1 – TSIO-360-E CH48108-1 – TSIO-360-KB CH48108-1 LTSIO-360-KB CH48108-1 IO-540-G, -K CH48110-1 IO-540-P, -S CH48110-1 IO-540-S CH48110-1 IO-540-AA1A5 CH48110-1

CFO-100-1 CFO-100-1 CFO-100-1 CFO-100-1

O-360-E1AD CH48103-1* CFO-100-1 TO-360-E1A6D LTO-360-E1A6D CH48103-1* CFO-100-1

Dimensional Data

Popular spin-on oil filters

Champion

Part No. CH48103-1 CH48104-1 CH48108-1 CH48109-1 CH48110-1 CH48111-1

A 4.48” (11.4 cm) 5.73” (14.6 cm) 4.48” (11.4 cm) 5.73” (14.6 cm) 4.48” (11.4 cm) 5.73” (14.6 cm)

B 0.43” (1.09 cm) 0.43” (1.09 cm) 0.43” (1.09 cm) 0.43” (1.09 cm) 0.43” (1.09 cm) 0.43” (1.09 cm)

C 1.00” Hex (2.54 cm) 1.00” Hex (2.54 cm) 1.00” Hex (2.54 cm) 1.00” Hex (2.54 cm) 1.00” Hex (2.54 cm) 1.00” Hex (2.54 cm)

D 3.71” (9.4 cm) 3.71” (9.4 cm) 3.71” (9.4 cm) 3.71” (9.4 cm) 3.71” (9.4 cm) 3.71” (9.4 cm)

Thread (SAE) 13/16-16-UNS-2B 13/16-16-UNS-2B 3/4-16-UNF-2B 3/4-16-UNF-2B 3/4-16-UNF-2A 3/4-16-UNF-2A

Dry Weight Lbs./Kg. 1.32lbs. (0.59kg) 1.41lbs. (0.64kg) 1.40lbs. (0.64kg) 1.51lbs. (0.68kg) 1.38lbs. (0.63kg) 1.47lbs. (0.67kg)

Aircraft engines not listed, but equipped with oil filters at overhaul, may accept Champion filters. Write Aviation Service Department for further information. Please include description of your engine. * Requires Lyco (54E23093)

34


Turbine Exciters

Product Features

Turbine Exciters

Champion Quality and Reliability. Every Champion Aerospace exciter carries our full warranty and is backed by the Champion name. Our exciters arebuilt to the same exacting standards that have made us a leader in aviation products for over 75 years. Champion Exciters are Widely Used in the Following Engine Applications: Honeywell: Pratt & Whitney: Sundstrand: Williams/Rolls-Royce:

AS907, TPE331, TFE731, ALF502, LF507, 131-9A/B, 331-600 PW150, PW206, PW308, JT15D, PT6A, PT6C, PW207 APS2000 FJ44-1A, FJ33

35


Turbine Exciters

Engine Application

Champion Part Number

OEM Part Number

Honeywell Engines HTF7000 (formerly AS907) CH92074-2 3038100-5 TPE331-10U, -11, -12, -14A/14B TFE731-2-1C/-2B TFE731-3-1C/1E TFE731-3-1F/1G TFE731-3A-2B/-200G 305012-2 3070378-2 TFE731-3AR/200G TFE731-3B-100S TFE731-3BR-100S TFE731-3R-1D TFE731-5-1B, -5A-1C, -5R-1H ALF 502R-3, -3A, -5 ALF 502L, L2, L2A, L2C, L3 305050 2-303-026-02 LF507-1F, 1H 131-9B CH92036 3888058-7 131-9A CH92036 3888058-7 331-600 Pratt & Whitney Canada JT15D-1, -1A, -1B, -4, -4B, -4D, -5, 5A CH92028 3041996-01 PW150 CH92043-2 3122413-07 CH92043-3 3122413-08 PW308C CH92051-3 30C1132-04 CH92051-4 30C1132-05 PW307A CH92083-5 30P0604-06 CH92083-6 30P0604-07 PW206A, B, B2, C, E, PW207C, D, D1, D2, E, CH92015 3043937-01, -02, -03 PT6C-67C, -67D CH92106 PT6A-21, -27, -28, -34, -34AG, -34B, -36, -41, -42, CH92015-1 3043937-04 -52, -60A, -61, -65B, -67B, -67D, -67P, -114, -114A, CH92106-1 3043937-06 -135, -135A, PT6C-67C, PT6T-3, -3B, -3E, -3BF, -3BG PW308A CH92090-1 30C4946-02 CH92090-2 30C4946-03 Sundstrand APIC (Auxiliary Power International) APS 2000 305088-2 179420-2 APS2300 CH92073-1 4952793 Williams International/Rolls-Royce FJ44 Series CH92007-1 68145 CH92070-1 71294 FJ33

Aircraft Engine Applications Applications

Boeing 737-600,-700,-800 Airbus A319, A320, A321, 340-500, -600

Boeing 737-300, -400, -500 Citation Jet, CJ1, CJ2

Notes

*FAA-PMA Pending.

36 Contact your preferred distributor for Champion factory FAA certified Exciter overhaul program.


Turbine Ignition Leads

®

Product Features

Contact Assembly - Provides sure sparks and clean, positive contact between lead, igniter and exciter.

Core Assembly - Meets stringent OEM and military requirements and provides maximum spark efficiency and insulation value.

®

Champion Aerospace provides OEMs with high-quality, military-grade ignition leads manufactured with technology designed for the 21st century. Champion is a full ignition system supplier to the turbine engine market. Champion has moved rapidly to supply the turbine aftermarket with top-quality, cost-effective replacement leads, as well as offering a lead overhaul program, a unique maintenance alternative. Regular, preventive maintenance helps avoid costly, unscheduled maintenance caused by worn turbine ignition leads. Often, cables that do not appear worn, but have weak shielding or poor connections can actually be about to fail. Whether you buy new FAA-PMA approved replacement leads or choose to overhaul your current leads, you’re assured of quality, prompt delivery and maximum reliability.

Turbine Ignition Leads

Military-Grade Stainless Steel Shielding - Provides positive RFI protection and resists abrasion.

37


Turbine Ignition Leads

Aircraft Engine Applications

ENGINE APPLICATION Allison Engine Company (Rolls-Royce)

CHAMPION LEAD NO.

OEM LEAD NO.

CH53351

23060813

250-B17C (All), -B17D (All), -B17E, -B17F (All), -B17F/1, -B17F2, -C20S 250-C18, -C18A, -C18B, -C18C5, -C19, -C20, -C20B (All), -C20 (T63-A-720), -C20J (All), -C20R/1, -C20R/2 (All), -C204/4 250-C30 (All), -C30G, -C30G/2, -C30M, -C30S, -C40B 250-C20W, -C30 (All), -C30G, -C30L, -C30M, -C30P, -C30R, -C30R/1, -C30S, -C30U, -C47B, -C47M 250-C28B, -C28C 250-C20F, -C20R (All)

53247 53158

23060814 23060815

53159 53153 53270

23060816 22306817 23060818

CF34-3A1, -3B, -3B1 CF34-8C1, C5 CF34-8C5A1/A3 CFE738-1, -1B

CH53515-3 CH53515-4 CH53515-1 CH53515-2 CH53515-1 CH53515-5 53323-4

4096T96P03 4096T96P04 4096T96P07 4096T96P08 4096T96P07 4096T96P11 3051406-4

General Electric

Honeywell

ALF502L-2, -2A, -2C, -3 53282 (Jumper) 2-303-025-02 53283 (Jumper) 2-303-079-02 53214 (Jumper A) 2-303-766-02 ALF502R-3, -3A, -5, -6 53215 (Jumper B) 2-303-767-02 53214, 53215, (Jumper) 2-303-766-02, 2-303-767-02 53216-1, 53217-1 (Ign. A, B) 2-303-768-03 2-303-769-03 53217-1, (Ign. B) 2-303-769-03 53214 (Jumper A) 2-303-766-02 LF507-IF, -IH 53215 (Jumper B) 2-303-767-02 53216-1 (Ign. A) 2-303-768-03 LF507-1F, 1H, AS907-1, 1A 53217-1 (Ign. B) 2-303-769-03 53280-1 2-303-742-03 53281-1 2-303-743-03 53282 (Jumper B) 2-303-025-02 53283 (Jumper B) 2-303-079-02 HTF7000 (formerly AS907) 53542-1 3038111-1 TPE331-25DA 50221-18 369876-18 50221-21 369876-21 TPE331-25FA 50221-15 369876-15 TPE 331-2-0014 50221-16 369876-16 TPE331-2UA-203D 50221-12 369876-12 TPE331-55B 50221-7 369876-7 TPE331-1-101E TPE331-1-101Z TPE331-3U-303V 50221-24 369876-24 TPE331-10UF-501H 50221-25 369876-25 TPE331-10UF-511H TPE331-10UF-512H TPE331-10UF-513H TPE331-10UG-513H TPE331-10UG-514H TPE331-10UGR-513H

AIRCRAFT APPLICATIONS

Canadair Challenger 600

BAe146-10 BAe 146-300 Series

AVRO RJ Series (Formerly BAe) AVRO RJ Series (Formerly BAe)

Challanger 300 Air Asia, Porter Skyvan Alaska Wildlife, DHC3 Beaver, Carstedt, Jetliner 600A Jetliner 600B Marsh, Turbo Thrush Handley Page, Jetstream III CASA-212 Jetstream 31 Merlin 300 MU-2

This chart is for reference only. Lead installation may change as a result of variations in ignition system configuration. Consult latest revision of the appropriate illustrated parts catalog for specific data. Champion FAA-PMA leads are manufactured by Champion Aerospace LLC

38 Contact your preferred distributor for Champion factory FAA certified lead overhaul program.


Turbine Ignition Leads

®

Aircraft Engine Applications ENGINE APPLICATION Honeywell (Cont’d)

CHAMPION LEAD NO.

OEM LEAD NO.

AIRCRAFT APPLICATIONS

TPE331-10UGR-514H 50221-24 369876-24 TPE331-10UR-513H 50221-25 369876-25 TPE331-8-401S TPE331-8-402S TPE331-8-403S TPE331-3UW-303G TPE331-3U-303G TPE331-3-303G TPE331-3-304G TPE331-6-252B 50221-24 369876-24 TPE331-2-201C 50221-8 369876-8 TPE331-5-251C TPE331-10-501C TPE331-10-511C

Cessna, 441 Conquest Fairchild, IV/Metro I, IVA/Metro II

TPE331-5-252D

50221-22

369876-22

Dornier, 228

TPE331-5-252K

50221-9

369876-9

690B

Bech, B-100 King Air CASA, 212-100 212-100 980/1000 Mitsubishi, Marquise, Solitaire

TPE331-5-252M

MU-2N

TPE331-1-151A

MU-2DP, MU-2F, MU-2G

TPE331-1-151G

50221-15

369876-15

Merlin IIB

50221-16

369876-16

TPE331-10UA-501G

50221-24

369876-24

Merlin III, IIIA, IV, IVA,

TPE331-10UA-511G

50221-29

369876-29

Metro II-10

TPE331-10U-511G

50221-24

369876-24

Merlin IIIB

TPE331-10U-512G

50221-28

369876-28

Merlin IIIC

TPE331-10U-513G

50221-32

Merlin IVC, Metro III

50221-33

Metro, II, IIA

TPE331-43A

50221-7

369876-7

Gulfstream Commander,

TPE331-43B

50221-9

369876-9

680T, 680V, 680W, 681

TPE331-5-251K

50221-12

369876-12

690/690A

TPE331-5-254K

50221-9

369876-9

840

TPE331-11U-612G

TPE331-6-251M

MU-2K, MU-2L, MU-2M, MU-2S

TPE331-25AA

50221-19

369876-19

MU-2B

TPE331-25AB

50221-9

369876-9

MU-2D

TPE331-14A-601P

53133-5

3105589-5

53133-6

3105589-6

Piper, Cheyenne 400LS

TPE331-14GR/HR

53338-1

3105901-1

Jetstream 41

53339-1

3105902-1

TPE331-14, -14A, -14B, -15

53133-5

3105589-5

TPE331-14, -14A, -14B

53133-6

3105589-6

TPE351-20

53133-7

3105589-7

TFE731-2, -3, -3A, -3AR, -3-1F, -3B, -3BR, -3R, -5R

53142-10

3071590-10

53142-11

3071590-11

TFE731-3-1E

53142-10

3071590-10

Jetstar 731

TFE731-3-1G

53142-11

3071590-11

IAI, 1124 Westwind,

Piper, Cheyenne 400LS

AAC, HS125-700

TFE731-3-5A-1C

Sabreliner 65, Falcon 50

TFE731-3R-1H

53142-10

3071590-10

BAe, HS125-700

TFE731-3B-100S

53142-11

3071590-11

Cessna, Citation III, Citation VII

TFE731-2, -3A,-3BR-100S

53142-12

3071590-12

TFE731-3A-2B, -3B, -3R

53142-13

3071590-13

TFE731-3AR TFE731-4R-2S This chart is for reference only. Lead installation may change as a result of variations in ignition system configuration. Consult latest revision of the appropriate illustrated parts catalog for specific data. Champion FAA-PMA leads are manufactured by Champion Aerospace LLC

Contact your preferred distributor for Champion factory FAA certified lead overhaul program. 39


®

Turbine Ignition Leads

Aircraft Engine Applications

ENGINE APPLICATION Honeywell (Cont’d)

CHAMPION LEAD NO. OEM LEAD NO.

TFE731-5R-1H 53142-10 3071590-10 TFE731-3-1F 53142-11 3071590-11 TFE731-2-1C 53142-12 3071590-12 TFE731-3AR-200G 53142-13 3071590-13 TFE731-3A-200G TFE731-5A-1C 53142-12 3071590-12 TFE731-5-1B 53142-13 3071590-13 TFE731-2-2B 53142-12+ (Pre S.B. 74-3003) 3071590-12 53142-13+ (Pre S.B. 74-3003) 3071590-13 53142-10++ (Post S.B. 74-3003) 3071590-10 53142-11++ (Post S.B. 74-3003) 3071590-11 TFE731-3R-1D 53142-12+ (Pre S.B. 74-3003) 3071590-12 53142-13+ (Pre S.B. 74-3003) 3071590-13

AIRCRAFT APPLICATIONS HS125-800 Lockheed, Jetstar Dassault, Falcon 10/100 1125 Astra Model 55 Falcon 900 L55 Learjet, L35/36

Pratt & Whitney CANADA PT-6 Series

PT6A-11 Piper Cheyenne I/IA, T1040 Dornier Skyservant PT6A-110 53402-02 3011871 Beech C90 PT6A-21 Cessna Caravan II*, Conquest I, PT6A-112 CH53399-04 3119832-01 Embraer EMB-110 P1, P2 EMB-111 Cessna Caravan I*, Avtek 400, PT6A-114, 114A Beech F90-1, Omac Laser 300 PT6A-135A Ayers Turbo Thrush T-11, PT6A-11AG CH53399-04 3119832-01 Schweizer G164B Turbine, Agcat PT6A-116, 121 CH53399-04 3119832-01 Jetcrafters Taurus, Piper Cheyenne IIXL, Riley Eagle 421, Riley Turbine 210, Schafer CH53399-04 3119832-01 Comanchero PT6A-135 Air Tractor AT400, Ayers Turbo Thrush T-15, Frakes Turbo Cat B CH53399-04 3119832-01 Weatherly 620TP PT6A-15AG DHC-2-Turbo Beaver, Beech, C90/A C90A, 99, Schafer Comanchero 500, PT6A, 6A, 6B Beech 99A/B, Catic Y-12, DHC-6 Twin PT6A-20 Otter, Embraer EMB-110/B, B1, C, E, PT6A-20A, 20B CH53399-04 3119832-01 & P, Caraja, Let L-410A, Pilatus PC-6 PT6A-25 PT6A-25A PT6A-25C PT6A-36, 34, 38 Beech T34C, Beech T34C-1,1900D, PT6A-62 NAC1T, Pilatus PC-7, Embraer PT6A-66 EMB-312, Beech C99, Arava, Pilatus PT6A-67, 114, 114A, 135A CH53399-07* 3119833-01 PC-9, Piaggio Avanti, Beech Starship I CH53399-09 3119832-02 PT6A-67D Ratheon Beech 1900 / 1900C CH53399-10 3119835-02 Beech E90, 99A, A100, Embraer CH53399-04 3119832-01 EMB-121A, Piper Cheyenne II PT6A-28 Avalon 680, Embraer EMB-110K1, S1, P1, P2, Frakes Mallard, IAI Arava, IAI 102, Omni Turbo Titan, PT6A-34 CH53399-04 3119832-01 Spectrum One Ayres Turbo Thrush T34, Frakes Turbo Cat A, B, C, NAC Fieldmaster, PzL 106A Turbo Kruk, Schweizer CH53399-04 3119832-01 G164B Turbine, Agcat PT6A-34AG PT6A-41 PT6A-42, 42A PT6A-45A Beech 200, Piper Cheyenne III, PT6A-45B Beech B200, C12S, Pilatus PC-9, PT6A-52 Frakes Mohawk 198, Shorts 330, PT6A-60A, 60AG PT6A-61, 64 Beech 300, Piper Cheyenne IIIA, PT6A-65/65B, 65AG, 66, 66A, 66B, 66D, 67, 67A, 67B, 67D, Beech 1900, Hawk Gafhawk 125, 67F, 67R, 67T, 67AF, 6B PT6A-65R/AR CH53399-06 3119836-01 Shorts 360

This chart is for reference only. Lead installation may change as a result of variations in ignition system configuration. Consult latest revision of the appropriate illustrated parts catalog for specific data. Champion FAA-PMA leads are manufactured by Champion Aerospace LLC * Cessna Caravan, New Lead Routing Procedure, Outside Plenum. See PWC Service Bulletin 1512.

40 Contact your preferred distributor for Champion factory FAA certified lead overhaul program.


Turbine Ignition Leads

®

Aircraft Engine Applications

ENGINE APPLICATION Pratt & Whitney CANADA PT-6 Series (Cont’d)

CHAMPION LEAD NO.

OEM LEAD NO. AIRCRAFT APPLICATIONS

CH53399-06 3119836-01 PT6A-41AG PT6A-45R CH53399-06 3119836-01 PT6A-50 CH53399-05 3119835-01 PT6B-36/36A/36B/35F CH53463 3123061-01 PT 6C-67C CH53490 3050604-01 PT6T-36 PT6T-3B/3B1/6/3BE/3D CH53399-01 3119829-01

Pratt & Whitney CANADA JT15D Series

Frakes Turbo-CAT, Schweizer G-164D Fairchild Metro IIIA, Hawk Gafhawk 125, Shorts 330, Shorts C23A Sherpa, USAC Turbo DHC-7 Sikorsky S-76, H-76 Bell 212, 412, Sikorsky S58T

JT15D JT15D-1 53067-21 (Pin Connector) T3 3107371-01 JT15D-1A/1B 53067-38.5 (Pin Connector) T3 3107371-02 JT15D-4 JT15D-4B JT15D-4C JT15D-4D JT15D-5,5A,5D 53300-1 (Button Connector) T5 3118347-01 53300-2 (Button Connector) T5 3118347-02 JT15D-5,5A,5D,5F Reference PWC Service Bulletin to Retrofit JT15D-4 to 53300-1 & 53300-2. Also See Igniter Plug Listing.

Aerospatiale Corvette Cessna Citation 500 Cessna Citation I Cessna Citation II, Mitsubishi Diamond I Cessna Citation S/II S211 Mitsubishi Diamond IA Beechjet, T-47A

PW115, 118, 118A, 199B, 120, 121, 120A PW123/123AF PW124B/125B PW126/126A PW127 H PW150/150A

53367-01 50383H 53302 53335-01 (Ceramic) 50383-K 53335-01 CH53536 CH53456-2

3120676-01 3033339 3038915 3117291-01 3035333 3117291-01 3056566-01 3122414-04

Embraer EMB-120 Dornier 328 ATR-42 DHC-8-100 BAe ATP

PW206A, C, E PW206B PW207C, D, E

CH53442-4 CH53530 CH53442-3 CH53442-4

3121144-02 3056743-01 3122957-01 3121144-02

MD900, Augusta AIO9E MD Explorer, Bell 427, EC135 EC135, Augusta AIO9E

PW305,306, A, B, C PW307A PW308A, C

CH53238-1 CH53544-1 CH53483-5

31B3615-02 30P0605-02 30C1133-03

BAe 1000, Lear 60

Arriel 1A, -1A1, -1A2, -1B, -1D, -1D1, -1S, -1S1

53317-3

9550166530

Pratt & Whitney CANADA PW100 Series*

Pratt & Whitney CANADA PW200 Series*

Pratt & Whitney CANADA PW300 Series

Turbomeca

Williams International/Rolls-Royce

Dash 8Q, 400 DeHavilland

Dassault- Falcon EX 2000

FJ44- Series 53221 50853 Cessna Citation Jet, CJ 1,2,3 53279 50852 Swearingen/Jaffe SJ-30

Turbine Engine Applications (APU) Honeywell

36-100E 50160-61 369259-61 36-100 (M) -150 (M) 53359-3 3888302-3 36-150 (A), (AA), (J), (W), (CX) 53359-6 3888302-6

CL 6013A BAe 146, 146-300 Embraer 120 BAe ATP 125-800/ -1000 Cessna 650 Saab 340 IAI Astea 1125 Falcon 20-5

This chart is for reference only. Lead installation may change as a result of variations in ignition system configuration. Consult latest revision of the appropriate illustrated parts catalog for specific data. Champion FAA-PMA leads are manufactured by Champion Aerospace LLC **Type “2” ignition systems require Champion P/N 50383K (PWC P/N 3035333) *FAA-PMA Pendning

Contact your preferred distributor for Champion factory FAA certified lead overhaul program.

41


Turbine Ignition Leads

®

TSCP 700 50160-48

Boeing 737-300, 400, 500 Airbus A320, A321 Boeing 727-100, 200, Boeing 737-200, 300, 400, DC 9, 10, 30, 50, MD80 MD90 Boeing 757, 767 Airbus A300, A310

DC10, MD11

LearJet 45/45XR Lockheed L-1011 Boeing 747-400

3888302-22 3119834-01 3910351-01 179505-3 179505-4

Boeing 737-300, -400, -500

UNIVERSAL KIT

PT-6 Series, PW100 Series, PW205 Series

53057

(PWC PN 3108407-01)

OPTIONAL TOOLS FOR REPAIR

(Use 52243 Crimp Tool) (Use 52243 Crimp Tool) (-4 Includes Extension Ferrule)

53051 53164-3, -4 53369 53100-1, 53436 53434

Crimp Tool (Ref. Sat-124) Contact Hook

52243 52258

NOTES

This chart is for reference only. Lead installation may change as a result of variations in ignition system configuration. Consult latest revision of the appropriate illustrated parts catalog for specific data. Champion FAA-PMA leads are manufactured by Champion Aerospace LLC *Type “2” ignition systems require Champion P/N 50383K (PWC P/N 3035333)

42 Contact your preferred distributor for Champion factory FAA certified lead overhaul program.

Canadair CL-RJ Fokker 100

53267-3 53267-4

REPAIR KITS

TPE331 TFE731 PW100 PT6 PW305

APS2000

Sundstrand APIC (Auxiliary Power International)

Fokker 100

53359-22 CH53399-08 50383-L

Pratt & Whitney CANADA

3888302-9 3888302-15 3888302-16 3888302-18 304269-5 3876132-1 3876132-8 369259-7 369259-20 3888316-1 3888076-3 388076-1, 2 3876132-6 Airbus A330, A340 369259-47 Airbus A300B

331-350C 53179-7

RE100(LJ) ST6L-73 PW901A

OEM LEAD NO. AIRCRAFT APPLICATIONS

331-200,-250

85 Series 131-9D

36-208B 36-300

36-150 (RJ) 36-150 (RR)

53359-9 53359-15 53359-16 53359-18 53236-5 53179-1 53179-8 50160-7 50160-20 53368-1 53109-3 53109-1, 2 53179-6 3876132-7 50160-47 369259-48

36-150 (R)

ENGINE APPLICATION CHAMPION LEAD NO. Honeywell (Formerly Allied Signal Engines) (Cont’d)

Turbine Engine Applications (APU)


General Aviation Igniters

Product Features

Coated Bushing Bushing coated to prevent lead sticking, allowing for easier removal and installation.

Corrosion Protection Silver-plated shell for protection against corrosion and seizing.

Tungsten Contact Provides increased resistance to arcing with mating lead. Positive Insulator Retention Upper insulator shaped to provide positve component retention.

Leakage Protection Dual seals for protection against gas leakage under high temperature conditions.

Shaped Insulator Lower insulator shaped to provide positive component retention. Protective Coating Special coating prevents excessive chafing of shell, extending igniter service life.

Design Features

Turbine Igniters

Patented Iridium Pin Design Provides maximum resistance to spark erosion and increased service life.

Champion turbine igniters are a product of the Champion Aerospace commitment to the highest standards of quality and technology, a commitment that has made Champion the #1 choice of engine manufacturers, maintenance technicians and pilots around the world. Champion-engineered safety-retention features are the best in the business and Champion developments in the turbine igniter design include fuel drain slots which keep the igniter from quenching out, air-cooling holes for longer life and engobe semi-conductive materials for quicker, more reliable starts.

Champion Turbine Igniters cover over 300 different engine designs and are OEM on: Allison, Honeywell, General Electric, Pratt & Whitney, Sundstrand/Turbomeca, Teledyne, Textron Lycoming, Williams International, Westinghouse and Rolls-Royce.

43


General Aviation Igniters For airline igniter applications consult Champion Aerospace AV-22 catalog.

Illustrated below are six plug designs by firing end configuration. Gap Description

Typical Firing End Configuration Gap Description

High-Voltage Recessed Surface Gap (Long Life)

Typical Firing End Configuration

Low-Voltage Surface Gap (Solid Semiconductor)

High-Voltage Surface Gap

Low-Voltage Shunted Surface Gap

High-Voltage Air Gap

Low-Voltage Glow Coil Element

Igniter Replacement Gaskets M-677 FS118-1, FS153-1, CH31547C, CH31615 (6800087)

CH63038 CH31753A, CH31773 (6800848) (nickel)

CH63008 FHE205, FHE267-2A (6800148)

6800847 CH31753A, CH31773 (cemented)

CH63037 AA138S (6800158) (copper)

6800948 CH31772A, CH31785, CH31806

6860337 PT6 & PW100

6860326 JT15D

44


General Aviation Igniters

For airline igniter applications consult Champion Aerospace AV-22 catalog.

Engine Mfr. & Model ALLISON (Rolls-Royce)

(FAA Approved) PRIMARY PROPULSION PLANT Champion Engine Mfr. Part No. Part No. Aircraft Make Aircraft Model

501-D13, -D13A, D, E, H,-D22 FS89-1 6805734 Lockheed Convair 580, Electra, 382 Hercules FS109-1A 6847727 Lockheed L-100 Series Hercules, Convair 580A 501-D22A, C, G CH34168 6877518 Aerospace Tech 250-B15, -B15A, -B15E, -B15G, -B17 -B17B, -B17C, -B17D, -B17E, -C10, -C10A, or of Australia Nomad 22B, N24A -C10B, -C10D, -C18, -C18A, -C18B, -C18C, CH34269 23006266 Aerospatiale Twin Star AS355F-1, -2, M2, A5 555 UR - C 1 9 , -C20, -C20B, -C20C, -C20F, -C20J, (long life) Agusta 109A -C20R/1, -C20R/2, -C20R/4, -C20S, -C20W Bell 206B Breda 369D Helio H634 Twin Hiller Aviation RH1100A Hindustan HTT-34 YB63-1 1017565 MBB B0105, 105CB, 105CBS 250-B15A, -B15E, -B15G, -B17D, -B17E, McDonnell Douglas MD500, 500U, D, E, (MD-88) -B17F, -B17F/1, -B17F/2, -C18, -C18C, -C18, -C18C, -C20J, -C20R, -C20R/1, Panstwowe Zaklady MI-2 -C20R/2, -C20R/4, -C20S, -C20W Partenavia AP-68TP-300 Spartacus Pilatus BN Turbine Islander Schweizer 330 SIAI Marchetti SF260TP, SF600 Soloy (Bell) 47-Conversion CH34187-A 6899084 Bell Long Ranger-206-L1, 206-L3, 214, 222, 407, 430 250-C28, -C28B, -C28C, -C30, -C30G, -C30G2, -C30L, -C30M, -C30P, -C30R, or MBB BO-105LS-A3 23006267 Boeing 530F, G, N -C30S, -C30R/3M, -C30R/1,-C30R/3, -C30U CH34304 (long life) Sikorsky S-76A MKII -C40, -C40B, -C47, -C47B, -C47E, -C47M CH31898-1 23062672 SAAB 2000, C-130J GMA 2100A, AE2100, -2100A, -2100C, Embraer EMB 135, 140, 145 -2100D3, AE3007 Cessna Citation X

GENERAL ELECTRIC

CJ610 FHE146-7A 37C311124 Hansa HFB320 Gates LearJet 23, 24B, 24D, 25, 25B, 25C, 25D, 25G CF700 FHE146-7A 37C311124 Dassault Falcon 20, D, E, F Sabreliner Corp. Sabreliner 75A CF34-1A FHE256-10A 4048T30P06 Canadair Challenger 601/601-3A CF34-3A (Before S/N 350336) FHE256-10A 4048T30P06 Canadair Challenger 601/601-3A CF34-3A (After S/N 350336) FHE256-10B 4048T30P07 Canadair Challenger 601/601-3A CF34-3A (After S/N 350336) CH34661 4048T30P10 Canadair Challenger 601/601-3A CF34-3A1, -3A2, -3B CH31858-1, -2 Canadair Challenger 601-3R/604 CF34-3A1, -3B1 CH31858-1, -2 Canadair Bombardier CRJ-100/200 CF34-8C1, -8C5 CH31926 4096T33P07 Canadair Bombardier CRJ-700-900 CF34-8E CH31926 Embraer 170/175 CF34-10E CH31900-6 1374M13P11 Embraer 190/195 CH31965 CT64-820-4 FHE111-30 4026T27P01 CT7-2A, T700-T2C CH34158 4053T22P01 Westland W30, 200, 300/404 CT7-2A, CT7-2B, T700-T2C CH34439 4053T22P06 Sikorsky 570DC Bell 214ST CT7-2A, -2D1, -5A, -5A1, -5A2, -5A3, -6, CH34419 5044T67P07 Saab-Fairchild SF340 Sikorsky S-92 -6A, -7A, -7A1, -8, -9B, -9B1, -9B2, -9C, -9D Casa CN235 EH Indust. EN101 CT-58-100-2, -110-1, -110-2, -140-1, -140A/L CH34095 37B200275P102 Agusta AS-61 -140-2 Kawasaki KV-10711/11A Mitsubishi SH-3B, S-61A

HONEYWELL (formally Alliedsignal Engines)

TPE331 CH31547C** 369949-3

CASA Commander Div. Beech King Air B100 British Aerospace Cessna Dornier Fairchild Mitsubishi

C212-200, -300 680T, V, W, 681, 690A, B, 840, 900, 980, 1000 Jetstream 31 Conquest II 228-100-200, 101, 201, 212 Merlin IIB, IVC, Metro-III, SA-227-AT, AC, TT/41 MU-2B, D, F, G , J, K, MU2B-40, MU2B-60, MY2S

**Includes Installation Gaskets.

Contact your preferred distributor for Champion factory FAA certified lead overhaul program.

45


General Aviation Igniters For airline igniter applications consult Champion Aerospace AV-22 catalog.

(FAA Approved) Champion Engine Mfr. Engine Mfr. & Model Part No. Part No. HONEYWELL (formally Alliedsignal Engines)

PRIMARY PROPULSION PLANT Aircraft Make Aircraft Model

TPE331-14, -14A, -14B CH31701A 3105547-1 Piper Cheyenne 400 TPE331-14 GR/HR Y209-2 3105893-4 British Aerospace Jetsream 41 CH34627-1 3105893-5 TFE731-2, -3, -3A, -3B, -3R, -3AB, -3AR, CH31815-2 3074541-4 Cessna Citation III, Citation VII -3B, -4R-2S, -5, -5A, -5R, -5AR (long life) Dassault Falcon 10A, 50, 100, 900, CASA 101 Bombardier Lear Jet 31, 35, 36, 54, 56, LR55-ER, -LR, XLR CH31621A 3070967-1 British Aerospace 125-700, 731, 800 TFE731, -20, -40, -60 Israel Aircraft Ind Westwind 1124, 1124A, Astra 1125 CH31815-2 3074541-4 Lockheed Jetstar II, 731 Sabreliner Corp Sabreliner 65/65A ATF3-6, -6A CH31641 (lower) 3001430-1 Dassault Falcon 200, French Guardian, HU-25A Requires both numbers listed or CH31642 (upper) 3001430-2 CH31767 (lower) 3003119-1 (long l i f e ) CH31768 (upper) 3003119-2 (long life) T53-07A, T53-09A, B, C, T53-11A, FHE113-10 1-300-197-03 Bell 204B, 205 CH34016-1 1-300-348-06 Bell 205A T53-13B, T53-17A, T53-13A LTS-101-600A, -600B, 650A-2, 650-A1, 750A-1 CH34016-1 1-300-348-06 Aerospatiale AS350, AS350D Astar, SA-633G1, Dauphin 2 LTS-101-650C-2, -650C-3, -650C-3A, CH34016-1 1-300-348-07 Bell 214A, 222, 222B, 222U, 222UT 600A-2, -650B-1, -600A3, -750B-1, -750C-1 LTP-101-600A-1A CH34016-1 1-300-348-07 MBB/Kawasaki BK-117-A3 -700A-1A Air Tractor AT-302 Piaggio P166-DL3 Page AG-Cat B, Thrush ALF-502-L, -L2, -L2A, -L2C, -L3, -R3, -R3A, CH34452A 2-300-732-05 Canadair Challenger CL600 -R4, -R5, -R6 British Aerospace BAe 146-100, 200, 300, QT AL-512 CH34135 2-300-821-01 Boeing Vertol Chinook 234, 234ER, 234LR, 234MLR,234U CH34452A 2-300-732-05 Fadec equipped AVRO-RJ Series LF507-1F, -1H HTF7000 (formerly AS907) CH34826-6* 3038110-6 Bombardier Challanger 300

PRATT & WHITNEY JT12A, -4, -5A, -6, -6A, -8 J60-P-5B JTFD12A

PRATT & WHITNEY CANADA, INC.

FHE151 or AA33S, A, D FHE151

424815 424848-E 424815

Lockheed Sabreliner Corp. Sikorsky

Jetstar Sabreliner 40, 60 CH54A, S-64E, -F, Skycrane

(Glow Plug Ignition) PT6A-6, -6A, -B, -11, -11AG-20, -15AG -20A, AGF2-6 3014054 Beech KingAir Commuter 90, A90, B90, C90, E90, 99 -20B, -21, -25, -25A, -27, -28, -28A, -29, -34, & 100, A100 -34B, -36, -110 DeHavilland Turbo Beaver, Twin Otter PT6A-29, -34B, -AG, -36, -38, -40, -41, -41AG, CH34055 or 3035102 Aerospatiale TBM 700 -42, -45A/B/R, -50, -60A, -61A, -65B/R/AG/AR, CH34406 3035882 -110, -112, -114, -116, -121, -135A Agusta-Bell AB-212, AB-412 Airtractor, Inc. AT-400, AT-400A, AT-402, AT-502, AT-503 AVTEK 400 Ayers Turbo Thrush S2R-T Beech C-90, King Air-200, F90A, 1900, 300, 350, Bell 212, 412 Cessna Conquest 1, Caravan I, II DeHavilland Dash 7 PT6B-9, -35F, -36A, -36B Dornier DO-128-6, DO-24-TT, Seastar Embraer Bandeirante, Xingu, Appjost, Tucano PT6C-67A, 67C CH34758-2 3050627-03 Frakes Mohawk 298, Turbo-Cat S2-R, AB139 * FAA-PMA Pending

**Includes Installation Gaskets

46 Contact your preferred distributor for Champion factory FAA certified Igniter inspection program.

C


.

General Aviation Igniters

®

For airline igniter applications consult Champion Aerospace AV-22 catalog.

(FAA Approved) PRIMARY PROPULSION PLANT Champion Engine Mfr. Engine Mfr. & Model Part No. Part No. Aircraft Make Aircraft Model PRATT & WHITNEY CANADA, INC. (Cont’d)

PT6T-3, -3A, -3B, -3BE, -3D, -3DE, -3DF PT6A, PT6B, PT6T Series (Spark Ignition) CH34406 or 3035882 Bell 212, 412 CH34055 3035102 Piaggio Avanti, P180 (IC 3032096) Pilatus PC-6, -7, -12 Piper Cheyenne, I, II, III, IIIA, IIXL, TIO40 Short Bros SD-330, 360 Sikorsky S58T, S76B Westland Lynx PW-100, -115, -118, -119B, -120, -120A, -121, CH34817 3055161-01 Aerospatiale/Aeritalia ATR-42, 72 CH34055 3035102 British Aerospace ATP -123/B/C/E, 123AF, -124/A/B, -125B, -126, -126A,-127E or DeHavilland DASH 8 CH34406 3035882 Dornier 328 Embraer EMB 120, 121, Caraja Fokker 50 PW150, A CH31918-2 3122415-03 DeHavilland Dash 8/400 CH31955-1 3056557-02 PW206 A CH34643-1 3120953-01 Eurocopter EC135 PW206A, B, B2, C, E CH34723 3120880-01 McDonnell Douglas MD900, A109E, B0108, EC135 CH34682** 31B5168-01 British Aerospace BAe 1000, Cessna Soverrign, 328 Jet PW305A, 305B, 306A, 306B, 306C 31B5268-01 Lear G200 PW307 CH31958-3 30P0606-03 Dassault Falcon 7X CH31929-4 30C1356-04 Raytheon, Dassault Hawker Horizon, Falcon 2000EX PW308A, C CH34804-3 9058600-1 Cessna Bravo, Encore, Excel PW500 Series CH34668-1 (T5) 3117463-01 Aerospatiale Corvette SN601 JT15D, -1, -1A, -1B, -41, -4B, -4C, -4D, -5, -5A, CH34659-3 (T5) 3119400-01 Cessna Citation I, II, SII, 5 Ultra -5B, -5C, -5D, -5F Long Life Beech MU-300 Diamond I, IA, II, Beechjet 400 FHE246-4 (T3) 3039828 SIAI-Marchetti S211

ROLLS ROYCE

BR700, 710A1-10, 710A2-20 Y242-5 Y242-5 BR710 Y242-5 Y242-5 BR715 CH34760-1 CH34760-1 Dart FHE19-6L CR104-2 R-R Snecma M45H-Mark 501 CH34126 CBS113-1, 2 CR114-2 Spey RB168,RB183, 506-14,-14A, -14C, -14D, FHE164E 511-14, -14W, -8, 511-8/Model 2970, 555-15/H YW90 L912017 Bristol Siddeley-Viper FHE205B CBS116 500 Series, MK521,522,526 R.R. Viper Bristol Siddeley-Viper FHE267-2A** CBS111-2 600 Series, MK601-22, R.R. Viper TAY 611-8,611-8C, 620-15, 650-14, Y183-5 L912019 650-15 TAY 650-14, 650-15, 651-54 Y183-6 L912023 Incorporating modification 72-1302

Gulfstream Bombardier

GV, Canadiar Global Express Global Express

Convair Fokker, Fairchild Gulfstream NAMC Fokker Gulfstream British Aerospace Fokker Beech Hawker Siddeley Piaggio Hawker Siddeley

600, 640 F27, FH227 Gulfstream I, Albatross YS-11 VFW614 GII, III 111 F28 BH-125 HS-125 PD-808 HS125-600

Gulfstream Fokker

GIV, GIV-SP F100, F70

Folker

F100

Arriel 1A, -1A1, -1A2, -1B, -1C, -1C1, -1C2, -1D CH34745 9550175400 -1D1, 1E2, -1K, -1K1, 1S, -1S1, 2C1, 2C2 Arriel 1A, -1A1, -1A2, -1B, -1D, -1D1, 1S, -1S1, -2B, 2C CH34595 9550168770 Arrius 2F, 2B, 2B1, -2B2 CH34593 9550166660

Agusta Eurocopter Sikorsky Eurocopter Eurocopter

109K Astar, AS350, BK117, EC145, EC155 S-76 AS350, AS365NE, EC120, EC130, EC135 EC-120

TURBOMECA

WALTER

M601E-11, M601F

CH34630

WILLIAMS INTERNATIONAL/ROLLS-ROYCE

FJ44-1A, -2A, -2C CH31956 68032 FJ33 CH34812-2 67906

* FAA-PMA Pending

**Includes Installation Gaskets

Cessna Raytheon Swearingen Adam Aircraft

Let L-420, PZL-106 BT Citation Jet, CJ1, CJ2, CJ3, CJ4 Premier I SJ30 A700

Contact your preferred distributor for Champion factory FAA certified Igniter inspection program. 47


General Aviation APU Igniters For airline igniter applications consult Champion Aerospace AV-22 catalog.

(FAA Approved) Champion Engine Mfr. Engine Mfr. & Model Part No. Part No. TURBINE ENGINE APPLICATIONS (APU) AUXILIARY POWER INTERNATIONAL CORP.

PRIMARY PROPULSION PLANT Aircraft Make

Aircraft Model

APS500-T62T-40C14 CH38013 160544-1 APS1000 (T-62T-46C) APS2100 APS2300 CH34848 4952647

Fokker Embraer Saab Avro British Aerospace

50 (F27 Mark 050) EMB-135, -145 2000 146-RJ70A, 85A, 100A BAe 146-100A, 200A, 300A

T20G Gemini CH38013 160544-1 T62T-39 FHE159-6 26519-1 T62T-40C Series (APS 500) T62T-40C14-APS 500 R/C14 is installed CH34834 4952382

Beech Cessna Gulfstream Aerospace Gulfstream Commander Israel Aircraft Lear Mitsubishi/Beech Piper Swearingen Boeing Boeing Vertol Cessna Convair Dassault DeHavilland Cessna Fairchild Gulfstream BAe Raytheon Lockheed Sabreliner Corp. Embraer

King Air Citation I, II 980 Commodore Jet Lear Jet Diamond I, MU-2 Cheyenne Merlin, Metro 707 Model 234 Citation III 880 Falcon 20, 20D, 50 Dash 7, Dash 8 Citation III, VI, VII FH227 II 125-400, -600, -700, -800, -1000 Beech Jet Jetstar Sabreliner ERJ 135/145, Emb 120

85-37 FS47-11 75153 85-71, -90E P85-90F CH31723 or 369162 85-91C 85-98/C/CK CH31824 3888210-1 85-98/CK (A) 85-980/W/DCK/DHF 85-99 85-115/C/CK 85-115H 85-129/-129A, C, E, F, G 85-139/H 85-163/CK 85-185L 85-291C 85-291E FS47-11 75153 30-54 CH31615** 369964-5 30-95, 141 30-92 CH31615** 369964-5

Grumman

Gulfstream I

HAMILTON SUNDSTRAND

HONEYWELL

**Includes Installation Gaskets *FAA-PMA Pending

G

Convair Convair

580

580

Sud Aviation British Aerospace Hawker Siddeley

Caravelle BAe III Trident III

Hawker Siddeley Aerospatiale

Trident I & II Mercure 2

Convair

580 (Avensa)

Fairchild Convair Hawker Siddeley Lockheed Dassault

F27 600 DH125 Jetstar Falcon

48 Contact your preferred distributor for Champion factory FAA certified Igniter inspection program.

C


s

.

General Aviation APU Igniters

For airline igniter applications consult Champion Aerospace AV-22 catalog.

(FAA Approved) AUXILIARY AIRBORNE TURBINE UNIT Champion Engine Mfr. Part No. Part No. Aircraft Make Aircraft Model

Engine Mfr. & Model HONEYWELL (Cont.)

36-4A CH31615** 369964-5 Fokker 36-6 FHE159-6 3888002-1 Grumman 36-16/-16A NAMC 36-28 Fokker 36-50 Fokker 36-100 (E), (M) CH34249 or 3888096-1 Dassault CH34492 or 3888096-2 Canadair CH31713 369964-6 Fokker CH34553 3888096-3 Hawker Siddeley CH34585 3888096-4 DeHavilland British Aerospace 36-150RJ CH34549 304634-2 Canadair Embraer 36-150 Series (Except-F2M) CH34313 3888002-2 British Aerospace Aeritalia Aerospatiale Dassault Cessna Fokker Dornier IAI AstrA 1125 Saab-Fairchild 36-150 (RJ) (RR) CH34549 304634-2 Bombardier Fokker 36-150 F2M CH34706 3888002-5 Falcon RE220 (RJ) CH31930 WB3888446-1 Bombardier RE220 (GV) CH34730 (Series 21) WB3888401-1 Gulfstream RE100 (LJ) CH34549 304634-2 Learjet

TURBINE ENGINE APPLICATIONS (GPU) Champion Part No. Engine Mfr. Part No. Engine Mfr. & Model ALLIEDSIGNAL AUXILIARY POWER (ASAP)

F28 GII YS-11 VFW614 F28 Falcon 50, Falcon 20G CL-600, 601, 604 F28 HS125-700 DHC-5 BAe146-100/200 CL-RJ, CRJ200 EMB-120 BAe/AERO 146-300, 125-800/1000 ATR-42 Falcon 900, 20-5 Citation III, X 100 DO-328 340 CL601, RJ100, 200, Falcon 2000, 2000EX, Fokker-100, 100 2000 Global Express, CRJ 700, 900 GV Learjet 45/45XR

Applications

85-90 85-91 85-291 85-184

FS47-11 (HV) or 75153 Various Ground Power Equipment Manufacturers FHE118 (LV), (-1B) CH31723 or 373399 or 369162 Various Ground Power Equipment Manufacturers CH31824 (long life) 3888210-1

ST6L-77

CH34055

PRATT & WHITNEY CANADA, INC. * FAA-PMA Pending

3035102

AIRCO

**Includes Installation Gaskets

NOTES

Contact your preferred distributor for Champion factory FAA certified Igniter inspection program. 49


General Aviation Igniters For airline igniter applications consult Champion Aerospace AV-22 catalog. NOTES

50 Contact your preferred distributor for Champion factory FAA certified Igniter inspection program.


.

Table of Contents

MODEL/PART NO. EQUIPMENT DESCRIPTION PAGE Model 2600A & 2600AX-CE*........................ Spark Plug Vibrator Cleaner....................................................52 Model CT-475AV-CE* .................................. Cleaner and Tester................................................................52 CT-906 ..................................................... Plug Master Flex-Handle Ratchet Wrench..................................53 CT-907 ..................................................... Plug Mate Magnetic Spark Plug Socket.....................................53 No. 2612 ................................................... Spark Plug Lubricant .............................................................53 CT-709 ..................................................... Oil Filter Wrench...................................................................54 CT-913A, B ................................................ Lead-Master Wrenches..........................................................53 CT-456A ................................................... Spark Plug/Igniter Viewer.......................................................53 CT-496 ..................................................... Igniter Lead Connector Wear Gauge.........................................54 CT-497 ..................................................... Igniter Lead Connector Wear Gauge.........................................54 CT-911 & CT-912......................................... T-Handle Wrenches...............................................................53 CT-449 ..................................................... Thread Clean-Out Tool...........................................................54 CT-457 ..................................................... Fine Wire Gap-Setting Tool......................................................54 CT-415AV .................................................. Gap-Setting Tool...................................................................54 CT-450 ..................................................... Retractable Gap Gauge..........................................................54 Model 2500A ............................................. Gap-Setting Tool...................................................................56 CT-494 ..................................................... Igniter Erosion Gauge............................................................55 No. 52243 ................................................ Crimping Tool.......................................................................54 CT-446 ..................................................... Spark Plug Tray.....................................................................54 CT-923 ..................................................... Oil Filter Can Cutter...............................................................55 CT-924 ..................................................... Can Holder..........................................................................55 CT-925 ..................................................... Media Cutter........................................................................55 CT-492 ..................................................... Igniter Erosion Gauge............................................................55 CT-498 ..................................................... Igniter Erosion Gauge............................................................55 No. 91893................................................. Abrasive Compound..............................................................55 *Pending Approval

Service Tools & Equipment

LICENSE ARRANGEMENT: Champion service tools are distributed under license by Ideal Aviation, Mesa, AZ.

51


®

Service Tools & Equipment

Model 2600A Spark Plug Vibrator Cleaner

The Champion vibrator cleaner has been designed to clean fine-wire or massiveelectrode spark plugs that accumulate heavy lead compound deposits. Such deposits are virtually impossible to remove with standard abrasive cleaners. • Quick-change cleaning head assemblies • Easy replacement of single cutter blades • Powerful vibrator drive unit for reliability and long life • Flexible rubber mounting for portable or permanent bench installation

† CT-435F

Specifications Size: 5 1/4” x 4 1/4” x 7 1/2” (13.4 x 10.8 x 18.7 cm.) Shipping Wt: 7 lbs. (3.2 kg) (incl. accessories) Carton Size: 8” x 8” x 8” (20.0 x 20.0 x 20.0 cm.) Electrical Requirements: 110 V 60 Hz

† CT-435A Assembly Fine Wire and Two Prong

ACCESSORY PARTS LIST Qty. 1 ea. 1 ea.† 10 ea.† 1 ea.†

Description Vibrator Drive Unit Single Head Assembly A Full Cutter Blades (1 pkg) 9/64 Allen Wrench

Champion P/N

CT-435A CT-435F

† Parts standard with Model 2600A.

REPLACEMENT PARTS LIST Part No. Description 2600-4 Switch 2600-6 Adjustment Stud 5 /16” - 18 Stop Nut 2600-7 2600-10 Vibrator Damper 2600-11 Vibrator Unit 2600-19 #8-32 X 1/4” Set Screw

Contact Champion for parts other than those listed.

Model CT-475AV Spark Plug Service Unit

For Testing: Steel adapters of 14 and 18 mm are standard equipment and conveniently stored on top of cleaner for ready availability. Molded of rugged A. B. S. plastic which is durable, oil resistant and easy to clean.An aluminum-base frame is included, which permits easy mounting to a work bench and quick removal. The solid state ignition system produces a stable ignition test voltage providing greater accuracy and reliability. Its lack of moving parts eliminates the major cause of tester failures. Cleaning is by a dry-abrasive air blast, which quickly and effectively removes conductive deposits.

All compressed air for both cleaning and Cleaner & Tester testing passes through a “built-in” automatic For Cleaning: Two flexible rubber water trap to stop harmful air line moisture. adapters handle 14 and 18mm plug types. Specifications Size: 11 1/2” x 16 3/8” x 12 1/8” (29.2 x 41.5 x 30.7cm) Shipping Weight: 15 lbs. (6.80 kg) Color: Grey, Red, Black Compressed Air Required: 125 - 180psi (8.9 - 12.8 kg/cm˝) Electrical Requirements: 115V Carton Size: 12 1/2” x 13” x 17 1/2” (31.8 x 33.0 x 44.5 cm) Note: Use 91893 abrasive charge only. (See Replacement Parts List.) Model 800 Cleaners, use two (2) charges.

REPLACEMENT PARTS LIST Description Part No.

Water Trap................................................ 91010 Airline Section L2.......................................91053 Steel Adapter 18mm...................................91096 Airline Section L5.......................................91138 Mirror......................................................91836 Rubber Adapter 14mm.......................91657 (5-502) Abrasive Charge................................ 91893(533) Steel Adapter 14mm...................................91299 Airline Section L3...................................... 92048 Rubber Adapter 18mm....................92203 (5-503) Ignition System Retro Fit Kit......................... 91817 Red and Black Knob Kit..............................92401 Adapter Hold Down Cap............................. 92463 Switch-Push Button................................... 92487 Valve Stem, Knob & ‘O’ Ring........................ 92548 Cleaner Valve Assembly..............................92746 Water Trap Bowl Kit.......................... 92784 (L300) Cleaner Bag/Manifold Assembly.................. 93095 Airline Section L1...................................... 93250 Steel Nozzle Jet...............................93274 (5-512) Compression Chamber Assembly................ 93330 Elect. Control Module/Switch & Leads..........93415 Cleaner & Bag (CT-475 Only)...................... 93453 Coil (CT-475 Only).....................................93519 Rubber Nozzle Tip............................. 94023 (622) Hinge and Spring Kit.................................. 94245 Air Inlet Nipple/Mounting Nut...................... 94283 Airline Section L4...................................... 94306 Abrasive Shield......................................... 94486 Compression Gauge................................. 94523 Shielding Barrel Contactor............... 94783 (8-683) Cleaner Bag Model 800, 2400......................8-813

LICENSE ARRANGEMENT: Champion service tools are distributed under license by Ideal Aviation, Mesa, AZ.

52


Service Tools & Equipment

CT-906

CT-907

No. 91893

Plug Master Flex-Handle Ratchet Wrench (Formerly CT-405)

Magnetic Spark Plug Socket (Formerly CT-430)

Abrasive Compound

Especially designed to make spark plug removal and installation easier and faster. Flexhandle allows 30° angle travel in either direction. Extra fine reversible ratchet action requires only 6° travel for next bit. Popular 3/8” (0.95 cm) square drive fits Model CT-907 and other standard sockets. Knurled handle, rust-resistant chrome finish.

A companion tool to the champion plug master and other 3/8” (0.95 cm) square drive wrench handles. Especially designed for shielded aviation spark plugs. Built-in permanent Alnico magnet holds plugs firmly, practically eliminating dropped plugs.

Approximate Length: 11” (27.9 cm) long

Length: 3-1/2” (8.9 cm) 1/2” (0.95 cm) square drive 7/8” (2.2 cm) deep hex.

Weight: 12 oz. (340 g) Packed individually.

Finish:

Crome

Weight: 8-1/2” oz. (241 g) Packed individually.

No. 91893 abrasive compound replaces #533 abrasive in all Champion spark plug cleaner units. Cleaners formerly using the #533 abrasive will require two bags of 91893 to fully charge the unit. The chart below should be followed when replacing abrasive: 1. Use two bags of 91893 abrasive to fully charge Champion 2400, 800H, 800E and 700 cleaners. 2. Use one bag of 91893 to fully charge the CT475AV cleaner/tester. #622 Teflon nozzle tip sold separately.

CT-913A, B

CT-911 & CT-912

No. 2612

LeadMaster Wrenches

T-Handle Wrenches

Spark Plug Thread Lubricant

Lead-Master wrenches reduce time to remove CT-911 Special 3/4” (1.9 cm) open box and install spark plug ignition leads, also permits wrench. short arc turning due to 12-point grip head. Shipping Weight: 4 oz. (112 g) Shipping Weight: 9 oz. (280 g) CT-912 Special 7/8” (2.2 cm) open box wrench. Shipping Weight: 4 oz. (112 g)

®

A high-temperature, graphited lubricant for application to spark plug installation threads to prevent galling and seizure. Sturdy plastic 4 fl. oz. bottle with brush attached to cap. Size: 5-5/8” x 7-1/4” x 5-1/4” (14.4 x 18.4 x 13.3 cm) Shipping Weight:

4 lbs. (1.814 kg)

LICENSE ARRANGEMENT: Champion service tools are distributed under license by Ideal Aviation, Mesa, AZ.

53


®

Service Tools & Equipment

CT-496

CT-709

CT-497

Oil Filter Wrench

Igniter Lead Wear Gauge

Igniter lead connector wear guage for ARP670 type 2M fittings common to PT6 leads and others. Features a calibrated pin to measure connector wear. Opposite end sized to measure neoprene grommet expansion.

Designed for easy removal of Cessna oil filter adapters from 150 Series thru 300 Series aircraft. Manufactured from tool quality steel, features both 3/8” and 1/2” drives, as well as “flip over” reversability.

Shipping Weight: 11 oz. (311 g)

Size: 15/16” (3.33 cm)

Igniter Lead Connector Wear Gauge

Igniter lead connector wear gauge for ARP670 Type 3M fittings common to TPE6331, TFE731 leads and others. Features a spring weighted pin for an accurate “pull test” of connectors.

Shipping Weight: 11 oz. (311 g) Carton Size: 3-1/2” x 1-1/4” x 1-1/4” (8.89 x 3.18 x 3.18 cm)

CT-449 Thread Clean-Out Tool For cleaning aircraft engine spark plug 18 mm bushings to assure correct installation of new or overhauled spark plugs. Regular 7/8” (2.22 cm) hex fits spark plug sockets. Precision ground threads, three deep flutes retain carbon debris. Approximate Length: 4” (10.1 cm) long Weight: 7 oz. (198 g) Packed individually.

CT-450 Retractable Gap Gauge High impact red plastic case contains 4 sets of accurate retractable go and no go wire gauges:

Note:

CT-415AV Gap Setting Tool w/ 7/8” Thread Adapter w/ CT-466 A low-cost efficient gap setting tool for closing gaps on massive electrode-type aviation spark plugs. Designed for use as a hand tool, for mounting on a bench, or to be held in a vise. Complete with one adapter for 18mm massive plugs (Part CT-446 & CT-446-18 No. GT-204) and one CT-450 gap gauge. Also Spark Plug Tray includes GT-208 adapter for regapping REM37BY plugs. Sturdy steel tray holds up to 12 or 18 avia tion spark plugs. Speeds handling of used Size: 7-1/2” (19.5 cm) High or new plugs. Holes numbered to corre spond with engine cylinders. Protects Weight: 1-1/2 lbs. (0.68 kg) against shielding barrel contamination. Packed individually. Flat rubber, non-slip pads. Approx. Length: 5” x 8” x 3-1/2” (12.7 x 20.3 x 8.9 cm)

2 sets: .015 - .019 (.016 Nom) (0.40 - 0.50 mm)

Weight: 7 oz. (198 g) Packed individually.

2 sets: .018 - .022 (.019 Nom) (0.45 - 0.55 mm)

CT-457

Size: 3-1/2” (8.9 cm) long

Fine Wire Gap Setting Tool

Weight: 1-1/4 oz. (35 g) Replacement package of 4 wire gauge sets complete as described above. Order Part No. CT-450-WG.

Many leads incorporate type 2M & 3M connectors at opposite ends. Both CT-496 & CT-497 gauges are recommended.

Designed exclusively for adjusting fine wire electrode spark plug gaps. Slot fits iridium ground electrodes for quick, safe adjustment.

Size: 2-1/4” x 2” x 1/4” (5.7 x 5.0 x 0.63 cm) Weight: 1/2 oz. (14 g) Packed individually.

No. 52243 Crimping Tool A special tool used to crimp turbine iginition lead contacts to the unshield center wire. Shipping Weight: 14.4 oz. (408 g)

LICENSE ARRANGEMENT: Champion service tools are distributed under license by Ideal Aviation, Mesa, AZ.

54


Service Tools & Equipment

®

CT-494 Igniter Erosion Gauge

CT-923

Can Cutter

The new improved CT923 Cutter allows for oil filters to be cut in either direction. This is a complete tool with no parts or adapters to change. It is very easy to use, and will provide a simple effective means of cutting open oil filters. The cutter blades in the CT923 are the same blades that are used in the CT470. Also cuts the Champion RBC308 filter used on the Rotax 912 and 914 engines. Note: CT-923-4 Cutter Blade

The CT-494 accurately determines wear on 10 of our most popular surface gap igniters. insuring maximum igniter life without exceeding safe wear limitations. For use with following igniters: CH31547, CH31621, CH34055, CH34168, CH34187, CH34269, CH34304, CH34406, FHE146-7 and FHE246-4 Heavy duty protective sleeve included. Shipping Weight: 1 oz. (28 g)

CT-921

Oil Filter Torque Wrench The CT-921 can be used for oil filter installation and removal. It is calibrated to 17 foot pounds, the recommended torque. Can easily be recalibrated when necessary. 1” Hex.

Replacement Parts For 2500A Gap Setting Tool:

CT-2500A Gap Setting Tool Complete with accessories and gauges listed below, instructions for use. Packed individually, partially assembled. Size: 6” x 5 1/2” x 6” (15.2 x 13.9 x 15.2 cm) Handle Size: 9 1/2” (24.1 cm) long Shipping weight: 5 1/2 lbs. (2.49 kg) A precision gap-setting tool for all massive-electrode Champion spark plugs. Permits simultaneous adjustment of two opposite prongs without removing the spacing gauge. Designed for permanent installation on bench or heavy wooden board.

CT-458-2 Lever CT-458-3 Toggle Link CT-458-4 ToggleArm (Long Top Arm) CT-458-5 Toggle Pin CT-458-6 Stationary Finger CT-458-7 Stationary Finger Support CT-458-10 Upper Collet Bushing CT-458-11 Centering Bushing CT-458-12 Collet Adjustment Bushing CT-458-13 Spring Pin CT-458-15 Finger Pin GT-1-17L Spacing Gauge .015” (0.15-.019/0.40-0.50mm) GT-1-17J Spacing Gauge .018” (0.36 - 0.46mm) GT-1-27 Spacing Gauge Handle Assembly Note: Parts not listed are either standard or not normally required. Accessories Packaged in Model 2500A Gap Setting Tool: 10 Qty. GT-1-17L 1 Qty. GT-1-27

Spacing Gauge .015 - .019” (0.40 - 0.50 mm) Spacing Gauge Handle Assembly.

LICENSE ARRANGEMENT: Champion service tools are distributed under license by Ideal Aviation, Mesa, AZ.

55


76022_Champion_

®

Service Tools & Equipment Current/Discontinued Aviation Spark Plugs

SIZE 18mm 1/2” Reach: 18mm 13/16” Reach: 18mm 1-1/8” Reach: 14mm 3/8” Reach: 14mm 1/2” Reach: 14mm 3/4” Reach:

CURRENT PLUG TYPES M40J* M41E REM40E REM38E REM38S RHM40E RHM40E RHM38E RHM38S REB37E REB36S REB32E – RHB37E – RHB32E RHB29E RHB36S RHB32S RHB27S RHB27S RHU32E RHU27E RHU32S REJ38 NON-SHIELDED UNAVAILABLE RHL27SA* RHL28SA* REL37B NON-SHIELDED UNAVAILABLE EL602YC REN30S

DISCONTINUED PLUG TYPES AY4 M42E, M41N, D41N, C27, C26 EM41E, EM42E, ED41N, C27S, C26S, REM39N, RED39N, RC26S REM37N, RED37N, R25S REM38P, REM38W HM41E RHM39N, RHD39N RHM37N, RHD37N RHM38P, RHM38W REB37N, REA37N, R37S-1, RC35S, C35S, REB87N, REA87N, REB36W, R819, HO14S REB32N, REA32N, R56S, RC34S, C34S REB29N, REA29N, R33S RHB38E, RHB37N, RHA37E, RHA37N, RHB87N, RHA87N, R119, R115 RHB32N, RHB33E, RHA32E, RHA32N, R111 RHB29N, RHA29E, RHA29N, R103 R214D, RHB36P, RHB36W RHB32P, RHB32W RHB27P RHB27W RHU37E RHU30P, RHU30W C10S4, 78S J43, AJ66 HL26P/HL601P* HL31P/HL602P* REL37W, REL38B L34R, AJ10 EL601Y

NOTES

Champion service tools are distributed under license by Ideal Aviation, Mesa, AZ.

56

* Racing Spark Plug Only.


76022_Champion_INS

8/29/06

9:47 AM

Page 1

Over Pressurized Lube Oil Filters Have you ever had a filter that appears to be â&#x20AC;&#x153;BLOWN UPâ&#x20AC;?? Looks like a balloon or the gasket is protruding from the base of the filter? Often the deformed filter is the only sign that a problem existed in the lube oil system. The first thing you want to blame is the filter. However, if the pressure was sufficient to blow out the gasket or unroll the lockseam, the pilot may have experienced immediate and costly problems. This should be considered a non- airworthy condition. A look at how a lube oil system functions will show that the oil pump creates oil pressure. A pressure-regulating valve controls the upper limit of this pressure, which is usually an integral part of the pump. Figure 1 is a simplified diagram of the lube oil system showing the pump, regulating valve, filter and bearings. Bearings

Spin-On Filter

Pressure Regulating Valve in Open Position Pump

Excess Oil

NORMAL PRESSURE FIG. 1

The oil pump supplies sufficient flow to lubricate the bearings and other moving parts of the engine. This oil must be under pressure if it is to properly separate the highly loaded parts of an engine and prevent excessive wear. The purpose of the regulating valve is to provide a constant pressure for the system.

Continue On next page...


76022_Champion_INS

8/29/06

9:47 AM

Page 2

The regulating valve consists of a ball or plunger, which regulates pressure with the aid of a spring. The spring is calibrated so that the plunger will lift off its seat when the oil pressure reaches the desired setting. Once the valve is open, the pressure remains fairly constant with only small changes occurring as the engine rpm varies. The filter and all other components in the oil system are subjected to the pressure established by the regulating valve. If this pressure is excessive, filter damage may occur. This is the point that many mechanics that are not familiar with lube systems fail to realize. Just remember any blockage in the system can also send the pressure beyond what the filter can stand which is rated at 400 psi. Burst. Figure 2 shows the system operating with the regulating valve stuck in the shut position. Under this condition the pressure will build up in seconds and unless something happens to relieve the pressure the filter will become the victim and not the cause. With a high spike of pressure the gasket will blow out or the lockseam will unwind as the pressure increases. Bearings Spin-On Filter

Pressure Regulating Valve Stuck in Closed Position Pump

EXCESSIVE PRESSURE FIG. 2

In conclusion, if a filter distorts due to over pressure in the system, the fault might be the regulating valve

Not the filter

Courtesy of Filter Manufacturers Council


CHAMPION Aerospace PRODUCTS WARRANTY SPARK PLUGS, IGNITERS, OIL FILTERS, LEADS & EXCITERS Champion Aerospace LLC (“Champion”) warrants that spark plugs, harnesses, oil filter, exciters, leads and igniters sold by it are, at the time of delivery, free from defects in material and workmanship, provided that no warranty is made with respect to: (a) (b) (c)

any product that has been subject to negligence, accident or improper storage; any product that has been improperly installed or maintained; or any product that has been operated beyond normal or recommended replacement intervals or wear limits.

Champion’s obligation under this warranty is limited to the replacement of, or at Champion’s option, the return of the purchase price of any product which is returned to Champion or its designated representative (at customer’s expense) within one (1) year from the date of purchase and which, upon inspection by Champion, is found by Champion to be defective in material or workmanship. Champion shall not be responsible for the cost of labor removing any defective product or installing any replacement product. THE AFORESAID WARRANTY IS EXCLUSIVE AND IN LIEU OF ALL OTHER WARRANTIES, WHETHER EXPRESSED, IMPLIED OR STATUTORY, INCLUDING, BUT NOT BY WAY OF LIMITATION, ANY WARRANTY OF MERCHANTABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE. NOTE: All service tools and test equipment bearing the Champion logo are distributed by Ideal Aviation, Inc. under license from Champion Aerospace LLC and are subject to the terms of a separate warranty provided by Ideal Aviation, Inc. All claims in connection with such products should be referred to Ideal Aviation, Inc., 564 E. Juanita Ave., Mesa, AZ 85204.

Champion Aerospace LLC LIMITATION OF LIABILITY If Champion Aerospace LLC (“Champion”) breaches any of its obligations to Distributor in connection with the sale of any products to Distributor, whether the breach is one of the warranty or for any cause whatsoever, whether in contract or in tort including negligence, Champion may request the return of the products and tender to Distributor the purchase price theretofore paid by Distributor and, in such event, Champion shall have no further redelivery of the products. If Champion so requests the return of the products, Distributor shall redeliver the products to Champion in accordance with Champion’s instructions at Champion’s expense. THE REMEDIES PROVIDED HEREIN AND IN CHAMPION’S WARRANTY SHALL CONSTITUTE THE SOLE RECOURSE OF DISTRIBUTOR AGAINST CHAMPION FOR BREACH OF ANY OF CHAMPION’S OBLIGATIONS IN CONNECTION WITH THE SALE OF ANY PRODUCTS TO DISTRIBUTOR, WHETHER THE CLAIM IS MADE IN TORT OR IN CONTRACT, INCLUDING CLAIMS BASED ON WARRANTY, NEGLIGENCE, STRICT LIABILITY, DECEIT FRAUD, MISREPRESENTATION OR OTHERWISE. IN NO EVENT SHALL CHAMPION BE LIABLE FOR SPECIAL, INDIRECT, INCIDENTAL OR CONSEQUENTIAL DAMAGES (REGARDLESS OF THE FORM OF ACTION, WHETHER IN CONTRACT OR IN TORT INCLUDING NEGLIGENCE) NOR LOST PROFITS, NOR SHALL CHAMPION’S LIABILITY FOR ANY CLAIMS OR DAMAGE ARISING OUT OF OR CONNECTED WITH THE MANUFACTURE, SALE, DELIVERY OR USE OF ANY PRODUCTS EXCEED THE PURCHASE PRICE OF THE PRODUCTS. Warranty Terminology The following serves as a basic explanation of some of the terms used in the Champion warranty. In no event does the following amend or expand Champion’s warranty. Furthermore, paragraph 3 through 9 lists several examples which are in no way exclusive to any other scenario. 1. Defect in Material. Defect in the materials used in the product. Examples: a defect in the metal used in this product. 2. Defect in Workmanship. Defect in the workmanship involved in the direct manufacture of the product. 3. Negligence. Any type of mishandling or unreasonable handling of the product or handling of the product which results in damage. 4. Accident. An event beyond the reasonable control of the person involved. 5. Improper Storage. Storage in any environment or location which may cause damage. Example: storage of the product outside of the protective poly tubes. 6. Improperly Installed. Installation not in strict accordance with Champion’s specifications. Example: the use of pliers instead of an approved wrench to tighten the product. Example: the installation of the product of an unapproved application. 7. Improperly Maintained. Maintenance not in strict accordance with Champion’s specifications. Example: the failure to inspect or replace at the specified or proper time (hours or cycles). 8. Operated Beyond Normal or Recommended Replacement Intervals. Operation beyond normal replacement levels. Example: the continued operation of an igniter at 401 cycles if it requires, by use or specification, replacement at 400 cycles. 9. Operated Beyond Normal or Recommended Wear Limits. Operation beyond normal wear or recommended limits. Example: the continued operation of an igniter 8.34 mm if, by use or specification, it has a maximum ground electrode (shell) erosion limit of 8.33 mm (.328 in.). Any igniter that has been subjected to: Negligence Improper Maintenance Accident Operated Beyond Replacement Interval Improper Storage Operated Beyond Wear Limits (collectively, the “Factors”) Improper Installation ... is beyond warranty coverage. Champion is in no way responsible for ascertaining the presence of any of the above factors; instead, the party to whom Champion extends the warranty is responsible to insure that the above factors do not exist. If an igniter is replaced during troubleshooting and Champion finds the igniter to be serviceable per the approved Component Maintenance Manual or Igniter Technical Notice and Champion notes no material or workmanship defect during the investigation, or notes or discovers the existence of one or more of the Factors, Champion will not allow warranty replacement or credit. If Champion notes a material or workmanship defect at the warranty investigation and notes that no Factors exist, a replacement or credit will be issued in accordance with the Champion Aerospace LLC Warranty Statement. For Technical Assistance Contact: Champion Aerospace LLC Product Support/Technical Services 1230 Old Norris Road Liberty, SC 29657 864-843-5400 Email: support @champaero.com

57


L-1318H Consolidated Application Data

SCOPE This reference manual provides complete application data for Slick Magnetos and Ignition Harnesses, Champion® Aviation Spark Plugs, SlickSTART™, Slick Ignition Upgrade Kits, and technical information on all Slick Piston Engine Ignition Products.

CHAMPION AEROSPACE PROPRIETARY INFORMATION THIS DOCUMENT IS PROPRIETARY PROPERTY OF CHAMPION AEROSPACE LLC. IT IS NOT TO BE COPIED OR REPRODUCED IN ANY MANNER, NOR SUBMITTED TO OTHER PARTIES FOR EXAMINATION WITHOUT PRIOR WRITTEN APPROVAL.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 ©2009 Champion Aerospace LLC

PAGE NO.

REVISION

COVER

H


L-1318

TABLE OF CONTENTS 0 0.0 0.1 0.1.1 0.2 0.2.1 0.2.2 0.2.3 0.2.4 0.2.5 0.3 0.3.1 0.3.2 0.3.3 0.3.4 0.3.5 0.4

INTRODUCTION ............................................................................................................................... 0-1 Copyright Statement ................................................................................................................... 0-1 Slick Ignition System Overview ................................................................................................... 0-1 A Complete Offering ............................................................................................................. 0-2 Aircraft Magnetos ........................................................................................................................ 0-2 Descriptive Part Number Explanation ................................................................................... 0-2 Rotation, Lag Angle and Retard Angle ................................................................................. 0-2 Magneto Installation Orientation - Right and Left .................................................................. 0-2 Core Policy ........................................................................................................................... 0-3 Rebate Program ................................................................................................................... 0-3 Ignition Harnesses ...................................................................................................................... 0-3 Ignition Wire .......................................................................................................................... 0-3 Magneto End Termination ..................................................................................................... 0-3 Spark Plug End Termination ................................................................................................. 0-3 Mounting Hardware .............................................................................................................. 0-3 Harness Color Selection ....................................................................................................... 0-4 Spark Plugs ................................................................................................................................ 0-4

1 1.1 1.2

HOW TO USE THIS MANUAL ........................................................................................................... 1-1 Product Application Information Worksheet................................................................................. 1-2 Abbreviations Used in this Manual .............................................................................................. 1-2

2 2.1 2.2 2.3 2.4

APPLICATION DATA ........................................................................................................................ 2-1 General Notes ............................................................................................................................. 2-1 Textron Lycoming Applications .................................................................................................... 2-1 Teledyne Continental Motors Applications ................................................................................... 2-1 SlickSTART™ ............................................................................................................................. 2-2

3

KIT APPLICATION ........................................................................................................................... 3-1

4

MAGNETO APPLICATIONS ............................................................................................................. 4-1

5

HARNESS APPLICATIONS (5/8”) ................................................................................................... 5-1

6

HARNESS APPLICATIONS (3/4”) ................................................................................................... 6-1

7

SPARK PLUG APPLICATIONS ........................................................................................................ 7-1

A

APPENDIX ....................................................................................................................................... A-1 KIT CONTENTS (3/4” SPARK PLUG) ......................................................................................... A-3 KIT CONTENTS (5/8” SPARK PLUG) ......................................................................................... A-4 MAGNETOS (IN PRODUCTION) ................................................................................................ A-7 MAGNETOS (INACTIVE) ............................................................................................................ A-9 VOLKSWAGEN CONVERSION APPLICATION ........................................................................ A-11

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

ii

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318 0.

INTRODUCTION

0.0

COPYRIGHT STATEMENT All rights reserved. This manual is produced exclusively for use with Slick magnetos and ignition harnesses, Champion® Aviation Spark Plugs and SlickSTART™ magneto start booster. It may not, in whole or in part, be copied, photocopied, reproduced, translated or reduced to any electronic medium or machine-readable form without prior consent, in writing, from Champion Aerospace. WARNING: IMPROPER OR UNAUTHORIZED APPLICATIONS OF THE INFORMATION CONTAINED IN THIS MANUAL MAY RESULT IN LOSSES OR DAMAGES TO THE USER. The accuracy and applicability of this manual have not been verified for any assembly, component, or part not manufactured by Champion Aerospace. Any use of this manual for other than its intended purpose, or for performing any installation, maintenance, replacement, adjustment, inspection, or overhaul of an assembly, component, or part not manufactured by Champion Aerospace, is not approved, endorsed or sanctioned by Champion Aerospace. No liability will be assumed by Champion Aerospace for actual, consequential or other types of damages directly or indirectly resulting from the unauthorized use of this manual for other than its stated purposes. When performing installation, maintenance, replacement, adjustment, inspection, or overhaul of any Slick assembly, component, or part, it is imperative that the latest revision of the appropriate Slick manual or product support document be referenced. Contact Champion Aerospace to be sure you have the latest manual or support document revision before performing any work. All reasonable attempts were made to make this manual as complete and accurate as possible. If you have any questions, comments, corrections, or require clarification of any information contained herein, please write Champion Aerospace Customer Service Department at 1230 Old Norris Road, Liberty, SC, 29657, or email slicksupport@champaero.com.

0.1

SLICK IGNITION SYSTEM OVERVIEW Champion Aerospace has been an innovative leader in the design and manufacture of aircraft ignition systems for over 30 years. Champion Aerospace designs and manufactures, not merely assembles, a superior product consistently specified by quality conscious OEMs. Champion Aerospace product line includes the following brands: Slick magnetos, Slick ignition harnesses, Slick ignition replacement parts, Champion® Aviation Spark Plugs, SlickSTART™ and LASAR®. Vertically Integrated Manufacturing Champion Aerospace manufactures nearly every component in its magnetos, harnesses, spark plugs, and most components in other ignition related products. This in-house manufacturing process allows Champion Aerospace to control quality to precise tolerances from raw material to finished product, setting industry standards. Champion Aerospace selects materials that are known for their reliability and durability. With proper installation and compliance with maintenance procedures, Slick ignition products should last to engine TBO before overhaul or replacement is required. Worldwide Network Slick Ignition Systems are available through an international network of aircraft parts distributors that offer outstanding product support, delivery and service. See Champion Aerospace Form L-1051 for details. Complete AOG Inventory Champion Aerospace supports its distribution network with complete AOG inventory available for next-day delivery.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

0-1

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318 0.1.1

A COMPLETE OFFERING Slick Ignition Components are available in the following configurations: - Engine Upgrade Kits: Cost saving kits include two magnetos, a complete harness, a complete set of spark plugs and all mounting hardware. - Single magnetos: Timing pins are included for easy installation. - Custom Fit Harnesses: Both complete and half harnesses are available. - Custom Fit Dual Harnesses: For TCM/Bendix dual magnetos. - Universal Harness Kits: For those who prefer to build up their own assemblies. - Individual Leads: For single lead replacement. - Service Parts: For all Slick magnetos and harnesses.

0.2

AIRCRAFT MAGNETOS

0.2.1

DESCRIPTIVE PART NUMBER EXPLANATION Champion Aerospace utilizes a descriptive part numbering system for both Slick magnetos and Slick ignition upgrade kits. Magneto Part Numbering Current production magnetos have four digits in the part number. The first two digits indicate the series: 43xx - 4300 Series for 4-cylinder engines 63xx - 6300 Series for 6-cylinder engines The last two numbers indicate the model number. Example: 4371 = 4300 Series four-cylinder number 71

0.2.2

ROTATION, LAG ANGLE AND RETARD ANGLE Rotation Rotation specifies the direction in which the magneto rotor shaft turns when viewed from the mounting end of the magneto. Left-Hand Rotation is counterclock-wise when viewed from the magneto-mounting end: Right-Hand Rotation is clockwise when viewed from the magneto-mounting end. Important: Check the data plate on the magneto being replaced for the shaft rotation. Replace with a magneto having the same rotation. Lag Angle - Impulse Coupled Magnetos The impulse coupling is a mechanical device that assists in engine starting. At low cranking speed, the magneto impulse coupling retards the magneto ignition timing until the engine crankshaft is at its proper position for starting. The lag angle, noted on the magneto data plate, is the impulse coupling’s retard angle measured in degrees. After engine start, the impulse coupling disengages and returns the magneto to normal engine timing. Lag Angle - Retard Breaker Magnetos The retard breaker assembly is an electrical device, powered by the aircraft battery, used to aid in starting the engine. At low cranking speed, the retard breaker retards the magneto ignition timing until the engine crankshaft is at its proper position for starting. The lag angle, noted on the magneto data plate, is the retard breaker’s retard angle measured in degrees. When the engine starter disengages, the retard breaker assembly is also disengaged and the magneto returns to normal engine timing.

0.2.3

MAGNETO INSTALLATION ORIENTATION - RIGHT AND LEFT In most cases, right and left magneto positions are referenced from the rear of the engine, i.e., from the pilot’s perspective. Reference engine and/or airframe manufacturer’s literature.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

0-2

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318 0.2.4

CORE POLICY Purchase of a Slick magneto requires the purchase of an accompanying Core Certificate. When the replacement magneto is installed, the replaced core and the Core Certificate should be returned to the distributor that sold you the replacement unit. Your distributor will then issue you a credit for the initial Core Certificate purchase.

0.2.5

REBATE PROGRAM Champion Aerospace will also accept competitive units according to the rebate program in effect at the time of the return. Please contact your authorized Champion Aerospace distributor for complete rebate program details.

0.3

IGNITION HARNESSES Slick ignition harnesses by Champion Aerospace are the top choice among manufacturers of piston-engine aircraft, offering distinct advantages over competitive products. Slick 5mm ignition harnesses consist of a length of conductor wire with a terminating connection at the magneto end and a terminating connection at the spark plug end.

0.3.1

IGNITION WIRE The ignition wire is a copper-coated stainless steel coiled conductor encased in silicone and fiberglass and sheathed by a woven metallic braid impregnated with silicone. The latest Slick harnesses can be ordered with an extra outer layer of silicone that is available in four custom colors: Yellow, Blue, Black and Red. Please see Section 0.3.5 for details. Unique Coiled Conductor The patented coiled conductor provides for flexibility and high fatigue resistance over a wide range of ambient temperatures and atmospheric conditions. The conductor has spring-like properties and expands or contracts with changes in temperature while being dampened by its inner silicone core. As a result, the expansion and contraction is more uniform and not localized along the wire, eliminating the kinking and resultant “shorting-out” commonly associated with stranded conductors. The coiled conductor also allows for tight bending radii thus eliminating the need for costly, bulky elbows that can collect heat and induce failure. Low Radio Noise The coiled conductor provides greater inductance and lower EMI (Electromagnetic Interference) than a stranded conductor, resulting in superior avionics noise suppression. The woven metallic braid provides mechanical strength and a ground plane shield for the coiled conductor to reduce radio frequency interference.

0.3.2

MAGNETO END TERMINATION Champion Aerospace manufactures magneto harness caps, insulators and mounting hardware for all Slick and TCM/Bendix four-, and six-cylinder applications including the TCM/Bendix Dual Magneto. Magneto end termination is accomplished with a lipped aluminum ferrule, high temperature nylon or silicone insulator “cigarettes,” and corrosion resistant, stainless steel compression springs and retaining electrode pins.

0.3.3

SPARK PLUG END TERMINATION Slick ignition harnesses can be configured for both 5/8-24 and 3/4-20 shielded aviation spark plugs. This spark plug size indicates the thread size on the spark plug barrel that mates with the harness lead nut. 5/8-24 spark plugs are often referred to as “small barrel” and 3/4-20 spark plugs are often referred to as “large barrel” or “all weather” plugs.

0.3.4

MOUNTING HARDWARE Slick mounting hardware is used to secure the ignition leads to the engine or surrounding baffles. Mounting hardware is included with every Slick ignition harness and in all ignition upgrade kits.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

0-3

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318 0.3.5

HARNESS COLOR SELECTION To order a Slick ignition harness in a custom color, indicate your color selection by adding the appropriate color code to the end of the model number. Y = Yellow, U = Blue, B = Black, and R = Red. Example: Order M4001R for a red ignition harness.

0.4

SPARK PLUGS Champion® Aviation Spark Plugs, available in both massive electrode and fine wire designs, offer superior heat transfer and leakage protection, advanced reliability, long life, and maximum cost-effectiveness. Champion® spark plugs are designed and manufactured by Champion Aerospace. Both 18-mm and 14-mm aviation spark plugs are available in low-cost massive electrode design or in long life, high performance Champion® Iridium fine wire design. Both plug styles are available in 5/8"-24 (small barrel) or in 3/4"-20 (large barrel). SPARK PLUG FEATURES • • • • • • • • •

High-conductivity copper core electrode High-alumina ceramic insulator Hot-lock assembly Two layers of corrosion protection Iridium fine wire electrode 18-mm and 14-mm designs Shielded and unshielded OEM for Lycoming/TCM and engine manufacturers worldwide Made in the USA.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

0-4

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

1.0

HOW TO USE THIS MANUAL The application data contained in this manual is divided by product category. Proceed as follows: A.

Fill out the Product Application Information Work-sheet in Section 1.1. This information is necessary to determine the correct product for your installation.

B.

Turn to Section 3, “Kit Application”, and locate your engine in the left hand column. If you use a single impulse coupled magneto or retard breaker magneto on one side and a direct drive magneto on the other side, then the appropriate kit number is shown on the same line of the second column labeled “Single IC/RB Kit”. If you use impulse-coupled magnetos on both sides, then the appropriate kit number is shown in the third column labeled “Dual IC”. Complete the kit number by adding the appropriate dash number for the desired spark plugs. If indicated, see Section 2.0 to review the applicable notes listed on that line.

C.

The kits described above provide the best value when replacing or upgrading your ignition system. All needed parts are conveniently packaged together. However, if you wish to buy the components individually, go to the subsequent sections to find the products that are approved for your installation: *

Magnetos: Turn to Section 4, “Magneto Application”. Find your engine model in the left hand column. Read across the table to find the appropriate right hand and left hand magneto part numbers. If indicated, see Section 2.0 to review the applicable notes listed on that line. NOTE: ON CERTAIN APPLICATIONS, UPGRADING FROM A SINGLE IMPULSE TO A DUAL IMPULSE SYSTEM MAY REQUIRE THE PURCHASE OF AN ADDITIONAL DRIVE GEAR OR ADAPTER.

*

Harnesses: Turn to Section 5, “Harness Application (5/8”)”, if you use 5/8" plugs (small barrel) or to Section 6, “Harness Application (3/4”)”, if you use 3/4" plugs (large barrel). In addition to harnesses for current production Slick magnetos, harness applications for 600 Series Slick magnetos and TCM/Bendix magnetos are also provided. [Unless specifically noted, “600 Series” refers to all Slick magnetos with the part number “6xx.”] Find your engine model in the left hand column. There will be many listings depending on the magnetos used. The appropriate harness will be on the line with a check mark on the intersection of the engine model line and the magneto model column. The complete ignition harness part number is shown in the second column labeled “Complete Harness” and the two half harnesses that make up the complete harness are listed in the third and fourth column labeled “RH Harness” and “LH Harness” respectively. If indicated, see Section 2.0 to review the applicable notes listed on that line.

*

Spark Plugs: Turn to Section 7, “Spark Plug Application”. Find your engine model in the first column. Each check mark across that line indicates that a plug is approved for that engine. Please insure that the desired plug is selected (massive vs. fine wire) and that the plug is compatible with the rest of the ignition system (3/4" vs. 5/8").

D.

The last section labeled “Appendix” contains general information that describes: (1) the contents of various kits; (2) the active and inactive magnetos; (3) special Volkswagen conversion data.

E.

SlickSTART™: SlickSTART™ is approved for use on the majority of airframe applications. The model number depends on the magnetos installed on the engine. The SS1001 is used only with Slick magnetos. The SS1002 is usually used with TCM/Bendix magnetos. SlickSTART™ is not approved for use with the TCM/Bendix “dual magneto”.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

1-1

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318 1.1

PRODUCT APPLICATION INFORMATION WORKSHEET The following information will aid you in selecting the correct magneto, upgrade kit, or ignition harness: 1.

Engine Manufacturer

2.

Engine Model Number

3.

Engine Type (4 or 6 Cylinder)

4.

Current Ignition System Manufacturer A.

Number of impulse coupled magnetos (1 or 2) Magneto Shaft Rotation (Right or Left) See dataplate on current magneto Lag Angle

B.

Number of Direct Drive (Non-Impulse) Magnetos

C.

Number of Retard Breaker Magnetos

D.

Are the magnetos pressurized?

E.

Spark plug size (5/8" or 3/4")

5.

Do you want to upgrade from a single impulse to a dual impulse system? If yes, an additional drive gear and/or adapter purchase may be required for 4-cylinder Lycoming engines.

1.2

6.

Are you upgrading from a 600 Series to a 6300 Series magneto? If yes, you will need to purchase an M3154 Adapter or a magneto equipped with an M3154 Adapter to be able to reuse the existing harness. Alternately, purchase a new harness configured for 6300 Series magnetos.

7.

Are you upgrading a complete engine from a TCM/ Bendix to a Slick system? If yes, purchase a complete Slick Ignition Upgrade Kit.

ABBREVIATIONS USED IN THIS MANUAL The following is a list of abbreviations used in this manual: IC DD RB REF

Impulse Coupled (...magneto) Direct Drive (...magneto) Retard Breaker (...magneto) Reference (References are summarized in the Section 2.0.

NOTE: Unless specifically noted, the term “600 Series” refers to all Slick magnetos with the part number designation “6xx.”.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

1-2

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

2.0

APPLICATION DATA

2.1

GENERAL NOTES Certain sections of this manual contain “Notes” columns that refer to applicability and/or restrictions for each installation. The table below provides a cross-reference to the reference codes listed in the notes columns: Ref

2.2

Description

1

Slick Magneto Model 4345 must be used with Textron Lycoming Isolation Drive Adapter, Lycoming P/N LW15416. This part is not supplied by Champion Aerospace. Reference Lycoming Service Instruction 1346 for further information.

2

When upgrading 4-cylinder Lycoming engines to dual impulse coupled magnetos, refer to Champion Aerospace publication SL2-93.

3

When upgrading 360 Lycoming engines from impulse coupled to retard breaker magneto’s refer to Lycoming Service Letter SL-1506.

4

When ordering the 4333 magneto only, no gear is included. However, the K4334-xx Ignition Upgrade Kit includes drive gears (qty. 2 ea.).

5

K4520 Ignition Upgrade Kit does not include drive gears.

6

Magneto is configured to accept 600 series harness. Harness adapter M3154 is included with magneto.

7

Will not fit Cessna model 337 with magnetic tach pickup on rear engine.

8

Refer to Champion Aerospace publication SL3-94 prior to ordering this magneto.

9

Upgrade from competitor magnetos on the Franklin 335 or 350 will require gears that may no longer be available. See Champion Aerospace publication SL3-92.

10

-nd and -wd shown in certain engine applications refer to narrow deck and wide deck, respectively

TEXTRON LYCOMING APPLICATIONS: • Right magneto can be direct drive (DD) or impulse coupled (IC). • If you are upgrading your 4-cylinder Lycoming engine ignition system from single impulse to dual impulse magnetos, a Textron-Lycoming 61665 Drive Gear is required. This gear is not supplied by Champion Aerospace. • If more than one magneto fits your application, choose the same magneto lag angle or retard angle as the one being replaced. • Slick Harness M4001 directly replaces part number M2363. M4001 can be used in any installation where an M2363 was previously specified.

2.3

TELEDYNE CONTINENTAL MOTORS APPLICATIONS: • On Teledyne Continental engines, magnetos should always be used in pairs. The right and left magnetos must be the same model numbers.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

2-1

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318 2.4

SlickSTART™: • SlickSTART™ is designed to replace all TCM/Bendix starting vibrators used in conjunction with Champion Aerospace Slick products and TCM/Bendix magnetos. • SlickSTART™ is also approved for use with Slick and TCM/Bendix impulse coupled magnetos to enhance engine starting performance. However, the best starting performance is realized when SlickSTART™ is used in conjunction with a retard-breaker magneto (Slick or TCM/Bendix). • SlickSTART™ is not approved for installation on any airframe equipped with TCM/Bendix D-2000 or D-3000 series impulse coupled or retard breaker magnetos.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

2-2

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


KIT APPLICATION

L-1318

Section 3.0 KIT APPLICATION

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

3-1/(3-2 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Franklin Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

4A-235-B31 (32°,116HP) 4A-235-B4 (26°,125HP)

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

K4392 K4392

Champion® Aviation Spark Plug 3/4”-20 Thread

Notes

-32S, -32 -32, -32S

Superior Air Parts Engine Engine - Model (Degree°, HP)

IO-360 (25°,180HP) O-360 (25°,180HP)

Single IC/RB Kit

Dual IC

K4516 K4516

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread

Notes

Champion® Aviation Spark Plug 3/4”-20 Thread

Notes

-38S, -40, -38 -38, -38S, -40

Teledyne Continental Motors Single IC/RB Kit

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

A-65-1 (30°,65HP) A-65-3 (30°,65HP) A-65-6 (30°,65HP) A-65-6J (30°,65HP) A-65-7 (30°,65HP) A-65-8 (30°,65HP) A-65-8F (30°,65HP) A-65-8FJ (30°,65HP) A-65-8J (30°,65HP)

K4522 K4522 K4522 K4522 K4522 K4522 K4522 K4522 K4522

K4334 K4334 K4334 K4334 K4334 K4334 K4334 K4334 K4334

-38S, -40 -40 -40 -40 -38S, -40 -40 -40 -40, -37BY -40

4 4 4 4 4 4 4 4 4

A-75-3 (30°,75HP) A-75-6 (30°,75HP) A-75-6J (30°,75HP) A-75-8 (30°,75HP) A-75-8F (30°,75HP) A-75-8FJ (30°,75HP) A-75-8J (30°,75HP) A-75-9 (30°,75HP) A-75-9J (30°,75HP)

K4522 K4522 K4522 K4522 K4522 K4522 K4522 K4522 K4522

K4334 K4334 K4334 K4334 K4334 K4334 K4334

-38S, -40, -38 -38S, -40 -38S, -40 -40 -40 -40 -40 -38S, -40 -38S, -40

4 4 4 4 4 4 4

K6327 K6327 K6327

-38S, -40, -38, -37BY -37BY, -38S, -40, -38 -37BY, -38, -38S, -40

Engine Engine - Model (Degree°, HP)

C-145-2 (26°,145HP) C-145-2H (26°,145HP) C-145-2HP (26°,145HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

3-3

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Teledyne Continental Motors

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

C-75-12 (30°,75HP) C-75-12F (30°,75HP) C-75-12FH (30°,75HP) C-75-12FHJ (30°,75HP) C-75-12FJ (30°,75HP) C-75-12J (30°,75HP) C-75-15 (30°,75HP) C-75-15F (30°,75HP) C-75-8 (30°,75HP) C-75-8F (30°,75HP) C-75-8FH (30°,75HP) C-75-8FHJ (30°,75HP) C-75-8FJ (30°,75HP) C-75-8J (30°,75HP)

K4520 K4520 K4520 K4520 K4520 K4520 K4520 K4520 K4334 K4334 K4334 K4334 K4334 K4334

-38S, -40, -38, -37BY -38S, -40, -38, -37BY -38, -37BY, -38S, -40 -40, -38, -37BY, -38S -40, -38, -38S, -37BY -37BY, -38S, -40, -38 -37BY, -38, -38S, -40 -38S, -40, -38, -37BY -38S, -40 -38S, -40 -38S, -40 -38S, -40 -38S, -40 -38S, -40

5 5 5 5 5 5 5 5 4 4 4 4 4 4

C-85-12 (30°,85HP) C-85-12F (30°,85HP) C-85-12FH (30°,85HP) C-85-12FHJ (30°,85HP) C-85-12FJ (30°,85HP) C-85-12J (30°,85HP) C-85-14 (30°,85HP) C-85-14F (30°,85HP) C-85-15 (30°,85HP) C-85-15F (30°,85HP) C-85-8 (30°,85HP) C-85-8F (30°,85HP) C-85-8FHJ (30°,87HP) C-85-8FJ (30°,87HP) C-85-8J (30°,87HP)

K4522 K4522 K4522 K4522 K4522

K4520 K4520 K4520 K4520 K4520 K4520 K4520 K4520 K4520 K4520 K4334 K4334 K4334 K4334 K4334

-38S, -40 -38S, -40 -38S, -40 -38S, -40 -38S, -40 -40, -38S -38S, -40, -38, -37BY -38S, -40 -38S, -40 -38S, -40 -38S, -40 -38S, -40 -38S, -40 -38S, -40 -38S, -40

5 5 5 5 5 5 5 5 5 5 4 4 4 4 4

K4522 K4522

K4520 K4520 K4520 K4520 K4520 K4520 K4520 K4520 K4334 K4334

-38S, -40 -38S, -40 -38S, -40 -38S, -40 -40, -38S -40, -38S -38S, -40 -38S, -40 -38S, -40 -40, -38S

5 5 5 5 5 5 5 5 4 4

Engine Engine - Model (Degree°, HP)

C-90-12F (25°,95HP) C-90-12FH (25°,95HP) C-90-12FJ (25°,95HP) C-90-12FP (25°,95HP) C-90-14F (25°,95HP) C-90-14FH (25°,95HP) C-90-14FJ (25°,95HP) C-90-16F (25°,95HP) C-90-8F (25°,95HP) C-90-8FJ (25°,95HP) E-165-2 (26°,165HP) E-165-2 (26°,165HP) E-165-2 (26°,165HP) E-165-2 (26°,165HP) E-165-3 (26°,165HP)

K6377 K6379 K6577 K6579 K6377

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

Single IC/RB Kit

09

Champion® Aviation Spark Plug 3/4”-20 Thread

-38, -38S, -40 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

-38S, -38, -40

Notes

8 8 8 8 8

PAGE NO.

REVISION

3-4

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

Dual IC

E-165-3 (26°,165HP) E-165-3 (26°,165HP) E-165-3 (26°,165HP) E-165-4 (26°,165HP) E-165-4 (26°,165HP) E-165-4 (26°,165HP) E-165-4 (26°,165HP)

K6379 K6577 K6579 K6377 K6379 K6577 K6579

E-185-1 (26°,205HP) E-185-1 (26°,205HP) E-185-1 (26°,205HP) E-185-1 (26°,205HP) E-185-10 (26°,205HP) E-185-10 (26°,205HP) E-185-10 (26°,205HP) E-185-10 (26°,205HP) E-185-11 (26°,205HP) E-185-11 (26°,205HP) E-185-11 (26°,205HP) E-185-11 (26°,205HP) E-185-2 (26°,185HP) E-185-2 (26°,185HP) E-185-2 (26°,185HP) E-185-2 (26°,185HP) E-185-3 (26°,205HP) E-185-3 (26°,205HP) E-185-3 (26°,205HP) E-185-3 (26°,205HP) E-185-5 (26°,185HP) E-185-5 (26°,185HP) E-185-5 (26°,185HP) E-185-5 (26°,185HP) E-185-8 (26°,205HP) E-185-8 (26°,205HP) E-185-8 (26°,205HP) E-185-8 (26°,205HP) E-185-9 (26°,205HP) E-185-9 (26°,205HP) E-185-9 (26°,205HP) E-185-9 (26°,205HP)

K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579

E-225-2 (26°,225HP) E-225-2 (26°,225HP) E-225-2 (26°,225HP) E-225-2 (26°,225HP) E-225-4 (26°,225HP) E-225-4 (26°,225HP)

K6377 K6379 K6577 K6579 K6377 K6379

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread -38S, -40, -38

-38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38, -40, -38S -40, -38, -38S -38S, -40, -38 -38, -38S, -40 -38, -38S, -40 -38, -38S, -40 -38S, -40, -38 -38S, -40, -38 -38, -38S, -40 -38, -40, -38S -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38, -38S, -40 -38, -40, -38S -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -38, -40 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -40, -38, -38S -40, -38, -38S -38S, -40, -38

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

-38S, -40, -38 -40, -38, -38S

Notes 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8

PAGE NO.

REVISION

3-5

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

E-225-4 (26°,225HP) E-225-4 (26°,225HP) E-225-8 (26°,225HP) E-225-8 (26°,225HP) E-225-8 (26°,225HP) E-225-8 (26°,225HP) E-225-9 (26°,225HP) E-225-9 (26°,225HP) E-225-9 (26°,225HP) E-225-9 (26°,225HP)

K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579

-40, -38, -38S -38S, -40, -38

GO-300-A (28°,175HP) GO-300-B (28°,175HP) GO-300-C (28°,175HP) GO-300-D (28°,175HP) GO-300-E (28°,175HP)

K6326 K6326 K6326 K6326 K6326

-38S, -40, -38, -37BY -38, -37BY, -40, -38S -40, -38, -37BY, -38S -38S, -40, -38, -37BY -38S, -40, -38, -37BY

IO-360-A (20°,210HP) IO-360-B (20°,180HP) IO-360-C (20°,210HP) IO-360-CB (20°,210HP) IO-360-D (20°,210HP) IO-360-DB (20°,210HP) IO-360-E (20°,210HP) IO-360-ES (24°,210HP) IO-360-G (20°,210HP) IO-360-GB (20°,210HP) IO-360-H (20°,210HP) IO-360-HB (20°,210HP) IO-360-J (20°,210HP) IO-360-JB (20°,210HP) IO-360-K (20°,195HP) IO-360-KB (20°,195HP)

K6322 K6322 K6322 K6322 K6322 K6322 K6322 K6322 K6322 K6322 K6322 K6322 K6322 K6322 K6322 K6322

IO-470-A (24°,240HP) IO-470-A (24°,240HP) IO-470-C (26°,250HP) IO-470-C (26°,250HP) IO-470-D (20°,260HP) IO-470-E (20°,260HP) IO-470-F (20°,260HP) IO-470-G (26°,250HP) IO-470-G (26°,250HP) IO-470-H (20°,260HP) IO-470-H (20°,260HP) IO-470-J (22°,225HP) IO-470-J (22°,225HP)

K6320 K6520 K6320 K6520 K6320 K6320 K6320 K6320 K6520 K6320 K6520 K6320 K6520

K6313 K6313 K6313

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion® Aviation Spark Plug 3/4”-20 Thread

-38S, -40, -38 -40, -38, -38S -40, -38, -38S -38S, -40, -38 -38S, -40, -38 -40, -38, -38S -40, -38, -38S -38S, -40, -38

-38, -38S -38, -38S, -40 -38, -38S -38, -38S -38, -38S -38 -38, -38S -38, -38S -38, -38S -38S, -38 -38S, -38 -38, -38S -38, -38S -38, -38S -38, -38S -38, -38S

Notes 8 8 8 8 8 8 8 8 8 8

7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7

-38, -38S, -40 -38, -38S, -40 -38, -38S, -40 -38, -38S, -40 -32 -32 -32 -40, -38, -38S -40, -38, -38S -32, -32S, -36S -38, -38S -38S, -40, -38 -38S, -40, -38

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

3-6

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

IO-470-K (22°,225HP) IO-470-K (22°,225HP) IO-470-L (20°,260HP) IO-470-LO (20°,260HP) IO-470-M (20°,260HP) IO-470-M (20°,260HP) IO-470-N (20°,260HP) IO-470-P (26°,250HP) IO-470-P (26°,250HP) IO-470-R (26°,250HP) IO-470-R (26°,250HP) IO-470-S (20°,260HP) IO-470-T (26°,250HP) IO-470-T (26°,250HP) IO-470-U (20°,260HP) IO-470-V (20°,260HP) IO-470-VO (20°,260HP) IO-520-A (22°,285HP) IO-520-B (22°,285HP) IO-520-BA (22°,285HP) IO-520-BB (22°,285HP) IO-520-C (22°,285HP) IO-520-CB (22°,285HP) IO-520-D (22°,300HP) IO-520-E (22°,300HP) IO-520-F (22°,300HP) IO-520-J (22°,285HP) IO-520-K (22°,300HP) IO-520-L (22°,300HP) IO-520-M (22°,285HP) IO-520-MB (22°,285HP) IO-520-N (22°,300HP) IO-520-NB (22°,300HP) IO-550-A (22°,300HP) IO-550-B (22°,300HP) IO-550-C (22°,300HP) IO-550-D (22°,300HP) IO-550-F (22°,300HP) IO-550-L (22°,300HP)

89

03

01

K6313

K6313 K6313

K6313 K6313 K6313 K6313 K6313 K6313

K6313 K6313

Dual IC K6320 K6520 K6320 K6320 K6320 K6520 K6320 K6320 K6520 K6320 K6520 K6320 K6320 K6520 K6320 K6320 K6320

09

Champion® Aviation Spark Plug 3/4”-20 Thread

Notes

-38S, -40, -38 -38S, -40, -38 -32 -32 -32, -32S, -36S -38, -38S -32 -38, -38S, -40 -38, -38S, -40 -40, -38, -38S -40, -38S, -38 -32 -38, -38S, -40 -38, -38S, -40 -32 -32 -32

K6320 K6320 K6320 K6320 K6320 K6320 K6320 K6320 K6320 K6320 K6320 K6320 K6320 K6320 K6320 K6320

-32 -32 -32 -32 -32 -32 -32 -32 -32 -32 -32 -32 -32 -32 -32 -32

K6320 K6320 K6320 K6320 K6320 K6320

-32 -32, -32S, -36S -32, -32S, -36S -32 -32 -32

K4520 K4520 K4520

ISSUED REVISED MO DAY YR MO DAY YR 01

K6313 K6513 K6313

K6313

O-200-A (25°,100HP) O-200-B (25°,100HP) O-200-C (25°,100HP)

11

Single IC/RB Kit

Champion® Aviation Spark Plug 5/8”-24 Thread

-38S, -40 -38S, -40 -38S, -40

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

5 5 5

PAGE NO.

REVISION

3-7

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Teledyne Continental Motors

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

O-300-A (26°,145HP) O-300-B (26°,145HP) O-300-C (26°,145HP) O-300-D (26°,145HP) O-300-E (26°,145HP)

K6327 K6327 K6327 K6327 K6327

-38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -37BY, -40, -38 -38S, -40, -38, -37BY

O-470-11 (26°,213HP) O-470-11 (26°,213HP) O-470-11 (26°,213HP) O-470-11 (26°,213HP) O-470-11B (26°,213HP) O-470-11B (26°,213HP) O-470-11B (26°,213HP) O-470-11B (26°,213HP) O-470-11B-C1 (26°,213HP) O-470-11B-C1 (26°,213HP) O-470-11B-C1 (26°,213HP) O-470-11B-C1 (26°,213HP) O-470-11-C1 (26°,213HP) O-470-11-C1 (26°,213HP) O-470-11-C1 (26°,213HP) O-470-11-C1 (26°,213HP) O-470-13 (26°,225HP) O-470-13 (26°,225HP) O-470-13 (26°,225HP) O-470-13 (26°,225HP) O-470-13A (26°,225HP) O-470-13A (26°,225HP) O-470-13A (26°,225HP) O-470-13A (26°,225HP) O-470-15 (26°,213HP) O-470-15 (26°,213HP) O-470-15 (26°,213HP) O-470-15 (26°,213HP) O-470-4 (26°,225HP) O-470-4 (26°,225HP) O-470-4 (26°,225HP) O-470-4 (26°,225HP) O-470-A (26°,225HP) O-470-A (26°,225HP) O-470-B (24°,240HP) O-470-B (24°,240HP) O-470-B-C1 (24°,240HP) O-470-B-C1 (24°,240HP) O-470-E (26°,225HP) O-470-E (26°,225HP) O-470-G (24°,240HP)

K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6377 K6379 K6577 K6579 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320

Engine Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Single IC/RB Kit

Champion® Aviation Spark Plug 3/4”-20 Thread

-38, -40, -38S -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40 -40, -38S -38S, -40 -38S, -40 -38S, -40 -38S, -40 -38S, -40 -38S, -40 -40, -38S -38S, -40 -38S, -40 -38S, -40 -40, -38, -38S -38, -38S, -40 -38, -38S, -40 -38S, -40, -38 -38S, -40, -38 -38, -38S, -40 -38, -40, -38S -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -40, -38, -38S -38S, -40, -38 -38S, -40, -38 -38, -38S, -40 -38, -40, -38S -38S, -40, -38

Notes

8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8

-38S, -40 -38S, -40 -38S, -40, -38 -38S, -40, -38 -40, -38 -40, -38 -38S, -40 -38S, -40

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

-38S, -40, -38

PAGE NO.

REVISION

3-8

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

O-470-G (24°,240HP) O-470-G-C1 (24°,240HP) O-470-G-C1 (24°,240HP) O-470-H (24°,240HP) O-470-H (24°,240HP) O-470-J (20°,225HP) O-470-J (20°,225HP) O-470-K (22°,230HP) O-470-K (22°,230HP) O-470-K-C1 (22°,230HP) O-470-K-C1 (22°,230HP) O-470-L (22°,230HP) O-470-L (22°,230HP) O-470-L-C1 (22°,230HP) O-470-L-C1 (22°,230HP) O-470-M (24°,240HP) O-470-M (24°,240HP) O-470-M-C1 (24°,240HP) O-470-M-C1 (24°,240HP) O-470-N (24°,240HP) O-470-N (24°,240HP) O-470-P (24°,240HP) O-470-P (24°,240HP) O-470-R (22°,230HP) O-470-R (22°,230HP) O-470-S (22°,230HP) O-470-S (22°,230HP) O-470-T (24°,230HP) O-470-U (24°,230HP) TSIO-360-A (20°,210HP) TSIO-360-A (20°,210HP) TSIO-360-AB (20°,210HP) TSIO-360-AB (20°,210HP) TSIO-360-B (20°,210HP) TSIO-360-B (20°,210HP) TSIO-360-BB (20°,210HP) TSIO-360-BB (20°,210HP) TSIO-360-C (20°,225HP) TSIO-360-C (20°,225HP) TSIO-360-CB (20°,225HP) TSIO-360-CB (20°,225HP) TSIO-360-D (20°,225HP) TSIO-360-D (20°,225HP) TSIO-360-DB (20°,225HP) TSIO-360-DB (20°,225HP) TSIO-360-E (20°,200HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Single IC/RB Kit

K6313 K6513

K6313 K6513

Dual IC K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6520 K6320 K6320

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread

Notes

-38S, -38, -40 -40, -38 -40, -38 -38S, -40, -38 -38S, -40, -38 -40, -38S -38S, -40 -38S, -40 -38S, -40 -40, -38 -40, -38 -38S, -40 -38S, -40 -40, -38 -40, -38 -38S, -40, -38 -38S, -40, -38 -40, -38 -38, -40 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -40, -38, -38S -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38

K6322 K6323 K6322 K6323 K6322 K6323 K6322 K6323 K6322 K6323 K6322 K6323 K6322 K6323 K6322 K6323 K6322

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

-32 -32 -38S, -38 -38S, -38 -38, -38S -38, -38S -38, -38S -38, -38S -38 -38 -38S, -38 -38, -38S -38 -38 -38, -38S -38, -38S -38, -38S -38, -38S -38S, -38

7 7 7 7 7 7 7 7 7

PAGE NO.

REVISION

3-9

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread

TSIO-360-E (20°,200HP) TSIO-360-EB (20°,200HP) TSIO-360-EB (20°,200HP) TSIO-360-F (20°,200HP) TSIO-360-F (20°,200HP) TSIO-360-FB (20°,200HP) TSIO-360-FB (20°,200HP) TSIO-360-G (20°,210HP) TSIO-360-G (20°,210HP) TSIO-360-GB (20°,210HP) TSIO-360-H (20°,210HP) TSIO-360-H (20°,210HP) TSIO-360-HB (20°,210HP) TSIO-360-HB (20°,210HP) TSIO-360-JB (20°,225HP) TSIO-360-JB (20°,225HP) TSIO-360-KB (20°,220HP) TSIO-360-LB (20°,210HP) TSIO-360-MB (20°,210HP) TSIO-360-NB (20°,210HP) TSIO-360-PB (20°,200HP) TSIO-360-RB (22°,220HP) TSIO-360-SB (20°,220HP)

K6323 K6322 K6323 K6322 K6323 K6322 K6323 K6322 K6323 K6323 K6322 K6323 K6322 K6323 K6322 K6323 K6323 K6323 K6323 K6323 K6323 K6323 K6323

-38S, -38 -38, -38S -38, -38S -38, -38S -38, -38S -38, -38S -38S, -38 -38, -38S -38, -38S -38 -38, -38S -38, -38S -38, -38S -38, -38S -38, -38S -38, -38S -38 -38 -38 -38 -38 -38 -38

TSIO-520-A (20°,285HP) TSIO-520-A (20°,285HP) TSIO-520-AE (20°,250HP) TSIO-520-AF (22°,310HP) TSIO-520-B (20°,285HP) TSIO-520-B (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-C (20°,285HP) TSIO-520-C (20°,285HP) TSIO-520-D (20°,285HP) TSIO-520-D (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-E (20°,300HP) TSIO-520-E (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-G (22°,300HP) TSIO-520-G (22°,300HP) TSIO-520-H (20°,285HP) TSIO-520-H (20°,285HP) TSIO-520-J (20°,310HP)

K6320 K6321 K6321 K6321 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320

-32, -32S -32, -32S -32, -32S, -36S -32 -32, -32S, -36S -32, -36S, -32S -32, -32S -32, -32S -32, -32S, -36S -32, -32S, -36S -32S, -36S, -32 -32S, -36S, -32 -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32S, -36S, -32 -32S, -36S, -32 -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

7 7 7 7

7 7 7

PAGE NO.

REVISION

3-10

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread

TSIO-520-J (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-K (20°,285HP) TSIO-520-K (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-L (20°,310HP) TSIO-520-L (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-M (22°,310HP) TSIO-520-M (22°,310HP) TSIO-520-N (20°,310HP) TSIO-520-N (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-P (22°,310HP) TSIO-520-P (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-U (22°,300HP) TSIO-520-U (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-VB (20°,325HP) TSIO-520-VB (20°,325HP) TSIO-520-WB (20°,325HP) TSIO-520-WB (20°,325HP)

K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328 K6320 K6328

-32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -36S, -32, -32S -36S, -32, -32S -32, -32S, -36S -32 -32 -32, -32S, -36S -36S, -32, -32S -36S, -32S, -32 -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -36S, -32, -32S -36S, -32, -32S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32S, -36S, -32 -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S -32, -32S, -36S

TSIO-550-A (24°,360HP) TSIO-550-B (24°,350HP) TSIO-550-C (24°,310HP) TSIO-550-E (24°,350HP)

K6328 K6328 K6328 K6328

-32 -32 -32 -32

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

PAGE NO.

REVISION

3-11

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Textron-Lycoming Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

AEIO-320-D1B (25°,160HP) AEIO-320-D1B (25°,160HP) AEIO-320-D1B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-E1A (25°,150HP) AEIO-320-E1A (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E2A (25°,150HP) AEIO-320-E2A (25°,150HP) AEIO-320-E2B (25°,150HP) AEIO-320-E2B (25°,150HP) AEIO-320-E2B (25°,150HP)

K4317 K4518 K4542 K4317 K4518 K4542 K4317 K4517 K4315 K4516

AEIO-360-A1A (20°,200HP) AEIO-360-A1A (25°,200HP) AEIO-360-A1B (20°,200HP) AEIO-360-A1B6 (20°,200HP) AEIO-360-A1D (20°,200HP) AEIO-360-A1D (25°,200HP) AEIO-360-A1E (20°,200HP) AEIO-360-A1E (20°,200HP) AEIO-360-A1E (25°,200HP) AEIO-360-A1E (25°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-B1B (25°,180HP) AEIO-360-B1F (25°,180HP) AEIO-360-B1F (25°,180HP) AEIO-360-B1F6 (25°,180HP) AEIO-360-B1F6 (25°,180HP) AEIO-360-B1F6 (25°,180HP) AEIO-360-B1G6 (25°,180HP) AEIO-360-B1G6 (25°,180HP) AEIO-360-B2F (25°,180HP) AEIO-360-B2F (25°,180HP) AEIO-360-B2F6 (25°,180HP) AEIO-360-B2F6 (25°,180HP) AEIO-360-B2F6 (25°,180HP) AEIO-360-B4A (25°,180HP) AEIO-360-B4A (25°,180HP) AEIO-360-H1A (25°,180HP) AEIO-360-H1A (25°,180HP) AEIO-360-H1A (25°,180HP)

K4536 K4536

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

K4317 K4517 K4315 K4516

Dual IC K4326 K4576 K4326 K4576 K4326 K4528 K4325 K4525 K4326 K4528 K4325 K4525

K4549 K4530 K4517 K4316 K4530 K4317 K4517 K4315 K4516

K4315 K4516 K4317 K4517 K4315 K4516

Champion® Aviation Spark Plug 3/4”-20 Thread -38S, -40, -38

-38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -37BY, -38, -40 -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -40, -38, -38S, -37BY -38, -38S, -37BY, -37 -38, -38S, -37BY, -37

K4548 K4548 K4532 K4528

-38, -38S, -37 -38, -38S, -37 -38, -38S, -37BY, -37 -38, -37, -36S, -37BY, -38S -38, -38S, -37

K4532 K4326 K4528 K4325

-38S, -37BY, -38, -37 -38, -38S, -37 -37BY, -37, -38, -36S, -38S -37, -38, -38S

K4525

-38, -37, -38S, -37BY -38, -38S, -37BY, -37 -38S, -40, -38, -37BY

K4326 K4576 K4325

-37BY, -38, -40, -38S

K4536

K4315 K4516

Champion® Aviation Spark Plug 5/8”-24 Thread

K4525 K4325 K4525 K4326 K4576 K4325 K4525 K4326 K4528 K4325 K4525

-38, -38S, -40 -38S, -40, -38 -36S, -38S, -40, -38, -37BY -38S, -37BY, -40, -36S, -38 -38S, -40, -38 -38S, -40, -38, -37BY -38, -38S, -40 -38, -37BY, -38S, -40 -38S, -40, -38 -37BY, -36S, -38S, -40, -38 -37BY, -38, -40, -36S, -38S -38S, -40, -38 -37BY, -38, -40, -38S -38, -38S, -40 -38S, -40, -38, -36S, -37BY -37BY, -36S, -38, -38S, -40

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

PAGE NO.

REVISION

3-12

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Textron-Lycoming

Engine - Model (Degree°, HP)

Engine

Single IC/RB Kit

AEIO-540-D4A5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-L1B5 (20°,300HP)

K6536 K6518 K6519 K6518

AIO-320-A1B (25°,160HP) AIO-320-A1B (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-B1B (25°,160HP) AIO-320-B1B (25°,160HP) AIO-320-C1B (25°,160HP) AIO-320-C1B (25°,160HP)

K4317 K4518 K4315 K4516

AIO-360-A1A (20°,200HP) AIO-360-A1B (20°,200HP) AIO-360-A2B (20°,200HP) AIO-360-A2B (20°,200HP) AIO-360-A2B (20°,200HP) AIO-360-B1B (20°,200HP)

K4317 K4518 K4317 K4518

K4549 K4315 K4516 K4549

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

K4326 K4576 K4325 K4525 K4326 K4576 K4326 K4576

-38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -38, -37BY, -40, -38S

K4548 K4548 K4325 K4525 K4548

-40, -38, -38S -38, -38S, -40 -38, -38S, -40 -38S, -40, -38, -37BY -37BY, -38S, -40, -38 -38S, -40, -38

K4545

-38, -38S

IO-320-B1A (25°,160HP) IO-320-B1A (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1C (25°,160HP) IO-320-B1C (25°,160HP) IO-320-B1D (25°,160HP) IO-320-B2A (25°,160HP) IO-320-B2A (25°,160HP) IO-320-C1A - 1/2" (25°,160HP) IO-320-C1A - 1/2" (25°,160HP) IO-320-C1A - 13/16" (25°,160HP) IO-320-C1A - 13/16" (25°,160HP) IO-320-D1A (25°,160HP) IO-320-D1A (25°,160HP) IO-320-D1B (25°,160HP) IO-320-D1B (25°,160HP) IO-320-E1A (25°,150HP)

K4326 K4575 K4325

-37BY, -38S, -40, -38

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

K4317 K4517 K4539 K4317 K4517

K4540

Notes

-38, -38S, -40 -38, -36S, -38S, -40 -38, -40, -38S, -36S -38S, -40, -38

HIO-360-D1A (20°,190HP)

K4315 K4516

Champion® Aviation Spark Plug 3/4”-20 Thread

K4525 K4326 K4528

-38, -38S, -40 -37BY, -38, -40, -38S -38S, -40, -38, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38, -37BY -38S, -40, -38, -37BY

K4575

-38S, -40

K4326

-38, -38S, -40 -38S, -40

-37, -36S

K4540

K4575

K4317 K4518 K4317 K4518 K4317

K4326 K4576 K4326 K4576 K4326

2 2 2 2 2 2 2 2 2 2 2 2

2

-36S, -37

2 -38S, -40, -38

-37BY, -38, -38S, -40 -38S, -40, -38 -38S, -37BY, -40, -38

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 1, 2, 3

-40, -38, -38S

K4326 K4528 K4326

2 2 2 2 2 2 2 2 2

-38S, -40, -38

2 2 2 2 2

PAGE NO.

REVISION

3-13

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Textron-Lycoming Engine Engine - Model (Degree°, HP)

IO-320-E1A (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E2A (25°,150HP) IO-320-E2A (25°,150HP) IO-320-E2B (25°,150HP) IO-320-E2B (25°,150HP) IO-320-E2B (25°,150HP) IO-320-F1A (25°,160HP) IO-320-F1A (25°,160HP) IO-360-A1A (25°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1C (20°,200HP) IO-360-A1C (20°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D6 (20°,200HP) IO-360-A2B (25°,200HP) IO-360-A2C (20°,200HP) IO-360-A2C (20°,200HP) IO-360-B1B (25°,180HP) IO-360-B1E (25°,180HP) IO-360-B1E (25°,180HP) IO-360-B1F (25°,180HP) IO-360-B1F (25°,180HP) IO-360-B1F6 (25°,180HP) IO-360-B1F6 (25°,180HP) IO-360-B1F6 (25°,180HP) IO-360-B2E-nd (25°,180HP) IO-360-B2E-nd (25°,180HP) IO-360-B2E-wd (25°,180HP) IO-360-B2F (25°,180HP) IO-360-B2F (25°,180HP) IO-360-B2F6 (25°,180HP) IO-360-B2F6 (25°,180HP) IO-360-B4A (25°,180HP) IO-360-B4A (25°,180HP) IO-360-B4A (25°,180HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Single IC/RB Kit K4517 K4315 K4516 K4317 K4517 K4315 K4516

Dual IC K4528 K4325 K4525 K4326 K4528 K4325 K4525 K4326 K4575

K4536 K4316 K4530 K4317 K4517 K4567 K4316 K4317 K4567 K4535 K4535 K4316 K4530 K4316 K4567 K4535 K4535 K4536 K4317 K4567

K4315 K4516

K4317 K4517 K4567

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread

-38S, -37BY, -40 -40, -38 -38S, -40, -37BY -40, -37BY, -38S -40, -38, -38S -38S, -40, -37BY -38S, -38, -40 -38S, -40, -37BY -38S, -40, -37BY -37, -38S -37, -38S -38, -38S, -37BY -40, -38S, -38

K4532 K4326 K4528 K4577 K4326 K4577

-38S, -37BY, -40, -38 -38, -38S -38, -38S, -37BY -38, -38S, -37BY -38, -38S -38S, -38 -36S, -38, -38S, -37BY -38, -38S, -37BY -38, -38S, -37BY -38, -38S, -40

K4532

-38, -37BY

K4577

-38, -38S, -37BY -37BY, -38, -38S -37BY, -38, -38S -38S, -40, -38, -37BY

-38, -38S

K4326 K4577 K4326 K4576 K4325 K4525 K4326 K4577 K4576 K4326 K4576 K4326 K4576 K4326 K4528 K4577

-38S, -40, -38 -40, -38, -37BY, -38S -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -40, -38, -38S, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38, -40, -38S -40, -38, -37BY, -38S -38S, -40, -38 -38S, -40, -38, -37BY -40, -38, -38S -38S, -40, -38, -37BY -38, -37BY, -40, -38S

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes 2 2 2 2 2 2 2 2 2 2 2 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 1, 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 1, 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3, 10 2, 3, 10 2, 3, 10 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

PAGE NO.

REVISION

3-14

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Textron-Lycoming Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

IO-360-C1B (20°,200HP) IO-360-C1B (20°,200HP) IO-360-C1C (20°,200HP) IO-360-C1C6 (20°,200HP) IO-360-C1C6 (20°,200HP) IO-360-C1C6 (25°,200HP) IO-360-C1C6 (25°,200HP) IO-360-C1D6 (20°,200HP) IO-360-C1D6 (25°,200HP) IO-360-C1E6 (20°,200HP) IO-360-C1E6 (20°,200HP) IO-360-C1E6 (25°,200HP) IO-360-C1E6 (25°,200HP) IO-360-C1F (20°,200HP) IO-360-C1F (25°,200HP) IO-360-D1A (20°,200HP) IO-360-F1A (25°,180HP) IO-360-F1A (25°,180HP) IO-360-K2A (20°,200HP) IO-360-K2A (20°,200HP)

K4317 K4567 K4316 K4530

IO-540-AA1A5 (20°,270HP) IO-540-C1B5 (25°,250HP) IO-540-C1B5 (25°,250HP) IO-540-C1C5 (25°,250HP) IO-540-C2C (25°,250HP) IO-540-C2C (25°,250HP) IO-540-C4B5 (25°,250HP) IO-540-C4B5 (25°,250HP) IO-540-C4C5 (25°,250HP) IO-540-D4A5 (25°,260HP) IO-540-D4B5 (25°,260HP) IO-540-D4B5 (25°,260HP) IO-540-E1A5 (20°,290HP) IO-540-G1C5 (20°,290HP) IO-540-G1C5 (20°,290HP) IO-540-G1E5 (20°,290HP) IO-540-K1A5 (20°,300HP) IO-540-K1A5 (20°,300HP) IO-540-K1A5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1C5 (20°,300HP) IO-540-K1G5 (20°,300HP) IO-540-K1H5 (20°,300HP) IO-540-K1K5 (20°,300HP) IO-540-L1A5 (20°,300HP)

K6536 K6535 K6536 K6535 K6317 K6565 K6535 K6536 K6536 K6536 K6316 K6519 K6536 K6316 K6519 K6519 K6316 K6518 K6519 K6316 K6519 K6519 K6518 K6518 K6518 K6519

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

K4535 K4535 K4566 K4316 K4566 K4317 K4568 K4316 K4317 K4316 K4566 K4317 K4568 K4316 K4317

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

K4547

-38, -38S, -37BY -38, -38S, -37BY -38, -38S, -37BY

Champion® Aviation Spark Plug 3/4”-20 Thread

Notes 2, 3 1, 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 1, 2, 3 2, 3 2, 3 2, 3 2, 3

-38, -38S K4547 K4326

-38, -38S, -37BY -38, -38S -37BY, -38S, -38 -38, -38S -38, -38S -38, -38S

K4326 K4547 K4326

-38, -38S, -37BY -38, -38S -38, -38S, -37BY -38, -38S -38, -38S

K4326 K4545 K4326 K4577

-36S, -38S, -40, -37

K4532

-38, -38S, -40

-38, -38S, -37BY -37, -38S -38, -38S, -40

-37 -40, -38, -38S -40, -38, -38S -38S, -40, -38 K6325 K6526

-38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -40, -38, -38S -40, -38, -38S -38S, -40, -38 -38S, -40, -38 -36S, -38S -38, -32S, -40, -38S, -36S -40, -38, -38S -40, -38, -38S -40, -36S, -38, -32S, -38S -38S, -38, -40, -36S -38S, -40, -36S, -38 -36S, -37, -32, -38S, -32S -36S, -38S -38S, -38, -40, -36S -38S, -40, -36S, -38 -38S, -40, -36S, -38 -38, -38S, -40, -36S -38, -38S, -40

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

3-15

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Textron-Lycoming

Engine - Model (Degree°, HP)

Engine

Single IC/RB Kit

IO-540-L1C5 (20°,300HP) IO-540-N1A5 (25°,260HP) IO-540-P1A5 (20°,290HP) IO-540-R1A5 (25°,260HP)

K6518 K6535 K6535 K6535

LIO-320-B1A (25°,160HP) LIO-320-C1A (25°,160HP) O-235-C1 (25°,115HP) O-235-C1 (25°,115HP) O-235-C1B (25°,115HP) O-235-C1C (25°,115HP) O-235-C1C (25°,115HP) O-235-C1C (25°,115HP) O-235-C2A (25°,115HP) O-235-C2A (25°,115HP) O-235-C2B (25°,115HP) O-235-C2B (25°,115HP) O-235-C2C (25°,115HP) O-235-C2C (25°,115HP) O-235-C2C (25°,115HP) O-235-E1 (25°,115HP) O-235-E1 (25°,115HP) O-235-E1 (25°,115HP) O-235-E2A (25°,115HP) O-235-E2A (25°,115HP) O-235-E2B (25°,115HP) O-235-E2B (25°,115HP) O-235-E2B (25°,115HP) O-235-F1 (25°,125HP) O-235-F1 (25°,125HP) O-235-F1 (25°,125HP) O-235-F1B (25°,125HP) O-235-F2A (25°,125HP) O-235-F2A (25°,125HP) O-235-F2B (25°,125HP) O-235-F2B (25°,125HP) O-235-G1 (25°,125HP) O-235-G1 (25°,125HP) O-235-G2A (25°,125HP) O-235-G2A (25°,125HP) O-235-G2B (25°,125HP) O-235-G2B (25°,125HP) O-235-G2B (25°,125HP) O-235-H2C (25°,115HP) O-235-H2C (25°,115HP) O-235-H2C (25°,115HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Dual IC

K4317 K4517 K4317 K4518 K4316 K4516 K4316 K4516 K4317 K4517 K4315 K4516 K4315 K4516

K4326 K4528

K4315 K4516

-38S, -37BY, -40, -38 -37, -38S

Notes

K4525 K4326 K4528 K4326 K4576 K4325 K4525 K4325 K4525 K4326 K4528 K4325 K4525 K4325

K4326 K4528 K4326 K4576 K4326 K4528 K4326 K4528 K4325 K4525 K4325 K4525

2 2 -38S, -40, -38

-38S, -40, -38, -37BY -37BY, -38S, -40, -38

K4325

K4525 K4536 K4317 K4517 K4317 K4518 K4317 K4517 K4317 K4517 K4315 K4516

Champion® Aviation Spark Plug 3/4”-20 Thread

-38S, -40, -38 -37, -38S -37, -36S, -38S -37, -36S, -38S K4526 K4526

K4317 K4517 K4536 K4315 K4516

Champion® Aviation Spark Plug 5/8”-24 Thread

-38, -38S, -40 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38, -38S, -40 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -38, -40 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38, -40, -38S -38S, -40, -38, -37BY -40, -38, -38S -38S, -40, -38, -37BY -38S, -40, -38, -37BY -40, -38, -38S -38S, -40, -38, -37BY -38S, -40, -38, -37BY -40, -38, -38S, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -40, -38, -38S -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -40, -38, -38S -38S, -40, -38, -37BY -40, -38, -38S -37BY, -38, -38S, -40 -38S, -40, -38, -37BY -38S, -38, -40 -38S, -40, -38, -37BY -38S, -40, -38, -37BY

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

PAGE NO.

REVISION

3-16

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Textron-Lycoming Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

O-235-J2A (25°,125HP) O-235-J2A (25°,125HP) O-235-J2B (25°,125HP) O-235-J2B (25°,125HP) O-235-J2B (25°,125HP) O-235-K2A (20°,118HP) O-235-K2A (20°,118HP) O-235-K2B (20°,118HP) O-235-K2C (20°,118HP) O-235-K2C (20°,118HP) O-235-L2A (20°,118HP) O-235-L2A (20°,118HP) O-235-L2C (20°,118HP) O-235-L2C (20°,118HP) O-235-L2C (20°,118HP) O-235-M1 (20°,118HP) O-235-M1 (20°,118HP) O-235-M2C (20°,118HP) O-235-M2C (20°,118HP) O-235-N2A (20°,116HP) O-235-N2A (20°,116HP) O-235-N2C (20°,116HP) O-235-N2C (20°,116HP) O-235-N2C (20°,116HP) O-235-N2C (20°,116HP) O-235-N2C (20°,116HP) O-235-P1 (20°,116HP) O-235-P1 (20°,116HP)

K4317 K4517 K4315 K4516 K4316 K4530 K4316 K4316 K4565 K4316 K4530 K4316 K4537 K4565 K4316 K4530 K4316 K4565 K4316 K4530 K4315 K4316 K4516

Dual IC K4326 K4528 K4325

Champion® Aviation Spark Plug 5/8”-24 Thread

-38S, -40, -38 -38S, -40, -38, -37BY -38S, -38, -40

K4525

-38S, -40, -38, -37BY -38S, -40, -38, -37BY

K4532

-38S, -40, -38, -37BY

-38S, -40, -38 -38S, -40, -38 -38, -40, -38S K4534

-38S, -40, -38, -37BY

K4532

-40, -38, -38S, -37BY

K4529

-40, -38, -38S, -37BY -38S, -40, -38, -37BY

K4532

-38S, -40, -38, -37BY

K4534

-38S, -40, -38, -37BY

K4532

-38S, -40, -38, -37BY

-38S, -40, -38 -38S, -40, -38

-38S, -40, -38 -38S, -40, -38 -38S, -38, -40 -38S, -40, -38 -38S, -40, -38

K4325

K4565 K4316 K4530

K4525 K4529

-37BY, -38S, -40, -38 -37BY, -38S, -40, -38 -37BY, -38S, -40, -38

K4532

-38S, -40, -38, -37BY

O-290-D (20°,125HP) O-290-D (20°,125HP) O-290-D2 (18°,135HP)

K4317 K4517 K4530

K4326 K4528 K4532

-38S, -40 -38S, -40

O-320-A1A (25°,150HP) O-320-A1A (25°,150HP) O-320-A1A (25°,150HP) O-320-A1B (25°,150HP) O-320-A1B (25°,150HP) O-320-A2A (25°,150HP) O-320-A2A (25°,150HP) O-320-A2B (25°,150HP) O-320-A2B (25°,150HP) O-320-A2C (25°,150HP) O-320-A2D (25°,150HP) O-320-A2D (25°,150HP) O-320-A2D (25°,150HP) O-320-A3A (25°,150HP)

K4315 K4516

K4325

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

K4317 K4517 K4317 K4517 K4317 K4517 K4536 K4315 K4516 K4317

Champion® Aviation Spark Plug 3/4”-20 Thread

-38S, -40, -38

K4525 K4326 K4528 K4326 K4528 K4326 K4528

K4525 K4326

2 2 2

-38S, -40, -38

2 2 2 2 2 2 2 2 2 2 2 2 2 2

-38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -37BY, -38S, -40, -38 -38, -38S, -40 -38S, -40, -38, -37BY -40, -38, -37BY -38S, -40, -38 -37BY, -38S, -40, -38 -38S, -40, -38, -37BY

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

-38S, -40

-40, -38, -37BY, -38S -38S, -40, -38, -37BY

K4325

Notes

-38S, -40, -38

PAGE NO.

REVISION

3-17

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Textron-Lycoming Engine Engine - Model (Degree°, HP)

O-320-A3A (25°,150HP) O-320-A3B (25°,150HP) O-320-A3B (25°,150HP) O-320-A3C (25°,150HP) O-320-B1A (25°,160HP) O-320-B1A (25°,160HP) O-320-B1B (25°,160HP) O-320-B1B (25°,160HP) O-320-B2A (25°,160HP) O-320-B2A (25°,160HP) O-320-B2B (25°,160HP) O-320-B2B (25°,160HP) O-320-B2C (25°,160HP) O-320-B2D (25°,160HP) O-320-B3A (25°,160HP) O-320-B3A (25°,160HP) O-320-B3B (25°,160HP) O-320-B3B (25°,160HP) O-320-B3C (25°,160HP) O-320-C1A (25°,150HP) O-320-C1B (25°,150HP) O-320-C1B (25°,150HP) O-320-C2A (25°,150HP) O-320-C2A (25°,150HP) O-320-C2B (25°,150HP) O-320-C2B (25°,150HP) O-320-C2C (25°,150HP) O-320-C2C (25°,150HP) O-320-C3A (25°,150HP) O-320-C3B (25°,150HP) O-320-C3B (25°,150HP) O-320-C3C (25°,150HP) O-320-C3C (25°,150HP) O-320-D1A (25°,150HP) O-320-D1A (25°,150HP) O-320-D1A (25°,160HP) O-320-D1A (25°,160HP) O-320-D1C (25°,150HP) O-320-D1C (25°,150HP) O-320-D1C (25°,160HP) O-320-D1C (25°,160HP) O-320-D1D (25°,150HP) O-320-D1D (25°,150HP) O-320-D1D (25°,150HP) O-320-D1D (25°,160HP) O-320-D1D (25°,160HP) O-320-D1D (25°,160HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Single IC/RB Kit K4517 K4317 K4517 K4536 K4317 K4517 K4317 K4517 K4317 K4517 K4317 K4517 K4543 K4536 K4317 K4517 K4317 K4517 K4536 K4317 K4317 K4517 K4317 K4517 K4317 K4517 K4317 K4517 K4317 K4317 K4517 K4317 K4517 K4317 K4517 K4317 K4517 K4317 K4518 K4317 K4518 K4315 K4516 K4315 K4516

Dual IC K4528 K4326 K4528

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread

-40, -38, -38S, -37BY -38S, -40, -38 -37BY, -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY

K4326 K4528 K4326 K4528 K4326 K4528

K4326 K4528 K4326 K4528 K4326 K4326 K4528

-38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38, -38S, -40 -38S, -40, -37BY, -38 -38S, -40, -38, -37BY -38S, -37BY, -40, -38 -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -38, -40, -38S -37BY, -38S, -40, -38 -38, -38S, -40 -37BY, -38, -38S, -40

K4326 K4528 K4326 K4528 K4326 K4326 K4528 K4326 K4528 K4326 K4528 K4326 K4528 K4326 K4576 K4326 K4576 K4325 K4525 K4325 K4525

-38S, -40, -38 -37BY, -38S, -40, -38 -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38 -40, -38, -37BY, -38S -40, -38, -38S -38, -37BY, -38S, -40 -38S, -40, -38 -38, -37BY, -38S, -40 -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -38, -37BY, -38S, -40 -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38, -37BY

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

PAGE NO.

REVISION

3-18

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Textron-Lycoming Engine Engine - Model (Degree°, HP)

O-320-D1F (25°,150HP) O-320-D1F (25°,150HP) O-320-D1F (25°,160HP) O-320-D1F (25°,160HP) O-320-D2A (25°,150HP) O-320-D2A (25°,150HP) O-320-D2A (25°,160HP) O-320-D2A (25°,160HP) O-320-D2B (25°,150HP) O-320-D2B (25°,160HP) O-320-D2C (25°,150HP) O-320-D2C (25°,150HP) O-320-D2C (25°,160HP) O-320-D2C (25°,160HP) O-320-D2F (25°,150HP) O-320-D2F (25°,150HP) O-320-D2F (25°,160HP) O-320-D2F (25°,160HP) O-320-D2G (25°,150HP) O-320-D2G (25°,150HP) O-320-D2G (25°,150HP) O-320-D2G (25°,160HP) O-320-D2G (25°,160HP) O-320-D2G (25°,160HP) O-320-D2H (25°,150HP) O-320-D2H (25°,150HP) O-320-D2H (25°,150HP) O-320-D2H (25°,160HP) O-320-D2H (25°,160HP) O-320-D2H (25°,160HP) O-320-D2J (25°,150HP) O-320-D2J (25°,150HP) O-320-D2J (25°,160HP) O-320-D2J (25°,160HP) O-320-D3G (25°,150HP) O-320-D3G (25°,150HP) O-320-D3G (25°,150HP) O-320-D3G (25°,160HP) O-320-D3G (25°,160HP) O-320-D3G (25°,160HP) O-320-E1A (25°,150HP) O-320-E1A (25°,150HP) O-320-E1C (25°,150HP) O-320-E1C (25°,150HP) O-320-E1F (25°,150HP) O-320-E1F (25°,150HP) O-320-E1J (25°,150HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Single IC/RB Kit K4317 K4518 K4317 K4518 K4317 K4518 K4317 K4518 K4536 K4536 K4317 K4518 K4317 K4518 K4317 K4518 K4317 K4518 K4315 K4516 K4315 K4516 K4315 K4516 K4315 K4516

K4315 K4516 K4315 K4516 K4317 K4517 K4317 K4518 K4317 K4518 K4315

Dual IC K4326 K4576 K4326 K4576 K4326 K4576 K4326 K4576

K4326 K4576 K4326 K4576 K4326 K4576 K4326 K4576 K4325 K4525 K4325 K4525 K4325 K4525 K4325 K4525 K4325 K4527 K4325 K4527 K4325 K4525 K4325 K4525 K4326 K4528 K4326 K4576 K4326 K4576 K4325

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread -38S, -40, -38

-38, -40, -38S, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -38, -37BY, -40, -38S -38S, -40, -38 -38, -37BY, -40, -38S -40, -38, -38S, -37BY -38S, -40, -38, -37BY -40, -38, -38S -37BY, -38S, -40, -38 -38, -38S, -40 -38S, -40, -38, -37BY -38, -38S, -40 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38, -38S, -40 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -37BY, -38, -40, -38S -40, -38, -38S -38, -37BY, -40, -38S -40, -38, -38S -37BY, -38, -38S, -40 -38S, -40, -38, -37BY -38S, -40, -38 -37BY, -38, -40, -38S -38S, -40, -38, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -38S, -37BY, -38, -40 -38S, -40, -38 -40, -38, -38S, -37BY

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

-38S, -40, -38

Notes 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

PAGE NO.

REVISION

3-19

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Textron-Lycoming Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

O-320-E1J (25°,150HP) O-320-E1J (25°,150HP) O-320-E2A (25°,140HP) O-320-E2A (25°,140HP) O-320-E2A (25°,150HP) O-320-E2A (25°,150HP) O-320-E2B (25°,150HP) O-320-E2C (25°,140HP) O-320-E2C (25°,150HP) O-320-E2D (25°,150HP) O-320-E2D (25°,150HP) O-320-E2D (25°,150HP) O-320-E2F (25°,150HP) O-320-E2F (25°,150HP) O-320-E2G (25°,150HP) O-320-E2G (25°,150HP) O-320-E2G (25°,150HP) O-320-E2H (25°,150HP) O-320-E2H (25°,150HP) O-320-E3D (25°,150HP) O-320-E3D (25°,150HP) O-320-E3D (25°,150HP) O-320-E3H (25°,150HP) O-320-E3H (25°,150HP)

K4516

O-360-A1A-nd (25°,180HP) O-360-A1A-nd (25°,180HP) O-360-A1A-wd (25°,180HP) O-360-A1A-wd (25°,180HP) O-360-A1D (25°,180HP) O-360-A1D (25°,180HP) O-360-A1F (25°,180HP) O-360-A1F6 (25°,180HP) O-360-A1F6 (25°,180HP) O-360-A1G (25°,180HP) O-360-A1G (25°,180HP) O-360-A1G6 (25°,180HP) O-360-A1G6 (25°,180HP) O-360-A1H (25°,180HP) O-360-A1H (25°,180HP) O-360-A1H6 (25°,180HP) O-360-A1H6 (25°,180HP) O-360-A2A (25°,180HP) O-360-A2A (25°,180HP) O-360-A2D (25°,180HP) O-360-A2D (25°,180HP) O-360-A2F (25°,180HP)

K4317 K4567 K4317 K4517 K4536 K4541 K4542 K4317 K4518 K4317 K4518 K4317 K4518 K4317 K4517 K4315 K4516 K4317 K4517 K4536 K4543 K4317

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

K4317 K4517 K4317 K4517 K4536 K4317 K4317 K4315 K4516 K4317 K4518 K4315 K4516 K4317 K4517 K4315 K4516 K4317 K4518

Dual IC

K4525 K4326 K4528 K4326 K4528

Champion® Aviation Spark Plug 5/8”-24 Thread -40, -38, -38S, -37BY -38S, -40, -38, -37BY

-38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -38, -37BY, -38S, -40 -38S, -40, -38, -37BY

K4326 K4326 K4325 K4525 K4326 K4576 K4325 K4525 K4326 K4528 K4325 K4525 K4326 K4576 K4326 K4577 K4326 K4528

K4326 K4576 K4326 K4576 K4326 K4576 K4326 K4528

Champion® Aviation Spark Plug 3/4”-20 Thread

-38S, -40, -38 -40, -38, -38S -38S, -40, -38 -38S, -37BY, -38, -40 -38S, -40, -38, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -38S, -37BY, -38, -40 -38S, -40, -38, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38

-38S, -40, -38

PAGE NO.

REVISION

3-20

H

-38S, -40, -38 -40, -38, -37BY, -38S -38, -38S, -40, -37BY -38, -37BY, -40, -38S -38, -38S, -40, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -38, -37BY, -38S, -40 -38, -38S, -40 -37BY, -38S, -40, -38 -38S, -40, -38 -37BY, -38S, -40, -38 -40, -38 -40, -38, -38S -38S, -40, -38, -37BY -37BY, -40, -38S, -38 -38, -38S, -40, -37BY

K4326

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

-40, -38, -37BY, -38S

-40, -38, -37BY K4326 K4528

Notes

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Textron-Lycoming Engine Engine - Model (Degree°, HP)

O-360-A2F (25°,180HP) O-360-A2G (25°,180HP) O-360-A2G (25°,180HP) O-360-A2H (25°,180HP) O-360-A2H (25°,180HP) O-360-A2H (25°,180HP) O-360-A3A (25°,180HP) O-360-A3A (25°,180HP) O-360-A4A (25°,180HP) O-360-A4A (25°,180HP) O-360-A4G (25°,180HP) O-360-A4G (25°,180HP) O-360-A4J (25°,180HP) O-360-A4J (25°,180HP) O-360-A4K (25°,180HP) O-360-A4K (25°,180HP) O-360-A4K (25°,180HP) O-360-A4M (25°,180HP) O-360-A4M (25°,180HP) O-360-A4M (25°,180HP) O-360-A4N (25°,180HP) O-360-A4N (25°,180HP) O-360-B1A (25°,168HP) O-360-B1A (25°,168HP) O-360-B1A (25°,168HP) O-360-B2A (25°,168HP) O-360-B2A (25°,168HP) O-360-C1A (25°,180HP) O-360-C1A (25°,180HP) O-360-C1C (25°,180HP) O-360-C1E (25°,180HP) O-360-C1E (25°,180HP) O-360-C1E (25°,180HP) O-360-C1F (25°,180HP) O-360-C1F (25°,180HP) O-360-C1F (25°,180HP) O-360-C1G (25°,180HP) O-360-C1G (25°,180HP) O-360-C2A (25°,180HP) O-360-C2A (25°,180HP) O-360-C2B (25°,180HP) O-360-C2B (25°,180HP) O-360-C2B (25°,180HP) O-360-C2C (25°,180HP) O-360-C2E (25°,180HP) O-360-C2E (25°,180HP) O-360-C2E (25°,180HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Single IC/RB Kit K4518 K4317 K4567 K4315 K4516 K4317 K4517 K4317 K4517 K4317 K4567 K4317 K4517 K4315 K4516 K4315 K4516

K4315 K4516 K4317 K4517 K4317 K4517 K4536 K4315 K4516 K4315 K4516 K4317 K4517 K4317 K4517 K4315 K4516

Dual IC K4576 K4326 K4577 K4325 K4525 K4326 K4528 K4326 K4528 K4326 K4577 K4326 K4528 K4325 K4525 K4325 K4525 K4325 K4527 K4325 K4525 K4326 K4528 K4326 K4528

K4525 K4325 K4525 K4326 K4528 K4326 K4528 K4325

-38S, -40, -38 -40, -38, -37BY, -38S -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -40, -38, -37BY, -38S -38S, -40, -38 -40, -38, -38S, -37BY -38, -38S, -40 -38S, -40, -38, -37BY -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38 -38, -37BY, -40, -38S -40, -38, -37BY, -38S -38S, -40, -38 -40, -38, -38S, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -40, -38, -38S -37BY, -38S, -40, -38 -37BY, -38, -38S, -40 -38, -38S, -40 -38S, -40, -38, -37BY -38, -38S, -40 -38S, -40, -38, -37BY -37BY, -38S, -40, -38 -38, -38S, -40 -38S, -40, -38, -37BY -37BY, -38S, -40, -38 -38, -40, -38S -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38 -38S, -40, -38, -37BY -38S, -40, -38, -37BY -38S, -37BY, -38, -40

K4325 K4525

Champion® Aviation Spark Plug 3/4”-20 Thread

-40, -38, -38S, -37BY

K4325

K4525 K4536 K4315 K4516

Champion® Aviation Spark Plug 5/8”-24 Thread

-38S, -40, -38 -38S, -40, -38, -37BY -40, -38, -38S, -37BY

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

PAGE NO.

REVISION

3-21

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Textron-Lycoming Engine Engine - Model (Degree°, HP)

Single IC/RB Kit

O-360-D1A (25°,168HP) O-360-D1A (25°,168HP) O-360-D1A (25°,168HP) O-360-D2A (25°,168HP) O-360-D2A (25°,168HP) O-360-F1A6 (25°,180HP) O-360-F1A6 (25°,180HP) O-360-G1A6 (25°,180HP) O-360-G1A6 (25°,180HP)

K4315 K4516

O-540-A1A (25°,250HP) O-540-A1A (25°,250HP) O-540-A1A5 (25°,250HP) O-540-A1A5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1C5 (25°,250HP) O-540-A1C5 (25°,250HP) O-540-A1D (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A2B (25°,250HP) O-540-A2B (25°,250HP) O-540-A3D5 (25°,250HP) O-540-A4A5 (25°,250HP) O-540-A4A5 (25°,250HP) O-540-A4B5 (25°,250HP) O-540-A4B5 (25°,250HP) O-540-A4D5 (25°,250HP) O-540-B1A5 (25°,235HP) O-540-B2A5 (25°,235HP) O-540-B2B5 (25°,235HP) O-540-B2B5 (25°,235HP) O-540-B2B5-wd (25°,235HP) O-540-B2B5-wd (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5-wd (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5-wd (25°,235HP)

K6317 K6565 K6317 K6565 K6317 K6535 K6536 K6565

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

K4317 K4517

Dual IC K4325 K4525 K4326 K4528 K4325 K4527 K4325 K4527 K6325 K6526 K6325 K6526 K6325 K6526

K6325 K6526 K6536 K6317 K6535 K6536 K6565 K6317 K6565 K6535 K6317 K6565

K6536 K6536 K6536 K6317 K6565 K6317 K6566 K6316 K6516 K6519 K6317 K6317 K6566 K6317

Champion® Aviation Spark Plug 5/8”-24 Thread

K6325 K6526

K6325 K6526 K6325 K6526 K6325 K6526

K6325 K6526 K6325

Champion® Aviation Spark Plug 3/4”-20 Thread -38S, -40, -38

-38S, -40, -38, -37BY -37BY, -38, -40, -38S -40, -38, -38S -38S, -40, -38, -37BY -40, -38, -38S -38, -37BY, -40, -38S -40, -38, -38S -38, -38S, -40

Notes 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

-38, -38S, -40 -38, -38S, -40 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -38, -40 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38, -38S, -40 -38, -40, -38S -38S, -40, -38 -38, -38S, -40 -38, -38S, -40 -38S, -40, -38 -40, -38, -38S -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38, -38S, -40 -38, -40, -38S -38S, -40, -38

10 10

-38S, -40, -38 -38, -38S, -40 -38, -38S, -40 K6325 K6325

-38S, -40, -38 -38S, -40, -38

10

-38S, -40, -38

10

-40, -38, -38S K6325

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

3-22

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Textron-Lycoming

Engine - Model (Degree°, HP)

Engine

Single IC/RB Kit

O-540-B4B5-wd (25°,235HP) O-540-D1A5 (25°,250HP) O-540-D1A5 (25°,250HP) O-540-E4A5 (25°,260HP) O-540-E4A5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4C5 (25°,260HP) O-540-E4C5 (25°,260HP) O-540-G1A5 (25°,260HP) O-540-G1A5 (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-H2A5 (25°,260HP) O-540-H2A5 (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-H2A5 (25°,260HP) O-540-H2A5 (25°,260HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5-wd (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5-wd (25°,235HP) O-540-B4B5-wd (25°,235HP) O-540-D1A5 (25°,250HP) O-540-D1A5 (25°,250HP) O-540-E4A5 (25°,260HP) O-540-E4A5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4C5 (25°,260HP) O-540-E4C5 (25°,260HP) O-540-G1A5 (25°,260HP)

K6566 K6535 K6536 K6535 K6536 K6317 K6565 K6317 K6566 K6316 K6519 K6316 K6519 K6316 K6518 K6316 K6519 K6316 K6519 K6317 K6565 K6518 K6316 K6519 K6316 K6519 K6317 K6565 K6316 K6516 K6519 K6317 K6317 K6566 K6317 K6566 K6535 K6536 K6535 K6536 K6317 K6565 K6317 K6566 K6316 K6519 K6316

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread

-38S, -40, -38 -38S -38S -40, -38, -38S -38S, -40, -38 K6325 K6526 K6325

Notes 10

-38S, -40, -38 -40, -38, -38S -38S, -40, -38 -38S, -40, -38

10 10

-38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38, -38S, -40 -38, -38S, -40

10 10

-38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38, -38S, -40 K6325 K6526

10 10

-40, -38, -38S -38, -38S, -40 -38, -38S, -40 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38, -38S, -40

K6325 K6526

-40, -38, -38S -38, -38S, -40 -38S, -40, -38 -38, -38S, -40 -38, -38S, -40

K6325 K6325

-38S, -40, -38 -38S, -40, -38 -40, -38, -38S

K6325

-38S, -40, -38 -38S, -40, -38 -38S -38S -40, -38, -38S -38S, -40, -38

K6325 K6526 K6325

-38S, -40, -38 -40, -38, -38S -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

3-23

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT APPLICATION

L-1318


L-1318

Textron-Lycoming

Engine - Model (Degree°, HP)

Engine

Single IC/RB Kit

O-540-G1A5 (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-H2A5 (25°,260HP) O-540-H2A5 (25°,260HP)

K6519 K6316 K6518 K6316 K6519 K6316 K6519 K6317 K6565

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Dual IC

Champion® Aviation Spark Plug 5/8”-24 Thread

Champion® Aviation Spark Plug 3/4”-20 Thread

Notes

-38S, -40, -38 -38, -38S, -40 -38, -38S, -40 -38S, -40, -38 -38S, -40, -38 -38S, -40, -38 -38, -38S, -40 K6325 K6526

-40, -38, -38S -38, -38S, -40

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

3-24

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


MAGNETO APPLICATION

L-1318

Section 4.0 MAGNETO APPLICATION

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

4-1/(4-2 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Franklin Engine - Model (Degree°, HP)

Left Magneto Model

Right Magneto Model

4A-235-B31 (32°,116HP) 4A-235-B4 (26°,125HP)

4392 4392

4392 4392

6A-350-C1 (28°,220HP) 6A-350-C1A (28°,220HP) 6A-350-C2 (28°,215HP) 6A-350-C2A (28°,212HP) 6A-350-D1 (28°,200HP) 6A-350-D1A (28°,230HP) 6A-350-D1B (28°,220HP)

6399 6399 6399 6399 6399 6399 6399

6399 6399 6399 6399 6399 6399 6399

6A4-150-B3 (28°,150HP) 6A4-150-B31 (28°,150HP) 6A4-150-B4 (28°,150HP) 6A4-165-B3 (32°,165HP) 6A4-165-B4 (32°,165HP) 6A4-165-B6 (32°,165HP)

6399 6399 6399 6399 6399 6399

6399 6399 6399 6399 6399 6399

Left Magneto Model

Right Magneto Model

Notes

Left Magneto Model

Right Magneto Model

Notes

4330

4330

Left Magneto Model

Right Magneto Model

4316 4316

4316 4316

Notes

MAGNETO APPLICATION

Engine

Great Plains Engine Engine - Model (Degree°, HP)

GREAT PLAINS-Volkswagen (30°,65HP) Type 1-1600 (25°,57HP) Type 1-1835 (25°,65HP) Type 1-2180 (25°,76HP) Type 4-2400 (25°,85HP)

4316 4316 4316 4316 4316

Grob Engine Engine - Model (Degree°, HP)

Grob-Volkswagen (30°,65HP)

HAPI Engine Engine - Model (Degree°, HP)

HAPI-Volkswagen-E (30°,65HP) HAPI-Volkswagen-G (30°,65HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

PAGE NO.

REVISION

4-3

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

LIMBACH Engine Engine - Model (Degree°, HP)

Left Magneto Model

Right Magneto Model

4330

4330

Left Magneto Model

Right Magneto Model

4316

4316

Left Magneto Model

Right Magneto Model

4316

4316

Left Magneto Model

Right Magneto Model

4371 4371

4371 4371

Left Magneto Model

Right Magneto Model

4333; 4302 4302 4302 4302 4302 4302 4302 4302 4302 4333; 4302 4333; 4302

4333; 4302 4302 4302 4302 4302 4302 4302 4302 4302 4333; 4302 4333; 4302

LIMBACH-Volkswagen (30°,65HP)

Notes

Monnett Engine Engine - Model (Degree°, HP)

MONNETT-Volkswagen (30°,65HP)

Notes

Mosler Engine Engine - Model (Degree°, HP)

MOSLER-Volkswagen (30°,65HP)

Notes

Superior Air Parts Engine Engine - Model (Degree°, HP)

IO-360 (25°,180HP) O-360 (25°,180HP)

Notes

Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

A-65-1 (30°,65HP) A-65-12 (30°,65HP) A-65-12F (30°,65HP) A-65-12FJ (30°,65HP) A-65-12J (30°,65HP) A-65-14 (30°,75HP) A-65-14F (30°,75HP) A-65-14FJ (30°,75HP) A-65-14J (30°,75HP) A-65-3 (30°,65HP) A-65-6 (30°,65HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes 4

4 4

PAGE NO.

REVISION

4-4

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors Left Magneto Model

Right Magneto Model

A-65-6J (30°,65HP) A-65-7 (30°,65HP) A-65-8 (30°,65HP) A-65-8F (30°,65HP) A-65-8FJ (30°,65HP) A-65-8J (30°,65HP) A-65-9 (30°,65HP) A-65-9F (30°,65HP) A-65-9FJ (30°,65HP) A-65-9J (30°,65HP)

4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4302 4302 4302 4302

4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4302 4302 4302 4302

4 4 4 4 4 4

A-75-3 (30°,75HP) A-75-6 (30°,75HP) A-75-6J (30°,75HP) A-75-8 (30°,75HP) A-75-8F (30°,75HP) A-75-8FJ (30°,75HP) A-75-8J (30°,75HP) A-75-9 (30°,75HP) A-75-9J (30°,75HP)

4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4302 4302

4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4333; 4302 4302 4302

4 4 4 4 4 4 4

C-145-2 (26°,145HP) C-145-2H (26°,145HP) C-145-2HP (26°,145HP)

6364; 664 6364; 664 6364; 664

6364; 664 6364; 664 6364; 664

C-75-12 (30°,75HP) C-75-12F (30°,75HP) C-75-12FH (30°,75HP) C-75-12FHJ (30°,75HP) C-75-12FJ (30°,75HP) C-75-12J (30°,75HP) C-75-15 (30°,75HP) C-75-15F (30°,75HP) C-75-8 (30°,75HP) C-75-8F (30°,75HP) C-75-8FH (30°,75HP) C-75-8FHJ (30°,75HP) C-75-8FJ (30°,75HP) C-75-8J (30°,75HP)

4301 4301 4301 4301 4301 4301 4301 4301 4333; 4330 4333; 4330 4333; 4330 4333; 4330 4333; 4330 4333; 4330

4301 4301 4301 4301 4301 4301 4301 4301 4333; 4330 4333; 4330 4333; 4330 4333; 4330 4333; 4330 4333; 4330

5 5 5 5 5 5 5 5 4 4 4 4 4 4

C-85-12 (30°,85HP) C-85-12F (30°,85HP) C-85-12FH (30°,85HP) C-85-12FHJ (30°,85HP) C-85-12FJ (30°,85HP) C-85-12J (30°,85HP) C-85-14 (30°,85HP) C-85-14F (30°,85HP)

4301 4301 4301 4301 4301 4301 4301 4301

4301 4301 4301 4301 4301 4301 4301 4301

5 5 5 5 5 5 5 5

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

MAGNETO APPLICATION

Engine

PAGE NO.

REVISION

4-5

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

Left Magneto Model

Right Magneto Model

Notes

C-85-15 (30°,85HP) C-85-15F (30°,85HP) C-85-8 (30°,85HP) C-85-8F (30°,85HP) C-85-8FHJ (30°,87HP) C-85-8FJ (30°,87HP) C-85-8J (30°,87HP)

4301 4301 4333; 4330; 4302 4333; 4330; 4302 4333; 4330; 4302 4333; 4330; 4302 4333; 4330; 4302

4301 4301 4333; 4330; 4302 4333; 4330; 4302 4333; 4330; 4302 4333; 4330; 4302 4333; 4330; 4302

5 5 4 4 4 4 4

C-90-12F (25°,95HP) C-90-12FH (25°,95HP) C-90-12FJ (25°,95HP) C-90-12FP (25°,95HP) C-90-14F (25°,95HP) C-90-14FH (25°,95HP) C-90-14FJ (25°,95HP) C-90-16F (25°,95HP) C-90-8F (25°,95HP) C-90-8FJ (25°,95HP)

4301 4301 4301 4301 4301 4301 4301 4301 4333; 4330; 4302 4333; 4330; 4302

4301 4301 4301 4301 4301 4301 4301 4301 4333; 4330; 4302 4333; 4330; 4302

5 5 5 5 5 5 5 5 4 4

E-165-2 (26°,165HP) E-165-3 (26°,165HP) E-165-4 (26°,165HP)

6377; 6379 6377; 6379 6377; 6379

6377; 6379 6377; 6379 6377; 6379

8 8 8

E-185-1 (26°,205HP) E-185-10 (26°,205HP) E-185-11 (26°,205HP) E-185-2 (26°,185HP) E-185-3 (26°,205HP) E-185-5 (26°,185HP) E-185-8 (26°,205HP) E-185-9 (26°,205HP)

6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379

6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379

8 8 8 8 8 8 8 8

E-225-2 (26°,225HP) E-225-4 (26°,225HP) E-225-8 (26°,225HP) E-225-9 (26°,225HP)

6377; 6379 6377; 6379 6377; 6379 6377; 6379

6377; 6379 6377; 6379 6377; 6379 6377; 6379

8 8 8 8

GO-300-A (28°,175HP) GO-300-B (28°,175HP) GO-300-C (28°,175HP) GO-300-D (28°,175HP) GO-300-E (28°,175HP)

6367; 667 6367; 667 6367; 667 6367; 667 6367; 667

6367; 667 6367; 667 6367; 667 6367; 667 6367; 667

IO-240-B (26°,125HP)

4309

4310

IO-360-A (20°,210HP) IO-360-B (20°,180HP) IO-360-C (20°,210HP)

6314 6314 6314

6314 6314 6314

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

7 7 7

PAGE NO.

REVISION

4-6

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Engine Engine - Model (Degree°, HP)

IO-360-CB (20°,210HP) IO-360-D (20°,210HP) IO-360-DB (20°,210HP) IO-360-E (20°,210HP) IO-360-ES (24°,210HP) IO-360-G (20°,210HP) IO-360-GB (20°,210HP) IO-360-H (20°,210HP) IO-360-HB (20°,210HP) IO-360-J (20°,210HP) IO-360-JB (20°,210HP) IO-360-K (20°,195HP) IO-360-KB (20°,195HP) IO-470-A (24°,240HP) IO-470-C (26°,250HP) IO-470-D (20°,260HP) IO-470-E (20°,260HP) IO-470-F (20°,260HP) IO-470-G (26°,250HP) IO-470-H (20°,260HP) IO-470-J (22°,225HP) IO-470-K (22°,225HP) IO-470-L (20°,260HP) IO-470-LO (20°,260HP) IO-470-M (20°,260HP) IO-470-N (20°,260HP) IO-470-P (26°,250HP) IO-470-R (26°,250HP) IO-470-S (20°,260HP) IO-470-T (26°,250HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Left Magneto Model

Right Magneto Model

Notes

6314 6314 6314 6314 6314 6314 6314 6314 6314 6314 6314 6314 6314

6314 6314 6314 6314 6314 6314 6314 6314 6314 6314 6314 6314 6314

7 7 7 7 7 7 7 7 7 7 7 7 7

6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 662 6310; 6380; 6362; 6382; 680; 662

6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 662 6310; 6380; 6362; 6382; 680; 662

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

MAGNETO APPLICATION

Teledyne Continental Motors

PAGE NO.

REVISION

4-7

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

IO-470-U (20°,260HP) IO-470-V (20°,260HP) IO-470-VO (20°,260HP)

IO-520-A (22°,285HP) IO-520-B (22°,285HP) IO-520-BA (22°,285HP) IO-520-BB (22°,285HP) IO-520-C (22°,285HP) IO-520-CB (22°,285HP) IO-520-D (22°,300HP) IO-520-E (22°,300HP) IO-520-F (22°,300HP) IO-520-J (22°,285HP) IO-520-K (22°,300HP) IO-520-L (22°,300HP) IO-520-M (22°,285HP) IO-520-MB (22°,285HP) IO-520-N (22°,300HP) IO-520-NB (22°,300HP)

IO-550-A (22°,300HP) IO-550-B (22°,300HP) IO-550-C (22°,300HP) IO-550-D (22°,300HP) IO-550-F (22°,300HP) IO-550-L (22°,300HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Left Magneto Model

Right Magneto Model

6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662

6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662

6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662

6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662

6310; 6309 6310 6310 6310 6310 6310

6310; 6313 6310 6310 6310 6310 6310

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

PAGE NO.

REVISION

4-8

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors Left Magneto Model

Right Magneto Model

LTSIO-360-E (20°,200HP) LTSIO-360-EB (20°,200HP) LTSIO-360-KB (20°,220HP) LTSIO-360-RB (22°,220HP)

6320 6320 6320 6320

6320 6320 6320 6320

LTSIO-520-AE (20°,250HP)

6324

6324

O-200-A (25°,100HP) O-200-B (25°,100HP) O-200-C (25°,100HP)

4301 4301 4301

4301 4301 4301

O-300-A (26°,145HP) O-300-B (26°,145HP) O-300-C (26°,145HP) O-300-D (26°,145HP) O-300-E (26°,145HP)

6364; 664 6364; 664 6364; 664 6364; 664 6364; 664

6364; 664 6364; 664 6364; 664 6364; 664 6364; 664

6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662

6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6377; 6379 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662

Engine - Model (Degree°, HP)

O-470-11 (26°,213HP) O-470-11B (26°,213HP) O-470-11B-C1 (26°,213HP) O-470-11-C1 (26°,213HP) O-470-13 (26°,225HP) O-470-13A (26°,225HP) O-470-15 (26°,213HP) O-470-4 (26°,225HP) O-470-A (26°,225HP) O-470-B (24°,240HP) O-470-B-C1 (24°,240HP) O-470-E (26°,225HP) O-470-G (24°,240HP) O-470-G-C1 (24°,240HP) O-470-H (24°,240HP) O-470-J (20°,225HP) O-470-K (22°,230HP) O-470-K-C1 (22°,230HP) O-470-L (22°,230HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

MAGNETO APPLICATION

Engine

5 5 5

8 8 8 8 8 8 8 8

PAGE NO.

REVISION

4-9

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors Engine Engine - Model (Degree°, HP)

O-470-L-C1 (22°,230HP) O-470-M (24°,240HP) O-470-M-C1 (24°,240HP) O-470-N (24°,240HP) O-470-P (24°,240HP) O-470-R (22°,230HP) O-470-S (22°,230HP) O-470-T (24°,230HP) O-470-U (24°,230HP)

TSIO-360-A (20°,210HP) TSIO-360-AB (20°,210HP) TSIO-360-B (20°,210HP) TSIO-360-BB (20°,210HP) TSIO-360-C (20°,225HP) TSIO-360-CB (20°,225HP) TSIO-360-D (20°,225HP) TSIO-360-DB (20°,225HP) TSIO-360-E (20°,200HP) TSIO-360-EB (20°,200HP) TSIO-360-F (20°,200HP) TSIO-360-FB (20°,200HP) TSIO-360-G (20°,210HP) TSIO-360-GB (20°,210HP) TSIO-360-H (20°,210HP) TSIO-360-HB (20°,210HP) TSIO-360-JB (20°,225HP) TSIO-360-KB (20°,220HP) TSIO-360-LB (20°,210HP) TSIO-360-MB (20°,210HP) TSIO-360-NB (20°,210HP) TSIO-360-PB (20°,200HP) TSIO-360-RB (22°,220HP) TSIO-360-SB (20°,220HP) TSIO-520-A (20°,285HP) TSIO-520-AE (20°,250HP) TSIO-520-AF (22°,310HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Left Magneto Model

Right Magneto Model

6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6309; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662

6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6313; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662 6310; 6380; 6362; 6382; 680; 662

6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324 6324; 6314 6324; 6314 6324; 6314 6324 6324 6324 6324 6324 6324 6324

6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324; 6314 6324 6324; 6314 6324; 6314 6324; 6314 6324 6324 6324 6324 6324 6324 6324

6310; 6380; 6320; 6362; 6382; 680; 662 6320 6320

6310; 6380; 6320; 6362; 6382; 680; 662 6320 6320

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

PAGE NO.

REVISION

4-10

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors Engine - Model (Degree°, HP)

TSIO-520-B (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-BE (24°,310HP) TSIO-520-C (20°,285HP) TSIO-520-CE (20°,325HP) TSIO-520-D (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-E (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-G (22°,300HP) TSIO-520-H (20°,285HP) TSIO-520-J (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-K (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-L (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-M (22°,310HP) TSIO-520-N (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-P (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-U (22°,300HP) TSIO-520-UB (22°,300HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Left Magneto Model

Right Magneto Model

6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6320; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6320; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662

6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6320; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6320; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

MAGNETO APPLICATION

Engine

PAGE NO.

REVISION

4-11

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors Engine

Left Magneto Model

Right Magneto Model

6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662

6310; 6380; 6320; 6362; 6382; 680; 662 6310; 6380; 6320; 6362; 6382; 680; 662

6320 6320 6320 6320

6320 6320 6320 6320

Left Magneto Model

Right Magneto Model

4373 4373 4373 4371 4373 4371

4353; 4370; 4373 4353; 4370; 4373 4370; 4373 4370; 4371 4370; 4373 4370; 4371

AEIO-360-A1A (20°,200HP) AEIO-360-A1A (25°,200HP) AEIO-360-A1B (20°,200HP) AEIO-360-A1B (25°,200HP) AEIO-360-A1B6 (20°,200HP) AEIO-360-A1B6 (25°,200HP) AEIO-360-A1D (20°,200HP) AEIO-360-A1D (25°,200HP) AEIO-360-A1E (20°,200HP) AEIO-360-A1E (25°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-B1B (25°,180HP) AEIO-360-B1F (25°,180HP) AEIO-360-B1F6 (25°,180HP) AEIO-360-B1G6 (25°,180HP) AEIO-360-B2F (25°,180HP) AEIO-360-B2F6 (25°,180HP) AEIO-360-B4A (25°,180HP) AEIO-360-H1A (25°,180HP)

4345; 4347 4345; 4347 4372 4373 4372 4373 4372 4373 4372 4373 4371 4347 4373 4371 4371 4373 4371 4373 4371

4370 4370 4370; 4372 4370; 4373 4370; 4372 4370; 4373 4370; 4372 4370; 4373 4370; 4372 4370; 4373 4370; 4371 4370 4373 4370; 4371 4371 4373 4370; 4371 4370; 4373 4370; 4371

AEIO-540-D4A5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-L1B5 (20°,300HP)

6393 6351; 6393 6393; 6351

6350 6371; 6350; 6351 6350

Engine - Model (Degree°, HP)

TSIO-520-VB (20°,325HP) TSIO-520-WB (20°,325HP)

TSIO-550-A (24°,360HP) TSIO-550-B (24°,350HP) TSIO-550-C (24°,310HP) TSIO-550-E (24°,350HP)

Notes

Textron-Lycoming Engine Engine - Model (Degree°, HP)

AEIO-320-D1B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-E1A (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E2A (25°,150HP) AEIO-320-E2B (25°,150HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

1 1

PAGE NO.

REVISION

4-12

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming Left Magneto Model

Right Magneto Model

AIO-320-A1B (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-B1B (25°,160HP) AIO-320-C1B (25°,160HP)

4373 4371 4373 4373

4370; 4373 4370; 4371 4370; 4373 4370; 4373

AIO-360-A1A (20°,200HP) AIO-360-A1B (20°,200HP) AIO-360-A2B (20°,200HP) AIO-360-B1B (20°,200HP) AIO-360-B1B (25°,200HP)

4372 4372 4371 4372 4373

4372 4370; 4372 4370; 4371 4370; 4372 4370; 4373

HIO-360-D1A (20°,190HP)

4345

4345

HO-360-C1A (25°,180HP)

4347

4370

IO-320-B1A (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1C (25°,160HP) IO-320-B1D (25°,160HP) IO-320-B2A (25°,160HP) IO-320-C1A - 1/2" (25°,160HP) IO-320-C1A - 13/16" (25°,160HP) IO-320-D1A (25°,160HP) IO-320-D1B (25°,160HP) IO-320-E1A (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E2A (25°,150HP) IO-320-E2B (25°,150HP) IO-320-F1A (25°,160HP)

4373 4371 4373 4347 4373 4373 4373 4373 4373 4373 4371 4373 4371 4373

4373 4370; 4371 4342; 4370; 4373 4370 4370; 4373 4354; 4373 4354; 4373 4370; 4373 4370; 4373 4370; 4373 4370; 4371 4370; 4373 4370; 4371 4373

IO-360-A1A (25°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1C (20°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D6 (20°,200HP) IO-360-A2A (20°,200HP) IO-360-A2B (20°,200HP) IO-360-A2B (25°,200HP) IO-360-A2C (20°,200HP) IO-360-B1B (25°,180HP) IO-360-B1D (25°,180HP) IO-360-B1E (25°,180HP) IO-360-B1F (25°,180HP) IO-360-B1F6 (25°,180HP) IO-360-B2E-nd (25°,180HP)

4345 4372 4373 4372 4373 4345 4372 4372 4345 4372 4373 4345 4347 4347 4373 4373 4371 4373

4370 4370; 4372 4370; 4373 4370; 4372 4370; 4373 4370 4370; 4372 4370; 4372 4342; 4370 4370; 4372 4370; 4373 4370 4370 4342 4370; 4373 4373 4370; 4371 4373

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

MAGNETO APPLICATION

Engine

1

1

1

PAGE NO.

REVISION

4-13

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming Engine

Left Magneto Model

Right Magneto Model

IO-360-B2E-wd (25°,180HP) IO-360-B2F (25°,180HP) IO-360-B2F6 (25°,180HP) IO-360-B4A (25°,180HP) IO-360-C1A (20°,200HP) IO-360-C1B (20°,200HP) IO-360-C1C (20°,200HP) IO-360-C1C6 (20°,200HP) IO-360-C1C6 (25°,200HP) IO-360-C1D6 (20°,200HP) IO-360-C1D6 (25°,200HP) IO-360-C1E6 (20°,200HP) IO-360-C1E6 (25°,200HP) IO-360-C1F (20°,200HP) IO-360-C1F (25°,200HP) IO-360-D1A (20°,200HP) IO-360-E1A (25°,180HP) IO-360-F1A (25°,180HP) IO-360-K2A (20°,200HP)

4373 4373 4373 4373 4345 4345 4372 4372 4373 4372 4373 4372 4373 4372 4373 4345 4347 4373 4372

4373 4373 4373 4370; 4373 4370 4370 4370; 4372 4370; 4372 4370; 4373 4370; 4372 4370; 4373 4370; 4372 4370; 4373 4370; 4372 4370; 4373 4370 4370 4370; 4373 4370; 4372

IO-540-A1A5 (20°,290HP) IO-540-AA1A5 (20°,270HP) IO-540-AA1B5 (20°,270HP) IO-540-AB1A5 (23°,230HP) IO-540-AC1A5 (20°,300HP) IO-540-B1A5 (20°,290HP) IO-540-B1C5 (20°,290HP) IO-540-C1B5 (25°,250HP) IO-540-C1C5 (25°,250HP) IO-540-C2C (25°,250HP) IO-540-C4B5 (25°,250HP) IO-540-C4C5 (25°,250HP) IO-540-D4A5 (25°,260HP) IO-540-D4B5 (25°,260HP) IO-540-D4C5 (25°,260HP) IO-540-E1A5 (20°,290HP) IO-540-E1B5 (20°,290HP) IO-540-G1A5 (20°,290HP) IO-540-G1B5 (20°,290HP) IO-540-G1C5 (20°,290HP) IO-540-G1D5 (20°,290HP) IO-540-G1E5 (20°,290HP) IO-540-G1F5 (20°,290HP) IO-540-J4A5 (25°,250HP) IO-540-K1A5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1C5 (20°,300HP) IO-540-K1D5 (20°,300HP)

6393 6393 6361 6351 6351 6393 6393 6393 6393 6355 6393 6393 6393 6351 6393 6393 6393 6393 6393 6351 6351 6351; 6393 6351 6393 6351 6351 6351; 6393 6393

6350 6350 6360 6351 6351 6350 6350 6350 6350 6350; 6355 6350 6350 6350 6350; 6351 6350 6350 6350 6350 6350 6350; 6351 6371 6371; 6350 6351 6350 6350; 6351 6371; 6351; 6350 6350; 6351 6350

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

1 1

1

PAGE NO.

REVISION

4-14

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming Left Magneto Model

Right Magneto Model

IO-540-K1E5 (20°,300HP) IO-540-K1F5 (20°,300HP) IO-540-K1G5 (20°,300HP) IO-540-K1H5 (20°,300HP) IO-540-K1J5 (20°,300HP) IO-540-K1K5 (20°,300HP) IO-540-L1A5 (20°,300HP) IO-540-L1C5 (20°,300HP) IO-540-M1A5 (20°,300HP) IO-540-N1A5 (25°,260HP) IO-540-P1A5 (20°,290HP) IO-540-R1A5 (25°,260HP) IO-540-S1A5 (20°,300HP)

6351 6393 6351 6351 6393 6351 6351 6351 6393 6393 6393 6393 6393

6351 6350 6350; 6351 6350; 6351 6350 6350; 6351 6350; 6351 6350; 6351 6350 6350 6350 6350 6350; 6371

LIO-320-B1A (25°,160HP) LIO-320-C1A (25°,160HP)

4330 4330

4330 4330

LIO-360-C1E6 (20°,200HP) LIO-360-C1E6 (25°,200HP)

4374 4374

4302 4302

LTIO-540-J2B (20°,350HP)

6394

6340

4373 4347 4371 4373 4373 4371 4371 4373 4371 4371 4347 4373 4373 4373 4373 4371 4371 4373 4371 4372 4372 4372 4372 4381; 4372 4372 4372

4370; 4373 4370 4370; 4371 4370; 4373 4370; 4373 4370; 4371 4370; 4371 4370; 4373 4370; 4371 4370; 4371 4370 4370; 4373 4370; 4373 4370; 4373 4370; 4373 4370; 4371 4370; 4371 4370; 4373 4370; 4371 4370; 4372 4370; 4372 4370; 4372 4370; 4372 4370; 4381; 4372 4370; 4372 4370; 4372

Engine - Model (Degree°, HP)

O-235-C1 (25°,115HP) O-235-C1B (25°,115HP) O-235-C1C (25°,115HP) O-235-C2A (25°,115HP) O-235-C2B (25°,115HP) O-235-C2C (25°,115HP) O-235-E1 (25°,115HP) O-235-E2A (25°,115HP) O-235-E2B (25°,115HP) O-235-F1 (25°,125HP) O-235-F1B (25°,125HP) O-235-F2A (25°,125HP) O-235-F2B (25°,125HP) O-235-G1 (25°,125HP) O-235-G2A (25°,125HP) O-235-G2B (25°,125HP) O-235-H2C (25°,115HP) O-235-J2A (25°,125HP) O-235-J2B (25°,125HP) O-235-K2A (20°,118HP) O-235-K2B (20°,118HP) O-235-K2C (20°,118HP) O-235-L2A (20°,118HP) O-235-L2C (20°,118HP) O-235-M1 (20°,118HP) O-235-M2C (20°,118HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

MAGNETO APPLICATION

Engine

PAGE NO.

REVISION

4-15

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming Engine Engine - Model (Degree°, HP)

Left Magneto Model

Right Magneto Model

O-235-N2A (20°,116HP) O-235-N2C (20°,116HP) O-235-P1 (20°,116HP) O-235-P2A (20°,116HP)

4372 4381; 4372; 4371 4372 4372

4370; 4372 4381; 4370; 4372; 4371 4370; 4372 4342

O-290-D (20°,125HP) O-290-D2 (18°,135HP)

4373 4372

4370; 4373 4370; 4372

O-320-A1A (25°,150HP) O-320-A1B (25°,150HP) O-320-A2A (25°,150HP) O-320-A2B (25°,150HP) O-320-A2C (25°,150HP) O-320-A2D (25°,150HP) O-320-A3A (25°,150HP) O-320-A3B (25°,150HP) O-320-A3C (25°,150HP) O-320-B1A (25°,160HP) O-320-B1B (25°,160HP) O-320-B2A (25°,160HP) O-320-B2B (25°,160HP) O-320-B2C (25°,160HP) O-320-B2D (25°,160HP) O-320-B3A (25°,160HP) O-320-B3B (25°,160HP) O-320-B3C (25°,160HP) O-320-C1A (25°,150HP) O-320-C1B (25°,150HP) O-320-C2A (25°,150HP) O-320-C2B (25°,150HP) O-320-C2C (25°,150HP) O-320-C3A (25°,150HP) O-320-C3B (25°,150HP) O-320-C3C (25°,150HP) O-320-D1A (25°,150HP) O-320-D1A (25°,160HP) O-320-D1C (25°,150HP) O-320-D1C (25°,160HP) O-320-D1D (25°,150HP) O-320-D1D (25°,160HP) O-320-D1F (25°,150HP) O-320-D1F (25°,160HP) O-320-D2A (25°,150HP) O-320-D2A (25°,160HP) O-320-D2B (25°,150HP) O-320-D2B (25°,160HP) O-320-D2C (25°,150HP) O-320-D2C (25°,160HP)

4371 4373 4373 4373 4347 4371 4373 4373 4347 4347 4373 4373 4373 4347 4347 4373 4373 4347 4373 4373 4373 4373 4373 4373 4373 4373 4373 4373 4373 4373 4371 4371 4373 4373 4373 4373 4347 4347 4373 4373

4370; 4371 4370; 4373 4370; 4373 4370; 4373; 4342 4370 4370; 4371 4370; 4373 4370; 4373 4370 4370; 4347 4370; 4347 4370; 4373 4370; 4373 4342 4370 4370; 4373 4370; 4373 4370 4370; 4373 4370; 4373 4370 4370; 4373 4370; 4373 4370; 4373 4370; 4373 4370; 4373 4370; 4373; 4342 4370; 4373; 4342 4370; 4373 4370; 4373 4370; 4371 4370; 4371 4370; 4373 4370; 4373 4370; 4373 4370; 4373 4370 4370 4370; 4373 4370; 4373

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

PAGE NO.

REVISION

4-16

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming Engine - Model (Degree°, HP)

Left Magneto Model

Right Magneto Model

O-320-D2F (25°,150HP) O-320-D2F (25°,160HP) O-320-D2G (25°,150HP) O-320-D2G (25°,160HP) O-320-D2H (25°,150HP) O-320-D2H (25°,160HP) O-320-D2J (25°,150HP) O-320-D2J (25°,160HP) O-320-D3G (25°,150HP) O-320-D3G (25°,160HP) O-320-E1A (25°,150HP) O-320-E1C (25°,150HP) O-320-E1F (25°,150HP) O-320-E1J (25°,150HP) O-320-E2A (25°,140HP) O-320-E2A (25°,150HP) O-320-E2B (25°,150HP) O-320-E2C (25°,140HP) O-320-E2C (25°,150HP) O-320-E2D (25°,150HP) O-320-E2F (25°,150HP) O-320-E2G (25°,150HP) O-320-E2H (25°,150HP) O-320-E3D (25°,150HP) O-320-E3H (25°,150HP)

4373 4373 4371 4371 4371 4371 4371 4371 4371 4371 4373 4373 4373 4371 4373 4373 4347 4373 4373 4371 4373 4371 4373 4371 4373

4370; 4373 4370; 4373 4370; 4371 4370; 4371 4370; 4371 4370; 4371 4371 4371 4370; 4371 4370; 4371 4370; 4373 4370; 4373 4370; 4373 4370; 4371 4370; 4373 4370; 4373 4370 4370; 4373 4370; 4373 4370; 4371 4370; 4373 4370; 4371 4370; 4373 4370; 4371 4370; 4373

O-360-A1A-nd (25°,180HP) O-360-A1A-wd (25°,180HP) O-360-A1D (25°,180HP) O-360-A1F (25°,180HP) O-360-A1F6 (25°,180HP) O-360-A1G (25°,180HP) O-360-A1G6 (25°,180HP) O-360-A1H (25°,180HP) O-360-A1H6 (25°,180HP) O-360-A2A (25°,180HP) O-360-A2D (25°,180HP) O-360-A2F (25°,180HP) O-360-A2G (25°,180HP) O-360-A2H (25°,180HP) O-360-A3A (25°,180HP) O-360-A4A (25°,180HP) O-360-A4G (25°,180HP) O-360-A4J (25°,180HP) O-360-A4K (25°,180HP) O-360-A4M (25°,180HP) O-360-A4N (25°,180HP) O-360-B1A (25°,168HP)

4373 4373 4347 4373 4373 4373 4373 4373 4373 4373 4347 4373 4373 4371 4373 4373 4373 4373 4371 4371 4371 4371

4370; 4373 4370; 4373 4370 4353 4370; 4373 4370; 4373 4370; 4373 4370; 4373 4370; 4373 4370; 4373 4342; 4370 4370; 4373 4370; 4373 4370; 4371 4370; 4373 4370; 4373 4370; 4373 4370; 4373 4370; 4371 4370; 4371 4371 4370; 4371

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

MAGNETO APPLICATION

Engine

PAGE NO.

REVISION

4-17

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming Engine Engine - Model (Degree°, HP)

Left Magneto Model

Right Magneto Model

O-360-B2A (25°,168HP) O-360-C1A (25°,180HP) O-360-C1C (25°,180HP) O-360-C1E (25°,180HP) O-360-C1F (25°,180HP) O-360-C1G (25°,180HP) O-360-C2A (25°,180HP) O-360-C2B (25°,180HP) O-360-C2C (25°,180HP) O-360-C2E (25°,180HP) O-360-D1A (25°,168HP) O-360-D2A (25°,168HP) O-360-F1A6 (25°,180HP) O-360-G1A6 (25°,180HP)

4373 4373 4347 4371 4371 4373 4373 4371 4347 4371 4371 4373 4371 4371

4370; 4373 4370; 4373 4370 4370; 4371 4370; 4371 4370; 4373 4370; 4373 4370; 4371 4370 4370; 4371 4370; 4371 4370; 4373 4371 4371

6355 6355 6355; 6393 6355 6393 6393; 6355 6355 6393 6355 6355 6393 6393 6393 6355 6355 6351 6355 6355 6355 6393 6393 6355 6355 6351; 6393 6393 6351 6351 6351 6351 6355 6351

6350; 6355 6350; 6355 6355; 6350 6355 6350 6350; 6355 6350; 6355 6350 6350; 6355 6355 6350 6350 6350 6350; 6355 6350; 6355 6350; 6351 6350; 6355 6350; 6355 6350; 6355 6350 6350 6350; 6355 6350; 6355 6371; 6350; 6351 6390 6350; 6351 6350; 6351 6350; 6351 6350; 6351 6350 6350; 6351

O-540-A1A (25°,250HP) O-540-A1A5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1C5 (25°,250HP) O-540-A1D (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A2B (25°,250HP) O-540-A3D5 (25°,250HP) O-540-A4A5 (25°,250HP) O-540-A4B5 (25°,250HP) O-540-A4D5 (25°,250HP) O-540-B1A5 (25°,235HP) O-540-B2A5 (25°,235HP) O-540-B2B5 (25°,235HP) O-540-B2B5-wd (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5-wd (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5-wd (25°,235HP) O-540-D1A5 (25°,250HP) O-540-E4A5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4C5 (25°,260HP) O-540-F1B5 (25°,260HP) O-540-G1A5 (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-H2A5 (25°,260HP) O-540-J3A5 (23°,235HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

PAGE NO.

REVISION

4-18

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming Engine Engine - Model (Degree°, HP)

TIO-540-A2B (20°,310HP) TIO-540-A2C (20°,310HP) TIO-540-AE2A (20°,350HP) TIO-540-AF1A (20°,270HP) TIO-540-AG1A (20°,270HP) TIO-540-J2B (20°,350HP) TIO-540-U2A (20°,350HP) TIO-540-W2A (20°,350HP) TIO-540-W2B (20°,350HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Left Magneto Model

Right Magneto Model

6363 6363 6361 6361 6361 6363 6360 6361 6360

6360 6360 6360 6360 6360 6360 6361 6360 6361

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

PAGE NO.

REVISION

4-19/(4-20 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Section 5.0 HARNESS APPLICATION (5/8”)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-1/(5-2 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

L-1318


L-1318

Franklin 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

6A-350-C1 (28°,220HP) 6A-350-C1 (28°,220HP) 6A-350-C1A (28°,220HP) 6A-350-C1A (28°,220HP) 6A-350-C2 (28°,215HP) 6A-350-C2 (28°,215HP) 6A-350-C2A (28°,212HP) 6A-350-C2A (28°,212HP) 6A-350-D1 (28°,200HP) 6A-350-D1 (28°,200HP) 6A-350-D1A (28°,230HP) 6A-350-D1A (28°,230HP) 6A-350-D1B (28°,220HP) 6A-350-D1B (28°,220HP)

M6056 M2772 M6056 M2772 M6056 M2772 M6056 M2772 M6056 M2772 M6056 M2772 M6056 M2772

M6054 M2773 M6054 M2773 M6054 M2773 M6054 M2773 M6054 M2773 M6054 M2773 M6054 M2773

M6055 M2774 M6055 M2774 M6055 M2774 M6055 M2774 M6055 M2774 M6055 M2774 M6055 M2774

X

6A4-150-B3 (28°,150HP) 6A4-150-B31 (28°,150HP) 6A4-150-B31 (28°,150HP) 6A4-150-B4 (28°,150HP) 6A4-150-B4 (28°,150HP)

M6056 M6056 M2772 M6056 M2772

M6054 M6054 M2773 M6054 M2773

M6055 M6055 M2774 M6055 M2774

X X

6A4-165-B3 (32°,165HP) 6A4-165-B3 (32°,165HP) 6A4-165-B4 (32°,165HP) 6A4-165-B4 (32°,165HP) 6A4-165-B6 (32°,165HP) 6A4-165-B6 (32°,165HP)

M6056 M2772 M6056 M2772 M6056 M2772

M6054 M2773 M6054 M2773 M6054 M2773

M6055 M2774 M6055 M2774 M6055 M2774

X

9 9 9 9 9 9 9 9 9 9 9 9 9 9

X X X X X X X X X X X X X

HARNESSES 5/8”

Engine

S4

00

X X X

X X X X X

Great Plains 0 0 00 20 -20 30 6 D ; S 00 200 0; 43 63 0; 0 0; 00; 0 4 - 2 - 2 0 - 1 2 - 1 0 6 0 S S6 20 S4 S D 42 62 6 Notes 00

Engine Engine - Model (Degree°, HP)

GREAT PLAINS-Volkswagen (30°,65HP) Type 1-1600 (25°,57HP) Type 1-1835 (25°,65HP) Type 1-2180 (25°,76HP) Type 4-2400 (25°,85HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

M2266 M2266 M2266 M2266 M2266

LH Harness

RH Harness

00

S4

X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-3

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Grob 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

GROB-Volkswagen (30°,65HP)

Complete Harness

LH Harness

RH Harness

M2266

00

S4

X

HAPI 0 0 00 20 -20 30 6 D S 00 00 3 6 0; 0; 20; 2 12 ; 4 0; 0 2 1 0 0 0 00 4 0 S S6 S4 S6 D2 Notes 42 62 6 00

Engine Engine - Model (Degree°, HP)

HAPI-Volkswagen-E (30°,65HP) HAPI-Volkswagen-G (30°,65HP)

Complete Harness

LH Harness

RH Harness

M2266

X

M2266

X

0 30

S4

Limbach 0 0 00 20 -20 30 6 D S 00 00 3 6 0; 0; 20; 2 12 ; 4 0; 0 2 1 0 0 0 00 4 0 S S6 S4 S6 D2 Notes 42 62 6 00

Engine Engine - Model (Degree°, HP)

LIMBACH-Volkswagen (30°,65HP)

Complete Harness

LH Harness

RH Harness

M2266

0 30

S4

X

Monnett 0 0 00 20 -20 30 6 D S 00 00 3 6 0; 0; 20; 2 12 ; 4 0; 0 2 1 0 0 0 00 4 0 S S6 S4 S6 D2 Notes 42 62 6 00

Engine Engine - Model (Degree°, HP)

MONNETT-Volkswagen (30°,65HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness M2266

LH Harness

RH Harness

0 30

S4

X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-4

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Mosler 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

MOSLER-Volkswagen (30°,65HP)

Complete Harness

LH Harness

RH Harness

M2266

00

S4

X

Superior Air Parts 0 0 00 20 -20 30 6 D S 00 00 3 6 0; 0; 20; 2 12 ; 4 0; 0 2 1 0 0 0 00 4 0 S S6 S4 S6 D2 Notes 42 62 6 00

Engine - Model (Degree°, HP)

IO-360 (25°,180HP) O-360 (25°,180HP)

Complete Harness

LH Harness

RH Harness

M4001 M4001

M1795 M1795

M2992 M2992

S4

X X

Teledyne Continental Motors 0 0 00 20 -20 30 6 D 0 ; ; 63 ; S 00 0 20 -20 -12 -12 000 0; 0 0 6 0 S4 S6 2 Notes S4 S 62 6 D 00

Engine Engine - Model (Degree°,

HP)

A-65-1 (30°,65HP) A-65-1 (30°,65HP) A-65-3 (30°,65HP) A-65-3 (30°,65HP) A-65-6 (30°,65HP) A-65-6 (30°,65HP) A-65-6J (30°,65HP) A-65-6J (30°,65HP) A-65-7 (30°,65HP) A-65-7 (30°,65HP) A-65-8 (30°,65HP) A-65-8 (30°,65HP) A-65-8F (30°,65HP) A-65-8F (30°,65HP) A-65-8FJ (30°,65HP) A-65-8FJ (30°,65HP) A-65-8J (30°,65HP) A-65-8J (30°,65HP) A-65-9 (30°,65HP) A-65-9 (30°,65HP) A-65-9F (30°,65HP) A-65-9F (30°,65HP) A-65-9FJ (30°,65HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2045 M2351 M2045 M2351 M2045 M2351 M2045 M2351 M2045 M2351 M2045 M2351 M2045 M2351 M2045 M2351 M2045 M2351 M2351 M2045 M2351 M2045 M2351

M1960 M2353 M1960 M2353 M1960 M2353 M1960 M2353 M1960 M2353 M1960 M2353 M1960 M2353 M1960 M2353 M1960 M2353 M2353 M1960 M2353 M1960 M2353

M1970 M2352 M1970 M2352 M1970 M2352 M1970 M2352 M1970 M2352 M1970 M2352 M1970 M2352 M1970 M2352 M1970 M2352 M2352 M1970 M2352 M1970 M2352

S4

X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-5

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

Engine

0 30


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine

Complete Harness

LH Harness

RH Harness

A-65-9FJ (30°,65HP) A-65-9J (30°,65HP)

M2045 M2351

M1960 M2353

M1970 M2352

X

A-75-3 (30°,75HP) A-75-6 (30°,75HP) A-75-6J (30°,75HP) A-75-8 (30°,75HP) A-75-8F (30°,75HP) A-75-8FJ (30°,75HP) A-75-8J (30°,75HP) A-75-9 (30°,75HP) A-75-9J (30°,75HP)

M2045 M2045 M2045 M2045 M2045 M2045 M2045 M2045 M2045

M1960 M1960 M1960 M1960 M1960 M1960 M1960 M1960 M1960

M1970 M1970 M1970 M1970 M1970 M1970 M1970 M1970 M1970

X X X X X X X X X

C-125-2 (28°,125HP)

M2130

M2132

M2131

C-145-2 (26°,145HP) C-145-2 (26°,145HP) C-145-2 (26°,145HP) C-145-2H (26°,145HP) C-145-2H (26°,145HP) C-145-2H (26°,145HP) C-145-2HP (26°,145HP) C-145-2HP (26°,145HP) C-145-2HP (26°,145HP)

M2932 M1884 M2130 M2932 M1884 M2130 M2932 M1884 M2130

M2930 M1920 M2132 M2930 M1920 M2132 M2930 M1920 M2132

M2931 M1915 M2131 M2931 M1915 M2131 M2931 M1915 M2131

C-75-12 (30°,75HP) C-75-12 (30°,75HP) C-75-12F (30°,75HP) C-75-12F (30°,75HP) C-75-12FH (30°,75HP) C-75-12FH (30°,75HP) C-75-12FHJ (30°,75HP) C-75-12FHJ (30°,75HP) C-75-12FJ (30°,75HP) C-75-12FJ (30°,75HP) C-75-12J (30°,75HP) C-75-12J (30°,75HP) C-75-15 (30°,75HP) C-75-15 (30°,75HP) C-75-15F (30°,75HP) C-75-15F (30°,75HP) C-75-8 (30°,75HP) C-75-8 (30°,75HP) C-75-8F (30°,75HP) C-75-8F (30°,75HP) C-75-8FH (30°,75HP)

M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M2045 M2351 M2045 M2351 M2045

M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1960 M2353 M1960 M2353 M1960

M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1970 M2352 M1970 M2352 M1970

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

00

X

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-6

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Complete Harness

LH Harness

RH Harness

C-75-8FH (30°,75HP) C-75-8FHJ (30°,75HP) C-75-8FHJ (30°,75HP) C-75-8FJ (30°,75HP) C-75-8FJ (30°,75HP) C-75-8J (30°,75HP) C-75-8J (30°,75HP)

M2351 M2045 M2351 M2045 M2351 M2045 M2351

M2353 M1960 M2353 M1960 M2353 M1960 M2353

M2352 M1970 M2352 M1970 M2352 M1970 M2352

C-85-12 (30°,85HP) C-85-12 (30°,85HP) C-85-12F (30°,85HP) C-85-12F (30°,85HP) C-85-12FH (30°,85HP) C-85-12FH (30°,85HP) C-85-12FHJ (30°,85HP) C-85-12FHJ (30°,85HP) C-85-12FJ (30°,85HP) C-85-12FJ (30°,85HP) C-85-12J (30°,85HP) C-85-12J (30°,85HP) C-85-14 (30°,85HP) C-85-14 (30°,85HP) C-85-14F (30°,85HP) C-85-14F (30°,85HP) C-85-15 (30°,85HP) C-85-15 (30°,85HP) C-85-15F (30°,85HP) C-85-15F (30°,85HP) C-85-8 (30°,85HP) C-85-8 (30°,85HP) C-85-8F (30°,85HP) C-85-8F (30°,85HP) C-85-8FHJ (30°,87HP) C-85-8FHJ (30°,87HP) C-85-8FJ (30°,87HP) C-85-8FJ (30°,87HP) C-85-8J (30°,87HP) C-85-8J (30°,87HP)

M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M2045 M2351 M2045 M2351 M2045 M2351 M2045 M2351 M2045 M2351

M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1960 M2353 M1960 M2353 M1960 M2353 M1960 M2353 M1960 M2353

M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1970 M2352 M1970 M2352 M1970 M2352 M1970 M2352 M1970 M2352

C-90-12F (25°,95HP) C-90-12F (25°,95HP) C-90-12FH (25°,95HP) C-90-12FH (25°,95HP) C-90-12FJ (25°,95HP) C-90-12FJ (25°,95HP) C-90-12FP (25°,95HP)

M1780 M2007 M1780 M2007 M1780 M2007 M1780

M1755 M2013 M1755 M2013 M1755 M2013 M1755

M1745 M2012 M1745 M2012 M1745 M2012 M1745

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

X X X X X X X X X X X X X X

HARNESSES 5/8”

Engine

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-7

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine

Complete Harness

LH Harness

RH Harness

C-90-12FP (25°,95HP) C-90-14F (25°,95HP) C-90-14F (25°,95HP) C-90-14FH (25°,95HP) C-90-14FH (25°,95HP) C-90-14FJ (25°,95HP) C-90-14FJ (25°,95HP) C-90-16F (25°,95HP) C-90-16F (25°,95HP) C-90-8F (25°,95HP) C-90-8F (25°,95HP) C-90-8FJ (25°,95HP) C-90-8FJ (25°,95HP)

M2007 M1780 M2007 M1780 M2007 M1780 M2007 M1780 M2007 M2045 M2351 M2045 M2351

M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1755 M2013 M1960 M2353 M1960 M2353

M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1745 M2012 M1970 M2352 M1970 M2352

E-165-2 (26°,165HP) E-165-2 (26°,165HP) E-165-3 (26°,165HP) E-165-3 (26°,165HP) E-165-4 (26°,165HP) E-165-4 (26°,165HP)

M6068 M2176 M6068 M2176 M6068 M2176

M6066 M2178 M6066 M2178 M6066 M2178

M6067 M2177 M6067 M2177 M6067 M2177

X

E-185-1 (26°,205HP) E-185-1 (26°,205HP) E-185-10 (26°,205HP) E-185-10 (26°,205HP) E-185-11 (26°,205HP) E-185-11 (26°,205HP) E-185-2 (26°,185HP) E-185-2 (26°,185HP) E-185-3 (26°,205HP) E-185-3 (26°,205HP) E-185-5 (26°,185HP) E-185-5 (26°,185HP) E-185-8 (26°,205HP) E-185-8 (26°,205HP) E-185-9 (26°,205HP) E-185-9 (26°,205HP)

M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176

M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178

M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177

X

E-225-2 (26°,225HP) E-225-2 (26°,225HP) E-225-4 (26°,225HP) E-225-4 (26°,225HP) E-225-8 (26°,225HP) E-225-8 (26°,225HP) E-225-9 (26°,225HP) E-225-9 (26°,225HP)

M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176

M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178

M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177

X

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

X X X X X X X X X X X X X

X X X X X

X X X X X X X X X X X X X X X

X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-8

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 D ; S 00 200 0; 43 63 0; 0 0; 00; 0 4 - 2 - 2 0 - 1 2 - 1 0 6 0 S S6 20 S4 S Notes D 42 62 6

Complete Harness

LH Harness

RH Harness

GO-300-A (28°,175HP) GO-300-A (28°,175HP) GO-300-A (28°,175HP) GO-300-B (28°,175HP) GO-300-B (28°,175HP) GO-300-B (28°,175HP) GO-300-C (28°,175HP) GO-300-C (28°,175HP) GO-300-C (28°,175HP) GO-300-D (28°,175HP) GO-300-D (28°,175HP) GO-300-D (28°,175HP) GO-300-E (28°,175HP) GO-300-E (28°,175HP) GO-300-E (28°,175HP)

M2938 M2023 M2345 M2938 M2023 M2345 M2938 M2023 M2345 M2938 M2023 M2345 M2938 M2023 M2345

M2936 M2027 M2347 M2936 M2027 M2347 M2936 M2027 M2347 M2936 M2027 M2347 M2936 M2027 M2347

M2937 M2026 M2346 M2937 M2026 M2346 M2937 M2026 M2346 M2937 M2026 M2346 M2937 M2026 M2346

X

IO-470-A (24°,240HP) IO-470-A (24°,240HP) IO-470-A (24°,240HP) IO-470-C (26°,250HP) IO-470-C (26°,250HP) IO-470-C (26°,250HP) IO-470-D (20°,260HP) IO-470-D (20°,260HP) IO-470-D (20°,260HP) IO-470-E (20°,260HP) IO-470-E (20°,260HP) IO-470-E (20°,260HP) IO-470-F (20°,260HP) IO-470-F (20°,260HP) IO-470-F (20°,260HP) IO-470-G (26°,250HP) IO-470-G (26°,250HP) IO-470-G (26°,250HP) IO-470-H (20°,260HP) IO-470-H (20°,260HP) IO-470-H (20°,260HP) IO-470-J (22°,225HP) IO-470-J (22°,225HP) IO-470-J (22°,225HP) IO-470-K (22°,225HP) IO-470-K (22°,225HP) IO-470-K (22°,225HP) IO-470-L (20°,260HP) IO-470-L (20°,260HP) IO-470-L (20°,260HP)

M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978

M2829

M2830

X

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010

M2005

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X X X X X X X X X

HARNESSES 5/8”

Engine

S4

00

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-9

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine

Complete Harness

LH Harness

RH Harness

IO-470-LO (20°,260HP) IO-470-LO (20°,260HP) IO-470-LO (20°,260HP) IO-470-M (20°,260HP) IO-470-M (20°,260HP) IO-470-M (20°,260HP) IO-470-N (20°,260HP) IO-470-N (20°,260HP) IO-470-N (20°,260HP) IO-470-P (26°,250HP) IO-470-P (26°,250HP) IO-470-P (26°,250HP) IO-470-R (26°,250HP) IO-470-R (26°,250HP) IO-470-R (26°,250HP) IO-470-S (20°,260HP) IO-470-S (20°,260HP) IO-470-S (20°,260HP) IO-470-T (26°,250HP) IO-470-T (26°,250HP) IO-470-T (26°,250HP) IO-470-U (20°,260HP) IO-470-U (20°,260HP) IO-470-U (20°,260HP) IO-470-V (20°,260HP) IO-470-V (20°,260HP) IO-470-V (20°,260HP) IO-470-VO (20°,260HP) IO-470-VO (20°,260HP) IO-470-VO (20°,260HP)

M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978

M2829

M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010

M2005

IO-520-A (22°,285HP) IO-520-A (22°,285HP) IO-520-A (22°,285HP) IO-520-B (22°,285HP) IO-520-B (22°,285HP) IO-520-B (22°,285HP) IO-520-BA (22°,285HP) IO-520-BA (22°,285HP) IO-520-BA (22°,285HP) IO-520-BB (22°,285HP) IO-520-BB (22°,285HP) IO-520-BB (22°,285HP) IO-520-C (22°,285HP) IO-520-C (22°,285HP) IO-520-C (22°,285HP)

M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978

M2829

M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010

M2005

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-10

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Complete Harness

LH Harness

RH Harness

IO-520-CB (22°,285HP) IO-520-CB (22°,285HP) IO-520-CB (22°,285HP) IO-520-D (22°,300HP) IO-520-D (22°,300HP) IO-520-D (22°,300HP) IO-520-E (22°,300HP) IO-520-E (22°,300HP) IO-520-E (22°,300HP) IO-520-F (22°,300HP) IO-520-F (22°,300HP) IO-520-F (22°,300HP) IO-520-J (22°,285HP) IO-520-J (22°,285HP) IO-520-J (22°,285HP) IO-520-K (22°,300HP) IO-520-K (22°,300HP) IO-520-K (22°,300HP) IO-520-L (22°,300HP) IO-520-L (22°,300HP) IO-520-L (22°,300HP) IO-520-M (22°,285HP) IO-520-M (22°,285HP) IO-520-M (22°,285HP) IO-520-MB (22°,285HP) IO-520-MB (22°,285HP) IO-520-MB (22°,285HP) IO-520-N (22°,300HP) IO-520-N (22°,300HP) IO-520-N (22°,300HP) IO-520-NB (22°,300HP) IO-520-NB (22°,300HP) IO-520-NB (22°,300HP)

M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978

M2829

M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010

M2005

IO-550-A (22°,300HP)

M2828

M2829

M2830

LTSIO-520-AE (20°,250HP)

M1978

M2010

M2005

O-200-A (25°,100HP) O-200-A (25°,100HP) O-200-B (25°,100HP) O-200-B (25°,100HP) O-200-C (25°,100HP) O-200-C (25°,100HP)

M1780 M2007 M1780 M2007 M1780 M2007

M1755 M2013 M1755 M2013 M1755 M2013

M1745 M2012 M1745 M2012 M1745 M2012

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X X X X X X X X X X

HARNESSES 5/8”

Engine

S4

00

00

X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-11

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine

Complete Harness

LH Harness

RH Harness

O-300-A (26°,145HP) O-300-A (26°,145HP) O-300-A (26°,145HP) O-300-B (26°,145HP) O-300-B (26°,145HP) O-300-B (26°,145HP) O-300-C (26°,145HP) O-300-C (26°,145HP) O-300-C (26°,145HP) O-300-D (26°,145HP) O-300-D (26°,145HP) O-300-D (26°,145HP) O-300-E (26°,145HP) O-300-E (26°,145HP) O-300-E (26°,145HP)

M2932 M1884 M2130 M2932 M1884 M2130 M2932 M1884 M2130 M2932 M1884 M2130 M2932 M1884 M2130

M2930 M1920 M2132 M2930 M1920 M2132 M2930 M1920 M2132 M2930 M1920 M2132 M2930 M1920 M2132

M2931 M1915 M2131 M2931 M1915 M2131 M2931 M1915 M2131 M2931 M1915 M2131 M2931 M1915 M2131

X

O-470-11 (26°,213HP) O-470-11 (26°,213HP) O-470-11B (26°,213HP) O-470-11B (26°,213HP) O-470-11B-C1 (26°,213HP) O-470-11B-C1 (26°,213HP) O-470-11-C1 (26°,213HP) O-470-11-C1 (26°,213HP) O-470-13 (26°,225HP) O-470-13 (26°,225HP) O-470-13A (26°,225HP) O-470-13A (26°,225HP) O-470-15 (26°,213HP) O-470-15 (26°,213HP) O-470-4 (26°,225HP) O-470-4 (26°,225HP) O-470-A (26°,225HP) O-470-A (26°,225HP) O-470-A (26°,225HP) O-470-B (24°,240HP) O-470-B (24°,240HP) O-470-B (24°,240HP) O-470-B-C1 (24°,240HP) O-470-B-C1 (24°,240HP) O-470-B-C1 (24°,240HP) O-470-E (26°,225HP) O-470-E (26°,225HP) O-470-E (26°,225HP) O-470-G (24°,240HP) O-470-G (24°,240HP)

M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176 M6068 M2176 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878

M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178 M6066 M2178 M2829

M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177 M6067 M2177 M2830

X

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

00

X X X X X X X X X X X X X X

X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-12

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-470-G (24°,240HP) O-470-G-C1 (24°,240HP) O-470-G-C1 (24°,240HP) O-470-G-C1 (24°,240HP) O-470-H (24°,240HP) O-470-H (24°,240HP) O-470-H (24°,240HP) O-470-J (20°,225HP) O-470-J (20°,225HP) O-470-J (20°,225HP) O-470-K (22°,230HP) O-470-K (22°,230HP) O-470-K (22°,230HP) O-470-K-C1 (22°,230HP) O-470-K-C1 (22°,230HP) O-470-K-C1 (22°,230HP) O-470-L (22°,230HP) O-470-L (22°,230HP) O-470-L (22°,230HP) O-470-L-C1 (22°,230HP) O-470-L-C1 (22°,230HP) O-470-L-C1 (22°,230HP) O-470-M (24°,240HP) O-470-M (24°,240HP) O-470-M (24°,240HP) O-470-M-C1 (24°,240HP) O-470-M-C1 (24°,240HP) O-470-M-C1 (24°,240HP) O-470-N (24°,240HP) O-470-N (24°,240HP) O-470-N (24°,240HP) O-470-P (24°,240HP) O-470-P (24°,240HP) O-470-P (24°,240HP) O-470-R (22°,230HP) O-470-R (22°,230HP) O-470-R (22°,230HP) O-470-S (22°,230HP) O-470-S (22°,230HP) O-470-S (22°,230HP) O-470-T (24°,230HP) O-470-T (24°,230HP) O-470-T (24°,230HP) O-470-U (24°,230HP) O-470-U (24°,230HP) O-470-U (24°,230HP)

M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978 M2828 M1878 M1978

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010 M2829

M2005 M2830

M2010

M2005

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X X X X X X X X X X

HARNESSES 5/8”

Engine

S4

00

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-13

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

TSIO-470-B (22°,260HP) TSIO-470-C (22°,260HP) TSIO-470-D (22°,260HP)

M1978 M1978 M1978

M2010 M2010 M2010

M2005 M2005 M2005

TSIO-520-A (20°,285HP) TSIO-520-A (20°,285HP) TSIO-520-AE (20°,250HP) TSIO-520-B (20°,285HP) TSIO-520-B (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-C (20°,285HP) TSIO-520-C (20°,285HP) TSIO-520-CE (20°,325HP) TSIO-520-CE (20°,325HP) TSIO-520-D (20°,285HP) TSIO-520-D (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-E (20°,300HP) TSIO-520-E (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-G (22°,300HP) TSIO-520-G (22°,300HP) TSIO-520-H (20°,285HP) TSIO-520-H (20°,285HP) TSIO-520-J (20°,310HP) TSIO-520-J (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-K (20°,285HP) TSIO-520-K (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-L (20°,310HP) TSIO-520-L (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-M (22°,310HP) TSIO-520-M (22°,310HP) TSIO-520-N (20°,310HP) TSIO-520-N (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-P (22°,310HP)

M1878 M1978 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878

M2010 M2010

M2005 M2005

M2010

M2005

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

00

X X X X X X X X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

5-14

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine - Model (Degree°, HP)

TSIO-520-P (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-U (22°,300HP) TSIO-520-U (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-VB (20°,325HP) TSIO-520-VB (20°,325HP) TSIO-520-WB (20°,325HP) TSIO-520-WB (20°,325HP)

Complete Harness

LH Harness

RH Harness

M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978 M1878 M1978

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X X

M2010

M2005

X

Textron-Lycoming

Engine

00 00 00 -2 6-2 0 00 30 4 0 D S S 3 63 0 00 0; 0; 20; 20 12 ; 4 0; 0 2 1 0 0 0 0 0 0 S4 S6 S4 S6 D2 Notes 42 62 6

Complete Harness

LH Harness

RH Harness

AEIO-320-D1B (25°,160HP) AEIO-320-D1B (25°,160HP) AEIO-320-D1B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-E1A (25°,150HP) AEIO-320-E1A (25°,150HP) AEIO-320-E1A (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E2A (25°,150HP) AEIO-320-E2A (25°,150HP) AEIO-320-E2A (25°,150HP) AEIO-320-E2B (25°,150HP) AEIO-320-E2B (25°,150HP) AEIO-320-E2B (25°,150HP)

M4005 M2364 M2365 M4005 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365

M2981 M1980 M2017 M2981 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017

M2982 M1975 M2016 M2982 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016

X

AEIO-360-A1A (20°,200HP) AEIO-360-A1A (20°,200HP) AEIO-360-A1A (20°,200HP) AEIO-360-A1A (25°,200HP) AEIO-360-A1A (25°,200HP)

M4004 M2364 M2365 M4004 M2364

M2989 M1980 M2017 M2989 M1980

M2990 M1975 M2016 M2990 M1975

X

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X

2, 3 2, 3 2, 3 2, 3 2, 3

X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-15

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

Engine

S4

00

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

AEIO-360-A1A (25°,200HP) AEIO-360-A1B (20°,200HP) AEIO-360-A1B (20°,200HP) AEIO-360-A1B (20°,200HP) AEIO-360-A1B (25°,200HP) AEIO-360-A1B (25°,200HP) AEIO-360-A1B (25°,200HP) AEIO-360-A1B6 (20°,200HP) AEIO-360-A1B6 (20°,200HP) AEIO-360-A1B6 (20°,200HP) AEIO-360-A1B6 (25°,200HP) AEIO-360-A1B6 (25°,200HP) AEIO-360-A1B6 (25°,200HP) AEIO-360-A1C (20°,200HP) AEIO-360-A1C (25°,200HP) AEIO-360-A1D (20°,200HP) AEIO-360-A1D (20°,200HP) AEIO-360-A1D (20°,200HP) AEIO-360-A1D (25°,200HP) AEIO-360-A1D (25°,200HP) AEIO-360-A1D (25°,200HP) AEIO-360-A1E (20°,200HP) AEIO-360-A1E (20°,200HP) AEIO-360-A1E (20°,200HP) AEIO-360-A1E (25°,200HP) AEIO-360-A1E (25°,200HP) AEIO-360-A1E (25°,200HP) AEIO-360-A1E6 (20°,200HP) AEIO-360-A1E6 (25°,200HP) AEIO-360-A2A (20°,200HP) AEIO-360-A2A (25°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-A2B (25°,200HP) AEIO-360-A2B (25°,200HP) AEIO-360-A2B (25°,200HP) AEIO-360-A2C (20°,200HP) AEIO-360-A2C (25°,200HP) AEIO-360-B1B (25°,180HP) AEIO-360-B1B (25°,180HP) AEIO-360-B1B (25°,180HP) AEIO-360-B1D (25°,180HP) AEIO-360-B1F (25°,180HP) AEIO-360-B1F (25°,180HP) AEIO-360-B1F (25°,180HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2365 M4012 M2364 M2365 M4012 M2364 M2365 M4012 M2364 M2365 M4012 M2364 M2365 M4012 M4012 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M4004 M4004 M4004 M4001 M2364 M2365 M4001 M2364 M2365 M4012 M4012 M4004 M2364 M2365 M4004 M4005 M2364 M2365

M2017 M4019 M1980 M2017 M4019 M1980 M2017 M4019 M1980 M2017 M4019 M1980 M2017 M4019 M4019 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M2989 M2989 M2989 M1795 M1980 M2017 M1795 M1980 M2017 M4019 M4019 M2989 M1980 M2017 M2989 M2981 M1980 M2017

M2016 M4020 M1975 M2016 M4020 M1975 M2016 M4020 M1975 M2016 M4020 M1975 M2016 M4020 M4020 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M2990 M2990 M2990 M2992 M1975 M2016 M2992 M1975 M2016 M4020 M4020 M2990 M1975 M2016 M2990 M2982 M1975 M2016

00

S4

X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

5-16

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine

Complete Harness

LH Harness

RH Harness

AEIO-360-B1F6 (25°,180HP) AEIO-360-B1F6 (25°,180HP) AEIO-360-B1F6 (25°,180HP) AEIO-360-B1G6 (25°,180HP) AEIO-360-B1G6 (25°,180HP) AEIO-360-B1G6 (25°,180HP) AEIO-360-B2F (25°,180HP) AEIO-360-B2F (25°,180HP) AEIO-360-B2F (25°,180HP) AEIO-360-B2F6 (25°,180HP) AEIO-360-B4A (25°,180HP) AEIO-360-B4A (25°,180HP) AEIO-360-B4A (25°,180HP) AEIO-360-H1A (25°,180HP) AEIO-360-H1A (25°,180HP) AEIO-360-H1A (25°,180HP)

M4001 M2364 M2365 M4001 M2364 M2365 M4005 M2364 M2365 M4001 M4004 M2364 M2365 M4001 M2364 M2365

M1795 M1980 M2017 M1795 M1980 M2017 M2981 M1980 M2017 M1795 M2989 M1980 M2017 M1795 M1980 M2017

M2992 M1975 M2016 M2992 M1975 M2016 M2982 M1975 M2016 M2992 M2990 M1975 M2016 M2992 M1975 M2016

AEIO-540-D4A5 (25°,260HP) AEIO-540-D4A5 (25°,260HP) AEIO-540-D4A5 (25°,260HP) AEIO-540-D4A5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-D4C5 (25°,260HP) AEIO-540-D4D5 (25°,260HP) AEIO-540-L1B5 (20°,300HP)

M6014 M6030 M2121 M2154 M6000 M6030 M6001 M2121 M2154 M6000 M6014 M6001

M6027 M6023 M2123 M2155 M2961 M6023 M2959 M2123 M2155 M2961 M6027 M2959

M2956 M6024 M2122 M2156 M2962 M6024 M2960 M2122 M2156 M2962 M2956 M2960

AIO-320-A1B (25°,160HP) AIO-320-A1B (25°,160HP) AIO-320-A1B (25°,160HP) AIO-320-A2A (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-B1B (25°,160HP) AIO-320-B1B (25°,160HP) AIO-320-B1B (25°,160HP) AIO-320-C1B (25°,160HP)

M4005 M2364 M2365 M4007 M4001 M2364 M2365 M4005 M2364 M2365 M4005

M2981 M1980 M2017 M2977 M1795 M1980 M2017 M2981 M1980 M2017 M2981

M2982 M1975 M2016 M2976 M2992 M1975 M2016 M2982 M1975 M2016 M2982

AIO-360-A1A (20°,200HP) AIO-360-A1A (20°,200HP) AIO-360-A1A (25°,200HP) AIO-360-A1A (25°,200HP)

M2364 M2365 M2364 M2365

M1980 M2017 M1980 M2017

M1975 M2016 M1975 M2016

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X

2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

2, 3 2, 3 2, 3 2, 3

X X X

PAGE NO.

REVISION

5-17

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine

S4

00

Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

AIO-360-A1B (20°,200HP) AIO-360-A1B (20°,200HP) AIO-360-A1B (25°,200HP) AIO-360-A1B (25°,200HP) AIO-360-A2B (20°,200HP) AIO-360-A2B (20°,200HP) AIO-360-A2B (20°,200HP) AIO-360-A2B (25°,200HP) AIO-360-A2B (25°,200HP) AIO-360-A2B (25°,200HP) AIO-360-B1B (20°,200HP) AIO-360-B1B (25°,200HP)

M2364 M2365 M2364 M2365 M4001 M2364 M2365 M4001 M2364 M2365 M2365 M2365

M1980 M2017 M1980 M2017 M1795 M1980 M2017 M1795 M1980 M2017 M2017 M2017

M1975 M2016 M1975 M2016 M2992 M1975 M2016 M2992 M1975 M2016 M2016 M2016

GO-435-C2A (25°,260HP) GO-435-C2A2 (25°,260HP) GO-435-C2B (25°,260HP) GO-435-C2B1 (25°,260HP) GO-435-C2B2 (25°,260HP)

M2474 M2474 M2474 M2474 M2474

M2475 M2475 M2475 M2475 M2475

M2476 M2476 M2476 M2476 M2476

X X X X X

GO-480-B (25°,270HP) GO-480-B1A6 (25°,270HP) GO-480-B1C (25°,270HP) GO-480-B1D (25°,270HP) GO-480-C1D6 (25°,295HP) GO-480-D1A (25°,275HP) GO-480-G1A6 (25°,295HP) GO-480-G1B6 (25°,295HP) GO-480-G1D6 (25°,295HP) GO-480-G1J6 (25°,295HP) GO-480-G1J6 (25°,295HP)

M2474 M2474 M2474 M2474 M2474 M2854 M2474 M2854 M2474 M2736 M2742

M2475 M2475 M2475 M2475 M2475 M2855 M2475 M2855 M2475 M2737 M2743

M2476 M2476 M2476 M2476 M2476 M2476 M2476 M2476 M2476 M2738 M2744

X X X X X X X X X X

GSO-480-B1J6 (25°,340HP) GSO-480-B1J6 (25°,340HP)

M2748 M2745

M2749 M2746

M2750 M2747

X

HIO-360-A1A (25°,180HP) HIO-360-B1A (25°,180HP) HIO-360-C1A (25°,205HP) HIO-360-C1B (25°,205HP) HIO-360-D1A (20°,190HP) HIO-360-D1A (20°,190HP)

M2817 M2795 M2795 M2411 M4007 M2655

M2818 M2793 M2793 M2412 M2977 M2656

M2819 M2794 M2794 M2413 M2976 M2657

HO-360-A1A (25°,180HP) HO-360-B1A (25°,180HP) HO-360-B1B (25°,180HP) HO-360-C1A (25°,180HP)

M2364 M2364 M2364 M2364

M1980 M1980 M1980 M1980

M1975 M1975 M1975 M1975

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X

X

X X X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X X X X

2, 3 2, 3 2, 3 2, 3

PAGE NO.

REVISION

5-18

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Complete Harness

LH Harness

RH Harness

IGSO-480-A1A6 - 1/2" (25°,340HP) IGSO-480-A1A6 - 1/2" (25°,340HP) IGSO-480-A1A6 - 13/16" (25°,340HP) IGSO-480-A1A6 - 13/16" (25°,340HP) IGSO-480-A1B6 - 1/2" (25°,340HP) IGSO-480-A1B6 - 1/2" (25°,340HP) IGSO-480-A1B6 - 13/16" (25°,340HP) IGSO-480-A1B6 - 13/16" (25°,340HP) IGSO-480-A1E6 - 1/2" (25°,340HP) IGSO-480-A1E6 - 1/2" (25°,340HP) IGSO-480-A1E6 - 13/16" (25°,340HP) IGSO-480-A1E6 - 13/16" (25°,340HP)

M2244

M2246

M2245

M2277

M2279

M2278

M2244

M2246

M2245

M2277

M2279

M2278

M2244

M2246

M2245

M2277

M2279

M2278

M2244

M2246

M2245

M2277

M2279

M2278

M2244

M2246

M2245

M2277

M2279

M2278

M2244

M2246

M2245

M2277

M2279

M2278

X

IGSO-540-A1D (25°,380HP) IGSO-540-A1E (25°,380HP) IGSO-540-A1F (25°,380HP) IGSO-540-B1A (25°,380HP) IGSO-540-B1C (25°,380HP)

M2259 M2259 M2259 M2259 M2259

M2261 M2261 M2261 M2261 M2261

M2260 M2260 M2260 M2260 M2260

X X X X X

IO-320-A1A (25°,150HP) IO-320-A2A (25°,150HP) IO-320-B1A (25°,160HP) IO-320-B1A (25°,160HP) IO-320-B1A (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1C (25°,160HP) IO-320-B1C (25°,160HP) IO-320-B1C (25°,160HP) IO-320-B1D (25°,160HP) IO-320-B1D (25°,160HP) IO-320-B1D (25°,160HP) IO-320-B2A (25°,160HP)

M4000 M4000 M4000 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4007 M2364 M2365 M4004

M2975 M2975 M2975 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2977 M1980 M2017 M2989

M2976 M2976 M2976 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2976 M1975 M2016 M2990

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X X X

HARNESSES 5/8”

Engine

S4

00

X X X

X X X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-19

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine

Complete Harness

LH Harness

RH Harness

IO-320-B2A (25°,160HP) IO-320-B2A (25°,160HP) IO-320-C1A - 1/2" (25°,160HP) IO-320-C1A - 1/2" (25°,160HP) IO-320-C1A - 1/2" (25°,160HP) IO-320-C1A - 13/16" (25°,160HP) IO-320-C1A - 13/16" (25°,160HP) IO-320-C1A - 13/16" (25°,160HP) IO-320-D1A (25°,160HP) IO-320-D1A (25°,160HP) IO-320-D1A (25°,160HP) IO-320-D1B (25°,160HP) IO-320-D1B (25°,160HP) IO-320-D1B (25°,160HP) IO-320-E1A (25°,150HP) IO-320-E1A (25°,150HP) IO-320-E1A (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E2A (25°,150HP) IO-320-E2A (25°,150HP) IO-320-E2A (25°,150HP) IO-320-E2B (25°,150HP) IO-320-E2B (25°,150HP) IO-320-E2B (25°,150HP) IO-320-F1A (25°,160HP) IO-320-F1A (25°,160HP) IO-320-F1A (25°,160HP)

M2364 M2365 M4000 M2364 M2365 M4000

M1980 M2017 M2975 M1980 M2017 M2975

M1975 M2016 M2976 M1975 M2016 M2976

M2364

M1980

M1975

M2365

M2017

M2016

M4005 M2364 M2365 M4005 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4000 M2364 M2365

M2981 M1980 M2017 M2981 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2975 M1980 M2017

M2982 M1975 M2016 M2982 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2976 M1975 M2016

X

IO-360-A1A (20°,200HP) IO-360-A1A (20°,200HP) IO-360-A1A (20°,200HP) IO-360-A1A (25°,200HP) IO-360-A1A (25°,200HP) IO-360-A1A (25°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (25°,200HP)

M4004 M2402 M2365 M4004 M2402 M2365 M4012 M4004 M4006 M4007 M2364 M2365 M4012

M2989 M2403 M2017 M2989 M2403 M2017 M4019 M2989 M2983 M2977 M1980 M2017 M4019

M2990 M2404 M2016 M2990 M2404 M2016 M4020 M2990 M2984 M2976 M1975 M2016 M4020

X

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2

X X X X X X

2 X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-20

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

IO-360-A1B (25°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1C (20°,200HP) IO-360-A1C (20°,200HP) IO-360-A1C (20°,200HP) IO-360-A1C (25°,200HP) IO-360-A1C (25°,200HP) IO-360-A1C (25°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D (25°,200HP) IO-360-A1D (25°,200HP) IO-360-A1D (25°,200HP) IO-360-A1D (25°,200HP) IO-360-A1D6 (20°,200HP) IO-360-A1D6 (20°,200HP) IO-360-A1D6 (20°,200HP) IO-360-A1D6 (25°,200HP) IO-360-A2A (20°,200HP) IO-360-A2A (20°,200HP) IO-360-A2A (20°,200HP) IO-360-A2A (25°,200HP) IO-360-A2A (25°,200HP) IO-360-A2A (25°,200HP) IO-360-A2B (20°,200HP) IO-360-A2B (20°,200HP) IO-360-A2B (20°,200HP) IO-360-A2B (20°,200HP) IO-360-A2B (20°,200HP) IO-360-A2B (25°,200HP) IO-360-A2B (25°,200HP)

M4004 M4006 M4007 M2364 M2365 M4012 M4006 M4007 M2364 M2420 M4012 M4006 M4007 M2364 M2420 M4012 M2364 M2365 M4012 M2364 M2365 M4006 M4004 M2364 M2420 M4006 M4004 M2364 M2420 M4012 M2364 M2420 M4012 M4004 M2364 M2365 M4004 M2364 M2365 M4006 M4007 M4012 M2364 M2365 M4006 M4007

M2989 M2983 M2977 M1980 M2017 M4019 M2983 M2977 M1980 M2421 M4019 M2983 M2977 M1980 M2421 M4019 M1980 M2017 M4019 M1980 M2017 M2983 M2989 M1980 M2421 M2983 M2989 M1980 M2421 M4019 M1980 M2421 M4019 M2989 M1980 M2017 M2989 M1980 M2017 M2983 M2977 M4019 M1980 M2017 M2983 M2977

M2990 M2984 M2976 M1975 M2016 M4020 M2984 M2976 M1975 M2422 M4020 M2984 M2976 M1975 M2422 M4020 M1975 M2016 M4020 M1975 M2016 M2984 M2990 M1975 M2422 M2984 M2990 M1975 M2422 M4020 M1975 M2422 M4020 M2990 M1975 M2016 M2990 M1975 M2016 M2984 M2976 M4020 M1975 M2016 M2984 M2976

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-21

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

IO-360-A2B (25°,200HP) IO-360-A2B (25°,200HP) IO-360-A2B (25°,200HP) IO-360-A2C (20°,200HP) IO-360-A2C (20°,200HP) IO-360-A2C (20°,200HP) IO-360-A2C (25°,200HP) IO-360-A2C (25°,200HP) IO-360-A2C (25°,200HP) IO-360-A3B6 (20°,200HP) IO-360-A3B6 (25°,200HP) IO-360-B1A (25°,180HP) IO-360-B1A (25°,180HP) IO-360-B1B (25°,180HP) IO-360-B1B (25°,180HP) IO-360-B1B (25°,180HP) IO-360-B1C (25°,177HP) IO-360-B1C (25°,177HP) IO-360-B1D (25°,180HP) IO-360-B1D (25°,180HP) IO-360-B1D (25°,180HP) IO-360-B1E (25°,180HP) IO-360-B1E (25°,180HP) IO-360-B1E (25°,180HP) IO-360-B1F (25°,180HP) IO-360-B1F (25°,180HP) IO-360-B1F (25°,180HP) IO-360-B1F6 (25°,180HP) IO-360-B2E-nd (25°,180HP) IO-360-B2E-nd (25°,180HP) IO-360-B2E-nd (25°,180HP) IO-360-B2E-wd (25°,180HP) IO-360-B2E-wd (25°,180HP) IO-360-B2E-wd (25°,180HP) IO-360-B2F (25°,180HP) IO-360-B2F (25°,180HP) IO-360-B2F (25°,180HP) IO-360-B2F6 (25°,180HP) IO-360-B2F6 (25°,180HP) IO-360-B2F6 (25°,180HP) IO-360-B4A (25°,180HP) IO-360-B4A (25°,180HP) IO-360-B4A (25°,180HP) IO-360-B4A (25°,180HP) IO-360-C1A (20°,200HP) IO-360-C1A (20°,200HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M4012 M2364 M2365 M4012 M2364 M2365 M4012 M2364 M2365 M4006 M4006 M2364 M2365 M4004 M2364 M2365 M2364 M2365 M4004 M2364 M2365 M4006 M2364 M2423 M4005 M2364 M2365 M4001 M4006 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4006 M4004 M2364 M2365 M4004 M2364

M4019 M1980 M2017 M4019 M1980 M2017 M4019 M1980 M2017 M2983 M2983 M1980 M2017 M2989 M1980 M2017 M1980 M2017 M2989 M1980 M2017 M2983 M1980 M2424 M2981 M1980 M2017 M1795 M2983 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M2983 M2989 M1980 M2017 M2989 M1980

M4020 M1975 M2016 M4020 M1975 M2016 M4020 M1975 M2016 M2984 M2984 M1975 M2016 M2990 M1975 M2016 M1975 M2016 M2990 M1975 M2016 M2984 M1975 M2425 M2982 M1975 M2016 M2992 M2984 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2984 M2990 M1975 M2016 M2990 M1975

00

S4

X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-22

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

IO-360-C1A (20°,200HP) IO-360-C1A (25°,200HP) IO-360-C1A (25°,200HP) IO-360-C1A (25°,200HP) IO-360-C1B (20°,200HP) IO-360-C1B (20°,200HP) IO-360-C1B (20°,200HP) IO-360-C1B (25°,200HP) IO-360-C1B (25°,200HP) IO-360-C1B (25°,200HP) IO-360-C1C (20°,200HP) IO-360-C1C (20°,200HP) IO-360-C1C (20°,200HP) IO-360-C1C (20°,200HP) IO-360-C1C (25°,200HP) IO-360-C1C (25°,200HP) IO-360-C1C (25°,200HP) IO-360-C1C (25°,200HP) IO-360-C1C (25°,200HP) IO-360-C1C6 (20°,200HP) IO-360-C1C6 (20°,200HP) IO-360-C1C6 (20°,200HP) IO-360-C1C6 (25°,200HP) IO-360-C1C6 (25°,200HP) IO-360-C1C6 (25°,200HP) IO-360-C1D6 (20°,200HP) IO-360-C1D6 (20°,200HP) IO-360-C1D6 (20°,200HP) IO-360-C1D6 (25°,200HP) IO-360-C1D6 (25°,200HP) IO-360-C1D6 (25°,200HP) IO-360-C1E6 (20°,200HP) IO-360-C1E6 (20°,200HP) IO-360-C1E6 (20°,200HP) IO-360-C1E6 (25°,200HP) IO-360-C1E6 (25°,200HP) IO-360-C1E6 (25°,200HP) IO-360-C1F (20°,200HP) IO-360-C1F (20°,200HP) IO-360-C1F (20°,200HP) IO-360-C1F (25°,200HP) IO-360-C1F (25°,200HP) IO-360-C1F (25°,200HP) IO-360-D1A (20°,200HP) IO-360-D1A (20°,200HP) IO-360-D1A (20°,200HP)

M2365 M4004 M2364 M2365 M4012 M2364 M2365 M4012 M2364 M2365 M4027 M4013 M2658 M2423 M4027 M4007 M4013 M2658 M2423 M4027 M2364 M2423 M4027 M2364 M2423 M4012 M2364 M2365 M4012 M2364 M2365 M4027 M2658 M2423 M4027 M2658 M2423 M4007 M2658 M2423 M4007 M2658 M2423 M4007 M2364 M2365

M2017 M2989 M1980 M2017 M4019 M1980 M2017 M4019 M1980 M2017 M4021 M4009 M2659 M2424 M4021 M2977 M4009 M2659 M2424 M4021 M1980 M2424 M4021 M1980 M2424 M4019 M1980 M2017 M4019 M1980 M2017 M4021 M2659 M2424 M4021 M2659 M2424 M2977 M2659 M2424 M2977 M2659 M2424 M2977 M1980 M2017

M2016 M2990 M1975 M2016 M4020 M1975 M2016 M4020 M1975 M2016 M4022 M4010 M2660 M2425 M4022 M2976 M4010 M2660 M2425 M4022 M1975 M2425 M4022 M1975 M2425 M4020 M1975 M2016 M4020 M1975 M2016 M4022 M2660 M2425 M4022 M2660 M2425 M2976 M2660 M2425 M2976 M2660 M2425 M2976 M1975 M2016

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

5-23

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

IO-360-D1A (25°,200HP) IO-360-D1A (25°,200HP) IO-360-D1A (25°,200HP) IO-360-E1A (25°,180HP) IO-360-E1A (25°,180HP) IO-360-E1A (25°,180HP) IO-360-F1A (25°,180HP) IO-360-F1A (25°,180HP) IO-360-F1A (25°,180HP) IO-360-K2A (20°,200HP) IO-360-K2A (20°,200HP) IO-360-K2A (20°,200HP) IO-360-K2A (25°,200HP) IO-360-K2A (25°,200HP) IO-360-K2A (25°,200HP) IO-360-L2A (25°,160HP) IO-360-L2A (25°,180HP)

M4007 M2364 M2365 M4011 M2364 M2365 M4006 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4005 M4005

M2977 M1980 M2017 M1795 M1980 M2017 M2983 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2981 M2981

M2976 M1975 M2016 M2976 M1975 M2016 M2984 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2982 M2982

IO-540-A1A5 (20°,290HP) IO-540-A1A5 (20°,290HP) IO-540-A1A5 (20°,290HP) IO-540-AA1A5 (20°,270HP) IO-540-AA1A5 (20°,270HP) IO-540-AA1A5 (20°,270HP) IO-540-AA1B5 (20°,270HP) IO-540-AB1A5 (23°,230HP) IO-540-AC1A5 (20°,300HP) IO-540-B1A5 (20°,290HP) IO-540-B1A5 (20°,290HP) IO-540-B1A5 (20°,290HP) IO-540-B1B5 (20°,290HP) IO-540-B1C5 (20°,290HP) IO-540-B1C5 (20°,290HP) IO-540-B1C5 (20°,290HP) IO-540-C1B5 (25°,250HP) IO-540-C1B5 (25°,250HP) IO-540-C1B5 (25°,250HP) IO-540-C1B5 (25°,250HP) IO-540-C1C5 (25°,250HP) IO-540-C1C5 (25°,250HP) IO-540-C1C5 (25°,250HP) IO-540-C2C (25°,250HP) IO-540-C2C (25°,250HP) IO-540-C2C (25°,250HP) IO-540-C4B5 (25°,250HP) IO-540-C4B5 (25°,250HP)

M6032 M2121 M2154 M6014 M2121 M2154 M6014 M6014 M6000 M6032 M2121 M2154 M6032 M6032 M2121 M2154 M6002 M6014 M2121 M2154 M6002 M2121 M2154 M6002 M2121 M2154 M6002 M6014

M6029 M2123 M2155 M6027 M2123 M2155 M6027 M6027 M2961 M6029 M2123 M2155 M6029 M6029 M2123 M2155 M2877 M6027 M2123 M2155 M2877 M2123 M2155 M2877 M2123 M2155 M2877 M6027

M6028 M2122 M2156 M2956 M2122 M2156 M2956 M2956 M2962 M6028 M2122 M2156 M6028 M6028 M2122 M2156 M2878 M2956 M2122 M2156 M2878 M2122 M2156 M2878 M2122 M2156 M2878 M2956

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-24

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine - Model (Degree°, HP)

IO-540-C4B5 (25°,250HP) IO-540-C4B5 (25°,250HP) IO-540-C4C5 (25°,250HP) IO-540-C4D5 (25°,250HP) IO-540-D4A5 (25°,260HP) IO-540-D4A5 (25°,260HP) IO-540-D4A5 (25°,260HP) IO-540-D4B5 (25°,260HP) IO-540-D4B5 (25°,260HP) IO-540-D4B5 (25°,260HP) IO-540-D4C5 (25°,260HP) IO-540-D4C5 (25°,260HP) IO-540-D4C5 (25°,260HP) IO-540-E1A5 (20°,290HP) IO-540-E1A5 (20°,290HP) IO-540-E1A5 (20°,290HP) IO-540-E1A5 (20°,290HP) IO-540-E1B5 (20°,290HP) IO-540-E1B5 (20°,290HP) IO-540-E1B5 (20°,290HP) IO-540-E1C5 (20°,290HP) IO-540-G1A5 (20°,290HP) IO-540-G1A5 (20°,290HP) IO-540-G1A5 (20°,290HP) IO-540-G1A5 (20°,290HP) IO-540-G1B5 (20°,290HP) IO-540-G1B5 (20°,290HP) IO-540-G1B5 (20°,290HP) IO-540-G1B5 (20°,290HP) IO-540-G1C5 (20°,290HP) IO-540-G1C5 (20°,290HP) IO-540-G1D5 (20°,290HP) IO-540-G1D5 (20°,290HP) IO-540-G1D5 (20°,290HP) IO-540-G1D5 (20°,290HP) IO-540-G1E5 (20°,290HP) IO-540-G1E5 (20°,290HP) IO-540-G1E5 (20°,290HP) IO-540-G1E5 (20°,290HP) IO-540-G1E5 (20°,290HP) IO-540-G1F5 (20°,290HP) IO-540-G1F5 (20°,290HP) IO-540-G1F5 (20°,290HP) IO-540-G1F5 (20°,290HP) IO-540-J4A5 (25°,250HP) IO-540-J4A5 (25°,250HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2121 M2154 M6014 M6014 M6014 M2121 M2154 M6000 M2121 M2154 M6000 M2121 M2154 M6014 M6032 M2121 M2154 M6016 M2121 M2154 M6016 M6032 M2121 M2154 M2453 M6030 M2121 M2154 M2453 M6000 M2453 M6000 M2121 M2453 M2154 M6000 M2453 M6032 M2121 M2154 M6000 M2121 M2453 M2154 M6015 M2121

M2123 M2155 M6027 M6027 M6027 M2123 M2155 M2961 M2123 M2155 M2961 M2123 M2155 M6027 M6029 M2123 M2155 M6008 M2123 M2155 M6008 M6029 M2123 M2155 M2454 M6023 M2123 M2155 M2454 M2961 M2454 M2961 M2123 M2454 M2155 M2961 M2454 M6029 M2123 M2155 M2961 M2123 M2454 M2155 M6006 M2123

M2122 M2156 M2956 M2956 M2956 M2122 M2156 M2962 M2122 M2156 M2962 M2122 M2156 M2956 M6028 M2122 M2156 M6009 M2122 M2156 M6009 M6028 M2122 M2156 M2455 M6024 M2122 M2156 M2455 M2962 M2455 M2962 M2122 M2455 M2156 M2962 M2455 M6028 M2122 M2156 M2962 M2122 M2455 M2156 M6007 M2122

X X X X X X X X X X X X X X X

HARNESSES 5/8”

Engine

S4

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-25

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

IO-540-J4A5 (25°,250HP) IO-540-J4A5 (25°,250HP) IO-540-K1A5 (20°,300HP) IO-540-K1A5 (20°,300HP) IO-540-K1A5 (20°,300HP) IO-540-K1A5 (20°,300HP) IO-540-K1A5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1C5 (20°,300HP) IO-540-K1C5 (20°,300HP) IO-540-K1C5 (20°,300HP) IO-540-K1C5 (20°,300HP) IO-540-K1D5 (20°,300HP) IO-540-K1D5 (20°,300HP) IO-540-K1D5 (20°,300HP) IO-540-K1E5 (20°,300HP) IO-540-K1E5 (20°,300HP) IO-540-K1E5 (20°,300HP) IO-540-K1E5 (20°,300HP) IO-540-K1F5 (20°,300HP) IO-540-K1F5 (20°,300HP) IO-540-K1F5 (20°,300HP) IO-540-K1F5 (20°,300HP) IO-540-K1G5 (20°,300HP) IO-540-K1G5 (20°,300HP) IO-540-K1G5 (20°,300HP) IO-540-K1G5 (20°,300HP) IO-540-K1H5 (20°,300HP) IO-540-K1H5 (20°,300HP) IO-540-K1H5 (20°,300HP) IO-540-K1H5 (20°,300HP) IO-540-K1J5 (20°,300HP) IO-540-K1J5 (20°,300HP) IO-540-K1J5 (20°,300HP) IO-540-K1J5 (20°,300HP) IO-540-K1K5 (20°,300HP) IO-540-K1K5 (20°,300HP) IO-540-K1K5 (20°,300HP) IO-540-K1K5 (20°,300HP) IO-540-K2A5 (20°,300HP) IO-540-L1A5 (20°,300HP) IO-540-L1A5 (20°,300HP)

M2453 M2154 M6000 M2453 M6001 M2121 M2154 M6000 M6030 M2121 M2453 M2154 M6000 M2121 M2453 M2154 M6032 M2121 M2154 M6000 M2121 M2453 M2154 M6030 M2121 M2453 M2154 M6001 M2121 M2453 M2154 M6001 M2121 M2453 M2154 M6030 M2121 M2453 M2154 M6001 M2121 M2453 M2154 M2453 M6000 M2121

M2454 M2155 M2961 M2454 M2959 M2123 M2155 M2961 M6023 M2123 M2454 M2155 M2961 M2123 M2454 M2155 M6029 M2123 M2155 M2961 M2123 M2454 M2155 M6023 M2123 M2454 M2155 M2959 M2123 M2454 M2155 M2959 M2123 M2454 M2155 M6023 M2123 M2454 M2155 M2959 M2123 M2454 M2155 M2454 M2961 M2123

M2455 M2156 M2962 M2455 M2960 M2122 M2156 M2962 M6024 M2122 M2455 M2156 M2962 M2122 M2455 M2156 M6028 M2122 M2156 M2962 M2122 M2455 M2156 M6024 M2122 M2455 M2156 M2960 M2122 M2455 M2156 M2960 M2122 M2455 M2156 M6024 M2122 M2455 M2156 M2960 M2122 M2455 M2156 M2455 M2962 M2122

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-26

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Complete Harness

LH Harness

RH Harness

IO-540-L1A5 (20°,300HP) IO-540-L1A5 (20°,300HP) IO-540-L1C5 (20°,300HP) IO-540-L1C5 (20°,300HP) IO-540-L1C5 (20°,300HP) IO-540-L1C5 (20°,300HP) IO-540-M1A5 (20°,300HP) IO-540-M1A5 (20°,300HP) IO-540-M1A5 (20°,300HP) IO-540-M1C5 (20°,300HP) IO-540-N1A5 (25°,260HP) IO-540-N1A5 (25°,260HP) IO-540-N1A5 (25°,260HP) IO-540-P1A5 (20°,290HP) IO-540-P1A5 (20°,290HP) IO-540-P1A5 (20°,290HP) IO-540-R1A5 (25°,260HP) IO-540-R1A5 (25°,260HP) IO-540-R1A5 (25°,260HP) IO-540-R1A5 (25°,260HP) IO-540-S1A5 (20°,300HP) IO-540-S1A5 (20°,300HP) IO-540-S1A5 (20°,300HP) IO-540-T4B5 (25°,260HP) IO-540-W1A5 (23°,235HP)

M2453 M2154 M6001 M2121 M2453 M2154 M6030 M2121 M2154 M6030 M6002 M6030 M2121 M6002 M2121 M2154 M6002 M6030 M2121 M2154 M6031 M2121 M2154 M6000 M6002

M2454 M2155 M2959 M2123 M2454 M2155 M6023 M2123 M2155 M6023 M2877 M6023 M2123 M2877 M2123 M2155 M2877 M6023 M2123 M2155 M6025 M2123 M2155 M2961 M2877

M2455 M2156 M2960 M2122 M2455 M2156 M6024 M2122 M2156 M6024 M2878 M6024 M2122 M2878 M2122 M2156 M2878 M6024 M2122 M2156 M6026 M2122 M2156 M2962 M2878

IVO-360-A1A (25°,180HP)

M2364

M1980

M1975

LIO-320-B1A (25°,160HP) LIO-320-B1A (25°,160HP) LIO-320-B1A (25°,160HP) LIO-320-C1A (25°,160HP) LIO-320-C1A (25°,160HP) LIO-320-C1A (25°,160HP)

M4000 M2112 M2365 M4000 M2112 M2365

M2975 M1870 M2017 M2975 M1870 M2017

M2976 M1871 M2016 M2976 M1871 M2016

X

LIO-360-C1E6 (20°,200HP) LIO-360-C1E6 (20°,200HP) LIO-360-C1E6 (20°,200HP) LIO-360-C1E6 (25°,200HP) LIO-360-C1E6 (25°,200HP) LIO-360-C1E6 (25°,200HP)

M4027 M2658 M2423 M4027 M2658 M2423

M4021 M2659 M2424 M4021 M2659 M2424

M4022 M2660 M2425 M4022 M2660 M2425

X

O-235-C1 (25°,115HP) O-235-C1 (25°,115HP) O-235-C1 (25°,115HP) O-235-C1B (25°,115HP)

M4004 M2364 M2365 M4004

M2989 M1980 M2017 M2989

M2990 M1975 M2016 M2990

X

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X X X X X X X X X X

HARNESSES 5/8”

Engine

S4

00

X X X X X X X X X X X

2, 3 2 2 2 2 2 2

X X X X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X

2 2 2 2

X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-27

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-235-C1B (25°,115HP) O-235-C1B (25°,115HP) O-235-C1C (25°,115HP) O-235-C1C (25°,115HP) O-235-C1C (25°,115HP) O-235-C2A (25°,115HP) O-235-C2A (25°,115HP) O-235-C2A (25°,115HP) O-235-C2B (25°,115HP) O-235-C2B (25°,115HP) O-235-C2B (25°,115HP) O-235-C2C (25°,115HP) O-235-C2C (25°,115HP) O-235-C2C (25°,115HP) O-235-E1 (25°,115HP) O-235-E1 (25°,115HP) O-235-E1 (25°,115HP) O-235-E2A (25°,115HP) O-235-E2A (25°,115HP) O-235-E2A (25°,115HP) O-235-E2B (25°,115HP) O-235-E2B (25°,115HP) O-235-E2B (25°,115HP) O-235-F1 (25°,125HP) O-235-F1 (25°,125HP) O-235-F1 (25°,125HP) O-235-F1B (25°,125HP) O-235-F1B (25°,125HP) O-235-F1B (25°,125HP) O-235-F2A (25°,125HP) O-235-F2A (25°,125HP) O-235-F2A (25°,125HP) O-235-F2B (25°,125HP) O-235-F2B (25°,125HP) O-235-F2B (25°,125HP) O-235-G1 (25°,125HP) O-235-G1 (25°,125HP) O-235-G1 (25°,125HP) O-235-G2A (25°,125HP) O-235-G2A (25°,125HP) O-235-G2A (25°,125HP) O-235-G2B (25°,125HP) O-235-G2B (25°,125HP) O-235-G2B (25°,125HP) O-235-H2C (25°,115HP) O-235-H2C (25°,115HP)

M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4005 M2364 M2365 M4001 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4005 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4001 M2364

M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2981 M1980 M2017 M1795 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2981 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M1795 M1980

M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2982 M1975 M2016 M2992 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2982 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2992 M1975

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-28

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-235-H2C (25°,115HP) O-235-J2A (25°,125HP) O-235-J2A (25°,125HP) O-235-J2A (25°,125HP) O-235-J2B (25°,125HP) O-235-J2B (25°,125HP) O-235-J2B (25°,125HP) O-235-K2A (20°,118HP) O-235-K2A (20°,118HP) O-235-K2A (20°,118HP) O-235-K2B (20°,118HP) O-235-K2B (20°,118HP) O-235-K2B (20°,118HP) O-235-K2C (20°,118HP) O-235-K2C (20°,118HP) O-235-K2C (20°,118HP) O-235-L2A (20°,118HP) O-235-L2A (20°,118HP) O-235-L2A (20°,118HP) O-235-L2C (20°,118HP) O-235-L2C (20°,118HP) O-235-L2C (20°,118HP) O-235-M1 (20°,118HP) O-235-M1 (20°,118HP) O-235-M1 (20°,118HP) O-235-M2C (20°,118HP) O-235-M2C (20°,118HP) O-235-M2C (20°,118HP) O-235-N2A (20°,116HP) O-235-N2A (20°,116HP) O-235-N2A (20°,116HP) O-235-N2C (20°,116HP) O-235-N2C (20°,116HP) O-235-N2C (20°,116HP) O-235-P1 (20°,116HP) O-235-P1 (20°,116HP) O-235-P1 (20°,116HP) O-235-P2A (20°,116HP) O-235-P2A (20°,116HP) O-235-P2A (20°,116HP)

M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4005 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365

M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2981 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017

M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2982 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016

O-290-D (20°,125HP) O-290-D2 (18°,135HP) O-290-D2A (18°,135HP) O-290-D2B (25°,135HP) O-290-D2C (25°,135HP)

M4004 M4004 M2364 M2364 M2364

M2989 M2989 M1980 M1980 M1980

M2990 M2990 M1975 M1975 M1975

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2 2 2 2 2

X X X

PAGE NO.

REVISION

5-29

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-320-A1A (25°,150HP) O-320-A1A (25°,150HP) O-320-A1A (25°,150HP) O-320-A1B (25°,150HP) O-320-A1B (25°,150HP) O-320-A1B (25°,150HP) O-320-A2A (25°,150HP) O-320-A2A (25°,150HP) O-320-A2A (25°,150HP) O-320-A2B (25°,150HP) O-320-A2B (25°,150HP) O-320-A2C (25°,150HP) O-320-A2C (25°,150HP) O-320-A2C (25°,150HP) O-320-A2D (25°,150HP) O-320-A2D (25°,150HP) O-320-A2D (25°,150HP) O-320-A3A (25°,150HP) O-320-A3A (25°,150HP) O-320-A3A (25°,150HP) O-320-A3B (25°,150HP) O-320-A3B (25°,150HP) O-320-A3B (25°,150HP) O-320-A3C (25°,150HP) O-320-A3C (25°,150HP) O-320-A3C (25°,150HP) O-320-B1A (25°,160HP) O-320-B1A (25°,160HP) O-320-B1A (25°,160HP) O-320-B1B (25°,160HP) O-320-B1B (25°,160HP) O-320-B2A (25°,160HP) O-320-B2A (25°,160HP) O-320-B2A (25°,160HP) O-320-B2B (25°,160HP) O-320-B2B (25°,160HP) O-320-B2B (25°,160HP) O-320-B2C (25°,160HP) O-320-B2C (25°,160HP) O-320-B2D (25°,160HP) O-320-B3A (25°,160HP) O-320-B3A (25°,160HP) O-320-B3A (25°,160HP) O-320-B3B (25°,160HP) O-320-B3B (25°,160HP) O-320-B3B (25°,160HP)

M4001 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2402 M4004 M2402 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2402 M2365 M4004 M2364 M2365 M4004 M2364 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2402 M4004 M4004 M2364 M2365 M4004 M2364 M2365

M1795 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M2403 M2989 M2403 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M2403 M2017 M2989 M1980 M2017 M2989 M1980 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M2403 M2989 M2989 M1980 M2017 M2989 M1980 M2017

M2992 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M2404 M2990 M2404 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M2404 M2016 M2990 M1975 M2016 M2990 M1975 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M2404 M2990 M2990 M1975 M2016 M2990 M1975 M2016

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

5-30

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-320-B3C (25°,160HP) O-320-B3C (25°,160HP) O-320-B3C (25°,160HP) O-320-C1A (25°,150HP) O-320-C1A (25°,150HP) O-320-C1A (25°,150HP) O-320-C1B (25°,150HP) O-320-C1B (25°,150HP) O-320-C1B (25°,150HP) O-320-C2A (25°,150HP) O-320-C2A (25°,150HP) O-320-C2A (25°,150HP) O-320-C2B (25°,150HP) O-320-C2B (25°,150HP) O-320-C2B (25°,150HP) O-320-C2C (25°,150HP) O-320-C2C (25°,150HP) O-320-C2C (25°,150HP) O-320-C3A (25°,150HP) O-320-C3A (25°,150HP) O-320-C3A (25°,150HP) O-320-C3B (25°,150HP) O-320-C3B (25°,150HP) O-320-C3B (25°,150HP) O-320-C3C (25°,150HP) O-320-C3C (25°,150HP) O-320-C3C (25°,150HP) O-320-D1A (25°,150HP) O-320-D1A (25°,150HP) O-320-D1A (25°,150HP) O-320-D1A (25°,160HP) O-320-D1A (25°,160HP) O-320-D1A (25°,160HP) O-320-D1B (25°,150HP) O-320-D1B (25°,150HP) O-320-D1B (25°,160HP) O-320-D1B (25°,160HP) O-320-D1C (25°,150HP) O-320-D1C (25°,150HP) O-320-D1C (25°,150HP) O-320-D1C (25°,160HP) O-320-D1C (25°,160HP) O-320-D1C (25°,160HP) O-320-D1D (25°,150HP) O-320-D1D (25°,150HP) O-320-D1D (25°,150HP)

M4004 M2402 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M2364 M2365 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4001 M2364 M2365

M2989 M2403 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M1980 M2017 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M1795 M1980 M2017

M2990 M2404 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M1975 M2016 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2992 M1975 M2016

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

5-31

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

M4001 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4001 M2364 M2365 M4001 M2364 M2365 M4001 M2364 M2365 M4001 M2364

M1795 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M1795 M1980 M2017 M1795 M1980 M2017 M1795 M1980 M2017 M1795 M1980

M2992 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2992 M1975 M2016 M2992 M1975 M2016 M2992 M1975 M2016 M2992 M1975

00

S4

O-320-D2C (25 O-320-D1D (25°,160HP) O-320-D1D (25°,160HP) O-320-D1D (25°,160HP) O-320-D1F (25°,150HP) O-320-D1F (25°,150HP) O-320-D1F (25°,150HP) O-320-D1F (25°,160HP) O-320-D1F (25°,160HP) O-320-D1F (25°,160HP) O-320-D2A (25°,150HP) O-320-D2A (25°,150HP) O-320-D2A (25°,150HP) O-320-D2A (25°,160HP) O-320-D2A (25°,160HP) O-320-D2A (25°,160HP) O-320-D2B (25°,150HP) O-320-D2B (25°,150HP) O-320-D2B (25°,150HP) O-320-D2B (25°,160HP) O-320-D2B (25°,160HP) O-320-D2B (25°,160HP) O-320-D2C (25°,150HP) O-320-D2C (25°,150HP) O-320-D2C (25°,150HP) O-320-D2C (25°,160HP) O-320-D2C (25°,160HP) O-320-D2C (25°,160HP) O-320-D2F (25°,150HP) O-320-D2F (25°,150HP) O-320-D2F (25°,150HP) O-320-D2F (25°,160HP) O-320-D2F (25°,160HP) O-320-D2F (25°,160HP) O-320-D2G (25°,150HP) O-320-D2G (25°,150HP) O-320-D2G (25°,150HP) O-320-D2G (25°,160HP) O-320-D2G (25°,160HP) O-320-D2G (25°,160HP) O-320-D2H (25°,150HP) O-320-D2H (25°,150HP) O-320-D2H (25°,150HP) O-320-D2H (25°,160HP) O-320-D2H (25°,160HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-32

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-320-D2H (25°,160HP) O-320-D2J (25°,150HP) O-320-D2J (25°,150HP) O-320-D2J (25°,150HP) O-320-D2J (25°,160HP) O-320-D2J (25°,160HP) O-320-D2J (25°,160HP) O-320-D3G (25°,150HP) O-320-D3G (25°,150HP) O-320-D3G (25°,150HP) O-320-D3G (25°,160HP) O-320-D3G (25°,160HP) O-320-D3G (25°,160HP) O-320-E1A (25°,150HP) O-320-E1A (25°,150HP) O-320-E1A (25°,150HP) O-320-E1B (25°,150HP) O-320-E1B (25°,150HP) O-320-E1C (25°,150HP) O-320-E1C (25°,150HP) O-320-E1C (25°,150HP) O-320-E1F (25°,150HP) O-320-E1F (25°,150HP) O-320-E1F (25°,150HP) O-320-E1J (25°,150HP) O-320-E1J (25°,150HP) O-320-E1J (25°,150HP) O-320-E2A (25°,140HP) O-320-E2A (25°,140HP) O-320-E2A (25°,140HP) O-320-E2A (25°,150HP) O-320-E2A (25°,150HP) O-320-E2A (25°,150HP) O-320-E2B (25°,150HP) O-320-E2B (25°,150HP) O-320-E2B (25°,150HP) O-320-E2C (25°,140HP) O-320-E2C (25°,140HP) O-320-E2C (25°,140HP) O-320-E2C (25°,150HP) O-320-E2C (25°,150HP) O-320-E2C (25°,150HP) O-320-E2D (25°,150HP) O-320-E2D (25°,150HP) O-320-E2D (25°,150HP) O-320-E2F (25°,150HP)

M2365 M4002 M2364 M2365 M4002 M2364 M2365 M4001 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M2364 M2365 M4005 M2364 M2365 M4005 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4007 M2364 M2365 M4007 M2364 M2365 M4001 M2364 M2365 M4005

M2017 M2513 M1980 M2017 M2513 M1980 M2017 M1795 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M1980 M2017 M2981 M1980 M2017 M2981 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M2977 M1980 M2017 M2977 M1980 M2017 M1795 M1980 M2017 M2981

M2016 M2512 M1975 M2016 M2512 M1975 M2016 M2992 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M1975 M2016 M2982 M1975 M2016 M2982 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2976 M1975 M2016 M2976 M1975 M2016 M2992 M1975 M2016 M2982

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-33

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-320-E2F (25°,150HP) O-320-E2F (25°,150HP) O-320-E2G (25°,150HP) O-320-E2G (25°,150HP) O-320-E2G (25°,150HP) O-320-E2H (25°,150HP) O-320-E2H (25°,150HP) O-320-E2H (25°,150HP) O-320-E3D (25°,150HP) O-320-E3D (25°,150HP) O-320-E3D (25°,150HP) O-320-E3H (25°,150HP) O-320-E3H (25°,150HP) O-320-E3H (25°,150HP)

M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4005 M2364 M2365

M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2981 M1980 M2017

M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2982 M1975 M2016

O-340-A1A (25°,170HP) O-340-A2A (25°,170HP)

M2364 M2364

M1980 M1980

M1975 M1975

O-360-A1A-nd (25°,180HP) O-360-A1A-nd (25°,180HP) O-360-A1A-nd (25°,180HP) O-360-A1A-wd (25°,180HP) O-360-A1A-wd (25°,180HP) O-360-A1A-wd (25°,180HP) O-360-A1C (25°,180HP) O-360-A1C (25°,180HP) O-360-A1D (25°,180HP) O-360-A1D (25°,180HP) O-360-A1D (25°,180HP) O-360-A1D (25°,180HP) O-360-A1F (25°,180HP) O-360-A1F (25°,180HP) O-360-A1F (25°,180HP) O-360-A1F6 (25°,180HP) O-360-A1F6 (25°,180HP) O-360-A1G (25°,180HP) O-360-A1G (25°,180HP) O-360-A1G (25°,180HP) O-360-A1G6 (25°,180HP) O-360-A1G6 (25°,180HP) O-360-A1G6 (25°,180HP) O-360-A1H (25°,180HP) O-360-A1H (25°,180HP) O-360-A1H (25°,180HP) O-360-A1H6 (25°,180HP) O-360-A1P (25°,180HP)

M4006 M2364 M2365 M4004 M2364 M2365 M2364 M2365 M4004 M4014 M2364 M2365 M4005 M2364 M2365 M4005 M2814 M4005 M2364 M2365 M4005 M2364 M2365 M4004 M2364 M2365 M4001 M4004

M2983 M1980 M2017 M2989 M1980 M2017 M1980 M2017 M2989 M2975 M1980 M2017 M2981 M1980 M2017 M2981 M2815 M2981 M1980 M2017 M2981 M1980 M2017 M2989 M1980 M2017 M1795 M2989

M2984 M1975 M2016 M2990 M1975 M2016 M1975 M2016 M2990 M4010 M1975 M2016 M2982 M1975 M2016 M2982 M2816 M2982 M1975 M2016 M2982 M1975 M2016 M2990 M1975 M2016 M2992 M2990

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X

2 2

X

2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

5-34

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-360-A2A (25°,180HP) O-360-A2A (25°,180HP) O-360-A2A (25°,180HP) O-360-A2D (25°,180HP) O-360-A2D (25°,180HP) O-360-A2D (25°,180HP) O-360-A2E (25°,180HP) O-360-A2F (25°,180HP) O-360-A2F (25°,180HP) O-360-A2F (25°,180HP) O-360-A2G (25°,180HP) O-360-A2G (25°,180HP) O-360-A2G (25°,180HP) O-360-A2H (25°,180HP) O-360-A2H (25°,180HP) O-360-A2H (25°,180HP) O-360-A3A (25°,180HP) O-360-A3A (25°,180HP) O-360-A3A (25°,180HP) O-360-A3D (25°,180HP) O-360-A4A (25°,180HP) O-360-A4A (25°,180HP) O-360-A4A (25°,180HP) O-360-A4D (25°,180HP) O-360-A4G (25°,180HP) O-360-A4G (25°,180HP) O-360-A4G (25°,180HP) O-360-A4J (25°,180HP) O-360-A4J (25°,180HP) O-360-A4J (25°,180HP) O-360-A4K (25°,180HP) O-360-A4K (25°,180HP) O-360-A4K (25°,180HP) O-360-A4M (25°,180HP) O-360-A4M (25°,180HP) O-360-A4M (25°,180HP) O-360-A4N (25°,180HP) O-360-A4N (25°,180HP) O-360-A4N (25°,180HP) O-360-A4P (25°,180HP) O-360-B1A (25°,168HP) O-360-B1A (25°,168HP) O-360-B1A (25°,168HP) O-360-B1B (25°,168HP) O-360-B2A (25°,168HP) O-360-B2A (25°,168HP)

M4004 M2364 M2365 M4004 M2364 M2365 M4004 M4005 M2364 M2365 M4006 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4004 M4004 M2364 M2365 M4004 M4006 M2364 M2365 M4004 M2450 M2420 M4001 M2364 M2365 M4001 M2364 M2365 M4002 M2364 M2365 M4001 M4001 M2364 M2365 M4001 M4004 M2364

M2989 M1980 M2017 M2989 M1980 M2017 M2989 M2981 M1980 M2017 M2983 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2989 M2989 M1980 M2017 M2989 M2983 M1980 M2017 M2989 M2451 M2421 M1795 M1980 M2017 M1795 M1980 M2017 M2513 M1980 M2017 M1795 M1795 M1980 M2017 M1795 M2989 M1980

M2990 M1975 M2016 M2990 M1975 M2016 M2990 M2982 M1975 M2016 M2984 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2990 M2990 M1975 M2016 M2990 M2984 M1975 M2016 M2990 M2452 M2422 M2992 M1975 M2016 M2992 M1975 M2016 M2512 M1975 M2016 M2992 M2992 M1975 M2016 M2992 M2990 M1975

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-35

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 5/8”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-360-B2A (25°,168HP) O-360-B2B (25°,168HP) O-360-B2C (25°,168HP) O-360-C1A (25°,180HP) O-360-C1A (25°,180HP) O-360-C1A (25°,180HP) O-360-C1C (25°,180HP) O-360-C1C (25°,180HP) O-360-C1C (25°,180HP) O-360-C1E (25°,180HP) O-360-C1E (25°,180HP) O-360-C1E (25°,180HP) O-360-C1F (25°,180HP) O-360-C1F (25°,180HP) O-360-C1F (25°,180HP) O-360-C1G (25°,180HP) O-360-C1G (25°,180HP) O-360-C1G (25°,180HP) O-360-C2A (25°,180HP) O-360-C2A (25°,180HP) O-360-C2A (25°,180HP) O-360-C2B (25°,180HP) O-360-C2B (25°,180HP) O-360-C2B (25°,180HP) O-360-C2C (25°,180HP) O-360-C2C (25°,180HP) O-360-C2C (25°,180HP) O-360-C2D (25°,180HP) O-360-C2E (25°,180HP) O-360-C2E (25°,180HP) O-360-C2E (25°,180HP) O-360-C4F (25°,180HP) O-360-C4P (25°,180HP) O-360-D1A (25°,168HP) O-360-D1A (25°,168HP) O-360-D1A (25°,168HP) O-360-D2A (25°,168HP) O-360-D2A (25°,168HP) O-360-D2A (25°,168HP) O-360-D2B (25°,168HP) O-360-F1A6 (25°,180HP) O-360-F1A6 (25°,180HP) O-360-F1A6 (25°,180HP) O-360-G1A6 (25°,180HP) O-360-G1A6 (25°,180HP) O-360-G1A6 (25°,180HP)

M2365 M4001 M2402 M4004 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4004 M2364 M2365 M4001 M2364 M2365 M4004 M2364 M2365 M4001 M4001 M2364 M2365 M4001 M4001 M4001 M2364 M2365 M4004 M2364 M2365 M2364 M4002 M2364 M2365 M4002 M2364 M2365

M2017 M1795 M2403 M2989 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M2989 M1980 M2017 M1795 M1980 M2017 M2989 M1980 M2017 M1795 M1795 M1980 M2017 M1795 M1795 M1795 M1980 M2017 M2989 M1980 M2017 M1980 M2513 M1980 M2017 M2513 M1980 M2017

M2016 M2992 M2404 M2990 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2990 M1975 M2016 M2992 M1975 M2016 M2990 M1975 M2016 M2992 M2992 M1975 M2016 M2992 M2992 M2992 M1975 M2016 M2990 M1975 M2016 M1975 M2512 M1975 M2016 M2512 M1975 M2016

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

5-36

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Complete Harness

LH Harness

RH Harness

O-360-J2A (25°,145HP)

M2402

M2403

M2404

O-540-A1A (25°,250HP) O-540-A1A (25°,250HP) O-540-A1A5 (25°,250HP) O-540-A1A5 (25°,250HP) O-540-A1A5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1C5 (25°,250HP) O-540-A1C5 (25°,250HP) O-540-A1C5 (25°,250HP) O-540-A1D (25°,250HP) O-540-A1D (25°,250HP) O-540-A1D (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A2B (25°,250HP) O-540-A2B (25°,250HP) O-540-A2B (25°,250HP) O-540-A3D5 (25°,250HP) O-540-A3D5 (25°,250HP) O-540-A3D5 (25°,250HP) O-540-A4A5 (25°,250HP) O-540-A4A5 (25°,250HP) O-540-A4A5 (25°,250HP) O-540-A4B5 (25°,250HP) O-540-A4B5 (25°,250HP) O-540-A4B5 (25°,250HP) O-540-A4C5 (25°,250HP) O-540-A4D5 (25°,250HP) O-540-A4D5 (25°,250HP) O-540-A4D5 (25°,250HP) O-540-B1A5 (25°,235HP) O-540-B1A5 (25°,235HP) O-540-B1A5 (25°,235HP) O-540-B1B5 (25°,235HP) O-540-B1B5 (25°,235HP) O-540-B1D5 (25°,235HP) O-540-B2A5 (25°,235HP) O-540-B2A5 (25°,235HP)

M6002 M2121 M6002 M2121 M2154 M6002 M6014 M2121 M2154 M6002 M2121 M2154 M6014 M2121 M2154 M6014 M6031 M6002 M2121 M2154 M6002 M2121 M2154 M6002 M2121 M2154 M6002 M2121 M2154 M6002 M2121 M2154 M6002 M6014 M2121 M2154 M6014 M2121 M2154 M2121 M2154 M6014 M6014 M2121

M2877 M2123 M2877 M2123 M2155 M2877 M6027 M2123 M2155 M2877 M2123 M2155 M6027 M2123 M2155 M6027 M6025 M2877 M2123 M2155 M2877 M2123 M2155 M2877 M2123 M2155 M2877 M2123 M2155 M2877 M2123 M2155 M2877 M6027 M2123 M2155 M6027 M2123 M2155 M2123 M2155 M6027 M6027 M2123

M2878 M2122 M2878 M2122 M2156 M2878 M2956 M2122 M2156 M2878 M2122 M2156 M2956 M2122 M2156 M2956 M6026 M2878 M2122 M2156 M2878 M2122 M2156 M2878 M2122 M2156 M2878 M2122 M2156 M2878 M2122 M2156 M2878 M2956 M2122 M2156 M2956 M2122 M2156 M2122 M2156 M2956 M2956 M2122

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X

2, 3

X X X X X X X X X X X X X

HARNESSES 5/8”

Engine

S4

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-37

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

O-540-B2A5 (25°,235HP) O-540-B2B5 (25°,235HP) O-540-B2B5 (25°,235HP) O-540-B2B5 (25°,235HP) O-540-B2B5-wd (25°,235HP) O-540-B2B5-wd (25°,235HP) O-540-B2B5-wd (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5-wd (25°,235HP) O-540-B2C5-wd (25°,235HP) O-540-B2C5-wd (25°,235HP) O-540-B4A5 (25°,235HP) O-540-B4A5 (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5-wd (25°,235HP) O-540-B4B5-wd (25°,235HP) O-540-B4B5-wd (25°,235HP) O-540-D1A5 (25°,250HP) O-540-D1A5 (25°,250HP) O-540-D1A5 (25°,250HP) O-540-D1A5 (25°,250HP) O-540-E4A5 (25°,260HP) O-540-E4A5 (25°,260HP) O-540-E4A5 (25°,260HP) O-540-E4A5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4C5 (25°,260HP) O-540-E4C5 (25°,260HP) O-540-E4C5 (25°,260HP) O-540-F1A5 (25°,260HP) O-540-F1B5 (25°,260HP) O-540-F1B5 (25°,260HP) O-540-F1B5 (25°,260HP) O-540-G1A5 (25°,260HP) O-540-G1A5 (25°,260HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2154 M6002 M2121 M2154 M6004 M2121 M2154 M6000 M2883 M2121 M2456 M2154 M6001 M2121 M2154 M2121 M2154 M6004 M2121 M2154 M6004 M2121 M2154 M6014 M6002 M2121 M2154 M6014 M6002 M2121 M2154 M6002 M2121 M2154 M6004 M2121 M2154 M6000 M2121 M2154 M6002 M6014 M2121 M2154 M6000 M2121

M2155 M2877 M2123 M2155 M2877 M2123 M2155 M2961 M2884 M2123 M2457 M2155 M2959 M2123 M2155 M2123 M2155 M2877 M2123 M2155 M2877 M2123 M2155 M6027 M2877 M2123 M2155 M6027 M2877 M2123 M2155 M2877 M2123 M2155 M2877 M2123 M2155 M2961 M2123 M2155 M2877 M6027 M2123 M2155 M2961 M2123

M2156 M2878 M2122 M2156 M2956 M2122 M2156 M2962 M2885 M2122 M2458 M2156 M2960 M2122 M2156 M2122 M2156 M2956 M2122 M2156 M2956 M2122 M2156 M2956 M2878 M2122 M2156 M2956 M2878 M2122 M2156 M2878 M2122 M2156 M2956 M2122 M2156 M2962 M2122 M2156 M2878 M2956 M2122 M2156 M2962 M2122

S4

00

X X X X X X X

10 10 10

X X X X X X X X

10 10 10

X X X X X X X X

10 10 10

X X X X X X X X X X X X X X

10 10 10

X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

5-38

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Complete Harness

LH Harness

RH Harness

O-540-G1A5 (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-H1A5 (25°,260HP) O-540-H2A5 (25°,260HP) O-540-H2A5 (25°,260HP) O-540-H2A5 (25°,260HP) O-540-J3A5 (23°,235HP)

M2154 M6001 M2121 M2154 M6000 M2154 M2121 M6000 M2121 M2154 M6000 M6002 M2121 M2154 M6002

M2155 M2959 M2123 M2155 M2961 M2155 M2123 M2961 M2123 M2155 M2961 M2877 M2123 M2155 M2877

M2156 M2960 M2122 M2156 M2962 M2156 M2122 M2962 M2122 M2156 M2962 M2878 M2122 M2156 M2878

TIO-540-C1A (20°,250HP) TIO-540-C1A (20°,250HP)

M2121 M2790

M2123 M2791

M2122 M2792

X

TVO-435-A1A (25°,260HP) TVO-435-B1A - 1/2" (25°,270HP) TVO-435-B1A - 1/2" (25°,270HP) TVO-435-B1A - 13/16" (25°,270HP) TVO-435-B1A - 13/16" (25°,270HP) TVO-435-D1A (25°,270HP) TVO-435-D1B (25°,270HP) TVO-435-F1A (25°,280HP) TVO-435-F1A (25°,280HP) TVO-435-G1A (25°,280HP) TVO-435-G1B (25°,280HP)

M2471 M2712

M2472 M2713

M2473 M2714

X X

M2709

M2710

M2711

M2712

M2713

M2714

M2709

M2710

M2711

M2712 M2712 M2712 M2709 M2712 M2712

M2713 M2713 M2713 M2710 M2713 M2713

M2714 M2714 M2714 M2711 M2714 M2714

X X X

M2471

M2472

M2473

X

M2471

M2472

M2473

X

M2471

M2472

M2473

X

M2471

M2472

M2473

X

M2471

M2472

M2473

X

Engine - Model (Degree°, HP)

VO-435-A1B - 1/2" (25°,260HP) VO-435-A1B - 13/16" (25°,260HP) VO-435-A1C - 1/2" (25°,260HP) VO-435-A1C - 13/16" (25°,260HP) VO-435-A1D - 1/2" (25°,260HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X

10 10 10

X X X X X X

10 10 10

X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

HARNESSES 5/8”

Engine

S4

00

X

X X X

X X X

PAGE NO.

REVISION

5-39

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine

S4

00

Complete Harness

LH Harness

RH Harness

VO-435-A1D - 13/16" (25°,260HP) VO-435-A1E - 1/2" (25°,260HP) VO-435-A1E - 13/16" (25°,260HP) VO-435-A1F - 1/2" (25°,260HP) VO-435-A1F - 13/16" (25°,260HP) VO-435-B1A - 1/2" (25°,265HP) VO-435-B1A - 13/16" (25°,265HP)

M2471

M2472

M2473

X

M2471

M2472

M2473

X

M2471

M2472

M2473

X

M2471

M2472

M2473

X

M2471

M2472

M2473

X

M2471

M2472

M2473

X

M2471

M2472

M2473

X

VO-540-C1C3 (25°,305HP)

M2471

M2472

M2473

X

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

HARNESSES 5/8”

00

PAGE NO.

REVISION

5-40

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Section 6.0

HARNESSES 3/4”

HARNESS APPLICATION (3/4”)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-1/(6-2 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Franklin 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

4A-235-B31 (32°,116HP) 4A-235-B4 (26°,125HP)

M4049 M4049

M2096 M2096

M2095 M2095

6A-350-C1 (28°,220HP) 6A-350-C1 (28°,220HP) 6A-350-C1A (28°,220HP) 6A-350-C1A (28°,220HP) 6A-350-C2 (28°,215HP) 6A-350-C2 (28°,215HP) 6A-350-C2A (28°,212HP) 6A-350-C2A (28°,212HP) 6A-350-D1 (28°,200HP) 6A-350-D1 (28°,200HP) 6A-350-D1A (28°,230HP) 6A-350-D1A (28°,230HP) 6A-350-D1B (28°,220HP) 6A-350-D1B (28°,220HP)

M6089 M2769 M6089 M2769 M6089 M2769 M6089 M2769 M6089 M2769 M6089 M2769 M6089 M2769

M6087 M2770 M6087 M2770 M6087 M2770 M6087 M2770 M6087 M2770 M6087 M2770 M6087 M2770

M6088 M2771 M6088 M2771 M6088 M2771 M6088 M2771 M6088 M2771 M6088 M2771 M6088 M2771

6A4-150-B3 (28°,150HP) 6A4-150-B31 (28°,150HP) 6A4-150-B31 (28°,150HP) 6A4-150-B4 (28°,150HP) 6A4-150-B4 (28°,150HP)

M2769 M2769 M6089 M2769 M6089

M2770 M2770 M6087 M2770 M6087

M2771 M2771 M6088 M2771 M6088

6A4-165-B3 (32°,165HP) 6A4-165-B3 (32°,165HP) 6A4-165-B4 (32°,165HP) 6A4-165-B4 (32°,165HP) 6A4-165-B6 (32°,165HP) 6A4-165-B6 (32°,165HP)

M2769 M6089 M2769 M6089 M2769 M6089

M2770 M6087 M2770 M6087 M2770 M6087

M2771 M6088 M2771 M6088 M2771 M6088

6AS-335-A (30°,260HP) 6AS-335-B (30°,260HP)

M2769 M2769

M2770 M2770

M2771 M2771

X X

9 9

6AS-350-A (25°,250HP) 6AS-350-A1 (25°,250HP)

M2769 M2769

M2770 M2770

M2771 M2771

X X

9 9

6V-335-A (32°,210HP) 6V-335-A (36°,210HP) 6V-335-B (32°,210HP)

M2769 M2769 M2769

M2770 M2770 M2770

M2771 M2771 M2771

X X X

9 9 9

6V4-200-C32 (36°,200HP) 6V4-200-C33 (36°,200HP)

M2769 M2769

M2770 M2770

M2771 M2771

X X

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X

9 9 9 9 9 9 9 9 9 9 9 9 9 9

X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-3

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 3/4”

Engine

S4

00


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine

Complete Harness

LH Harness

RH Harness

C-125-2 (28°,125HP)

M2336

M2338

M2337

C-145-2 (26°,145HP) C-145-2 (26°,145HP) C-145-2 (26°,145HP) C-145-2H (26°,145HP) C-145-2H (26°,145HP) C-145-2H (26°,145HP) C-145-2HP (26°,145HP) C-145-2HP (26°,145HP) C-145-2HP (26°,145HP)

M2935 M2318 M2336 M2935 M2318 M2336 M2935 M2318 M2336

M2933 M2320 M2338 M2933 M2320 M2338 M2933 M2320 M2338

M2934 M2319 M2337 M2934 M2319 M2337 M2934 M2319 M2337

X

E-165-2 (26°,165HP) E-165-2 (26°,165HP) E-165-3 (26°,165HP) E-165-3 (26°,165HP) E-165-4 (26°,165HP) E-165-4 (26°,165HP)

M6071 M2339 M6071 M2339 M6071 M2339

M6069 M2340 M6069 M2340 M6069 M2340

M6070 M2341 M6070 M2341 M6070 M2341

X

E-185-1 (26°,205HP) E-185-1 (26°,205HP) E-185-10 (26°,205HP) E-185-10 (26°,205HP) E-185-11 (26°,205HP) E-185-11 (26°,205HP) E-185-2 (26°,185HP) E-185-2 (26°,185HP) E-185-3 (26°,205HP) E-185-3 (26°,205HP) E-185-5 (26°,185HP) E-185-5 (26°,185HP) E-185-8 (26°,205HP) E-185-8 (26°,205HP) E-185-9 (26°,205HP) E-185-9 (26°,205HP)

M6071 M2339 M6071 M2339 M6071 M2339 M6071 M2339 M6071 M2339 M6071 M2339 M6071 M2339 M6071 M2339

M6069 M2340 M6069 M2340 M6069 M2340 M6069 M2340 M6069 M2340 M6069 M2340 M6069 M2340 M6069 M2340

M6070 M2341 M6070 M2341 M6070 M2341 M6070 M2341 M6070 M2341 M6070 M2341 M6070 M2341 M6070 M2341

X

E-225-2 (26°,225HP) E-225-2 (26°,225HP) E-225-4 (26°,225HP) E-225-4 (26°,225HP) E-225-8 (26°,225HP) E-225-8 (26°,225HP) E-225-9 (26°,225HP) E-225-9 (26°,225HP)

M6071 M2339 M6071 M2339 M6071 M2339 M6071 M2339

M6069 M2340 M6069 M2340 M6069 M2340 M6069 M2340

M6070 M2341 M6070 M2341 M6070 M2341 M6070 M2341

X

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

00

X

X X X X X X X X

X X X X X

X X X X X X X X X X X X X X X

X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

6-4

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Complete Harness

LH Harness

RH Harness

GO-300-A (28°,175HP) GO-300-A (28°,175HP) GO-300-A (28°,175HP) GO-300-B (28°,175HP) GO-300-B (28°,175HP) GO-300-B (28°,175HP) GO-300-C (28°,175HP) GO-300-C (28°,175HP) GO-300-C (28°,175HP) GO-300-D (28°,175HP) GO-300-D (28°,175HP) GO-300-D (28°,175HP) GO-300-E (28°,175HP) GO-300-E (28°,175HP) GO-300-E (28°,175HP)

M2941 M2342 M2348 M2941 M2342 M2348 M2941 M2342 M2348 M2941 M2342 M2348 M2941 M2342 M2348

M2939

M2940

M2350 M2939

M2349 M2940

M2350 M2939

M2349 M2940

M2350 M2939

M2349 M2940

M2350 M2939

M2349 M2940

M2350

M2349

X

GTSIO-520-C (22°,340HP) GTSIO-520-C (22°,340HP) GTSIO-520-D (20°,375HP) GTSIO-520-D (20°,375HP) GTSIO-520-E (20°,375HP) GTSIO-520-E (20°,375HP) GTSIO-520-F (20°,435HP) GTSIO-520-F (20°,435HP) GTSIO-520-H (20°,375HP) GTSIO-520-H (20°,375HP) GTSIO-520-K (20°,435HP) GTSIO-520-K (20°,435HP) GTSIO-520-L (24°,375HP) GTSIO-520-L (24°,375HP) GTSIO-520-M (24°,375HP) GTSIO-520-M (24°,375HP) GTSIO-520-N (24°,375HP) GTSIO-520-N (24°,375HP)

M2100 M1950 M2100 M1950 M2100 M1950 M2100 M1950 M2100 M1950 M2100 M1950 M2100 M1950 M2100 M1950 M2100 M1950

M2115 M1955 M2115 M1955 M2115 M1955 M2115 M1955 M2115 M1955 M2115 M1955 M2115 M1955 M2115 M1955 M2115 M1955

M2110 M1945 M2110 M1945 M2110 M1945 M2110 M1945 M2110 M1945 M2110 M1945 M2110 M1945 M2110 M1945 M2110 M1945

X

IO-240-B (26°,125HP)

M4045

M4043

M4044

IO-346-A (24°,165HP) IO-346-B (24°,165HP)

M2332 M2332

M2334 M2334

M2333 M2333

IO-360-A (20°,210HP) IO-360-A (20°,210HP) IO-360-A (20°,210HP) IO-360-B (20°,180HP) IO-360-B (20°,180HP) IO-360-B (20°,180HP)

M2015 M2778 M2046 M2015 M2778 M2046

M2025 M2781 M2048 M2025 M2781 M2048

M2020 M2782 M2047 M2020 M2782 M2047

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X X X X X X X X X

X X X X X X X

HARNESSES 3/4”

Engine

S4

00

00

X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

6-5

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine

Complete Harness

LH Harness

RH Harness

IO-360-C (20°,210HP) IO-360-C (20°,210HP) IO-360-C (20°,210HP) IO-360-CB (20°,210HP) IO-360-CB (20°,210HP) IO-360-CB (20°,210HP) IO-360-D (20°,210HP) IO-360-D (20°,210HP) IO-360-D (20°,210HP) IO-360-DB (20°,210HP) IO-360-DB (20°,210HP) IO-360-DB (20°,210HP) IO-360-E (20°,210HP) IO-360-E (20°,210HP) IO-360-E (20°,210HP) IO-360-ES (24°,210HP) IO-360-ES (24°,210HP) IO-360-ES (24°,210HP) IO-360-G (20°,210HP) IO-360-G (20°,210HP) IO-360-G (20°,210HP) IO-360-GB (20°,210HP) IO-360-GB (20°,210HP) IO-360-GB (20°,210HP) IO-360-H (20°,210HP) IO-360-H (20°,210HP) IO-360-H (20°,210HP) IO-360-HB (20°,210HP) IO-360-HB (20°,210HP) IO-360-HB (20°,210HP) IO-360-J (20°,210HP) IO-360-J (20°,210HP) IO-360-J (20°,210HP) IO-360-JB (20°,210HP) IO-360-JB (20°,210HP) IO-360-JB (20°,210HP) IO-360-K (20°,195HP) IO-360-K (20°,195HP) IO-360-K (20°,195HP) IO-360-KB (20°,195HP) IO-360-KB (20°,195HP) IO-360-KB (20°,195HP)

M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046

M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048

M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047

IO-470-A (24°,240HP) IO-470-A (24°,240HP) IO-470-A (24°,240HP)

M2381 M1480 M1990

M2380

M2379

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-6

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine - Model (Degree°, HP)

IO-470-A (24°,240HP) IO-470-A (24°,240HP) IO-470-C (26°,250HP) IO-470-C (26°,250HP) IO-470-C (26°,250HP) IO-470-C (26°,250HP) IO-470-C (26°,250HP) IO-470-D (20°,260HP) IO-470-D (20°,260HP) IO-470-D (20°,260HP) IO-470-D (20°,260HP) IO-470-D (20°,260HP) IO-470-E (20°,260HP) IO-470-E (20°,260HP) IO-470-E (20°,260HP) IO-470-E (20°,260HP) IO-470-E (20°,260HP) IO-470-F (20°,260HP) IO-470-F (20°,260HP) IO-470-F (20°,260HP) IO-470-F (20°,260HP) IO-470-F (20°,260HP) IO-470-G (26°,250HP) IO-470-G (26°,250HP) IO-470-G (26°,250HP) IO-470-G (26°,250HP) IO-470-G (26°,250HP) IO-470-H (20°,260HP) IO-470-H (20°,260HP) IO-470-H (20°,260HP) IO-470-H (20°,260HP) IO-470-H (20°,260HP) IO-470-J (22°,225HP) IO-470-J (22°,225HP) IO-470-J (22°,225HP) IO-470-J (22°,225HP) IO-470-J (22°,225HP) IO-470-K (22°,225HP) IO-470-K (22°,225HP) IO-470-K (22°,225HP) IO-470-K (22°,225HP) IO-470-K (22°,225HP) IO-470-L (20°,260HP) IO-470-L (20°,260HP) IO-470-L (20°,260HP) IO-470-L (20°,260HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

HARNESSES 3/4”

Engine

S4

00

00

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885

M1890

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

6-7

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

IO-470-L (20°,260HP) IO-470-LO (20°,260HP) IO-470-LO (20°,260HP) IO-470-LO (20°,260HP) IO-470-LO (20°,260HP) IO-470-LO (20°,260HP) IO-470-M (20°,260HP) IO-470-M (20°,260HP) IO-470-M (20°,260HP) IO-470-M (20°,260HP) IO-470-M (20°,260HP) IO-470-N (20°,260HP) IO-470-N (20°,260HP) IO-470-N (20°,260HP) IO-470-N (20°,260HP) IO-470-N (20°,260HP) IO-470-P (26°,250HP) IO-470-P (26°,250HP) IO-470-P (26°,250HP) IO-470-P (26°,250HP) IO-470-P (26°,250HP) IO-470-R (26°,250HP) IO-470-R (26°,250HP) IO-470-R (26°,250HP) IO-470-R (26°,250HP) IO-470-R (26°,250HP) IO-470-S (20°,260HP) IO-470-S (20°,260HP) IO-470-S (20°,260HP) IO-470-S (20°,260HP) IO-470-T (26°,250HP) IO-470-T (26°,250HP) IO-470-T (26°,250HP) IO-470-T (26°,250HP) IO-470-U (20°,260HP) IO-470-U (20°,260HP) IO-470-U (20°,260HP) IO-470-U (20°,260HP) IO-470-V (20°,260HP) IO-470-V (20°,260HP) IO-470-V (20°,260HP) IO-470-V (20°,260HP) IO-470-VO (20°,260HP) IO-470-VO (20°,260HP) IO-470-VO (20°,260HP) IO-470-VO (20°,260HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1990 M1730 M2216 M2381 M1480 M1730 M2216 M2381 M1480 M1730 M2216 M2381 M1480 M1730 M2216 M2381 M1480 M1730 M2216 M2381 M1480 M1730 M2216

M2218 M2380

M2217 M2379

S4

00

00

X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

X X X X X

M1885 M2218 M2380

M1890 M2217 M2379

M1885 M2218 M2380

M1890 M2217 M2379

M1885 M2218 M2380

M1890 M2217 M2379

M1885 M2218 M2380

M1890 M2217 M2379

M1885 M2218 M2380

M1890 M2217 M2379

M1885 M2218

M1890 M2217

X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-8

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine - Model (Degree°, HP)

IO-520-A (22°,285HP) IO-520-A (22°,285HP) IO-520-A (22°,285HP) IO-520-A (22°,285HP) IO-520-A (22°,285HP) IO-520-B (22°,285HP) IO-520-B (22°,285HP) IO-520-B (22°,285HP) IO-520-B (22°,285HP) IO-520-B (22°,285HP) IO-520-BA (22°,285HP) IO-520-BA (22°,285HP) IO-520-BA (22°,285HP) IO-520-BA (22°,285HP) IO-520-BA (22°,285HP) IO-520-BB (22°,285HP) IO-520-BB (22°,285HP) IO-520-BB (22°,285HP) IO-520-BB (22°,285HP) IO-520-BB (22°,285HP) IO-520-C (22°,285HP) IO-520-C (22°,285HP) IO-520-C (22°,285HP) IO-520-C (22°,285HP) IO-520-C (22°,285HP) IO-520-CB (22°,285HP) IO-520-CB (22°,285HP) IO-520-CB (22°,285HP) IO-520-CB (22°,285HP) IO-520-CB (22°,285HP) IO-520-D (22°,300HP) IO-520-D (22°,300HP) IO-520-D (22°,300HP) IO-520-D (22°,300HP) IO-520-D (22°,300HP) IO-520-E (22°,300HP) IO-520-E (22°,300HP) IO-520-E (22°,300HP) IO-520-E (22°,300HP) IO-520-E (22°,300HP) IO-520-F (22°,300HP) IO-520-F (22°,300HP) IO-520-F (22°,300HP) IO-520-F (22°,300HP) IO-520-F (22°,300HP) IO-520-J (22°,285HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381

M2380

M2379

X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X

HARNESSES 3/4”

Engine

S4

00

00

X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-9

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

IO-520-J (22°,285HP) IO-520-J (22°,285HP) IO-520-J (22°,285HP) IO-520-J (22°,285HP) IO-520-K (22°,300HP) IO-520-K (22°,300HP) IO-520-K (22°,300HP) IO-520-K (22°,300HP) IO-520-K (22°,300HP) IO-520-L (22°,300HP) IO-520-L (22°,300HP) IO-520-L (22°,300HP) IO-520-L (22°,300HP) IO-520-L (22°,300HP) IO-520-M (22°,285HP) IO-520-M (22°,285HP) IO-520-M (22°,285HP) IO-520-M (22°,285HP) IO-520-M (22°,285HP) IO-520-MB (22°,285HP) IO-520-MB (22°,285HP) IO-520-MB (22°,285HP) IO-520-MB (22°,285HP) IO-520-MB (22°,285HP) IO-520-N (22°,300HP) IO-520-N (22°,300HP) IO-520-N (22°,300HP) IO-520-N (22°,300HP) IO-520-N (22°,300HP) IO-520-NB (22°,300HP) IO-520-NB (22°,300HP) IO-520-NB (22°,300HP) IO-520-NB (22°,300HP) IO-520-NB (22°,300HP)

M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740

IO-550-A (22°,300HP) IO-550-A (22°,300HP) IO-550-B (22°,300HP) IO-550-B (22°,300HP) IO-550-C (22°,300HP) IO-550-C (22°,300HP) IO-550-D (22°,300HP) IO-550-D (22°,300HP) IO-550-E (22°,300HP) IO-550-F (22°,300HP) IO-550-F (22°,300HP)

M2381 M1740 M1740 M2381 M1740 M2381 M1740 M2381 M1740 M1740 M2381

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

LH Harness

RH Harness

S4

00

00

X X M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940

M1890 M1935

M2380 M1940 M1940 M2380 M1940 M2380 M1940 M2380 M1940 M1940 M2380

M2379 M1935 M1935 M2379 M1935 M2379 M1935 M2379 M1935 M1935 M2379

X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-10

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Complete Harness

LH Harness

RH Harness

IO-550-G (22°,280HP) IO-550-L (22°,300HP) IO-550-L (22°,300HP) IO-550-N (22°,310HP)

M1740 M1740 M2381 M1740

M1940 M1940 M2380 M1940

M1935 M1935 M2379 M1935

LTSIO-360-E (20°,200HP) LTSIO-360-E (20°,200HP) LTSIO-360-EB (20°,200HP) LTSIO-360-EB (20°,200HP) LTSIO-360-KB (20°,220HP) LTSIO-360-KB (20°,220HP) LTSIO-360-RB (22°,220HP) LTSIO-360-RB (22°,220HP)

M2015 M2046 M2015 M2046 M2015 M2046 M2015 M2046

M2025 M2048 M2025 M2048 M2025 M2048 M2025 M2048

M2020 M2047 M2020 M2047 M2020 M2047 M2020 M2047

X

LTSIO-520-AE (20°,250HP) LTSIO-520-AE (20°,250HP)

M1730 M1740

M1885 M1940

M1890 M1935

X

O-300-A (26°,145HP) O-300-A (26°,145HP) O-300-A (26°,145HP) O-300-B (26°,145HP) O-300-B (26°,145HP) O-300-B (26°,145HP) O-300-C (26°,145HP) O-300-C (26°,145HP) O-300-C (26°,145HP) O-300-D (26°,145HP) O-300-D (26°,145HP) O-300-D (26°,145HP) O-300-E (26°,145HP) O-300-E (26°,145HP) O-300-E (26°,145HP)

M2935 M2318 M2336 M2935 M2318 M2336 M2935 M2318 M2336 M2935 M2318 M2336 M2935 M2318 M2336

M2933 M2320 M2338 M2933 M2320 M2338 M2933 M2320 M2338 M2933 M2320 M2338 M2933 M2320 M2338

M2934 M2319 M2337 M2934 M2319 M2337 M2934 M2319 M2337 M2934 M2319 M2337 M2934 M2319 M2337

X

O-470-11 (26°,213HP) O-470-11 (26°,213HP) O-470-11B (26°,213HP) O-470-11B (26°,213HP) O-470-11B-C1 (26°,213HP) O-470-11B-C1 (26°,213HP) O-470-11-C1 (26°,213HP) O-470-11-C1 (26°,213HP) O-470-13 (26°,225HP) O-470-13 (26°,225HP) O-470-13A (26°,225HP) O-470-13A (26°,225HP) O-470-15 (26°,213HP)

M6071 M2339 M6071 M2339 M6071 M2339 M6071 M2339 M6071 M2339 M6071 M2339 M6071

M6069 M2340 M6069 M2340 M6069 M2340 M6069 M2340 M6069 M2340 M6069 M2340 M6069

M6070 M2341 M6070 M2341 M6070 M2341 M6070 M2341 M6070 M2341 M6070 M2341 M6070

X

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X

X X X X X X X

X

X X X X X X

HARNESSES 3/4”

Engine

S4

00

00

X X X X X X X X

X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-11

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-470-15 (26°,213HP) O-470-4 (26°,225HP) O-470-4 (26°,225HP) O-470-A (26°,225HP) O-470-A (26°,225HP) O-470-A (26°,225HP) O-470-A (26°,225HP) O-470-A (26°,225HP) O-470-B (24°,240HP) O-470-B (24°,240HP) O-470-B (24°,240HP) O-470-B (24°,240HP) O-470-B (24°,240HP) O-470-B-C1 (24°,240HP) O-470-B-C1 (24°,240HP) O-470-B-C1 (24°,240HP) O-470-B-C1 (24°,240HP) O-470-B-C1 (24°,240HP) O-470-E (26°,225HP) O-470-E (26°,225HP) O-470-E (26°,225HP) O-470-E (26°,225HP) O-470-E (26°,225HP) O-470-G (24°,240HP) O-470-G (24°,240HP) O-470-G (24°,240HP) O-470-G (24°,240HP) O-470-G (24°,240HP) O-470-G-C1 (24°,240HP) O-470-G-C1 (24°,240HP) O-470-G-C1 (24°,240HP) O-470-G-C1 (24°,240HP) O-470-G-C1 (24°,240HP) O-470-H (24°,240HP) O-470-H (24°,240HP) O-470-H (24°,240HP) O-470-H (24°,240HP) O-470-H (24°,240HP) O-470-J (20°,225HP) O-470-J (20°,225HP) O-470-J (20°,225HP) O-470-J (20°,225HP) O-470-J (20°,225HP) O-470-K (22°,230HP) O-470-K (22°,230HP) O-470-K (22°,230HP)

M2339 M6071 M2339 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990

M2340 M6069 M2340 M2380

M2341 M6070 M2341 M2379

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

00

X X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-12

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-470-K (22°,230HP) O-470-K (22°,230HP) O-470-K-C1 (22°,230HP) O-470-K-C1 (22°,230HP) O-470-K-C1 (22°,230HP) O-470-K-C1 (22°,230HP) O-470-K-C1 (22°,230HP) O-470-L (22°,230HP) O-470-L (22°,230HP) O-470-L (22°,230HP) O-470-L (22°,230HP) O-470-L (22°,230HP) O-470-L-C1 (22°,230HP) O-470-L-C1 (22°,230HP) O-470-L-C1 (22°,230HP) O-470-L-C1 (22°,230HP) O-470-L-C1 (22°,230HP) O-470-M (24°,240HP) O-470-M (24°,240HP) O-470-M (24°,240HP) O-470-M (24°,240HP) O-470-M (24°,240HP) O-470-M-C1 (24°,240HP) O-470-M-C1 (24°,240HP) O-470-M-C1 (24°,240HP) O-470-M-C1 (24°,240HP) O-470-M-C1 (24°,240HP) O-470-N (24°,240HP) O-470-N (24°,240HP) O-470-N (24°,240HP) O-470-N (24°,240HP) O-470-N (24°,240HP) O-470-P (24°,240HP) O-470-P (24°,240HP) O-470-P (24°,240HP) O-470-P (24°,240HP) O-470-P (24°,240HP) O-470-R (22°,230HP) O-470-R (22°,230HP) O-470-R (22°,230HP) O-470-R (22°,230HP) O-470-R (22°,230HP) O-470-S (22°,230HP) O-470-S (22°,230HP) O-470-S (22°,230HP) O-470-S (22°,230HP)

M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730

M1885 M1940 M2380

M1890 M1935 M2379

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

HARNESSES 3/4”

Engine

S4

00

00

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X

M1885

M1890

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

6-13

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine

Complete Harness

LH Harness

RH Harness

O-470-S (22°,230HP) O-470-T (24°,230HP) O-470-T (24°,230HP) O-470-T (24°,230HP) O-470-T (24°,230HP) O-470-T (24°,230HP) O-470-U (24°,230HP) O-470-U (24°,230HP) O-470-U (24°,230HP) O-470-U (24°,230HP) O-470-U (24°,230HP)

M1740 M2381 M1480 M1990 M1730 M1740 M2381 M1480 M1990 M1730 M1740

M1940 M2380

M1935 M2379

M1885 M1940

M1890 M1935

TSIO-360-A (20°,210HP) TSIO-360-A (20°,210HP) TSIO-360-A (20°,210HP) TSIO-360-AB (20°,210HP) TSIO-360-AB (20°,210HP) TSIO-360-AB (20°,210HP) TSIO-360-B (20°,210HP) TSIO-360-B (20°,210HP) TSIO-360-B (20°,210HP) TSIO-360-BB (20°,210HP) TSIO-360-BB (20°,210HP) TSIO-360-BB (20°,210HP) TSIO-360-C (20°,225HP) TSIO-360-C (20°,225HP) TSIO-360-C (20°,225HP) TSIO-360-CB (20°,225HP) TSIO-360-CB (20°,225HP) TSIO-360-CB (20°,225HP) TSIO-360-D (20°,225HP) TSIO-360-D (20°,225HP) TSIO-360-D (20°,225HP) TSIO-360-DB (20°,225HP) TSIO-360-DB (20°,225HP) TSIO-360-DB (20°,225HP) TSIO-360-E (20°,200HP) TSIO-360-E (20°,200HP) TSIO-360-E (20°,200HP) TSIO-360-EB (20°,200HP) TSIO-360-EB (20°,200HP) TSIO-360-EB (20°,200HP) TSIO-360-F (20°,200HP) TSIO-360-F (20°,200HP) TSIO-360-F (20°,200HP) TSIO-360-FB (20°,200HP)

M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015

M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025

M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

00

X X X X

M1885 M1940 M2380

M1890 M1935 M2379

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-14

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Complete Harness

LH Harness

RH Harness

TSIO-360-FB (20°,200HP) TSIO-360-FB (20°,200HP) TSIO-360-G (20°,210HP) TSIO-360-G (20°,210HP) TSIO-360-G (20°,210HP) TSIO-360-GB (20°,210HP) TSIO-360-GB (20°,210HP) TSIO-360-H (20°,210HP) TSIO-360-H (20°,210HP) TSIO-360-H (20°,210HP) TSIO-360-HB (20°,210HP) TSIO-360-HB (20°,210HP) TSIO-360-HB (20°,210HP) TSIO-360-JB (20°,225HP) TSIO-360-JB (20°,225HP) TSIO-360-JB (20°,225HP) TSIO-360-KB (20°,220HP) TSIO-360-LB (20°,210HP) TSIO-360-LB (20°,210HP) TSIO-360-MB (20°,210HP) TSIO-360-MB (20°,210HP) TSIO-360-NB (20°,210HP) TSIO-360-NB (20°,210HP) TSIO-360-PB (20°,200HP) TSIO-360-PB (20°,200HP) TSIO-360-RB (22°,220HP) TSIO-360-RB (22°,220HP) TSIO-360-SB (20°,220HP) TSIO-360-SB (20°,220HP)

M2778 M2046 M2015 M2778 M2046 M2015 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2015 M2778 M2046 M2778 M2015 M2046 M2015 M2046 M2015 M2046 M2015 M2046 M2015 M2046 M2015 M2046

M2781 M2048 M2025 M2781 M2048 M2025 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2025 M2781 M2048 M2781 M2025 M2048 M2025 M2048 M2025 M2048 M2025 M2048 M2025 M2048 M2025 M2048

M2782 M2047 M2020 M2782 M2047 M2020 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2020 M2782 M2047 M2782 M2020 M2047 M2020 M2047 M2020 M2047 M2020 M2047 M2020 M2047 M2020 M2047

TSIO-470-B (22°,260HP) TSIO-470-B (22°,260HP) TSIO-470-C (22°,260HP) TSIO-470-C (22°,260HP) TSIO-470-D (22°,260HP) TSIO-470-D (22°,260HP)

M1730 M1740 M1730 M1740 M1730 M1740

M1885 M1940 M1885 M1940 M1885 M1940

M1890 M1935 M1890 M1935 M1890 M1935

TSIO-520-A (20°,285HP) TSIO-520-A (20°,285HP) TSIO-520-A (20°,285HP) TSIO-520-A (20°,285HP) TSIO-520-A (20°,285HP) TSIO-520-A (20°,285HP) TSIO-520-AE (20°,250HP) TSIO-520-AE (20°,250HP) TSIO-520-AE (20°,250HP)

M2381 M2780 M1480 M1990 M1730 M1740 M2780 M1730 M1740

M2380 M2785

M2379 M2786

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X X X X X X X X X X X X X X X X X X X

HARNESSES 3/4”

Engine

S4

00

00

X X X X X X X X X X X X X X X

M1885 M1940 M2785 M1885 M1940

M1890 M1935 M2786 M1890 M1935

X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-15

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

TSIO-520-AF (22°,310HP) TSIO-520-AF (22°,310HP) TSIO-520-B (20°,285HP) TSIO-520-B (20°,285HP) TSIO-520-B (20°,285HP) TSIO-520-B (20°,285HP) TSIO-520-B (20°,285HP) TSIO-520-B (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-BB (20°,285HP) TSIO-520-BE (24°,310HP) TSIO-520-BE (24°,310HP) TSIO-520-BE (24°,310HP) TSIO-520-BE (24°,310HP) TSIO-520-BE (24°,310HP) TSIO-520-C (20°,285HP) TSIO-520-C (20°,285HP) TSIO-520-C (20°,285HP) TSIO-520-C (20°,285HP) TSIO-520-C (20°,285HP) TSIO-520-C (20°,285HP) TSIO-520-CE (20°,325HP) TSIO-520-CE (20°,325HP) TSIO-520-CE (20°,325HP) TSIO-520-CE (20°,325HP) TSIO-520-CE (20°,325HP) TSIO-520-D (20°,285HP) TSIO-520-D (20°,285HP) TSIO-520-D (20°,285HP) TSIO-520-D (20°,285HP) TSIO-520-D (20°,285HP) TSIO-520-D (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-DB (20°,285HP) TSIO-520-E (20°,300HP) TSIO-520-E (20°,300HP) TSIO-520-E (20°,300HP) TSIO-520-E (20°,300HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2787 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2787 M1990 M1480 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2806 M1990 M1480 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990

M2788 M1940 M2380 M2783

M2789 M1935 M2379 M2784

S4

00

00

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2788

M1890 M1935 M2789

X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2804

M1890 M1935 M2805

X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-16

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine - Model (Degree°, HP)

TSIO-520-E (20°,300HP) TSIO-520-E (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-EB (20°,300HP) TSIO-520-G (22°,300HP) TSIO-520-G (22°,300HP) TSIO-520-G (22°,300HP) TSIO-520-G (22°,300HP) TSIO-520-G (22°,300HP) TSIO-520-G (22°,300HP) TSIO-520-H (20°,285HP) TSIO-520-H (20°,285HP) TSIO-520-H (20°,285HP) TSIO-520-H (20°,285HP) TSIO-520-H (20°,285HP) TSIO-520-H (20°,285HP) TSIO-520-J (20°,310HP) TSIO-520-J (20°,310HP) TSIO-520-J (20°,310HP) TSIO-520-J (20°,310HP) TSIO-520-J (20°,310HP) TSIO-520-J (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-JB (20°,310HP) TSIO-520-K (20°,285HP) TSIO-520-K (20°,285HP) TSIO-520-K (20°,285HP) TSIO-520-K (20°,285HP) TSIO-520-K (20°,285HP) TSIO-520-K (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-KB (20°,285HP) TSIO-520-L (20°,310HP) TSIO-520-L (20°,310HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

HARNESSES 3/4”

Engine

S4

00

00

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-17

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

TSIO-520-L (20°,310HP) TSIO-520-L (20°,310HP) TSIO-520-L (20°,310HP) TSIO-520-L (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-LB (20°,310HP) TSIO-520-M (22°,310HP) TSIO-520-M (22°,310HP) TSIO-520-M (22°,310HP) TSIO-520-M (22°,310HP) TSIO-520-M (22°,310HP) TSIO-520-M (22°,310HP) TSIO-520-N (20°,310HP) TSIO-520-N (20°,310HP) TSIO-520-N (20°,310HP) TSIO-520-N (20°,310HP) TSIO-520-N (20°,310HP) TSIO-520-N (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-NB (20°,310HP) TSIO-520-P (22°,310HP) TSIO-520-P (22°,310HP) TSIO-520-P (22°,310HP) TSIO-520-P (22°,310HP) TSIO-520-P (22°,310HP) TSIO-520-P (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-R (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-T (22°,310HP) TSIO-520-T (22°,310HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740

LH Harness

RH Harness

S4

00

00

X X M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940

M1890 M1935

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-18

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Complete Harness

LH Harness

RH Harness

TSIO-520-U (22°,300HP) TSIO-520-U (22°,300HP) TSIO-520-U (22°,300HP) TSIO-520-U (22°,300HP) TSIO-520-U (22°,300HP) TSIO-520-U (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-UB (22°,300HP) TSIO-520-VB (20°,325HP) TSIO-520-VB (20°,325HP) TSIO-520-VB (20°,325HP) TSIO-520-VB (20°,325HP) TSIO-520-VB (20°,325HP) TSIO-520-VB (20°,325HP) TSIO-520-WB (20°,325HP) TSIO-520-WB (20°,325HP) TSIO-520-WB (20°,325HP) TSIO-520-WB (20°,325HP) TSIO-520-WB (20°,325HP) TSIO-520-WB (20°,325HP)

M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740 M2381 M2779 M1480 M1990 M1730 M1740

M2380 M2783

M2379 M2784

TSIO-550-A (24°,360HP) TSIO-550-A (24°,360HP) TSIO-550-B (24°,350HP) TSIO-550-B (24°,350HP) TSIO-550-C (24°,310HP) TSIO-550-C (24°,310HP) TSIO-550-E (24°,350HP) TSIO-550-E (24°,350HP)

M1730 M2779 M1730 M2779 M1730 M2779 M1730 M2779

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940 M2380 M2783

M1890 M1935 M2379 M2784

X X X X X X

M1885 M1940

M1890 M1935

M1885 M2783 M1885 M2783 M1885 M2783 M1885 M2783

M1890 M2784 M1890 M2784 M1890 M2784 M1890 M2784

X X

HARNESSES 3/4”

Engine

S4

00

00

X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-19

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine

Complete Harness

LH Harness

RH Harness

AEIO-320-D1B (25°,160HP) AEIO-320-D1B (25°,160HP) AEIO-320-D1B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-D2B (25°,160HP) AEIO-320-E1A (25°,150HP) AEIO-320-E1A (25°,150HP) AEIO-320-E1A (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E1B (25°,150HP) AEIO-320-E2A (25°,150HP) AEIO-320-E2A (25°,150HP) AEIO-320-E2A (25°,150HP) AEIO-320-E2B (25°,150HP) AEIO-320-E2B (25°,150HP) AEIO-320-E2B (25°,150HP)

M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235

M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236

X

AEIO-360-A1A (20°,200HP) AEIO-360-A1A (20°,200HP) AEIO-360-A1A (20°,200HP) AEIO-360-A1A (25°,200HP) AEIO-360-A1A (25°,200HP) AEIO-360-A1A (25°,200HP) AEIO-360-A1B (20°,200HP) AEIO-360-A1B (20°,200HP) AEIO-360-A1B (20°,200HP) AEIO-360-A1B (25°,200HP) AEIO-360-A1B (25°,200HP) AEIO-360-A1B (25°,200HP) AEIO-360-A1B6 (20°,200HP) AEIO-360-A1B6 (20°,200HP) AEIO-360-A1B6 (20°,200HP) AEIO-360-A1B6 (25°,200HP) AEIO-360-A1B6 (25°,200HP) AEIO-360-A1B6 (25°,200HP) AEIO-360-A1C (20°,200HP) AEIO-360-A1C (25°,200HP) AEIO-360-A1D (20°,200HP) AEIO-360-A1D (20°,200HP) AEIO-360-A1D (25°,200HP) AEIO-360-A1D (25°,200HP) AEIO-360-A1E (20°,200HP) AEIO-360-A1E (20°,200HP) AEIO-360-A1E (20°,200HP)

M4029 M2360 M2235 M4029 M2360 M2235 M4029 M2360 M2235 M4029 M2360 M2235 M4029 M2360 M2235 M4029 M2360 M2235 M2508 M2508 M2360 M2235 M2360 M2235 M2508 M2360 M2235

M4025 M2362 M2237 M4025 M2362 M2237 M4025 M2362 M2237 M4025 M2362 M2237 M4025 M2362 M2237 M4025 M2362 M2237 M2506 M2506 M2362 M2237 M2362 M2237 M2506 M2362 M2237

M4026 M2361 M2236 M4026 M2361 M2236 M4026 M2361 M2236 M4026 M2361 M2236 M4026 M2361 M2236 M4026 M2361 M2236 M2507 M2507 M2361 M2236 M2361 M2236 M2507 M2361 M2236

X

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-20

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine

Complete Harness

LH Harness

RH Harness

AEIO-360-A1E (25°,200HP) AEIO-360-A1E (25°,200HP) AEIO-360-A1E (25°,200HP) AEIO-360-A1E6 (20°,200HP) AEIO-360-A1E6 (25°,200HP) AEIO-360-A2A (20°,200HP) AEIO-360-A2A (25°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-A2B (20°,200HP) AEIO-360-A2B (25°,200HP) AEIO-360-A2B (25°,200HP) AEIO-360-A2B (25°,200HP) AEIO-360-A2C (20°,200HP) AEIO-360-A2C (25°,200HP) AEIO-360-B1B (25°,180HP) AEIO-360-B1B (25°,180HP) AEIO-360-B1B (25°,180HP) AEIO-360-B1D (25°,180HP) AEIO-360-B1F (25°,180HP) AEIO-360-B1F (25°,180HP) AEIO-360-B1F (25°,180HP) AEIO-360-B1F6 (25°,180HP) AEIO-360-B1F6 (25°,180HP) AEIO-360-B1F6 (25°,180HP) AEIO-360-B1G6 (25°,180HP) AEIO-360-B1G6 (25°,180HP) AEIO-360-B1G6 (25°,180HP) AEIO-360-B2F (25°,180HP) AEIO-360-B2F (25°,180HP) AEIO-360-B2F (25°,180HP) AEIO-360-B2F6 (25°,180HP) AEIO-360-B4A (25°,180HP) AEIO-360-B4A (25°,180HP) AEIO-360-B4A (25°,180HP) AEIO-360-H1A (25°,180HP) AEIO-360-H1A (25°,180HP) AEIO-360-H1A (25°,180HP)

M2508 M2360 M2235 M2508 M2508 M2508 M2508 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2508 M2508 M2360 M2235 M2508 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2508 M2360 M2235 M2508 M2360 M2235

M2506 M2362 M2237 M2506 M2506 M2506 M2506 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2506 M2506 M2362 M2237 M2506 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2361 M2236 M2507 M2507 M2507 M2507 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2507 M2507 M2361 M2236 M2507 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2507 M2361 M2236 M2507 M2361 M2236

AEIO-540-D4A5 (25°,260HP) AEIO-540-D4A5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-D4B5 (25°,260HP) AEIO-540-D4C5 (25°,260HP)

M2120 M2157 M2120 M2157 M2899

M2117 M2158 M2117 M2158 M2900

M2118 M2159 M2118 M2159 M2901

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-21

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 3/4”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine

Complete Harness

LH Harness

RH Harness

AIO-320-A1A (25°,160HP) AIO-320-A1B (25°,160HP) AIO-320-A1B (25°,160HP) AIO-320-A1B (25°,160HP) AIO-320-A1B (25°,160HP) AIO-320-A2A (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-A2B (25°,160HP) AIO-320-B1B (25°,160HP) AIO-320-B1B (25°,160HP) AIO-320-B1B (25°,160HP) AIO-320-C1B (25°,160HP)

M2492 M2508 M2492 M2360 M2235 M2508 M2508 M2360 M2235 M2508 M2360 M2235 M2508

M2493 M2506 M2493 M2362 M2237 M2506 M2506 M2362 M2237 M2506 M2362 M2237 M2506

M2494 M2507 M2494 M2361 M2236 M2507 M2507 M2361 M2236 M2507 M2361 M2236 M2507

AIO-360-A1A (20°,200HP) AIO-360-A1A (20°,200HP) AIO-360-A1A (20°,200HP) AIO-360-A1A (25°,200HP) AIO-360-A1A (25°,200HP) AIO-360-A1B (20°,200HP) AIO-360-A1B (20°,200HP) AIO-360-A1B (20°,200HP) AIO-360-A1B (25°,200HP) AIO-360-A1B (25°,200HP) AIO-360-A2A (20°,200HP) AIO-360-A2A (25°,200HP) AIO-360-A2B (20°,200HP) AIO-360-A2B (20°,200HP) AIO-360-A2B (20°,200HP) AIO-360-A2B (25°,200HP) AIO-360-A2B (25°,200HP) AIO-360-A2B (25°,200HP) AIO-360-B1B (20°,200HP) AIO-360-B1B (20°,200HP) AIO-360-B1B (20°,200HP) AIO-360-B1B (25°,200HP) AIO-360-B1B (25°,200HP) AIO-360-B1B (25°,200HP)

M2360 M4029 M2235 M2360 M2235 M2360 M4029 M2235 M2360 M2235 M4029 M4029 M2508 M2360 M2235 M2508 M2360 M2235 M2235 M4029 M2492 M2235 M4029 M2492

M2362 M4025 M2237 M2362 M2237 M2362 M4025 M2237 M2362 M2237 M4025 M4025 M2506 M2362 M2237 M2506 M2362 M2237 M2237 M4025 M2493 M2237 M4025 M2493

M2361 M4026 M2236 M2361 M2236 M2361 M4026 M2236 M2361 M2236 M4026 M4026 M2507 M2361 M2236 M2507 M2361 M2236 M2236 M4026 M2494 M2236 M4026 M2494

GO-435-C2A (25°,260HP) GO-435-C2A2 (25°,260HP) GO-435-C2B1 (25°,260HP) GO-435-C2B2 (25°,260HP)

M2682 M2682 M2682 M2682

M2683 M2683 M2683 M2683

M2684 M2684 M2684 M2684

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

X

2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X X X X

PAGE NO.

REVISION

6-22

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine

S4

00

Complete Harness

LH Harness

RH Harness

GO-480-B (25°,270HP) GO-480-B1C (25°,270HP) GO-480-B1D (25°,270HP) GO-480-C1D6 (25°,295HP) GO-480-D1A (25°,275HP) GO-480-G1A6 (25°,295HP) GO-480-G1B6 (25°,295HP) GO-480-G1D6 (25°,295HP) GO-480-G1D6 (25°,295HP) GO-480-G1J6 (25°,295HP) GO-480-G1J6 (25°,295HP)

M2682 M2682 M2682 M2682 M2850 M2682 M2850 M2682 M2688 M2739 M2489

M2683 M2683 M2683 M2683 M2849 M2683 M2849 M2683 M2689 M2740 M2490

M2684 M2684 M2684 M2684 M2684 M2684 M2684 M2684 M2690 M2741 M2491

X X X X X X X X

GSO-480-B1B3 (25°,340HP) GSO-480-B1J6 (25°,340HP) GSO-480-B1J6 (25°,340HP)

M2809 M2751 M2486

M2807 M2752 M2487

M2808 M2753 M2488

X X

HIO-360-A1A (25°,180HP) HIO-360-B1A (25°,180HP) HIO-360-C1A (25°,205HP) HIO-360-E1AD (20°,190HP) HIO-360-E1BD (20°,190HP) HIO-360-F1AD (20°,190HP)

M2859 M2856 M2856 M2944 M2944 M2944

M2861 M2858 M2858

M2860 M2857 M2857

HO-360-A1A (25°,180HP) HO-360-B1A (25°,180HP) HO-360-B1B (25°,180HP) HO-360-C1A (25°,180HP)

M2360 M2360 M2360 M2360

M2362 M2362 M2362 M2362

M2361 M2361 M2361 M2361

IGSO-480-A1A6 - 1/2" (25°,340HP) IGSO-480-A1A6 - 1/2" (25°,340HP) IGSO-480-A1A6 - 13/16" (25°,340HP) IGSO-480-A1A6 - 13/16" (25°,340HP) IGSO-480-A1B6 - 1/2" (25°,340HP) IGSO-480-A1B6 - 1/2" (25°,340HP) IGSO-480-A1B6 - 13/16" (25°,340HP) IGSO-480-A1B6 - 13/16" (25°,340HP) IGSO-480-A1E6 - 1/2" (25°,340HP)

M2247

M2249

M2248

M2280

M2282

M2281

M2247

M2249

M2248

M2280

M2282

M2281

M2247

M2249

M2248

M2280

M2282

M2281

M2247

M2249

M2248

M2280

M2282

M2281

M2247

M2249

M2248

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X

X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X

PAGE NO.

REVISION

6-23

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

IGSO-480-A1E6 - 1/2" (25°,340HP) IGSO-480-A1E6 - 13/16" (25°,340HP) IGSO-480-A1E6 - 13/16"

M2280

M2282

M2281

M2247

M2249

M2248

M2280

M2282

M2281

IGSO-540-A1D (25°,380HP) IGSO-540-A1D (25°,380HP) IGSO-540-A1D (25°,380HP) IGSO-540-A1E (25°,380HP) IGSO-540-A1E (25°,380HP) IGSO-540-A1E (25°,380HP) IGSO-540-A1F (25°,380HP) IGSO-540-A1F (25°,380HP) IGSO-540-A1F (25°,380HP) IGSO-540-B1A (25°,380HP) IGSO-540-B1A (25°,380HP) IGSO-540-B1A (25°,380HP) IGSO-540-B1C (25°,380HP) IGSO-540-B1C (25°,380HP) IGSO-540-B1C (25°,380HP)

M2289 M2292 M2256 M2289 M2292 M2256 M2289 M2292 M2256 M2289 M2292 M2256 M2289 M2292 M2256

M2291 M2294 M2258 M2291 M2294 M2258 M2291 M2294 M2258 M2291 M2294 M2258 M2291 M2294 M2258

M2290 M2293 M2257 M2290 M2293 M2257 M2290 M2293 M2257 M2290 M2293 M2257 M2290 M2293 M2257

IO-320-A1A (25°,150HP) IO-320-A2A (25°,150HP) IO-320-B1A (25°,160HP) IO-320-B1A (25°,160HP) IO-320-B1A (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1B (25°,160HP) IO-320-B1C (25°,160HP) IO-320-B1C (25°,160HP) IO-320-B1C (25°,160HP) IO-320-B1D (25°,160HP) IO-320-B1D (25°,160HP) IO-320-B1D (25°,160HP) IO-320-B2A (25°,160HP) IO-320-B2A (25°,160HP) IO-320-B2A (25°,160HP) IO-320-C1A - 1/2" (25°,160HP) IO-320-C1A - 1/2" (25°,160HP) IO-320-C1A - 1/2" (25°,160HP) IO-320-C1A - 13/16" (25°,160HP) IO-320-C1A - 13/16" (25°,160HP)

M2508 M2508 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508

M2506 M2506 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506

M2507 M2507 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507

M2360

M2362

M2361

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

X X X X X X X X X X X X X X X X X X X X X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

2

PAGE NO.

REVISION

6-24

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming

Complete Harness

LH Harness

RH Harness

0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

IO-320-C1A - 13/16" (25°,160HP) IO-320-D1A (25°,160HP) IO-320-D1A (25°,160HP) IO-320-D1A (25°,160HP) IO-320-D1B (25°,160HP) IO-320-D1B (25°,160HP) IO-320-D1B (25°,160HP) IO-320-E1A (25°,150HP) IO-320-E1A (25°,150HP) IO-320-E1A (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E1B (25°,150HP) IO-320-E2A (25°,150HP) IO-320-E2A (25°,150HP) IO-320-E2A (25°,150HP) IO-320-E2B (25°,150HP) IO-320-E2B (25°,150HP) IO-320-E2B (25°,150HP) IO-320-F1A (25°,160HP) IO-320-F1A (25°,160HP) IO-320-F1A (25°,160HP)

M2235

M2237

M2236

X

M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235

M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236

X

IO-360-A1A (20°,200HP) IO-360-A1A (20°,200HP) IO-360-A1A (20°,200HP) IO-360-A1A (25°,200HP) IO-360-A1A (25°,200HP) IO-360-A1A (25°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (20°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B (25°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (20°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1B6 (25°,200HP) IO-360-A1B6D (25°,200HP) IO-360-A1C (20°,200HP) IO-360-A1C (20°,200HP) IO-360-A1C (20°,200HP)

M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2641 M2508 M2360 M2641 M2915 M2508 M2360 M2235

M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2642 M2506 M2362 M2642

M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2643 M2507 M2361 M2643

X

M2506 M2362 M2237

M2507 M2361 M2236

X

Engine Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X

X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

PAGE NO.

REVISION

6-25

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 3/4”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

IO-360-A1C (25°,200HP) IO-360-A1C (25°,200HP) IO-360-A1C (25°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D (20°,200HP) IO-360-A1D (25°,200HP) IO-360-A1D (25°,200HP) IO-360-A1D (25°,200HP) IO-360-A1D6 (20°,200HP) IO-360-A1D6 (20°,200HP) IO-360-A1D6 (20°,200HP) IO-360-A1D6 (25°,200HP) IO-360-A2A (20°,200HP) IO-360-A2A (20°,200HP) IO-360-A2A (20°,200HP) IO-360-A2A (25°,200HP) IO-360-A2A (25°,200HP) IO-360-A2A (25°,200HP) IO-360-A2B (20°,200HP) IO-360-A2B (20°,200HP) IO-360-A2B (25°,200HP) IO-360-A2B (25°,200HP) IO-360-A2C (20°,200HP) IO-360-A2C (20°,200HP) IO-360-A2C (20°,200HP) IO-360-A2C (25°,200HP) IO-360-A2C (25°,200HP) IO-360-A2C (25°,200HP) IO-360-A3B6 (20°,200HP) IO-360-A3B6 (25°,200HP) IO-360-A3B6D (25°,200HP) IO-360-B1A (25°,180HP) IO-360-B1A (25°,180HP) IO-360-B1B (25°,180HP) IO-360-B1B (25°,180HP) IO-360-B1B (25°,180HP) IO-360-B1C (25°,177HP) IO-360-B1C (25°,177HP) IO-360-B1D (25°,180HP) IO-360-B1D (25°,180HP) IO-360-B1D (25°,180HP) IO-360-B1E (25°,180HP) IO-360-B1E (25°,180HP) IO-360-B1E (25°,180HP) IO-360-B1F (25°,180HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2508 M2360 M2235 M2508 M2360 M2235 M2360 M2235 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2508 M2916 M2360 M2235 M2508 M2360 M2235 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508

M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2506 M2362 M2237 M2506 M2362 M2237 M2362 M2237 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2506

M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2507 M2361 M2236 M2507 M2361 M2236 M2361 M2236 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2507

M2362 M2237 M2506 M2362 M2237 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506

M2361 M2236 M2507 M2361 M2236 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507

00

S4

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

PAGE NO.

REVISION

6-26

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

IO-360-B1F (25°,180HP) IO-360-B1F (25°,180HP) IO-360-B1F6 (25°,180HP) IO-360-B2E-nd (25°,180HP) IO-360-B2E-nd (25°,180HP) IO-360-B2E-nd (25°,180HP) IO-360-B2E-wd (25°,180HP) IO-360-B2E-wd (25°,180HP) IO-360-B2F (25°,180HP) IO-360-B2F (25°,180HP) IO-360-B2F (25°,180HP) IO-360-B2F6 (25°,180HP) IO-360-B2F6 (25°,180HP) IO-360-B2F6 (25°,180HP) IO-360-B4A (25°,180HP) IO-360-B4A (25°,180HP) IO-360-B4A (25°,180HP) IO-360-C1A (20°,200HP) IO-360-C1A (20°,200HP) IO-360-C1A (20°,200HP) IO-360-C1A (25°,200HP) IO-360-C1A (25°,200HP) IO-360-C1A (25°,200HP) IO-360-C1B (20°,200HP) IO-360-C1B (20°,200HP) IO-360-C1B (20°,200HP) IO-360-C1B (25°,200HP) IO-360-C1B (25°,200HP) IO-360-C1B (25°,200HP) IO-360-C1C (20°,200HP) IO-360-C1C (20°,200HP) IO-360-C1C (25°,200HP) IO-360-C1C (25°,200HP) IO-360-C1C6 (20°,200HP) IO-360-C1C6 (20°,200HP) IO-360-C1C6 (25°,200HP) IO-360-C1C6 (25°,200HP) IO-360-C1D6 (20°,200HP) IO-360-C1D6 (20°,200HP) IO-360-C1D6 (20°,200HP) IO-360-C1D6 (25°,200HP) IO-360-C1D6 (25°,200HP) IO-360-C1D6 (25°,200HP) IO-360-C1E6 (20°,200HP) IO-360-C1E6 (20°,200HP) IO-360-C1E6 (20°,200HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2360 M2235 M2508 M2508 M2360 M2235 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2616 M2508 M2360 M2616 M2661 M2616 M2661 M2616 M2508 M2360 M2508 M2360 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2661 M2616

M2362 M2237 M2506 M2506 M2362 M2237 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2617 M2506 M2362 M2617 M2662 M2617 M2662 M2617 M2506 M2362 M2506 M2362 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2662 M2617

M2361 M2236 M2507 M2507 M2361 M2236 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2618 M2507 M2361 M2618 M2663 M2618 M2663 M2618 M2507 M2361 M2507 M2361 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2663 M2618

00

S4

X

2, 3 2, 3 2, 3 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-27

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 3/4”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine

Complete Harness

LH Harness

RH Harness

IO-360-C1E6 (25°,200HP) IO-360-C1E6 (25°,200HP) IO-360-C1E6 (25°,200HP) IO-360-C1F (20°,200HP) IO-360-C1F (20°,200HP) IO-360-C1F (20°,200HP) IO-360-C1F (25°,200HP) IO-360-C1F (25°,200HP) IO-360-C1F (25°,200HP) IO-360-D1A (20°,200HP) IO-360-D1A (20°,200HP) IO-360-D1A (20°,200HP) IO-360-D1A (25°,200HP) IO-360-D1A (25°,200HP) IO-360-D1A (25°,200HP) IO-360-E1A (25°,180HP) IO-360-E1A (25°,180HP) IO-360-E1A (25°,180HP) IO-360-F1A (25°,180HP) IO-360-F1A (25°,180HP) IO-360-F1A (25°,180HP) IO-360-J1A6D (20°,200HP) IO-360-J1A6D (25°,200HP) IO-360-J1AD (20°,200HP) IO-360-J1AD (25°,200HP) IO-360-K2A (20°,200HP) IO-360-K2A (20°,200HP) IO-360-K2A (20°,200HP) IO-360-K2A (25°,200HP) IO-360-K2A (25°,200HP) IO-360-K2A (25°,200HP) IO-360-L2A (25°,160HP) IO-360-L2A (25°,180HP)

M2508 M2661 M2616 M2508 M2661 M2616 M2508 M2661 M2616 M2508 M2360 M2616 M2508 M2360 M2616 M2508 M2360 M2235 M2508 M2360 M2235 M2915 M2915 M2508 M2508 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2508

M2506 M2662 M2617 M2506 M2662 M2617 M2506 M2662 M2617 M2506 M2362 M2617 M2506 M2362 M2617 M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2663 M2618 M2507 M2663 M2618 M2507 M2663 M2618 M2507 M2361 M2618 M2507 M2361 M2618 M2507 M2361 M2236 M2507 M2361 M2236

M2506 M2506 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2506

M2507 M2507 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2507

IO-540-A1A5 (20°,290HP) IO-540-A1A5 (20°,290HP) IO-540-A1A5 (20°,290HP) IO-540-AA1A5 (20°,270HP) IO-540-AA1A5 (20°,270HP) IO-540-AA1A5 (20°,270HP) IO-540-AA1B5 (20°,270HP) IO-540-AC1A5 (20°,300HP) IO-540-B1A5 (20°,290HP) IO-540-B1A5 (20°,290HP) IO-540-B1A5 (20°,290HP) IO-540-B1B5 (20°,290HP)

M6042 M2120 M2157 M6018 M2120 M2157 M6018 M6018 M6042 M2120 M2157 M6042

M6043 M2117 M2158 M6012 M2117 M2158 M6012 M6012 M6043 M2117 M2158 M6043

M2888 M2118 M2159 M6013 M2118 M2159 M6013 M6013 M2888 M2118 M2159 M2888

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

S4

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-28

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine - Model (Degree°, HP)

IO-540-B1C5 (20°,290HP) IO-540-B1C5 (20°,290HP) IO-540-B1C5 (20°,290HP) IO-540-C1B5 (25°,250HP) IO-540-C1B5 (25°,250HP) IO-540-C1B5 (25°,250HP) IO-540-C1B5 (25°,250HP) IO-540-C1C5 (25°,250HP) IO-540-C1C5 (25°,250HP) IO-540-C1C5 (25°,250HP) IO-540-C2C (25°,250HP) IO-540-C2C (25°,250HP) IO-540-C2C (25°,250HP) IO-540-C4B5 (25°,250HP) IO-540-C4B5 (25°,250HP) IO-540-C4B5 (25°,250HP) IO-540-C4B5 (25°,250HP) IO-540-C4C5 (25°,250HP) IO-540-C4D5 (25°,250HP) IO-540-D4A5 (25°,260HP) IO-540-D4A5 (25°,260HP) IO-540-D4A5 (25°,260HP) IO-540-D4B5 (25°,260HP) IO-540-D4B5 (25°,260HP) IO-540-D4B5 (25°,260HP) IO-540-D4C5 (25°,260HP) IO-540-D4C5 (25°,260HP) IO-540-D4C5 (25°,260HP) IO-540-E1A5 (20°,290HP) IO-540-E1A5 (20°,290HP) IO-540-E1A5 (20°,290HP) IO-540-E1B5 (20°,290HP) IO-540-E1B5 (20°,290HP) IO-540-E1B5 (20°,290HP) IO-540-E1C5 (20°,290HP) IO-540-G1A5 (20°,290HP) IO-540-G1A5 (20°,290HP) IO-540-G1A5 (20°,290HP) IO-540-G1B5 (20°,290HP) IO-540-G1B5 (20°,290HP) IO-540-G1C5 (20°,290HP) IO-540-G1D5 (20°,290HP) IO-540-G1D5 (20°,290HP) IO-540-G1D5 (20°,290HP) IO-540-G1E5 (20°,290HP) IO-540-G1E5 (20°,290HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M6042 M2120 M2157 M2896 M6042 M2120 M2157 M2896 M2120 M2157 M2896 M2120 M2157 M2896 M6042 M2120 M2157 M6042 M6042 M6042 M2120 M2157 M2899 M2120 M2157 M2899 M2120 M2157 M2896 M2120 M2157 M2896 M2120 M2157 M2896 M2896 M2120 M2157 M2120 M2157 M2899 M6003 M2120 M2157 M6003 M2120

M6043 M2117 M2158 M2897 M6043 M2117 M2158 M2897 M2117 M2158 M2897 M2117 M2158 M2897 M6043 M2117 M2158 M6043 M6043 M6043 M2117 M2158 M2900 M2117 M2158 M2900 M2117 M2158 M2897 M2117 M2158 M2897 M2117 M2158 M2897 M2897 M2117 M2158 M2117 M2158 M2900 M2963 M2117 M2158 M2963 M2117

M2888 M2118 M2159 M2898 M2888 M2118 M2159 M2898 M2118 M2159 M2898 M2118 M2159 M2898 M2888 M2118 M2159 M2888 M2888 M2888 M2118 M2159 M2901 M2118 M2159 M2901 M2118 M2159 M2898 M2118 M2159 M2898 M2118 M2159 M2898 M2898 M2118 M2159 M2118 M2159 M2901 M2964 M2118 M2159 M2964 M2118

X X X X X X X X X X X X X X X X X X X X X X X X

HARNESSES 3/4”

Engine

S4

00

X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X

PAGE NO.

REVISION

6-29

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

IO-540-G1E5 (20°,290HP) IO-540-G1F5 (20°,290HP) IO-540-G1F5 (20°,290HP) IO-540-G1F5 (20°,290HP) IO-540-J4A5 (25°,250HP) IO-540-J4A5 (25°,250HP) IO-540-J4A5 (25°,250HP) IO-540-K1A5 (20°,300HP) IO-540-K1A5 (20°,300HP) IO-540-K1A5 (20°,300HP) IO-540-K1A5D (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1B5 (20°,300HP) IO-540-K1C5 (20°,300HP) IO-540-K1C5 (20°,300HP) IO-540-K1C5 (20°,300HP) IO-540-K1D5 (20°,300HP) IO-540-K1D5 (20°,300HP) IO-540-K1D5 (20°,300HP) IO-540-K1E5 (20°,300HP) IO-540-K1E5 (20°,300HP) IO-540-K1E5 (20°,300HP) IO-540-K1F5 (20°,300HP) IO-540-K1F5 (20°,300HP) IO-540-K1F5 (20°,300HP) IO-540-K1F5D (20°,300HP) IO-540-K1G5 (20°,300HP) IO-540-K1G5 (20°,300HP) IO-540-K1G5 (20°,300HP) IO-540-K1G5D (20°,300HP) IO-540-K1H5 (20°,300HP) IO-540-K1H5 (20°,300HP) IO-540-K1H5 (20°,300HP) IO-540-K1J5 (20°,300HP) IO-540-K1J5 (20°,300HP) IO-540-K1J5 (20°,300HP) IO-540-K1K5 (20°,300HP) IO-540-K1K5 (20°,300HP) IO-540-K1K5 (20°,300HP) IO-540-K2A5 (20°,300HP) IO-540-L1A5 (20°,300HP) IO-540-L1A5 (20°,300HP) IO-540-L1A5 (20°,300HP) IO-540-L1C5 (20°,300HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2157 M6003 M2120 M2157 M6017 M2120 M2157 M2899 M2120 M2157 M2919 M2120 M6003 M2157 M2899 M6018 M2120 M2157 M2896 M2120 M2157 M6003 M2120 M2157 M2120 M6018 M2157 M2919 M6003 M2120 M2157 M2919 M6003 M2120 M2157 M6018 M2120 M2157 M6003 M2120 M2157 M2899 M6003 M2120 M2157 M6003

M2158 M2963 M2117 M2158 M6010 M2117 M2158 M2900 M2117 M2158

M2159 M2964 M2118 M2159 M6011 M2118 M2159 M2901 M2118 M2159

M2117 M2963 M2158 M2900 M6012 M2117 M2158 M2897 M2117 M2158 M2963 M2117 M2158 M2117 M6012 M2158

M2118 M2964 M2159 M2901 M6013 M2118 M2159 M2898 M2118 M2159 M2964 M2118 M2159 M2118 M6013 M2159

M2963 M2117 M2158

M2964 M2118 M2159

X

M2963 M2117 M2158 M6012 M2117 M2158 M2963 M2117 M2158 M2900 M2963 M2117 M2158 M2963

M2964 M2118 M2159 M6013 M2118 M2159 M2964 M2118 M2159 M2901 M2964 M2118 M2159 M2964

X

S4

00

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-30

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Complete Harness

LH Harness

RH Harness

IO-540-L1C5 (20°,300HP) IO-540-L1C5 (20°,300HP) IO-540-M1A5 (20°,300HP) IO-540-M1A5 (20°,300HP) IO-540-M1A5 (20°,300HP) IO-540-M1C5 (20°,300HP) IO-540-N1A5 (25°,260HP) IO-540-P1A5 (20°,290HP) IO-540-P1A5 (20°,290HP) IO-540-P1A5 (20°,290HP) IO-540-R1A5 (25°,260HP) IO-540-R1A5 (25°,260HP) IO-540-S1A5 (20°,300HP) IO-540-S1A5 (20°,300HP) IO-540-S1A5 (20°,300HP) IO-540-T4A5D (25°,260HP) IO-540-T4B5 (25°,260HP) IO-540-T4B5D (25°,260HP) IO-540-W1A5 (23°,235HP) IO-540-W1A5D (23°,235HP) IO-540-W3A5D (23°,235HP)

M2120 M2157 M6017 M2120 M2157 M6017 M2120 M6018 M2120 M2157 M2120 M2157 M6018 M2120 M2157 M2919 M2899 M2919 M2896 M2919 M2919

M2117 M2158 M6010 M2117 M2158 M6010 M2117 M6012 M2117 M2158 M2117 M2158 M6012 M2117 M2158

M2118 M2159 M6011 M2118 M2159 M6011 M2118 M6013 M2118 M2159 M2118 M2159 M6013 M2118 M2159

M2900

M2901

X

M2897

M2898

X

IVO-360-A1A (25°,180HP)

M4033

M4031

M4032

LIO-320-B1A (25°,160HP) LIO-320-B1A (25°,160HP) LIO-320-B1A (25°,160HP) LIO-320-C1A (25°,160HP) LIO-320-C1A (25°,160HP) LIO-320-C1A (25°,160HP)

M2508 M2360 M2235 M2508 M2360 M2235

M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2361 M2236 M2507 M2361 M2236

LIO-360-C1E6 (20°,200HP) LIO-360-C1E6 (20°,200HP) LIO-360-C1E6 (25°,200HP) LIO-360-C1E6 (25°,200HP)

M2661 M2616 M2661 M2616

M2662 M2617 M2662 M2617

M2663 M2618 M2663 M2618

LO-360-A1G6D (25°,180HP) LO-360-E1A6D (25°,180HP)

M2915 M2917

LTIO-540-F2BD (20°,325HP) LTIO-540-J2B (20°,350HP) LTIO-540-J2BD (20°,350HP) LTIO-540-N2BD (20°,350HP) LTIO-540-R2AD (20°,350HP) LTIO-540-V2AD (20°,350HP)

M2918 M6057 M2918 M2918 M2918 M2995

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X X X X X X X X X X X X X X X

2, 3

X

2 2 2 2 2 2

X X X X X X

2, 3 2, 3 2, 3 2, 3

X X X X X

2, 3 2, 3

X M6058

M6059

X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X X X

PAGE NO.

REVISION

6-31

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 3/4”

Engine

S4

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-235-C1 (25°,115HP) O-235-C1 (25°,115HP) O-235-C1 (25°,115HP) O-235-C1B (25°,115HP) O-235-C1B (25°,115HP) O-235-C1B (25°,115HP) O-235-C1C (25°,115HP) O-235-C1C (25°,115HP) O-235-C1C (25°,115HP) O-235-C2A (25°,115HP) O-235-C2A (25°,115HP) O-235-C2A (25°,115HP) O-235-C2B (25°,115HP) O-235-C2B (25°,115HP) O-235-C2B (25°,115HP) O-235-C2C (25°,115HP) O-235-C2C (25°,115HP) O-235-C2C (25°,115HP) O-235-E1 (25°,115HP) O-235-E1 (25°,115HP) O-235-E1 (25°,115HP) O-235-E2A (25°,115HP) O-235-E2A (25°,115HP) O-235-E2A (25°,115HP) O-235-E2B (25°,115HP) O-235-E2B (25°,115HP) O-235-E2B (25°,115HP) O-235-F1 (25°,125HP) O-235-F1 (25°,125HP) O-235-F1 (25°,125HP) O-235-F1B (25°,125HP) O-235-F1B (25°,125HP) O-235-F1B (25°,125HP) O-235-F2A (25°,125HP) O-235-F2A (25°,125HP) O-235-F2A (25°,125HP) O-235-F2B (25°,125HP) O-235-F2B (25°,125HP) O-235-F2B (25°,125HP) O-235-G1 (25°,125HP) O-235-G1 (25°,125HP) O-235-G1 (25°,125HP) O-235-G2A (25°,125HP) O-235-G2A (25°,125HP) O-235-G2A (25°,125HP) O-235-G2B (25°,125HP)

M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508

M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506

M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-32

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-235-G2B (25°,125HP) O-235-G2B (25°,125HP) O-235-H2C (25°,115HP) O-235-H2C (25°,115HP) O-235-H2C (25°,115HP) O-235-J2A (25°,125HP) O-235-J2A (25°,125HP) O-235-J2A (25°,125HP) O-235-J2B (25°,125HP) O-235-J2B (25°,125HP) O-235-J2B (25°,125HP) O-235-K2A (20°,118HP) O-235-K2A (20°,118HP) O-235-K2A (20°,118HP) O-235-K2B (20°,118HP) O-235-K2B (20°,118HP) O-235-K2B (20°,118HP) O-235-K2C (20°,118HP) O-235-K2C (20°,118HP) O-235-K2C (20°,118HP) O-235-L2A (20°,118HP) O-235-L2A (20°,118HP) O-235-L2A (20°,118HP) O-235-L2C (20°,118HP) O-235-L2C (20°,118HP) O-235-L2C (20°,118HP) O-235-M1 (20°,118HP) O-235-M1 (20°,118HP) O-235-M1 (20°,118HP) O-235-M2C (20°,118HP) O-235-M2C (20°,118HP) O-235-M2C (20°,118HP) O-235-N2A (20°,116HP) O-235-N2A (20°,116HP) O-235-N2A (20°,116HP) O-235-N2C (20°,116HP) O-235-N2C (20°,116HP) O-235-N2C (20°,116HP) O-235-P1 (20°,116HP) O-235-P1 (20°,116HP) O-235-P1 (20°,116HP) O-235-P2A (20°,116HP) O-235-P2A (20°,116HP) O-235-P2A (20°,116HP)

M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235

M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237

M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-33

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 3/4”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-290-D (20°,125HP) O-290-D2 (18°,135HP) O-290-D2A (18°,135HP) O-290-D2B (25°,135HP) O-290-D2C (25°,135HP)

M2508 M2360 M2360 M2360 M2360

M2506 M2362 M2362 M2362 M2362

M2507 M2361 M2361 M2361 M2361

X

O-320-A1A (25°,150HP) O-320-A1A (25°,150HP) O-320-A1A (25°,150HP) O-320-A1B (25°,150HP) O-320-A1B (25°,150HP) O-320-A1B (25°,150HP) O-320-A2A (25°,150HP) O-320-A2A (25°,150HP) O-320-A2A (25°,150HP) O-320-A2B (25°,150HP) O-320-A2B (25°,150HP) O-320-A2C (25°,150HP) O-320-A2C (25°,150HP) O-320-A2C (25°,150HP) O-320-A2D (25°,150HP) O-320-A2D (25°,150HP) O-320-A2D (25°,150HP) O-320-A3A (25°,150HP) O-320-A3A (25°,150HP) O-320-A3A (25°,150HP) O-320-A3B (25°,150HP) O-320-A3B (25°,150HP) O-320-A3B (25°,150HP) O-320-A3C (25°,150HP) O-320-A3C (25°,150HP) O-320-A3C (25°,150HP) O-320-B1A (25°,160HP) O-320-B1A (25°,160HP) O-320-B1A (25°,160HP) O-320-B1B (25°,160HP) O-320-B1B (25°,160HP) O-320-B2A (25°,160HP) O-320-B2A (25°,160HP) O-320-B2A (25°,160HP) O-320-B2B (25°,160HP) O-320-B2B (25°,160HP) O-320-B2B (25°,160HP) O-320-B2C (25°,160HP) O-320-B2C (25°,160HP) O-320-B2D (25°,160HP)

M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2508

M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2506

M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2507

X

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

2 2 2 2 2

X X X X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-34

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-320-B3A (25°,160HP) O-320-B3A (25°,160HP) O-320-B3A (25°,160HP) O-320-B3B (25°,160HP) O-320-B3B (25°,160HP) O-320-B3B (25°,160HP) O-320-B3C (25°,160HP) O-320-B3C (25°,160HP) O-320-B3C (25°,160HP) O-320-C1A (25°,150HP) O-320-C1A (25°,150HP) O-320-C1A (25°,150HP) O-320-C1B (25°,150HP) O-320-C1B (25°,150HP) O-320-C1B (25°,150HP) O-320-C2A (25°,150HP) O-320-C2A (25°,150HP) O-320-C2A (25°,150HP) O-320-C2B (25°,150HP) O-320-C2B (25°,150HP) O-320-C2B (25°,150HP) O-320-C2C (25°,150HP) O-320-C2C (25°,150HP) O-320-C2C (25°,150HP) O-320-C3A (25°,150HP) O-320-C3A (25°,150HP) O-320-C3A (25°,150HP) O-320-C3B (25°,150HP) O-320-C3B (25°,150HP) O-320-C3B (25°,150HP) O-320-C3C (25°,150HP) O-320-C3C (25°,150HP) O-320-C3C (25°,150HP) O-320-D1A (25°,150HP) O-320-D1A (25°,150HP) O-320-D1A (25°,150HP) O-320-D1A (25°,160HP) O-320-D1A (25°,160HP) O-320-D1A (25°,160HP) O-320-D1B (25°,150HP) O-320-D1B (25°,150HP) O-320-D1B (25°,160HP) O-320-D1B (25°,160HP) O-320-D1C (25°,150HP) O-320-D1C (25°,150HP) O-320-D1C (25°,150HP)

M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2360 M2235 M2360 M2235 M2508 M2360 M2235

M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2362 M2237 M2362 M2237 M2506 M2362 M2237

M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2361 M2236 M2361 M2236 M2507 M2361 M2236

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-35

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 3/4”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-320-D1C (25°,160HP) O-320-D1C (25°,160HP) O-320-D1C (25°,160HP) O-320-D1D (25°,150HP) O-320-D1D (25°,150HP) O-320-D1D (25°,150HP) O-320-D1D (25°,160HP) O-320-D1D (25°,160HP) O-320-D1D (25°,160HP) O-320-D1F (25°,150HP) O-320-D1F (25°,150HP) O-320-D1F (25°,150HP) O-320-D1F (25°,160HP) O-320-D1F (25°,160HP) O-320-D1F (25°,160HP) O-320-D2A (25°,150HP) O-320-D2A (25°,150HP) O-320-D2A (25°,150HP) O-320-D2A (25°,160HP) O-320-D2A (25°,160HP) O-320-D2A (25°,160HP) O-320-D2B (25°,150HP) O-320-D2B (25°,150HP) O-320-D2B (25°,150HP) O-320-D2B (25°,160HP) O-320-D2B (25°,160HP) O-320-D2B (25°,160HP) O-320-D2C (25°,150HP) O-320-D2C (25°,150HP) O-320-D2C (25°,150HP) O-320-D2C (25°,160HP) O-320-D2C (25°,160HP) O-320-D2C (25°,160HP) O-320-D2F (25°,150HP) O-320-D2F (25°,150HP) O-320-D2F (25°,150HP) O-320-D2F (25°,160HP) O-320-D2F (25°,160HP) O-320-D2F (25°,160HP) O-320-D2G (25°,150HP) O-320-D2G (25°,150HP) O-320-D2G (25°,150HP) O-320-D2G (25°,160HP) O-320-D2G (25°,160HP) O-320-D2G (25°,160HP) O-320-D2H (25°,150HP)

M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508

M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506

M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-36

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-320-D2H (25°,150HP) O-320-D2H (25°,150HP) O-320-D2H (25°,160HP) O-320-D2H (25°,160HP) O-320-D2H (25°,160HP) O-320-D2J (25°,150HP) O-320-D2J (25°,150HP) O-320-D2J (25°,150HP) O-320-D2J (25°,160HP) O-320-D2J (25°,160HP) O-320-D2J (25°,160HP) O-320-D3G (25°,150HP) O-320-D3G (25°,150HP) O-320-D3G (25°,150HP) O-320-D3G (25°,160HP) O-320-D3G (25°,160HP) O-320-D3G (25°,160HP) O-320-E1A (25°,150HP) O-320-E1A (25°,150HP) O-320-E1A (25°,150HP) O-320-E1B (25°,150HP) O-320-E1B (25°,150HP) O-320-E1C (25°,150HP) O-320-E1C (25°,150HP) O-320-E1C (25°,150HP) O-320-E1F (25°,150HP) O-320-E1F (25°,150HP) O-320-E1F (25°,150HP) O-320-E1J (25°,150HP) O-320-E1J (25°,150HP) O-320-E1J (25°,150HP) O-320-E2A (25°,140HP) O-320-E2A (25°,140HP) O-320-E2A (25°,140HP) O-320-E2A (25°,150HP) O-320-E2A (25°,150HP) O-320-E2A (25°,150HP) O-320-E2B (25°,150HP) O-320-E2B (25°,150HP) O-320-E2B (25°,150HP) O-320-E2C (25°,140HP) O-320-E2C (25°,140HP) O-320-E2C (25°,140HP) O-320-E2C (25°,150HP) O-320-E2C (25°,150HP) O-320-E2C (25°,150HP)

M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235

M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237

M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-37

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 3/4”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-320-E2D (25°,150HP) O-320-E2D (25°,150HP) O-320-E2D (25°,150HP) O-320-E2F (25°,150HP) O-320-E2F (25°,150HP) O-320-E2F (25°,150HP) O-320-E2G (25°,150HP) O-320-E2G (25°,150HP) O-320-E2G (25°,150HP) O-320-E2H (25°,150HP) O-320-E2H (25°,150HP) O-320-E2H (25°,150HP) O-320-E3D (25°,150HP) O-320-E3D (25°,150HP) O-320-E3D (25°,150HP) O-320-E3H (25°,150HP) O-320-E3H (25°,150HP) O-320-E3H (25°,150HP) O-320-H2AD (25°,160HP)

M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2917

M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236

O-340-A1A (25°,170HP) O-340-A2A (25°,170HP)

M2360 M2360

M2362 M2362

M2361 M2361

O-360-A1AD (25°,180HP) O-360-A1A-nd (25°,180HP) O-360-A1A-nd (25°,180HP) O-360-A1A-nd (25°,180HP) O-360-A1A-wd (25°,180HP) O-360-A1A-wd (25°,180HP) O-360-A1A-wd (25°,180HP) O-360-A1C (25°,180HP) O-360-A1C (25°,180HP) O-360-A1D (25°,180HP) O-360-A1D (25°,180HP) O-360-A1F (25°,180HP) O-360-A1F (25°,180HP) O-360-A1F (25°,180HP) O-360-A1F6 (25°,180HP) O-360-A1F6 (25°,180HP) O-360-A1F6D (25°,180HP) O-360-A1G (25°,180HP) O-360-A1G (25°,180HP) O-360-A1G (25°,180HP) O-360-A1G6 (25°,180HP) O-360-A1G6 (25°,180HP) O-360-A1G6 (25°,180HP)

M2915 M2508 M2360 M2235 M2508 M2360 M2235 M2360 M2235 M2360 M2235 M2508 M2360 M2235 M2508 M2235 M2916 M2508 M2360 M2235 M2508 M2360 M2235

M2506 M2362 M2237 M2506 M2362 M2237 M2362 M2237 M2362 M2237 M2506 M2362 M2237 M2506 M2237

M2507 M2361 M2236 M2507 M2361 M2236 M2361 M2236 M2361 M2236 M2507 M2361 M2236 M2507 M2236

M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2361 M2236 M2507 M2361 M2236

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X X X X X X X X X X X X X X X X X X X X X

2 2 X

X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

X X

2, 3 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3, 10 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

PAGE NO.

REVISION

6-38

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6

Engine Engine - Model (Degree°, HP)

O-360-A1G6D (25°,180HP) O-360-A1H (25°,180HP) O-360-A1H (25°,180HP) O-360-A1H (25°,180HP) O-360-A1H6 (25°,180HP) O-360-A1LD (25°,180HP) O-360-A1P (25°,180HP) O-360-A2A (25°,180HP) O-360-A2A (25°,180HP) O-360-A2A (25°,180HP) O-360-A2D (25°,180HP) O-360-A2D (25°,180HP) O-360-A2E (25°,180HP) O-360-A2F (25°,180HP) O-360-A2F (25°,180HP) O-360-A2F (25°,180HP) O-360-A2G (25°,180HP) O-360-A2G (25°,180HP) O-360-A2G (25°,180HP) O-360-A2H (25°,180HP) O-360-A2H (25°,180HP) O-360-A2H (25°,180HP) O-360-A3A (25°,180HP) O-360-A3A (25°,180HP) O-360-A3A (25°,180HP) O-360-A3AD (25°,180HP) O-360-A3D (25°,180HP) O-360-A4A (25°,180HP) O-360-A4A (25°,180HP) O-360-A4A (25°,180HP) O-360-A4D (25°,180HP) O-360-A4G (25°,180HP) O-360-A4G (25°,180HP) O-360-A4G (25°,180HP) O-360-A4J (25°,180HP) O-360-A4J (25°,180HP) O-360-A4J (25°,180HP) O-360-A4K (25°,180HP) O-360-A4K (25°,180HP) O-360-A4K (25°,180HP) O-360-A4M (25°,180HP) O-360-A4M (25°,180HP) O-360-A4M (25°,180HP) O-360-A4N (25°,180HP) O-360-A4N (25°,180HP) O-360-A4N (25°,180HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness M2915 M2508 M2360 M2235 M2508 M2915 M2508 M2508 M2360 M2235 M2360 M2235 M2508 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2915 M2508 M2508 M2360 M2235 M2508 M2508 M2360 M2235 M2508 M2613 M2641 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235

LH Harness

RH Harness

M2506 M2362 M2237 M2506

M2507 M2361 M2236 M2507

X

M2506 M2506 M2362 M2237 M2362 M2237 M2506 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2507 M2361 M2236 M2361 M2236 M2507 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236

X X

M2506 M2506 M2362 M2237 M2506 M2506 M2362 M2237 M2506 M2614 M2642 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2507 M2361 M2236 M2507 M2507 M2361 M2236 M2507 M2615 M2643 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236

X X

00

S4

X X X X X

X X X X X X X X X X X X X X X X X X

X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

PAGE NO.

REVISION

6-39

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

HARNESSES 3/4”

00


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

O-360-A4P (25°,180HP) O-360-A5AD (25°,180HP) O-360-B1A (25°,168HP) O-360-B1A (25°,168HP) O-360-B1A (25°,168HP) O-360-B1B (25°,168HP) O-360-B2A (25°,168HP) O-360-B2A (25°,168HP) O-360-B2A (25°,168HP) O-360-B2B (25°,168HP) O-360-C1A (25°,180HP) O-360-C1A (25°,180HP) O-360-C1A (25°,180HP) O-360-C1C (25°,180HP) O-360-C1C (25°,180HP) O-360-C1C (25°,180HP) O-360-C1E (25°,180HP) O-360-C1E (25°,180HP) O-360-C1E (25°,180HP) O-360-C1F (25°,180HP) O-360-C1F (25°,180HP) O-360-C1F (25°,180HP) O-360-C1G (25°,180HP) O-360-C1G (25°,180HP) O-360-C1G (25°,180HP) O-360-C2A (25°,180HP) O-360-C2A (25°,180HP) O-360-C2A (25°,180HP) O-360-C2B (25°,180HP) O-360-C2B (25°,180HP) O-360-C2B (25°,180HP) O-360-C2C (25°,180HP) O-360-C2C (25°,180HP) O-360-C2C (25°,180HP) O-360-C2D (25°,180HP) O-360-C2E (25°,180HP) O-360-C2E (25°,180HP) O-360-C2E (25°,180HP) O-360-C4F (25°,180HP) O-360-C4P (25°,180HP) O-360-D1A (25°,168HP) O-360-D1A (25°,168HP) O-360-D1A (25°,168HP) O-360-D2A (25°,168HP) O-360-D2A (25°,168HP) O-360-D2A (25°,168HP)

M2508 M2915 M2508 M2360 M2235 M2508 M2508 M2360 M2235 M2508 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2360 M2235 M2508 M2508 M2360 M2235 M2508 M2508 M2508 M2360 M2235 M2508 M2360 M2235

M2506

M2507

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

00

S4

X X

M2506 M2362 M2237 M2506 M2506 M2362 M2237 M2506 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2362 M2237 M2506 M2506 M2362 M2237 M2506 M2506 M2506 M2362 M2237 M2506 M2362 M2237

M2507 M2361 M2236 M2507 M2507 M2361 M2236 M2507 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2361 M2236 M2507 M2507 M2361 M2236 M2507 M2507 M2507 M2361 M2236 M2507 M2361 M2236

X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

PAGE NO.

REVISION

6-40

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Complete Harness

LH Harness

RH Harness

O-360-D2B (25°,168HP) O-360-E1A6D (25°,180HP) O-360-F1A6 (25°,180HP) O-360-F1A6 (25°,180HP) O-360-F1A6 (25°,180HP) O-360-G1A6 (25°,180HP) O-360-G1A6 (25°,180HP) O-360-G1A6 (25°,180HP) O-360-J2A (25°,145HP)

M2360 M2917 M2508 M2360 M2235 M2508 M2360 M2235 M2360

M2362

M2361

M2506 M2362 M2237 M2506 M2362 M2237 M2362

M2507 M2361 M2236 M2507 M2361 M2236 M2361

O-540-A1A (25°,250HP) O-540-A1A (25°,250HP) O-540-A1A5 (25°,250HP) O-540-A1A5 (25°,250HP) O-540-A1A5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1B5 (25°,250HP) O-540-A1C5 (25°,250HP) O-540-A1C5 (25°,250HP) O-540-A1C5 (25°,250HP) O-540-A1D (25°,250HP) O-540-A1D (25°,250HP) O-540-A1D (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A1D5 (25°,250HP) O-540-A2B (25°,250HP) O-540-A2B (25°,250HP) O-540-A2B (25°,250HP) O-540-A3D5 (25°,250HP) O-540-A3D5 (25°,250HP) O-540-A3D5 (25°,250HP) O-540-A4A5 (25°,250HP) O-540-A4A5 (25°,250HP) O-540-A4B5 (25°,250HP) O-540-A4B5 (25°,250HP) O-540-A4C5 (25°,250HP) O-540-A4D5 (25°,250HP) O-540-A4D5 (25°,250HP) O-540-A4D5 (25°,250HP) O-540-B1A5 (25°,235HP) O-540-B1A5 (25°,235HP) O-540-B1A5 (25°,235HP)

M2896 M2120 M2896 M2120 M2157 M6042 M2896 M2120 M2157 M2896 M2120 M2157 M6042 M2120 M2157 M6042 M2896 M2120 M2157 M2896 M2120 M2157 M2896 M2120 M2157 M2896 M2120 M2896 M2120 M2896 M2896 M2120 M2157 M2896 M2120 M2157

M2897 M2117 M2897 M2117 M2158 M6043 M2897 M2117 M2158 M2897 M2117 M2158 M6043 M2117 M2158 M6043 M2897 M2117 M2158 M2897 M2117 M2158 M2897 M2117 M2158 M2897 M2117 M2897 M2117 M2897 M2897 M2117 M2158 M2897 M2117 M2158

M2898 M2118 M2898 M2118 M2159 M2888 M2898 M2118 M2159 M2898 M2118 M2159 M2888 M2118 M2159 M2888 M2898 M2118 M2159 M2898 M2118 M2159 M2898 M2118 M2159 M2898 M2118 M2898 M2118 M2898 M2898 M2118 M2159 M2898 M2118 M2159

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X X X X

2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3 2, 3

X X X X X X X X X X X X X X

HARNESSES 3/4”

Engine

S4

00

X X X X X X X X X X X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X

PAGE NO.

REVISION

6-41

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

O-540-B1B5 (25°,235HP) O-540-B1B5 (25°,235HP) O-540-B1D5 (25°,235HP) O-540-B2A5 (25°,235HP) O-540-B2A5 (25°,235HP) O-540-B2A5 (25°,235HP) O-540-B2B5 (25°,235HP) O-540-B2B5 (25°,235HP) O-540-B2B5 (25°,235HP) O-540-B2B5-wd (25°,235HP) O-540-B2B5-wd (25°,235HP) O-540-B2B5-wd (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5 (25°,235HP) O-540-B2C5-wd (25°,235HP) O-540-B2C5-wd (25°,235HP) O-540-B2C5-wd (25°,235HP) O-540-B4A5 (25°,235HP) O-540-B4A5 (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5 (25°,235HP) O-540-B4B5-wd (25°,235HP) O-540-B4B5-wd (25°,235HP) O-540-B4B5-wd (25°,235HP) O-540-D1A5 (25°,250HP) O-540-D1A5 (25°,250HP) O-540-D1A5 (25°,250HP) O-540-D1A5 (25°,250HP) O-540-E4A5 (25°,260HP) O-540-E4A5 (25°,260HP) O-540-E4A5 (25°,260HP) O-540-E4A5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5 (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4B5-wd (25°,260HP) O-540-E4C5 (25°,260HP) O-540-E4C5 (25°,260HP) O-540-E4C5 (25°,260HP) O-540-F1A5 (25°,260HP) O-540-F1B5 (25°,260HP) ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Complete Harness

LH Harness

RH Harness

M2120 M2157 M2896 M6042 M2120 M2157 M2896 M2120 M2157 M2896 M2120 M2157 M2896 M2899 M2120 M2157 M2896 M2120 M2157 M2120 M2157 M2896 M2120 M2157 M2896 M2120 M2157 M6042 M2896 M2120 M2157 M6042 M2896 M2120 M2157 M2896 M2120 M2157 M2896 M2120 M2157 M2899 M2798 M2157 M2896 M6042

M2117 M2158 M2897 M6043 M2117 M2158 M2897 M2117 M2158 M2897 M2117 M2158 M2897 M2900 M2117 M2158 M2897 M2117 M2158 M2117 M2158 M2897 M2117 M2158 M2897 M2117 M2158 M6043 M2897 M2117 M2158 M6043 M2897 M2117 M2158 M2897 M2117 M2158 M2897 M2117 M2158 M2900 M2796 M2158 M2897 M6043

M2118 M2159 M2898 M2888 M2118 M2159 M2898 M2118 M2159 M2898 M2118 M2159 M2898 M2901 M2118 M2159 M2898 M2118 M2159 M2118 M2159 M2898 M2118 M2159 M2898 M2118 M2159 M2888 M2898 M2118 M2159 M2888 M2898 M2118 M2159 M2898 M2118 M2159 M2898 M2118 M2159 M2901 M2797 M2159 M2898 M2888

S4

00

X X X X X X X X X X X X

10 10 10

X X X X X X X

10 10 10

X X X X X X X X

10 10 10

X X X X X X X X X X X X X X

10 10 10

X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-42

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Complete Harness

LH Harness

RH Harness

O-540-F1B5 (25°,260HP) O-540-F1B5 (25°,260HP) O-540-G1A5 (25°,260HP) O-540-G1A5 (25°,260HP) O-540-G1A5 (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G1A5-wd (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5 (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-G2A5-wd (25°,260HP) O-540-H1A5 (25°,260HP) O-540-H1B5D (25°,260HP) O-540-H2A5 (25°,260HP) O-540-H2A5 (25°,260HP) O-540-H2A5 (25°,260HP) O-540-H2B5D (25°,260HP) O-540-J1A5D (23°,235HP) O-540-J3A5 (23°,235HP) O-540-J3A5D (23°,235HP) O-540-J3C5D (25°,235HP) O-540-L3C5D (25°,235HP)

M2120 M2157 M2899 M2120 M2157 M2899 M2120 M2157 M2899 M2157 M2120 M2899 M2120 M2157 M2899 M2919 M2896 M2120 M2157 M2919 M2919 M2896 M2919 M2919 M2919

M2117 M2158 M2900 M2117 M2158 M2900 M2117 M2158 M2900 M2158 M2117 M2900 M2117 M2158 M2900

M2118 M2159 M2901 M2118 M2159 M2901 M2118 M2159 M2901 M2159 M2118 M2901 M2118 M2159 M2901

M2897 M2117 M2158

M2898 M2118 M2159

TIGO-541-D1B (20°,450HP) TIGO-541-E1A (20°,425HP)

M2890 M2890

M2891 M2891

M2892 M2892

X X

TIO-540-A1A (20°,310HP) TIO-540-A1B (20°,310HP) TIO-540-A2A (20°,310HP) TIO-540-A2B (20°,310HP) TIO-540-A2B (20°,310HP) TIO-540-A2C (20°,310HP) TIO-540-A2C (20°,310HP) TIO-540-AE2A (20°,350HP) TIO-540-AF1A (20°,270HP) TIO-540-AG1A (20°,270HP) TIO-540-C1A (20°,250HP) TIO-540-C1A (20°,250HP) TIO-540-F2BD (20°,325HP) TIO-540-J2B (20°,350HP) TIO-540-J2BD (20°,350HP) TIO-540-N2BD (20°,350HP) TIO-540-R2AD (20°,350HP)

M2037 M2037 M2037 M2037 M6044 M2037 M6044 M6044 M6044 M6044 M2120 M2851 M2918 M6057 M2918 M2918 M2918

M2041 M2041 M2041 M2041 M2965 M2041 M2965 M2965 M2965 M2965 M2117 M2853

M2039 M2039 M2039 M2039 M2966 M2039 M2966 M2966 M2966 M2966 M2118 M2852

X X X X

M6058

M6059

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X X X X X

10 10 10

X X X X X X

10 10 10

X X X X X X X X X

M2897

M2898

X X X X

HARNESSES 3/4”

Engine

S4

00

X X X X X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

X X X

PAGE NO.

REVISION

6-43

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine Engine - Model (Degree°, HP)

Complete Harness

LH Harness

RH Harness

M2965

M2966

X

M2965 M2965

M2966 M2966

X X

S4

00

TIO-540-S1AD (20°,300HP) TIO-540-U2A (20°,350HP) TIO-540-V2AD (20°,350HP) TIO-540-W2A (20°,350HP) TIO-540-W2B (20°,350HP)

M2997 M6044 M2995 M6005 M6044

TIO-541-A1A (20°,310HP) TIO-541-E1A4 (20°,380HP) TIO-541-E1B4 (20°,380HP) TIO-541-E1C4 (20°,380HP)

M2628 M2628 M2628 M2628

M2629 M2629 M2629 M2629

M2630 M2630 M2630 M2630

TIVO-540-A2A (25°,315HP)

M2480

M2481

M2482

TO-360-C1A6D (20°,210HP)

M2942

TVO-435-A1A (25°,260HP) TVO-435-B1A - 1/2" (25°,270HP) TVO-435-B1A - 1/2" (25°,270HP) TVO-435-B1A - 13/16" (25°,270HP) TVO-435-B1A - 13/16" (25°,270HP) TVO-435-B1B (25°,270HP) TVO-435-D1A (25°,270HP) TVO-435-D1B (25°,270HP) TVO-435-F1A (25°,280HP) TVO-435-F1A (25°,280HP) TVO-435-G1A (25°,280HP) TVO-435-G1B (25°,280HP)

M2865 M2865

M2866 M2866

M2867 M2867

M2447

M2448

M2449

M2865

M2866

M2867

M2447

M2448

M2449

X

M2447 M2447 M2865 M2865 M2447 M2447 M2865

M2448 M2448 M2866 M2866 M2448 M2448 M2866

M2449 M2449 M2867 M2867 M2449 M2449 M2867

X X

M2483 M2483

M2484 M2484

M2485 M2485

X X

M2483 M2483

M2484 M2484

M2485 M2485

X X

M2483 M2483

M2484 M2484

M2485 M2485

X X

M2483 M2483

M2484 M2484

M2485 M2485

X X

M2865

M2866

M2867

X

VO-435-A1B - 1/2" (25°,260HP) VO-435-A1B - 13/16" (25°,260HP) VO-435-A1C - 1/2" (25°,260HP) VO-435-A1C - 13/16" (25°,260HP) VO-435-A1D - 1/2" (25°,260HP) VO-435-A1D - 13/16" (25°,260HP) VO-435-A1E - 1/2" (25°,260HP) VO-435-A1E - 13/16" (25°,260HP) VO-435-A1F - 1/2" (25°,260HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

X X

X X X X X X

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2, 3

X X X X

X X X X X

PAGE NO.

REVISION

6-44

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming 0 0 00 20 -20 30 6 3 63 ;D ; ; S 00 00 ; 4 0; 20 -20 -12 -12 000 0 0 0 0 6 0 S4 S6 2 S4 S Notes D 42 62 6 00

Engine

S4

00

Complete Harness

LH Harness

RH Harness

VO-435-A1F - 13/16" (25°,260HP) VO-435-B1A - 1/2" (25°,265HP) VO-435-B1A - 1/2" (25°,265HP) VO-435-B1A - 13/16" (25°,265HP) VO-435-B1A - 13/16" (25°,265HP)

M2865

M2866

M2867

X

M2865 M2447 M2865

M2866 M2448 M2866

M2867 M2449 M2867

X

M2447

M2448

M2449

VO-540-A1A (25°,310HP) VO-540-B1A (25°,305HP) VO-540-B1B (25°,305HP) VO-540-B1B3 (25°,305HP) VO-540-B1C (25°,305HP) VO-540-B1D (25°,305HP) VO-540-B1F (25°,305HP) VO-540-B2A (25°,305HP) VO-540-B2D (25°,305HP) VO-540-C1A (25°,315HP) VO-540-C1B (25°,315HP) VO-540-C1C3 (25°,305HP) VO-540-C2A (25°,315HP) VO-540-C2C (25°,315HP)

M2480 M2480 M2480 M2831 M2480 M2480 M2480 M2480 M2480 M2480 M2480 M2715 M2480 M2697

M2481 M2481 M2481 M2832 M2481 M2481 M2481 M2481 M2481 M2481 M2481 M2716 M2481 M2698

M2482 M2482 M2482 M2833 M2482 M2482 M2482 M2482 M2482 M2482 M2482 M2717 M2482 M2699

X X X

X X X X X X X X X X X X X X

HARNESSES 3/4”

Engine - Model (Degree°, HP)

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

6-45/(6-46 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Section 7.0

SPARK PLUGS

SPARK PLUG APPLICATION

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

7-1/(7-2 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Curtiss-Wright

GR-2600; A2, A2A, A2B, B2, B5

x

GR-975; 13/16" reach cyl. GR-975; 1/2" reach cyl.

x

R-1300; 1A, 1B, 3, 3A, 3B, 3C, 3D R-1820; F-2A, F-3A, F-56, G-2, G-3, G-3B, G-5, G-5E R-2600; 11, 13, 3, 8 R-760; 13/16" reach cyl. R-760; 1/2" reach cyl. R-975; 13/16" reach cyl. R-975; 1/2" reach cyl.

x x x x

x x x

x x x x x

x

x

x

x x

Whirlwind-GR; 540E Whirlwind-J; 13/16" reach cyl. Whirlwind-J; 1/2" reach cyl. Whirlwind-R; 540E

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x

x

x

x

x x x

x x

Franklin

4A-235; B, B2, B3, B6 4A-235; B31, B4

6AS-335; A, B 6AS-350; A, A1 6V-350; A, B 6VS-335; A, A1, B, B1

89

03

01

x x x

RHM40E

RHM38E

x x x x

x

x x x x

x

ISSUED REVISED MO DAY YR MO DAY YR 01

x x

x

6A-335; B, B1A, D 6A-335; A 6A-350; C1, C1A, C2, C2A, D1, D1A, D1B 6A-350; C1L, C1R, D

11

RHB37E

x

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

SPARK PLUGS

2A-120; A, B, C, D

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

PAGE NO.

REVISION

7-3

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Jacobs

L-4 Series, L-5 Series, L-6 Series R-755; S, SM R-755; A1, A2, A2M, A2M1, B1, B2, B2M, E

x

x

x

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x

x

x x

x

Ken Royce

Ken Royce-7; F, G Ken Royce-90; 5G

x x

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x x

Kinner

B-5 Series, B-54 C-5 Series K-5 Series R-5 Series R-540; 1, 3 R-55, R-56

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

REM40E

3/4”-20 Thread Fine Wire Massive

x x x x x x

ISSUED REVISED MO DAY YR MO DAY YR 11

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x x x x x x

PAGE NO.

REVISION

7-4

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

LeBlond

LeBlond-110; 7DF LeBlond-70; 5DE, 5E LeBlond-85; 5DF, 5F LeBlond-90; 5F

x x x x

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x x x x

Menasco

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x x x

x x x

Pirate-A; 4 Pirate-B; 4 Pirate-C; 4 Pirate-M; 50

x x x x

x x x x

Super Buccaneer-C6S; 4

x

x

Super Pirate-D; 4 Super Pirate-D4; 87

x x

x x

SPARK PLUGS

Buccaneer-A; 6 Buccaneer-B; 6 Buccaneer-B6S

Pezetel

ASZ-62IR; 16, M18 PZL-3S, PZL-3S 2nd Series, PZL-3SR ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

x x

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x x

PAGE NO.

REVISION

7-5

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Pratt & Whitney

x

RHM40E

x

RHM38E

RHB37E

RHM38S

RHB36S

RHB32E

Double Wasp-Double Wasp Series

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x

R-1340 Wasp Series; 13/16" reach cyl. R-1340 Wasp Series; 1/2" reach cyl.

x

R-1800; Twin Wasp E1

x

R-1830; 49, 53, 57, 61, 65, 67, 75, 82, 86M2, 90B, 90C, 90D, 92, 92A, 94, 94M1, 94M2, 96, Twin Wasp Series

x

x

R-2000; 11, 11M1, 11M2, 11M3, 11M4, 3, 4, 4M1, 4M2, 7, 7M1, 7M2, 7M3, 9, 9A, 9M1, 9M2, 9M3, 9M4, 9M6

x

x

R-2800; 21, 21M1, 27, 27M1, 31, 31M1, 31M2, 51, 51M1, 51M2, 51M3, 51M4, 59, 59M1, 63, 71, 75, 75M1, 75M2, 75M3, 79, Twin Wasp Series R-2800; 97

x

x

x x

x

x

R-985; 13, 17, 19, 1M1, 23, 25, 27, 39, 39A, 48, 5, 50, AN, AN-1, AN-10, AN-12, AN-12B, AN-14B, AN-14BM1, AN-2, AN-3, AN-4, AN-5, AN-6, AN-6B, AN-8, Wasp Jr.

x

SR-1340 Wasp Series; E

x

x

x

x

x

x

x

Twin Wasp-S1C; G Twin Wasp-S1C3; G Twin Wasp-S3C4; G Twin Wasp-S4C4; G Twin Wasp-SC; G Twin Wasp-SC3; G

x x x x x x

Ranger

6-390; D3 6-410; B1, B1A, B2A, B2B, B3 6-440; C2, C3, C4, C5 ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

x x x Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x x x PAGE NO.

REVISION

7-6

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Superior Air Parts

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

x x

RHB36S

x x

RHB32S

REM40E

REM37BY

x x

3/4”-20 Thread Fine Wire Massive

REM38E

IO-360 O-360

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

Teledyne Continental Motors

x

x

x

x x

x

x x x

x x

A-75; 3 A-75; 6, 6J, 9, 9J A-75; 8, 8F, 8FJ, 8J

x x

C-115; 1, 2

x

x

x

x

x

C-125; 1, 2

x

x

x

x

x

C-145; 2, 2H, 2HP

x

x

x

x

x

x

x

C-75; 12, 12F, 12FH, 12FHJ, 12FJ, 12J, 15, 15F C-75; 8, 8F, 8FH, 8FHJ, 8FJ, 8J

x x

x

x

x x

x x

x

x

C-85; 14 C-85; 12, 12F, 12FH, 12FHJ, 12FJ, 12J, 14F, 15, 15F, 8, 8F, 8FHJ, 8FJ, 8J

x x

x

x

x x

x x

x

x

C-90; 12F, 12FH, 12FJ, 12FP, 14F, 14FH, 14FJ, 16F, 8F, 8FJ

x

x

x

E-165; 2, 3, 4

x

x

x

x

x

x

E-185; 1, 10, 11, 2, 3, 5, 8, 9

x

x

x

x

x

x

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

x

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

REM40E

REM38E

REM37BY

x

3/4”-20 Thread Fine Wire Massive

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

x

PAGE NO.

REVISION

7-7

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

SPARK PLUGS

A-65; 12, 12F, 12FJ, 12J, 14, 14F, 14FJ, 14J, 8FJ, 9, 9F, 9FJ, 9J A-65; 1, 7 A-65; 3, 6, 6J, 8, 8F, 8J

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive


L-1318

Teledyne Continental Motors

FSO-470; A

x

RHM40E

RHB37E

x

x

x

x

x

x

GTSIO-520; E GTSIO-520; C, D, F, H, K, L, M, N

x x x

x

x

x

x

IO-346; A, B

x

x

x

x

IO-360; B IO-360; DB IO-360; A, AB, C, CB, D, E, ES, G, GB, H, HB, J, JB, K, KB IO-470; A, C, G, J, K, P, R, T IO-470; H, M IO-470; D, E, F, L, LO, N, S, U, V, VO

x x x x x

x x x x x

x

x

x

x x x

x

x x

x

x

x x x x

x

x

x x

IO-520; A, B, BA, BB, C, CB, D, E, F, J, K, L, M, MB, N, NB

x

IO-550; A, D, E, F, G, L, N IO-550; B, C IO-550; P, R

x

IOF-240; B

x x

x x

x

x

IOF-550; B, C, D, E, F, L, N, P, R LIO-470; A

x

x x

x

IO-240; B

x x

x

x

x

LIO-520; P

x

x

x

LTSIO-360; E, EB, KB, RB

x

x

LTSIO-520; AE

x

O-200; A, B, C

x

O-300; A, B, C, D, E

x

ISSUED REVISED MO DAY YR MO DAY YR 89

x

x

GO-300; A, B, C, D, E, F

01

RHM38E

x

GIO-470; A

11

RHB32E

RHM38S

x

RHB36S

x

RHB32S

REM40E

REM37BY

x

3/4”-20 Thread Fine Wire Massive

REM38E

E-225; 2, 4, 8, 9

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

03

01

09

x

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

x

x

x

x

x

x

x

PAGE NO.

REVISION

7-8

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Teledyne Continental Motors

x

x x

RHM40E

x x x

RHM38E

RHB37E

RHB32E

RHM38S

x x

RHB36S

x x x x

RHB32S

REM40E

REM37BY

x x x

3/4”-20 Thread Fine Wire Massive

REM38E

O-470; 11, 13, 13A, 15, 4 O-470; B, G, H, M, N, P, R, S O-470; 2 O-470; B-C1, G-C1, K-C1, L-C1, M-C1 O-470; 11-C1, 11B, 11B-C1, A, E, J, K, L O-470; T, U

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x x x x

x x x x

x x

R-670; 11, 11A, 3, 4, 5, 8, A, B, C, D, E, F, G, H

x

R-9; A

x

x

x

TSIO-360; A, AB, B, C, D, DB, E, EB, F, FB, G, H, HB, JB TSIO-360; BB, CB, GB, KB, LB, MB, NB, PB, RB, SB

x

x

x x

x

TSIO-470; B, C, D

x

TSIO-520; AF, LB TSIO-520; A, BB, BE TSIO-520; AE, B, C, CE, D, DB, E, EB, G, H, J, JB, K, KB, L, M, N, NB, P, R, T, U, UB, VB, WB

x x

x x

x

x

x

x x x

TSIO-550; A, B, C, E

x

W-670; 16, 23, 24, 6A, 6N, K, M

x

x

x

x

x

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

x x

x x x x

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

x

RHB37E

x x x x

RHB32E

x x x x

RHM38S

x

RHB36S

x

RHB32S

x

x x

RHM40E

x x x

x

RHM38E

x x x x

REM40E

x x x x

REM38E

AEIO-360; A2A, A2C AEIO-360; A2B AEIO-360; A1D, A1E AEIO-360; B1D, B1F6, B2F6, H1A

x x

3/4”-20 Thread Fine Wire Massive

REM37BY

AEIO-320; D1B, D2B, E1A, E1B, E2A, E2B AEIO-320; A

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x

x

x x x x

x x x

PAGE NO.

REVISION

7-9

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

SPARK PLUGS

Textron-Lycoming


L-1318

Textron-Lycoming

RHM40E

x x x

RHM38E

x x x

x x x x

x x x

x x x x

x x x

x x x

x x x

RHB37E

x x

x x x x

RHB32E

x

RHM38S

x x x x

RHB36S

x

x x x x

RHB32S

AEIO-540; D4B5 AEIO-540; L1B5, L1B5D AEIO-540; D4A5, D4C5, D4D5 AEIO-540; L1D5

x x

REM40E

x x x x x

REM38E

x

3/4”-20 Thread Fine Wire Massive

REM37BY

REM38S

AEIO-360; B1H AEIO-360; A1C AEIO-360; A1A, A1B, A1B6 AEIO-360; A1E6 AEIO-360; B1B, B1F, B1G6, B2F, B4A, H1B

Engine

REB37E

REB36S

5/8”-24 Thread Fine Wire Massive

x

x

x

x

x

x

AIO-320; A1B, A2A, A2B, B1B, C1B AIO-320; A1A

x

x

x

x

x

x x

x x

AIO-360; A1A, A1B, A2A, A2B AIO-360; B1B

x x

x x

x x

x x

x x

x x

x x

GO-435; C2, C2A, C2A2, C2B, C2B1, C2B2, C2C, C2D, C2E, D1

x

x

x

x

x

x

x

x

x

x

GO-480; G1A6 GO-480; B, B1A6, B1B, B1C, B1D, C1B6, C1D6, C2C6, C2D6, C2E6, C3A6, D1A, F1A6, F2A6, F2D6, F3A6, F3B6, F4A6, F4B6, F6 GO-480; G1B6, G1D6, G1H6, G1J6, G2D6, G2F6 GO-480; E1A6

x

x

HO-360; A1A, C1A HO-360; B1A, B1B

x

x x x

x

01

89

03

01

x

x

x

x x

x x

x x

x

x

x

x

x x

x

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

x

x x

x x x

x x

x x x

09

x

x

IGO-480; A1A6, A1B6

11

x x

x

x

x x

ISSUED REVISED MO DAY YR MO DAY YR

x

x

GSO-480; B1A6, B1B3, B1B6, B1C6, B1E6, B1G6, B1J6, B2C6, B2D6, B2G6, B2H6 GSO-480; A1C6, A2A6 GSO-480; B1F6 GSO-480; A1A6 HIO-360; E1BD HIO-360; A1A, A1B, B1A, B1B HIO-360; C1A, C1B, D1A HIO-360; E1AD, F1AD

x

x

x

x x x

x

PAGE NO.

REVISION

7-10

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming

x

IO-320; 13/16" reach cyl. IO-320; C1B IO-320; F1A IO-320; A1A, A2A, B1A, B1B, B1C, B1D, B1E, B2A, D1A, D1B, D1C IO-320; E1A, E2A, E2B IO-320; E1B IO-320; 1/2" reach cyl.

x x

IO-360; C1A IO-360; F1A IO-360; A1B6 IO-360; A1B6D IO-360; A1A IO-360; A1B IO-360; C1B IO-360; A1C, A1D6, A1D6D, A2A, A2B, A2C, A3B6, A3D6D, C1C, C1C6, C1D6, C1E6, C1E6D, C1F, D1A, J1A6D, J1AD IO-360; A1D IO-360; B1A, B1C, B1D, B1E, B1F, B1F6, B1G6, B2E-nd, B2E-wd, B2F, B2F6, B4A, E1A IO-360; B1B IO-360; A3B6D IO-360; K2A, L2A IO-360; M1A IO-360; C1G6

x x x

IO-540; P1A5, R1A5 IO-540; K1A5, K1A5D, K1B5D, K1G5D, K1H5, K1J5, K2A5 IO-540; K1C5, K1D5, K1E5D, K1F5, K1F5D, K1G5, K1J5D, K1K5 IO-540; E1A5, E1B5, E1C5, K1B5 IO-540; J4A5 IO-540; K1E5

x x x

x x x

x x x

x x x

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

x x

x x

x x x x x x x x

x

x

x

x

x

x x x

x

x

x x

x x x x

x x

x x x x x x x x

x x x x x

x x

x x

x x

x x x x

x x

x x x

x

x x

x x

x x

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

x

x

x x

x x x

x x x x x x x x

x x

x

x x x x

x x

x

x

x

x x x x x

x x

x

x x

x x x

x x x

x

RHM40E

x

x x

x x x

x

x

x x x x

x

RHM38E

x

RHB37E

x x

RHB32E

x

x x

x x

x x x

x

x

x x

x x x

x x x

x

x x

x x

x x x

x

x x

x x

x

x

x x x

PAGE NO.

REVISION

7-11

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

SPARK PLUGS

IGSO-540; B1A, B1C IGSO-540; A1A, A1C, A1D, A1E, A1F, A1H

x

RHM38S

x

RHB36S

x

RHB32S

IGSO-480; 13/16" reach cyl. IGSO-480; 1/2" reach cyl.

3/4”-20 Thread Fine Wire Massive REM40E

x

REM38E

x

Engine

REM37BY

REB37E

IGO-540; A1A, A1B, A1C, B1A, B1B, B1C

REB36S

REM38S

5/8”-24 Thread Fine Wire Massive


L-1318

Textron-Lycoming

IO-720; 13/16" reach cyl. IO-720; 13/16" reach cyl. IO-720; 1/2" reach cyl.

RHB32E

RHB37E

REM40E

REM38E

x x

x x x

x x x

x x x

x

x x x

x x x

x

RHM40E

RHM38S

x x

x x x x

RHM38E

RHB36S

REM37BY

x x

x x

x x x

x x x

x x x

x

x x x

x x x

x x x

x x

x

x

x

x x

x x

x x

x

x x

x x

LHIO-360; C1A, C1B LHIO-360; F1AD

x

x x

LIO-320; C1A LIO-320; B1A

x x

LIO-360; C1E6 LO-360; A1G6D, A1H6 LO-360; E1A6D, E1AD, E2AD, E2BD

x x

x

x

x

x

x x

x

x x

LTO-360; E1A6D LTO-360; A1A6D

x x

x x

O-235; C1, C1B, C1C, C2A, C2B, C2C, E1, E1B, E2A, E2B, F1, F1B, F2A, F2B, G1, G1B, G2A, G2B, H2C, J2A, J2B, K2A, K2B, K2C, L2A, L2C, M1, M2C, M3C, N2A, N2C, P1, P2A, P2C, P3C ISSUED REVISED MO DAY YR MO DAY YR 09

x

x

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

x

x x

x

LTIO-540; F2BD, J2BD, N2BD, R2AD LTIO-540; J2B, K1AD, U2A, V2AD, W2A

01

x

x

x

03

x

x

IVO-540; A1A

89

x

x

x

01

x

x

IVO-360; A1A

11

x

RHB32S

IO-540; M1A5, M1A5D, M1B5D, M1C5, M2A5D, S1A5, U1A5D, U1B5D IO-540; N1A5 IO-540; AA1A5, AA1B5 IO-540; G1A5, G1B5, G1C5, G1D5, G1E5 IO-540; AC1A5 IO-540; A1A5, B1A5, B1B5, B1C5, C1B5, C1C5, C2C, C4B5, C4C5, C4D5, C4D5D, D4B5, D4C5, L1A5, L1A5D, L1B5D, L1C5, T4A5D, T4B5, T4B5D, T4C5D, V4A5D IO-540; AB1A5, D4A5 IO-540; W1A5, W1A5D, W3A5D IO-540; G1F5 IO-540; C4B5D

REB37E

Engine

3/4”-20 Thread Fine Wire Massive

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x

x x x

x

x

x

x x

x x

x x

x

x

x

x

x x

x x

x x

x

x x

x x

x

PAGE NO.

REVISION

7-12

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Textron-Lycoming

RHM38E

RHM40E

x x

x

x x

x x x

x x x

x x x

x x x

x x x

x x x

x x x

x

RHB37E

x x

RHB32E

x

RHM38S

x

RHB36S

REM40E

x x

RHB32S

REM38E

3/4”-20 Thread Fine Wire Massive

REM37BY

O-290; A, AP, B, C, CP, D2A, D2B, D2C O-290; D, D2

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

O-320; D1A, D1B, D1C, D1D, D1F, D2A, D2C, D2F, D2G, D2H, D2J, D3G, E2A, E2C O-320; D2B O-320; A1A, A1B, A2A, A2B, A2D, A3A, A3B, A3C, B1A, B1B, B2A, B2B, B2C, B2D, B3A, B3B, B3C, C1A, C1B, C2A, C2B, C2C, C3A, C3B, C3C, E1A, E1B, E1C, E1F, E1J, E2B, E2D, E2F, E2G, E2H, E3D, E3H O-320; A2C O-320; H1AD, H1BD, H2AD, H2BD, H3AD, H3BD

x

x x

x x

x

x x

x x

O-340; A1A, A2A, B1A

x

x

x

x

x

x

O-360; A1A-nd, A1A-wd, A1AD, A1C, A1D, A1F, A1F6, A1F6D, A1G, A1G6, A1G6D, A1H, A1LD, A1P, A2A, A2D, A2E, A2F, A2G, A2H, A3A, A3AD, A3D, A4A, A4AD, A4D, A4G, A4J, A4K, A4M, A4N, A4P, A5AD, B1A, B1B, B2A, B2B, B2C, C1A, C1C, C1E, C1F, C1G, C2A, C2B, C2C, C2D, C2E, C4F, C4P, D1A, D2A, D2B, F1A6 O-360; A1H6 O-360; E1A6D, E1AD, E1BD, E2AD, E2BD, G1A6, J2A

x

x

x

x

x

x

x

x

x x

x x

x

x x

x x

x x

x

x x

x

x

x

x

O-435; A, A2, C2 O-435; C, C1, K, K1 O-435; B O-435; 1/2" reach cyl., 25

x x x

O-540; L3C5D O-540; A1A, A1A5, A1B5, A1C5, A1D, A1D5, A2B, A3D5, A4A5, A4B5, A4C5, A4D5, B1A5, B1B5, B1D5, B2A5, B2B5, B2B5-wd, B2C5, B2C5-wd, B4A5, B4B5, B4B5-wd, E4A5, E4B5, E4B5-wd, E4C5, F1A5, F1B5, G1A5, G1A5-wd, G2A5, G2A5-wd, H1A5, H1A5D, H1B5D, H2A5, H2A5D, H2B5D, J1A5D, J1B5D, J1C5D, J1D5D, J2A5D, J2B5D, J2C5D, J2D5D, J3A5, J3A5D, J3C5D O-540; D1A5

x x

R-680; 2, 5, 6, B2, B4, B4B, B4C, B4D, B4E, B5, B6, D5, D6, E1, E2, E3, E3A, E3B R-680; 4

x

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

x x x x

x

x

x

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

x x

x

x x

x

x

x

x

PAGE NO.

REVISION

7-13

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

SPARK PLUGS

x


L-1318

Textron-Lycoming

TIGO-541; B1A, C1A, D1A, D1B, E1A, G1AD

x

TIO-360; C1A6D TIO-360; A1A, A1B, A3B6

x x

TIO-540; A1A, A1B, A1C, A2A, A2B, A2C, AA1AD, AB1AD, AB1BD, AE2A, AF1A, AF1B, AG1A, AH1A, AJ1A, C1A, E1A, F2BD, G1A, H1A, J2BD, K1AD, N2BD, R2AD, S1AD, T2AD, V2AD TIO-540; U2A, W2B TIO-540; J2B, W2A TIO-540; AK1A

x

x

x

x

x

x

x

x x

x

x

x

x

x

x x

x x

x x x

x x x

x

TIO-541; A1A, E1A4, E1B4, E1C4, E1D4

x x

x

x

TIVO-540; A2A

x

TO-360; C1A6D, E1A6D, F1A6D TO-360; A1A6D

x x

x x

x

x x x

x x x

x

TVO-435; A1A, C1A, D1A, E1A, F1A, G1A, G1B TVO-435; B1B, D1B TVO-435; 13/16" reach cyl. TVO-435; 1/2" reach cyl.

x x

VO-360; A1A, A1B, B1A

x

VO-435; 13/16" reach cyl. VO-435; 1/2" reach cyl.

x

x

x

x

x

x

x

x

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

x x

x

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

x x

x x

x

x

x

VO-540; A1A, A2A, B1A, B1B, B1B3, B1C, B1D, B1E, B1F, B1H3, B2A, B2C, B2D, B2E, B2G, C1A, C1B, C1C3, C2A, C2B, C2C

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

x

x

x

x

x

x

x

x

PAGE NO.

REVISION

7-14

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Warner

RHM40E

RHM38E

RHB37E

RHB32E

RHM38S

RHB36S

RHB32S

3/4”-20 Thread Fine Wire Massive REM40E

REM38E

REM37BY

REB37E

Engine

REM38S

REB36S

5/8”-24 Thread Fine Wire Massive

Scarab-Series; 28, 29, 30, 40, 50

x

x

Scarab Jr.-Series; 40, 50

x

x

Super Scarab-165 Super Scarab-165; A, B, D

x x

x x

Super Scarab-185 Super Scarab-185; J, K

x x

x x

Super Scarab-Series; 40, 50, 50A

x

x

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

7-15/(7-16 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

APPENDIX

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

A-1/(A-2 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Kit Contents (3/4” Spark Plug)

Kit PN

L MAG

R MAG

Comp. Harness

Clamp Kit

Gasket

Stud(s)

Adapter(s)

Champion® Aviation Spark Plug Notes

K4315

4371

4370

M2508

M3784

2ea. M3426

N/A

N/A

-37

2

K4316

4372

4370

M2508

M3784

2ea. M3426

N/A

N/A

-37

2

K4317

4373

4370

M2508

M3784

2ea. M3426

N/A

N/A

-37

2, 3

K4325

4371

4371

M2508

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-37

2

K4326

4373

4373

M2508

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-36S

K4392

4392

4392

M4049

M3784

2ea. M3411

N/A

N/A

-32

K4548

4372

4372

M4029

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-37

2, 3

K4549

4372

4370

M4029

M3784

2ea. M3426

N/A

N/A

-37

2, 3

K6313

6309

6313

M2381

M3328

2ea. M3411

N/A

N/A

-32

K6316

6351

6350

M2899

M3784

2ea. M3426

N/A

N/A

-32

K6317

6355

6350

M2896

M3784

2ea. M3426

N/A

N/A

-38

K6320

6310

6310

M2381

M3328

2ea. M3411

N/A

N/A

-32

K6321

6320

6320

M2780

M3328

2ea. M3411

N/A

N/A

-32

K6322

6314

6314

M2778

M3328

2ea. M3411

N/A

N/A

-38

K6323

6324

6324

M2778

M3328

2ea. M3411

N/A

N/A

-38

K6325

6355

6355

M2896

M3784

2ea. M3426

N/A

N/A

-38

K6328

6320

6320

M2779

M3328

2ea. M3411

N/A

N/A

-32

K6377

6377

6377

M6071

M3328

2ea. M3411

N/A

N/A

-38

8

K6379

6379

6379

M6071

M3328

2ea. M3411

N/A

N/A

-38

8

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2, 3

7

PAGE NO.

REVISION

A-3

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT CONTENTS

L-1318


L-1318

Kit Contents (5/8” Spark Plug)

Kit PN

L MAG

R MAG

Comp. Harness

Clamp Kit

Gasket

Stud(s)

Adapter(s)

Champion® Aviation Spark Plug Notes

K4334

4333

4333

M2045

M3784

2ea. M3411

N/A

N/A

-37BY

4

K4516

4371

4370

M4001

M3784

2ea. M3426

N/A

N/A

-36S

2

K4517

4373

4370

M4004

M3784

2ea. M3426

N/A

N/A

-36S

2

K4518

4373

4370

M4005

M3784

2ea. M3426

N/A

N/A

-37BY

2

K4520

4301

4301

M1780

M3328

2ea. M3411

N/A

N/A

-37BY

5

K4522

4302

4302

M2045

M3784

2ea. M3411

N/A

N/A

-37BY

K4525

4371

4371

M4001

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-36S

2

K4526

4330

4330

M4000

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-37

2

K4527

4371

4371

M4002

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-37BY

2, 3

K4528

4373

4373

M4004

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-36S

2, 3

K4529

4381

4381

M4001

M3784

2ea. M3426

N/A

N/A

-37BY

2

K4530

4372

4370

M4004

M3784

2ea. M3426

N/A

N/A

-37

2

K4532

4372

4372

M4004

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-37

2, 3

K4534

4372

4372

M4001

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-37BY

2

K4535

4345

4370

M4012

M3784

2ea. M3426

N/A

N/A

-37BY

1, 2, 3

K4536

4347

4370

M4004

M3784

2ea. M3426

N/A

N/A

-37

2

K4537

4381

4370

M4001

M3784

2ea. M3426

N/A

N/A

-37BY

2

K4539

4347

4370

M4007

M3784

2ea. M3426

N/A

N/A

-37BY

2

K4540

4373

4354

M4000

M3784

2ea. M3426

N/A

N/A

-36S

2

K4541

4347

4370

M4014

M3784

2ea. M3426

N/A

N/A

-37BY

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2, 3

PAGE NO.

REVISION

A-4

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Kit Contents (5/8” Spark Plug)

Kit PN

L MAG

R MAG

Comp. Harness

Clamp Kit

Gasket

Stud(s)

Adapter(s)

Champion® Aviation Spark Plug Notes

K4542

4373

4353

M4005

M3784

2ea. M3426

N/A

N/A

-37BY

2, 3

K4543

4347

4342

M4004

M3784

2ea. M3426

N/A

N/A

-37BY

2, 3

K4545

4345

4345

M4007

M3784

2ea. M3426

N/A

N/A

-37BY

1, 2, 3

K4547

4372

4372

M4027

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-37BY

2, 3

K4565

4372

4370

M4001

M3784

2ea. M3426

N/A

N/A

-37BY

2

K4566

4372

4370

M4027

M3784

2ea. M3426

N/A

N/A

-37BY

2, 3

K4567

4373

4370

M4006

M3784

2ea. M3426

N/A

N/A

-36S

2, 3

K4568

4373

4370

M4027

M3784

2ea. M3426

N/A

N/A

-37BY

2, 3

K4575

4373

4373

M4000

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-36S

K4576

4373

4373

M4005

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-37BY

2, 3

K4577

4373

4373

M4006

M3784

1ea. M3410; 2ea. M3426

2ea. M3413 Mounting Stud

1ea. M2638-4

-36S

2, 3

K6326

6367

6367

M2938

M3520

2ea. M3411

N/A

N/A

-37BY

K6327

6364

6364

M2932

M3520

2ea. M3411

N/A

N/A

-37BY

K6513

6309

6313

M2828

M3328

2ea. M3411

N/A

N/A

-38

K6516

6351

6350

M2883

M3784

2ea. M3426

N/A

N/A

-38

K6518

6351

6350

M6001

M3784

2ea. M3426

N/A

N/A

-36S

K6519

6351

6350

M6000

M3784

2ea. M3426

N/A

N/A

-36S

K6520

6310

6310

M2828

M3328

2ea. M3411

N/A

N/A

-38

K6526

6355

6355

M6002

M3784

2ea. M3426

N/A

N/A

-38

K6535

6393

6350

M6002

M3784

2ea. M3426

N/A

N/A

-36S

K6536

6393

6350

M6014

M3784

2ea. M3426

N/A

N/A

-36S

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

2

PAGE NO.

REVISION

A-5

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

KIT CONTENTS

L-1318


L-1318

Kit Contents (5/8” Spark Plug)

Kit PN

L MAG

R MAG

Comp. Harness

Clamp Kit

Gasket

Stud(s)

Adapter(s)

Champion® Aviation Spark Plug Notes

K6565

6355

6350

M6002

M3784

2ea. M3426

N/A

N/A

-38

K6566

6355

6350

M6004

M3784

2ea. M3426

N/A

N/A

-38

K6577

6377

6377

M6068

M3328

2ea. M3411

N/A

N/A

-37BY

8

K6579

6379

6379

M6068

M3328

2ea. M3411

N/A

N/A

-37BY

8

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

PAGE NO.

REVISION

A-6

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Lag Angle

Weight (lbs)

Clamp Kit

SlickSTART™

Notes

Rotation

Mag Type

4301 4302 4303 4309 4310

25° 0° 30° 0° 30°

4.92 4.17 4.92 4.17 4.17

M3328 M3784 M3784 M3328 M3328

SS1001 SS1001 SS1001 SS1001 SS1001

5

Left Right Left Left Left

IC DD IC DD RB

4316 4330 4331 4333 4342

25° 25° 0° 25° 0°

4.92 4.92 4.17 4.92 4.17

M3328 M3784 M3483 M3784 M3784

SS1001 SS1001 SS1001 SS1001 SS1001

Right Right Right Right Left

IC IC DD IC TD

4344 4345 4347 4348 4353

0° 15° 25° 25° 0°

4.17 4.17 4.17 4.17 4.17

M3784 M3784 M3784 M3784 M3784

SS1001 SS1001 SS1001 SS1001 SS1001

Right Left Left Right Left

TD RB RB RB TD

4354 4370 4371 4372 4373

25° 0° 20° 15° 25°

4.92 4.17 4.92 4.92 4.92

M3784 M3784 M3784 M3784 M3784

SS1001 SS1001 SS1001 SS1001 SS1001

Left Left Left Left Left

TD DD IC IC IC

4374 4381 4392 6309 6310

15° 5° 30° 35° 30°

4.92 4.92 4.92 4.17 4.92

M3784 M3784 M3784 M3328 M3328

SS1001 SS1001 SS1001 SS1001 SS1001

Right Left Right Right Right

IC IC IC RB IC

6313 6314 6320 6324 6331

0° 30° 30° 30° 35°

4.17 4.92 4.92 4.92 4.92

M3328 M3328 M3328 M3328 M3784

SS1001 SS1001 SS1001 SS1001 SS1001

Right Left Right Left Right

DD IC ICP ICP ICP

6340 6350 6351 6355 6360

0° 0° 35° 45° 0°

4.00 4.17 4.92 4.92 4.20

M3784 M3784 M3784 M3784 M3784

SS1001 SS1001 SS1001 SS1001 SS1001

Right Left Left Left Left

DDP DD IC IC DDP

6361 6362 6363 6364 6365

35° 30° 30° 35° 25°

4.92 4.92 4.17 4.92 4.17

M3784 M3328 M3784 M3520 M3784

SS1001 SS1001 SS1001 SS1001 SS1001

Left Right Left Left Left

ICP IC RBP IC RBP

Model

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

4

1

7

6

PAGE NO.

REVISION

A-7

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

MAGNETOS (IN PRODUCTION)

Magnetos (In Production)


L-1318

Magnetos (In Production) Lag Angle

Weight (lbs)

Clamp Kit

SlickSTART™

6367 6371 6377 6379 6380

35° 0° 45° 45° 30°

4.92 4.17 4.92 4.92 4.92

M3520 M3784 M3328 M3328 M3328

SS1001 SS1001 SS1001 SS1001 SS1001

6382 6390 6391 6393 6394

30° 0° 25° 37° 30°

4.92 4.17 4.17 4.17 4.17

M3328 M3784 M3784 M3784 M3784

SS1001 SS1001 SS1001 SS1001 SS1001

6399

35°

4.92

M3970

SS1001

Model

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

8 8

6

Rotation

Mag Type

Right Left Left Left Right

IC TD IC IC IC

Right Left Right Left Right

IC TD RBP RB RBP

Right

IC

PAGE NO.

REVISION

A8

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


L-1318

Lag Angle

Weight (lbs)

Rotation

Mag Type

4201 4202 4203 4216 4230

25° 0° 30° 25° 25°

4.92 4.17 4.92 4.92 4.92

SS1001 SS1001 SS1001 SS1001 SS1001

Left Right Left Right Right

IC DD IC IC IC

4242 4244 4245 4247 4248

0° 0° 15° 25° 25°

4.17 4.17 4.17 4.17 4.17

SS1001 SS1001 SS1001 SS1001 SS1001

Left Right Left Left Right

TD TD RB RB RB

4250 4251 4253 4254 4270

0° 20° 0° 25° 0°

4.17 4.92 4.17 4.92 4.17

SS1001 SS1001 SS1001 SS1001 SS1001

Left Left Left Left Left

DD IC TD TD DD

4271 4272 4273 4274 4281

20° 15° 25° 15° 5°

4.92 4.92 4.92 4.92 4.92

SS1001 SS1001 SS1001 SS1001 SS1001

Left Left Left Right Left

IC IC IC IC IC

6210 6214 6220 6224 6250

30° 30° 30° 30° 0°

4.92 4.92 4.92 4.92 4.17

SS1001 SS1001 SS1001 SS1001 SS1001

Right Left Right Left Left

IC IC ICP ICP DD

6251 6252 6255 6260 6261

35° 45° 45° 0° 35°

4.92 4.92 4.92 4.20 4.92

SS1001 SS1001 SS1001 SS1001 SS1001

Left Left Left Left Left

IC IC IC DDP ICP

6262 6263 6264 6267 6271

30° 30° 35° 35° 0°

4.92 4.17 4.92 4.92 4.17

SS1001 SS1001 SS1001 SS1001 SS1001

Right Left Left Right Left

IC RBP IC IC TD

6280 6282 6290 6293

30° 30° 0° 37°

4.92 4.92 4.17 4.17

SS1001 SS1001 SS1001 SS1001

Right Right Left Left

IC IC TD RB

Model

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Clamp Kit

SlickSTART™

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 © 2009 Champion Aerospace LLC

Notes

1

PAGE NO.

REVISION

A-9/(A-10 Blank)

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page

MAGNETOS (INACTIVE

Magnetos (Inactive)


L-1318

Volkswagen Conversion Application Engine Make

Model

Plug Size

Harness Part Number

Left Magneto Model

Right Magneto Model

Great Plains

.

5/8

M2266

4316

4316

HAPI HAPI

E G

5/8 5/8

M2266 M2266

4316 4316

4316 4316

Notes

VOLKSWAGEN CONVERSION APPLICATION

NOTE: Two cylinder engine applications utilize Slick Magneto PN: 2316. Champion Aerospace does not currently offer a harness for two cylinder engine applications.

ISSUED REVISED MO DAY YR MO DAY YR 11

01

89

03

01

09

Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 Š 2009 Champion Aerospace LLC

PAGE NO.

REVISION

A-11

H

CHAMPION AEROSPACE LLC PROPRIETARY INFORMATION - Subject to the restrictions on the Title page


Champion Aerospace LLC 1230 Old Norris Road Liberty, South Carolina, U.S.A. 29657 http:\\www.championaerospace.com

Form L-1318H

Champion Aerospace, Slick, and LASAR® are registered trademarks of Champion Aerospace LLC © 2009 Champion Aerospace LLC


General Aviation

AIRCRAFT AIR FILTERS Cleaning Instructions for FAA-PMA Dry-Type Filters & Replacement Filter Application Information Document Number P469075* Rev 7

Thank you for choosing Donaldson replacement air filters. Donaldson air filters are specially designed for your aircraft engine. To properly maintain your air intake system, please follow the recommended service guidelines and cleaning instructions detailed in this document.

General Service Guidelines

Cleaning Instructions

Storage

The air filter can be cleaned either by compressed air or washing in a solution of water and detergent (any general purpose detergent may be used). The compressed air cleaning method is recommended when the air filter has only dust on it. Washing is recommended when the air filter contains a combination of dust and oil or carbon. The instrument air filters (noted on back page) are NOT cleanable.

When storing new and cleaned air filters, be sure they are protected from dust and potential damage.

Recommended Service Schedule Replace your air filter after three years, five cleanings or 500 flight hours; whichever occurs first. DO NOT over-service the filter. Over-servicing increases the risk of damage to the air filter from excessive handling and unnecessarily exposes the engine to dirty air.

Service Guidelines Maintain the filter housing and air transfer duct so there are no dust leaks to the engine.

• DO NOT install a wet air filter on the engine; i.e., after cleaning. • DO NOT clean or reuse damaged filters. • DO NOT use solvents or gasoline to clean filters. Put a mark on the filter each time it is cleaned to keep track of the number of cleanings. • DO NOT apply oil to the filter before or after servicing.

Pre-Flight Inspection Visually inspect the air filter without removing it from the housing during each pre-flight inspection. Remove and clean the filter only if excessive dust or other contaminants are visible.

Compressed Air Cleaning 1. To prevent damage to the air filter, use compressed air less than 10 psi, and keep the nozzle at least one inch away from the filter. 2. Blow the compressed air through the filter in the direction opposite the normal airflow (opposite the airflow arrow). 3. Blow air through the filter until no more dust is being removed. The filter is ready for inspection.

Detergent & Water Cleaning 1. Remove loose dust by running water through the filter in the opposite direction of the normal airflow. Use a gentle water stream of less than 40 psi. 2. Mix 1 ounce of detergent per 2 gallons of water, warm or cold, soft or hard (one cup per 16 gallons). Soak the filter in the solution for 15 minutes. Do not soak more than 24 hours. Swish the filter element around in the solution to help remove dirt. 3. Rinse the filter opposite the airflow with a gentle stream of water (less than 40 psi) to remove all suds and dirt. If the clean side has been contaminated with dirty water during the soak cycle, rinsing from both sides will be necessary. 4. Dry the filter thoroughly before reuse. Warm air of less than 160°F must be circulated. Do not use a light bulb to dry the filter. The filter is now ready for inspection.

Inspection 1. Look through the filter toward a bright light. Inspect the filter thoroughly from all sides for holes and tears in the filter media. 2. Check the filter for damaged metal parts. DO NOT reuse damaged filters. 3. If your filter contains a gasket, inspect the gasket for damage. If it is not smooth and flat, replace the gasket, because the seal may not be air tight. If your filter does not contain gaskets, be sure the sealing surface is smooth and flat.

Installation

* This document replaces bulletins 1400-26 and P478873.

1. Inspect the housing surface on which the filter seals. It must have a clean, smooth and flat surface. 2. Reinstall the filter. Be sure it is mounted securely and there are no dust leaks past the edge of the filter and gasket. 3. This a dry-type filter – DO NOT apply oil to the filter.


FAA/PMA Eligibility List Donaldson Part Number

OEM Part & Serial Numbers

CESSNA

P10-7210

P10-7150 C-294510-0201 120, 140, A.............................ALL 150, 150A-H, J-M..................ALL F150G-H, J-M........................ALL A150K-M................................ALL FA150K-L...............................ALL 152, A152...............................ALL F152, FA152...........................ALL

P10-7172 C-294510-0301 170, 170A-B...........................ALL 172, 172A-I ...........................ALL 172K-N, P, Q..........................ALL F172D-H, K-N, P...................ALL

P198281

P198281, CA3559

172S........................................08001 & ON 172R........................................80001 thru 08816, 80018 thru 80585 (if SB98-71-02 is complied with) 172R........................................80586 & ON

P10-7336 C-294510-0401 FR172E-H, J-K.......................ALL R172K.....................................ALL T41A-D...................................ALL

AM102635EA* C-294510-0401 R172E-H, J, K........................ALL

P10-8337 C-294510-0501 AM102035FP* C-294510-0501 172RG.....................................ALL

P11-0172 C-294510-0601 AM107635FP* C-294510-0601 177, A-B.................................ALL 177RG.....................................ALL

P10-6150**

0750038-4

180A-H, J-K...........................ALL 182, 182A-R ..........................ALL 182S........................................18280945 & UP 182T, T182T............................ALL 185, 185A-E ..........................ALL A185E, A185F .......................ALL F182P-Q.................................ALL

P198290

P198290, CA3717

182S........................................80001 thru 80244 (if SB98-71-02 is complied with) 182S........................................80245 thru 80944

P13-1367 C-294510-0901 R182........................................ALL T182........................................ALL TR182.....................................ALL

P10-7188 C-294510-0101 188, A.....................................ALL 188B.......................................thru 18801825 A188, A...................................ALL A188B.....................................thru 18801825

P11-2206

1250704-3

U206F ....................................U20602200 & UP U206G ...................................ALL 207, A.....................................ALL 210G-H, J-N, R......................ALL

AM102135FP

Donaldson Part Number

1250704-3

206..........................................ALL 207..........................................ALL 210..........................................ALL

AM102235FP

1250704-4

P11-3206

1250704-4

210..........................................ALL

T210K-M................................ALL T210N.....................................thru 21064135

OEM Part & Serial Numbers 1250846-1

TU206A-G..............................ALL TP206A-E...............................ALL T207, A...................................ALL T210G-H, J-N........................ALL T210R.....................................ALL

AM101935FP* 1250846-1

Donaldson Part Number

OEM Part & Serial Numbers

P12-8157 9910141-1 AM103035EA* 9910141-1 404..........................................ALL

BEECHCRAFT P12-2322

169-380064-3

P617058

169-380011

P13-0374

45-921210, 13917

P10-2646

35-380035-3

P10-5304

35-380035-1, 35-380035-5

P13-7627

35-380035-7

P13-6680

105-389000-3

P13-3881

P133881

TP206A-G..............................ALL T207, A...................................ALL T210G-H, K-N........................ALL 210-5, A..................................ALL

B19.........................................MB866 & UP C23..........................................M1971, M1980 & UP C24R.......................................MC533, MC537 & UP

P13-1364 C-294510-0801

19A.........................................ALL 23............................................ALL A23.........................................ALL A23A.......................................ALL A23-19....................................ALL B23.........................................ALL A23-24....................................ALL

T210N . ..................................21064136 & UP T210R.....................................ALL TP210N..................................ALL TP210R...................................ALL

P197268

P197268

T206H.....................................ALL

P10-7336 C-294510-0401 337E-H....................................ALL

P10-9337 C-294510-0701 337E-H....................................ALL P337G, H................................ALL T337E-H.................................ALL

AM102335FP C-294510-0701 337, 337A-H...........................ALL T337 B-H................................ALL P337H.....................................ALL T337-SP.................................ALL

P10-8337 C-294510-0501 T337E-H.................................ALL

AM102035FP* C-294510-0501 337, 337A-H...........................ALL T337 B-H................................ALL P337H.....................................ALL T337-SP.................................ALL

P13-8988 C-294510-1001 P14-8670 C-294510-0902 T303........................................ALL

AM102735EA 9910018-2 310L, N, P, Q..........................ALL T310L, N, P, Q........................ALL 320D-F....................................ALL 401, A-B.................................ALL 402, A-B.................................ALL

P12-6138 9910200-1 AM102935EA* 9910200-1 310R........................................ALL

P10-8421

9910018-1***

T310R.....................................ALL 310P, Q (w/SK402-27)...........ALL 320, A-F (w/SK402-27)..........ALL 335..........................................ALL 401, A-B (w/SK402-27)..........ALL 402, A-B (w/SK402-27)..........ALL 402B.......................................0801 & UP 421, A-C.................................ALL

AM106735EA* 9910018-1***

T310R.....................................ALL 310P, Q (w/SK402-27)...........ALL 320, A-F (w/SK402-27)..........ALL 401, A-B (w/SK402-27)..........ALL 402, A-B (w/SK402-27)..........ALL 402B.......................................0801 & UP 421, A-C.................................ALL

P12-8156

9913001-1

340, 340A...............................ALL 414, 414A...............................ALL 402C........................................ALL

35-33.......................................ALL 35-B33....................................ALL 35-C33....................................ALL E33..........................................ALL F33..........................................ALL B35.........................................D-2606 thru D-2631 C35..........................................ALL D35.........................................ALL E35..........................................ALL F35..........................................ALL G35.........................................ALL H35.........................................ALL J35..........................................ALL K35..........................................ALL M35........................................ALL N35.........................................ALL P35..........................................ALL

S35 ........................................D7310-D7626, D7643 thru D7650, D7671

36............................................E-1 thru E-184 A36.........................................E-185 thru E-1304 C33A.......................................ALL E33A.......................................ALL F33A.......................................CE-290 thru CE-792 F33C........................................CJ-26 thru CJ-148 G33.........................................CD-1255 thru CD-1304 S35..........................................D-7627, D7634 thru D-7650, D-7672 thru D-7976 V35..........................................D-7977 thru D-8598 V35A.......................................D-8599 thru D-9068 V35B.......................................D-9069 thru D-10151 V35TC.....................................D-9069 thru D-10151 A36.........................................E-1305 thru E-3635 A36TC.....................................ALL B36TC.....................................ALL F33A.......................................CE-793 & UP F33C........................................CJ-149 & UP V35B.......................................D-10152 & UP V35TC.....................................D-10152 & UP 76............................................ALL 77............................................ALL

P12-8219 P12-8219, 122601, AM101020FP 95-55.......................................TC-1 & UP 95-A55....................................ALL 95-B55, B55A........................ thru TC-2456


FAA/PMA Eligibility List Donaldson Part Number

OEM Part & Serial Numbers

P12-7996 P12-7996, 121128-2, AM101120FP 95-C55, C55A . ......................TE-1 & UP D55, D55A..............................ALL E55, E55A............................... thru TE-1079 58............................................TH-1 thru TH-740

P12-8167

96-389005-1

E55, E55A...............................TE-1079 & UP 58............................................TH-741 & UP

P10-8700

50-389070-15

AM101820FP

50-389070-15

P12-4439

50-389070-23

56TC.......................................TG1 thru TG51 60, A60...................................P4 thru P246 B60.........................................P247 & UP 56TC.......................................ALL 60, A60...................................ALL

58P..........................................TJ3 & UP 58TC.......................................ALL

P10-5798

50-389070-11

A65.........................................LC240 & UP 70............................................All B80.........................................LD270 thru LD327

AM101720FP

50-389070-11

A65.........................................LC-240, LC-335 70............................................LB-1 thru LB-35 65-B80....................................LD-270 thru LD-511 65-88.......................................LP-1 thru LP-26, LP-28, LP-30 thru LP-47

PIPER P10-7150

J-3..........................................ALL J3C-65....................................ALL J3C-65S.................................ALL J4A, A-S, E............................ALL J5A.........................................ALL J5A-80....................................ALL PA-11, S.................................ALL PA-12, S.................................ALL PA-16, 17...............................ALL PA-18, -105............................ALL PA-18A...................................ALL PA-18S...................................ALL PA-18-“125”(Army L-21A)...ALL PA-18AS-“125”.....................ALL PA-18S-“125”.......................ALL PA-18AS-“135”.....................ALL PA-18S-“135”.......................ALL PA-18-“135”..........................ALL PA-18-“150”..........................ALL PA-18A-“150” ......................18-1 thru 18-6963 PA-18S-“150”.......................ALL PA-18A (Restricted).............ALL PA-18A-“135” (Restricted)...ALL PA-18A-“150” (Restricted)...18-1 thru 18-6963 PA-19.....................................ALL PA-20, -115, -135..................ALL PA-22.....................................ALL

P11-4419

26874-00, 460-889

PA-23-250 .............................Lycoming Turbo only PA-24-260 .............................24-4783, 24-4804 through 24-5034

Donaldson Part Number

OEM Part & Serial Numbers

P617058 PS60007-2, 460-632, 89308, CA161PL, AFP-2, 638873

PA-23-250..............................27-01 through 27-2504 PA-23-235..............................27-505 through 27-622 PA-24.....................................24-1477 and up PA-24-250..............................24-1477 and up or 24-103 through 24-3687 if carburetor air filter kit 754 285 has been installed PA-24-260..............................24-3642, 24-4000 through 24-4782, 24-4784 to 24-4803 PA-25-150..............................ALL PA-28-140..............................ALL PA-28-150..............................ALL PA-28-160..............................ALL PA-28-180..............................ALL PA-28-181..............................ALL PA-28-235..............................ALL PA-28-201T............................ALL PA-28R-201T.........................ALL PA-28RT-201T.......................ALL PA-32-260..............................ALL PA-32-300..............................32-7640001 and up PA-32R-300...........................ALL PA-32-301..............................ALL PA-32RT-300..........................ALL PA-32R-301 (SP)...................ALL PA-32R-301 (HP)...................ALL PA-32-301FT..........................ALL PA-34-200T............................ALL PA-34-220T............................ALL PA-36-285..............................ALL PA-36-300..............................ALL PA-36-375..............................ALL

P617053 PS60007-1 460-630, 89309, CA144PL, AFP-1, 638876 PA-28R-180...........................ALL PA-28R-200...........................ALL PA-28R-201...........................ALL PA-28RT-201..........................ALL PA-28RT-201T.......................ALL PA-30.....................................ALL PA-34-200..............................ALL PA-39.....................................ALL PA-44-180..............................ALL

Donaldson Part Number

OEM Part & Serial Numbers

P13-6739

560-947

P10-7150

P12-0494, 560-772

P13-8580

86881-2, 560-953

P15-1936

PS60007-3, 561-020

PA-32-301T, PA-32R-301T.....32R-8029001 thru 32R-8629006, 3229003 PA-38-112..............................ALL PA-44-180T............................ALL

PA-32R-301...........................ALL PA-32R-301T.........................3257001 and ON PA-32-301XTC.......................ALL PA-46-310P...........................ALL PA-46-350P...........................ALL

MOONEY P10-7150

M10........................................ALL

P10-7172

13219

P13-0234

125997-010, BA6210

AM108365FP

P13-6287

ED04011

600417-501

ED04028

600417-503

M18C......................................ALL M20........................................ALL M20A-D, G.............................ALL M20J......................................ALL M20K (231)............................ALL

M20K (252)............................25-1000 & ON M20M.....................................ALL M20R......................................ALL M20S......................................ALL

AERONCA P10-7150

65-CA.....................................ALL S65..........................................ALL S65CA....................................ALL 7AC, DC, EC, FC,...................ALL 7JC, KC..................................ALL 7ACA......................................ALL 7BCM (Army L-16A).............ALL 7CCM (Army L-16B).............ALL 7ECA.......................................ALL 7GCAA...................................ALL 7GCBC....................................ALL 7KCAB....................................ALL S7AC......................................ALL S7CCM...................................ALL S7DC......................................ALL S7EC.......................................ALL

P617774

460-629, 32198-00, CA162, BA-115, 6487894

P13-6602

PA-28-236..............................28-7911001 thru 28-7911282

560-854

AVIAT

P13-8683

560-904

A-1 . .......................................ALL

P10-6590

460-817, 560-747

PA-23-250..............................27-2505 and up PA-E23-250............................ALL PA32-300 32-40000 to 32-7540198

PA-28-236..............................28-7911283 & UP PA-31.....................................ALL PA-31-300..............................ALL PA-31-325..............................ALL PA-31-350..............................ALL PA-31-1020............................ALL PA-32R-300T.........................ALL

AM105770FP

47075, 460-609

PA-31P...................................ALL PA-31P-350...........................ALL

P10-7150

81630, 81631

AMERICAN CHAMPION P10-7150

7ACA......................................ALL 7ECA.......................................ALL 7FC..........................................ALL

P10-6150

P10-4145

7KCAB....................................ALL 8KCAB....................................ALL 7GCBC....................................ALL 8GCBC....................................ALL 7GCAA...................................ALL


BELLANCA

GRUMMAN/TIGER

TAYLORCRAFT

P10-6150

P10-7150

P10-7150

17-30.......................................ALL 14-19-3A................................ALL

P617058 AF-2, BA-104, 6485710 17-30A....................................ALL

B-N Group Ltd. P617058 AF-2, BA-104, 6485710 BN-2.......................................ALL BN-2A....................................ALL BN-2A-2.................................ALL BN-2A-3.................................ALL BN-2A-6.................................ALL BN-2A-8.................................ALL BN-2A-9.................................ALL BN-2A-20...............................ALL BN-2A-21...............................ALL BN-2A-27...............................ALL BN-2B-20...............................ALL BN-2B-21...............................ALL BN-2B-26...............................ALL BN-2B-27...............................ALL

DIAMOND AIRCRAFT P10-7172

BA5110

DA-40F...................................ALL

13203

AA-1.......................................ALL AA-1A....................................ALL AA-1B....................................ALL AA-1C.....................................ALL AA-5.......................................0001 thru 0640

LUSCOMBE P10-7150 ALL 8, A-F......................................ALL T-8F.........................................ALL

MAULE P10-7172

P12-6491

M-4, C, S, T............................ALL M-4-180C, S..........................ALL M-4-220, C, S, T....................ALL M-180T...................................ALL M-5-180C...............................ALL MX-7-160, 180.......................ALL M-5-210C, TC........................ALL M-5-235C...............................ALL M-5-220C...............................ALL M-6-180.................................ALL M-6-235.................................ALL M-7-235.................................ALL

SWIFT (GLOBE) P10-7150

GC-1A.....................................ALL GC-1B.....................................ALL

BC65.......................................ALL BCS-65...................................ALL BC12-65.................................ALL BCS12-65...............................ALL BC12-D1.................................ALL BCS12-D1..............................ALL BC12D85................................ALL BCS12D85..............................ALL BC12D-4-85...........................ALL BCS12D-4-85........................ALL BF65.......................................ALL BF12-65..................................ALL BFS65.....................................ALL 19, F19, F21............................ALL DC-65.....................................ALL DCO-65...................................ALL F22, A-C.................................ALL

UNIVAR/AIRCOUPE P10-7150

A-2, A2-A...............................ALL F-1, F-1A................................ALL

VARGA P10-7150

2150A.....................................ALL Notes: * - “AM” model will be phased out and replaced by the “P” model listed immediately above ** - AM105635FP is replaced by P10-6150 *** - All aircraft modified by SK402-27

952-887-3435 866-323-0394 Toll Free

Donaldson Company, Inc. PO Box 1299 Minneapolis, MN 55440-1299

Worldwide Support

www.donaldson.aero/ga

Brochure No. P469075 rev 7 (7/10) © 2010 Donaldson Company, Inc. All rights reserved. Donaldson Company, Inc. reserves the right to change or discontinue any model or specification at any time and without notice. Printed in the U.S.A.


General Aviation

INSTRUMENT AIR FILTERS Replacement Filter Application Information Document Number P486322* Rev 1

General Service Guidelines Installation

Storage When storing new air filters, be sure they are protected from dust and potential damage.

Recommended Service Schedule Replace your air filter annually or 500 flight hours, whichever occurs first, and at each pump replacement. These instrument air filters are NOT cleanable.

1. Inspect the housing surface on which the filter seals. It must have a clean, smooth and flat surface. 2. If your filter contains a gasket, inspect the gasket for damage. If it is not smooth and flat, replace the gasket because the seal may not be air tight. 3. Install the filter. Be sure it is mounted securely and there are no dust leaks past the edge of the filter and gasket. NOTE: This is a dry-type filter – DO NOT apply oil or clean the filter.

FAA / PMA Eligibility List Donaldson Part Number

OEM Part & Serial Numbers

CESSNA EBG03-0001 P10-52251

C-294501-0101 C-294501-0103

150, 150A-H, 150J-M............ALL 172D-I, 172K-M.....................ALL 177, 177A-B, 177RG..............ALL 180F-H, 180J, 180K...............ALL 182D-H, 182J-L.....................ALL 206, 207, 207A.......................ALL 210G, 210H, 210J-M.............ALL 210N.......................................thru 21064135 310L, N, P, Q..........................ALL 320D-F....................................ALL 337E-H....................................ALL 401, 401A-B...........................ALL 402, 402A-B...........................ALL 411, 411A...............................ALL 414, 414A...............................ALL 421, 421A-B...........................ALL A185F.....................................18502311 & UP FR172E-H, J...........................ALL T41C, D...................................thru R172-0409 P206, P206A-E......................ALL P337G, H................................ALL T207, T207A...........................ALL T210G, H, J-M.......................ALL T210N.....................................thru 21064135 T310L, N, P, Q........................ALL T337E-H.................................ALL TP206A-E...............................ALL TU206A-F...............................ALL TU206G..................................thru U20606846 U206, U206A-F......................ALL U206G.....................................thru U20606846

Donaldson Part Number EBG03-0002 P10-5290

OEM Part & Serial Numbers C-294501-0201 C-294501-0203

210N.......................................21064136-21064772 310L, N, P, Q..........................ALL 320, 320A-F............................ALL 411, 411A...............................ALL T210N.....................................21064136-21064772 T310L, N, P, Q........................ALL TU206F...................................U20602200 & UP TU206G..................................ALL U206F.....................................U20602200 & UP U206G.....................................ALL

AM103435IA

C-294501-0301

AM103535IA

C-294501-0302

404..........................................ALL 414, A.....................................ALL 421C........................................ALL 402C........................................ALL 404..........................................ALL 421C........................................ALL

Donaldson Part Number

OEM Part & Serial Numbers

BEECHCRAFT EBG03-0003

205538-089

EBG03-0018

101-380039-1

19, 23, C23..............................ALL 24, 24R, 58..............................ALL C90, C90A..............................ALL C99..........................................ALL E90..........................................ALL F90, F90A...............................ALL B100.......................................ALL 200, 200C................................ALL 200CT.....................................ALL A200C.....................................ALL B200.......................................ALL B200C, B200CT.....................ALL B200T.....................................ALL 300, 300C................................ALL B300, B300C..........................ALL 1900C......................................ALL

MOONEY EBG015004

6260A77, 202760

M20J......................................24-001 thru 24-1604, 24-3000 thru 24-3026 M20K......................................25-0001 thru 25-1087

NOTE: Instrument Air Filters are not cleanable!

1 - P10-5225 is a detail of the PMA Filter Assembly EBG-030001

Donaldson Company, Inc. PO Box 1299 Minneapolis, MN 55440-1299 www.donaldson.aero/ga

Worldwide Support

952-887-3435 866-323-0394 Toll Free

Brochure No. P486322 rev 1 (9/10) © 2010 Donaldson Company, Inc. All rights reserved. Donaldson Company, Inc. reserves the right to change or discontinue any model or specification at any time and without notice. Printed in the U.S.A. * This document replaces bulletin P469075 for these listed part numbers only.


General Aviation

The FActs About Your Air Filter Before Buying Your Next Air Filter Check The Facts About Airflow, Engine Protection and Performance Technical Bulletin There’s been a lot of discussion about increased horsepower from increased airflow. We put Donaldson, Brackett, and Challenger Aviation (K&N) filters to the test to uncover the truth about airflow, engine protection and performance.

FACT: Donaldson has better airflow In laboratory airflow tests comparing Donaldson, Bracket and Challenger Aviation (K&N) filters for Cessna 172 aircraft, Donaldson had the lowest restriction (best airflow). Similar results were also found when testing filters for other aircraft models. The scanning electron microscope photos below show the difference. Donaldson filters use a synthetic media; Brackett uses an oiled, open-cell polyurethane foam; Challenger Aviation (K&N) filters consists of layers of surgical gauze coated with oil. Donaldson synthetic

Foam

Gauze

FACT: With Donaldson filters you get as good or better horsepower The difference in airflow restriction between filters must be significant (at least 4" H20) to realize a 1% HP gain (see technical explanation box, bottom). This difference does not exist between the gauze filters tested and Donaldson synthetic media. In fact, since the Donaldson filter restriction is lower, it would theoretically provide a fractional performance advantage. A significant difference in pressure loss (4" H20 or greater) was observed versus the foam panel filters. Therefore, both gauze and Donaldson synthetic media filters may provide a performance increase over foam filters.

Why Does Donaldson Have Better Airflow? • Our filter media is composed of synthetic fibers • Evenly distributed uniform size and shape media fibers • More media area and less frame • Deeper filter pleats • No oil

How can a filter increase horsepower? A filter that offers less restriction could increase horsepower. At ground level the engine is assumed operating at 100% HP and experiencing atmospheric pressure of 29.92" Hg or 407" H20 (60°F). Decreasing the restriction by 4" H20 linearly would increase the engine’s performance by 1%. At higher elevations, this performance difference increased slightly. For example, at 10,000 ft. elevation, atmospheric pressure is 20.58" Hg or 280" H20 (60°F). At that elevation, decreasing the restriction by 4" H20 would increase the engine’s performance by 1.4%.

Above: Laboratory test results showing airflow and restriction.

F112208 (7/08)


OEM Part No & S/N

FACT: Donaldson Filters Stop More Dirt Donaldson filters deliver consistent and reliable performance; they achieve 98.5% or greater filtration efficiency according to ISO5011 fine and coarse dust requirements, greatly exceeding the other filters. Donaldson filters stop more dirt and protect your engine better.

If a worn or poorly fit air filter allows as much as a tablespoon of abrasive dirt into the cylinders, it will cause wear to the extent that an overhaul will be required. Notes: Phoenix air concentration 65.5 μg/h Engine rated airflow 190 cfm Based on filter efficiency tested per ISO5011

– Textron Lycoming publication

Other Donaldson Filter Facts Long Lasting

Selection

Donaldson filters are rated to last 500 hours, five to 10 times longer than foam filters. Replace your air filter after three years, five cleanings or 500 flight hours; whichever occurs first.

Donaldson offers over 75 filter models for Cessna, Beech, Maule, Mooney, Piper and others.

OEM and FAA-PMA Certified Donaldson filters are designed to manufacturer specifications. No STCs required.

Thoroughly Tested Third party lab tests show Donaldson filters meet or exceed FAA fire safety regulation per FAR 25.853 and FAR 23.1107 Induction system filters.

Easy to Install and Maintain Donaldson filters are designed for easy installation and maintenance – no removable parts or oil, may be washed with water.

Heavy-duty Experience Donaldson has been designing and manufacturing engine filters since 1925. We are a leading world-wide filter supplier for commercial jets, military vehicles, off-road equipment, trucks, light-duty vehicles, power plants, dust collectors, industrial compressors and more.

Visit www.donaldson.aero/ga for more filter facts

Donaldson Company, Inc. Minneapolis, MN 55440-1299 www.donaldson.aero/ga

North & South America Bloomington, Minnesota 952-887-3435 866-323-0394 Toll-Free


General Aviation

The FActs About Your Air Filter Before Buying Your Next Air Filter Check The Facts About Airflow, Engine Protection and Performance Technical Bulletin There’s been a lot of discussion about increased horsepower from increased airflow. We put Donaldson, Brackett, and Challenger Aviation (K&N) filters to the test to uncover the truth about airflow, engine protection and performance.

FACT: Donaldson has better airflow In laboratory airflow tests comparing Donaldson, Bracket and Challenger Aviation (K&N) filters for Cessna 172 aircraft, Donaldson had the lowest restriction (best airflow). Similar results were also found when testing filters for other aircraft models. The scanning electron microscope photos below show the difference. Donaldson filters use a synthetic media; Brackett uses an oiled, open-cell polyurethane foam; Challenger Aviation (K&N) filters consists of layers of surgical gauze coated with oil. Donaldson synthetic

Foam

Gauze

FACT: With Donaldson filters you get as good or better horsepower The difference in airflow restriction between filters must be significant (at least 4" H20) to realize a 1% HP gain (see technical explanation box, bottom). This difference does not exist between the gauze filters tested and Donaldson synthetic media. In fact, since the Donaldson filter restriction is lower, it would theoretically provide a fractional performance advantage. A significant difference in pressure loss (4" H20 or greater) was observed versus the foam panel filters. Therefore, both gauze and Donaldson synthetic media filters may provide a performance increase over foam filters.

Why Does Donaldson Have Better Airflow? • Our filter media is composed of synthetic fibers • Evenly distributed uniform size and shape media fibers • More media area and less frame • Deeper filter pleats • No oil

How can a filter increase horsepower? A filter that offers less restriction could increase horsepower. At ground level the engine is assumed operating at 100% HP and experiencing atmospheric pressure of 29.92" Hg or 407" H20 (60°F). Decreasing the restriction by 4" H20 linearly would increase the engine’s performance by 1%. At higher elevations, this performance difference increased slightly. For example, at 10,000 ft. elevation, atmospheric pressure is 20.58" Hg or 280" H20 (60°F). At that elevation, decreasing the restriction by 4" H20 would increase the engine’s performance by 1.4%.

Above: Laboratory test results showing airflow and restriction.

F112208 (7/08)


OEM Part No & S/N

FACT: Donaldson Filters Stop More Dirt Donaldson filters deliver consistent and reliable performance; they achieve 98.5% or greater filtration efficiency according to ISO5011 fine and coarse dust requirements, greatly exceeding the other filters. Donaldson filters stop more dirt and protect your engine better.

If a worn or poorly fit air filter allows as much as a tablespoon of abrasive dirt into the cylinders, it will cause wear to the extent that an overhaul will be required. Notes: Phoenix air concentration 65.5 μg/h Engine rated airflow 190 cfm Based on filter efficiency tested per ISO5011

– Textron Lycoming publication

Other Donaldson Filter Facts Long Lasting

Selection

Donaldson filters are rated to last 500 hours, five to 10 times longer than foam filters. Replace your air filter after three years, five cleanings or 500 flight hours; whichever occurs first.

Donaldson offers over 75 filter models for Cessna, Beech, Maule, Mooney, Piper and others.

OEM and FAA-PMA Certified Donaldson filters are designed to manufacturer specifications. No STCs required.

Thoroughly Tested Third party lab tests show Donaldson filters meet or exceed FAA fire safety regulation per FAR 25.853 and FAR 23.1107 Induction system filters.

Easy to Install and Maintain Donaldson filters are designed for easy installation and maintenance – no removable parts or oil, may be washed with water.

Heavy-duty Experience Donaldson has been designing and manufacturing engine filters since 1925. We are a leading world-wide filter supplier for commercial jets, military vehicles, off-road equipment, trucks, light-duty vehicles, power plants, dust collectors, industrial compressors and more.

Visit www.donaldson.aero/ga for more filter facts

Donaldson Company, Inc. Minneapolis, MN 55440-1299 www.donaldson.aero/ga

North & South America Bloomington, Minnesota 952-887-3435 866-323-0394 Toll-Free


CorrosionX is the most useful and versatile product of its kind. As one customer stated, "It's a complete service facility in a can." And, it's economical. Users estimate that a single 16-oz. can of CorrosionX will outperform and outlast 8 - 10 cans of the popular household "lubricant/penetrant," making it far more economical to use. A supervisor in a maintenance facility for a major oil company called it an "inventory reducer" because they use it for so many different applications. STOPS AND PREVENTS CORROSION AND RUST Use CorrosionX where you want corrosion control without a messy wax coating. A light spray of CorrosionX on power heads, generator sets and engines two or three times a year will keep them looking like new -- even in saltwater conditions. A MULTI-FUNCTIONAL PRODUCT In addition to its corrosion fighting properties, CorrosionX is also a super lubricant and penetrant. It lubricates under heavy loads and high temperatures. Use it on sheaves, hinges, locks, cables/wire ropes, windlasses or other rotating devices. It is ideal for fishing reels and guns. And, CorrosionX penetrates like nothing you've ever used. Corroded or rusted nuts, bolts or fittings can usually be removed within a few minutes. NOT HARMFUL TO THE ENVIRONMENT The Volatile Organic Content (VOC) of CorrosionX is only 8.6% (the "popular" brand is 76% solvent). Plus it's nontoxic, non-carcinogenic, and is nonflammable when not in aerosol form (the propellant is flammable). CorrosionX has a 100% Money Back Guarantee - NO IF'S, AND'S OR BUT'S


Part #

Size

90101 90102 91002 94004 94005 94002 94001 90104 96004 96005 96002 96001 80102 80103 84004 84005 84002 84001 50010 77000 77001 61001 61002 61004

6 oz Aero 16 oz Aero 16 oz Trigger 1 Gallon Pail 5 Gallon Pail 30 Gallon Drum 55 Gallon Drum 12 oz Aero 1 Gallon Pail 5 Gallon Pail 30 Gallon Drum 55 Gallon Drum 16 oz Aero 16 oz Trigger 1 Gallon Pail 5 Gallon Pail 30 Gallon Drum 55 Gallon Drum 4 oz Applicator 1 oz Applicator 1 oz Applicator 12 oz Bottle 16 oz Bottle 1 Gallon

Description CorrosionX CorrosionX CorrosionX CorrosionX CorrosionX CorrosionX CorrosionX CorrosionX HD CorrosionX HD CorrosionX HD CorrosionX HD CorrosionX HD CorrosionX Aviation CorrosionX Aviation CorrosionX Aviation CorrosionX Aviation CorrosionX Aviation CorrosionX Aviation CorrosionX For Guns ReelX SpeedX RejeX RejeX RejeX

Case Qty 12 12 12 4 1 1 1 12 4 1 1 1 12 12 4 1 1 1 12 24 24 12 12 4


NOTHING STICKS BUT THE SHINE

THOSE WHO KNOW HAVE TAKEN A SHINE TO REJEX

REJEX (pronounced “rejects”) is an advanced polymer protective coating – not just another wax or polish – that seals and protects aircraft against bug splats, exhaust stains, bird droppings, oil, grease, and belly grime.

“We were impressed with this product’s ability to keep bug splats and exhaust

X REJECTS TURBINE EXHAUST RESIDUE

stains from sticking to paint.”

X REDUCES COSTLY CLEAN-UP TIME X LONGER LASTING X BUGS DON’T STICK

“One of the problems that has really bugged me is cleaning bugs, belly

grime

X AMAZING SHINE

100% SATISFACTION GUARANTEED

and

exhaust stains from my airplane. RejeX is the answer! I can

Most economical for commercial airlines, military, FBOs and detailers RejeX 1 gallon

wipe the bugs off with a wet rag, and belly dirt and exhaust deposits come off with half the effort.” Norman Hoffman, President Interjet, Inc. • Addison, Texas

Enough to treat a large twin or business jet RejeX 16 oz.

Our fleet has never looked better, nor

Ideal for most single-engine aircraft RejeX 12 oz.

taken less time and effort to clean, than since we began using RejeX.” Mal Shipton, Owner GOANA Air Safaris • Australia

2801 Adamo Drive, Tampa, FL 33605 1-800-328-9766 • www.tysonbolt.com


Product Catalog VOLUME 9.0 lpaero.com


WINDSHIELD INSTALLATION AND HANDLING INSTRUCTIONS Depending on your aircraft make and model, the windows which you purchase may require trimming and/or drilling. The following directions will give you tips on the proper procedures for accomplishing this. Check our list of installation supplies for acrylic drill bits, cleaners, finish restorers, tapes and sealants. WE HIGHLY RECOMMEND THE PURCHASE OF OUR ACRYLIC DRILL BITS WHEN HOLES ARE TO BE DRILLED IN THE ACRYLIC. WINDSHIELD TRIM VARIATION: We can guarantee fit on most of our windshields, but many aircraft manufacturers allowed variations to exist in the original trim of the windshields. We therefore manufacture and trim the replacement windshields for these aircraft slightly oversize to allow trimming for each individual aircraft. These windshields may require trimming or grinding to fit upon installation. NOTE: As a service to our customers we will accurately trim any windshield or window which we manufacture to the exact size of your original window at no additional charge. Please notify us in advance of your shipping the original window or template to us. All transportation charges will be the responsibility of the customer. HANDLING: It is very important to keep the windshield well supported at all times. Do not allow a strain to be put on the windshield during the cutting or grinding operations. Warm temperatures are not required during these operations; however, acrylic will take much more abuse at 80 degrees than at 30 degrees. DO NOT STORE ANY WINDOW OUTDOORS WHILE THE PROTECTIVE COVERING IS STILL ON THE WINDOW. THE COVERING WILL BECOME VERY DIFFICULT, IF NOT IMPOSSIBLE, TO REMOVE WITHOUT DAMAGING THE WINDOW. PREPARATION FOR INSTALLATION: After inspection of the window, trim the protective covering to expose enough of the edge of the window to allow for fitting including the portions going into channels and under fairings. The remaining protective covering should be left on the window to protect it until fitting has been completed. Residue left behind by the â&#x20AC;&#x153;Spraylatâ&#x20AC;? protective coating may be removed by soaking the area with isopropyl alcohol and rubbing with an alcohol soaked soft flannel cloth. Residue left behind by the adhesive backed paper covering can also be removed by the above method. If, however, the paper covering has been stored on the window for an extended period of time, you will have to soak the paper with kerosene and keep it wet for several hours. You will then be able to remove the paper backing, but the adhesive will remain. This may be removed by using a mixture of equal parts of kerosene and isopropyl alcohol. Soak a soft flannel cloth with this mixture and rub the window with the cloth. The window should be cleaned after this procedure with a dish washing liquid and plenty of water. REMOVE THE REMAINING PROTECTIVE COATING AND INSPECT THE WINDSHIELD BEFORE FINAL INSTALLATION. SEE WARRANTY.

not allow the weight of the windshield to rest on the edge being cut away. After cutting, the edges should be sanded with a belt sander to remove all saw marks. Satisfactory results may also be had by using a 7" or 9" disc sander with a coarse 40 to 80 grit sanding disc. This will remove material quite rapidly with only slight pressure. A belt sander may be used with similar results. For best results the edges should be smoothed and rounded with fine sandpaper. This can be sanded by hand, with a rotary drum sander, or a file may be used in place of sanding. Smoothing the edges will lessen the tendency towards edge cracking or breakage. It will also extend the service life of the windshield. NOT RECOMMENDED: Trimming with a jig saw, saber saw, or a hand saw is not advisable. If hand sawing is absolutely necessary, a coping saw with a bone cutting blade with 30 teeth per inch may be used. Extreme care must be used to avoid the blade hanging up and starting a crack. We recommend that the blade be inserted in the saw backward so that the blade cuts when it is drawn towards you. Do not allow the edges of the acrylic to pinch and bind the blade DRILLING WINDSHIELDS: Do not use a standard metal or wood cutting bit to drill acrylic. This type of bit must be resharpened for acrylic. Take this bit and square off the cutting edge as per the drawing. The drill bit sharpened in this way will scrape a clean hole through the acrylic with no tendency to dig in or grab. Sharpen your drill bit as shown or purchase one of our special acrylic drill bits. The small price you pay for the correct drill bit will pay you dividends a hundredfold by drilling smooth clean holes. Practice drilling on your old windshield or a piece of scrap acrylic before drilling your new windshield. Use a high speed with very light pressure when drilling. Holes should be drilled oversize to allow for expansion and contraction of the acrylic; Example: Drill a 3/16" hole for a 1/8" screw. Do not over-tighten screws. Screws should be snug only. Over-tightening will cause cracks around the holes. STANDARD WOOD OR METAL BITS WILL CAUSE BINDING AS IT BREAKS THROUGH THE OPPOSITE SIDE OF THE ACRYLIC. THIS WILL CAUSE SMALL CHIPS, FRACTURES, CRACKS, OR CAUSE THE WINDOW TO BREAK. DO NOT TAKE THE CHANCE!

MARKING FOR TRIM - PAPER PATTERN: The windshield may be marked with a china marking grease pencil, a felt tip marker, or masking tape. A fast and accurate method for trimming can be accomplished through the use of a paper pattern made by laying a piece of craft paper over the outside of the old original windshield and trimming the paper exactly to size. The paper will lay flat on windshields of simple curvature and can be taped in position. The windshield outline can then be traced onto the paper with a marker. This pattern can then be cut out, properly aligned over the new windshield and the new windshield marked to size. On windshields of compound curvature the paper should be pulled tight across the outside center of the original windshield and taped at this point. At a 90-degree angle to this the paper should again be pulled tight and taped. The loose areas between the tape should be cut with a razor knife and overlapped with enough cuts to allow the paper to follow the curvature of the windshield. Once this is accomplished, masking tape should be used over all the cuts to hold them in place. An outline of the original may now be made and cut to size. This pattern may then be removed from the original windshield, aligned properly on the new windshield, taped in position and traced. When tracing these patterns on the new windshield allowances should be made for areas which were short on the original installation. If mailing patterns to us be sure to mark the pattern as to left side, right side, and outside. MARKING FOR TRIM - CUT AND FIT: If the original windshield is not in condition to make a pattern then you must cut the new windshield to fit. Remove the wing and cowl fairings and place the new windshield in position allowing the top and sides to hang over. Mark and trim the bottom first. Make sure that the windshield is aligned at the wing roots or that trimming will bring about alignment at the wing roots. After trimming and fitting the bottom, the sides and top will not be difficult to fit. Care should be taken to fit the windshield in place using small cuts rather than one large cut. Remember, you can always trim a little more, but once cut you can never add to it. MARKING FOR TRIM - OVERLAY: Place the new windshield over the outside of the old windshield and trace a trim line. This will give an oversize rough trim. This method is not recommended for any Cessna windshield or any other windshield where a tight fit between the windshields cannot be achieved. WINDSHIELD TRIMMING: Trimming is best done with a band saw using a 1/4" or 3/8" wide raker blade with 14 or more teeth per inch. Mask the band saw table to protect the windshield from scratches. Support the windshield during the cutting operation and do

WARRANTY: Our windshields and windows are warranted against defective materials and workmanship. The warranty is limited only to the replacement of the defective parts. There is no allowance for labor costs incurred during installation and removal of a defective part. Prior to installation the protective coating should be peeled and the part inspected. After inspection the window may be recovered with the protective coating which was removed or recovered with a cling type plastic food wrap. We will not assume any liability for damages due to improper installation or any damage incurred during shipping. Our warranty does not cover cracking, crazing, scratches or breakage. Any item shipped to us without proper authorization will be refused. Call for a return authorization number.

L.P. AERO PLASTICS, INC. 1086 BOQUET RD. JEANNETTE, PA 15644-4707

Phone: (724) 744-4448 Fax: (724) 744-7372


Table of Contents Policies and Warranty . . . .. . . . . . 2 Supplies & Accessories . . . . . . . . . 3 Cross Reference List . . . . . . . . . . 10 Make and Model List . . . . . . . . . 30 INDUSTRY LEADER

At LP Aero Plastics, we take pride in having provided the aviation industry with superior quality replacement windows for over 50 years. Our catalog has now been expanded to include windshields, windows, lenses, accessories and installation supplies for over 500 different aircraft models of both domestic and foreign manufacture. Our windshield listings can be confirmed with serial and model numbers, year of manufacture, thickness of material, and cross-referenced with OEM part numbers. This comprehensive catalog is designed to clearly provide the appropriate information essential to ordering the correct parts. Being the most complete source of aircraft windshields and windows, LP AERO PLASTICS’ new catalog is the most vital tool in window replacement.

QUALITY

All LP AERO PLASTICS’ windshields and windows are manufactured of high optic quality acrylics. These are available in clear, green, and solar gray tints for the pilot’s compartment and medium gray, dark gray, medium bronze and dark bronze for the passenger windows and skylights. For ease of installation, they are trimmed to OEM specifications. Our quality control systems are approved by the Federal Aviation Administration, meeting the Federal Aviation Regulations, and the Department of Defense, meeting MIL-I-45208A. All FAA-PMA approved parts are shipped with the FAA-PMA approval tag, which has the complete approved applicability list attached. An “Airworthiness Approval Tag”, FAA form 8130-3, which is “NOT FOR EXPORT” is also attached. Our ODAR (Organizational Designated Airworthiness Representative) is available to assist in numerous certification issues for the OEM, TC, and STC projects.

SERVICE

Special attention is given by our staff to provide a fast, economical delivery. We make every attempt to secure the best freight discounts available and we pass those discounts on to our customers. We are able to ship many of the large Cessna, Piper, Beechcraft and other model windshields by UPS, FedEx, DHL and others. Check our price list in the rear of this catalog for those windshields, which will now ship via UPS. An extensive inventory of over 2000 different part numbers enables our Shipping Department to ship most orders within one day. AOG ORDERS are expedited and prioritized for the fastest possible shipment for a $50.00 nominal fee, per ship set. (see page 2)

WORLD WIDE

PRICE

Total services are available for export shipments, including all documentation and crating as necessary for air freight. Our on-staff FAA-DMIR (Designated Manufacturing Inspection Representative) permits our company to provide prompt efficient compliance with the requirements of all foreign aviation authorities of the importing countries. The “Airworthiness Approval Tag”, FAA form 8130-3 for export, must be requested prior to the shipment being made. The name of the importing country must be supplied. Our prices are usually well below OEM prices and our discounts comparable or better. We sell wholesale only with Dealer and Distributor discounts extended to those companies qualified in aircraft parts, maintenance, sales, and service.

SPECIAL ORDERS

We are able to custom make windshields, windows and canopies from your specifications or your tools: home builts, extra thick windows, special vents, camera windows, large domes, and out-of-production windshields and windows. Any window manufactured by our company which varies in any way from our PMA approved data will not be supplied with a FAA-PMA tag. Installation of any non-standard, non FAA-PMA approved part on a certificated aircraft will require a 337 field approval or an STC. We will provide documentation and assistance in the approval process.

RETURNS

Any item* purchased from LP AERO PLASTICS may be returned for a full refund within 30 days of the original shipment date. Items returned 31 to 60 days after the original shipment date will be refunded less a 20% restocking charge. All returned items are subject to inspection and must be as new, untrimmed, unmodified, and undamaged. All factory protective coatings must be in place and intact. Returned items must be shipped prepaid and insured, and have an LP Aero Plastics “RETURN AUTHORIZATION NUMBER” written on the outside of the shipping container next to the shipping label. Please call for return authorization. After 60 days all sales are final and no refunds will be given. *All custom-made and non-standard windows are payable in advance and cannot be returned. Note: As an additional service to our customers, certain parts which are listed in this catalog are not manufactured by LP Aero Plastics but are in stock or available. The quality system of these parts is governed by their respective manufacturers.

© 2010 LP Aero Plastics, Inc. All Rights Reserved

Toll Free: 800-957-2376 Phone: (724) 744-4448 Fax: (724) 744-7372 Email: info@lpaero.com

Volume 9.0b

LP Aero Plastics 1086 Boquet Road Jeannette, PA 15644-4707


Aircraft Windshields and Windows

P 2 gee 2 ag Pa

Policies and Warranty WARRANTY:

Our windshields and windows are warranted against defective materials and workmanship. The warranty is limited to the replacement of the defective parts. There is no allowance for labor costs incurred during installation and removal of a defective part. Prior to installation the protective coating should be peeled and the part inspected. After inspection the window may be recovered with the protective coating, which was removed, or recovered with a cling type plastic food wrap. We will not assume any liability for damages due to improper installation or any damage incurred during shipping. Our warranty does not cover cracking, crazing, scratches or breakage. Any Item shipped to us without proper authorization will be refused. Call for a return authorization number.

AOG SERVICE:

AOG orders will receive expedited and priority processing, manufacturing and shipping. There will be a $50.00 AOG fee. This fee may be adjusted upward based on the number of parts ordered.

TINTS: Federal Aviation Regulation (FAR) 23.775 states that, from the pilots back forward as seated in flight position, the windshield and windows must have a minimum light transmittance of 70%. The Green Tint (#2111) and Solar Gray Tint (#2515) have a minimum light transmittance of 72 to 75%. All type certified aircraft must comply with this regulation. Tints are not available for most pressurized aircraft outer pressure windows. The inner "scratch panel" windows may be tinted. Optional darker tints are available in gray and bronze where allowable and for any experimental aircraft. All orders will be filled with clear windows unless the particular tint is specified. There will be an additional charge of 20% for all in-stock tints unless otherwise noted.

CUSTOM:

Contact our custom department for special order canopies, windshields, or windows. We are able to manufacture windshields and windows from your specifications or your tools: home-builts, extra thick windows, special vents, camera windows, large domes, and out of production windshields and windows used by Type Certificated, Supplemental Type Certificated and Experimental aircraft. Any window manufactured by our company, which varies in any way from our FAA-PMA approved data, will not be supplied with a FAA-PMA tag. These windows will be manufactured in compliance with FAR 21.303 "Owner/Operator Produced Parts". An "Owner/Operator Produced Parts Form" will be provided and must be completed and submitted along with the window specifications, engineering data, and/or sample window in order for our company to proceed with the fabrication of the window order. A field approval FAA form 337 or STC will be required for installation in a certificated aircraft. We recommend that the form 337 be approved prior to proceeding with the fabrication of the window. Non PMA’d parts will be supplied with a letter of certification and any additional information which may be required by the FAA or their representative for approval.

RETURNS: Any item* purchased from LP AERO PLASTICS may be returned for a FULL REFUND WITHIN 30 DAYS of the original shipment date. Items returned 31 to 60 days after the original shipment date will be refunded less a 20% restocking charge. All returned items are subject to inspection and must be as new, untrimmed, unmodified, and undamaged. All factory protective coatings must be in place and intact. Returned items must be shipped prepaid and insured, and have an LP AERO PLASTICS “RETURN AUTHORIZATION NUMBER” written on the outside of the shipping container next to the shipping label. Please call for return authorization. AFTER 60 DAYS ALL SALES ARE FINAL AND NO REFUNDS WILL BE GIVEN. *ALL CUSTOM-MADE AND NON-STANDARD WINDOWS ARE PAYABLE IN ADVANCE AND CANNOT BE RETURNED.

SHIPPING:

All shipments are FOB shipping point sent the least expensive way, freight collect and COD unless otherwise specified. Air freight, motor freight, Parcel Post, Federal Express, DHL, and UPS are available.

EXPORTS:

Each FAA-PMA approved window is supplied with an FAA-PMA identification tag and an FAA form 8130-3 tag FOR DOMESTIC USE ONLY -NOT FOR EXPORT. The 8130-3 tag for export must be requested at the time of order placement and there is an additional charge. Please contact our office for special rates on export services and crating.

WHOLESALE ONLY:

Fixed Base Operators, Dealers and Distributors, must be companies established in the aircraft parts, maintenance, sales or service business.

Effective August 31, 2010 MASTERCARD - VISA - AMERICAN EXPRESS - DISCOVER MINIMUM ORDER $10.00 AOG FEE $50.00 Toll Free: 800-957-2376 Phone: (724) 744-4448 Fax: (724) 744-7372 Email: info@lpaero.com


P gee 3 ag Pa 3

Supplies and Accessories Window Care, Installation Products, Parts and Accessories LP Aero Plastics - Acrylic Polish and Sealant Not just any polish is good enough to carry our name! A superior no-wax, non-yellowing formula containing polyethylene polymers. This superior product not only gives a super slick surface to your windshield and windows, but can also be used on your entire aircraft, including all the painted gloss surfaces, aluminum and fiberglass. Ease of application and removal is unmatched. Sold in 16 oz. single bottles and in cases of 12. PART NO. LP Aero Plastics Acrylic Polish and Sealant 16 oz. squeeze bottle

SP-PL16

LP Aero Plastics Acrylic Polish and Sealant - Case of 12 bottles

SP-PLCS

DuPont Sontara® Window Wipes New Sontara® window wipes are made of a proprietary blend of fibers that are softer than most conventional wipes. Since many scratches are caused by grit and dirt already on the surface of the window, this product features apertures that help pick up and remove dirt effectively. Using LP Aero Plastics Acrylic Polish and Sealant to "float up" the dirt before wiping is the best way to minimize the risk of scratching. DuPont Sontara® Window Wipes - Box of 25 wipes

SP-AC1213WW125

DuPont Sontara® Window Wipes - Case of 500 wipes

SP-AC1213WWCS

LP Aero Plastics – Window Care Kit This Window Care Kit contains one 16 oz. bottle of LP Aero Plastics Polish and Sealant, one box of 25 Sontara Window Wipes, instructions and other documentation LP Aero Plastics Window Care Kit

SP-PL16WW

LP Aero Plastics Window Care Kit - Case of 12 kits

SP-PL16WWCS

“210” Plastic Cleaner and Polish For those who prefer an anti-fog, anti-static windshield and plastic cleaner in an aerosol spray. “210” Plastic Cleaner and Polish - 14 oz. Spray Can

SP-210A

“210 Plus” Plastic Scratch Remover A fine liquid abrasive for removing fine scratches that ordinary cleaner/polishes can’t handle. “210 PLUS” Plastic Scratch Remover - 15 oz. Squeeze Bottle

SP-210P

LP Aero Plastics 1086 Boquet Road Jeannette, PA 15644-4707


Aircraft Windshields and Windows

P 4 gee 4 ag Pa

Supplies and Accessories Prism Kit This inspection prism kit is ideal and invaluable for inspecting windows on the aircraft where the holes and edges are hidden by the aircraft skin or fairings. By applying the couplant and positioning the prism on the window next to the edge of the skin, it allows you to see the entire edge of the acrylic including the mounting holes from top to bottom. You are able to see cracks and breaks in the acrylic or glass. The prism has included angles of 45°, 70°, 110°, and 135°. PART NO. Window Inspection Prism kit Prism Repair

SP-PRIKT SP-PRIREP

Special Acrylic Drill Bits Don’t be fooled by the over the counter so-called “plastic drill bits” purchased at your local hardware store. Our drill bits are specially sharpened to scrape a clean hole through your acrylic window. These drill bits will not chip or crack the acrylic like standard drill bits. They are available in individual sizes from 1/8" to 1/2" and 1/2" 100 degree countersink. Sets with countersink and index box take the guesswork out of which bits to purchase. This type of bit is required when drilling windshields and windows is specified. Remember that acrylic expands and contracts, so drill your holes oversize. 1/8" ......................................................................................

SP-D18

9/64" ....................................................................................

SP-D964

5/32" ....................................................................................

SP-D532

3/16" ....................................................................................

SP-D316

7/32" ....................................................................................

SP-D732

1/4" ......................................................................................

SP-D14

9/32" ....................................................................................

SP-D932

5/16" ....................................................................................

SP-D516

3/8" ......................................................................................

SP-D38

7/16" ....................................................................................

SP-D716

1/2" ......................................................................................

SP-D12

100° countersink ...................................................................

SP-CS100

Drill Bit Set in index with countersink .....................................

SP-DBST

Foam Tape This is an adhesive backed, closed cell foam tape which is available in various sizes by the roll. This tape can be wrapped around the edges of the windows to both cushion and seal. DO NOT STRETCH DURING APPLICATION, IT WILL PULL BACK AND LEAVE GAPS. Piper used this extensively in their window installations. Foam tape 1/4" x 1/32" x 100' Foam tape 1/4" x 1/16" x 100' Foam tape 1/4" x 1/8" x 75' Foam tape 1/4” x 1/8” x 10’ used on sealing flange of vent windows Foam tape 1/2" x 1/4" x 50' Foam tape 1 1/4" x 1/16" x 100' Foam tape 1 1/4" x 1/16" x 25' Foam tape 1 1/4" x 1/16" per lineal foot

Toll Free: 800-957-2376 Fax: (724) 744-7372 Email: info@lpaero.com

SP-FT132 SP-FT116 SP-FT5112 SP-FT1410 SP-FT121450 SP-FT114100 SP-FT114125 SP-FT11412


P gee 5 ag Pa 5

Supplies and Accessories Felt Tape Adhesive backed in various widths and thicknesses. Used on numerous Cessna front and rear windshields. Available in rolls and by the foot. PART NO. Felt - adhesive backed 1/16" x 1 ¼" (per lineal ft.) Felt - adhesive backed 1/16" x 1 1/2" (per lineal ft.) Felt - adhesive backed 1/16" x 2" (per lineal ft.)

SP-F114 SP-F112 SP-F2

Piper Black Tar Tape Available in rolls 1/16" x 1" by 50 ft. Used by Piper on many of the older windshield installations. Piper black tar sealing tape 1/16" x 1" x 50'

SP-TT50

Strip Sealants The following are strip type sealants. These are especially useful in filling large gaps. These sealants are used in many Cessna installations. Green, 1/8" x 1/2" x 25' roll - Cessna sealant 579.6 (Presstite)

SP-5796

Polyurethane Sealant Bostik 1100FS Fast Set Polyurethane Sealant is now being recommended by Piper Aircraft for many of their window installations. This is a non-hardening, paintable, fast curing, sealant. (Work life - 70 minutes, Tack free - 90 minutes, Full cure 1.5 to 3 days) Do not use where holes have been drilled through the sealing/mounting edge of the windshield. Bostik 1100FS urethane sealant 10.3 oz. tube - black Bostik 1100FS urethane sealant 10.3 oz. tube – white

SP-1100BL SP-1100WT

RTV-732 Silicone Sealant, 1200 and 1205 Prime Coats Dow Corning Silicone Sealant in clear and black. 10.3 oz. tubes. The Dow Corning Prime Coat #1200 is used on most metals and the Dow Corning Prime Coat #1205 is used on most plastics and composites. Be sure to mask both the window and the aircraft skin prior to applying the sealant. This will make for very easy cleanup and a professional installation. This applies to any sealant you may use. RTV-732 Dow Corning silicone sealant 10.3 oz. tube - clear RTV-732 Dow Corning silicone sealant 10.3 oz. tube - black

SP-R732C SP-R732B

Two-Part Polysulfide Sealants This is a two-part, gray sealant, available in both an 8 oz. can with separate accelerant and a two-part cartridge for use with a hand application gun. We stock the “B2” which allows a 2 hour work time and a 48 hour cure time. This sealant meets AMS-S-8802B, which supersedes Military Specifications - MIL-S-8802 Interchangeable sealants: Advanced Chemistry & Technology - MC-236B Courtaulds Aerospace - Pro-Seal 890B, PR-1440B, PR-1487 D Aircraft Products - BR4005B Flamemaster Corp - CS3204B Fiber Resin Corp - PS-1102B J & R Industries - WS-8020B ½ pint can - Two-Part sealant kit (AC-236 B2) 5 oz. Cartridge sealant kit - with nozzle (AC-236 B2) Hand application gun - for use with cartridges Replacement plastic collar for hand application gun

SP-32048 SP-6611 SP-K162 SP-BEZ

LP Aero Plastics 1086 Boquet Road Jeannette, PA 15644-4707


Aircraft Windshields and Windows

P 6 gee 6 ag Pa

Supplies and Accessories Two-Part Polysulfide Sealants, Weather Resistant – Other Exterior moldline and canopy/windshield sealant. Two-part, black, 2 hour work time, 9 hour cure time. This sealant meets MAT-645F, Class B-2 Interchangeable sealants: Courtaulds Aerospace - PR-1425 Courtaulds Aerospace - PR-1489 PART NO. 3.5 oz. Cartridge sealant kit - with nozzle 6 ml Adhesion promoter for use with SP-AC-251B2 Hand application gun - for use with cartridges

SP-AC-251B2 SP-137 SP-K162

Bonding Kits For Grumman/Gulfstream/American General/Tiger Aircraft AA-1 and AA-5 Series Windshields and Canopies The sealant and instruction sheet are included for bonding the windshield to the windshield bow and the canopy to its frame. There are two different bonding systems used for these applications. The original bonding system consisted of Dow Corning RTV 732 as the bonding agent with Dow Corning 1200 Prime Coat for the aluminum and 1205 Prime Coat for the acrylic with a 72 hour cure time. Tiger Aircraft used a bonding system that consisted of a two-part polysulfide AC-251 B2 with AC-137 promoter with a two hour work time and 12 hour cure with full cure in 7 days. Windshield Bonding kit with one AC-251 B2 and AC-137

SP-BKG1

AA-1 Canopy Bonding kit with two AC-251 B2 and one AC-137

SP-BKG2

Acrylic Cement Used when bonding acrylic to acrylic, as in compass mount blocks, reinforcing strips, patches, etc. The liquid acrylic cement is water-like in consistency and is most easily applied with a syringe. The thickened cement is heavy bodied and is easily applied from the tube. The liquid cement requires tight contact between both bonding surfaces, while the thickened cement will fill slight gaps. Both will have excellent bonding strength when fully cured. WeldŽOn 3 - Liquid acrylic cement - 1 pint WeldŽOn 3 - Liquid acrylic cement - 4 oz. WeldŽOn 16 - Syringe for acrylic cement WeldŽOn 16 - Thickened acrylic cement - 5 oz. tube

SP-C1PT SP-C4OZ SP-SYGE SP-292001

Installation Kits for Beechcraft Conversions 978, 979, 980, 981, 991, 997 Each kit contains the stainless screws, nuts, and washers as well as the adhesive/sealant to mount the designated window Installation kit - use with 981 Installation kit - use with 978, 979, 980, 991, 997 Installation kit - use with 977

SP-IK981 SP-IK978 SP-IK977

The following parts are required for new installations of the 977 series windshield Front windshield aluminum retainer Defroster duct outlet adapter - may need 1 or 2 - check your aircraft installation Defroster diffuser Glareshield

Toll Free: 800-957-2376 Fax: (724) 744-7372 Email: info@lpaero.com

SP-D0002-001 SP-D0004-001 SP-D0003-001 SP-D0005-001


P gee 7 ag Pa 7

Supplies and Accessories Windshield Installation Kits for Piper PA-24, -28, -30, - 32, -34, -39, and .44 PA-24, -30 models with 1 or 2 piece windshields 2 ea. SP-32048 - polysulfide sealant – ½ pint can kit 1 ea. SP-FT114125 - Foam sealing tape 1 1/4" x 1/16" x 25' PA-24, -30 models with 1 or 2 piece windshields 2 ea. SP-6611 - polysulfide sealant – 5 oz. cartridge kits 1 ea. SP-FT114125 - Foam sealing tape 1 1/4" x 1/16" x 25' PA-24, -30 models with 1 or 2 piece windshields 2 ea. SP-6611 - polysulfide sealant – 5 oz. cartridge kits 1 ea. SP-FT114125 - Foam sealing tape 1 1/4" x 1/16" x 25' 1 ea. SP-K162 – Cartridge hand application gun PA-28, -32, -34, -44 models with 2 piece windshields 2 ea. SP-1100BL - polyurethane sealant - black 1 ea. SP-FT114125 - Foam sealing tape 1 1/4" x 1/16" x 25' PA-28 1 piece conversion installation kit includes the attaching parts, hardware, sealant and STC PA-32 1 piece conversion installation kit includes the attaching parts, hardware, sealant and STC PA-34 1 piece conversion installation kit includes the attaching parts, hardware, sealant and STC PA-44 1 piece conversion installation kit includes the attaching parts, hardware, sealant and STC

SP-2430-WSCAN

SP-2430-WSCRT

SP-2430-WSCRTG

SP-PA-WS2PC

SP-K2028KIT-28 SP-95032-001KIT SP-97016-001KIT SP-K2028KIT-44

Side Window Installation Kits for Piper PA-24, -28, -30, - 32, -34, -39, and .44 PA-24, -28, -30 models with four side windows 2 ea. SP-1100BL - polyurethane sealant - black 2 ea. SP-FT114125 - Foam sealing tape 1 1/4" x 1/16" x 25' PA-24, -28, -30, -32, -34, -44 models with six side windows 3 ea. SP-1100BL - polyurethane sealant - black 2 ea. SP-FT114125 - Foam sealing tape 1 1/4" x 1/16" x 25' PA-32, -34 models with eight side windows 4 ea. SP-1100BL - polyurethane sealant - black 3 ea. SP-FT114125 - Foam sealing tape 1 1/4" x 1/16" x 25'

SP-PA-4WIN SP-PA-6WIN

SP-PA-8WIN

Vent Window Hinge and Latch Assemblies For replacing vent window hardware on: Beechcraft models 33, 35, 36, 55, 56, 58, 95.

PART NO.

Hinge & latch assembly 2 hinge assemblies with mounting screws Latch and catch with mounting screws

SP-BHL SP-BHO SP-BLO

Bellanca Viking & Super Viking Hinge & latch assembly

SP-BLHL

Piper PA-28, -32, -34, -44 Hinge & latch assembly Hinge assembly only Latch assembly only

SP-PHL SP-PHIG SP-PLAT

LP Aero Plastics 1086 Boquet Road Jeannette, PA 15644-4707


Aircraft Windshields and Windows

P 8 gee 8 ag Pa

Supplies and Accessories Compass Mounting Kits These compass mounting kits are designed primarily for use on Cessna windshields which are using our STC compass mounting block bonded to the windshield. The windshield part number is designated with a suffix (/CMB). Kits are available with or without a new Airpath compass. Compass and mounting kit for Cessna STC conversions. Kit includes Airpath C2200L4 compass, compass housing, deviation card, attached mount, and hardware.

SP-CMKT

Compass mounting kit for Cessna STC conversions Kit is applicable only to the Airpath C2200L4 and includes compass housing, deviation card, attached mount, and hardware (Airpath C2200L4 Compass not included).

SP-CHKT

Glareshield Compass Mount This is a polished, clear acrylic, compass mounting bracket for kit aircraft, which is bent at a 90 degree angle and allows you to mount your compass to the top of your glareshield. Compass mount for glareshield installations - acrylic – Non-PMA LP-081

Aircraft Quality, Cell Cast Sheet Acrylic Sheet acrylic is available in the following colors, sizes, and thicknesses. These sheets meet ASTM D4802-02 or Federal specification L-P-391D and are of aircraft quality. Each sheet is available in clear, 2111 green tint, and 2515 solar gray tint. Additional tints are available in some thicknesses and sizes. Also available are some acrylic sheets meeting MIL-PRF-5425E, MIL-PRF-8184E, and MILPRF-25690B. Please contact us with your request. LIST PRICE PER SQUARE FOOT THICKNESS* CLEAR GREEN (2111) Gray (2515) UV-GT UV-SG CODE .060" 12.20 15.75 C .080" 12.20 15.75 15.75 23.70 23.70 C .100" 12.20 15.75 15.75 23.70 23.70 C .125" 13.00 16.30 16.30 22.90 22.90 C .150" 13.80 16.80 16.80 23.20 23.20 C .187" 15.40 17.10 17.10 24.70 24.70 C .250" 17.60 19.90 19.90 30.20 30.20 C .312” 23.45 31.40 31.40 39.90 39.90 C NOTE – These are nominal thicknesses based on the industry’s cell cast acrylic sheet tolerances. The tolerance range chart is shown on the inside back cover of the catalog. Pricing and sheets sizes of other tints are available upon request. Minimum order may be required. Acrylic Sheet Sizes: Standard size: 48" x 72" - .060”, .080”, .100” 48" x 96" - .125”, .250” 72" x 96" - .125”, .150”, .187”, .250” Not all colors are available in each of these sizes. All sales are based on availability from current stock. THERE IS A 20% CUTTING CHARGE ON ALL OTHER SIZES. MINIMUM CUTTING CHARGE OF $10.00. A CRATING CHARGE MAY APPLY.

Toll Free: 800-957-2376 Fax: (724) 744-7372 Email: info@lpaero.com


P gee 9 ag Pa 9

Supplies and Accessories ACRYLIC SHEET COLORS

Color

Code

Visible Light Transmittance

Green Tint Green Tint – UV and Infrared Blocking Solar Gray Solar Gray – UV and Infrared Blocking Medium Gray Dark Gray Bronze Dark Bronze Blue Medium Blue

GT GT-UV SG SG-UV MG DG BZ DB BL MB

77% 77% 76% 76% 59% 13% 49% 10% 78% 55%

ALL PRICES SUBJECT TO CHANGE WITHOUT NOTICE

© 2010 LP Aero Plastics, Inc. All Rights Reserved

LP Aero Plastics 1086 Boquet Road Jeannette, PA 15644-4707


P Pa ag gee 1 10 0

Aircraft Windshields and Windows

Manufacturer's Part Number Cross Reference List OEM Part No.

LP Part No.

TINT

OEM Part No.

AERO COMMANDER

AMERICAN CHAMPION

AERONCA

AMERICAN GENERAL

(SEE GULFSTREAM AMERICAN

LP Part No.

TINT

(SEE AERONCA OR BELLANCA)

(SEE BELLANCA)

(SEE GULFSTREAM AMERICAN)

AEROSPATIALE SOCATA

ARCTIC AIRCRAFT COMPANY (SEE INTERSTATE AIRCRAFT)

TB10.22.030.100

972

TB10.22.030.101

973

TB10.22.030.102

972

SG

TB10.22.030.103

973

SG

TB10.24.030.100

967

TB10.24.030.101

967

TB10.25.030.106

968

TB10.25.030.107

970

TB10.25.030.108

968

SG

TB10.25.030.109

970

SG

TB10.25.900.100

969

TB10.25.900.101

971

TB10.25.900.115

969

SG

TB10.25.900.116

971

SG

000-170028-2

150

TB10.63.000.108

974

002-430000-117

284

GT

TB20.18.001.102

975

002-430000-118

285

GT

TB20.18.001.103

976

002-430000-129

284.250

GT

TB21.24.001.101

967

002-430000-130

285.250

GT

892.25.0.072.1

1141

002-430001-57

029

GT

892.25.0.072.2

1142

002-430001-59

028

GT

892.25.1.140.1

1143

SG

002-430001-61

029.250

GT

892.25.1.140.2

1144

SG

002-430001-63

028.250

GT

892.25.2.117.1

1143

002-430051-1

269

GT

892.25.2.117.2

1144

002-430051-3

269

894.25.0.003.0

1140

002-430051-21

269

Z00.07126.27

973

002-430051-27

269

002-430052-1

211WV

GT

002-430052-11

211

GT

002-430052-13

188

GT

002-430052-27

211WV

GT

002-430053-1

254

GT

002-430053-2

255

GT

002-430053-3

254.250

GT

002-430053-4

255.250

GT

002-430053-9

254

GT

002-430053-10

255

GT

002-430053-11

254.250

GT

002-430053-12

255.250

GT

002-430053-19

254

GT

SG

SG

AIR TRACTOR 10211-1

080

10250-1

077

ALON A13250-5

872

A13250-31

872

GT

A13250-32

873

GT

A13250-53

872

A13250-54

873

A13260-7

870

A13260-8

871

A13270-6

874

A13270-7

874

Toll Free: 800-957-2376 Fax: (724) 744-7372 Email: info@lpaero.com

GT

AYRES 10153-1

535

10627-001

013

10627-002

013

10838-001

014

BEECHCRAFT 000-170000-53

1057

000-170000-54

1058

000-170001-13

1055

000-170001-14

1056

000-170028-1

149

GT

002-430053-20

255

GT

002-430053-21

254.250

GT

LP Aero Plastics 1086 Boquet Road Jeannette, PA 15644-4707


P Pa ag gee 1 11 1 Manufacturer's Part Number Cross Reference List OEM Part No.

LP Part No.

TINT

002-430053-22

255.250

GT

35-410291-167

002-430053-41

254

GT

35-410291-217

211

GT

002-430053-42

255

GT

35-410291-219

188

GT

002-430053-43

254.250

GT

35-410291-221

211WV

GT

002-430053-44

255.250

GT

35-410291-231

250

GT

002-440033-23

383

35-410291-232

251

GT

251411-1

1111

POLARIZE

35-410291-626

258

GT

251411-3

1112

POLARIZE

35-410291-628

252

GT

33-410010-1

140

GT

35-410291-650

258

GT

33-410010-2

141

GT

35-410291-652

252

GT

35-001029-19

256

35-410291-SA20

258

35-001029-20

257

35-410474-1

270

35-115136-2

286

35-410474-27

270

35-115136-3

286

35-410474-29

270

35-400320-4

253

35-410474-31

270

35-400320-10

253

35-400320-32

253

BEECHCRAFT continued

OEM Part No.

LP Part No.

TINT

BEECHCRAFT continued 281

35-410474-57

270

GT

35-410474-59

270

GT GT GT

35-400320-34

253

GT

35-410474-61

270

35-410000-98

256

GT

35-410474-63

270

35-410000-99

257

GT

35-410474-75

270

35-410291-4

252

35-440010-13

383

35-410291-8

250

36-400011-89

029

GT

35-410291-11

251

36-400011-91

028

GT

35-410291-12

254

36-430011-105

024

GT

35-410291-13

255

36-430011-107

025

GT

35-410291-14

252

36-430011-337

024.250

GT

35-410291-20

252

36-430011-339

025.250

GT

35-410291-34

250

36-430044-3

294.250

GT

35-410291-35

251

36-430044-5

294

GT

35-410291-86

258

36-430045-5

253

35-410291-96

258

45-115136-2

573

35-410291-126

254

45-115136-3

572

35-410291-127

255

45-410301-1

268

35-410291-128

254

GT

45-410301-19

268

35-410291-129

255

GT

45-410302-13

569

35-410291-130

254

GT

45-410303-1

570

35-410291-131

255

GT

45-410303-27

570

35-410291-132

252

GT

45-410304-13

571

35-410291-134

252

GT

50-110066-26

298

35-410291-136

258

GT

50-110066-27

299

35-410291-138

258

GT

50-400005-6

249

35-410291-146

254

GT

50-400005-8

249

35-410291-147

255

GT

50-400331-23

282

35-410291-164

280

50-400331-24

283

35-410291-165

281

50-400459-9

142

GT

35-410291-166

280

50-400459-10

144

GT

Clear unless otherwise indicated GT=Green Tint SG=Solar Grey BZ=Bronze DB=Dark Bronze

GT

MG=Medium Grey BL=Blue

DG=Dark Grey MB=Medium Blue

GT GT


P Pa ag gee 1 12 2

Aircraft Windshields and Windows

Manufacturer's Part Number Cross Reference List OEM Part No.

LP Part No.

TINT

50-400459-35

143

GT

101-420080-6

1119

50-420013-191

1108

GT

101-420080-7

1118

50-420013-1053

1108

GT

101-420080-8

1119

50-420066-103

1100

101-420081-1

1114

50-420066-104

1101

101-420081-2

1115

50-420066-317

1100

101-420081-5

1114

50-420066-318

1101

101-420081-6

1115

50-420066-353

1102

101-430183-3

1120

50-420066-354

1103

101-430183-5

1120

50-420066-419

1116

101-430194-3

1123

50-420066-420

1117

101-440042-1

1121

50-420066-437

1116

101-440042-2

1122

50-420066-438

1117

101-440042-3

1121

50-420083-25

1104

101-440042-4

1122

50-420083-26

1105

105-420015-15

173

50-420083-45

1106

105-420015-16

174

50-420083-46

1107

108-360014-11

005

50-440014-43

1109

GT

108-430000-13

001

GT

50-440014-44

1110

GT

108-430000-15

003

GT

50-440014-837

1109

GT

108-430000-16

004

GT

50-440014-838

1110

GT

108-430010-5

002

GT

95-420012-15

253.250

GT

114-430040-3

1124

DB

95-420012-17

253.250

GT

114-430156-1

1125

DB

96-170000-7

149

BEECHCRAFT continued

OEM Part No.

LP Part No.

BEECHCRAFT continued

169-110000-237

274

169-110000-239

274

96-170000-8

150

96-420011-1

254.250

GT

169-110000-247

274

96-420011-2

255.250

GT

169-364017-11

274

96-420011-3 (assy.)

252.250

GT

169-420000-27

119

96-420011-7

258.250

GT

169-420000-28

121

96-420011-11

254.250

GT

169-420000-29

123

96-420011-12

255.250

GT

169-420000-30

125

96-420011-23

254.250

GT

169-420000-117

120

96-420011-24

255.250

GT

169-420000-118

132

96-420011-632

258.250

GT

169-420000-127

124

96-420011-634

252.250

GT

169-420000-128

126

96-420029-1

269

GT

169-420005-57

248

96-420029-3

269

169-420005-61

175

96-430010-11

284

GT

169-420005-89

259

96-430010-12

285

GT

169-420005-99

272

96-430010-67

284.250

GT

169-420005-125

264

96-430010-68

285.250

GT

169-420005-127

278

96-430010-87

285

GT

169-420005-165

265

96-430010-89

285.250

GT

169-420005-167

176

101-420080-1

1118

169-420005-168

177

101-420080-2

1119

169-420005-169

278

101-420080-5

1118

169-420005-177

178

Toll Free: 800-957-2376 Fax: (724) 744-7372 Email: info@lpaero.com

TINT

LP Aero Plastics 1086 Boquet Road Jeannette, PA 15644-4707


P Pa ag gee 1 13 3 Manufacturer's Part Number Cross Reference List OEM Part No.

LP Part No.

TINT

BEECHCRAFT continued

OEM Part No.

LP Part No.

TINT

GT

BEECHCRAFT continued

169-420005-178

179

169-420038-47

120

169-420005-197

114

169-420038-48

132

GT

169-420005-201

259

169-420038-49

124

GT

169-420005-603

259

169-420038-50

126

GT

169-420010-17

180

169-420038-51

113

GT

169-420010-71

180

169-420038-53

128

GT

169-420021-5

259

GT

169-420038-54

130

GT

169-420021-7

114

GT

169-420038-55

108

GT

169-420021-9

178

GT

169-420038-56

109

GT

169-420021-10

179

GT

169-420038-65

273

GT

169-420021-11

176

GT

169-420038-67

273

GT

169-420021-12

177

GT

169-420038-71

173

GT

169-420021-13

278

GT

169-420038-72

174

GT

169-420021-15

180

GT

169-430015-9

112

169-420021-19

131

GT

169-430015-29

113

169-420021-23

259

GT

169-440005-133

127

169-420023-15

131

169-440005-134

129

169-420035-23

273

169-440005-185

128

169-420035-35

273

169-440005-186

130

169-420035-37

273

169-420035-43

273

169-420035-605

273

169-420036-7

107

169-420036-8

266

169-420036-103

107

169-420036-119

108

169-420036-120

109

3-469

231

169-420037-3

267

3-470

232

169-420037-17

267

4-594

227

169-420037-21

267

4-714

226

169-420037-23

267

4-715

225

169-420037-25

267

4-945-1

116

169-420038-7

107

GT

4-947-1

238

169-420038-8

266

GT

4-948-1

240

169-420038-9

119

GT

4-1446

291

169-420038-10

121

GT

4-1487

297

169-420038-11

123

GT

7-463

233

169-420038-12

125

GT

7-468

202

169-420038-13

127

GT

7-521

205

169-420038-14

129

GT

7-538

234

169-420038-17

267

GT

7-538

239

169-420038-31

273

GT

7-852-2

203

169-420038-35

107

GT

7-852-3

204

169-420038-37

267

GT

7-1256-1

290

169-420038-41

112

GT

7-1256-2

289

169-420038-45

273

GT

7-1256-1R

289

Clear unless otherwise indicated GT=Green Tint SG=Solar Grey BZ=Bronze DB=Dark Bronze

BELL HELICOPTER TEXTRON 206-031-115-011

2001

BL

206-031-115-033

2000

BL

206-031-116-101

2002

BL

206-031-116-103

2003

BL

BELLANCA

MG=Medium Grey BL=Blue

DG=Dark Grey MB=Medium Blue


P Pa ag gee 1 14 4

Aircraft Windshields and Windows

Manufacturer's Part Number Cross Reference List OEM Part No.

LP Part No.

TINT

BELLANCA continued

OEM Part No.

LP Part No.

TINT

BRITTEN-NORMAN continued

7-1256-1L

290

NB-15-D-1589

876

7-1264

192

NB-15-D-1593

878

7-1286

288

NB-15-D-1594

879

7-1418

293

SG

NB-15-H-1063

826

7-1443

207

NB-15-H-1064

9841-16

808

NB-15-1859

LP-NB-15-1859

9892-6

800

NB-15-1861

LP-NB-15-1861

9897-2

805

NB-15-2251

LP-NB-15-2251

15054-1

813

NB-15-2252

LP-NB-15-2252

15121-18

212

NB-15-2261

LP-NB-15-2261

19015-14

801

NB-15-2263

LP-NB-15-2263

190223-1

802

GT

NB-15-2265

LP-NB-15-2265

196552

819

GT

NB-15-2267

LP-NB-15-2267

196562

817

GT

NB-15-2515

LP-NB-15-2515

196940-1

816

GT

NB-15-2553

LP-NB-15-A2-2553

825

196940-2

820

GT

NB-15-2554

LP-NB-15-A2-2554

206113-1

818

GT

NB-15-2555

LP-NB-15-A2-2555

NB-15-2561

LP-NB-15-A2-2561

NB-15-2563

LP-NB-15-2563

BLANIK 105-02.07

1510

105-03.10

1516

105-03.16

1519

105-03.111

1518

105-04.10

1513

105-04.11

1514

105-04.12

1515

BRITTEN-NORMAN

NB-15-2569

LP-NB-15-2569

NB-15-3125

LP-NB-15-3125

NB-15-3127

LP-NB-15-3127

NB-15-3155

LP-NB-15-3155

NB-15-3157

LP-NB-15-3157

SG

NB-15-3159

LP-NB-15-3159

SG

NB-15-3161

LP-NB-15-3161

SG

NB-15-3163

LP-NB-15-3163

SG

LP-NB-15-3164

SG

NB-04-ND-1837

880

NB-15-3164

NB-04-ND-2083

881

NB-20-D-2311

NB-15-ND-1653

880

NB-20-D-4295

868

NB-15-A2-2251

862

NB-20-D-4296

869

NB-15-A2-2252

884

NB-85-921

LP-NB-85-921

NB-15-A2-2553

LP-NB-15-A2-2553

NB-85-922

LP-NB-85-922

NB-15-A2-2554

LP-NB-15-A2-2554

NB-85-2237

LP-NB-85-2237

NB-15-A2-2555

LP-NB-15-A2-2555

NB-85-2245

LP-NB-85-2245

NB-15-A2-2561

LP-NB-15-A2-2561

NB.90.0069

LP-NB.90.0069

NB-15-D-707

862

NB.90.0070

LP-NB.90.0070

NB-15-D-708

884

NB-15-D-1028

884

CESSNA

NB-15-D-1177

861

NB-15-D-1179

866

NB-15-D-1181

865

NB-15-D-1249

864

NB-15-D-1251

863

NB-15-D-1253

867

NB-15-D-1259

883

Toll Free: 800-957-2376 Fax: (724) 744-7372 Email: info@lpaero.com

SG

875

0311001-19

307

0311001-20

736

0311001-21

731

0311001-22

734

0311001-23

735

0311204-3

733

0311245

732

0411144

344

LP Aero Plastics 1086 Boquet Road Jeannette, PA 15644-4707


P Pa ag gee 1 15 5 Manufacturer's Part Number Cross Reference List OEM Part No.

LP Part No.

TINT

0411144-1

344

BZ

0411172-3

301

0411172-5

300

0512180-6

349

0411172-49

303

0512180-7

348

GT

0411182

342

0512180-8

349

GT

0411372-50

344

0513230-10

313

0412020-10

360

0513230-12

345

0412020-21

360

0513230-14

345

0412145

343

0513230-20

359

0412522-7

363

0513230-22

359

0413033-13

365

0513230-27

337

0413033-14

365

0513230-29

337

0413033-18

365

GT

0513230-32

353

0413033-19

365

GT

0513230-33

353

GT

0413339-10

303

0513230-34

353

GT

0413390-20

364

0513300-8

314

0513300-16

311

0517024-1

367

0517024-2

367

CESSNA continued

OEM Part No.

LP Part No.

TINT

0512180-4

349

GT

0512180-5

348

CESSNA continued

GT

GT GT

0413419-200

303

0413419-201

303/302

0413419-202

303/302

0413419-203

303

0517024-4

423

0413437-1

302

0517024-5

368

0417008-15

365

0517024-6

368

GT

0417008-16

365

0517024-7

423

GT

0417008-17

365

GT

0517024-9

423

0417008-18

365

GT

0517024-11

424

0510000-6

310

0517024-12

425

0510000-15

306

0517024-13

424

GT

0510001-5

312

0517024-14

425

GT

0510001-6

312

0523115-5

373

0511106-3

374

0591200-3

388

0511106-104

376

0611098

321

0511797-1

346

0611098-1

321

0511797-2

346

0611099-1

323

0512000-54

370

0611158

322

0512030-13

385

0611218

320

0512030-14

386

0611218-1

320

0512030-15

389

0612134

305

0512030-23

385

GT

0613050

308

0512030-24

386

GT

0613050-1

308

0512030-25

389

GT

0613050-2

308

0512030-203

389

GT

0700111-1

361

0512100-9

389

0700111-2

361

0512100-208

389

0700112-1

384

0512180-1

348

0700112-2

384

0512180-2

349

0700112-3

387

0512180-3

348

0700112-4

387

Clear unless otherwise indicated GT=Green Tint SG=Solar Grey BZ=Bronze DB=Dark Bronze

GT

GT

GT

BZ

GT

MG=Medium Grey BL=Blue

DG=Dark Grey MB=Medium Blue

GT

GT GT GT


P Pa ag gee 1 16 6

Aircraft Windshields and Windows

Manufacturer's Part Number Cross Reference List OEM Part No.

LP Part No.

TINT

0710108-1

362.125

GT

0710108-2

362

GT

0710108-3

362

0722100-10

382

0710620-16

392

GT

0722100-15

416

0711050-28

391

GT

0722100-16

417

0711051-1

369

0791300-4

309

0711051-2

369

GT

0791300-7

315

0711051-6

391

GT

0791300-13

315

0711051-7

391

0791300-15

316

0711051-9

068

0791300-16

316

GT

0711600-10

394

0811040-4

946

GT

0711600-11

393

0811040-10

161

GT

0711600-19

395

0811042-2

947

GT

0711600-20

396

0811042-4

163

GT

0711600-27

395

GT

0811043-1

957

GT

0711600-28

396

GT

0811043-2

958

GT

0711600-29

393

GT

0811046-1

959

GT

0711600-30

394

GT

0811046-2

960

GT

CESSNA continued

OEM Part No.

LP Part No.

TINT

0717019-2

405

GT

0722100-4

381

CESSNA continued

GT

GT

0711675-10

397

0811046-4

164

GT

0711675-11

371

0811046-5

162

GT

0711675-12

372

0811047-1

961

GT

0711675-13

371

GT

0811047-2

962

GT

0711675-14

372

GT

0811173-1

169

GT

0711675-15

397

GT

0811173-2

171

GT

0711800-10

397

GT

0811174-1

170

GT

0711800-11

371

GT

0811174-2

172

GT

0711800-12

372

GT

0811175-1

165

GT

0711800-18

390

GT

0811175-2

167

GT

0713000-6

309

GT

0811176-1

166

GT

0713000-24

315

0811176-2

168

GT

0713000-53

315

0811202-7

720

GT

0713100-10

316

0811202-15

721

GT

0713100-11

316

0811202-25

720

GT

0713287-11

339

0811202-200

720

GT

0713287-12

339

GT

0811208-200

720

GT

GT GT

0713334-2

339

GT

0811208-201

720

GT

0713538-1

318

GT

0811231-1

723

GT

0713538-3

317

GT

0811231-2

724

GT

0713600-8

338

0811232-1

725

GT

0713600-10

338

GT

0811232-2

726

GT

0717010-15

391

GT

0811285-6

567

GT

0717010-16

392

GT

0811486-6

548

GT

0717010-18

392

0811516-1

333

GT

0717013-7

402

GT

0811516-2

341

GT

0717013-8

402

GT

0811680-14

541

GT

0717019-1

404

GT

0811684-1

331

GT

Toll Free: 800-957-2376 Fax: (724) 744-7372 Email: info@lpaero.com

LP Aero Plastics 1086 Boquet Road Jeannette, PA 15644-4707


P Pa ag gee 1 17 7 Manufacturer's Part Number Cross Reference List OEM Part No.

LP Part No.

TINT

LP Part No.

TINT

0811690-25

543

GT

0811690-26

546

GT

1211670-4

218

GT

1211673-5

219

0811691-1

543

GT

GT

1212846-1

340

0811691-2

GT

334

GT

1212846-2

340

GT

0811691-3

335

GT

1212846-3

340

GT

0811700-1

536

1212846-4

340

GT

0811700-57

536

1213000-20

327

GT

0811702-1

336

1213001-17

067

GT

0811702-3

719

1213388-1

067

GT

0811725-21

542

GT

1213400-15

325

GT

0811726-1

332

GT

1213400-24

324

GT

0811755-7

545

GT

1213400-200

326

GT

0811755-8

547

GT

1213700-5

066

GT

0813659-1

716

1213800-200

330

GT

0813659-4

716

1221060-1

074

0813659-5

716

1221060-3

533

0813659-8

407

1221060-5

534

0813659-9

716

1400057-1

749

0813659-200

406

1400057-4

756

GT

0814218-2

722

1400057-26

749

GT

0823411-13

689

1400057-28

749

GT

0823411-14

679

1411312-2

752

GT

0891107-3

720

GT

1411312-3

729

GT

0891107-4

721

GT

1411312-4

752

GT

0891107-5

721

GT

1412312-1

730

GT

1210040-7

366

1412312-2

730

GT

1210040-8

375

1412312-3

730

GT

1210040-23

375

1412312-4

730

GT

1210041-2

347

1412312-5

747

GT

1210532-1

076

GT

1412312-6

747

GT

1210532-2

076

GT

1412312-7

747

GT

1210533-1

079

1412312-8

747

GT

1210533-2

079

1413700-28

741

GT

1211061-47

070

1413702-1

812

GT

1211061-54

069

1413702-3

728

GT

1211061-56

072

1422599-1

713

1211061-57

072

1422599-2

714

1211061-58

071

1511004-2

753

GT

1211349-1

075

GT

1511159-3

765

GT

1211400-14

221

GT

1511159-4

766

GT

1211400-16

220

GT

1511160-1

760

1211400-17

223

GT

1511161-1

757

1211400-18

224

GT

1511161-2

758

1211400-19

222

GT

1512004-5

740

GT

1211448-7

420

GT

1512004-6

740

GT

1211448-24

217

GT

1512004-7

737

GT

CESSNA continued

OEM Part No.

CESSNA continued

Clear unless otherwise indicated GT=Green Tint SG=Solar Grey BZ=Bronze DB=Dark Bronze

GT

GT

MG=Medium Grey BL=Blue

DG=Dark Grey MB=Medium Blue

GT


P Pa ag gee 1 18 8

Aircraft Windshields and Windows

Manufacturer's Part Number Cross Reference List OEM Part No.

LP Part No.

TINT

1512004-8

737

GT

1717060-205

530

GT

1512063-9

762

GT

2511010-1

1045

GT

1512063-10

762

GT

2511010-4

1044

GT

1512063-11

764

GT

2511010-5

1046

GT

1512063-12

764

GT

2511010-6

1047

GT

1513700-3

741

GT

2511124-1

1043

GT

1513770-1

775

GT

2511128-1

1042

GT

1517102-1

759

GT

2513503-1

1040

CESSNA continued

OEM Part No.

LP Part No.

TINT

CESSNA continued

1610003-3

377

2513503-2

1041

1610003-13

377

2611024-1

1006

GT

1610004-21

379

2611024-2

1007

GT

1610004-22

379

GT

2612057-1

1008

GT

1610016-9

378

GT

2612057-2

1009

GT

1610029-1

414

GT

2613088-1

1010

GT

1610029-2

415

GT

2613088-2

1011

GT

1610032-12

413

GT

2617024-2

1013

GT

1610032-13

411

GT

2617024-4

1013

GT

1610032-15

410

GT

2617059-1

1012

GT

1610032-16

412

GT

2617059-2

1014

GT

1710000-9

329

5011135-4

032

GT

1710000-10

329

5011135-8

033

GT

1712000-5

527

5011135-12

035

GT

1712000-6

528

5011135-16

031

GT

1712000-7

529

5011162-3

754

1712000-8

527

G