Issuu on Google+


índice

52 Divulgação

64 66

Tião Moreira/ZDL

4 EDITORIAL/CARTAS 6 LIMITE 10 DISTÂNCIAS E METAS 20 REGULAMENTAÇÃO 24 LINHA DE CHEGADA 32 TÉCNICOS 37 GUIA DO TÊNIS 51 MURAL SA 52 TROFÉU BRASIL 56 REEBOK 10KM 58 VOLTA DO LAGO 59 COLUNA NUTRIÇÃO 60 MIZUNO 10 MILHAS 61 ASSINANTE SA 62 CORRIDA DAS PONTES 63 MINHA HISTÓRIA 64 VOLKSWAGEN RUN 65 COLUNA MEDICINA ESPORTIVA 66 MARATONA DE SÃO PAULO 67 PERGUNTE AO TREINADOR 68 RECORDAR É CORRER 70 CALENDÁRIO 74 COLUNA RICARDO D’ANGELO

BM&FBOVESPA/Divulgação

Foto da capa: Shutterstock

A SuperAção é uma publicação mensal da Editora Multiesportes. Circula em todo o território nacional. Edição nº 77/Julho de 2009. EDITORA MULTIESPORTES Depto. Administrativo, Comercial e Redação - Av. Nossa Senhora de Fátima, 95 - Taquaral - Campinas/SP - CEP: 13076-000 Fone/Fax (19) 3254-3144 / 3252-2609 / 3251-0349 - Assinaturas: (19) 3294-4290 E-mail: superacao@interesportes.com.br - www.interesportes.com.br DIRETORES: Sergio Luis Coutinho Nogueira/Carlos Eduardo M. C. Nogueira - EDITOR: Rafael De Marco - REPORTAGEM: Fernando Evans/ Julianne Cerasoli FOTOS: Fernanda Paradizo (colaboradora)/Sergio Carvalho (colaborador) - PRODUTORA: Joyce M. Francia Cerasoli - PROMOÇÃO: Emerson Gonçalves da Silva CIRCULAÇÃO, ASSINATURAS e SAC: Nathália Franco (19) 3294-4290 - EDITORAÇÃO/ARTE: Priscila S. Belavenute TRATAMENTO DE IMAGENS: Marcos Antônio Marquezin - IMPRESSÃO: Gráfica Igil DEPTO COMERCIAL - Fone (19) 3254-3144 / 3252-2609 ADVERTÊNCIA - As informações contidas nesta revista são para fins educacionais e de informação. Qualquer mudança no seu estado de atividade física e nas dietas deve ser supervisionada por um profissional habilitado, desde que você tenha liberação médica. A revista não se responsabiliza pela utilização inadequada das informações aqui veiculadas e nem pelas opiniões de colaboradores.


editorial TÊNIS, TÊNIS, TÊNIS, TÊNIS, TÊNIS...

D

izer que corredor é apaixonado por tênis é chover no molhado. Por outro lado, trazer informações atualizadas sobre modelos consagrados e as novidades no mercado é mais que obrigação para uma revista especializada na modalidade. Assim, nosso Guia do Tênis procura proporcionar dados relevantes sobre os produtos que as principais marcas esportivas oferecem ao consumidor. O trabalho consumiu esforços de toda a equipe da redação de SuperAção e o resultado pode ser conferido nas 14 páginas, a partir da página 37, desta edição. Certamente o caro leitor encontrará modelos que se encaixam perfeitamente as suas necessidades, sejam elas referentes a pisada, amortecimento e até mesmo design e cores. Se os tênis são uma necessidade para proteger o 'instrumento de trabalho' e auxiliar na performance, o papel dos treinadores especializados em corrida segue a mesma linha, salvo as devidas proporções, óbvio. São eles os principais responsáveis por planejar e colocar em prática um cronograma de atividades cujo resultado será a satisfação de cruzar a linha de chegada com saúde e, de preferência, dentro do tempo estipulado previamente. O trabalho desses profissionais tem sido valorizado com o crescimento do interesse das pessoas pela modalidade. Basta observar o movimento nos parques, praças e

ruas. Mas você sabe qual é o melhor estilo de técnico para cada perfil de atleta? Saber escolher a pessoa que comandará parte de sua vida pode fazer toda a diferença para o sucesso da empreitada. Existem corredores que só funcionam com alguém falando na orelha, dando ordens; outros, não suportam pressão e precisam mais de um professor amigão que de um ditador. Por tudo isso, SA traz reportagem que ajuda a conhecer e dá dicas sobre como escolher o treinador ideal. Para quem já tem o seu treinador, ou ainda vai buscar orientação, fundamental também é definir exatamente qual a meta dentro do esporte. É claro que correr 10km ou uma maratona exigem esforços bastante diferentes e reconhecer como encarar cada distância ajuda a definir que tipo de corredor é cada um. Mesmo que as pessoas migrem de uma prova para outra e evoluam para desafios maiores ao longo do tempo, é importante alertar que, até chegar a esse ponto, sempre com segurança e qualidade de vida, informação e disciplina para não exagerar na dose são fatores primordiais. Isso é corrida com responsabilidade para com o próprio organismo, sem abrir mão do prazer da superação. Boas corridas! Rafael De Marco, Editor

cartas Tribuna “Olá, amigos da SuperAção. Eu participei pela terceira vez consecutiva da 10Km Tribuna FM, em Santos, e adorei. Queria parabenizar a todos pela belíssima organização, que a prova continue crescendo nas próximas edições e, ano que vem, estarei lá. Valeu!” Valter Uberaba (MG)

Kit “Quero me parabenizar pelo kit Nike e também pela matéria feita pela revista, pois fiquei muito

8

feliz por ter sido o escolhido pela equipe da Revista SuperAção. Obrigado!” Artur Magno Fernandes Belo Horizonte (MG) Calendário “Oi, SuperAção. Precisava escrever para agradecer o cuidado de vocês para com nós leitores. Só quem necessita de informações precisas para se inscrever em uma prova sabe o quanto é bom contar com um calendário correto e completo como o da SA. Continuem assim. Parabéns.” Eduardo F. Sartanelli São Paulo (SP)

Envie sua carta para Av. Nossa Sra. de Fátima, 95 - Taquaral - Campinas - SP- Cep: 13076-000, ou envie um e-mail para superacao@interesportes.com.br


PATROCINAR É ACREDITAR NO ATLETA DO COMEÇO AO FIM. OU MELHOR, DO TIRO DE LARGADA À FAIXA DE CHEGADA. CAIXA. Patrocinadora Oficial do Atletismo Brasileiro.

SAC CAIXA 0800 726 0101 - informações, reclamações, sugestões e elogios 0800 726 2492 - para pessoas com deficiência auditiva Ouvidoria: 0800 725 7474 caixa.gov.br

AN-CX-MKTEsp-GPBRASIL205x275.indd 1

6/18/09 3:13:19 PM


limite

Recorde no deserto

O ultramaratonista Carlos Dias entrou para o livro dos recordes pela segunda vez por ter sido o sul-americano que completou a Copa do Mundo dos Desertos (Racing The Planet) em menor tempo. Ele correu nos desertos de Gobi, Saara, Antártida e Atacama, considerados os mais extremos do mundo. A empreitada durou quase um ano (de junho de 2008 a abril deste ano, quando correu no Atacama, no Chile, etapa que considerou a mais difícil de todas). “A Antártida exigiu muito pelo peso da neve e ventos fortíssimos, mas o deserto do Atacama, pela troca constante de piso e a altitude aliada ao sal, me deixou exausto todos os dias da prova”, relembra. A primeira ocasião em que teve seu nome gravado no Guinness foi por ter percorrido o Brasil de norte a sul em 100 dias. O próximo desafio é cruzar os Estados Unidos de São Francisco a Nova Iorque pela Rota 80, percurso de 5 mil quilômetro que pretende completar em 60 dias.

Corrida dos famosos

Promovida pela Rede Globo, a competição entre famosos do Rio e de São Paulo foi uma atração à parte na Maratona de São Paulo. A equipe Vida Corrida, do Rio de Janeiro, levou a melhor sobre a paulista Fôlego. O time carioca, orientado por Lauter Nogueira, contou com Clayton Conservani, Tande, Adriana Samuel, Mariana Brochado, Fabíola da Silva, Smigol, Fernando Fisher, Tiago Gomes, Tico Santa Cruz, Rodolpo Mattheis e Olivier Cozan. Já os representantes de São Paulo, treinados por José Rubens D’Elia, foram Gustavo Borges, Hortência, Felipe Diniz, Cafu, Caio Ribeiro, Rogério Sampaio, Marcos Gomes, Juliana Didoni, Guilherme Berenguer, Juninho Paulista e Flávia Freire. Divulgação

Track&Field Run Series

A Track&Field Run Series atraiu cerca de 1.200 atletas em Curitiba (PR), na manhã de 14 de junho. A corrida do Shopping Mueller contou com percursos de 5km e 10km, com vitórias de Jorge Damascena Paim, com 34min44, e Letícia da Silva Salto, com 39min18 nos 10km; e Sergio Rodrigues da Silva, que marcou 15min50, e Juliana Veras, que fez 20min43, na menor distância.

Figura

166

O ex-padre irlandês que agarrou o maratonista brasileiro Vanderlei Cordeiro de Lima quando este liderava a maratona olímpica em Atenas-04 e invadiu a pista de Silverstone durante o Grande Prêmio de Fórmula 1 da Inglaterra em 2003, foi aprovado na primeira fase de um programa de calouros na Inglaterra. Neil Horan, que largou a batina em 2005, apresentouse no “Britain’s Got Talent” mostrando uma dança folclórica irlandesa. Os produtores do programa, o mesmo que revelou a cantora Susan Boyle, afirmaram que não sabiam do passado do candidato, que acabou não passando para as finais do programa.

Promoção

Cinco brasileiros terão a chance de participar da Maratona de Amsterdã, na Holanda, viajando com passagens, translados e hospedagem pagos pela Mizuno. A cada R$ 300,00 gastos em produtos da marca nas lojas Centauro, entre os dias 29/06 e 17/07, vale um cupom, que deve ser depositado na urna de qualquer loja da rede. Se a compra for feita com Cartões Bradesco, o consumidor ganhará cupons em dobro. O sorteio será realizado dia 31 de julho, e a prova, dia 18 de outubro. Mais informações nos sites da Mizuno (www.mizunobr.com. br), Centauro (www.centauro.com.br) e Cartões Bradesco (www.bradescocartoes.com.br).


limite

No topo do mundo

Para quem acha que correr uma prova 42km nas ruas da cidade onde mora já é tarefa das mais dasafiadoras, tem gente que se reúne todo dia 29 de maio para disputar aquela que é a maratona realizada em maior altitude de que se tem notícia. Trata-se de uma maneira, no mínimo dura, de homenegear os primeiros homens, Tenzing Norgay Sherpa e Edmund Hillary, a chegar ao topo da montanha mais alta do mundo, o Everest, justamente em 29 de maio de 1959. A largada acontece a 5.356m de altitude e a chegada ocorre a 3.446m, no Nepal. Nesse ambiente hostil, não é de surpreender que conhecer o terreno ajuda. Prova disso é que nada menos que os 22 primeiros colocados neste ano são nepaleses. Mas ninguém segurou Furba Tamang, de apenas 21 anos, que marcou 3h40min47 e conquistou, nesta sétima edição, a vitória e o novo recorde da prova. Para se ter uma ideia da façanha do garoto, o segundo colocado, Ram Kumar Tamang, completou o percurso em 4h07min02.

Alphaville Running

O final de tarde do sábado de 6 de junho foi o momento escolhido para a largada da segunda etapa do Circuito de Corridas Zarro Brasil 2009 – Alphaville Running – ATC. Disputada num percurso totalmente plano, foi a chance para os participantes tentarem suas melhores marcas. Como a edição marcou a estreia de um novo percurso, a aferição da distância mostrou que um possui 9.950m e, o outro, 5.050m. Correndo um pouco menos ou um pouco mais, quem se deu melhor foram Ana Cláudia Emperador, com 19min20, e Jaciane Barroso Araujo, com 39min, no feminino, e Valdir Bueno de Camargo (15min44) e Edinaldo Caetano Vilela (31min36), entre os homens.

Domínio brasileiro

Como de costume, os brasileiros dominaram o Campeonato Sul-Americano de Atletismo, disputado no Peru, entre os dias 19 e 21 de junho. Os atletas tupiniquins conquistaram ao todo 16 medalhas de ouro, 20 de prata e 17 de bronze, deixando a Colômbia na segunda posição e a Argentina na terceira. Fabiano Peçanha (1min47s82) e Kleberson Davide (1min49s33) protagonizaram uma dobradinha verde-amarela nos 800m, enquanto Damião Ancelmo de Souza foi o grande destaque da equipe de fundo, com o ouro nos 10.000m (29min23s57) e o bronze nos 5.000m (13min57s94). No feminino, Sueli Pereira da Silva somou uma prata na distância menor ao fazer 16min14s95 e um bronze nos 10.000m (33min47s15), prova que teve ainda Cruz Nonata na segunda colocação (33min36s60). Fabiana Murer venceu no salto com vara.


treinamento

Sim,

você pode! Está em dúvida se consegue encarar, e vencer, o desafio nas ruas? Acompanhe as dicas dos treinadores selecionados por SuperAção e descubra como cruzar a linha de chegada inteiro, seja após 10km, 21km ou 42km

10 16


!

Julianne Cerasoli

D

HYRUDU TXLO{PHWURV ¿FD DLQGD PDLV JRVWRVR TXDQGR VH tem um objetivo que, ao mesmo tempo em que testa os OLPLWHV HVWi GH DFRUGR FRP VXD SRVVLELOLGDGH GH FRPSURPHWLPHQWRFRPRHVSRUWHHQtYHOGHFRQGLFLRQDPHQWRItVLFR (DFRUULGDGHUXDWHPµQDSUDWHOHLUD¶RSo}HVSDUDWRGRVRVJRVWRV 4XHP WLYHU FHUFD GH K VHPDQDLV SDUD D PRGDOLGDGH VRPDQGRWUHLQRVHVSHFt¿FRVHFRPSOHPHQWDUHVSRGHVHSUHSDUDU WUDQTXLODPHQWHSDUDXPDSURYDGHNPHQTXDQWRDTXHOHTXH WLYHUI{OHJRSDUDGHGLFDUKSRUVHPDQDSDUDDFRUULGDSRGHVHU SUHVHQWHDGRFRPXPDPDUDWRQD 2EYLDPHQWH DV FRUULGDV QmR GLIHUHP DSHQDV HP GLVWkQFLD 2 WUHLQDPHQWR QmR p WmR VLPSOHV GR WLSR µVH HX FRUULD NP HTXHURSDVVDUSDUDNPEDVWDGREUDURVORQJRV¶&DGDSURYD WHPVXDVSUHUURJDWLYDVHPUHODomRjSUHSDUDomR3HQVDQGRQLVVR SuperAçãoSURFXURXHVSHFLDOLVWDVSDUDWUDoDUHPRSHU¿OGHWUHLQDPHQWRSDUDTXHPTXHUWHUPLQDULQWHLURXPDSURYDGHNP PHLDPDUDWRQDRXPDUDWRQD&RQKHoDRFDPLQKRGDVSHGUDVSDUD FKHJDUOi

11

SUPERAÇÃO


treinamento

a

ar p m k 0 1

12 16

lha u g r o se

$PDLVSRSXODUGDVFRUULGDVGHUXDDSULQFtSLRQmRH[LJHPXLWR 1mR p QHFHVViULR XP ODUJR WHPSR GH H[SHULrQFLD SDUD FRQVHJXLU HQIUHQWDU NP HP ULWPR PRGHUDGR &RQWXGR QHJOLJHQFLDU D SUHSDUDomR HVTXHFHQGR GH WUDEDOKDU D YHORFLGDGHFRPWLURVHDUHVLVWrQFLDPXVFXODUFRP WUDEDOKRVGHVREUHSHVRSRGHID]HUFRPTXHR SUD]HUGRLQtFLRVHWRUQHGRUHPGHFRUUrQFLD GHDOJXPDOHVmRRXHVWDJQDomR /RJRTXHPDOPHMDWHUPLQDUEHPXPDSURYD GD GLVWkQFLD GHYH SDVVDU SRU XP SHUtRGR GHDGDSWDomR³*HUDOPHQWHHQWUHVHLVPHVHVH XPDQRSDUDDGDSWDUDURWLQDHFULDUXPDERD EDVHIRFDQGRGLVWkQFLDVPHQRUHVHQWUHNPH NP´ UHFRPHQGD R WUHLQDGRU 'LHJR /RSH] GDHTXLSH7ULORSH](TXHWDPEpPHVWHMDGLVSRVWRDHQJDMDUQRPi[LPRKSRUVHPDQD ±LVVRQRSLFRGDSUHSDUDomRHLQFOXLQGRFRUULGDHPXVFXODomR±SDUDDWLQJLUVHXREMHWLYR $TXLFRQVLGHUDPRVRVUHTXLVLWRVQHFHVViULRV SDUDFRPSOHWDUDSURYDHQWUHHPLQXWRV RTXHpXPDERDPDUFDSDUDDPDGRUHV 'H DFRUGR FRP /RSH] D TXLORPHWUDJHP VHPDQDOFKHJDDRVNPDLQGDFRQVLGHUDQGR RPRPHQWRHPTXHRFRUUHGRUWHUiPDLVµWUDEDOKR¶(PPpGLD¿FDQRVNP,VVRGLYLGLGRHPTXDWURGLDVQDVHPDQD&RQVLGHUDQGR TXHGRLVGLDV¿FDPOLYUHVSDUDDPXVFXODomR H RXWUR SDUD GHVFDQVR R WUHLQDGRU SURS}H D VHJXLQWHGLYLVmR³2LQGLYtGXRWUHLQDFRUULGD WHUoDTXLQWDViEDGRHGRPLQJRPXVFXODomR VHJXQGDHTXDUWDHGHVFDQVDQDVH[WD´ 8P GRV GLDV GH FRUULGD p UHVHUYDGR DR ORQJR ³(OH GHYH ¿FDU HQWUH NP GLVWkQFLDGDSURYD HNP XPSRXFRPDLVTXHD GLVWkQFLD PDLV D PHWDGH GHOD ´ UHFRPHQGD /RSH]$RVLQWHUYDODGRVSRUVXDYH]¿FDP UHVHUYDGRV GRLV GLDV 6HJXLQGR D SURJUDPDomRDQWHULRUWHUoDHTXLQWDSRUH[HPSOR³2 FRUUHGRU GHYH ID]HU EDVWDQWH DTXHFLPHQWR H VpULHV GH YHORFLGDGH DWp P  WRWDOL]DQGR PLQ(DVpULHSULQFLSDOQDVGLVWkQFLDVHQWUH PHNPFRPLQWHUYDORHUHSHWLo}HVµ[¶ GHSHQGHQGRGRDWOHWD´LQGLFDRWUHLQDGRU

r


21km

ro i e t n i ar g e h c para

2SUy[LPRSDVVRjSULPHLUDYLVWDEDVWDQWHGLVWDQWHPDVTXHQDYHUGDGHpXPDHYROXomRQDWXUDO SDUDRFRUUHGRUDVVtGXRGHNPpDPHLDPDUDWRQD'HDFRUGRFRP0DUFHOR2UWL]WUHLQDGRUGD%5 (VSRUWHSURIHVVRUGHSyVJUDGXDomRHP¿VLRORJLD GRH[HUFtFLRRSHU¿OGHTXHPSDUWLFLSDGHHYHQWRV GRWLSRpEDVLFDPHQWHHVWDUWUHLQDQGRUHJXODUPHQWH HVHPLQWHUUXSo}HVKiPDLVGHXPDQRHPHLR³1R HQWDQWRDRFRQWUiULRGRTXHPXLWRVLPDJLQDPSDUD FRPSOHWDU XPD PHLD PDUDWRQD FRP VXFHVVR FKHJDQGRLQWHLURVHPPDLRUHVSUHRFXSDo}HVFRPGHVHPSHQKR pQHFHVViULRFRUUHUHQWUHNPHNP QDVVHPDQDVPDLVLPSRUWDQWHVGRWUHLQDPHQWR,VWR SRGHULDVHUH[HFXWDGRFRPXPWHPSRGHDKRUDV GH FRUULGDV VHPDQDLV DFRPSDQKDGR SRU GXDV VHVV}HVGHPXVFXODomR$IUHTXrQFLDVHPDQDOPtQLPD GHYHVHUGHYH]HVQDVHPDQDGHFRUULGDHPGLVWkQFLDVHLQWHQVLGDGHVDOWHUQDGDV´UHFRPHQGD 0DV HVVH YROXPH QmR p XP Q~PHUR IHFKDGR GHSHQGHQGR GD IDVH GR WUHLQDPHQWR ³$ TXLORPHWUDJHP VHPDQDO GHYH VHPSUH YDULDU FRPR VH IRVVHXPDHVFDGDVXELQGRVHPDQDDVHPDQDVHPSUH DFRPSDQKDGDGHXPDVHPDQDGHUHFXSHUDomR1R HQWDQWRHPDOJXQVSHUtRGRVGHWUHLQDPHQWRHOHJH VHXPPDLRUYROXPHVHPDQDOHHPRXWURVSHUtRGRV IRFDVHPDLVDLQWHQVLGDGH(VWHMRJRHQWUHYROXPHH LQWHQVLGDGHpXPDDUWHGHWHUPLQDGDSHODSHULRGL]DomRGRWUHLQDPHQWR2DWOHWDTXHQmRSHULRGL]DVHXV WUHLQRVGHSRLVGHDOJXPWHPSRFRPHoDDREVHUYDU TXHVXDSHUIRUPDQFHSRXFRVHDOWHUDHjVYH]HVPHOKRUDGHPDQHLUDPXLWRWtPLGD´DOHUWD2UWL] %DVLFDPHQWHDSUHSDUDomRSURSRVWDSHORWUHLQDGRU SDUD TXHP TXHU FRPSOHWDU XPD PHLD FRQVLVWH HPNPDNPQDVGXDVDRLWRVHPDQDVTXHSUHFHGHPDSURYD³$QWHVGLVVRRDWOHWDGHYHULDHVWDU WUHLQDQGRSHORPHQRVNPDNPQDVHPDQDHP GRLVDWUrVWUHLQRVMiKiYiULRVPHVHV2PDLVLPSRUWDQWHpTXHSHORPHQRVXPWUHLQRVHPDQDOWHQKD GLVWkQFLDGHNPDNPHRVGHPDLVSRGHPVHU PDLVFXUWRV NPDNP (VWHpRYROXPHPtQLPR 0HQRV TXH LVVR SURYDYHOPHQWH HOH WHUi TXH ID]HU DOJXPDVFDPLQKDGDVGXUDQWHDSURYD´ 2V ORQJRV UHDOL]DGRV QXPD LQWHQVLGDGH PHQRU ±RWUHLQDGRUWUDEDOKDFRPPHGLomRSRUPHLRGHOLPLDUHVVHQGRRLQGLFDGRSDUDHVWHWLSRGHWUHLQRR

OLPLDUGHODFWDWR±DWLQJHQRSLFRGDSUHSDUDomRGH NPDNP³/RJLFDPHQWHSDUDDTXHOHVTXHQmR WrPWHPSRSDUDGHGLFDUVHPDLVDRVWUHLQRVGHFRUULGD HVWD p XPD VXJHVWmR PtQLPD QHFHVViULD SDUD FRPSOHWDUDPHLDPDUDWRQD6HQGRDVVLPQRVGRLV D WUrV PHVHV TXH SUHFHGHP HVWD SURYD R FRUUHGRU SUHFLVDGHGRLVDWUrVWUHLQRVORQJRVQRPrV´ (PUHODomRDRVLQWHUYDODGRVRWUHLQDGRUGHIHQGHTXHVHMDPUHDOL]DGRVQDLQWHQVLGDGHGRžOLPLDU DQDHUyELR SRGHQGRFKHJDUjYHORFLGDGHGR920i[³&RPRDFLPDGHVWDVLQWHQVLGDGHVWHPRVXP VDOWR H[SUHVVLYR GRV KRUP{QLRV GR HVWUHVVH DGUHQDOLQD QRUDGUHQDOLQD H FRUWLVRO  VXJHUHVH SDUD HVWD FRQGLomR TXH R DWOHWD UHDOL]H XPD VHVVmR GH WUHLQDPHQWRLQWHUYDODGRVHPDQDO´LQGLFD³4XDQGR UHDOL]DPRVRVWUHLQRVLQWHUYDODGRVXWLOL]DPRVQRVVDUHVHUYDGHJOLFRJrQLRDUPD]HQDGDQRP~VFXORH ItJDGR&RPRHVWDUHVHUYDpOLPLWDGDDVRPDWyULD GRWHPSRGRVWLURVQmRGHYHXOWUDSDVVDUDWpQR Pi[LPRPLQXWRV'HQWURGHVVDGXUDomRRDWOHWD SRGHFXPSULUSRUH[HPSORWLURVGHPLQXWRV RX  WLURV GH  PLQXWRV RX  WLURV GH  PLQXWRV´ H[HPSOL¿FD $YHORFLGDGHTXHHOHLUiFXPSULUDSURYDpSUDWLFDPHQWH D PHVPD GR ž OLPLDU ³3RU H[HPSOR TXHP WLYHU R ž OLPLDU HP NPK D WiWLFD SHUIHLWDSDUDHOHID]HUHVWDGLVWkQFLDpMXVWDPHQWHQHVWD YHORFLGDGH QHP DFLPD QHP DEDL[R$WOHWDV SUR¿VVLRQDLV FKHJDP D WHU HVWH tQGLFH HP NPK H NPK´ H[SOLFD 6HJXQGR R WUHLQDGRU XPD GH VXDVDOXQDVTXHHVWUHDYDQDGLVWkQFLDXWLOL]RXHVWH VLVWHPDGHWUHLQDPHQWRHFRPSOHWRXD0HLDGH6mR 3DXORHPK

13

SUPERAÇÃO


treinamento

42k m

14 16

to s u s s em

&RUUHUXPDPDUDWRQDGH¿QLWLYDPHQWHQmRpSDUD TXDOTXHUXP3HORPHQRVFHUWDPHQWHQmRpSDUDRV PDLV LPSDFLHQWHV $ SURJUDPDomR GHYH VHU IHLWD VHPDWURSHORVFRPXPVHPHVWUHGHDQWHFHGrQFLDH DH[SHULrQFLDQRPXQGRGDVFRUULGDVGHYHVHUGHQR PtQLPRXPDQRVHQGRTXHRLGHDOpUHDOL]iODDSyV WUrVDQRVGHWUHLQRVVHPLQWHUUXSomRSDVVDQGRSRU GLYHUVDV SDUWLFLSDo}HV HP FRPSHWLo}HV PHQRUHV LQFOXLQGR PHLDV PDUDWRQDV ³4XDQWR PDLV H[SHULHQWHHWUHLQDGRIRURPDUDWRQLVWDPHOKRUIDUiVHXV UHVXOWDGRVSRLVDSURYDH[LJHPDWXUDomRRUJkQLFD ¿VLROyJLFD GH UHVLVWrQFLD SVLFROyJLFD H PXLWD H[SHULrQFLDQDDGPLQLVWUDomRGDGLVWkQFLDSDUDRERP GHVHPSHQKR DWOpWLFR VDXGiYHO´ IULVD D WUHLQDGRUD 0LULDP&DOGDVVR 3DUDTXHPVHDQLPRX0LULDPDYLVD³2GLItFLO p UHDOL]DU WRGR R WUHLQR GD PDUDWRQD H QmR FRUUHU DSURYD´(PFRQWUDSDUWLGDDSUR¿VVLRQDOVDOLHQWD

s

TXHHQIUHQWDUXPDPDUDWRQDVHPWUHLQRHVSHFt¿FR UHVXOWDUiQXPVRIULPHQWRDLQGDPDLRU±HFRQFHQWUDGRGXUDQWHNP±JHUDQGRDWpDYHUVmRjGLVWkQFLD ³6HFRQVHJXLUFRPSOHWDUDGLVWkQFLDVHPWUHLQRYDL VHUHPFLPDGHPXLWDGRUHRDWOHWDSRVVLYHOPHQWH QmR YDL TXHUHU PDLV SDUWLFLSDU GH PDUDWRQDV SRLV YDL OHYDU PXLWR WHPSR SDUD VH UHFXSHUDU 6LWXDomR GLIHUHQWHGDTXHOHDWOHWDWUHLQDGRTXHHVWDUiLQWHLUR DSyVXPDVHPDQD´ $ SUHSDUDomR EiVLFD SURSRVWD SRU 0LULDP p FRPSRVWDGHVHLVPHVRFLFORVGLYLGLGRVHPSHUtRGR GHEDVHULWPRGHFRPSHWLomRFRPSHWLomRHDSURQWHTXHYDULDPHPUHODomRDRYROXPHHLQWHQVLGDGH VHQGR TXH DV ~OWLPDV  VHPDQDV GH WUHLQDPHQWR HVSHFt¿FRVmRSULPRUGLDLV³$TXLORPHWUDJHPPtQLPDGHYHVHUGHNPVHPDQDLVVHQGRTXHDFDGD VHPDQDGHYHVHDFUHVFHQWDUXPSRXFRGHTXLORPHWUDJHP FRPR SRU H[HPSOR NP DWp D WHUFHLUD


VHPDQD GH FDGD PrV EDL[DQGRD QD TXDUWD VHPDQD SDUD VHGLPHQWDomR GR WUHLQR SRGHQGR FKHJDU D NP GHSHQGHQGR GR FRQGLFLRQDPHQWR ItVLFR $VVLP GHYH VHJXLU D PHVPD SURJUHVVLYLGDGH DWp FKHJDUGLDVGHDQWHFHGrQFLDjSURYDTXDQGRVH GLPLQXLDTXLORPHWUDJHPSDUDFKHJDUQRGLDGDPDUDWRQDEHPGHVFDQVDGR´H[SOLFD 2 LGHDO VHJXQGR D WUHLQDGRUD p GLVSRU GH VHLV GLDVGHWUHLQDPHQWRSRUVHPDQDRTXHQR¿QDOGDV FRQWDV UHVXOWD HP FHUFD GH  KRUDV VHPDQDLV GH GHGLFDomRQ~PHURTXHDXPHQWDSURSRUFLRQDOPHQWHHPUHODomRDRUHQGLPHQWRTXHVHEXVFDQDSURYD&DVRQmRGLVSRQKDGHWDQWRWHPSR0LULDPYr FRPRRPtQLPRSRVVtYHOTXDWURGLDVGHWUHLQRSRU VHPDQD $VURGDJHQVGRFDQGLGDWRDPDUDWRQLVWDYDULDP EDVWDQWHPDVJHUDOPHQWH¿FDPHQWUHHNPGLD ± R TXH DFRQWHFH JHUDOPHQWH DRV GRPLQJRV ³(P DOJXQV GLDV R LPSRUWDQWH p URGDU R WHPSR GH GXUDomRVHPVHLPSRUWDUFRPDGLVWkQFLDSHUFRUULGD ,VVR SRGH VHU IHLWR SRU K D K HP ULWPR OHYH FRP IUHTXrQFLD FDUGtDFD DEDL[R GH ESP SDUD DGTXLULUUHVLVWrQFLDPXVFXODUORFDOL]DGDDGDSWDUR VLVWHPD¿VLROyJLFRHDGDSWDUDUHVLVWrQFLDSVLFROyJLFD´ LQGLFD 0LULDP TXH UHFRPHQGD HVWH WLSR GH WUHLQRXPDYH]SRUVHPDQD 1R WUHLQR GRPLQLFDO DV GLVWkQFLDV SRGHP YDULDU 3RU H[HPSOR QR SULPHLUR PrV GR WUHLQDPHQWR HVSHFt¿FR NPNPNPNP QR VHJXQGR NPNPNPNP QR WHUFHLUR NPNPNP DWp FKHJDU D FRPSHWLomR 2V LQWHUYDODGRV ¿FDP FRP GXDV VHVV}HV VHPDQDLV SRGHQGRVHUVHSDUDGRVHQWUHLQWHUYDODGRVGHULWPR PDLVORQJRV HPXPGLDHGHYHORFLGDGHHPRXWUR $ WUHLQDGRUD OHPEUDTXH PDUDWRQDp ULWPR GDt DLPSRUWkQFLDGRVWUHLQRVLQWHUYDODGRV2VWLURVSRGHPVHULJXDLVRXSURJUHVVLYRVHUHVSHLWDURVLQWHUYDORV p IXQGDPHQWDO ³&DGD DWOHWD GHYH FDOFXODU R WHPSRGRVWLURVDWXDLVVREUHDPpGLDGRWHPSRGD H[HFXomRGRVWLURVGR~OWLPRWUHLQRSDUDVHUYLUGH EDVHDRSUy[LPRWUHLQR´LQIRUPD0LULDP $ SULQFLSDO UHIHUrQFLD SDUD VDEHU TXDO D PHWD SDUDRVNPpDPHLD³2WHPSRYDLVHUUHODWLYRDR ULWPR TXH HOH FRQVHJXH URGDU RV IXQG}HV NP  DRVWHPSRVTXHH[HFXWDRVLQWHUYDODGRVDRVHXPHOKRU WHPSR QRV NP QD PHLD PDUDWRQD HWF 2X VHMD GRLV RX PDLV DWOHWDV SRGHP ID]HU R PHVPR WUHLQR GD SODQLOKD H DWp D PHVPD TXLORPHWUDJHP SRUpPFDGDXPFRUUHQGRHPVHXULWPRHJUDXGH FRQGLFLRQDPHQWR´ SRQGHUD 0LULDP 3DUD FDOFXODU RULWPRDVHUDGRWDGRQDSURYDDWUHLQDGRUDLQGLFD

PXOWLSOLFDUDPDUFDGDPHLDSRUGRLVHVRPDUHQWUH HPLQXWRV3RUH[HPSORTXHPID]RVNP HP K IDULD D PDUDWRQD HQWUH K H K RX VHMDQXPULWPRHQWUHPLQHPLQNP³(VVH FiOFXORpyWLPRSDUDGHWHUPLQDURULWPRTXHRDWOHWD GHYHODUJDUSDUDDPDUDWRQDVHPRULVFRGHTXHEUD &ODUR TXH LVVR EDVHDQGRVH HP XP FRUUHGRU TXH WHQKD UHDOL]DGR R WUHLQDPHQWR HVSHFt¿FR GD SURYDTXHDDGPLQLVWUDomRGHULWPRVHMDQHVVDPpGLD HFRPWRGRVDTXHOHVFXLGDGRVGHHVWDUDOLPHQWDGR KLGUDWDGRHWF´

15

SUPERAÇÃO


treinamento

COMO

LÁ R A G CHE

LSRGH UPLQDGRW UDU WH H G U WD X F VXSH H[H LFXODUHP SUR¿VVLRQDLV SDUD UW D S H G D KR H OG V HOR FDPLQ  GL¿FX DOHP DV GLFDV GR S WD  V P UH D  o R UH Y HLQR Y TXH DSD WUiV UDRREMHWL ODUR WU LVTXHU REVWiFXORV GDVRVµQmRV¶SDUD DUDFKHJD F S p V O D V D H LV G P L D WR GDVDVSUH DUDLVVRR XH¶ TX DYH]SRU ,GHQWL¿FD DPDVVD3  PDVFDVRµHPSDT  GHL[DUGHXP Q R m P D U D V DJRUDERWD PWRGRVRVVHQWLGR XVLQWDTXHWHPXP H R U WR D Q H OK D pWUDE RWUHLQDP DVSHFWRG HPDOJXP

16


17

SUPERAÇÃO


treinamento

POR QUE OS TREINOS NÃO SÃO IGUAIS PARA TODO MUNDO? 4XDQGR VH IDOD TXH p QHFHVViULR EXVFDU DMXGD GH SUR¿VVLRQDLV SDUD SUHVFUHYHU H DFRPSDQKDU RV WUHLQRV GH FRUULGD QmR p XPD TXHVWmR GH SUHFLRVLVPR&DEHDHOHVDQDOLVDUDVYDULiYHLVTXH GLIHUHQFLDPXPFDVRGRRXWURDYDOLDQGRGHVGH FDUDFWHUtVWLFDVItVLFDVDWpWHPSRGLVSRQtYHOSDUD DDWLYLGDGHSDVVDQGRSHORKLVWyULFRQRHVSRUWH REMHWLYRV HWF ( LVVR GHYH VHU HQFDL[DGR QRV SULQFtSLRVGRWUHLQDPHQWRHVSRUWLYRGHIRUPDD QmRXOWUDSDVVDUROLPLWHHQWUHSUHSDUDURFRUUHGRU SDUDVXDPHWDHHYLWDUOHV}HVHVREUHFDUJDV6mR HVVHVSULQFtSLRVTXHYmRGLIHUHQFLDURWUHLQRGH XPDSHVVRDSDUDRXWUDSHVVRD

18 16

1 - Sobrecarga: pDDSOLFDomRGHHVWUHVVH RX GHPDQGD PDLRU GR TXH D QRUPDO VREUH R VLVWHPD¿VLROyJLFRRXVREUHDOJXPyUJmRTXH UHVXOWDHPDXPHQWRGDIRUoDRXGDIXQomRGRV PHVPRV (VWH SULQFtSLR H[SOLFD R PpWRGR SHOR TXDOYRFrPHOKRUDRVHXFRQGLFLRQDPHQWRItVLFR $R ÀH[LRQDU R DQWHEUDoR UHSHWLGDPHQWH RV P~VFXORVGREtFHSVVRIUHPSRXFDRXQHQKXPD PXGDQoD 3RUpP DR ÀH[LRQDU R DQWHEUDoR UHSHWLGDPHQWH FRP XP SHVR DGLFLRQDO RX XPD IRUoD µPDLRU GR TXH D QRUPDO¶ RV P~VFXORV UHVSRQViYHLV SRU HVWH PRYLPHQWR JDQKDUmR IRUoD 6H YRFr GHVHMD PHOKRUDU D IXQomR RX D IRUPDItVLFDGHYHVREUHFDUUHJDUDTXHOHP~VFXOR RX VLVWHPD 2 PpWRGR PDLV FRPXP SDUD VREUHFDUUHJDU R VLVWHPD PXVFXORHVTXHOpWLFR p R WUHLQDPHQWR GH UHVLVWrQFLD 2 XVR GH SHVRV HOiVWLFRV UHVLVWLGRV RX R XVR GD SUySULD UHVLVWrQFLD GD iJXD KLGURJLQiVWLFD  REULJDUi RVP~VFXORVWUDEDOKDGRVDID]HUHPXPHVIRUoR DLQGDPDLRUUHVXOWDQGRQRDXPHQWRGHIXQomR RX GH IRUoD 2 VLVWHPD FDUGLRUUHVSLUDWyULR WDPEpPGHYHVHUVXEPHWLGRjVREUHFDUJDFRP R SURSyVLWR GH PHOKRUDU DV VXDV IXQo}HV 2 SULQFtSLRGHVREUHFDUJDSRGHVHUXWLOL]DGRDLQGD SDUDGHVHQYROYHUDÀH[LELOLGDGH

2 - Sobrecarga progressiva: p R DXPHQWR JUDGXDO H VLVWHPiWLFR GH WHQVmR RX IRUoD DSOLFDGD VREUH R VLVWHPD ¿VLROyJLFR RX VREUHXPyUJmRD¿PGHHYLWDUULVFRVGHOHVmR RXGHIDGLJDFU{QLFD([DJHUDUQROHYDQWDPHQWR GH SHVRV RX QDV FRUULGDV SRGH DXPHQWDU R ULVFR GH OHVmR 6XEPHWHU R FRUSR j VREUHFDUJD PXLWR UDSLGDPHQWH UHSUHVHQWD JUDQGH DPHDoD DR RUJDQLVPR HP WHUPRV ¿VLROyJLFRV 0HVPR TXH R DWOHWD FRQVLJD HYLWDU SRVVtYHLV OHV}HV PXVFXORHVTXHOpWLFDVDLQGDDVVLPSRGHSDVVDUD VRIUHU GH IDGLJD FU{QLFD 2 LGHDO p DXPHQWDU D FDUJDGRVSHVRVSURJUHVVLYDPHQWHRTXHUHGX] DDPHDoDGHOHVmRSRLVSHUPLWHRGHVFDQVRHD UHFXSHUDomRDGHTXDGDGRVP~VFXORV 3 - Adaptação: p D FDSDFLGDGH GH XP VLVWHPD RX yUJmR SDUD VH MXQWDU DR HVIRUoR RX VREUHFDUJD DGLFLRQDO D SDUWLU GR DXPHQWR GH IRUoD RX IXQomR 2 FRUSR KXPDQR DGTXLUH PDLRU FRQGLFLRQDPHQWR ItVLFR SRUTXH VH DGDSWD jV H[LJrQFLDV TXH OKH VmR LPSRVWDV 6H R FRUSR GHVHPSHQKDU UHSHWLGDPHQWH R PHVPR WLSRGHH[HUFtFLRFRPDPHVPDFDUJDGHSHVR R H[HUFtFLR YDL VH WRUQDQGR PDLV IiFLO SRLV R FRUSR YDL VH DGHTXDQGR j VREUHFDUJD 3DUD DXPHQWDU R GHVHPSHQKR GHYH KDYHU DXPHQWR QDFDUJDSDUDTXHRFRUSRVHDGSWHDFDGDQRYR GHVD¿R 4 - Especificidade: pRSULQFtSLRTXH UHFRPHQGD R WUHLQDPHQWR H[FOXVLYR GD SDUWH GR VLVWHPD RX GR FRUSR TXH HVWHMD UHFHEHQGR D VREUHFDUJD $ DGDSWDomR ¿VLROyJLFD VHUi HVSHFt¿FD SDUD HVWD SDUWH GR FRUSR RX VLVWHPD HQYROYLGR 5 - Variabilidade/Treinamento cruzado: p D YDULDomR GD LQWHQVLGDGH GD GXUDomR RX GR HVWLOR WUHLQDPHQWR FUX]DGR 


GDV VHVV}HV GH H[HUFtFLR QD EXVFD GH XP PHOKRUHTXLOtEULRPXVFXODUHGHXPDH[FHOHQWH IRUPD ItVLFD $XPHQWDU D GHPDQGD VREUH RV GLYHUVRVJUXSRVPXVFXODUHVRXVREUHRVLVWHPD ยฟVLROyJLFRSRVVLELOLWDXPSURFHVVRGHDGDSWDomR PDLV DPSOR SDUD R FRUSR $ GLYHUVLยฟFDomR p QHFHVViULD GHYLGR j OHL GD HVSHFLยฟFLGDGH )D]HQGR VHPSUH R PHVPR WLSR GH H[HUFtFLR RV UHVXOWDGRV DOFDQoDGRV VHUmR VHPSUH RV PHVPRV 0XLWDV SHVVRDV HQIUHQWDP SUREOHPDV FRPRVSURJUDPDV GHH[HUFtFLRV9DULDU RWLSR GH WUDEDOKR ItVLFR SURYDYHOPHQWH GDUi D HVVHV DWOHWDVDPRWLYDomRWmRGHVHMDGDSDUDFRQWLQXDU SHUGHQGR SHVR RX DOFDQoDU VHXV REMHWLYRV GH PHOKRU FRQGLFLRQDPHQWR TXH OKH p LPSRVWR $FLPDGHWXGRDYDULDELOLGDGHpXPGHYHUSDUD DVD~GHHSDUDRWUHLQDPHQWR 6 - Reversibilidade: pRSULQFtSLRTXH FRQVWDWDDUHYHUVmRJUDGXDOGRFRUSRDRHVWiJLR GH SUpWUHLQDPHQWR TXDQGR Ki LQWHUUXSomR GRV H[HUFtFLRV 2 FRQGLFLRQDPHQWR QmR SRGH VHU LQWHUURPSLGR 4XDQGR LVVR DFRQWHFH DV IXQo}HV ยฟVLROyJLFDV H D IRUoD UHWRUQDP DRV QtYHLVLQLFLDLVGHFRQGLFLRQDPHQWR$UHYHUVmR pRSULQFtSLRPHQRVDSUHFLDGRSHORVSUDWLFDQWHV GHH[HUFtFLR2XYRFrWUDEDOKDRFRUSRRXSHUGH R FRQGLFLRQDPHQWR 8P IDWR TXH SRGH VHUYLU GHFRQVRORpDFDSDFLGDGHGRFRUSRDUPD]HQDU XPD ยณPHPyULD PXVFXODU RX FRQGLFLRQDGRUDยด 3HVTXLVDV LQGLFDP TXH LQGLYtGXRV TXH PDQWrP XP ERP QtYHO GH FRQGLFLRQDPHQWR SRU XP ORQJR SHUtRGR SHUGHP RV EHQHItFLRV ยฟVLROyJLFRV PDLV OHQWDPHQWH 4XHP Mi WHYH XPERPFRQGLFLRQDPHQWRWHUiPDLVIDFLOLGDGH

HPUHDGTXLUtORHPUD]mRGRVGLYHUVRVIDWRUHV DVVRFLDGRVjPHPyULDGRP~VFXOR 7 - Diferenรงas individuais/ Individualidade biolรณgica: PXLWRV IDWRUHV FRQWULEXHP SDUD D YDULDomR LQGLYLGXDO HP UHVSRVWD DR WUHLQDPHQWR 'H FRQVLGHUiYHO LPSRUWkQFLD p R QtYHO GH DSWLGmR UHODWLYD GD SHVVRD QR LQtFLR GR WUHLQDPHQWR e LUUHDO HVSHUDU TXH SHVVRDV GLIHUHQWHV HVWHMDP QR PHVPR ยณHVWDGRยด GH WUHLQDPHQWR DR PHVPR WHPSR e FRQWUDSURGXWLYR LQVLVWLU TXH WRGRV RV PHPEURV GH XPD PHVPD HTXLSH WUHLQHP GD PHVPD PDQHLUD RX FRP R PHVPR ULWPR UHODWLYR RX DEVROXWR GH WUDEDOKR 2V EHQHItFLRV GR WUHLQDPHQWR VmR DPSOLDGRV TXDQGRRVSURJUDPDVVmRSODQHMDGRVGHIRUPD D VDWLVID]HU DV QHFHVVLGDGHV H FDSDFLGDGHV LQGLYLGXDLV GRV SDUWLFLSDQWHV 8P LQGLYtGXR p R UHVXOWDGR GD VRPD GR JHQyWLSR EDJDJHP JHQpWLFD WUDQVPLWLGD DR LQGLYtGXR   IHQyWLSR H[SUHVVmR GRV JHQV GHWHUPLQDGD SHOD KHUDQoD JHQpWLFD 2VJHQyWLSRVSRGHPVHUFODVVLยฟFDGRV FRPR ELyWLSR FRPSRVLomR FRUSRUDO SURYiYHO IRUoD Pi[LPD SRVVtYHO SURYiYHO SHUFHQWXDO GH ยฟEUDV PXVFXODUHV ( RV IHQyWLSRV FRPR QtYHO GH GHVHQYROYLPHQWR PXVFXODU QtYHO GR FRQVXPR GH 2รฐ 92รฐ Pi[  SHUFHQWXDO UHDO GH ยฟEUDVPXVFXODUHVHIRUoDPi[LPD$OpPGHVVDV FDUDFWHUtVWLFDV LQGLYLGXDLV FDUDFWHUtVWLFDV FROHWLYDVFRPRUDoDLGDGHVH[RHRQtYHOVyFLR HFRQ{PLFRFXOWXUDO LQร€XHQFLDUmR QD IRUPDomR GDLQGLYLGXDOLGDGH Elaborado por Miriam Caldasso

Prerrequisitos ([SHULrQFLD .PVHPDQDO 7HPSRVHPDQDO 'LDVGHWUHLQR

   

10km PHVHVDDQR  NPHPPpGLD  0i[K  [VHPDQD 

21km 0DLVGHDQRHPHLR  DNPHPPpGLD  DKHPPpGLD[PXVFXODomR 0tQLPR[VHPDQD 

19

SUPERAร‡รƒO

42km 7UrVDQRV NPHPPpGLD KHPPpGLD D[VHPDQD


vida corrida Fotos: Shutterstock

TUDO NOS CONFORMES? NEM TANTO! 20 16


Estudo da Federação Paulista de Atletismo mostra que 23% das corrida de rua do estado ainda são realizadas de forma irregular

Julianne Cerasoli

G

rande centro da corrida de rua no Brasil, São Paulo aposta cada vez mais em qualidade. Pelo menos é para isso que a Federação de Atletismo Paulista (FPA) trabalha. Dados da entidade revelam que, em 2008, foram disputadas 282 provas no estado, com total de 372 mil inscritos. Números impressionantes, sem dúvida. No entanto, o dado que tem merecido maior atenção é o de 65 corridas, ou 23%, realizadas sem o devido alvará de regulamentação e autorização do evento esportivo. O documento, expedido pela federação, é re-

sultado da análise de toda a infraestrutura, desde o percurso, passando pelo acompanhamento de técnicos especializados, postos de água e presença de equipe médica, por exemplo. Apesar de o número de competições ilegais preocupar, pode-se observar XPDPHOKRUDVLJQL¿FDWLYDQRFHQiULR8PH[HPSOR está na estatística de que, em 2001, quando a presidência da federação implantou o Departamento de Corridas de Rua, só 11 documentos foram registrados. Porém, o objetivo é se aproximar o máximo possível de 100%. “Vejo a tendência a uma maior

A importância de regulamentar - O alvará emitido pela FPA é o documento que credencia o evento quanto a sua estrutura organizacional e técnica, desde a quantidade de água disponibilizada até, e principalmente, o material humano.

- Em São Paulo, capital, sem o alvará emitido pela FPA, a Companhia de Engenharia do Tráfego – CET não acolhe, por questão legal, o pedido para a realização de um determinado evento. - Os custos para se obter o alvará, bem como os relativos aos trabalhos de supervisão da FPA, são definidos de acordo com as particularidades e objetivos de cada evento. - Os benefícios do alvará para o promotor de eventos são vários. Ele estará cumprindo a lei e, assim, poderá mostrar a todos os seus parceiros e patrocinadores que sua realização está credenciada pelo único órgão responsável pela atividade no Estado de São Paulo, que é a FPA. Aos participantes, ficará clara a transparência do evento, bem como a aplicação das normas de segurança devidas. - A obtenção de alvará tem, como primeiro passo, o preenchimento, por parte do organizador, de formulários específicos. O conteúdo será analisado pelo Departamento de Corridas de Rua da FPA, que levará em consideração a estrutura apresentada, tendo a prerrogativa de vetar os eventos que possam trazer prejuízos à sociedade.

21

SUPERAÇÃO


vida corrida

compreensão dos organizadores no sentido de fazer eventos melhores, em condições mais adequadas para os atletas de performance e para a população em geral. Isso, ressalto, é uma tendência. Mas, ainda, alguns deles fogem para não pagar as taxas, que são relativamente baixas para a supervisão do evento. Costumo dizer aos organizadores que a responsabilidade de quem faz provas para 50 ou 5.000 pessoas é a mesma. Por isso temos de seguir as normas. O custo para cumpri-las é muito mais baixo do que fazer uma prova irregular em que as FKDQFHVGHDOJRGDUHUUDGRVmRVLJQL¿FDWLYDVHDV consequências bem piores do que pagar um simples alvará de supervisão”, observa o presidente da FPA, José Antonio Martins Fernandes. O dirigente salienta que este é um trabalho conjunto da entidade com o governo do Estado, dos

22 16

departamentos de trânsito das cidades e das secretarias municipais de esportes. “Devido a esses resultados, encaminhamos nossa preocupação quanto à segurança transmitida pelo alvará ao secretário de Esportes, Lazer e Turismo, Claury Santos Alves da Silva, para que faça uma carta de intenções e um fórum com os secretários municipais para discutir a melhor forma de participação dessas cidades. Muitos deles não sabem sequer que existem normas. E até permitem que organizadores menos esclarecidos realizem competições sem a devida organização e sem cumprir as regulamentações. Para que haja crescimento sustentado, precisamos, a cada ano, aperfeiçoar o nível de eventos. Assim, haverá mais participantes disputando com plena segurança e não fazendo de sua corrida uma aventura”, considera o presidente.


Outra parte importante desse processo, o corredor pode exercer seu direito de participar de eventos que lhe deem a devida segurança. “Eles devem procurar participar das provas supervisionadas pelos yUJmRVRÂżFLDLVIHGHUDo}HVHVWDGXDLVFRQIHGHUDomR em que todas as normas de segurança, que sĂŁo regulamentadas, estejam sendo cumpridas pelos organizadores, como distribuição de ĂĄgua, ambulâncias, ambulatĂłrio, percurso aferido, trânsito controlado pelo ĂłrgĂŁo municipal, hospitais em alerta.â€?

Crescimento Mesmo atingindo uma certa estagnação no estado, o nĂşmero de corridas de rua continua crescendo. Para Fernandes, a chave da ampliação da quantidade de provas estĂĄ no interior. “A tendĂŞncia segue sendo de alta. Na capital, a Prefeitura, por meio do SecretĂĄrio de Esportes, Lazer e Recreação, Walter Feldman, faz provas nas regionais da cidade, aumentando a estatĂ­stica em cerca de 20 corridas na capital, juntando-se a outras 60 anuais. Apesar do crescimento, vejo que em alguns locais o limite de capacidade jĂĄ atingiu o mĂĄximo, como ĂŠ o caso da capital paulista. Por outro lado, o nĂşmero de provas realizadas em 2008 atingiu cerca de 50 municĂ­pios de SĂŁo Paulo, que tem cerca de 650 cidades. ConcluĂ­mos, entĂŁo, que muitos municĂ­pios ainda nĂŁo tĂŞm corridas, ou, se tĂŞm, nĂŁo dĂŁo conhecimento Ă  FPA ou Ă  Secretaria Municipal de Esportes. Portanto, vejo, ainda, um potencial de crescimento.â€? Os nĂşmeros revelam que pouco mais de 70% dos corredores paulistas sĂŁo homens, o que tambĂŠm indica um potencial de agregar ainda mais o pĂşblico feminino. Mesmo que o crescimento jĂĄ nĂŁo seja tĂŁo acelerado, ele certamente ĂŠ qualitativo. “Vale salientar que, nas provas, as inovaçþes estĂŁo cada vez mais presentes e a organização estĂĄ melhorando. Assim, os organizadores conseguem agregar mais patrocinadores e pessoas envolvidas neste esporte IDVFLQDQWH´UHDÂżUPDRSUHVLGHQWH TĂŁo fascinante que, citando um relatĂłrio nĂŁoRÂżFLDO IHLWR SHOR FDQDO GH WHOHYLVmR D FDER 6SRU79 )HUQDQGHV DÂżUPD TXH D FRUULGD KRMH p D PRdalidade mais praticada no Brasil, ultrapassando o futebol. Muito em virtude da facilidade de acesso ao esporte, assim como Ă  proliferação das provas. Por isso, mais do que nunca, ĂŠ hora de apostar em qualidade.

Custos Confira a Norma nÂş 07 de reconhecimento e homologação de Corridas de Rua, que traz os valores mĂĄximos estipulados pela Confederação Brasileira de Atletismo: “CBAt - NORMA nÂş 07 - Reconhecimento e Homologação de Corridas de Rua # 1Âş - As solicitaçþes devem ser acompanhadas do pagamento da respectiva taxa de reconhecimento, conforme abaixo: - Prova Classe A-1: R$ 5.000,00 (cinco mil reais), devendo a CBAt ser consultada sobre a melhor forma para o seu pagamento. - Prova Classe A-2: R$ 4.000,00 (quatro mil reais), devendo a CBAt ser consultada sobre a melhor forma para o seu pagamento. - Prova Classe B: valor a ser definido pela respectiva Federação Estadual, ficando limitado ao mĂĄximo de 50% do valor da taxa da CBAt para prova Classe A. # 2Âş. - A taxa prevista no parĂĄgrafo 1Âş. acima ĂŠ exclusivamente para a emissĂŁo do Permit ou AlvarĂĄ pelas entidades respectivas, cumpridas as exigĂŞncias tĂŠcnicas das normas, nĂŁo englobando a prestação de serviços ou de apoio adicionais a serem prestados pelas Federaçþes Estaduais aos organizadores, sem prejuĂ­zo do pagamento dos ĂĄrbitros conforme determinado nestas normas, os quais devem ser objeto de acordo especĂ­fico para cada prova entre a entidade estadual e o organizador.â€? De acordo com o presidente, a FPA cobra valores de acordo com o tamanho de cada competição. E estes valores sĂŁo acertados com os organizadores.

23

SUPERAĂ‡ĂƒO


linha de chegada

24 16

FILA NIGHT RUN – 2ª ETAPA 30 DE MAIO – BRASÍLIA (DF) – 10KM

2ª RECIFE TE QUER SAUDÁVEL/FARMÁCIA BOMPREÇO 31 DE MAIO – RECIFE (PE) – 10KM

Masculino SA Elite 1º Israel Barbosa de Deus 2º Paulo Braz da Silva

31:23 31:58

Masculino SA Elite 1º Edison Vieira da Silva 2º Frank Gomes de Oliveira

SA Nível Ouro 3º Jose Rocha Garcia 4º César Francisco da Silva 5º Adelmo dos Santos Alves

32:40 32:50 32:52

SA Nível Prata 6º Márcio Vieira de Freitas 7º Antonio Bezerra Soares 8º Adiel Pereira de Souza 9º Nildomar Valadares Passos 10º Elias Souza do Nascimento 11º Francisco Felix de Souza 12º Lucas Pinheiro Beserra 13º Flavio Fernandes Vieira

34:19 34:33 34:56 35:27 35:29 35:33 35:57 36:49

SA Nível Bronze 14º Alvane Ferreira Martins 15º Marcelo Granato 16º Expedito Marques da Fonseca 17º Lucas Gualberto Andrade 18º Gustavo Castro Araujo 19º Cleber Marcos de Toledo 20º Wellington Moura e Silva 21º João Evangelista Vieira 22º Aurelindo de Souza Primo 23º Carlos Alberto Guimarães 24º Leonardo Schwindt 25º Rafael Silva da Rocha 26º Kleber de Araujo Parussolo 27º José Carlos Sousa Costa 28º Mauricio R Delmondes 29º Fábio Alves de Oliveira

37:07 37:39 38:06 38:12 38:19 38:26 38:30 38:32 38:40 39:08 39:39 39:41 39:48 39:48 39:50 39:54

Feminino SA Elite 1º Odineide Felix de Amorim

37:20

SA Nível Prata 2º Regina Matias da Silva 3º Mirela Albrecht 4º Jackeline Silva Mendes

41:02 41:57 43:50

SA Nível Bronze 5º Cristina Oliveira 6º Gleise Fonseca Botelho 7º Joelma C. S. Barbosa 8º Lilian Silva Freitas 9º Angelina T Grangeiro 10º Simone Neiva

44:04 44:27 46:32 46:46 47:08 47:52

SA Nível Ouro 3º Severino Ramos dos Santos 4º Alexandre Jose dos Santos 5º Rojario Dias da Silva 6º Rildo Pereira da Silva 7º Jan Eric Lira SA Nível Prata 8º Eraldo Ribeiro Monteiro 9º Ronaldo Justino Alves 10º Jailson dos Santos Silva 11º Deuson Nelson Santos 12º Manoel Jose de Oliveira 13º Ailton Gomes de Veras 14º Adriano Severino da Silva 15º Wellington da Silva SA Nível Bronze 16º Luiz Carlos Xavier 17º Armando Johnson da Silva 18º Misael Martiniano de Souza 19º Luciano Luis da Silva 20º Jose Henrique Coutinho Filho 21º Cristiano José Irineu 22º Gerson Xavier de Oliveira 23º Davi Honorato de Melo 24º Haziel Nascimento Batisia 25º Jose Hilton Barros da Silva 26º Antonio Laurindo Mota 27º Jose Cavalcante de Andrade 28º Luciano Ferreira de Souza 29º Eraldo Santana da Silva 30º Levi Marques Silva 31º Jose Aldo da Silva Filho 32º Wedson S do Nascimento 33º Allan Gregorio da Silva 34º Isaac de Souza Assunção Feminino SA Elite 1º Mery Emanuella Oliveira 2º Waldir Silvestre dos Santo 3º Maria de Lourdes Ferreira

Corre Plantando o Futuro Usina São José Usina São José Photo Shop Corre Usina São José Grupo Hi Corre Corre Rapidão Cometa

Diários Associados Grupo Hi

Corre Corre Avançar Corre Cmne Corre ADC BomBril Acorja Corre Cepere

Corredores do Futuro Multsport Clube de Corredores

SA Nível Ouro 4º Fernanda Maria da Silva SA Nível Prata 5º Conceição Margarida Gomes

31:21 31:57 32:08 32:26 32:38 33:18 33:43 34:17 35:44 36:16 36:16 36:41 36:46 36:49 36:51 37:02 37:36 37:56 38:04 38:10 38:12 38:13 38:19 38:35 38:42 38:52 38:54 38:57 39:09 39:13 39:35 39:39 39:50 39:50

36:24 36:30 37:02 38:00

Banco BMG

40:17

10K Masculino *Recorde (27min48) a 31’59” - SA Elite 32min a 33’59” - SA Nível Ouro 34min a 36’59” - SA Nível Prata 37min a 39’59” - SA Nível Bronze

15K Masculino Recorde (42min15) a 49’59 – SA Elite 50min a 54’59 – SA Nível Ouro 55min a 59’59 – SA Nível Prata 1h a 1h04’59” – SA Nível Bronze

MEIA MARATONA Masculino *Recorde (59min33) a 1h09’59” - SA Elite 1h10 a 1h13’59” - SA Nível Ouro 1h14 a 1h21’59” - SA Nível Prata 1h22 a 1h27’59” - SA Nível Bronze

MARATONA Masculino *Recorde (2h06min05) a 2h19’59”SA Elite 2h20 a 2h29’59” - SA Nível Ouro 2h30 a 2h39’59” - SA Nível Prata 2h40 a 3h19’59” - SA Nível Bronze

Feminino *Recorde (32min06) a 37’59” - SA Elite 38min a 39’59” - SA Nível Ouro 40min a 43’59” - SA Nível Prata 44min a 47’59” - SA Nível Bronze

Feminino Recorde (48min38) a 59’59 – SA Elite 1h a 1h09’59” – SA Nível Ouro 1h10 a 1h19’59” – SA Nível Prata 1h20 a 1h29’59” – SA Nível Bronze

Feminino *Recorde (1h04min50) a 1h21’59” - SA Elite 1h22 a 1h27’59” - SA Nível Ouro 1h28 a 1h34’59” - SA Nível Prata 1h35 a 1h43’59” - SA Nível Bronze

Feminino *Recorde (2h27min41) a 2h44’59’’ - SA Elite 2h45 a 2h59 - SA Nível Ouro 3h00 a 3h20 - SA Nível Prata 3h20 a 3h40 - SA Nível Bronze


6º Quiteria Feliciano Barbosa 7º Pamela Moura Cavalcante 8º Rizonete Martiniano

Corre Acorja Corpore Sano

42:00 43:02 43:03

SA Nível Bronze 9º Ana Catarina Siqueira Dias 10º Cristiane Alves Xavier 11º Juliana Iob de Oliveira Acorja 12º Maria Gorete Barbosa Gomes 13º Emanuela Teodozio da Silva ADC BomBril 14º Joselene Rodrigues de Lima 15º Daniele Carvalho Teixeira ADC BomBril

44:37 45:00 46:36 46:50 47:33 47:37 47:52

MIZUNO 10 MILHAS 2009 31 DE MAIO – RIO DE JANEIRO (RJ) – 16,09KM Masculino 1º Lourival do Nascimento Libanio 2º Adair José Henrique dos Santos 3º Weder Dias Ferreira 4º Francescole Leonardo Rodrigues 5º Gleiciomar Perreira dos Santos 6º Adriano Ferreira Sanches 7º Carlos Silva 8º Flávio Roberto C. dos Santos 9º Thiago Martins da Silva 10º Breno dos Santos 11º José Antonio Souza Silva 12º Fabio Mattos dos Santos 13º Alex Carvalho dos Santos 14º Renato de Arruda Coradelo 15º Carlos Magno da Cruz 16º Roberto Dantas Couto 17º Gilson da Rocha Venãncio 18º José Hilton Cavalcanti 19º Bruno Gonçalves Rangel 20º Ronald Máximo 21º Antonio Carlos F. da Silva 22º Percy da Silva Justino 23º Ronaldo Veloso Acacio 24º Fabio de Jesus Duarte 25º Frank Land Pereira Torres 26º Pedro Antonio Madalena 27º Lindenberg da Costa 28º Gustavo Luz Tavora 29º Marival Amaral 30º Sergio Chibante 31º Luis Felipe de M Wright 32º Paulo Sergio Pereira 33º Antonio Munerato Diegues 34º Jose Luiz Bruno 35º José Carlos Barreto da Silva 36º Genivaldo Rosa 37º Jussandro Teles Vieira 38º Josue Soares da Silva 39º Gilmar Nogueira de Azevedo 40º Eduardo Guilherme Sanchez 41º Reginaldo Câmara 42º Renaldo Avelino Frotté 43º Gerlan Campos de Souza

51:09 52:51 54:08 54:56 55:13 55:28 57:05 57:21 58:11 58:20 59:07 59:13 59:16 59:31 59:42 59:44 59:48 1:00:17 1:00:46 1:00:47 1:00:54 1:00:55 1:01:25 1:01:28 1:01:47 1:01:52 1:02:02 1:02:02 1:02:04 1:02:54 1:03:04 1:03:11 1:03:24 1:03:27 1:03:37 1:03:39 1:03:47 1:04:09 1:04:09 1:04:13 1:04:20 1:04:22 1:04:28

44º Daniel Gaspary Teixeira 45º Luiz Guilherme da S Furtado 46º Jose Pinheiro Fernandes 47º José Carlos Rodrigues 48º Hernando Teixeira Garcia 49º Ben Ysaac Cohen da Silva 50º Leonardo Cunha Pimentel

1:05:15 1:05:32 1:05:57 1:06:14 1:06:14 1:06:28 1:06:30

Feminino 1º Gisele Barros de Jesus 2º Elaine Nohra Simões 3º Raimunda Maria da Fonseca 4º Andreia de Andrade Lengruber 5º Silvia Moreira Lopes Ribeiro 6º Renata Moreira Pereira 7º Andrea Folegatti de Souza Melo 8º Claudia Michelle Graeff Cannes 9º Marcela Lemos Barcellos 10º Fernanda Corrêa Fernandes 11º Maíra Vendrame 12º Vanessa Ameixoeira de Seixas 13º Gabriela Queyroi Chaves 14º Regina Maria Lima Fernandes 15º Márcia Moreira Ferreira 16º Meirian dos Santos 17º Denize Alves da Costa Pires 18º Katia Fuhro de Oliveira 19º Claudia Warrak 20º Hellen Rose dos Santos Noel 21º Adriana Lutosa Gaspar 22º Marilda Gonçalves 23º Claudia Webber 24º Vera Lucia Reis e Albuquerque 25º Andrea Maria de Freitas 26º Maria Carolina Martins 27º Lucia Maiolino 28º Glacy Diamantino Leao 29º Salete Faria Campos 30º Suelene das Graças Vieira 31º Ricardo David Ibiapina 32º Juliana de Miranda Vieira 33º Ana Cristina Nunes 34º Fernanda Vale 35º Maria das Graças Soares 36º Vivian Assis de Oliveira 37º Rada Skenderija Carvalho 38º Hanna Schteinberg 39º Nadia Teixeira de Siqueira 40º Patricia Lima 41º Ana Luiza de Faria Matos 42º Letícia Barreto Wermelinger 43º Maria Beatriz Saade 44º Cristiane Sousa Braga 45º Inge Penido 46º Marise Crivelli 47º Marcia Martins 48º Cláudia Paes Muro 49º Rosemary Portella 50º Rosangela Pimentel da Silva

1:01:11 1:01:37 1:04:27 1:04:38 1:04:42 1:05:54 1:06:17 1:08:30 1:09:23 1:10:22 1:11:09 1:12:20 1:13:03 1:15:16 1:15:18 1:15:19 1:15:24 1:15:31 1:15:59 1:16:14 1:16:55 1:17:33 1:17:35 1:17:35 1:17:47 1:18:10 1:18:19 1:18:36 1:19:37 1:19:47 1:19:54 1:20:04 1:20:09 1:20:19 1:20:29 1:20:59 1:21:21 1:21:23 1:21:28 1:21:28 1:21:34 1:21:42 1:21:55 1:22:03 1:22:12 1:22:30 1:22:52 1:22:53 1:23:14 1:23:16


linha de chegada MARATONA INTERNACIONAL DE SÃO PAULO 31 DE MAIO – SÃO PAULO (SP) – 42KM Masculino SA Elite 1º Elias Kemboi Chelimo 2º Franck Caldeira de Almeida 3º Jose do Nascimento Souza SA Nível Ouro 4º Giomar Pereira da Silva 5º Tola Ketema Nigusse 6º Domingos Nonato da Silva 7º Celio Falcão 8º Marcelo H. Rocha 9º Jose Pereira da Silva 10º Jose Rubens da Silva 11º Ricardo de Melo Rodrigues SA Nível Prata 12º Joseph Kipkemei Talam 13º Joseph Kiplagat Cheruiyot 14º Matusalen de Lima 15º Genildo Ribeiro Fernandes 16º Divinomar B dos Santos 17º Geraldo da Silva 18º Antonio Marcos Ventura 19º Jose Nildo Ferreira Passos 20º Vanderley Santos Pereira 21º Edvaldo Pereira de Souza

26 16

SA Nível Bronze 22º Edson Gonçalves de Oliveira 23º Paulo João 24º Vladimir da Silva 25º Jorge Celestino da Silva 26º Osvaldir Fernandes da Silva 27º Ismael de Jesus 28º Hefer Cardoso de Freitas 29º Adalcio Ferreira dos Santos 30º Edevanil Candido Noronha 31º Rodeval Santos da Silva 32º Reinaldo da Silva 33º Antonio Soares Filho 34º Albano Alves dos Reis 35º Daniel Faustino dos Santos 36º Ires de Oliveira e Silva 37º Francisco dos Santos Silva 38º Oraldo Romoaldo da Silva 39º Basilio Cordeiro da Rocha 40º Jose Evandro J SouzaMpr 41º Segio Jesus do Nacimento 42º Manoel Januario da Silva 43º Ronaldo Ribeiro de Miranda 44º Edvaldo Oliveira de Souza 45º Sergio Pinheiro de Souza 46º Harrisson Ramos Dajuda 47º Leonildo Jose de Almeida 48º Daniel Silva da CostaAfac 49º Jose Nildo da Silva 50º Adalberto Pereira Santos 51º Josivaldo da Costa Silva 52º Ednaldo de Andrade Felix 53º Joao Pereira Brandao Filho 54º Jose Ivanilson da Silva 55º Alex Sandro Tavares Barbosa 56º Raimundo dos S. Mourao 57º Angelisio Silva dos Reis 58º Adimilson de Freitas 59º Claudio Jose Roque 60º Eduardo Silverio Calisto 61º Carlos Eduardo Rodrigues 62º Cícero Edson Dias da Silva

Cruzeiro Esporte Clube Facitec/Supercei/Rebook

2:13:59 2:17:22 2:19:17

Cruzeiro Esporte Clube

2:21:36 2:22:37 Asics/Adauto Domingues 2:23:21 Acrimet/Top Spin/Runtech 2:26:37 MhrRunnersTeam/LeiteHercule 2:27:58 Cruzeiro Esporte Clube 2:29:01 Graficos Sangar 2:29:45 Limpebras Eng. Ambiental 2:29:57

Fila Fila Ubp Pref Frutal Pão de Açucar Praia Clube/Avel Laces/Alegre Es Parseca Acrimet/Top Spin/Runtech Branca Esports Amizade Caoa Hyundai Sagrado Coração Eq. Amantes da Natureza Garças Brancas/Guaratinguetá Prefeitura M Itupeva Edelson Esp. e Perf. Acústica Dan Diqbem E.C. Tavares Seme/Loja Esportiva Itu Rumo Certo Uehara Imóveis Osasco Nutriplus Basilio e Familia

Gelo Pro-Lar Magnesita Refratários S.A.

Bruxinha Produtos Naturais Igreja Bíblica da Paz Borghi Depósito Apore Afc Cosipa Meta Nutrição Esportiva Rumo Certo/Caixa Cae Personal Fabio Fernandes

2:30:24 2:33:26 2:33:48 2:36:20 2:37:00 2:37:54 2:38:00 2:38:03 2:38:18 2:39:59 2:41:15 2:42:24 2:42:41 2:43:18 2:44:19 2:44:19 2:45:04 2:45:36 2:45:43 2:46:36 2:47:36 2:47:49 2:47:55 2:48:19 2:48:30 2:49:05 2:49:22 2:49:40 2:50:11 2:50:31 2:50:36 2:51:47 2:52:36 2:52:44 2:53:12 2:53:13 2:53:25 2:53:37 2:53:38 2:53:39 2:53:41 2:53:46 2:53:49 2:54:01 2:54:20 2:54:35 2:55:08 2:56:18 2:56:21 2:56:45 2:57:00

63º Jose Feitoza Filho Nova Equipe 64º Misael Nery BarbosaJockey Club de São Paulo 65º Edson Pinheiro dos Santos Hercules/Npn 66º Genair Vitor Rezende Ascorb 67º Claudio Banin Jacutinga/Bioleve 68º Sebastião Roberto da Silva Rest.Kiloucura 69º Irismar Bento de Castro Morro Acima 70º Adriano Palmeira de Araujo Jesus 71º Rildo Santana E.C. Tavares 72º Gilson Vicente da Silva Santos Brasil – Tecon 73º Jorge Laurindo Terra 74º Jose Dias de Souza 75º Ronaldo dos Santos Nova Equipe 76º Jose Nilson dos Santos Semes Cubatão 77º Josenildo Galdino da Silva E.C. Tavares 78º Renato Modesto Grêmio Penha 79º José Roberto Bastos Santos E.C.Tavares 80º Jailton Pereira da Silva 81º Antonio Marcos Pereira Fr Sports/Itanhaem 82º Edson Epifanio dos Santos Aes Eletropaulo/Race 83º Jose Miranda Silva 84º Charles Eduardo Moura 85º Donizete A. da Cunha Extrema Atletismo 86º Luis Carlos Silva Ratinho Rotama 87º Rogerio Ramos Tigre Em Ação 88º Luiz Alberto Lopes dos Reis 100 Limites/Suzano-Santanna 89º Vilmar Comerlatto Correios 90º Francisco Expedito Almeida Fluir Run 91º Edivaldo B. do Nascimento Accord Atletismo 92º Carlos Francisco Junior Sesi Garanhuns 93º Ricardo de Abreu Adc Continental do Brasil 94º José João Chaves Walter Tuche 95º Antonio Carlos dos Santos Semes Cubatão 96º Alexandre Garcia Cesar Medley Triathlon 97º João Barboza de Souza Rodar Aclimação 98º Rodrigo Lobo da Fonseca Lobo - Assessoria Esportiva 99º Jorge de Carvalho Cbmerge 100º Everaldo M. dos Santos Força e Vida 101º Raimundo de Vasconcelos Bradesco Vida e Previdência 102º Esdras Veras Oliveira Atlas Brasil 103º José Luiz de Moraes 104º Andre M. de Deus TerraNetworksBrasil–Reebok 105º Renato F. de Oliveira Calhas Pontes 106º Sergio Callipo Junior Sejelp 107º Claudomiro dos Santos A.D.C.C.Mercúrio 108º Arivaldo Sousa Leite 109º Agnaldo José Monteiro 110º Claudio Roberto Macedo 111º Vanderlei Silva Soares Lemier Jeans 112º Benedito Jose Lutosa Neto 113º Ailton Fonseca de Oliveira Acorg-Guarujá 114º Luciano Nagliatti Boainain 115º Sergio Santos B. Junior Café Árabe 116º Aristides Jeronimo Silva Gold Nutrition Industria e Com 117º Carlos Pereira de Rezende Fuga Couros Moto X Smect Já 118º Ivan dos Reis PradoCorlam 119º Carlos Soares dos Santos Auto Posto Torres e Reilux 120º Amarildo Batista Campari 121º Julio Cesar Dotti Limite Team 122º Edjair Cavalcanti da Silva 123º Valdete Aparecido de Souza 124º Luis Railson Filho Jesus em Breve Voltará 125º Jose Cassio dos Santos Run For Life 126º Manoel Reis de J. Santos 127º Fernando Soares da Cruz Morada Imóveis 128º Genilson M. dos Santos Find Yourself 129º Antonio Nunes da S. Neto Coca Cola 130º Luciano Santos Lima Sme/Jpa-Jandira-SP 131º Menoti Di Paschoal Acústica Dan 132º Carlos Caltabellotta Caltas 133º Ivanildo Cassimiro da Silva Piquesporte Academia 134º Almir dos Santos Seme 135º Marinaldo da Costa Santos

2:57:12 2:57:14 2:57:36 2:57:39 2:57:57 2:58:28 2:58:38 2:58:48 2:59:07 2:59:32 2:59:49 3:00:12 3:00:31 3:00:38 3:00:40 3:01:14 3:01:40 3:02:07 3:02:20 3:02:22 3:02:23 3:02:29 3:02:38 3:02:46 3:02:56 3:03:09 3:03:18 3:03:31 3:03:39 3:03:51 3:04:06 3:04:12 3:04:23 3:04:32 3:04:32 3:04:39 3:04:40 3:04:56 3:05:01 3:05:07 3:05:15 3:05:32 3:05:44 3:06:29 3:06:31 3:06:45 3:07:05 3:07:16 3:07:21 3:07:26 3:07:32 3:07:39 3:07:42 3:07:54 3:08:03 3:08:16 3:08:16 3:08:23 3:08:40 3:08:55 3:09:10 3:09:11 3:09:16 3:09:23 3:09:26 3:09:29 3:09:30 3:09:39 3:09:40 3:09:41 3:09:47 3:10:00 3:10:04


136º Benedito da Silva Castro 137º Raul Batista Lima 138º Luiz Antonio Relva 139º Joseni da Silva 140º Joaquim Felicio de Souza 141º Leandro Mario da Silva 142º Reinaldo R. de Moraes 143º Maciel Feitoza de Lima 144º Tiago Kerr Martinez 145º Reinaldo de Souza Lima 146º Giovani Aparecido Camilo 147º Alexandre Batista Pinto 148º Edgar Pereira de Souza 149º Janilton Carlos Alves 150º Wagner Flavio da Costa 151º Itamar Jose Zampieri 152º Ivanildo Jose da Silva 153º Adair Jose Silva 154º Agnaldo Amorim Salvador 155º Edson Soares Ribeiro 156º Adilson A. do Nascimento 157º Marcos Rogerio Gomes 158º Jose Paulo dos Santos 159º Adriano Ricardo Sevilla 160º Sebastiao Vidal Nery 161º Marco Aurelio de Moraes 162º Jair Gomes da C. da Silva 163º Carlos Alberto V.de Salles 164º Adao Miranda da Silva 165º Jose Carlos da Costa 166º Jose Nilton Soares 167º Gilmar Jose Soares 168º Leonildo da Silva 169º Antonio Derivaldo Alves 170º Ezio Fachini 171º Rogerio Queiroz e Silva 172º Joatas Macena da Silva

Bosch/Enfa – Lapa Saude & Performance E.C. Tavares Bamaq Playteam Aasp Sorocaba Maciel Desbravadores/Hd Sindifícios Alex Ironman Adriano Bastos Treinamento Estão Roubando A Mega Sena HrBolsas/CalçadoseAcessórios Zampieri Eco Taboão da Serra Tavares Semes Cubatão Usina Moreno Acora Aon Vidal/C Dutra/Safra Churraskinhos Jesus Amvv Ass. Esportiva Rota da Geografia Help Express Bb Tecnologia Renovebens/Batalha Fort Diesel e Mecevoks

3:10:19 3:10:21 3:10:22 3:10:35 3:10:36 3:10:43 3:10:45 3:10:52 3:11:01 3:11:09 3:11:20 3:11:22 3:11:42 3:11:53 3:11:54 3:11:56 3:11:59 3:12:03 3:12:03 3:12:10 3:12:26 3:12:36 3:12:38 3:13:06 3:13:13 3:13:14 3:13:19 3:13:22 3:13:44 3:13:55 3:14:04 3:14:13 3:14:15 3:14:36 3:14:42 3:14:47 3:15:11

173º Miguel Angelo Duarte 174º José Alves Duarte 175º Joabe Heleno de Souza 176º Cicero Aparecido Lima 177º Ivanildo Pinheiro Maciel 178º Andre Gustavo Santos 179º Amaro Paulo dos Santos 180º José Vicente de S. Filho 181º Pedro Valdelino Rodrigues 182º Benedito Lima Filho 183º Carlos Martins Franco 184º Hugo R Gonzalez 185º Carlos Alexandre Lira 186º Jose da Silva Ribeiro 187º Paulo Cizicov 188º Rubens Francisco da Silva 189º Marcelo Costa Souza 190º Geadiel Luiz de Sales 191º João Lopes Nunes Vo2 192º Gervásio Araújo Filho 193º Erivaldo Nunes de Andrade 194º Eronildes Rocha dos Santos 195º Odair do Nascimento 196º Samuel Ferreira Magalhães 197º Francisco de Araujo 198º José Edmicio dos Santos 199º Jose Rinaldo da Silva 200º Ernani B. dos Santos Neto 201º Geraldo R.de Oliveira 202º Mauro Rosa 203º Nei Carlos Gomes 204º Haroldo Alves Flores 205º Cesinha Antonio Pires 206º Alberto Bogliolo Sirihal 207º Antonio Sergio N. Moreira 208º Joao Theoto Junior 209º Antonio Aparecido Gomes

Cuca Fortitech Secret.Esport.Salto Pelotão Geral Raça Metais Flavio Freire A. Esportiva Pizzinato Personal Mc Equipe de Corredores Pedrinho Iron Man Sorocaba Acosm/Sapucaí Mirim Metrus-Metro/SP Sfd Services Drastosa Nc Assessoria Esportiva Heart Training Acad.Reentry/Playteam/Prainha Quality Life Posto Arvore Grande Taboão da Serra Beds Colchões Corra Orientado Pacerribeirão Preto Jesus Salvador Borghi Carlos Eugenio Corredolatras Carrefour Corredólatras Bruxinha Prod. Nat.

3:15:25 3:15:28 3:15:30 3:15:34 3:15:38 3:15:39 3:15:48 3:15:50 3:15:59 3:16:01 3:16:29 3:16:30 3:16:37 3:16:44 3:16:51 3:17:04 3:17:05 3:17:24 3:17:25 3:17:29 3:17:35 3:17:35 3:17:47 3:17:47 3:17:48 3:17:49 3:17:57 3:18:02 3:18:05 3:18:07 3:18:15 3:18:18 3:18:20 3:18:22 3:18:23 3:18:30 3:18:39


linha de chegada 210º Benedito Mariano da Silva 211º Marcos Sanches Bezerra 212º Antonio Olivio da Silva 213º Jorge Jose da Costa 214º Paulo Afonso da Silva 215º Dionizio M.de Oliveira 216º Pedro Osmar de Almeida 217º Adalberto Pessoa de Araujo 218º Elenito Libanio Novaes 219º Valdecir Santos Canuto 220º Erick Mayer Reis Franca 221º Jose Roboa de Luz 222º Mauro Wedson dos Santos 223º Jose Carlos de Oliveira 224º Carlos Alberto F. Lopes 225º Marcos Aurelio G de Souza 226º Aureo Adriano Silva 227º Jose Antonio Caporrino Feminino SA Elite 1º Marizete Moreira dos Santos 2º Marizete de Paula Rezende SA Nível Ouro 3º Marily dos Santos 4º Edielza Alves dos Santos 5º Tolla Aberash Tesfaye Fila 6º Marluce Queiroz Borges 7º Sandra Aparecida Caporal 8º Caroline Jepchirchir 9º Yeshanbel Simegn Abnet 10º Maria Sandra Pereira Silva SA Nível Prata 11º Maria Helena de Oliveira 12º Vivian de Oliveira SA Nível Bronze 13º Michelle Seignier 14º Rosemeire Ferreira Silva 15º Luciane Losso 16º Ana Maria Ferreira Duarte 17º Maria Marlene B. Lima 18º Cleuma Caitano Marques 19º Maria Cilene da Rocha 20º Daniela Barcelos de Souza 21º Jane Tolentino

Corpo de Bombeiros do Estado Educa Seela Guaruja Correndo Com Jesus Syngenta Oxente-Bahia Cubtao/Projeto Crescer Atletas do Bem Estilo de Vida MG Run/Logos Supermercado Chibana Ltda.

Facitec Supercei Caso DF Mizuno

3:18:39 3:18:41 3:18:41 3:18:42 3:18:58 3:19:00 3:19:07 3:19:08 3:19:08 3:19:08 3:19:15 3:19:15 3:19:16 3:19:21 3:19:24 3:19:33 3:19:34 3:19:59

2:41:43 2:44:56

Obcursos-Caixa

2:45:46 2:51:51 2:53:28 2:55:30 2:56:26 2:56:58 2:57:49 2:59:40

Adriano Bastos Trein.

3:09:52 3:11:37

Cruzeiro Esporte Clube Phyto Exências Santa Constancia Fila

Univ. São Marcos/ Nova Acad. Tavares Ouro Fino Taboão da Serra E.C. Tavares MG Personal Training Futel

3:26:50 3:29:25 3:31:29 3:31:43 3:32:08 3:32:18 3:38:11 3:39:21 3:39:54

TRACK&FIELD RUN SERIES - BRASÍLIA 07 DE JUNHO – BRASÍLIA (DF) – 10KM

28 16

Masculino SA Elite 1º Paulo Braz da Silva 2º Israel Barbosa de Deus

31:40 31:58

SA Nível Ouro 3º Gilson William dos Reis 4º Damião Gomes a Silva 5º Jurandir Luiz dos Santos

32:37 33:27 33:43

SA Nível Prata 6º Raimundo Onato de Lima 7º Paulo Cesar da Silva Cruz 8º Joel Rufino da Silva 9º Francisco José de Deus Lima 10º Elionaldo Barbosa Santana 11º Lindomar Pereira Cardoso

34:06 34:06 34:19 34:44 35:24 35:49

SA Nível Bronze 12º Wesley do Nascimento 13º Aurelindo de Souza Primo 14º Roberto do Nascimento

37:28 38:23 38:39

15º Vinicius Alves e Santos 16º Leonardo Moreno Barros

39:07 39:48

Feminino SA Elite 1º Odineide Felix de Amorim

37:43

SA Nível Prata 2º Mirela C. Albrecht 3º Marlene do Nascimento

42:02 43:30

SA Nível Bronze 4º Andrelina Cardoso 5º Cristina Oliveira

44:37 44:58

ECO RUN SÃO PAULO 07 DE JUNHO - SÃO PAULO (SP) – 10KM Masculino SA Elite 1º Jose Rodrigues dos Santos 2º Claudio J Ferreira 3º Adriano Bastos

30:36 31:37 31:55

SA Nível Ouro 4º Odair Costa 5º Eliano Conga de Lima 6º Tarcisio Fernandes Eloi 7º Adailtom Lima

32:25 32:32 32:56 33:50

SA Nível Prata 8º Abel de Souza 9º Agostinho dos Santos Lima 10º Carlos Silva Manoel 11º Jamirez Assis 12º Adinaldo Nunes Gadelha 13º Moises Monteiro da Silva 14º Robson Santos 15º Rogério Soares da Silva 16º Laercio da Rocha 17º Ricardo Santos 18º Edivaldo da Graça Batalha 19º Jose Cicero dos Santos

34:01 34:15 34:39 34:49 35:06 35:08 35:37 35:37 35:47 35:55 36:09 36:17

SA Nível Bronze 20º Marcos Ferreira de Mello 21º Gustavo Ayres Netto 22º Itamar José Zampieri 23º Jorge Silva 24º Arlindo R Santos 25º Adao Mariano Aparecido 26º Acácio Gomes Barbosa 27º Alberto de Oliveira dos Santos 28º Marco Antonio Oliveira 29º Fernando Pires Teixeira 30º Adriano Gusmao 31º Fraser Pelvin 32º Guilherme de Abreu Gaia 33º Maurício Gomes Florenço

37:06 37:07 37:07 37:30 37:31 37:35 37:56 38:11 38:47 38:48 39:02 39:54 39:55 39:57

Feminino SA Elite 1º Tatiele Roberta de Carvalho 2º Shirleide da Silva

35:37 37:33

SA Nível Ouro 3º Jaciane Barroso Araujo 4º Estela Rosa 5º Vivian de Oliveira 6º Lindinalva Saraiva da Silva

38:32 38:51 39:47 39:58

SA Nível Prata 7º Paloma Barbosa Vasconcelos 8º Ariane Monticeli

40:17 40:40


9º Claudine de Almeida 10º Joelma da Silva Gomes 11º Patricia Ribeiro Baezo 12º Renata Bittar

41:24 41:47 42:08 43:11

6º Maria Luiza Santana 7º Joci Pereira dos Santos 8º Márcia Maria do Nascimento 9º Nelli Rodiani da Costa Mafuz 10º Ana Lúcia dos Santos Morais

SA Nível Bronze 13º Ana Lucia Flores 14º Dulce Melim 15º Elzioneide Araujo de Souza 16º Katia Ronise Tedeschi 17º Erika Andrea Izidio Szpektor 18º Julia do Vale Bargieri 19º Márcia Akemi Terashima 20º Paula Godinho da Silva 21º Luiza Helena Tamada

45:09 46:06 46:11 46:45 47:05 47:27 47:36 47:56 47:59

UNIMED RUN 10K 21 DE JUNHO – SÃO JOSÉ DOS CAMPOS (SP) – 10KM

REEBOK 10KM 20 DE JUNHO – SÃO PAULO (SP) – 10KM Masculino SA Elite 1º Adriano Bastos 2º Fabio Nascimento

31:36 31:48

SA Nível Ouro 3º Caio da Rocha Silva 4º Carlos Moreira dos Santos 5º Alan Wendell Bonfim 6º Antonio Fernandes Arruda 7º Tarciso Fernandes Eloi

32:13 32:20 32:29 33:07 33:32

SA Nível Prata 8º Raimundo Barbosa dos Santos 9º Ricardo Antonio de Rezende 10º Moises Monteiro da Silva 11º Jose Fernando Alvez Barbosa

34:27 35:40 36:14 36:44

SA Nível Bronze 12º Acácio Gomes Barbosa 13º Arnaldo Aparecido Ferreira 14º Aelson Oliveira Machado 15º Clismacleiton da Silva 16º Adriano Gusmão 17º Eduardo Ortolan

37:20 38:06 38:36 38:44 39:18 39:49

Feminino SA Nível Ouro 1º Beatriz Nascimento 2º Rosangela Figueiredo Silva

38:14 39:16

SA Nível Prata 3º Silvia Moreira Lopes Ribeiro 4º Fabiana Roque

40:03 40:54

SA Nível Bronze 5º Juliana Pegurari Cometi

46:04

46:08 46:08 46:17 46:18 47:07

Masculino SA Elite 1º Claudio Jose Ferreira SA Nível Ouro 2º Adailton Miguel de Lima 3º Jota Junior Pereira 4º Abel de Souza 5º Dario Jose da Rocha SA Nível Prata 6º Eder Nunes da Silva 7º Higino Miranda Filho Adc Cta 8º Jamirez Alves de Assis 9º Frediano Seni Venino 10º Laercio da Rocha 11º Leonardo Hebert Lopes 12º Simei Nogueira dos Santos 13º Luciano Marcos de Oliveira 14º Benedito P. de Oliveira 15º Diego de Morais Rovida 16º Valdir Oliveira da Silva SA Nível Bronze 17º Valmir dos Santos Araujo 18º Rogerio Raimundo 19º Altair Alves Andrade 20º Vander Maciel 21º Daniel dos Santos 22º Geraldo Aparecido Ribeiro 23º Rogerio dos Santos Fonseca 24º Luis Enrique Gutierrez 25º Cícero Alves dos Santos 26º Jose Geraldo de Souza 27º Armando Ramos Gouveia 28º Johanlemberg Almeida 29º Jose Carlos Pereira 30º Aluizio Vila Nova Brito 31º Robson de Paula 32º Paulo Henrique Nogueira 33º Izaias Souza Macena 34º João Batista Maria Leite 35º Carlos Shiroshi Kawasaki 36º Mario Sergio Molica Iserbem 37º Raimundo de Jesus 38º Reinaldo Costa 39º Ailton Carvalho Lima

31:18

Cia Athletica World Cidade de Mogi Pro Runner –Rocco Acorj

Cebel Amigos do Bosque Maia Acosm/Sapucaí-Mirim Garças Brc/Guara Defreitas Amigos do Bosque de Maia Perfect Body Fitness Vinac Acosm/Sapucaí-Mirim Adc Cognis Ericsson Run&Fun Cisa Trading Petrobras/Un-Revap Inpe – Cocta Fadenp Atibaia Amigos do Bosque Maia Coiotes Amigos do Bosque Maia Atibaia Ericsson/Run&Fun Amigos do Bosque Maia Equipes do Bosque Maia Johnson Clube

32:21 32:32 33:21 33:58 34:03 34:07 34:12 34:29 35:07 35:19 35:46 35:50 35:57 36:16 36:39 37:14 37:17 37:33 37:37 37:45 37:47 37:57 38:00 38:05 38:14 38:26 38:26 38:29 38:54 38:58 38:59 39:01 39:01 39:18 39:19 39:22 39:31 39:36


linha de chegada 40º Wilson Pereira Arantes 41º Eduardo Lopes Fernandes

Monsanto Qualidade Trainer

Feminino SA Elite 1º Maria Cecilia Severiano SA Nível Prata 2º Islene dos Santos Souza 3º Celia Regina Bittencour SA Nível Bronze 4º Beatriz Leonila Moreno 5º Rebeca Leitao Angeli 6º Sabrina Caires de Jesus 7º Maria Luiza Ribeiro Correia 8º Claudia Simone da Silva

39:53 39:54

37:49

Academia Trainer

Adc Inpe Cia Athletica World Amigos do Bosque Maia Bosque Maia Espaço Atlético

40:08 43:24

45:31 45:51 46:57 46:58 47:16

3ª CORRIDA HEBRAICA MACABI BRASIL 21 DE JUNHO – SÃO PAULO (SP) – 6KM Masculino 1º Sivaldo Santos Viana 2º Adriano Bastos 3º Marildo José Barduco 4º Adriano da Silva Soares 5º Naval Freitas 6º Benedito Donizetti Gomes 7º Ronicesse Felix de Lima 8º Carlos Moreira dos Santos 9º Antonio Soares Filho 10º Oseias dos Santos 11º Gilmar Souza de Almeida 12º Evandes Costa dos Santos 13º Ricardo de Oliveira Silva 14º Joseni da Silva 15º Giorgio Marques 16º Jose Carlos da Silva 17º Ivaldo Rodrigues Sampaio 18º Cristojésus Silva Garcia 19º Barnabé Gomes de Lima 20º Severino Candido de Araujo 21º Fabiano Vieira de Barros 22º Luciano Alves de Souza 23º Diego Gonçalves Ferraz 24º Jose Francisco Ramos 25º Cicero Edson Dias da Silva 26º Diego da Silva Oliveira 27º Vanderlei Silva Soares 28º Joel Oliveira Santos 29º Jose da Silva Xavier 30º Genildo Alcantara de Lima 31º Carlos Goncalves Costa 32º Marcos Pacheco 33º Ronaldo dos Santos 34º Edmilson Chaves Ribeiro

M Calçados/Diadora Pão de Açúcar/BM&F/New Balance Montevérgine Vo2 M Calçados/Diadora Calçados/Diadora Calçados/Diadora Albino Advogados Associados E.C. Tavares Ztrack/Clínica Paulista Dio’s Running Team E.C. Tavares E.C. Tavares Minc Seguros/Adriano Bastos Calçados Casa Eurico Medley Triathlon Metrus-Metrô/SP SEME-Santa Barbara D’Oeste FGB Assessoria Esportiva Benicio Adv/Correios E.C. Tavares Amil Dio’s Running Team Fábio Fernandes Pro Runner Team Lemier Jeans/Adriano Bastos IronMan Assessoria Esportiva PlayTeam Fábio Fernandes

Nova Equipe Ass Esportiva M Calçados/Diadora

17:58 18:01 18:09 18:17 18:25 18:36 18:37 18:59 19:11 19:15 19:19 19:25 19:29 19:32 19:42 19:43 19:50 19:52 19:54 19:55 19:55 19:57 20:02 20:05 20:10 20:16 20:17 20:21 20:25 20:27 20:27 20:29 20:30 20:32

35º Andre Alves de Amorim E.C. Tavares 36º Vladimir da Silva Caoa Hundai 37º Abimael Alves Ribeiro Cmse 38º Jose Fernandes Batista E.C. Tavares 39º Rogério Soares da Silva RML Training Life Style 40º Angelisio Silva dos Reis E.C. Tavares 41º Edivaldo da Graça Batalha Flavio Freire 42º Jose Ivanilson da Silva Hosp Dante Pazzanese 43º José Sérgio Vieira Vo2/Gatorade/adidas 44º Henrique Correa dos Santos Pro Runner Team 45º Delfino Barbosa da Silva Equipe Lobo 46º Jesuino Jose dos Santos E.C. Tavares 47º Valderi de Sousa Lima Jbs 48º Admilson dos SantosSEME-Santa Barbara D’Oeste 49º Edson Epifanio dos Santos Montevérgine 50º Horacelio Paulo da Silva AR4 Running Team 51º Adimilson Santos de Freitas Viação Cidade Dutra 52º Jose Milton de Lira Corpore/Ibirapuera 53º Josenildo Galdino da Silva E.C. Tavares 54º Anderson Jovino da Silva Medial Clube 55º José Pedro da Silva Bradesco Vida e Previdência 56º Fabio Cardoso de Sena 57º Paulo Henrique S. Lara 58º Jose Naldo de Lira Asfaltolokos 59º Ivanildo Dias de Souza VO2/Stefanini 60º Fábio Keiti Nathanson Pro Runner Team 61º Jose Ivan Barbosa de Souza Metrus-Metrô/SP 62º Arnaud Martins da Silva Equipe Yoki de Corrida 63º Francisco V. Mergulhão 4any1 64º Jose Maria dos Santos PlayTeam 65º Geraldo Nascimento Oliveira PlayTeam 66º Douglas Fernando Passarin SEME-Santa Barbara D’Oeste 67º Ozias Cabral Nascimento E.C. Tavares 68º Gilberto Brixner 69º Sildeni Costa Rezena Yoki Alimentos 70º Antônio Aparecido Gomes SESC-Interlagos 71º Fabio Luis Vasconcelos E.C. Tavares 72º Thiago Felipe Cipriano Painel Musical 73º Reynaldo Costa Painel Musical/Guia de Motéis 74º Reginaldo Maciel Belarmino Espaço Árabe 75º Reginaldo dos Santos Ilário PlayTeam 76º Thiago Rodrigues Silva Selva Aventura 77º Moacir Costa Filho E.C. Tavares/Sindicato 78º Rafael Candido de Oliveira E.C. Tavares 79º Sebastião Roberto da Silva Marcasinal 80º Levi Torres dos Santos Sandro Performance 81º Alexandre Joaquim da Silva pn Treinamento 82º Adriano Gusmão Comar Adriano Bastos Treinamento 83º Jose Edmicio dos Santos 84º Adilson Bezerra da Silva 85º Jose Antonio Caporrino Supermercado Chibana Ltda 86º Jonatas Roger Freitas Pro Runner Team 87º João Batista dos Santos 88º Carlos Henrique Carvalho Pro Runner Team 89º Marco Antonio de Oliveira PlayTeam 90º Marcos Aurelio Gonsalves Mg Run

20:33 20:33 20:34 20:35 20:36 20:37 20:44 20:44 20:51 20:54 20:54 20:56 20:59 21:09 21:12 21:12 21:15 21:18 21:23 21:27 21:28 21:29 21:30 21:30 21:33 21:33 21:34 21:35 21:37 21:37 21:37 21:41 21:42 21:48 21:49 21:51 21:53 21:54 21:55 21:56 21:57 21:58 21:59 21:59 22:00 22:02 22:02 22:05 22:06 22:06 22:06 22:08 22:09 22:12 22:12 22:14


91º Leandro Mario da Silva 92º Cláudio Augusto da Silva 93º Pedro A. Pereira 94º Mauricio de Andrade 95º William Masterson Belo 96º Luciano Elias Lacerda 97º Jairo Homar Marques 98º Valdir Raulino Junior 99º Milton Vieira Vanderley 100º Gilberto Magalhães Feminino 1º Janaina Pinto Fernandes 2º Vivian de Oliveira 3º Olivia de Fatima Fernandes 4º Liane Schwarz Buchman 5º Maria Margarida Gomes 6º Anarley da Conceição Brito 7º Jessica Messias Levadinha 8º Sofia Mazon Gonçalves 9º Suzana Christina Gottlob 10º Daniela Barcelos 11º Vivian Feher Radomysler 12º Patricia Maria Resende Pinto 13º Nair de Souza N. Carvalho 14º Daniela Micheletti Mucciolo 15º Maria José Andriola 16º Marcia Maria do Nascimento 17º Tania Rosa da Silva 18º Aline Cristine Canavezi 19º Rosana Maria Cabral 20º Andreia Fernandes Martins 21º Cristina Toloto 22º Edeni Ferreira da Silva 23º Maria Cristina Novaes Rosa 24º Mirian Rodrigues dos Santos 25º Edineuza Araújo Ferreira 26º Sandra Maria de Amorim 27º Maria Rita de Jesus 28º Débora Carla Freitas Barros 29º Ana Lucia Barbosa Meira 30º Cleonice Correa Barbosa 31º Nara Melo 32º Simone Dantas Gutierrez 33º Fatima Maria N.de Souza 34º Ana Carolina Ferreira 35º Silvia Moreira Lopes 36º Zelita Frese 37º Melissa Luiz de Melo 38º Eugenia Maria de Almeida 39º Alexsandra S. Brito 40º Katia Emilia dos Santos 41º Sylvia Amelia Mantovani 42º Thais Wagner 43º Joyce Pires Lopes Mendes 44º Silvana Cole

PlayTeam Hosp. Israelita Albert Einstein E.C. Tavares Ztrack/Clínica Paulista Amigos do Bem Limit Academia Equipe Yoki de Corrida Metrus-Metrô/SP Jose Luis Corrida Pedestre

VO2/Stefanini Adriano Bastos Treinamento VO2/Stefanini Hebraica Turma do Peninha PlayTeam T3team Itaú Unibanco MG Personal Training Acrimet/Top Spin/Run Tech Flavio Freire/Sport Life Konex Adriano Bastos Treinamento Medial Clube E.C. Tavares Nova Equipe Assessoria E.C. Tavares MG Run Medial Clube Corre Rafael Dio’s Running Team Ultimate Running Pro Runner Team E.C. Tavares 5 Ways/Bio Running MG Run Sinsaudesp

Pro Runner Team Pro Runner Team Lazam – Mds AR4 Running Team

Equipe Básica

22:15 22:17 22:19 22:20 22:21 22:22 22:23 22:26 22:27 22:29

22:44 22:55 23:45 23:57 24:00 24:38 24:58 25:07 25:12 25:22 25:40 25:50 25:51 26:00 26:09 26:31 26:41 26:43 26:44 26:46 26:53 26:55 26:58 27:07 27:28 27:29 27:36 27:41 27:42 27:46 27:50 27:51 27:52 27:58 28:01 28:06 28:07 28:12 28:24 28:27 28:31 28:40 28:44 28:47

45º Maria Jose da Silva Garcia 46º Marcela Menegatti 47º Nadia Noriko Harada 48º Silvia Helena da Cunha 49º Greice Kelly Romão Santos 50º Elaine Barbosa Gonçalves 51º Fabiana Heleno Toledo 52º Irene Dias de Andrade 53º Luiza da Silva Brito 54º Mayara Silva dos Santos 55º Maria Fernanda de Toledo 56º Mônica de Souza Faria 57º Celina Lucas Melchiori 58º Luciana de Nigris Garritano 59º Natasha Namie Nakagawa 60º Valdenise Aparecida de Souza 61º Tatiane Fernandes 62º Regina de Cassia Santana 63º Anacir Felix Laureano 64º Joana José Alves 65º Fernanda Rabello de Souza 66º Kelly Simões de Lima 67º Renata Corrêa Morishita 68º Katia de Freitas 69º Fatima Helena Gentil 70º Matilde Matiko Kussano 71º Silvia Helena Contri Shohet 72º Teresa Midori Setoue 73º Aparecida de Fátima Prado 74º Aparecida Fátima dos Santos 75º Juliana Scalissi Martins 76º Margarete Rose Rodrigues 77º Beatriz Ragazzi Pauli Simão 78º Vivian Salazar 79º Maria Aparecida Plantier 80º Marinete da Conceição Lima 81º Thaís Castro de Oliveira 82º Patricia Lobao Peres 83º Ryoko Sato Nakao 84º Yassuko Maruo Fairchild 85º Marisa Takahashi Hashimoto 86º Silvia Shimabukuro 87º Carolina Spera Paiva MG 88º Gabriela Novaes 89º Sonia Ap Facas da Silva 90º Sueli de Freitas Verissimo 91º Cristiane Oliveira da Silva 92º Marisa Sack 93º Maura Ioshiko Takemiya 94º Luzia Maura Paduim Silva 95º Regina Kiomi Takahira 96º Adesilde Souza Pereira 97º Cristiane Guilherme da Silva 98º Eleazar Cavalcante de Souza 99º Ana Cristina Osório Michel 100º Sherida Giannie Boetius

AES Eletropaulo/Ativida Pro Runner Team Corredores 100 Futuro ACM-Alphaville Fábio Fernandes Pro Runner Team E.C. Tavares Jbs pn Treinamento Adriano Bastos Treinamento Corredores da Cuesta-Botucatu Anasp Osasco PlayTeam ACM Guarulhos Hosp Dante Pazzanese Equipe 100 Limites Diebold Procomp Itaú Unibanco Metrus-Metrô/SP Flavio Freire/Na Ativa Adriano Bastos Treinamento E.C. Tavares AR4 Running Team Diebold Procomp Medial Clube

Flávio Freire Asses. E.C. Tavares Quality Solution E.C. Tavares Personal Training Nelson Evêncio Asses. Marcasinal C.A.Paulistano SEME-Santa Barbara D’Oeste Ztrack/Clínica Paulista Corredores da Cuesta-Botucatu E.C. Tavares Crayz Lazam – Mds PlayTeam

28:56 28:58 29:01 29:04 29:06 29:07 29:09 29:11 29:13 29:13 29:14 29:14 29:17 29:22 29:23 29:23 29:24 29:24 29:26 29:32 29:34 29:34 29:37 29:40 29:41 29:43 29:44 29:55 29:57 29:58 29:59 30:00 30:00 30:05 30:06 30:13 30:19 30:19 30:20 30:25 30:27 30:33 30:37 30:42 30:43 30:43 30:45 30:45 30:49 30:52 30:55 30:58 30:59 30:59 30:59 31:00


seu treino

Aescolha ĂŠ sua

32 16

Fotos: Shutterstock


Optar pelo treinador que se encaix e melhor no seu estilo ĂŠ um dos diferenciais para atingir objetivos na corrida, sejam eles unicamente esportivos ou por uma vida mais saudĂĄvel

Julianne Cerasoli

M

uito se fala sobre a importância de contar com o apoio de um SURÂżVVLRQDOGH(GXFDomR)tVLFD para orientar os treinamentos de corrida. Contudo, na hora de escolher, o que parece simples pode se tornar uma PLVVmR PLVWHULRVD VHMD SHOD JUDQGH RIHUWD VHMD pela falta de conhecimento acerca do que ĂŠ necessĂĄrio para ser um treinador especializado. AtĂŠ porque, como em qualquer ĂĄrea, hĂĄ os bons e os maus SURÂżVVLRQDLV3RUWDQWRTXDQWRPDLVLQIRUPDomRD UHVSHLWR GD IRUPDomR QHFHVViULD H GH TXDLV VXDV REULJDo}HVPDLVIiFLOVHUiHVVDWDUHID 7HFQLFDPHQWHRIDWRGHRSURÂżVVLRQDOVHUIRUPDGRHP(GXFDomR)tVLFDHSUHIHUHQFLDOPHQWHUHJLVWUDGRQRVFRQVHOKRVUHJLRQDOHQDFLRQDOGDiUHD MipXPERPLQtFLRSRLVHVWHVyUJmRVUHVSRQGHP SHODÂżVFDOL]DomRGDSURÂżVVmR &RQWXGR TXDQWR PDLV HVSHFtÂżFR VHX WUHLQDPHQWR PDLV LPSRUWDQWH p D HVSHFLDOL]DomR em atletismo e experiĂŞncia na ĂĄrea. “Quem estĂĄ aprendendo a desenvolver a prĂĄtica da corrida, na fase de conhecer o corpo, pode, teoricamente, ser orientado por um personal ou pelo instrutor GHPXVFXODomRSRUH[HPSOR´DYDOLDRWUHLQDGRU &OiXGLR&DVWLOKRGD6D~GH 3HUIRUPDQFH$WLYLGDGH)tVLFDÂł0DVYHMRYiULRVSURÂżVVLRQDLVWUDQVLWDQGR HQWUH RV GRLV FDPSRV GH DWXDomR FRQWLnuando a orientar essa pessoa quando ela passa a correr na rua e a participar de provas e creio que VHMD SHULJRVR SRLV p MXVWDPHQWH QHVVH PRPHQWR TXHRDOXQRSUHFLVDGHDOJXpPPDLVHVSHFLDOL]DGR´,VVRSRUTXHQDUXDPXGDVHFRPSOHWDPHQte a maneira de correr e a importância da tĂŠcnica

cresce muito. “AlĂŠm disso, ĂŠ o melhor momento para ensinĂĄ-lo a tĂŠcnica e impedir problemas no IXWXUR´RSLQD $tFRPHoDRXWURSUREOHPDFRPRHVFROKHUHVVH HVSHFLDOLVWD"'HQWUHRVWUHLQDGRUHVFXMDIRUPDomR ĂŠ direcionada ao atletismo tambĂŠm hĂĄ diferentes QtYHLV HVWDEHOHFLGRV SHOD ,$$) $VVRFLDomR ,QWHUQDFLRQDO GDV )HGHUDo}HV GH $WOHWLVPR  LQGR GHVGH,  DWp9  3DUDFDGDQtYHORWUHLQDGRU deve preencher determinados requisitos e particiSDUGRFXUVRFRQGX]LGRSHODHQWLGDGH(TXDQWR mais voltado para a performance ĂŠ o treinamento, PDLVLPSRUWDQWHLQYHVWLJDUDVFUHGHQFLDLVGRSURÂżVVLRQDO Mas hĂĄ ainda outros aspectos a atentar-se. O JHUHQWH GH GHVHQYROYLPHQWR GD &%$W &RQIHGHUDomR %UDVLOHLUD GH$WOHWLVPR  H WUHLQDGRU ,$$) QtYHO,9/i]DUR3HUHLUD9HOi]TXH]KiDQRVQD PRGDOLGDGH OLVWD RV VHJXLQWHV LWHQV D VHUHP REVHUYDGRVQDKRUDGHHVFROKHUXPWUHLQDGRUFDUDFWHUtVWLFDV GH SHUVRQDOLGDGH KLVWyULFR GH UHVXOWDGRVHVSRUWLYRVKLVWyULFRGHWUDEDOKRFRPDWOHWDV DPDGRUHV UHODo}HV LQWHUSHVVRDLV YDORUHV pWLFRV SRQWXDOLGDGHHJUDXGHFRPSURPHWLPHQWRFRPRV alunos. â€œĂ‰ muito importante ter uma ideia clara de qual tipo de personalidade tem o treinador esFROKLGRMiTXHDVIRUPDVGHFREUDQoDVWrPPXLWR DYHUFRPLVVR´DYDOLD 'HVFREULUWXGRLVVRORJRGHFDUDREYLDPHQWHQmR ĂŠ fĂĄcil, por isso, muitos corredores recorrem ao bom HYHOKRERFDDERFDÂł%DVHDGRHPQRVVDDVVHVVRULD o relato de nossos alunos nos mostra que a indicaomRHVWiHPSULPHLUROXJDU0DVRTXHQRVGiFUHdibilidade ĂŠ o fato de estarmos desenvolvendo um WUDEDOKR QD PHVPD HPSUHVD Ki GH] DQRV LVVR ID] com que a facilidade do aluno em encontrar uma DVVHVVRULD DXPHQWH´ DFUHGLWD $QGUp &DPSRV GD $QGUp&DPSRV3HUIRUPDQFH

33

SUPERAĂ‡ĂƒO


seu treino

Saber o que quer $OJR TXH IDFLOLWD HVVD GHFLVmR p VH SHUJXQWDU TXDORVHXSHU¿OFRPRDOXQRHRTXHHVSHUDGRWpFQLFR³2WLSRGHWUHLQDGRUHVWiOLJDGRGLUHWDPHQWH DRJUXSRTXHHOHSRVVXLHDOLQKDGHWUDEDOKRDGRWDGDDMXGDDGH¿QLUHVWHSHU¿O(VVDLGHQWL¿FDomR poderå ser observada pelos resultados, forma de SODQHMDPHQWRGHXPDWOHWDTXDQWLGDGHGHWUHLQDPHQWRVUHDOL]DGRVHWF´D¿UPD&DPSRV 2So}HV QmR IDOWDP$SHQDV HP 6mR 3DXOR Ki quase 400 assessorias esportivas e, dentro de um mercado cada vez mais competitivo, a busca Ê por LGHQWLGDGH³+RMHVHWHPGHWXGRTXHPDWHQGHD corredores de baixa renda, mulheres, quem quer performance, cardiopatas. Tem que pesquisar, ver VH R SHU¿O VH HQTXDGUD DR REMHWLYR H VH R JUXSR

34 16

HQWUDHPVLQHUJLDFRPRDOXQR´LQGLFD&DVWLOKR Assim como hå alunos diferentes, a personalidaGHGRWUHLQDGRUWDPEpPLQÀXLQDPDQHLUDFRPRHOH WUDEDOKDHSRUTXHQmRQRVSUySULRVFRUUHGRUHVTXH HOHDWUDL(QWUHWDQWRDWHQGrQFLDpTXHPHVWiYHQGHQGRRVHUYLoRVHDGDSWDU³'HIRUPDJHUDOSHQVR que o mÊtodo de trabalho varia de aluno para aluno, SRLVREMHWLYRVGLIHUHQWHVJHUDPWUDEDOKRVGLIHUHQWHV H XWLOL]DomR GH PHWRGRORJLDV GLIHUHQWHV e VDELGR que, para se prescrever um determinado treinamento, Ê importante você obter um conhecimento PXOWLODWHUDO´D¿UPD&DPSRVRTXHVLJQL¿FDVDEHU PRQWDUXPSURJUDPDSDUDXPSUDWLFDQWHUHJXODURX XP¾DWOHWDGH¿PGHVHPDQDœ³0HVPRVHRIRFRp DTXDOLGDGHGHYLGDDFUHGLWRTXHDDERUGDJHPPDLV H¿FD]pDTXHODTXHGHL[DVHXFOLHQWHVDWLVIHLWR´


As obrigaçþes dele 2SDSHOGRWUHLQDGRUQmRGHYHVHUDSHQDVSUHVcrever um treinamento fechado e procurar o aluno QRÂżQDOGRPrVeLPSRUWDQWHHVWDEHOHFHUXPGLiORJRSDUDTXHDPEDVDVSDUWHVHVWHMDPFDPLQKDQGR MXQWDV SDUD R PHVPR REMHWLYR 6DEHU SRU TXH WHP TXHFXPSULUGHWHUPLQDGDVHVVmRPHVPRTXHIRUXP GXURLQWHUYDODGRDMXGDQDPRWLYDomRHFRQVFLHQWL]D o corredor da necessidade de trabalhar passo a passo. “O papel do treinador na vida de qualquer aluno DPDGRU RX SURÂżVVLRQDO HVWi QD RULHQWDomR H SUHVFULomR GR VHX WUHLQDPHQWR GH IRUPD TXH DWHQGD j necessidade do cliente. Ao direcionar as atividades elaboradas, o treinador facilita o processo de aprenGL]DGRGRDOXQR´DYDOLD&DPSRV Castilho vĂŞ como problemĂĄtica o que chama de a PDLVQRYDÂľPRGDÂśHQWUHRVWUHLQDGRUHVDFRPSDQKDmento quase exclusivamente por e-mail. “A planilha p DSHQDV XP JXLD SDUD UHJLVWUDU HWDSDV HOD QmR VH UHVROYHVR]LQKD$FKRDWpSHULJRVRQmRWHUHVVHFRQWDWR 1mR DEUR PmR GH DFRPSDQKDU RV WUHLQRV GRV PHXVDOXQRVVHPDQDOPHQWHRXVHSRVVtYHOWUrVYHzes por semana, principalmente nos trabalhos mais GLItFHLVFRPRGHWpFQLFDHIRUoD´RSLQDÂł6R]LQKR R DWOHWD SRGH ID]HU WUHLQRV UHJHQHUDWLYRV RX DTXHOHVFRPFRQWUROHSRUIUHTXrQFLDFDUGtDFD(TXDQWR PDLVLQLFLDQWHPDLVLPSRUWDQWHYHUGHSHUWR´ AlĂŠm do acompanhamento dos treinos, deve ser IHLWDXPDDYDOLDomRSHULyGLFDFRPHQFDPLQKDPHQWRDH[DPHVPpGLFRVODERUDWRULDLVHWHVWHVItVLFRV uma vez que, mesmo que o rendimento nos treinos FRQWLQXHRPHVPRKiSDWRORJLDVTXHIRUoDPDWpD LQWHUUXSomRWRWDOGDFRUULGDHLVVRPXLWDVYH]HVVy DSDUHFHQHVVDVDYDOLDo}HV $SHVDU GD LPSRUWkQFLD GRV GDGRV FLHQWtÂżFRV nada substitui uma boa conversa, de preferĂŞncia, PHVPRTXHQmRVHMDSHVVRDOPHQWHGHSRLVGHFDGD VHVVmR$tHQWUDDSDUWHGRFRUUHGRUQHVVDUHODomR (OHGHYHSUHVWDUDWHQomRjVUHDo}HVGRFRUSRHVDEHU UHODWiODVDRWUHLQDGRUÂł7RGDVDVVHQVDo}HVGXUDQWH RWUHLQRHKRUDVGHSRLVVmR~WHLV&RVWXPRXVDUD SHUFHSomRVXEMHWLYDSHQGLGRQRWDVGHDDOpP GHGDGRVGLUHWRVFRPRGDIUHTXrQFLDFDUGtDFDPDV WXGR R TXH R DOXQR UHODWD p UHOHYDQWH (QWUHWDQWR pOyJLFRTXHHVVHGLiORJRpDOJRTXHVHHVWDEHOHFH FRPRWHPSR´UHVVDOWD&DVWLOKR 3DUD &DPSRV RV VHJXLQWHV SDUkPHWURV GHYHP VHUREVHUYDGRVFDQVDoRItVLFRRXPHQWDOTXDOTXHU

GRUTXHIXMDGRVSDGU}HVQRUPDLVQmRID]HUWUHLQRV H[WUDVRXPXGDQoDVVHPFRQVXOWDUVHXWpFQLFRDYHULJXDURWHPSRGHXWLOL]DomRGRWrQLVVHDDOLPHQWDomRpUHDOL]DGDGHIRUPDHTXLOLEUDGDGHDFRUGRFRP suas necessidades e prescrita por um nutricionista. ³0LQKDVXJHVWmRGHIHHGEDFNpTXHVHMDGLiULRRX VHPDQDO´ 8PD VDtGD TXH SRGH GDU DOJXP WUDEDOKR PDV FXMRE{QXVpPDLRUTXHR{QXVpPDQWHUXPGLiULR de treino, em que o corredor relata dados do treiQRFRPRIUHTXrQFLDFDUGtDFDGLVWkQFLDSHUFRUULGD WHPSRGRWUHLQRPpGLDGHYHORFLGDGHSHUFHSomRGH HVIRUoRFOLPDXPLGDGHKRUiULRGHWUHLQRDOLPHQWDomRHKLGUDWDomR DQWHVGXUDQWHHDSyVRWUHLQR  estado emocional antes do treino e fatores de esWUHVVHGRGLD$VVLP¿FDPDLVVLPSOHVJXDUGDUDV LQIRUPDo}HVHDYLGDGRWUHLQDGRUpIDFLOLWDGD

Os alunos Contudo, assim como hå diferentes tipos de WUHLQDGRUHVKiFRUUHGRUHVSDUDWRGRVRVJRVWRV³2 DOXQRWHPTXHHQWHQGHUTXHTXDQWRPDLVHVSHFt¿FR RREMHWLYRPDLVGLItFLOSDUDVHDGHTXDURVSDUkPHtros do treinamento e melhor tem que ser essa coPXQLFDomR´ VXEOLQKD R WUHLQDGRU &DPSRV 0DV R que ocorre muitas vezes, de acordo com Castilho, pRGHVJDVWHDRLQYpVGDFRQVWUXomRGHVVDUHODomR 1RLQtFLRRVDPDGRUHVWHQGHPDDFHLWDUPDLVRTXH R WUHLQDGRU IDOD 'HSRLV ³&RP R WHPSR YmR VH WRUQDQGRDXWRGLGDWDVHFRPHoDPDGLVFXWLUFRPR SUR¿VVLRQDO(FRVWXPRGL]HUTXHHVVHpRFRPHoR GR¿P+RMHKiPXLWDLQIRUPDomRQD,QWHUQHWHP revistas, mas, por mais que ele se informe, ainda precisa do treinador para interpretar esses dados e VRPiORVDVXDUHDOLGDGH´RSLQD Outro problema percebido por Castilho Ê o imeGLDWLVPR³4XDQGRRDOXQRQmRFRQVHJXHPDLVEDLxar o tempo para uma determinada distância, por H[HPSORFRPHoDDIDOWDUQRVWUHLQDPHQWRVHDLQGD TXHUPHOKRUDUSRLVQmRDFHLWDRXYLUTXHHVWiTXHEUDQGRRWUHLQR0DVQmRKiIyUPXODPLODJURVD´ 3DUDQmRFKHJDUQHVVH¾¿Pœ&DPSRVDSRVWDQR GLiORJR³1RVSUHRFXSDPRVFRPRUHVXOWDGRVHP HVTXHFHUTXHQRVVRVFOLHQWHVVmRVHUHVKXPDQRVH QmR PiTXLQDV VHQGR DVVLP TXDQWR PDLRU R FRQtato entre ambos, maior serå a facilidade de feedEDFNHPHQRUVHUiDSUREDELOLGDGHGHXPDHYHQWXDO FRQWXVmR´

35

SUPERAĂ‡ĂƒO


seu treino Encontre um treinador que combine com você

36 16

Elaborado por Lázaro Pereira Velázquez, gerente de desenvolvimento da CBAt (Confederação Brasileira de Atletismo) e treinador IAAF Nível IV


equipamento

GUIA DO TÊNIS Grande objeto de desejo de 10 entre 10 corredores, os tênis, assim como os atletas, passam por transformações de tempos em tempos. Enquanto você ganha segundos, minutos preciosos a cada prova, os calçados incorporam novas tecnologias, tecidos, cores e design a cada coleção. Para mostrar o que tem de mais novo no mercado, SuperAção entrou em contato com as principais marcas e transformou suas páginas em verdadeiras prateleiras dos sonhos. São mais de 50 modelos, muitos inéditos, alguns reformulados, e com certeza um deles vai conquistar você. Conheça, compare e corra às compras! Todas as informações foram fornecidas pelos fabricantes de materiais esportivos e/ou suas assessorias de imprensa

37

SUPERAÇÃO


equipamento Adidas

SAC: (11) 2161-2961 São Paulo / 0800 55 62 77 (demais estados) www.adidas.com.br ADISTAR RIDE Preço sugerido: R$ 449,90 Tipo de pisada: Neutra/supinada Categoria: Amortecimento, controle de movimento, competição e caminhada Cores: Running white, phantom s09, sun; running white, black 1, red s09 Tamanhos: 34 ao 39 (fem) / 37 ao 45 (masc) Peso: 290g (fem) / 345g (masc) Indicação de uso: Pessoas que treinam com frequência e para corredores mais pesados Tecnologia: Possui as tecnologias formotion, geofit, adiprene, adiprene +, no seam, torsion system, adiWEAR e blown rubber. O cabedal permite maior respiração e o forro tem calce anatômico. A palmilha permite melhor adaptação e a entressola proporciona estabilidade do centro à ponta do pé. Permite o controle dos movimentos e adaptação ao terreno. O solado de borracha expandida oferece aderência e durabilidade em áreas de muito desgaste ADISTAR SALVATION Preço sugerido: R$ 449,90 Tipo de pisada: Pronada/pronada excessiva Categoria: Amortecimento, estabilidade, competição, controle de movimento e caminhada Cores: Running white, black 1, red s09 Tamanhos: 34 ao 39 (fem) / 37 ao 45 (masc) Peso: 305g (fem) / 351g (masc) Indicação de uso: Treinos frequentes e para corredores mais pesados Tecnologia: Formotion, pro-moderator, geofit, adiprene, adiprene +, no seam, torsion system, adiWEAR e blown rubber. A unidade formotion 3D progressiva reduz a velocidade da pronação na região do calcanhar. As ranhuras longitudinais no solado ajudam a reduzir a velocidade de pronação na parte frontal. Blown rubber na parte frontal e adiWEAR no calcanhar proporcionam conforto e durabilidade SUPERNOVA SEQUENCE Preço sugerido: R$ 349,90 Tipo de pisada: Pronada/neutra Categoria: Amortecimento, estabilidade, competição, controle do movimento e caminhada Cores: Black 1, dark steel met. f09, tin met. F09; running white, metallic silver, red s09 Tamanhos: 34 ao 39 (fem) / 37 ao 45 (masc) Peso: 295g (fem) / 350g (masc) Indicação de uso: Treinos de velocidade, provas de média e longa distância Tecnologia: Formotion, pro-moderator, geofit, adiprene, adiprene +, no seam, torsion system, adiWEAR e blown rubber. O cabedal tem tecnologia de suporte sem costuras. A palmilha é construída com base dupla e antimicrobiana. A entressola garante maior propulsão e eficiência, além de oferecer absorção de choques, estabilidade, adaptação ao solo e suporte ao arco do pé. O solado oferece maior durabilidade em áreas de muito desgaste

16 38

ADIZERO TEMPO Preço sugerido: R$ 299,90 Tipo de pisada: Pronada Categoria: Estabilidade, leveza e competição Cores: Neon yellow s09, black 1, cobalt; running white, black 1, pure red f09 Tamanhos: 34 ao 39 (fem) / 37 ao 43 (masc) Peso: 280g Indicação de uso: Uso diário e competição Tecnologia: Adiprene, adiprene +, adiWEAR, torsyon system e blown rubber. Calçado com maior amortecimento, com estrutura para corridas longas


Asics

SAC: 0800 722 7427 www.asics.com.br LANÇAMENTOS: AGOSTO

GEL-NIMBUS® 11 Preço sugerido: R$ 499,90 Tipo de pisada: Supinada/neutra Categoria: Amortecimento Tamanhos: 5 ao 13 (fem) / 6 ao 16 (masc) Peso: 294,7g (fem) / 351,4g (masc) Tecnologia: I.G.S.® (Impact Guidance System), que auxilia o movimento natural do pé; Space Trusstic System®, sistema de estabilidade que permite a deformação controlada da entressola; entresola em Solyte®, material mais leve do que os convencionais EVA e SpEVA® da Asics, traz melhorias no amortecimento e durabilidade; cabedal com Biomorphic Fit™, que garante a superioridade do conforto e do calce, reduzindo o atrito do tênis com o pé; Dynamic Cradle™, um componente moldado da entressola elaborado para tipos de pés específicos, que melhora o calce e a pisada; e cabedal com design assimétrico de amarração, que segue o contorno anatômico do pé

GEL-CUMULUS® 11 Preço sugerido: R$ 359,90 Tipo de pisada: Supinada/neutra Categoria: Amortecimento Tamanhos: 5 ao 13 (fem) / 6 ao 15 (masc) Peso: 274,9g (fem) / 328,7g (masc) Tecnologia: I.G.S.® (Impact Guidance System), Space Trusstic System®, entresola em Solyte®; P.H.F.®, espuma que compõe a região do colar do contra-forte e possui efeito de memória, moldando-se ao tornozelo do atleta, no intuito de criar um calce personalizado GEL-PULSE™ Preço sugerido: R$ 299,90 Tipo de pisada: Supinada/neutra Categoria: Amortecimento Tamanhos: 5 ao 13 (fem) / 7 ao 16 (masc) Peso: 272,1g (fem) / 337,2g (masc) Tecnologia: Possui perfil relativamente baixo e as tecnologias Trusstic System®, entressola em SpEVA®; sistemas de amortecimento em GEL® (nas regiões traseira e dianteira do calçado) e cabedal Open Mesh

GEL-STRATUS® 3 Preço sugerido: R$ 329,90 Tipo de pisada: Supinada/neutra Categoria: Amortecimento Tamanhos: 5 ao 13 (fem) / 6 ao 15 (masc) Peso: 276g (fem) / 324g (masc) Tecnologia: Trusstic System®, entressola em SpEVA®, sistemas de amortecimento em GEL® (nas regiões traseira e dianteira do calçado), capazes de atenuar o impacto do pé durante as fases de impacto e propulsão; e cabedal Open Mesh, tecido do cabedal que oferece conforto e respiração

39

SUPERAÇÃO


equipamento MODELOS COM NOVAS CORES GEL-KAYANO® 15 Preço sugerido: R$ 499,90 Tipo de pisada: Neutra/pronada Categoria: Estabilidade Tamanhos: 5 ao 13 (fem) / 6 ao 16 (masc) Peso: 300,4g (fem) / 368,4g (masc) Tecnologia: A novidade é o Design Assimétrico de Amarração e a nova plataforma de entressola. Possui as tecnologias I.G.S.® (Impact Guidance System), que visa auxiliar o movimento natural do pé; Space Trusstic System®, entressola em Solyte®, que traz melhorias no amortecimento e durabilidade; palmilha ComforDry™, que garante desempenho e amortecimento otimizados; solado DuraSponge®, que garante durabilidade e amortecimento com menos peso GEL-1140™ Preço sugerido: R$ 299,90 Tipo de pisada: Neutra/pronada Categoria: Estabilidade Tamanhos: 5 ao 12 (fem) / 6 ao 17 (masc) Peso: 266,4g (fem) / 320,2g (masc) Tecnologia: Entressola em SpEVA®, que oferece durabilidade da entressola e atenuação de impacto; sistemas de amortecimento em GEL® (nas regiões traseira e dianteira do calçado); Trusstic System®, DuraSponge®; sistema de suporte DuoMax® e cabedal Open Mesh GEL-DS TRAINER® 14 Preço sugerido: R$ 399,90 Tipo de pisada: Neutra/pronada Categoria: Leveza Tamanhos: 5 ao12 (fem) / 6 ao 15 (masc) Peso: 246,6g (fem) / 289g (masc) Tecnologia: Traz a atualização da construção da entressola e nova geometria do cabedal. Possui as tecnologias I.G.S.® (Impact Guidance System); cabedal com design assimétrico de amarração; Space Trusstic System®, sistema de amortecimento em GEL® (nas regiões traseira e dianteira do calçado); Gilled Mesh, uma engenharia específica da lateral do cabedal otimizada para ainda mais ventilação; sistema de suporte DuoMax® GT-2140™ Preço sugerido: R$ 359,90 Tipo de pisada: Neutra + pronada Categoria: Estabilidade Tamanhos: 5 ao 13 (fem) / 6 ao 17 (masc) Peso: 277,7g (fem) / 340g (masc) Tecnologia: I.G.S.® (Impact Guidance System), entressola em Solyte®, Space Trusstic System®; sistemas de amortecimento em GEL® (nas regiões traseira e dianteira do calçado); sistema de suporte DuoMax®, que ajuda no suporte adequado do pé durante o momento de transição (do contato do tornozelo até a propulsão); palmilha ComforDry™, que garante o calçado fresco e seco

40 16

GEL-HYPER SPEED™ 3 Preço sugerido: R$ 259,90 Tipo de pisada: Neutra Categoria: Competição Tamanhos: 4 ao 14 (unissex) Peso: 195,5g Indicação de uso: Treinos e competições Tecnologia: Sistema de amortecimento em GEL® (na região traseira do calçado); entressola em SpEVA®, que oferece durabilidade e atenuação de impacto; componente da sola AHAR® (situado na parte do calcanhar), que acentua a durabilidade da sola, principalmente na fase de contato; Magic Sole™, que minimiza o peso e maximiza a respirabilidade; e cabedal Open Mesh


Athletic Sports SAC: 0800 109 867 www.athleticsports.com.br

FLASH 2 Preço sugerido: R$ 129,90 Tipo de pisada: Sub-pronada Categoria: Performance Cores disponíveis: Preto/laranja Tamanhos: 37 ao 43 Peso: 230g Tecnologias: Triple Density (tecnologia desenvolvida por da variação de densidade dos materiais confeccionados no solado). Esta variação proporciona o alto desempenho do atleta em diversos tipos de terrenos, estabilizando a pisada. Desenvolvido em material impermeável, com dupla e tripla densidade para apoio adicional, evita a pronação leve; Nova ATH Non Torsion, placa estabilizadora e ponte de transição que proporciona estabilidade; ATH Pró Grip, que deixa o solado antiderrapante; maior ventilação com o novo nylon Dupla Frontura. ADVANCED Preço sugerido: R$ 119,00 Tipo de pisada: Pronada/neutra Categoria: Style Cores disponíveis: Preto/prata, chumbo/prata, prata/preto/azul royal, branco/prata/vermelho, branco/preto e preto Tamanhos: 37 ao 44 Peso: 427g Tecnologia: ATH Non Torsion; Pronation Sys, sistema de ângulo de pronação que permite melhor rolamento do pé no toque ao solo. Evita dores na região lombar e articulações; ATH Pró Grip; Oxisys, alta tecnologia de amortecimento de impacto através de cápsula de ar; Triple Density NEW SPIRIT Preço sugerido: R$ 99,90 Tipo de pisada: Sub-pronada Categoria: Running Cores disponíveis: Branco/prata/vermelho, preto/prata/vermelho, branco/champagne, prata/chumbo/royal Tamanhos: 38 ao 43 Peso: 354g Tecnologia: ATH Non Torsion; ATH Max, solado em camada única de EVA, garantindo amortecimento e leveza; ATH Pró Grip; Oxisys; Triple Density

Diadora

SAC: (51) 3065-9900 www.diadora.com.br MYTHOS IMPERIUM II W Preço sugerido: R$ 337,90 Tipo de pisada: Neutra Categoria: Leveza Cores: Prata/vermelho Tamanhos: 34 ao 39 Peso: 400g (fem) / 450g (masc) Indicação de uso: Corridas curtas Tecnologia: A estrutura rígida oferece estabilidade para a parte traseira e protege contra ferimentos no arco do pé. Cria reação a cada flexão do pé, oferecendo maior projeção, impulso e velocidade. A distribuição do peso diminui a pressão da planta do pé. A estrutura em Tech Alloy, uma liga de aço flexível na entresola, devolve a energia de flexão do pé, aumentando a propulsão

41

SUPERAÇÃO


equipamento Fila

SAC: (11) 3818-1699 www.fila.com.br FUTURE Preço sugerido: R$ 299,90 Tipo de pisada: Neutra Categoria: Performance Cores: Laranja Tamanhos: 37 ao 44 (masc) Peso: 380g Indicação de uso: Competição Tecnologia: Cabedal desenvolvido com materiais sintéticos de alta qualidade, proporcionando conforto. Possui tecnologias SuperAction e Flow, que geram amortecimento e troca de ar FLEX Preço sugerido: R$ 159,90 Tipo de pisada: Neutra Categoria: Competição Cores: Branco Iron/Khaki Tamanhos: 37 ao 44 (masc) Peso: 320g Indicação de uso: Treinamento Tecnologia: Modelo feito com materiais sintéticos e metal mesh, garantindo qualidade e durabilidade. Entressola com a tecnologia SuperAction, para amortecimento e absorção de impactos. Solado de borracha 100% natural SPORT Preço sugerido: R$ 149,90 Tipo de pisada: Neutra Categoria: Competição Cores: Prata/preto Tamanhos: 37 ao 44 (masc) Peso: 350g Indicação de uso: Treinamento Tecnologia: Calçado desenvolvido com a combinação de materiais sintéticos e peças aplicadas, propiciando conforto e durabilidade. Entressola com tecnologia SuperAction e placa estabilizadora. Solado de borracha natural

Ironman Track & Field SAC: (11) 3048-1238 www.tf.com.br

42 16

IRONMAN RACING Preço sugerido: R$ 199,00 Tipo de pisada: Neutra/neutra com leve pronação Categoria: Competição, treino Cores: Detalhes em amarelo, cinza e azul Tamanhos: 39 ao 44 Peso: 256g Indicação de uso: Atletas de peso leve, com arcos normais Tecnologia: Possui a Ironshield (estabiliza as passadas e dá suporte à transição da pisada); na região traseira o Vibelock Rear permite que cada movimento tenha tratamento específico e variado de acordo com a pisada; na região posterior o Vibelock Forefoot absorve a energia de impacto e proporciona a flexão natural dos pés, evitando esforços desnecessários; o Vibelock Innersole não permite que a vibração das passadas chegue ao pé do atleta


K-swiss

SAC: (11) 3062-8103 www.kswiss.com.br RUN ONE MISOUL Preço sugerido: R$ 599,00 Tipo de pisada: Neutra a pronadora Tipo de pé: Plano e neutro Categoria: Amortecimento e/ou competição Cores: Branco/ouro/vermelho; azul/prata Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 350g (nº 40) Indicação de uso: Pode ser usado tanto em treinos e provas rápidas, como em corridas de médias e longas distâncias devido ao sistema de palmilhas, que podem ser trocadas de acordo com o tipo de treino Tecnologias: A palmilha indicada para curtas distâncias é constituída de material superleve, o K-Eva, associado ao SUPERFOAM™, que promove alto retorno de energia para os pés durante a passada. Uma placa de fibra de carbono também melhora a propulsão. Para médias e longas distâncias pode-se optar pela palmilha constituída de materiais que priorizam o amortecimento. O principal deles é o gel SI 18™, que protege contra impactos K-ONA Preço sugerido: R$ 439,00 Tipo de pisada: Neutra a pronadora Tipo de pé: Plano e neutro Cores: Branco/ouro/vermelho; azul/prata/vermelho Categoria: Leveza Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 255g (nº 40) Indicação de uso: Triathlon Tecnologias: Tênis oficial do IronMan no Havaí, apresenta a associação das tecnologias de amortecimento Super Foam Tecnology™ e SI 18™. O solado traz cânulas de escoamento de água. Cabedal com sistema Flow cool system™ em toda a extensão, mantendo a temperatura dos pés estável e secos e cadarços com exclusiva tecnologia Stay Tied Laces™, desenvolvidos para agir como ‘garras’, mantendo os laços ou nós firmes KONEJO Preço sugerido: R$ 399,00 Tipo de pisada: Neutra a pronada Tipo de pé: Plano Categoria: Estabilidade Cores: Prata e cinza c/ laranja e cinza e branco c/ azul Royal (masc); prata e cinza c/ laranja e prata e branco c/ azul claro (fem) Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 574g o par (nº 40) Indicação de uso: Corridas, caminhadas e fitness Tecnologia: Amortecimento Superfom™, com tripla densidade. Solado em borracha Aosta II™, com sulcos para aumento de flexibilidade e frenagem, superfície grande para aumento da estabilidade

KEAHOU Preço sugerido: R$ 399,00 Tipo de pisada: Neutra Tipo de pé: Cavo e neutro Categoria: Amortecimento Cores: Branco c/ vermelho e azul claro c/ branco (fem); prata e cinza c/ marinho e azul Royal c/ amarelo (masc) Tamanhos: 34 ao 39 (fem) / 38 ao 46 (masc) Peso: Aproximadamente 600g o par (nº 40) Indicação de uso: Corridas, caminhadas e fitness Tecnologia: Cabedal com tela mesh que proporciona respiração para os pés e couro sintético moldado, proporcionando leveza. O solado possui borracha AOSTA II para mais estabilidade e amortecimento, que também é garantido pelo GUIDEGLIDE™ peças com tripla densidade. O sistema SUPERFOM™ proporciona conforto

43

SUPERAÇÃO


equipamento Mizuno

SAC: São Paulo - (11) 3045-5522 / Outras localidades - 0800 70 70 566 www.mizunobr.com.br CREATION 10 Preço sugerido: R$ 549,99 Tipo de pisada: Neutra/supinada Categoria: Amortecimento Cores: Branco/laranja/prata, branco/verde claro/grafite, branco/azul/marinho, prata/verde/cinza e branco/rosa/ cinza (fem); branco/azul/prata, preto/prata, prata/azul/laranja, branco/vermelho/prata, branco/amarelo/chumbo e prata/marinho/vermelho (masc) Tamanhos: 34 ao 40 (fem) / 38 ao 46 (masc), com meio ponto Peso: 340g (nº 36) / 400g (nº 40) Indicação de uso: Provas de 10km Tecnologia: Gender Engineering (elaborada a partir do biótipo do homem e da mulher). A placa Wave Infinity, responsável pelo amortecimento, sofreu alterações, tornando o calçado mais macio e com a mesma durabilidade (500km sem perder as propriedades iniciais de amortecimento). A nova palmilha anatômica, de dupla densidade, oferece conforto extra aos corredores. NIRVANA 5 Preço sugerido: R$ 499,99 Tipo de pisada: Pronada (leve a moderada) Categoria: Amortecimento Cores: Branco/azul claro/marinho, branco/lavanda e branco/vinho/prata (fem); prata/vermelho/laranja, prata/preto e preto/vermelho/prata (masc) Tamanhos: 34 ao 40 (fem) / 38 ao 46 (masc), com meio ponto Peso: 310g (nº 36) / 365g (nº 40) Indicação de uso: Treinos leves e corridas até 10km Tecnologia: Possui a Gender Engineering. Nesta versão, apresenta pequenas modificações na placa Wave, proporcionando um produto mais leve e confortável PRO RUNNER 12 Preço sugerido: R$ 399,99 Tipo de pisada: Neutra Categoria: Amortecimento Cores: Prata/cinza/rosa, branco/rosa/preto e branco/preto/roxo (fem); branco/azul, prata/laranja/preto, prata/vermelho e prata/azul/laranja (masc) Tamanhos: 34 ao 40 (fem) / 38 ao 46 (masc), com meio ponto Peso: 260g (nº 36) / 320g (nº 40) Indicação de uso: Provas até 10km Tecnologia: Possui a Gender Engineering; Dynamotion Fit, que permite a interação dos movimentos do pé com o calçado; AP (Acceleration Polymer), que minimiza o tempo de transição; Mizuno Intercool (reduz a concentração de calor e umidade) e VS-1 (absorve o impacto e prolonga a duração do amortecimento do calçado de corrida). Cabedal construído em AIRmesh, para maior ventilação e conforto, e solado com borracha carbonada X10, que permite o uso prolongado do calçado em áreas de alto impacto e proporciona mais tração na batida do calcanhar

44 16

INSPIRE 5 Preço sugerido: R$ 379,99 Tipo de pisada: Levemente pronada Categoria: Amortecimento Cores: Branco/verde/prata, branco/rosa/cinza e branco/roxo/amarelo (fem); prata/preto/amarelo, branco/azul/ marinho e branco/vermelho/chumbo (masc) Tamanhos: 34 ao 40 (fem) / 38 ao 46 (masc), com meio ponto Peso: 260g (nº 36) / 320g (nº 40) Indicação de uso: Provas até 10km Tecnologia: Possui a Gender Engineering. É ecologicamente correto, já que parte do material da placa Wave, local do amortecimento do calçado, foi substituída por outra com propriedades biodegradáveis. Também possui a tecnologia Dynamotion Fit, que permite a interação dos movimentos do pé com o calçado por meio de uma construção especial que minimiza o estresse causado no calcanhar


AERO 7 Preço sugerido: R$ 349,99 Tipo de pisada: Neutra Categoria: Leveza, amortecimento Cores: Branco/Pink (fem); branco/marrom (masc) Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 195g (nº 36) / 245g (nº 40) Indicação de uso: Treinos de velocidade e competições até maratona Tecnologia: Desenvolvido para corredores que buscam ganhos de performance. O sistema Wave auxilia na distribuição do impacto das passadas uniformemente por toda a sola. O material do cabedal é confeccionado em tecido especial para melhor absorção de água e transpiração dos pés ELIXIR Preço sugerido: R$ 349,99 Tipo de pisada: Pronada Categoria: Competição Cores: Branco/azul/marinho (fem); branco/vermelho/preto (masc) Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 240g (nº 36) / 260g (nº 40) Indicação de uso: Maratona Tecnologia: O solado do tênis tem pontos especiais de tração na parte frontal, item que garante maior rapidez e estabilidade na transição do movimento das passadas. A sola é constituída pela borracha carbonada X10, que permite o uso prolongado do calçado em áreas de alto impacto e proporr ciona maior tração na batida do calcanhar. A tecnologia Dynamotion Fit, aliada à placa Wave de amortecimento, disponibiliza maior maciez e um melhor encaixe dos pés MUSHA Preço sugerido: R$ 299,99 Tipo de pisada: Neutra ou com pequeno grau de pronação Categoria: Leveza, amortecimento Cores: Amarela/preta/laranja Tamanhos: 38 ao 43 (unissex) Peso: 220g (nº 40) Indicação de uso: Maratona Tecnologia: Muito utilizado por atletas profissionais, é uma das melhores relações peso/ amortecimento do mercado de running, de acordo com o fabricante. O solado possui detalhes estratégicos de borracha com carbono para proporcionar maior tração com o solo

New Balance

SAC: (11) 2196-2401 www.newbalance.com.br

MR 1063 CU / WR 1063 WB Preço sugerido: R$ 499,00 Tipo de pisada: Neutra/supinada Tipo de pé: Normal ou cavo Categoria: Amortecimento Cores: Branco/prata/azul (fem); branco/prata/amarelo e branco/prata/azul (masc) Tamanhos: 34 ao 39 (fem) / 39 a 44 (masc) Peso: 345g (masc) / 270g (fem) Indicação de uso: Treino em rua ou esteira Tecnologia: Possui a Total Fit, que identifica 88 ‘points of fit’, resultando na construção de modelos cuja fôrma, design e tecnologias de cabedal, entressola e solado proporcionam o melhor fit do mercado, segundo o fabricante. A Conona Phanton Liner é a forração interna e sem costuras em tecido à base da casca do coco. O Abzorb DTS 2.0 é a tecnologia de amortecimento e absorção de impacto desenvolvida especialmente para corredores

45

SUPERAÇÃO


equipamento MR 750 WR / WR 750 WB Preço sugerido: R$ 279,00 Tipo de pisada: Neutra Tipo de pé: Normal Categoria: Amortecimento Cores: Branco/prata/azul (fem); branco/vermelho (masc) Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 257g (fem) / 328g (masc) Indicação de uso: Treino Tecnologias: Total Fit, cabedal com Air Mesh, Dual Density Collar (tecido leve e com trama aberta), N-Lock (sistema de amarração que envolve o pé, aumenta a firmeza e o conforto e minimiza a movimentação interna), Phanton Liner, Sure Lance (atacador que não desata durante a corrida) e Lightning Dry (facilita a transferência de suor e da umidade), além de entressola com Abzorb SBS

MR 769 SB / WR 769 ST Preço sugerido: R$ 349,00 Tipo de pisada: Pronada leve Tipo de pé: Plano Categoria: Estabilidade Cores: Branco/prata/vermelho (fem); branco/prata/azul (masc) Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 270g (fem) / 340g (masc) Indicação de uso: Treino em rua ou esteira Tecnologias: Total Fit, cabedal com refletivos em 360, Air Mesh, Dual Density Collar, N-Lock, Phanton Liner e Sure Lance, além de entressola com Abzorb (planta do pé), Abzorb DTS 1.0 (calcanhar), Stability Web (evita a flexão medial do calçado) e TS2 (minimiza a rotação exagerada do pé)

MR 904 LW / WR 904 LW Preço sugerido: R$ 349,00 Tipo de pisada: Neutra Tipo de pé: Normal Categoria: Leveza Cores: Branco/laranja (fem); preto/amarelo (masc) Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 230g (fem) / 280g (masc) Indicação de uso: Treino e competições Tecnologias: Possui a tecnologia Total Fit, cabedal com Lightweiight Air Mesh, Dual Density Collar, Lightning Dry, N-Lock, Phanton Liner e Sure Lance, além de entressola com Abzorb (calcanhar), Stability Web e TS2

MR 827 SR / WR 827 SB Preço sugerido: R$ 249,00 Tipo de pisada: Neutra Tipo de pé: Normal Categoria: Leveza Cores: Branco/azul turquesa (fem); branco/vermelho (masc) Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 217g (fem) / 277g (masc) Indicação de uso: Treino e competições Tecnologias: Possui a tecnologia Total Fit, cabedal com Air Mesh, refletivos em 360, Dual Density Collar, Lightning Dry, N-Lock e Sure Lance, além de entressola: Abzorb (calcanhar + planta do pé) e Stability Web

46 16


Nike

SAC: Grande São Paulo – (11) 5504-6644 / Outros Estados: 0800 703 6453 www.nikevoce.com.br VOMERO+4 (masculino) Preço sugerido: R$ 499,90 Tipo de pisada: Neutra/supinada Tipo de pé: Cavo ou normal Categoria: Amortecimento Cores: Cinza e azul; cinza e laranja; cinza e vermelho Tamanhos: 6 ao 15 Peso: 351g (nº 42) Indicação de uso: Treinos e provas de 5km a maratonas Tecnologias: A entressola em cushlon foi retrabalhada para oferecer maior estabilidade. Melhor relação ‘amortecimento x estabilidade’. O painel elástico do cabedal oferece maior ajuste ao pé do corredor. Cabedal em mesh; entressola em cushlon com sistema de amortecimento zoom air no calcanhar e planta do pé; BRS1000; Solado Waffle; compatível com sistema Nike+ VOMERO+4 (feminino) Preço sugerido: R$ 499,90 Tipo de pisada: Neutra ou supinadoraa Tipo de pé: Cavo e normal Categoria: Amortecimento Cores: Cinza com lilás, cinza com azul. A partir de FA09, três cores: cinza com amarelo, cinza com rosa, preto Tamanhos: 5.5 ao 12 Peso: 277g (nº 38) Indicação de uso: Treinos e provas de 5km a maratonas Tecnologia: Semelhante ao modelo masculino

Rainha

SAC: São Paulo - (11) 3045-5522 / Outras localidades - 0800 70 70 566 RAY Preço sugerido: R$ 99,99 Tipo de pisada e de pé: Neutra / Neutro Categoria: Amortecimento Cores: Prata/roxo, branco/roxo, prata/vinho, preto/prata, branco/rosa/cinza, preto/azul (fem); cinza/ chumbo e preto/prata (masc) Tamanhos: 34 ao 39 (fem) / 38 ao 43 (masc) Peso: 300g Indicação de uso: Caminhadas leves e corridas de baixa intensidade Tecnologia: Cabedal em tecido aerado e sobreposição de tela metalizada nas laterais RADIANT Preço sugerido: R$ 99,99 Tipo de pisada: Neutra Tipo de pé: Neutro Categoria: Estabilidade Cores: Preto/lilás, prata/violeta, chumbo/pink/prata, prata/lilás, preto/prata, prata/azul claro, prata/branco/azul, prata/chumbo/azul, preto/azul, branco/prata/vermelho Tamanhos: 34 ao 39 Peso: 265g Indicação de uso: Caminhadas leves e corridas de baixa intensidade Tecnologia: Tênis exclusivamente feminino com fôrma especial. Seu cabedal aerado facilita a respiração dos pés. Possui sistema de amortecimento com combinação de EVA de densidade diferenciada com uma placa estabilizadora que se estende até o meio do tênis

47

SUPERAÇÃO


equipamento Olympikus

SAC: 0800 728 2010 www.olympikus.com.br TERÁ ONE Preço sugerido: R$ 249,00 Tipo de pisada: Neutra Tipo de pé: Neutro Categoria: Amortecimento, performance Cores: Branco e rosa; branco e lilás (fem); branco e verde; branco e ouro; branco e vermelho e preto; prata Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 392g Indicação de uso: Provas de 5km até meia maratona Tecnologia: Utiliza a exclusiva tecnologia Tube Tech, que tem como principal característica o amortecimento de impacto, presente no calcanhar e na planta do pé

Reebok

SAC: (85) 3336-0819 / 3336-1442 www.reebok.com.br SELECTRIDE Preço sugerido: R$ 599,90 Tipo de pisada: Neutra Tipo de pé: Neutro Categoria: Amortecimento Cores: Cinza/roxa; branco/verde (fem) / preto/vermelho (masc) Tamanhos: 34 ao 39 (fem) / 37 ao 44 (masc) Peso: 290g (nº 36) / 340g (nº 40) Indicação de uso: Corridas de 5km a 10km Tecnologia: Possui sistema de amortecimento que funciona da seguinte forma: optando por RUN, após algumas passadas o atleta sente o tênis inflar, aumentando assim a capacidade de amortecimento. Se preferir TRAIN, o tênis fica mais baixo e adequado para treinos rápidos e laterais – evita torções e garante conforto

PREMIER SMOOTHFIT CUSHION Preço sugerido: R$ 399,90 Tipo de pisada: Neutra Tipo de pé: Neutro Categoria: Leveza, conforto Cores: Azul claro; azul escuro; preto Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 390g (nº 40) Indicação de uso: Corridas de 5km a 10km Tecnologia: SmoothFit (acabamento sem costura, o que reduz o atrito com a pele). Possui tecnologia de amortecimento DMX FOAM. A entressola em IMEVA proporciona mais conforto e o solado em borracha DMPRTEK garante durabilidade e tração

48 16

PREMIER TRINITY III Preço sugerido: R$ 399,90 Tipo de pisada: Pronada moderadaa Tipo de pé: Plano Categoria: Estabilidade, amortecimento Cores: Verde; verde água Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 340g (nº 40) Indicação de uso: Corridas de 5km a 10km Tecnologia: Conta com sistema ajuste KineticFit que oferece conforto, suporte e flexibilidade, além de material 3M Scotchlite, que garante maior segurança nas corridas noturnas. O forro interno é confeccionado com a tecnologia PLAY DRY para controle de umidade; palmilha de PU removível; amortecimento DMX FOAM e solado 3D Plus - tração e amortecimento


PREMIER ULTRA KFS VI Preço sugerido: R$ 369,90 Tipo de pisada: Neutra/supinada Tipo de pé: Cavo Categoria: Amortecimento, leveza Cores: Azul; verde água; rosa Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 390g (nº 40) Indicação de uso: Corridas de 5km a 10km Tecnologia: Conta com o sistema de ajuste KineticFit; possui memória ativa com função de ajuste perfeito do calçado ao formato do pé. O cabedal é desenvolvido em malha sintética ideal para as corridas noturnas. Conta ainda com as tecnologias de amortecimento DMX SHEAR e DMX FOAM, forro interno em PLAY DRY, que controla a umidade; a entressola em CMEVA (maior estabilidade), palmilha de EVA removível e solado de borracha DMPRTEK que oferece maior durabilidade e tração PREMIER ROAD PLUS Preço sugerido: R$ 369,90 Tipo de pisada: Pronada Tipo de pé: Plano Categoria: Estabilidade Cores: Laranja Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 390g (nº 40) Indicação de uso: Corridas de 5km a 10km Tecnologia: Sistema KineticFit, tecnologia que fornece conforto, apoio e flexibilidade em áreas críticas do pé. A forma em EVA de comprimento integral acrescenta conforto e amortecimento. Espuma DMX para ajudar no amortecimento

PREMIER VERONA KFS Preço sugerido: R$ 369,90 Tipo de pisada: Neutra Tipo de pé: Neutro Categoria: Leveza Cores: Vermelho/amarelo Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 340g (nº 40) Indicação de uso: Corridas de 5km a 10km Tecnologia: DMX FOAM, que garante amortecimento e estabilidade. O sistema KineticFit oferece conforto, suporte e estabilidade. O cabedal é desenvolvido em malha com trançado aberto – suporte e ventilação. A palmilha de PU ajuda no amortecimento e conforto. O forro interno em PLAY DRY controla a umidade. As ranhuras frontais garantem flexibilidade e a parte traseira do tênis é desenvolvida em borracha de carbono – maior tração e durabilidade

Saucony

SAC: (11) 3897-8808 www.saucony.com.br / info@saucony.com.br GRID FASTWITCH 3 Preço sugerido: R$ 399,90 Tipo de pisada: Pronada Tipo de pé: Plano Categoria: Competição Cores: Laranja/marinho Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 176g Indicação de uso: Corridas de 5km a meia maratona Tecnologia: A construção do cabedal é feita com o tecido tecnológico Dry-lex, que consiste em três camadas, pelas quais o suor do pé é conduzido e dissipado. Possui amortecimento Dual Density SSL EVA e solado com borracha de carbono, que melhora a tração TYPE A2 Preço sugerido: R$ 349,90 Tipo de pisada: Neutra Tipo de pé: Neutro Categoria: Performance Cores: Branco/azul Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 167g (fem) / 196g (masc) Indicação de uso: Corridas de 5km a meia maratona Tecnologia: Com solado baixo, amortecimento em EVA e sistema drenante na sola que elimina a água. Material da sola produzido em borracha expandida de carbono, leve e com melhores propriedades de tração que não comprometem a durabilidade. Entressola em EVA

49

SUPERAÇÃO


equipamento PROGRIDTM PARAMOUNT Preço sugerido: R$ 729,00 Tipo de pisada: Neutra / levemente pronada Tipo de pé: Neutro Categoria: Leveza, estabilidade Cores: Branco/prata (fem); branco/dourado (masc) Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 280g (fem) / 373g (masc) Indicação de uso: Corridas de todas as distâncias Tecnologia: Flexion Plate, plataforma de TPU (Poliuretano Termoplástico) resistente a impactos, que guia o movimento de transição do calcanhar até os dedos. O sistema de amortecimento é feito através do Full Length ProGrid™, um entrelaçado de Hytrel (um tipo de elastômero super resistente) por toda a extensão do solado. O cabedal tem tecido que regula a temperatura interna e a tecnologia Arch-Lock™, que mantém o pé firme na posição da entressola

PROGRIDTM TRIUMPH 5 Preço sugerido: R$ 499,90 Tipo de pisada: Neutraa Tipo de pé: Neutro Categoria: Amortecimento Cores: Prata/azul claro; branco/dourado (fem); preto/vermelho; azul/branco (masc) Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 268g (fem) / 323g (masc) Indicação de uso: Corridas de todas as distâncias Tecnologia: Sistema de absorção de impacto ProGridTM por toda a extensão do solado, que proporciona uma transição de passada mais suave. Aliado a isso, a combinação de EVA de dupla densidade na sola minimiza o choque na fase de ataque e maximiza a propulsão no final da passada. Possui o sistema Arck-LockTM, um arco na parte interna do cabedal que proporciona maior estabilidade e sustentação do pé

TOPPER

SAC: (11) 3045-5522 / 0800 70 70 566 www.topper.com.br FAST Preço sugerido: R$ 139,99 Tipo de pisada: Todas Tipo de pé: Todos Categoria: Amortecimento Cores: Branco/marinho/verde; chumbo/prata/vermelho; preto/prata/vermelho Tamanhos: 34 ao 43 Peso: 300g (nº 40) Indicação de uso: Eventual Tecnologia: Confeccionado em náilon e laminado. Possui sistema de amortecimento Dynatech, que contribui na performance e estabilidade. A placa estabilizadora protege o atleta contra lesões

50 16

IRON Preço sugerido: R$ 149,99 Tipo de pisada: Neutra Tipo de pé: Neutro Categoria: Caminhada/corrida casual Cores: Branco/lilás/roxo e prata/azul (feminino) e branco/marinho, prata/chumbo/vermelho e preto/prata (masculino). Tamanhos: 34 ao 43 Peso: 300g (nº 40) Indicação de uso: Corridas eventuais Tecnologia: Possui microperfurações para proporcionar maior conforto, respiração e ventilação dos pés, além do sistema de amortecimento Dynatech, que oferece leveza e estabilidade, resultando na melhoria da performance


mural sa Fábio Ura/ZDL

O ex-jogador de futebol Cafu e atletas cadeirantes na Maratona de São Paulo

Fábio Ura/ZDL

Integrantes da Equipe Fôlego na Maratona de São Paulo: Felipe Diniz, Rogério Sampaio, Juliana Didone, Flávia Freire, Cafu, Marcos Gomes, Gustavo Borges, Hortência, Caio Ribeiro, Juninho Paulista e José Rubens D’Elia

Equipe Garra, do Professor Daniel Biscola

Fábio Ura/ZDL

A Equipe Vida Corrida: Tande, Rodolfo Mattheis, Olivier Cozan, Mariana Brochado, Smigol, Adriana Samuel, Tico Santa Cruz, Tiago Gomes, Fabiola da Silva e Clayiton Conservani

51

SUPERAÇÃO


troféu brasil

ATLETISMO EM

ALTO NÍVEL 52 16


BM&F Bovespa conquista o oitavo título consecutivo do Troféu Brasil, que teve, na edição 2009, recordes e grandes desempenhos dos atletas BM&FBOVESPA/Divulgação

A

forte disputa entre as equipes BM&F Bovespa e Rede Atletismo elevou o nível e garantiu a quebra de recordes na 28ª edição do Troféu Brasil, disputado entre maio e junho, em Bragança Paulista (SP) e no Rio de Janeiro (RJ). Destaque para a saltadora Fabiana Murer, que conquistou, no Estádio Olímpico João Havelange, o Engenhão, o novo recorde sul-americano e melhor marca internacional do ano até então. Junto dela, outros oito atletas melhoraram tempos e distâncias, sendo um recorde brasileiro (Júlio César de Oliveira, no dardo) e sete do evento. No meio de tanta competitividade, melhor para a BM&F Bovespa, campeã pela oitava vez consecutiva. Rei das provas de fundo do Brasil já há algum tempo, Marílson Gomes dos Santos juntou mais dois ouros para sua galeria de medalhas no Troféu Brasil, além do título de melhor atleta masculino do torneio. Mesmo com os treinos focados na maratona, não faltou velocidade para o brasiliense, que quebrou o recorde do evento para vencer os 5.000m com 13min34s79, superando a antiga marca que já durava 16 anos, de Ronaldo da Costa (13min37s37, em 1993). O atleta ainda conseguiu o índice para o Mundial em agosto, mas deverá disputar apenas os 42km na Alemanha. “Estou muito feliz com o resultado. Foi a primeira vez que competi no Engenhão após os Jogos Pan-Americanos. Esperava fazer uma boa prova e bater o recorde da competição, além de ajudar minha equipe na pontuação.” O segundo colocado, Ubiratan dos Santos, cruzou a linha de chegada quase 20 segundos depois (13min52s34), deixando o terceiro posto para Damião de Souza, com 13min56s20. O bicampeão da maratona de Nova Iorque ainda viria a vencer a prova dos 10.000m, novamente com ampla vantagem e melhorando o recorde do TB, que já era seu. Marílson marcou 27min58s83 após fazer a passagem dos 5.000m num ritmo forte, em 13min57s32. “Terminar os 10.000m abaixo dos 28 minutos, no Brasil, mostra que a prova foi muito

Classificação geral por equipes 1º BM&F Bovespa 2º Rede Atletismo 3º EC Pinheiros ASICS 4º ORCAMPI UNIMED 5º Santa Mônica Rio 6º Futuro Olímpico 7º Metodista São Bernardo 8º UNISC 9º ASA-Sertãozinho Estrela Guarulhos

777 pontos 720 pontos 114 pontos 51 pontos 39 pontos 38 pontos 33 pontos 28 pontos 27 pontos 27 pontos

forte”, destacou. Damião de Souza, em seu primeiro Troféu Brasil, conseguiu melhorar uma posição em relação aos 5.000m e foi segundo (28min28s94). Daniel Chaves da Silva foi o terceiro (28min49s42). No feminino, Cruz Nonata da Silva ultrapassou Luzia de Sousa Pinto, que liderou grande parte dos 10.000m, na última volta para vencer com 33min02s65. “Todos os dias eu dizia para mim mesma que, depois da segunda colocação em 2008,

53

SUPERAÇÃO


trofĂŠu brasil

eu iria vencer este ano. Treinei muito e alcancei meu objetivoâ€?, contou Nonata, que dedicou a vitĂłULDDRVÂżOKRV-RVp$OH[DQGUHH$OHVVDQGUDGHH 13 anos. Luzia teve que se contentar com a prata (33min06s10). “NĂŁo deu para acompanhar a chegaGDGD&UX]PDVHVWRXIHOL]SRUTXHÂż]XPDERDFRUULdaâ€?, ressaltou. Sueli Pereira Silva, com 34min18s22, completou o pĂłdio. Cruz voltaria a repetir o resultado nos 5.000m, completando o percurso em 16min21s41 para bater Fabiana Cristine da Silva, que fez 16min34s15. Luzia de Souza Pinto foi outra que voltou ao pĂłdio ao terminar em terceiro, com 16min38s85. Nas distâncias de 800m a 3.000m com obstĂĄculos, destaque para Sabine LetĂ­cia Heitling, vencedora dos 3.000m e dos 1.500m, e Fabiano Peçanha, que levou os 1.500m e conseguiu a prata nos 800m. A campeĂŁ pan-americana se mostrou pĂŠ-quente no EngenhĂŁo e se tornou bicampeĂŁ do TB. Ela venceu com 10min05s93 e, apesar da grande vantagem para a segunda colocada, (PatrĂ­cia Fernanda Lobo fechou com 10min30s08 e Michelle Barreto da Costa com PLQV  ÂżFRX EHP DFLPD GR tQGLFH SDUD R Mundial - 9min40. “A Zenaide Vieira, minha maior adversĂĄria, nĂŁo participou da prova devido a uma contusĂŁo. Isso acabou diminuindo o meu ritmo. É

importante tĂŞ-la na pista, uma eleva a performance da outraâ€?, concluiu. A atleta ainda terĂĄ pelo menos mais duas chances para garantir a vaga. Sabine nĂŁo pĂ´de se queixar, contudo, de falta de concorrĂŞncia nos 1.500m, quando teve que se esforçar para superar Christiane Ritz na Ăşltima volta. “A prova foi bem concorrida e jĂĄ tinha me dado por vencida quando pensei melhor e decidi tentar mais uma vez; foi quando consegui superar Christiane,â€? admitiu a campeĂŁ com o tempo de 4min22s71. A Christiane coube se contentar com a prata (4min22s99), com Zenaide Vieira em terceiro (4min23s65). Nos 3.000m com obstĂĄculos masculino, melhor para Fernando Alex Fernandes, que venceu apĂłs 8min44s32, numa disputa acirrada com Gladson Barbosa, prata com 8min44s64. Celso Ficagna tambĂŠm chegou prĂłximo, com 8min45s32. Fabiano Peçanha, por sua vez, nĂŁo apenas venceu os 1.500m, como tambĂŠm foi o responsĂĄvel por uma das grandes zebras da competição ao superar Hudson de Souza, dono dos recordes sul-americano, brasileiro e do TB na prova. Peçanha ultrapassou Hudson na Ăşltima volta para cruzar a linha de chegada com 3min46s22, enquanto o medalhista de prata marcou 3min46s59. “EstĂĄ sendo o melhor ano da minha carreiraâ€?, comemorou o vencedor. O terceiro

Resultados de fundo e meio-fundo 10.000m masculino 1Âş Marilson dos Santos (BM&F Bovespa) - 27min58s83 2Âş DamiĂŁo de Souza (PĂŠ de VentoPetrĂłpolis) - 28min28s94 3Âş Daniel da Silva (BM&F Bovespa) 28min49s42 10.000m feminino 1Âş Cruz Nonata da Silva (BM&F Bovespa) - 33min02s65 2Âş Luzia de S. Pinto (Rede Atletismo) 33min06s10 3Âş Sueli Silva (JataĂ­) - 34min18s22 5.000m masculino 1Âş Marilson dos Santos (BM&FBovespa) - 13min34s79 2Âş Ubiratan dos Santos (Rede Atletismo) - 13min52s34 3Âş DamiĂŁo de Souza (PĂŠ de Vento) 13min56s20 5.000m feminino 1Âş Cruz N. da Silva (BM&F Bovespa) 16min21s41

54 16

2º Fabiana C. da Silva (BM&F Bovespa) - 16min34s15 3º Luzia de S. Pinto (Rede Atletismo) 16min38s85 3.000m com obståculos masculino 1º Fernando Fernandes (Rede Atletismo) - 8min44s32 2º Gladson Barbosa (EC Pinheiros ASICS) - 8min44s64 3º Celso Ficagna (BM&F Bovespa) 8min45s32 3.000m com obståculos feminino 1º Sabine Heitling (UNISC) 10min05s93 2º Patrícia F. Lobo (EC Pinheiros ASICS) - 10min30s08 3º Michelle B. da Costa (Rede Atletismo) - 10min34s44 1.500m masculino 1º Fabiano Peçanha (EC Pinheiros ASICS) - 3min46s22 2º Hudson de Souza (BM&F Bovespa) -

3min46s59 3º Eder Uillian O. da Silva (Rede Atletismo) - 3min46s71 1.500m feminino 1º Sabine Heitling (UNISC) - 4min22s71 2º Christiane Ritz (Rede Atletismo) 4min22s99 3º Zenaide Vieira (Rede Atletismo) 4min23s65 800m masculino 1º KlÊberson Davide (Rede Atletismo) 1min46s42 2º Fabiano Peçanha (EC Pinheiros ASICS) - 1min46s82 3º Fernando da Silva (Rede Atletismo) 1min47s63 800m feminino 1º Josiane Tito (Rede Atletismo) 2min03s85 2º Christiane Ritz dos Santos (Rede Atletismo) - 2min04s94 3º Perla dos Santos (BM&F Bovespa) - 2min06s16


BM&FBOVESPA/Divulgação

Oliveira, que superou o recorde brasileiro do lançamento de dardo, que durava quase nove anos, por FP2DWOHWDDOFDQoRXPHDLQGDVHFODVVL¿cou para seu terceiro Mundial adulto. TambÊm caíram nada menos que sete marcas do TrofÊu Brasil: alÊm de Marílson nos 5.000m, Fåbio Gomes da Silva conseguiu 5,55m no salto com vara; Gisele de Oliveira saltou 14,16m no triplo; Lucinana França fez 55s90 nos 400m s/ barreiras; a equipe da BM&F do revezamento 4x100m conseguiu a marca de 43s35; JosÊ Alessandro Bagio marcou 1h26min31 e Tânia Regina Spindler fez 1h37min31 na marcha atlÊtica de 20km. Todas estas provas foram realizadas no Engenhão. O decatlo, heptatlo e lançamento de martelo ¿]HUDPSDUWHGDSULPHLUDIDVHGRHYHQWRGLVSXWDGD entre 30 e 31 de maio, em Bragança Paulista (SP).

Equipes foi Eder Uillian da Silva, com 3min46s71. Nos 800m, a disputa foi tambÊm intensa, com a vitória de KlÊberson Davide (1min46s42), seguido de perto por Peçanha (1min46s82), após os dois terem corrido juntos o tempo todo. O terceiro foi Fernando da Silva, com 1min47s63. No feminino, vitória para Josiane Tito, que marcou 2min03s85, contra 2min04s94 de Christiane Ritz dos Santos e 2min06s16 de Perla dos Santos.

Chuva de recordes As provas de saltos eram as mais esperadas depois dos ótimos resultados internacionais de Fabiana Murer, Maurren Maggi e Jadel Gregório nas últimas temporadas. Fabiana não decepcionou, superando em dois centímetros seu próprio recorde sul-americano, de 2008, ao saltar 4,82m e ainda registrar a melhor marca do ano, que era da norteamericana Jennifer Stuczynski, que fez 4,81m. De quebra, a paulista foi eleita a melhor atleta feminina da competição. Nos saltos em distância, Keila Costa superou 0DXUUHQSRUFHQWtPHWURV PDP H¿FRX FRP R RXUR 1R WULSOR -DGHO FRQ¿UPRX R IDYRULtismo e venceu com 16,96m. O resultado garantiu, além dos 21cm de vantagem para o segundo colocado, Jefferson Sabino, a vaga para Berlim. Quem também se destacou foi Júlio César de

AlĂŠm das disputas dentro da pista, esta edição do TB contou com um ‘pega’ emocionante pelo tĂ­tulo por equipes entre BM&F Bovespa e a Rede AtletisPR1RÂżQDOD%0 )YHQFHXSRUSRQWRVD Para se ter uma ideia da intensidade da ‘briga’, a terceira colocada, Pinheiros, marcou apenas 114. Completaram os cinco primeiros colocados as equipes Orcampi Unimed (51) e Santa MĂ´nica Rio (39). A alta competitividade foi comemorada pelo presidente da CBAt, Roberto Gesta de Melo. “HĂĄ muito tempo nĂŁo vĂ­amos um TrofĂŠu Brasil tĂŁo forte. Tivemos vĂĄrios recordes na competição e vibrante disputa entre a BM&F Bovespa e a Rede. No total, tivemos 751 atletas, de 105 clubes de 18 estados e do Distrito Federal. E vale citar que nada menos que 52 equipes marcaram pontos no EngenhĂŁo, no grande evento atlĂŠtico do calendĂĄrio nacional.â€? A rivalidade com a Rede, que tem dois anos, deu tom especial Ă  vitĂłria, segundo o diretor-tĂŠcnico da equipe BM&F, SĂŠrgio Coutinho Nogueira. “No ano passado fomos surpreendidos por uma boa atuação da Rede e pelo assĂŠdio aos nossos atletas. VĂĄrios GHOHVUHFHEHUDPSURSRVWDVÂżQDQFHLUDVLUUHFXViYHLV SubstituĂ­mos alguns tĂŠcnicos que saĂ­ram, contratamos outros, reestrututramos o nosso trabalho e tudo deu certoâ€?, avaliou Nogueira. Foi a vitĂłria da competĂŞncia, da ĂŠtica, da uniĂŁo e sobre o dinheiroâ€?, acrescentou o tĂŠcnico-chefe da equipe, Ricardo D’Angelo, que levou 88 atletas ao Rio e somou 61 medalhas: 27 de ouro, 19 de prata e 15 de bronze.

55

SUPERAĂ‡ĂƒO


10k Fotos: Fernando Pilatos/VIPCOMM

Reebok 10KM

A corrida ajudou a aquecer o frio da noite de 20 de junho

A

56 16

QRLWHJHODGDTXHDQWHFHGHXRLQtFLRRÂżFLDO do Inverno no Brasil foi de bastante agitação para 3 mil atletas da corrida Reebok 10KM, que lotaram as ruas da Cidade UniverstiĂĄria, em SĂŁo Paulo, no dia 20 de junho. A marca esportiva promoveu um grande evento, com a participação de professores da Reebok Sports Club realizando o alongamento antes da prova, alĂŠm de muito som e show de luzes. Um ‘corredor humano’, com gritos de apoio e aplausos foi um incentivo a mais aos participantes, que nĂŁo se incomodaram com a temperatura na casa dos 14ÂşC. Na disputa dos 10km, um pelotĂŁo com cinco atletas tomou a dianteira da prova atĂŠ o km 4, quando Adriano Bastos e FĂĄbio Nascimento iniciaram um duelo particular, que durou atĂŠ o km 7,5. Com um ritmo forte, Bastos assumiu a liderança e cruzou a linha de chegada com 31min36, 14 segundos Ă  frente de Nascimento (31min50). “Adoro participar de provas noturnas pelo clima de festa, a mĂşsica envolvida e as atraçþes que dĂŁo uma cara diferente ao evento e conseguem interagir de uma forma motivadora com os participantesâ€?, disse o campeĂŁo. FĂĄbio Nascimento festejou a segunda colocação. “Estou satisfeito com o resultado. O REMHWLYR HUD HVWDU QR SyGLR´ DÂżUPRX 2 FRUUHGRU Caio da Rocha Silva terminou em terceiro lugar,

A Reebok 10 KM contou tamb ĂŠm com uma corrida de 5km

com 32min14. Na disputa feminina dos 10km, vitĂłria da atleta Beatriz Nascimento, que impĂ´s um bom ritmo e chegou tranquila Ă  linha de chegada, com 38min16 - e mais de um minuto de vantagem para a segunda colocada, Rosângela Figueiredo Silva (39min19). “Foi um resultado muito bom para mim. Meu objetivo ĂŠ melhorar cada vez maisâ€?, disse a vencedora. O pĂłdio teve ainda a presença de Silvia Moreira Lopes Ribeiro, com 40min05, na terceira posição. Simultaneamente ao evento de 10km, houve a realização da corrida de 5km, vencida por FĂĄbio Silva Leite (19min17), no masculino, e Vera LĂşcia Souza (23min04), no feminino. “Foi uma prova forte e rĂĄpida. O fato de ser Ă  noite ĂŠ muito legal. Foi muito bem organizadaâ€?, elogiou Silva.


100k Voga Assessoria/Divulgação

Volta do Lago

M

ais de 2 mil atletas encararam, no dia 21 de junho, a disputa da 6ÂŞVolta do L ago, em BrasĂ­lia, prova de 100km que pode ser disputada em grupos ou individualmente. Os atletas que largam do Cine Centro SĂŁo Francisco, no EixĂŁo Sul, percorrem 14 trechos que incluem pontos turĂ­sticos famosos da cidade, como a Ponte K ,J a Ermida oDm Bosco e a Concha AcĂşstica. eD acordo com AntĂ´nio Bastos JĂşnior, organizador do evento, o trajeto explora bem o potencial dos competidores, com trechos de subida, estrada de terra e declives. a turma dos ‘malucos’, que encaram os D 100km na categoria solo, o goiano FĂĄbio Santos, 43 anos, garantiu o bicampeonato. Apresentando um ritmo forte, o atleta bateu seu prĂłprio recorde na prova em mais de 40 minutos, fechando o percurso em 7h48min10 - ele venceu no ano passado com 8h32min48. Mas engana-se quem pensa que ele teve moleza na reta de chegada. oLgo atrĂĄs, com 7h49min20, chegou Juvam Palmeira, enquanto 0DUFRV+RÂżJJDUDQWLXRWHUFHLUROXJDUGRSyGLR (10h10min22). Ao todo, 20 homens e cinco mulheres encararam a disputa individual.

A prova pĂ´de ser disputa por equipes mistas compostas por dois, trĂŞs, quatro, seis ou oito competidores, alĂŠm de quartetos masculino e feminino. Com o tempo de 5h46min31, o time Gran Cursos foi o primeiro a completar o desaÂżR3RXFRPDLVGHGRLVPLQXWRVGHSRLVDHTXLpe Supercei/Poupex/D almo iRbeiro/Ida garantiu o vice-campeonato (5h48min40), enquanto o outro time da Gran Cursos/Free Corner aca bou em terceiro lugar (6h04min53).

A paisagem digna de cartĂŁo-postal da Ponte JK inspirou os atletas, que depois fizeram a festa no pĂłdio (acima)

58 16


Benefícios da linhaça para atletas

T

odo atleta necessita de uma alimentação balanceada. Frequentemente, estes indivĂ­duos sĂŁo expostos a situaçþes que ‘estressam’ o organismo, sendo necessĂĄrio fazer uma reposição adequada, nĂŁo sĂł das energias perdidas em forma de macronutrientes (carboidrato, proteĂ­na e gordura), mas tambĂŠm em vitaminas e minerais. A semente de linhaça ganhou destaque entre os alimentos chamados de funcionais, pois traz diversos benefĂ­cios Ă  saĂşde, como o auxĂ­lio na prevenção e redução de doenças, alĂŠm de satisfazer as recomendaçþes nutricionais. Isso porque tem um alto conteĂşdo de ĂĄcidos graxos Ă´mega-3, lignana e ÂżEUDV WRWDLV RV TXDLV VmR EHQpÂżFRV QD UHGXomR GRV fatores de risco para doenças como, por exemplo, cardiovasculares, ao reduzir o colesterol, e câncer. Para o atleta, este alimento pode trazer uma sĂŠrie de EHQHItFLRVGHQWUHHOHVDDomRDQWLQĂ€DPDWyULDGHYLGR Ă  presença de ĂĄcidos graxos essenciais, denominados como Ă´mega 3. Estes ĂĄcidos sĂŁo gorduras chamadas de poliinsaturadas, que ajudam a proteger o coração, jĂĄ que sĂŁo antioxidantes com potente ação contra a formação de placas de ateroma, alĂŠm de reforçar o VLVWHPD LPXQROyJLFR UHGX]LU LQĂ€DPDo}HV DWXDU QD redução do colesterol total e triglicĂŠrides e, ainda, retardar a coagulação sanguĂ­nea. Pelo atleta estar em constante desgaste, esse tipo de gordura poderia auxiliar na diminuição dos impactos do exercĂ­cio. AlĂŠm disso, a linhaça possui na sua composição FRPSRVWRV DVVRFLDGRV jV ÂżEUDV FRQKHFLGRV FRPR lignanas, que desempenham um papel de prevenção de cânceres de mama, de prĂłstata, de cĂłlon e de pulmĂŁo. Existem dois tipos de lignanas: enterodiol e enterolactona, ambas formadas no trato gastrointestinal pela ação de bactĂŠrias. A linhaça ĂŠ a maior fonte de precursores de lignanas em alimentos. A semente de linhaça ainda contĂŠm vitaminas B1, B2, C, E e caroteno, e minerais como ferro, zinco, potĂĄssio, magnĂŠsio, fĂłsforo e cĂĄlcio. Sendo que estes micronutrientes (vitaminas e minerais) desempenham uma sĂŠrie de funçþes, entre elas estruturais (geram a estrutura da formação de ossos e dentes), funcionais (participam na manutenção do ritmo cardĂ­aco, na contratilidade muscular, condutividade neural e no equilĂ­brio ĂĄcido bĂĄsico do organismo) e reguladoras (agem como parte importante das enzimas e dos KRUP{QLRV TXH PRGLÂżFDP H UHJXODP D DWLYLGDGH GDV

NUTRIĂ‡ĂƒO Dra. Tânia Rodrigues R

cÊlulas do nosso organismo). Todos os benefícios da linhaça se potencializam quando a semente Ê moída ou triturada, pois como a casca da semente Ê muito dura, sua digestão Ê comprometida, podendo passar direto pelo trato gastrointestinal, reduzindo a absorção de seus nutrientes. O consumo da semente de linhaça pode ocorrer de diferentes formas. Pode ser utilizada no complemento de inúmeras preparaçþes: pães, bolos, biscoitos, cereais e bebidas, e atÊ adicionadas a sucos, frutas, saladas, sobremesas, iogurtes e sopas. Existem vårias formas e receitas diferentes para começar a consumir esse alimento essencial para quem busca uma vida mais saudåvel. Composição nutricional da linhaça (por 100g): Nutriente Quantidade Calorias 333 cal Proteínas 22g Carboidratos 10,1g Gorduras 36,2g Fibras 21,94g Colesterol 0g Ômega-3 16,51g Ômega-6 5,74g Vit. A 18,47 UI Vit. E 28,2 UI Vit. B1 0,6mg

Nutriente Vit. B6 Vit. B12 PotĂĄssio SĂłdio MagnĂŠsio FĂłsforo Ferro Cobre Zinco ManganĂŞs SelĂŞnio

Quantidade 0,86mg 1,65mg 777mg 253mg 3270mg 6551mg 2,2mg 14,4mg 46,2mg 33,3mg 0,64mg

A linhaça tambÊm auxilia no aumento da vitalidade ItVLFDHVWLPXODQGRRDXPHQWRGRFRH¿FLHQWHPHWDEyOLFR PHOKRUDQGR D H¿FiFLD QD SURGXomR GH HQHUJLD H diminuindo a fadiga dos músculos após o exercício, alÊm de auxiliar na diminuição do peso, pois ajuda a controlar a obesidade e a sensação desnecessåria de apetite. Dra. Tânia Rodrigues Ê nutricionista, especialista em Fisiologia do Exercício (UNIFESP), sócia/diretora da RGNutri Consultoria em Nutrição - São Paulo e nutricionista do Clube BM&F.

59

SUPERAĂ‡ĂƒO


16k

Mizuno 10 Milhas Brasil

A

primeira das quatro etapas da Mizuno 10 Milhas Brasil reuniu, dia 31 de maio, cerca de 6 mil pessoas no Aterro do Flamengo, no Rio de Janeiro, para as disputas individual (16,09km) e de duplas (8,045km cada);foi o recor de do evento. Para dar ĂŞnfase Ă  nova campanha da tecnologia eGnder Engineering, que leva em conta as diferenças biomecânicas entre homens e mulhe res na corrida, a organização dividiu a largada, com homens correndo de um lado e mulheres do outro. Com o tempo de 51min09, o estudante mineiro Lourival do Nascimento Libanio venceu a prova individual masculina. A “ corrida serviu como um teste para eu correr uma meia maratona e vi que estou preparadoâ€?, contou o campeĂŁo, que disputou as 10 Milhas pela primeira vez. O pĂłdio teve ainda os atletas Adair JosĂŠ eHnrique dos Santos (52min51) e eW der D ias Ferreira (54min08), na segunda e ter ceira colocaçþes, respectivamente. Na disputa feminina, iGsele Barros de Jesus, 26 DQRV ÂżFRX FRP R WtWXOR Âł)RL D SULPHLUD YH] TXH disputei uma prova de 10 milhas e gostei muito. O SHUFXUVRIRLyWLPRPXLWREHPVLQDOL]DGRGRLQtFLR DR ÂżP DOpP GH WHU YiULRV SRQWRV GH KLGUDWDomR´ comentou a atleta, que cruzou a linha de chegada com 1h01min11. Minutos depois, chegaram Raimunda Maria Brito da Fonseca, com 1h04min27, em segundo lugar, e Silvia Moreira Lopes Ribeiro (1h04min42) em terceiro. Na prova de duplas, o clima foi de muita animação. eDnivaldo Francisco e dÉer oGmes fecharam

A etapa do Rio foi a primeira das quatro que compĂľem o circuito Mizuno 10 Milhas Brasil

60 16

Fotos: Divulgação

O Aterro do Flamengo recebeu cerca de 6 mil corredores

o percurso em 51min21, com Marcio Souza e AlEquam pere deri Moreira (51min44) em segundo lugar. O triaaperrarte tleta Marcos aHllack e Edson do Nascimento, com demnerum il PLQÂżFDUDPHPWHUFHLUR(QWUHDVGXSODVIHhinsIte istantem mininas, vitĂłria do time formado por abel e Paula dem atiam &ULVWLQDFRPKPLQGHL[DQGRSDUDWUiV3ULVFLtemussiliem hus, OD/RXUHQoRH.iWLD3LQWRGH$OPHLGD KPLQ  cessimus que terminaram em segundo. O pĂłdio teve ainda as SUHVHQoDV GH 0DULD GH )iWLPD 3HVVRD H 0DULD GD Consolação (1h18min33). Entre as duplas mistas, vitĂłria da experiĂŞncia. $ PDUDWRQLVWD 0iUFLD 1DUORFK FRUUHX DR ODGR GH $PDXUL-RVpGRV6DQWRVHJDUDQWLXRWtWXORFRPR tempo de 54min52. É “muito bom participar deste evento e senti uma diferença enorme no nĂşmero de pessoas, aumentou muito em relação ao ano passaGR´GLVVH0iUFLDTXHQRPRPHQWRVHGHGLFDDSURvas mais curtas. JosĂŠ Luiz Lima e Fernanda NĂłbrega (58min38), e Luis H enrique dos Santos e Neilda do Nascimento (58min59), completaram o pĂłdio. Outras trĂŞs cidades receberĂŁo as 10 Milhas Mizuno:SĂŁo Paulo (2 de agosto), Belo oHrizonte (4 de RXWXEUR H%UDVtOLD GHQRYHPEUR 


assinante sa

Julio Mine Arquivo pessoal

“I

niciei neste maravilhoso mundo das corridas em 2005, na Nike 10K, a convite de minha irmĂŁ, que tambĂŠm começara a correr naquele mesmo ano. 6HQGR D SURYD LQLFLDO ÂżTXHL HQFDQWDGR FRP R yWLPR DVtral que encontrei entre todos os integrantes do evento, que chegou a quase 10.000 pessoas, todas vestidas com a mesma camiseta amarela, que foi a marca registrada daquele evento. D e lĂĄ para cĂĄ, foram mais de uma centena de corridas, de 4 a 21km, a menor delas com sete pessoas e algumas com mais de 20.000 participantes, mas em todas elas encontrei aquele mesmo astral da primeira, ou seja, todos ajudando a todos, companheirismo, amizade e a preocupação com a saĂşde e o condicionamento fĂ­sico. Atualmente treino com a equipe de Vinhedo (SP) e muito tenho a agradecer ao professor Leandro, que incentiva a uniĂŁo, ajuda os integrantes da equipe e os demais corredores e nos dĂĄ o apoio tĂŠcnico necessĂĄrio para que continuemos a prĂĄtica desta atividade fĂ­sica de forma prazerosa e segura. Agradeço tambĂŠm a minha esposa Magali, que me incentiva a continuar treinando, mesmo que algumas ativiGDGHVGRQRVVRÂżQDOGHVHPDQDÂżTXHPSUHMXGLFDGDVSHORV longĂľes ou provas que fazemos, pois ela tambĂŠm sabe que ‘correr ĂŠ tudo de bom’.â€?

www.nikecorre.com

Foto ilustrativa do kit masculino

A parceria com a Nike do Brasil continua e em toda as ediçþes uma nova pessoa serĂĄ selecionada. Se vocĂŞ ĂŠ assinante da revista SuperAção, mande uma carta para ASSINANTE SUPERAĂ‡ĂƒO (Av. Nossa Senhora de FĂĄtima, 95 - Campinas/SP, CEP 13076-000) ou envie e-mail (superacao@interesportes.com. br) com este tĂ­tulo, nome completo, telefone e endereço do e-mail para contato, endereço completo e sua histĂłria em corridas de rua. NĂŁo esqueça das fotos, de preferĂŞncia em atividade. SĂŁo elas que ilustrarĂŁo as pĂĄginas e devem estar nĂ­tidas e grandes. As melhores histĂłrias serĂŁo selecionadas pela equipe da SuperAção e Nike do Brasil para publicação, e ganharĂŁo KIT NIKE.


10k

Corrida das Pontes do Recife Emerson Silva

O

62 16

s quenianos roubaram a cena - e o primeiro lugar do pódio - na 6ª Corrida das Pontes do Recife Bicbanco, na manhã do dia 14 de junho. O evento, um dos maiores do Nordeste, reuniu mais de 4 mil corredores em um dia de bastante sol na capital de Pernambuco. Na prova de 10km, que contou com 2,6 mil participantes, a largada principal ocorreu às 9h. Com certa tranquilidade, o queniano Biwott Stanley Kipleting foi impondo seu ritmo durante o percurso e garantiu a vitória com o tempo de 30min14. O campeão deixou para trás o brasileiro Ubiratan José dos Santos, que chegou a liderar a prova, mas acabou em segundo com o tempo de 30min33. Os brasileiros Josueldo Francisco do Nascimento (31min27) e Jorgivaldo Oliveira Santos (31min44) terminaram

na terceira e quarta colocações, respectivamente. Enio Kleiton de Lima fechou o pódio na quinta colocação, com 32min09. A exemplo do que aconteceu na prova masculina, entre as mulheres o alto do pódio também foi do Quênia. Anne Cheptanni Berewe teve mais tranquilidade que o compatriota Kipleting e fechou os 10km em 34min29, com quase de um minuto de vantagem para Marily dos Santos (35min15). Maria Lúcia Alves Vieira (36min40), Marluce Queiroz (38min05) e Solange Cerqueira de Souza (1h06min28) completaram o pódio feminino. Além da prova de 10km, o evento agitou toda a população com a realização da corrida de 5,6km, da corrida infantil de 2,5km, para crianças de 10 a 17 anos, da rede pública de ensino, e da caminhada.


minha história

Brincadeira de mulher Arquivo pessoal

“C

om o outono já avançado, o friozinho do litoral para alguns até poderia ser PRWLYRSDUD¿FDUGHEDL[RGRHGUHGRP 0DVjVKGDPDQKmGHViEDGRGHGHPDLR Mi HVWDYD HX GH Sp FRP XPD ~QLFD G~YLGD HQWUH EHUPXGD RX FDOoD SDUD YHVWLU H TXDVH SURQWD SDUD RGHVD¿RGRGLDD0DUDWRQDGH5HYH]DPHQWR%HUWLRJD0DUHVLDVQROLWRUDOQRUWHGH6mR3DXOR5HDlizada duas vezes por ano, pela Cia de Eventos, a FRPSHWLomRDWUDLDPDQWHVGDQDWXUH]DDSDL[RQDGRV SRU FRUULGDV GH UXD H DOJXQV PDOXFRV FRQKHFLGRV SRUXOWUDPDUDWRQLVWDVTXHSHUFRUUHPVR]LQKRVRV TXLO{PHWURVGHSURYD (X DSHVDU GH PH HQTXDGUDU HP WRGRV RV LWHQV LQFOXVLYHQRµPDOXFRV¶FRQWLQXRFRPRXPDVLPSOHV PRUWDODSWDDSHQDVSDUDXQVNP3DUDPLQKDDOHJULDHGDPDLRULDGRVHVSRUWLVWDVFDWHJRULDVGH RXSDUWLFLSDQWHVIRUPDPHTXLSHVGHUHYH]DPHQWR para atravessarem praias, trilhas, estradas de terra H DVIDOWR 1D PLQKD HTXLSH 83),7 /DGLHV 3RZHU QRYH PXOKHUHV TXH QR GLD D GLD GLYLGHP R WHPSR HQWUHWUDEDOKRHVWXGRVFDVDHHPDOJXQVFDVRV¿OKRVDOLHUDPDSHQDVDWOHWDVDPDGRUDVHPEXVFDGH GLYHUVmRHFODURGHXPSRXFRGHFRPSHWLomR'HVFREULHQTXDQWR¿FDYDQDWRUFLGDDFDGDWUDQVLomRj HVSHUDGDPLQKDYH]±HXVHULDD~OWLPD±TXHDGLVSXWDHUDWDQWRFRPDVFRQFRUUHQWHVIHPLQLQDVTXDQWR FRPD83),73RZHUHTXLSHPDVFXOLQDWDPEpPGH DOXQRVGD83),7$VVHVVRULD(VSRUWLYD 'R ODGR GH Fi 6DQGUD $QLWD 6XVLOD 0DIH &OiXGLD7DLDQD*HVLDQHVHUHYH]DUDPHDEULUDP PLQXWRVGRVPHQLQRVTXHHVWDYDPHPDSHQDVVHLV LQWHJUDQWHV (QTXDQWR DJXDUGiYDPRV D FKHJDGD GD SHQ~OWLPD FRUUHGRUD D 0DULDQD TXH OXWDYD FRQWUD RUHOyJLRSDUDPDQWHUDGLIHUHQoDQRWUHFKRHPTXH FRUULDRPDLVUiSLGRGDHTXLSHPDVFXOLQDRVRXWURV VHUHYH]DYDPQXPHVIRUoRSDUDDIHWDUPHXSVLFROyJLFR(QWUHXPµQyVYDPRVSDVVDU¶HXPµYRFrGHYLD LUFRPSUDUXPVDSDWRQDORMLQKDDOL¶VySDUDPHGLVWUDLUGDFRUULGDHXWHQWDYDDORQJDUHDTXHFHU 3DUDDPLQKDDOHJULDHWULVWH]DGHOHVHLVTXHFKHJDD0DULSDUDPHSDVVDURFKLS6HPVDEHUTXDQWRV minutos ou segundos atrás estava a turma dos raSD]HVHVHPQHPOHPEUDUTXHKDYLDPRXWUDVHTXLSHVIHPLQLQDVQDSURYDSDUWLSDUDRVNPHQWUH &DPEXUL H 0DUHVLDV$FRPSDQKDGD SDVVR D SDVVR SHORPHXPDULGRTXHQRDQRSDVVDGRSDUWLFLSRXGD VROR VXELPRV D VHUUD )XL XOWUDSDVVDGD SRU DOJXQV

FRPSHWLGRUHVPDVQHQKXPDPXOKHU3DVVHLRXWURV H VHJXLPRV QXP ULWPR FRQVWDQWH DOWHUQDQGR HQWUH FRUULGDWURWHFDPLQKDGDUXPRDRFpX3RUpPVHPSUHFRPRFRUDomRQDERFD'HSRLVGHXQVNPGH VXELGDLQWHQVDFRPGLUHLWRDPXLWRVLQFHQWLYRVGDV PHQLQDVGDHTXLSHGHDPLJRVTXHSDVVDYDPGHFDUUR H GH PXLWRV GHVFRQKHFLGRV SHOR FDPLQKR FKHJDPRVDRWRSR1DGDPHOKRUGRTXHOHUDSODFDGH µ)DOWDPPHWURVSDUDDGHVFLGD¶ 6RTXHLQXPULWPRDOXFLQDGRVHUUDDEDL[R&RUULYRHLFRUULDWpDHQWUDGDSDUDDSUDLDGH0DUHLDV µ)DOWDPHQRVGHNP¶DYLVRXDVWDIISRXFRDQWHVGD DUHLDIRIDGDSUDLDDLQGD~PLGDGDFKXYDGRGLDDQWHULRUFRPHoDUDOLWHUDOPHQWHPHVXJDU&DGDSDVVR SDUHFLDXPDHWHUQLGDGH$OX]YHUGHTXHDSRQWDYDD FKHJDGD HVWDYD GLVWDQWH$ SHOR PHQRV XPD OpJXD HUD VHQVDomR 8P SDVVR SRU YH] XPD UHVSLUDomR RIHJDQWH SRU YH] 5HVSLUD )DOWD SRXFR (VFDSR GDVRQGDVTXHLQVLVWLDPHPPHEXVFDUPDLVDOJXQV SDVVRVHQRYDPHQWHRFRUDomRDFHOHUD 1RV SDVVRV ¿QDLV DTXHOH DSHUWR QR SHLWR PDV QmRPDLVSHORHVIRUoRHVLPSHODHPRomRGHFRPSOHWDUDHWDSDHPKFUDYDGDHMXQWRGDVFRPSDQKHLUDV GH HTXLSH TXH FUX]DUDP R SyUWLFR GH FKHJDGD DR PHX ODGR SDUD QXP DEUDoR FROHWLYR FRPHPRUDUPRVDµ1266$9,7Ï5,$¶$K(PLQXWRVQD IUHQWHGDHTXLSHPDVFXOLQD5VVV´ Por Lilian Araujo Equipe UpFit Ladies Power

63

SUPERAÇÃO


10k

Circuito Volkswagen Run Fotos: Divulgação

U

64 16

ma corrida diferente. Ao invÊs de pneus, tênis. Ao invÊs do ronco dos motores, o som ritmado das passadas. Ao invÊs de trabalho, diversão. Deixando as måquinas de lado, a fåbrica da Volksw agen do Brasil em TaubatÊ, São Paulo, foi palco de uma corrida de 10km, no dia 14 de junho. A prova, que faz parte do Circuito Volksw agen Run, reuniu mil corredores, incluindo DWOHWDV SUR¿VVLRQDLV FRODERUDGRres da empresa e demais participantes. O trajeto levou os competidores para dentro da empresa. Na briga pelo pódio ou simplesmente SRU GLYHUVmR QR ¿QDO GH VHPDQD os atletas conheceram, mesmo que rapidamente, a linha de produção do Novo Gol e do Voyage, que fabrica 250 mil carros por ano. 1DFDWHJRULDPDVFXOLQDDYLWyULD¿FRXFRP'Dmião Ancelmo de Souza, que completou o percurso em 28min48, 10 segundos àfrente de Paulo Alves dos Santos (28min58), segundo colocado. O pódio ainda contou com as presenças do queniano Emmanuel Kipkemei Belt (29min03), Daniel Lopes Ferreira (29min24) e David Benedito de Macedo (29min28). Na disputa feminina, Fabiana Cristine da Silva triunfou ao registrar a marca de 34min36, com Sueli Pereira Silva (34min42) em segundo e Rosangela Raimunda Faria (34min54) em terceiro. Conceição Maria Carvalho Oliveira, com 35min03, foi a quarta colocada, enquanto a queniana Ednah Mukhw ana fechou o pódio em quinto com o tempo de 35min36. Depois de TaubatÊ, o Circuito Volksw agen Run terå provas nas fåbricas de São JosÊ dos Pinhais (PR), em 19 de julho, e São Bernardo do Campo (SP), em 22 de novembro. Os cinco primeiros colocados em cada categoria levam prêmios em dinheiro - o vencedor ganha R$5 mil;o 2ºcolocado, R$3,5 mil;o 3º, R$2,5 mil;o 4º, R$1 mil;e o 5º, R$500. Para os concluintes da prova em menos de 1h45, hå o sorteio de um Novo Gol por etapa. Em TaubatÊ, João Carlos da Silva, que trabalha na Ferramentaria da Volksw agen, levou o carrão para casa.

Correr em meio à linha de produção de automóveis Ê uma das atraçþes da prova

A primeira etapa do Circuito reuniu mil atletas e foi vencida por DamiĂŁo Ancelmo de Souza e Fabiana Cristine da Silva (abaixo)


As fases da corrida avaliação dinâmica dos membros inferiores durante a marcha e a corrida tem sido foco de diversas publicaçþes FLHQWt¿FDV 2V SDUkPHWURV ELRPHFkQLFRV GD corrida são fundamentais na determinação da H¿FLrQFLD GR PRYLPHQWR H VXDV LPSOLFDo}HV QRDSDUHFLPHQWRGHOHV}HV Podemos dividir o ciclo da corrida em duas fases: 1. FASE DE APOIO: representa 45%da corrida e se FDUDFWHUL]DSHODSUHVHQoDGRSpQRVROR6XEGLYLGHVH em contato inicial (choque do calcâneo), mÊdio apoio (apoio do pÊ total) e propulsão (desprendimento do KiOX[RXSULPHLURGHGR  2. FASE DE BALANÇO: representa 55% da corrida e VHFDUDFWHUL]DSHODDXVrQFLDGHFRQWDWRGRVSpVQRFKmR 2 WLSR GH FRUULGD SRGH VHU FDUDFWHUL]DGR SRU GLIHUHQoDV QDV GXUDo}HV GDV IDVHV GH DSRLR H GH EDODQoR Durante um trote, por exemplo, a duração da fase de apoio Ê maior do que a fase de balanço, enquanto que na corrida de longa distância, a duração da fase de DSRLRpLJXDOjIDVHGHEDODQoR$FRUULGDGHYHORFLGDGH se caracteriza por uma fase de apoio de duração menor do que a de balanço, alÊm de diferenças importantes na IRUPDGHDSRLRGRSpQDVXSHUItFLH $IDVHGHDSRLRSRGHVHUVXEGLYLGLGDHPWUrVVXE IDVHVFRQWDWRLQLFLDOPpGLRDSRLRHFRQWDWR¿QDORX SURSXOVmR ‡ &217$72 ,1,&,$/ ocorre na borda externa do FDOFDQKDUFRPRSpHPVXSLQDomR ‡ 0e',2$32,2 aplanamento do pÊ no solo com OHYHSURQDomR ‡35238/6­2o pÊ volta a supinar, transformandoVHQXPDDODYDQFDUtJLGDSDUDRLPSXOVRGRFRUSR Alguns movimentos estão presentes em cada passada e constituem elementos fundamentais da biomecâniFDQRUPDOGDFRUULGDFRPRDSURQDomRHDVXSLQDomR $3521$d­2SHUPLWHTXHRSpVHDGDSWHjVVXperfícies do terreno e ocorre durante a fase de mÊdio DSRLR2VPRYLPHQWRVTXHDFRPS}HPVmR ‡$%'8d­2'2$17(3ecaracterizado pelos dedos do pÊ apontando para fora da linha de progressão GDFRUULGD ‡'256,)/(;­2'272512=(/2 caracterizado pela região anterior do pÊ angulada para cima em relação ao calcanhar, gerando aproximação do dorso do

A

MEDICINA ESPORTIVA Dr. Cristiano Frota de Souza Laurino

SpjSDUWHDQWHULRUGDSHUQD ‡(9(56­2'25(7523e movimento da borda laWHUDOGRSpHPGLUHomRjSDUWHODWHUDOGDSHUQD$VRODGR FDOFDQKDU¿FDDSRQWDGDSDUDIRUDGDOLQKDGHSURJUHVVmR GDFRUULGD 2VPRYLPHQWRVTXHFRPS}HPD683,1$d­2VmR ‡$'8d­2'2$17(3e caracterizado pelos dedos do pÊ apontando para dentro da linha de progressão da FRUULGD ‡)/(;­23/$17$5'272512=(/2 a região anterior do pÊ angulada para baixo em relação ao calFDQKDU 2 Sp VH DEDL[D SURFXUDQGR DOLQKDUVH FRP R maior eixo da perna, elevando o calcanhar do chão, o que leva ao afastamento do dorso do pÊ àparte anterior GDSHUQD ‡,19(56­2'25(7523e caracterizado pela borda medial do pÊ, que se dirige para a parte medial da SHUQDHDVRODGRFDOFDQKDU¿FDDSRQWDGDSDUDGHQWURGD OLQKDGHSURJUHVVmRGDFRUULGD Durante a fase de apoio do pÊ no solo, o tempo proORQJDGRGHSHUPDQrQFLDGDSURQDomRRXGDVXSLQDomR pode gerar åreas de sobrecarga nos membros inferiores, desencadeando o aparecimento de lesþes musculares, WHQGLQRVDVFDUWLODJLQRVDVRXyVVHDV $FRQVHTXrQFLDGDSURQDomRH[FHVVLYD UiSLGDSURgressão para a pronação ou tempo de pronação prolonJDGR  VLJQL¿FD D SHUGD GRV PHFDQLVPRV GH DGDSWDomR GRSpQRVRORHDLQH¿FLHQWHWUDQVIHUrQFLDGHIRUoDVjV FRQGLo}HVGHVXSHUItFLH A recomendação de calçados para a corrida constituiVHXPGHVD¿RSDUDHVSHFLDOLVWDVQRVGLDVGHKRMHHGHYH basear-se em múltiplos aspectos, incluindo a mecânica LQGLYLGXDOGDFRUULGDHVHXVSDUkPHWURV¿VLROyJLFRV Boa corrida! Dr. Cristiano Laurino Ê Mestre em Ortopedia e Traumatologia pela UNIFESP. DireWRU&LHQWtÀFRGR&RPLWrGH7UDXPDWRORJLD'HVSRUWLYDGD6RFLHGDGH%UDVLOHLUDGH 2UWRSHGLDH7UDXPDWRORJLD 6%27 0HPEURGD$PHULFDQ$FDGHP\RI2UWKRSDHGLF 6XUJHRQV $$26 0pGLFRGR&OXEHGH$WOHWLVPR%0 )%29(63$$VVHVVRU0pGLFRGD&RQIHGHUDomR%UDVLOHLUDGH$WOHWLVPR &%$W 

65

SUPERAĂ‡ĂƒO


42k Fotos: TiĂŁo Moreira/ZDL

Maratona de SĂŁo Paulo

U

66 16

ma prova para todos os gostos - e fĂ´legos. A XV Maratona Internacional de SĂŁo Paulo, disputada na manhĂŁ do dia 31 de maio, nĂŁo reuniu apenas os amantes dos 42km, mas tambĂŠm abriu espaço para competidores de 10km e 25km. Tamanha variedade de percursos transformou o evento num sucesso de pĂşblico, com mais de 15 mil corredores pelas ruas da capital paulista. Na prova principal - e que dĂĄ nome ao evento - vitĂłria da baiana Marizete Moreira dos Santos no feminino, enquanto o queniano Elias Chelimo estragou a festa brasileira no masculino. Mais do que adversĂĄrias, Marizete Moreira dos Santos precisou superar as cĂŁibras para triunfar. Depois de impor um ritmo forte em boa parte do percurso, por volta do km 36 as dores começaram a incomodar a brasileira nas duas pernas. “No Ăşltimo tĂşnel (Tribunal de Justiça) nĂŁo conseguia respirar direito. NĂŁo sei de onde tirei força. Corri na raçaâ€?, expliFRXDDWOHWDTXHPDQWHYHVHÂżUPHSDUDYHQFHUFRP 2h42min24. A corredora comentou que os nĂşmeros indicavam que ela venceria a prova. “Meu nĂşmero de peito ĂŠ 201, o quarto do hotel 401 e hoje ĂŠ dia 31. Com tanto nĂşmero 1 eu tinha de ser a nĂşmero 1 tambĂŠmâ€?, disse a campeĂŁ. Marizete de Paula Rezende, com 2h45min37, terminou em segundo lugar, com Marily dos Santos em terceiro (2h46min27). Completaram o pĂłdio a brasileira Edielza Alves dos Santos (2h52min32) e a etĂ­ope Tolla Aberash Tesfaye (2h54min09). Entre os homens, o queniano Elias Chelimo venceu com certa tranquilidade. Ele completou o percurso em 2h13min59, com larga vantagem para Franck

Briga acirrada no pelotĂŁo de elite

Caldeira, segundo colocado com 2h17min23. “A corULGDIRLERD0DVDSURYDÂżFRXPDLVGLItFLODSDUWLUGR quilĂ´metro 26, quando o vento forte atrapalhou um pouco. Mas gostei da minha performanceâ€?, disse o campeĂŁo. O pĂłdio foi completado pelos atletas JosĂŠ do Nascimento Souza (2h19min17), Giomar Pereira da Silva (2h21min36) e o etĂ­ope Tola Ketema Nigusse (2h22min38). Na disputa dos 25km, Marildo JosĂŠ Barduco (1h25min45) e Edinalva da Silva Nunes (1h54min33) foram os campeĂľes, enquanto Renilson Vitorino da Silva (32min56) e Andreia Keilla GalvĂŁo Lemes (47min06) acabaram vitoriosos na prova de 10km.


pergunte ao treinador

SuperAção tira suas dúvidas “Corro há muitos anos, especialmente provas de 10km. Há algumas semanas, senti a panturrilha direita durante o treino na esteira e ainda está me incomodando. Gostaria de saber se tem algum tratamento que posso fazer em casa para voltar a correr. Obrigado.” Paulo Tarso Moraes Porto Alegre (RS) R: Paulo, você provavelmente sofreu uma lesão muscular e o correto é procurar o mais rapidamente possível um médico ortopedista. Em geral, os especialistas recomendam o uso de bolsa de gelo no local, entre 5 e 10min, diversas vezes ao dia, até que tenha o diagnóstico e o tratamento mais adequado para a lesão. Talvez seja necessário fazer algumas sessões de fisioterapia durante a fase aguda para ajudar na cicatrização e, na reabilitação, seja recomendado o fortalecimento e alongamento da área afetada. Espero que retorne logo às corridas! Renato Dutra “Faço academia, mas quero co-

meçar a correr. Gostaria de saber se somente o treino na esteira é suficiente. Tem algum problema em fazer corrida apenas na academia neste início? Um beijo.” Tatiana Carvalho Rio de Janeiro (RJ) R: Olá, Tatiana. Tudo bem? Muitas pessoas que fazem academia estão descobrindo o grande prazer que é correr! Não há problema em iniciar na corrida treinando em esteira. É até recomendável, pois nela é bem mais fácil controlar a velocidade e com isso conseguir correr por mais tempo. De qualquer forma, é sempre bom você fazer um ou outro treino de final de semana em parques ou ruas não muito movimentados, para se acostumar com outro tipo de piso e ir aprendendo a controlar seu ritmo sozinha. Ótimas corridas! Abraços, Nelson Evêncio “A maioria das corridas acontece no período da manhã e meu intestino funciona como um relógio, justamente nessa hora. Tem algum alimento que posso comer

para ‘segurar’ um pouco e poder curtir a competição? Abraço.” Felipe Melo Campinas (SP) R: Olá, Felipe! Essas alterações pontuais nunca são uma boa estratégia nutricional. Assim como não há alimentos mágicos para antes ou durante as provas, não podemos dizer que exista alimentos específicos que alterarem todo o seu relógio biológico assim, tão facilmente ou rapidamente. O nosso relógio biológico (e as nossas idas ao banheiro fazem parte dele) é regulado muito mais lentamente. Você vai ter que reacostumar aos poucos o seu corpo, seja por meio do tipo de alimento que come (e aqui as fibras têm grande participação no processo), assim como com o horário em que vai ao banheiro. E isso serve para qualquer horário, pois se a pessoa já sabe que a hora de uma competição pode não ser das mais favoráveis, ela deve pensar nisso antes do grande dia. Bons treinos! Danilo Balu

CONHEÇA O NOSSO TIME Prof. Danilo Balu Bacharel em Esporte e graduado em Nutrição pela USP Prof. Nelson Evêncio CREF nº 016048-G/SP Graduado em Educação Física pela Faculdade Osec Pós-Graduado em Treinamento Desportivo FMU Equipe Nelson Evêncio Assessoria Esportiva

Prof. Renato Dutra CREF 991-G/SP Bacharel em Esporte pela USP Pós-graduado em Treinamento Desportivo pela Escola Paulista de Medicina Sócio-Treinador da Ação Total Consultoria em Qualidade de Vida

Prof. Cláudio Roberto de Castilho CREF nº 008333-G/SP - CBAt 489 Graduado em Educação Física pela UMC Pós-Graduado em Treinamento Desportivo pela FMU Equipe Saúde & Performance Atividade Física

SuperAção tira dúvidas sobre treinamento, nutrição e tudo relacionado ao esporte. Para isso, firmou parceria com um time de profissionais com competência comprovada e respeito no meio. Para participar, escreva para nós: Av. Nossa Sra. de Fátima, 95, Taquaral - Campinas-SP, Cep 13076-000 ou envie e-mail para superacao@interesportes.com.br.

67

SUPERAÇÃO


Foi assim...

N

68 16

R ¿QDO GH PDLR H LQtFLR GH MXQKR WLYHPRVR7URIpX%UDVLOGH$WOHWLVPRTXHpRFDPSHRQDWRQDFLRQDO GHFOXEHV1HVWHDQRIRLUHDOL]DGRHPGXDV HWDSDVVHQGRXPDHP%UDJDQoD3DXOLVWD ,QWHULRU GH 6mR 3DXOR QD VHGH GR &OXEH 5HGHHRXWUDQR5LRGH-DQHLURQR(QJHQKmR 'HVGHDVHTXLSHVTXHGLULMRWrP VH VDJUDGR FDPSHmV QDFLRQDLV VHP LQWHUUXSomR'HDSHOD)XQLOHQVHHGH HPGLDQWHSHOD%0 )DJRUD%0 )%RYHVSD eXPDSURH]D$SHQDVTXDWURSHVVRDVPHDFRPSDQKDUDP QHVWD WUDMHWyULD GHVGH R LQtFLR HP WRGRVRVWtWXORVRVWpFQLFRV5LFDUGR'¶$QJHOR H$ULVWLGHV-XQTXHLUDRDGPLQLVWUDWLYR$JQDOGR 9HURQH]LHRDWOHWD9DQGHUOHL&RUGHLURGH/LPD KRMHSDWURQRGDHTXLSHHIXWXUDPHQWHJHUHQWHGR &OXEH %0 ) %RYHVSD $ JUDQGH PDLRULD GDV FRQTXLVWDVIRLQR5LRGH-DQHLURHDQWHVGHFRPHoDUR7URIpX%UDVLOGHVWHDQRHUDPWtWXORV FRQVHFXWLYRV 6LQFHUDPHQWH HX QR ¿QDO GR DQR SDVVDGR HVWDYDGHVPRWLYDGRHSHQVDQGRHPGHL[DUDGLUHomRWpFQLFDGRFOXEH0DVFRPRWRGRVVDEHP QR¿QDOGRDQRYiULRVWpFQLFRVHDWOHWDVGHQRVVR FOXEHIRUDPDVVHGLDGRVSHORFRQFRUUHQWHHPXLWRVIRUDPVHGX]LGRVDRVHQFDQWRVHVHWUDQVIHULUDP ,QFOXVLYH DOJXQV GRV SULQFLSDLV QRPHV GR DWOHWLVPRQDFLRQDO(QHVWHFDVRHXQmRSRGHULD GHL[DURFOXEHHPXPGLItFLOPRPHQWR$VVLP GHFLGL¿FDUPDLVXPDQRUHHVWUXWXUDUDHTXLSH UHRUJDQL]DU SUHVWLJLDU H GDU IRUoD DRV WpFQLFRV HDWOHWDVTXHSHUPDQHFHUDPPXLWRVGHOHVUHFXVDQGR LQFOXVLYH SURSRVWDV ¿QDQFHLUDV YDQWDMRVDV2SWDUDPSHODVHJXUDQoDHVWDELOLGDGHHYDORUHVTXHRQRVVRFOXEHWHPRIHUHFLGRDRORQJR GRWHPSR )LTXHLHMXQWRFRPRVWpFQLFRVPRQWDPRVD PHOKRUHTXLSHTXHSXGHPRVHDFRORFDPRVSDUD FRPSHWLUQDPHOKRUIRUPD9DORUL]DPRVDRPi[LPRDXQLmRDFRODERUDomRRUHVSHLWRHDLQGLYLGXDOLGDGH GH FDGD XP SDUD TXH VRPDGRV IRUPiVVHPRVXPJUXSRFRHVRHIRUWH 1D SULPHLUD HWDSD HP %UDJDQoD IRUDP UHDOL]DGDVTXDWURSURYDV9HQFHPRVWUrVGHODVMi VDLQGR j IUHQWH H VXUSUHHQGHQGR R DGYHUViULR

RECORDAR É CORRER Sergio Coutinho Nogueira

HPVXDVHGH1RPDUWHORIHPLQLQR.DWLXVFLDGH -HVXV 7ULVWDQ TXH HVWDYD GHVDFUHGLWDGD VH VXSHURXHYHQFHXGHIRUPDFRQYLQFHQWHHHPRFLRQDQWH1RGHFDWOR$QGHUVRQ(VWHYmR9HQkQFLR TXH YHLR SDUD R FOXEH QHVWH DQR H WUHLQD FRP RQRVVRH[GHFDWOHWD(GHPDU$OYHVGRV6DQWRV WDPEpPVXUSUHHQGHXFRPVXDFRQTXLVWD $R¿QDOGHHWDSDOLGHUiYDPRVFRPSRQWRVFRQWUDGRDGYHUViULRTXHDLQGDDFUHGLWDYDHPXPDUHDomRSDUDSRGHUHP³GDURFRXURQD %0 )´FRPRKDYLDPSURPHWLGRHPHQWUHYLVWD FROHWLYD 9HLRDVHJXQGDHWDSDQR5LRGH-DQHLURQD EHOD SLVWD GR (QJHQKmR 1D SULPHLUD SURYD D QRVVD &UX] 1RQDWD GD 6LOYD YHQFHX RV  PHWURV FRP PDUFD GH PLQV VXUSUHHQGHQGR D IDYRULWD /X]LD GH 6RX]D 3LQWR TXH KDYLD VLGR FRQWUDWDGD SHOR FRQFRUUHQWH DSHQDV SDUDFRPSHWLUR7URIpX%UDVLOHTXHIH]WDPEpP XPDEHODSURYDFRPPLQV1DRXWUD¿QDO GR GLD GHX D OyJLFD 0DUtOVRQ *RPHV GRV 6DQWRVWDPEpPGD%0 )%RYHVSDHWUHLQDGR SHOR $GDXWR 'RPLQJXHV PDQWHYH R IDYRULWLVPR2ELFDPSHmRGD0DUDWRQDGH1RYD,RUTXH IH] R UHFRUGH GR 7URIpX FRP PLQV VHJXLGRSRU'DPLmR6RX]DTXHIH]PLQV &RPHVWHVUHVXOWDGRVDXPHQWDYDDYDQWDJHPGR &OXEH %0 ) %RYHVSD PDV DLQGD WHUtDPRV DV SURYDV GH YHORFLGDGH TXH HUDP R SRQWR IRUWH GD5HGH 1R VHJXQGR GLD GD VHJXQGD HWDSD D 5HGH FRQ¿UPRX R IDYRULWLVPR QRV P PDVFXOLQR FRP -RVp &DUORV 0RUHLUD PDV D %0 ) UHVSRQGHX FRP YLWyULD QRV P IHPLQLQR FRP /XFLPDU0RXUDID]HQGRDERDPDUFDGHV 1HVWHGLDD5HGHYHQFHXRLWRSURYDVHD%0 ) %RYHVSD TXDWUR PDV QRV SRQWRV D YDQWDJHP VHJXLD¿UPHSDUDD%0 )%RYHVSD


3RUpP R FOLPD HQWUH RV DGYHUViULRV HUD GH TXH QR ViEDGR FRP RV UHYH]DPHQWRV SDVVDULDPjIUHQWHSDUD³GDURFRXUR´3RURXWURODGR QD%0 )%RYHVSDSHUPDQHFLDDWUDQTXLOLGDGH H PXLWD XQLmR GH WRGRV QD OXWD SRU XP PHVPR LGHDORWtWXOR 1RVPFRPREVWiFXORVIHPLQLQRYLWyULD GD6DELQH+HLWOLQJGD8QLVFFRPPLQV 1RVPHWURVJDQKRX)DELDQR3HoDQKDGD 3LQKHLURV$VLFV FRP PLQV TXHEUDQGR D KHJHPRQLD%0 )%RYHVSD5HGHDWpHQWmR (UDViEDGRSHQ~OWLPRGLDGHGLVSXWDVHWLYHPRVDVSURYDVGHPDUFKDDWOpWLFD1RIHPLQLQR YHQFHX 7kQLD 6SLQGOHU TXH KDYLD VLGR GLVSHQVDGDSHOD5HGHQR¿QDOGRDQRHIRLFRQWUDWDGD SHOD %0 ) %RYHVSD 1R PDVFXOLQR JDQKRX -RVp$OHVVDQGUR%DJLR 1RV  PHWURV FRP REVWiFXORV YLWyULD GH )HUQDQGR $OH[ )HUQDQGHV TXH KDYLD VLGR FRQWUDWDGRSHOD5HGHSDUDR7URIpX%UDVLOFRP PLQV HQTXDQWR TXH QRV  PHWURV QRYDYLWyULDGH&UX]1RQDWDGD%0 )%RYHVSDFRPPLQVFRPVXDFRPSDQKHLUDGH FOXEH)DELDQD&ULVWLQHGD6LOYDTXHUHWRUQDYDGH OHVmRHFRPSRXFRVGLDVGHWUHLQRVXUSUHHQGHQGRFRPXPyWLPRVHJXQGROXJDUHQXPH[HPSORGHVXSHUDomRIH]DPDUFDGHPLQV $ 5HGH TXH HVSHUDYD YLUDU QHVWH GLD QmR FRQVHJXLXGHSRLVGHYHUVXDHTXLSHGHUHYH]DPHQWR[PIHPLQLQRIUDQFDIDYRULWDSHUGHUSDUDDVULYDLVGD%0 )%RYHVSDFRPXPD GHPRQVWUDomR GH VLQFURQLVPR QDV SDVVDJHQV GHEDVWmRHPXLWDJDUUDQDSURYD1R[P PDVFXOLQRD5HGHWDPEpPIDYRULWDQmRWHUPLQRXDSURYDHYLXD%0 )%RYHVSDFKHJDUQD IUHQWH3RUpPSDUDDOHJULDGRULYDODHTXLSHIRL GHVFODVVL¿FDGD SRU LQYDVmR GD UDLD H D YLWyULD DFDERXVHQGRGD2UFDPSLHTXLSHGH&DPSLQDV $R¿QDOGHVWHGLDDYDQWDJHPFRQWLQXDYDFRP D%0 )%RYHVSD0DVQR~OWLPRGLDWHUtDPRV YiULDV¿QDLVHRWtWXORQmRSRGHULDHQHPGHYHULDVHUFRPHPRUDGRGHYpVSHUD 2GRPLQJRSURPHWLDVHUHPRFLRQDQWHFRPR WURIpXGHFDPSHmRVHQGRGLVSXWDGRSRQWRDSRQWRSRLVD5HGHDLQGDWLQKDHVSHUDQoDVGHWLUDUD GLIHUHQoDTXHDVHSDUDYDGD%0 )%RYHVSD(

FRPHoRX EHP YHQFHQGR RV  PHWURV VREUH EDUUHLUDVQRPDVFXOLQRHQRIHPLQLQR$FRQWHFH TXHD%0 )UHVSRQGHXjDOWXUDQRGDUGRIHPLQLQRFRPD$OHVVDQGUD5HVHQGHODQoDQGR PHWURV H (OLVDQJHOD $GULDQR YHQFHQGR R SHVR QXPJUDQGHHVIRUoRPHVPRFRQWXQGLGD 1R VDOWR WULSOR YLWyULD GH -DGHO *UHJyULR GR3LQKHLURV$VLFV3RUpPSRUXPUHFXUVRIHLWR SHOD 5HGH QmR VRPRX SRQWRV SDUD VHX FOXEH $VVLP HVVD SRQWXDomR IRL SDUD XP DWOHWD GD 5HGH -HIIHUVRQ 6DELQR 0DV D %0 ) GHX R WURFR FRP D YLWyULD GH 0DUtOVRQ *RPHV QRV  PHWURV H FRP QRYR UHFRUGH GR 7URIpX %UDVLO PLQV  (VVH UHVXOWDGR GHX XPD FHUWDIROJDj%0 )%RYHVSDQDOXWDSHORWtWXOR QDFLRQDO1RVPHWURVIHPLQLQRYROWDUDPDV HVSHUDQoDVGD5HGHFRPGREUDGLQKDORJRIUXVWDGDFRPDYLWyULDGH+XJR%DOGXLQRGH6RX]D QRVPPDVFXOLQRSHOD%0 )%RYHVSD 2GLDHVWDYDSRUWHUPLQDUHDLQGDWLYHPRVXP UHFRUGH VXODPHULFDQR FRP )DELDQD 0XUHU GD %0 )%RYHVSDQRVDOWRFRPYDUDFRPP 2EHOtVVLPRVDOWRIRLFRPHPRUDGRFRPJUDQGH DOHJULD SHOD DWOHWD FDUUHJDQGR D EDQGHLUD GR FOXEHMXQWRDVXDWRUFLGD 1R VDOWR HP GLVWkQFLD .HLOD &RVWD FRP PVXSHUDYDDFRPSDQKHLUDGHFOXEH0DXUUHQ 0DJJL TXH FRQVHJXLX P QXPD EHOD GLVSXWD1RVPHWURVHQRVPVREUHEDUUHLUDVYLWyULDVGHDWOHWDVGD5HGH 1DVGXDV~OWLPDVSURYDVWRUFLGDDWOHWDVWpFQLFRVHPHPEURVGR&OXEH%0 )MiFRPHPRUDYDPPDLVXPWtWXORFRQTXLVWDGR(SDUDFRURDU DHTXLSHDLQGDVXUSUHHQGHXFRPXPDEULOKDQWH YLWyULD QR  [ P PDVFXOLQR SURYD HP TXH HUD FRQVLGHUDGD ]HEUD 0RVWUDQGR XQLmR RUJDQL]DomRHVXSHUDomRGHWRGRVGXUDQWHDFRPSHWLomRRVJXHUUHLURVGD%0 )%RYHVSDDUUDQFDUDP QRV PHWURV ¿QDLV FRP 5DSKDHO )HUQDQGHV SDUDIHFKDUR7URIpX%UDVLOFRPFKDYHGHRXUR (D%0 )%RYHVSDVHVDJURXFDPSHmFRP SRQWRVHQTXDQWRD5HGHVRPRXSRQWRV )RL OLQGR (PRFLRQDQWH $ FRPSHWLomR IRL GLVSXWDGDSRQWRDSRQWRHQR¿QDODXQLmRIH] DIRUoDHGHXXPDQRYDYLWyULDDR&OXEH%0 ) %RYHVSD

69 17

SUPERAÇÃO


calendário CORRIDAS DE RUA

70

JULHO Dia Prova 03 1ª Corrida da Telemática de Área – 8km  ž'HVD¿RGD0DWD$WOkQWLFD$7ULEXQD  &RUULGD+RUWR)ORUHVWDO&DPSRVGR-RUGmR±NP  &LUFXLWR6(0(GH&RUULGDGH5XD±NP  )DVKLRQ5XQ±NP  (WDSD&LUFXLWR&RUSD3RUWR$OHJUH±NP  &RUULGDGR)RJR±NP  &RUULGD&RUSRUH%RPEHLURV.P  &LUFXLWR6(6&GH0LQLPDUDWRQD±NP  ,&RUULGDH&DPLQKDGD6'55LRGR6XO±NP  ž'HVD¿RGH&RUULGD$UUDLDOGR&DER±NP  &LUFXLWR%UDVLOHLURGH&RUULGDVGH0RQWDQKD  &RUULGD6SRUWV 7UDFNV  683(5.0  3URYD3HGHVWUHGH-XOKR±NP  &RUULGDGD)RJXHLUD±HNP  &LUFXLWR0RQJDJXiGH&RUULGDV(WDSD±NP  &LUFXLWR6(0(GH&RUULGDGH5XD±NP  &RUULGD3LQGD±NP  &URVV&RXQWU\GR&253$±HNP  &DPLQKDGDH&RUULGDSHOD,QFOXVmR6RFLDO±HNP  &LUFXLWRGDV(VWDo}HV,19(512  7UDFN )LHOG5XQ6HULHV'LDPRQG5XQ±NP  .1LJKW  &LUFXLWR,OKDEHODGH&RUULGDGH5XDHWDSD  5-&ODVVLF±&RUULGDGRV)X]LOHLURV1DYDLV±HNP  &LUFXLWRGDV(VWDo}HV,19(512  5~VWLFD,QWHUSUDLDV±HNP  &LUFXLWR6(0(GH&RUULGDGH5XD±NP  92/.6:$*(1581±NP  %HDFK&URVV.03HUXtEH,WDQKDpP  )DVW5XQ)OH[3p)LOD±HNP  0HLD0DUDWRQDGDVÈJXDV±NP  &LUFXLWR6(0(GH&RUULGDGH5XD±NP  &LUFXLWRGDV(VWDo}HV,19(512  &LUFXLWR%DUGR0DQpGH&RUULGDVGH5XD  &RUULGDGR3DUTXH0DULD$SDUHFLGD±NP  (FR5XQ%UDVtOLD±HNP  &RUULGDGD6ROLGDULHGDGH±NP  &LUFXLWR6HVFGH&RUULGD±NP  &LUFXLWRGD/RQJHYLGDGH%UDGHVFR±NP  (WDSD&LUFXLWR&RUSD±32$±HNP  &RUULGDGH$QLYHUViULRGD6RJLSD±HNP  5XQQLQJIRU1DWXUH(WDSD7HUUD±HNP  &RUULGD&LGDGHGH3LUDFLFDED±NP  (VWDomR0DUDWRQD±HNP

Local Brasília/DF &XEDWmR63 &DPSRVGR-RUGmR63 6mR3DXOR63 6mR3DXOR63 3RUWR$OHJUH56 %UDVtOLD') 6mR3DXOR63 6mR/HRSROGR56 5LRGR6XO56 $UUDLDOGR&DER5- 6%HQWR6DSXFDt63 *RLkQLD*2 6mR3DXOR63 *XDUDWLQJXHWi63 -XL]GH)RUD0* 0RQJDJXi63 6mR3DXOR63 3LQGDPRQKDQJDED63 3RUWR$OHJUH56 6mR3DXOR63 6mR3DXOR63 %HOR+RUL]RQWH0* %UDVtOLD') ,OKDEHOD63 5LRGH-DQHLUR5- %HOR+RUL]RQWH0* %DO&DPERUL~6& 6mR3DXOR63 &XULWLED35 3HUXtEH63 0RJLGDV&UX]HV63 3RoRVGH&DOGDV63 6mR3DXOR63 5LRGH-DQHLUR5- *XDUDWLQJXHWi63 &DMDPDU63 %UDVtOLD') 5LEHLUmR3UHWR63 6mR3DXOR63 &DPSLQDV63 3RUWR$OHJUH56 3RUWR$OHJUH56 2VDVFR63 3LUDFLFDED63 5LEHLUmR3LUHV63

Data de inscrição Até 01/07 $Wp   $WpDWOHWDV $Wp   $Wp   $Wp   $Wp   $Wp   $FRQ¿UPDU  $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $FRQ¿UPDU  $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   'LD   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp  

Valor Informações Donativos www.7cta.eb.mil.br (QFHUUDGDV  ZZZWULHVSRUWHVFRPEU 'H5D5 ZZZFRUSRUHRUJEU *UDWXLWR  ZZZDWLYRFRP 5  ZZZIDVKLRQUXQFRPEU 'H5D5   5  ZZZFRUUHGRUGHUXDFRPEU 'H5D5 ZZZFRUSRUHRUJEU 'H5D5 ZZZVHVFUVFRPEU *UDWXLWR  ZZZUVOVGUVFJRYEU 5  ZZZDWLYRFRP 5  ZZZFRUULGDVGHPRQWDQKDFRPEU 5NJDOLPHQWR ZZZVWUDFNVFRPEU 'H5D5 ZZZ\HVFRPFRPEU 'H5D5 ZZZUXQQHUEUDVLOFRPEU 5  ZZZFRUULGDGDIRJXHLUDFRPEU 'H5D5 ZZZUXQQHUEUDVLOFRPEU *UDWXLWR  ZZZDWLYRFRP 5    $FRQ¿UPDU  ZZZFRUSDHVSEU 5 ZZZFDPLQKDGDSHODLQFOXVDRFRPEU 'H5D5 ZZZFLUFXLWRGDVHVWDFRHVFRPEU 5  ZZZWUDFNDQG¿HOGFRPEU $FRQ¿UPDU  ZZZEVE¿WQHVVFRPEU *UDWXLWR  ZZZDWLYRFRP 'H5D5 ZZZFRUSRUHRUJEU 'H5D5 ZZZFLUFXLWRGDVHVWDFRHVFRPEU 'H5D5 ZZZDWLYRFRP *UDWXLWR  ZZZDWLYRFRP 5  ZZZYZEUFRPEU 'H5D5 ZZZWKHYHQWRVFRPEU 5  ZZZÀH[SHVSRUWFRPEU 5    *UDWXLWR  ZZZDWLYRFRP 'H5D5 ZZZFLUFXLWRGDVHVWDFRHVFRPEU 'H5D5   'H5D5   'H5D5 ZZZHFRUXQFRPEU 5NJDOLPHQWR   (VJRWDGD  ZZZDWLYRFRP 'H5D5 ZZZFRUULGDGDORQJHYLGDGHFRPEU 'H5D5   'H5D5 ZZZFRUSDHVSEU 'H5D5 ZZZUXQQLQJIRUQDWXUHFRP 5OOHLWH   'H5D5 ZZZDWLYRFRP

AGOSTO Dia Prova  &RUULGD3HGHVWUH&LGDGHGH*DUoD±NP  &LUFXLWRGH&RUULGDVGD&$,;$±HNP  &LUFXLWR6(0(GH&RUULGDGH5XD±NP  &LUFXLWR0L]XQR0LOKDV%UDVLO  7UDFN )LHOG5XQ6HULHV5LEHLUmR6KRSSLQJ±NP  9,,&,&255(  ,&RUULGDH&DPLQKDGD9LYDD/DUDQMD±NP  ;;,,,&RUULGDGR3RUWR)HUUHLUD)XWHERO&OXEH  &RUULGD,QIDQWLOGD)DPLOLD&RUGI  &RUULGDH&DPLQKDGD&RQWUDR&kQFHUGH0DPD±NP  ;,9&RUULGD&RUSRUH&HQWUR+LVWyULFR±NP  &LUFXLWR6(0(GH&RUULGDGH5XD±NP  &LUFXLWRGD/RQJHYLGDGH%UDGHVFR  &RUULGD0~OWLSOD(00RYLPHQWR±HNP  .P&LGDGHGH-D~  'H]0LOKDV*DURWR±NP  $OSKDYLOOH5XQQLQJ HWDSD   &LUFXLWR6(0(GH&RUULGDGH5XD±NP  &LUFXLWRGDV3UDLDV(WDSD±NP  &RUULGD7URIpX'XTXHGH&D[LDV±HNP  6WUHHW5XQ$%&&KDOOHQJHHWDSD±HNP

Local *DUoD63 %HOR+RUL]RQWH0* 6mR3DXOR63 6mR3DXOR63 5LEHLUmR3UHWR63 5HFLIH3( 1LWHUyL5- 3RUWR)HUUHLUD63 %UDVtOLD') 6mR3DXOR63 6mR3DXOR63 6mR3DXOR63 %DXUX63 *RLkQLD*2 -D~63 9LWyULD(6 %DUXHUL63 6mR3DXOR63 %HUWLRJD63 6mR3DXOR63 6WR$QGUp63

Data de inscrição $Wp   $Wp   $Wp   $WpDWOHWDV $Wp   $Wp   $Wp   $Wp   $FRQ¿UPDU  $Wp   $Wp   $Wp   $FRQ¿UPDU  $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp   $Wp  

Valor Informações 5    'H5D5 ZZZFLUFXLWRFDL[DFRPEU *UDWXLWR  ZZZDWLYRFRP 'H5D5 ZZZPLOKDVFRPEU 5  ZZZWUDFNDQG¿HOGFRPEU 5  ZZZDWLYRFRP 'H5D5   'H5D5 ZZZFRUSXVHYHQWRVFRPEU $FRQ¿UPDU  ZZZFRUGIFRPEU 5  ZZZ\HVFRPFRPEU 'H5D5 ZZZFRUSRUHRUJEU *UDWXLWR  ZZZDWLYRFRP $FRQ¿UPDUZZZFRUULGDGDORQJHYLGDGHFRPEU 'H5D5 ZZZZHEUXQFRPEU 5  ZZZUXQQHUEUDVLOFRPEU 5  ZZZJDURWRFRPEU 5  ZZZ]DUUREUDVLOFRPEU *UDWXLWR  ZZZDWLYRFRP 'H5D5   'H5D5 ZZZFRUSRUHRUJEU 5  ZZZDWLYRFRP


            

&RUULGD,QWHUQDFLRQDO0DWLODW1DUGLQL±NP &LUFXLWR%DUGR0DQpGH&RUULGDVGH5XD &LUFXLWR6(0(GH&RUULGDGH5XD±NP &LUFXLWRGDV(VWDo}HV3ULPDYHUD &RUULGD79%&DPSLQDV±NP &RUULGDGR/DJR6XO &RUULGD5~VWLFDH&DPLQKDGDGH6DSXFDt0LULP±HNP 1LVVDQ;7(55$1LJKW7UDLO5XQ 1LVVDQ;7(55$.LGV5XQQLQJ &LUFXLWRGH&RUULGDVGD&$,;$±HNP &RUULGD$QRV81,)$/±NP &LUFXLWRGD/RQJHYLGDGH%UDGHVFR &LUFXLWR6(0(GH&RUULGDGH5XD±NP

&DWDQGXYD63 *XDUDWLQJXHWi63 6mR3DXOR63 3RUWR$OHJUH56 &DPSLQDV63 %UDVtOLD') 6DSXFDt0LULP0* $QJUD5- $QJUD5- 3RUWR$OHJUH56 $OIHQDV0* 6-RVp5LR3UHWR63 6mR3DXOR63

$FRQ¿UPDU  'LD   $Wp   $Wp   $FRQ¿UPDU  $FRQ¿UPDU  $WpDWOHWDV $Wp   $Wp   $Wp   $Wp   $FRQ¿UPDU  $Wp  

$FRQ¿UPDU  ZZZPDWLODWFRPEU 5    *UDWXLWR  ZZZDWLYRFRP 'H5D5 ZZZFLUFXLWRGDVHVWDFRHVFRPEU $FRQ¿UPDUZZZWYEFRPEU 'H5D5 ZZZIUHHFRUQHUFRPEU 'H5D5 ZZZDFRVPFRPEU 'H5D5 ZZZ[WHUUDEUD]LOFRP 5  ZZZ[WHUUDEUD]LOFRP 'H5D5 ZZZFLUFXLWRFDL[DFRPEU 'H5D5 ZZZUXQQHUEUDVLOFRPEU $FRQ¿UPDU ZZZFRUULGDGDORQJHYLGDGHFRPEU *UDWXLWR  ZZZDWLYRFRP

Local 6mR3DXOR63 %DO&DPERUL~6& 6mR3DXOR63 6mR3DXOR63 5HFLIH3( 3RUWR$OHJUH56 6mR3DXOR63 %UDVtOLD') 3RUWR$OHJUH56 6mR3DXOR63 1RYD)ULEXUJR5- 5LEHLUmR3UHWR63 0RQJDJXi63 6mR3DXOR63 )RUWDOH]D&( 6mR3DXOR63 6mR9LFHQWH63 %HOR+RUL]RQWH0*

Data de inscrição $FRQ¿UPDU  $Wp   $Wp   $Wp   $Wp   $FRQ¿UPDU  $Wp   $FRQ¿UPDU  $Wp   $FRQ¿UPDU  $Wp   $FRQ¿UPDU  $Wp   $Wp   $Wp   $FRQ¿UPDU  $Wp   $FRQ¿UPDU 

Valor Informações $FRQ¿UPDU  ZZZFRUSRUHRUJEU 'H5D5 ZZZOXL]IHOLFLRFRP 'H5D5ZZZMMVHYHQWRVFRPEU 'H5D5 ZZZ\HVFRPFRPEU 5  ZZZDWLYRFRP $FRQ¿UPDU  ZZZWUDFNDQG¿HOGFRPEU *UDWXLWR  ZZZDWLYRFRP $FRQ¿UPDU  ZZZFRUUHGRUGHUXDFRPEU 'H5D5 ZZZFRUSDHVSEU $FRQ¿UPDU  ZZZFRUSRUHRUJEU 'H5D5 ZZZSURGHVSRUWHFRPEU $FRQ¿UPDUZZZFRUULGDGDORQJHYLGDGHFRPEU 'H5D5 ZZZUXQQHUEUDVLOFRPEU *UDWXLWR  ZZZDWLYRFRP 'H5D5 ZZZFLUFXLWRFDL[DFRPEU $FRQ¿UPDU  ZZZFDLUEDUVFKXWHORUJ 5    $FRQ¿UPDU  ZZZWUDFNDQG¿HOGFRPEU

JULHO Dia Prova  0HLD0DUDWRQD&DWDUDWDVGR,JXDoX  ,90HLD0DUDWRQD&RUUH5HFLIH  0HLD0DUDWRQDGDVÈJXDV±NP  0HLD0DUDWRQDGH&DPSLQDV

Local )R]GR,JXDoX35 5HFLIH3( 3RoRVGH&DOGDV0* &DPSLQDV63

Data de inscrição $Wp   $Wp   $Wp   $Wp  

Valor 'H5D5 5  5  'H5D5

AGOSTO Dia Prova  0HLD0DUDWRQD&LGDGHGH6mR%HUQDUGRGR&DPSR  0HLD0DUDWRQD$7ULEXQD  0HLD0DUDWRQDGH%OXPHQDX

Local 6%HUQDUGR&DPSR63 3UDLD*UDQGH63 %OXPHQDX6&

Data de inscrição $Wp   $FRQ¿UPDU  $Wp  

Valor Informações 'H5D5 ZZZFRUSRUHRUJEU $FRQ¿UPDU  ZZZWULHVSRUWHVFRPEU 'H5D5ZZZPHLDPDUDWRQDEOXPHQDXFRPEU

SETEMBRO Dia Prova  0HLD0DUDWRQD5~VWLFDGH*XDULED  ;,,,0HLD0DUDWRQD,QWHUQDFLRQDOGR5LRGH-DQHLUR  0HLD0DUDWRQDGDV3RQWHV±HNP

Local *XDULED63 5LRGH-DQHLUR5- 6mR3DXOR63

Data de inscrição $Wp   $Wp   $Wp  

Valor *UDWXLWD  'H5D5 5 

Informações ZZZUXQQHUEUDVLOFRPEU ZZZ\HVFRPFRPEU  

JULHO Dia Prova  5XQ'D\0DUDWRQD%UDVtOLD±HNP

Local %UDVtOLD')

Data de inscrição $Wp  

Valor 5

Informações ZZZPNVHVSRUWHVFRPEU

AGOSTO Dia Prova  .%RPELQKDV$GYHQWXUH0DUDWKRQ

Local %RPELQKDV6&

Data de inscrição $Wp  

Valor Informações 'H5D5 ZZZERPELQKDVUXQQHUVFRPEU

SETEMBRO Dia Prova  0DUDWRQDGDV3UDLDV%HUWLRJD

Local %HUWLRJD63

Data de inscrição $Wp  

Valor 'H5D5

SETEMBRO Dia Prova  &RUULGD&RUSRUH:7&±HNP  5~VWLFD3DQRUkPLFD'HFNGD%DUUDGR1RUWH±HNP  7URIpX,QGHSHQGrQFLDGR%UDVLO±NP  &RUULGD3HOD3D]&DL[D±HNP  9,,,&,&255(  7UDFN )LHOG5XQ6HULHV6KRSSLQJ,JXDWHPL±NP  &LUFXLWR6(0(GH&RUULGDGH5XD±NP  &RUULGDGRV)X]LOHLURV1DYDLV  &RUULGDGH$QLYHUViULRGD6RJLSD±HNP  &RUULGD,QIDQWLO  &URVV&RXQWU\GH1RYD)ULEXUJR$GYHQWXUH5-  &LUFXLWRGD/RQJHYLGDGH%UDGHVFR  &LUFXLWR0RQJDJXiGH&RUULGDV(WDSD±NP  &LUFXLWR6(0(GH&RUULGDGH5XD±NP  &LUFXLWRGH&RUULGDVGD&$,;$±HNP  &RUULGDH&DPLQKDGD³4XLO{PHWURVGH6ROLGDULHGDGH´  3URYD(FROyJLFD,OKD3RUFKDW±NP  7UDFN )LHOG5XQ6HULHV%+6KRSSLQJ±NP

MEIA MARATONA Informações ZZZSURFRUUHURUJEU ZZZFRUUHGRUHVGRUHFLIHFRPEU   ZZZWYEFRPEU

MARATONA

71

SUPERAÇÃO



Informações ZZZWKHYHQWRVFRPEU


calendรกrio REVEZAMENTO JULHO Dia Prova  0DUDWRQD%HWR&DUUHURยฑNP  ย0DUDWRQD3mRGH$o~FDUGH5HYH]GH)RUWDOH]D  %UDVtOLD0XOWLVSRUW'HVDยฟRQR&HUUDGRยฑHNP

Local 3HQKD6& )RUWDOH]D&( %UDVtOLD')

Data de inscriรงรฃo $Wp   $Wp   $Wp  

Valor 'H5D5 'H5D5 'H5D5

Informaรงรตes ZZZPDUDWRQDEHWRFDUUHURFRPEU ZZZPDUDWRQDGHUHYH]DPHQWRFRPEU ZZZYLYDEUDVLOLDFRP 

AGOSTO Dia Prova  ย0DUDWRQD3mRGH$o~FDUGH5HYH]GH%UDVtOLD  ยž5HYH]DPHQWR9ROWDGH6mR)UDQFLVFRยฑNP  &RUSRUDWH5XQ  0HLD0DUDWRQDGH5HYH](FR5XQ

Local %UDVtOLD') 6)UDQFLVFR6XO6& 6mR3DXOR63 6DOYDGRU63

Data de inscriรงรฃo $Wp   $Wp   $Wp   $WpDWOHWDV

Valor 'H5D5 'H5D5 5  'H5D5

Informaรงรตes ZZZPDUDWRQDGHUHYH]DPHQWRFRPEU ZZZHFRร€RULSDFRP ZZZFRUSRUDWHUXQFRPEU ZZZHFRUXQFRPEU

SETEMBRO Dia Prova  0HLD0DUDWRQDGH6DOYDGRUGH5HYH]DPHQWR  ย0DUDWRQD3mRGH$o~FDUGH5HYH]GH6mR3DXOR  $YHQWXUD&DPSRVGR-RUGmRยฑNP  6XSHUNPGH5HYH]DPHQWRยฑ(WDSD%UDVtOLD

Local 6DOYDGRU0* 6mR3DXOR63 &DPSRVGR-RUGmR63 %UDVtOLD')

Data de inscriรงรฃo $Wp   $Wp   $FRQยฟUPDU  $Wp  

Valor 'H5D5 'H5D5 $FRQยฟUPDU  'H5D5

Informaรงรตes ZZZ\HVFRPFRPEU ZZZPDUDWRQDGHUHYH]DPHQWRFRPEU ZZZFRUSRUHRUJEU ZZZ\HVFRPFRPEU



Informaรงรตes ZZZFEDWRUJEU

PROVAS DE PISTA JULHO Dia Prova  &DPS%UDVLOHLURV&DL[DGH$WOHWLVPRGH-XYHQLV

Local 8EHUOkQGLD0*






PROVAS INTERNACIONAIS MEIA MARATONA AGOSTO Dia Prova  0HGLD0DUDWyQGH%RJRWi

Local &RO{PELD

Informaรงรตes ZZZPHGLDPDUDWRQERJRWDFRP

SETEMBRO Dia Prova  )MRUG1RUZD\+DOI0DUDWKRQ  WK1LNH%XGDSHVW,QWยถO+DOI0DUDWKRQ  0HGLR0DUDWyQ$WODVGH*XDGDODMDUD  3LOD,QWยถO+DOI0DUDWKRQ  *UHDW6FRWWLVK5XQ+DOI0DUDWKRQ  5HHERN%ULVWRO+DOI0DUDWKRQ  6WRFNKROP+DOI0DUDWKRQ  1RYRVLELUVN+DOI0DUDWKRQ  0HGLD0DUDWRQ,QWยถO&LXGDGGH0HGHOOLQ  7XULQ+DOI0DUDWKRQ  ;;,0HGLD0DUDWyQGH%XHQRV$LUHV  573+DOI0DUDWKRQRI3RUWXJDO  'H[LD%LO5RXWHGX9LQ+DOI0DUDWKRQ

Local 1RUXHJD +XQJULD 0p[LFR 3RO{QLD *Um%UHWDQKD *Um%UHWDQKD 6XpFLD 5~VVLD &RO{PELD ,WiOLD $UJHQWLQD 3RUWXJDO /X[HPEXUJR

Informaรงรตes ZZZNQDUYLNPLODQR ZZZEXGDSHVWPDUDWKRQFRP ZZZPHGLRPDUDWRQDWODVFRP ZZZSLODKDOIPDUDWKRQSO ZZZUXQJODVJRZRUJ ZZZEULVWROKDOIPDUDWKRQFRP ZZZVWRFNKROPKDOIPDUDWKRQVH ZZZPDUDIRQQVNUX KWWSPDUDWRQPHGHOOLQFRP ZZZWXULQPDUDWKRQLW ZZZFKDPSLRQFKLSFRPDU ZZZPDUDWRQDFOXEHGHSRUWXJDOFRP

KWWSURXWHGXYLQUWOOX

MARATONA JULHO Dia Prova  =HUPDWW0DUDWKRQ  *ROG&RDVW$LUSRUW0DUDWKRQ  7KH*UHDW7LEHWDQ0DUDWKRQ  6ZLVV$OSLQH0DUDWKRQ'DYRV  6DQ)UDQFLVFR0DUDWKRQ

                    

5XVND0DUDWRQ 7RUVKDYQ0DUDWKRQ .DXDยถL0DUDWKRQDQG+DOI 0DUDWRQ:URFODZ 0RVFRZ,QWยถO3HDFH0DUDWKRQ 9LOQLXV0DUDWKRQ +DOI 7DOOLQQ0DUDWKRQ +DQV&KULVWLDQ$QGHUVHQ0DUDWKRQ 6\GQH\0DUDWKRQ UHDO%HUOLQ0DUDWKRQ 'DPWRW'DPORRS 0DXL0DUDWKRQ +DOI0DUDWKRQ 9DUD]GLQVNL3ROXPDUDWKRQ 0DUDWRQ/HRQ,QGHSHQGHQFLD 0DUDWRQGHOD&LXGDGGH0p[LFR 1HGEDQN&DSH7RZQ0DUDWKRQ /DNH7DKRH0DUDWKRQ 6FRWLDEDQN7RURQWR0DUDWKRQ +DOI ,QWHUQDWLRQDO/DNH*DUGD0DUDWKRQ )RUWLV6LQJHOORRS8WUHFKW 0DUDWRQLQDยณ&LWWD'L8GLQHยด

)LQOkQGLD ,OKDV)DURH (8$ 3RO{QLD 5~VVLD /LWXkQLD (VW{QLD 'LQDPDUFD $XVWUiOLD $OHPDQKD +RODQGD (8$ &URiFLD 0p[LFR 0p[LFR รˆIULFDGR6XO (8$ &DQDGi ,WiOLD +RODQGD ,WiOLD

ZZZUXVNDPDUDWRQFRP KWWSWRUVKDYQPDUDWKRQFRP ZZZWKHNDXDLPDUDWKRQFRP ZZZZURFODZPDUDWRQSO ZZZPDUDIRQPVNUX ZZZPDUDWRQDVOW ZZZMRRNVHH ZZZKFDPDUDWKRQGN ZZZUXQWKHEULGJHFRPDX ZZZUHDOEHUOLQPDUDWKRQFRP ZZZGDPORRSQO ZZZPDXLPDUDWKRQFRP ZZZPDUDWKRQKU ZZZPDUDWRQLQGHSHQGHQFLDFRPP[

ZZZPDUDWRQGIJREP[ ZZZZSDRUJ]D ZZZODNHWDKRHPDUDWKRQFRP ZZZWRURQWRZDWHUIURQWPDUDWKRQFRP

ZZZODNHJDUGDPDUDWKRQFRP KWWSDWKOHWLFQOVLQJHOORRSQO ZZZPDUDWRQLQDGLXGLQHLW

PROVAS DE PISTA Local 6XtoD $XVWUiOLD &KLQD 6XtoD (8$

Informaรงรตes ZZZ]HUPDWWPDUDWKRQFK ZZZJROGFRDVWPDUDWKRQFRPDX ZZZJUHDWWLEHWDQPDUDWKRQFRP ZZZVZLVVDOSLQHFK ZZZUXQVIPFRP

AGOSTO Dia Prova Local  6LEHULDQ,QWHUQDWLRQDO0DUDWKRQ 5~VVLD  0DUDWyQ,QWHUQDFLRQDO&LXGDGGH3DQDPi 3DQDPi  +HOVLQNL&LW\0DUDWKRQ )LQOkQGLD  ,1*(GPRQWRQ0DUDWKRQ &DQDGi  5H\NMDYLN0DUDWKRQ ,VOkQGLD  0DUDWRQDH0HLD0DUDWRQDGH3DUN&LW\ (8$  6644XHEHF&LW\0DUDWKRQ &DQDGi  +RNNDLGR0DUDWKRQ -DSmR

Informaรงรตes KWWSUXQVLPUX ZZZPDUDWKRQSDQDPDFRP ZZZKHOVLQNLFLW\PDUDWKRQยฟ ZZZHYHQWVUXQQLQJURRPFRP ZZZPDUDWKRQLV ZZZSFPDUDWKRQFRP ZZZTXHEHFPDUDWKRQFRP ZZZDLPVDVVRFLDWLRQRUJ

ULTRAMARATONA

SETEMBRO Dia Prova  -XQJIUDX0DUDWKRQ

Informaรงรตes ZZZMXQJIUDXPDUDWKRQFKZV

JULHO Dia Prova  8OWUD0DUDWRQD$WOkQWLFD0HOLGHV7UyLD

Local 6XtoD

JULHO Dia Prova  &DPSHRQDWRV0XQGLDLVGH0HQRUHV  &DPS6XO$PHULFDQRVGH-XYHQLV

Local ,WiOLD 9HQH]XHOD

Informaรงรตes ZZZFEDWRUJEU ZZZFEDWRUJEU

AGOSTO Dia Prova  &DPSHRQDWR0XQGLDOGH$WOHWLVPR

Local $OHPDQKD

Informaรงรตes ZZZFEDWRUJEU

SETEMBRO Dia Prova  )LQDO0XQGLDOGR$WOHWLVPR

Local *UpFLD

Informaรงรตes ZZZFEDWRUJEU

Local 3RUWXJDO

XOWUDPDUDWRQDDWODQWLFDEORJVSRWFRP

Informaรงรตes


Consumo mĂĄximo de oxigĂŞnio

S

74 16

empre vale recordar os principais conceitos relacionados ao desempenho aeróbio. Por meio desses conhecimentos cresce a possibilidade do desenvolvimento de potencialidades físicas, com EDVH HP DVSHFWRV FLHQWt¿FRV SRU PHLR GH atividades de treino. O consumo måximo de R[LJrQLR 92PD[ pXPSDUkPHWUR¿VLROygico de carga muito utilizado no esporte em geral, sobretudo para esportes aeróbios. O que Ê VO2max? VO2max ou capacidade aeróbia Ê o limite måximo da habilidade de uma pessoa gerar energia por meio das vias oxidativas. O VO2max Ê uma medida de nossa capacidade para obter oxigênio do ar para ser utilizado no músculo, produzindo, assim, energia aeróbia. Em simples palavras, o VO2max mede o quão apto estå o sistema cardiovascular. É possível calcular o VO2max com base em resultados de corridas, segundo Costill (2002). Por exemplo, se o tempo atual de uma milha (1.609m) para um determinado indivíduo Ê 5min45, calcula-se utilizando a seguinte fórmula: 133,61 – (13,89 x tempo em minutos). Assim, o cålculo estimado do VO2max de acordo com a fórmula projeta um valor relativo de 53,74ml/ kg/min. Existem fórmulas para marcas em duas milhas, seis milhas e 10km, respectivamente 128,81 – (5,95 x tempo em minutos), 120,62 – (1,59 x tempo em minutos) e 120,9 – (1,54 x tempo em minutos). Em recente estudo de Swain & Franklin (2002), as pessoas com valores de VO2max inicial abaixo de 40ml/kg/min, após treinamento em intensidades entre 28 a 32% da frequência cardíaca de reserva, mostraUDPVLJQL¿FDQWHVPHOKRUDVQRVYDORUHVGRSDUkPHWUR Entretanto, para aqueles com valores de VO2max aproximado de 40ml/kg/min e intervenção de treino em intensidades abaixo de 46% da frequência cardíaca GHUHVHUYDQmRIRLLGHQWL¿FDGDPHOKRUDQDFDSDFLGDde måxima aeróbia. A frequência cardíaca de reserva Ê a frequência cardíaca måxima menos a frequência de repouso. Por exemplo: uma frequência cardíaca måxima de 160bpm menos uma frequência cardíaca de repouso de 60bpm equivale a 100bpm. Realizar o exercício a 28% da frequência cardíaca de reserva colocaria o ritmo cardíaco a 88bpm (28% de 100bpm, somado o ritmo cardíaco de descanso de 60bpm). Investigadores da Universidade de Queensland,

ALTO RENDIMENTO Prof. Ms. Ricardo Antonio D’Angelo

Austrålia, descobriram que Ê possível melhorar o VO2max correndo a uma velocidade de consumo de 60% do Tmax (tempo durante o qual mantÊmse a velocidade de VO2max). A recuperação deverå compreender a mesma duração que a velocidade do esforço de VO2max. Por exemplo: se o tempo gasto correndo Ê de 2min45, a recuperação (um trote lento) deve ser de 2min45 (Anderson, 2002). Durante uma importante parte do tempo de recuperação, o ritmo FDUGtDFRSHUPDQHFHUiPXLWRDOWR8PDYH]¿QDOL]DGR o tempo de recuperação, deverå ser possível repetir o esforço vårias vezes. Com a frequência e regularidade do exercício, a tendência serå o aumento contínuo do número de repetiçþes. O volume de corrida percorrido durante o treinamento Ê um fator determinante para o desenvolvimento da resistência aeróbia, entretanto, o êxito da corrida depende, em grande parte, da qualidade e da velocidade do treinamento. A corrida lenta de longa distância se realiza a um ritmo consideravelmente mais lento que o ritmo de competição. Tal treinamento não alcança o desenvolvimento de padrþes neurológicos de UHFUXWDPHQWRGH¿EUDVPXVFXODUHVVROLFLWDGRVGXUDQte as competiçþes. O treinamento para as competiçþes UHTXHUXPULWPRPDLVUiSLGRXPDYH]TXHDV¿EUDV musculares exigidas serão diferentes de acordo com a velocidade da corrida. Os atletas que só treinam a uma velocidade menor que o ritmo de competição, SRUVXDYH]QmRUHFUXWDPWRGDVDV¿EUDVPXVFXODUHV SDUDDOFDQoDUDH¿FiFLDQHFHVViULDSDUDDFRPSHWLomR (Costill & Trappe, 2002). 5HIHUrQFLD %LEOLRJUi¿FD Jones E. Warren. VO2 Max: What Is It? How Do You Develop It?. NSCA’s Performance Training Journal, 2003. Prof. Ms. Ricardo Antonio D’Angelo Ê Doutorando em Biodinâmica do Movimento e Esporte, UNICAMP-2008 e Treinador Coordenador do Clube de Atletismo BM&FBOVESPA.


Aninha jรก sabe escrever o prรณprio nome.

11 reais

0300 789 3801 Doe Agora! Rita Aninha Aninha & Rita

Mas a Rita ainda

nรฃo teve essa sorte.

16 reais

0300 789 3802


RJ Classic a

22 Corrida dos

Fuzileiros Navais 5 KM, 10 KM E 20 KM Data: 19 de julho de 2009

Local: Aterro do flamengo Arena montada em frente ao monumento aos expedicionários da 2ª guerra mundial

Programação: 6h00 - início do evento - abertura do guarda-volumes 8h00 - largada geral todas as distâncias 10h00 - cerimônia de premiação

Valor da Inscrição: R$ 40,00 - associado corpore R$ 50,00 - não associado

Informações e inscrições: www.corpore.org.br PATROCÍNIO:

REALIZAÇÃO:


Revista Superação Ed. 77