Page 1

Aniversary 1 Oktober 2000 - 2014

KAMIS 5 MARET 2015 24 HALAMAN

Dumai Pos

ECERAN RP 3000 14 Jumadil Awwal 1436 H

Harga Langganan Rp 65.000 ( dalam kota) Luar Kota + Ongkos Kirim

PERTAMA DAN TERBESAR DI RIAU PESISIR

BIAYA HAJI BISA TURUN 3 JUTA „ BACA KE HAL

6

PILKADA SERENTAK DI RIAU DANA RP190 M, TAPI BANYAK PERSOALAN

86 Titik Api Baru di Riau LAPORAN : YANDI PEKANBARU PEKANBARU (DP) - Hujan yang mengguyur beberapa wilayah di Riau beberapa hari yang lalu belum cukup ampuh untuk mengurangi jumlah titik api di Riau. Bahkan jumlah titik a p i terpantau bertambah.

„ BACA KE HAL

P EN G U M U M A N CALON PESERTA JKN KECAMATAN DUMAI KOTA LIHAT HALAMAN 3-4 DAN 5

Beberapa daerah yang nihil titik api, kini mulai menyumbang titik api. Beberapa daerah juga mulai diselimuti kabut asap. Badan Meteorologi Klimatologi dan Geofisika, Rabu (24/3) menyatakan satelit Terra dan Aqua mendeteksi 86 titik panas atau “hotspot” yang menjadi indikasi kebakaran lahan dan hutan tersebar di Provinsi Riau pada Rabu. Dari kesemuanya, terdapat 55 titik yang memiliki tingkat keakuratan di atas 70 persen yang artinya adalah sumber kebakaran. “Data terbarui pada 4 Maret 2015 pukul 07.00 WIB menunjukan secara

„ BACA AGUNG KLAIM KE HAL 6

F:NET

B A CL A 6 HA

CUACA PANAS DIPERKIRAKAN BERAKHIR JUNI Pemilik Rumah Makan BPK Tewas Ditikam

Kejati Sita Ratusan Berkas Kasus Jembatan Pedamaran BAGANSIAPIAPI (DP) - Penyidik Kejaksaan Tinggi Provinsi Riau menyita sekitar 320 berkas terkait kasus dugaan korupsi Jem-

6

PEKANBARU - Rosmawati Boru Ginting, 30, harus meregang nyawa dalam perjalan menuju dikenal

batan Pedamaran I dan II di kantor pemerintahan Kabupaten Rokan

„ BACA KEJATI SITA RATUSAN KE HAL 6

F:NET

„ BACA PEMILIK KE HAL 6

„ Mengenal Badrodin Haiti di Kampunguya Jember

AnakPriyayiyangPakaiSepatuLarsLoak AZAN Magrib kurang 10 menit lagi ketika Jawa Pos (grup Sumut Pos) tiba di sebuah rumah sederhana di pertigaan yang menghubungkan Desa Gambirono, Bangsalsari, dengan Desa Paleran, Umbulsari, Jember. Laporan: HARI SETIAWAN, Jember

R

UMAH model kuno dan bercat kuning itu tampak tertutup rapat. Hanya ada seorang perempuan yang tengah mengepel teras musala di samping rumah itu. Rumah tersebut memiliki hala

Jl. Jendral Sudirman No. 88 Dumai, 28812, Riau-Indonesia T. +62765 31999 F. +62 765 36688 E. sales_dumai@grandzuri.com

„ BACA ANAK PRIYAYI KE HAL 6

REDAKTUR: GENTA MUKARRAM

website:www.dumaipos.co

email: dumaipos123@yahoo.com

TATA LETAK :JOKO


2

INTER-NASIONAL

Dumai Pos

KAMIS, 5 MARET 2015

NADJIB TEGASKAN

INDONESIA Sedih Atas Eksekusi Bali Nine JAKARTA(DP)— Duta Besar Indonesia untuk Australia Nadjib Riphat Kesoema menegaskan, rencana eksekusi terhadap dua terpidana mati Bali Nine bukan hanya menyedihkanbagiwargaAustralia, namunjugabagiIndonesia. Kepada wartawan di Perth, Rabu (4/3),DubesNadjibmenyatakan Nadjib Riphat dewasa ini terjadi diskusi luas di Kesoema Indonesiamengenaiefektivitaspidana hukumanmati. DubesIndonesiaNadjibRiphatKesoemadiPerth,Rabu (4/3)“Kamibukannyasenangdenganeksekusitersebut,” katanya. “Di Indonesia saat ini terjadi diskusi luas dan perdebatan mengenai isu hukuman mati, dan saya kira anda bisa melihat hasilnyadalamtempodekat,”tambahDubesNadjib. Karena itu, ia meminta semua pihak untuk memahami posisiIndonesiaatasmasalahini. DubesNadjibmengutipbanyaknyawargaIndonesiayang menjadi korban narkoba, dan meminta agar para korban ini jugaharusdiingat. Ia berada di Perth untuk memberikan ceramah dalam sebuahsebuahforumbisnis.(nwk/nwk) F:NET

Sarankan PM Australia

Sejarah

Hari Ini Dalam

Bunuh Diri

4-3-1849: DAVID RICE ATCHISON SEHARI JADI PRESIDEN AS

Hampir semua presiden Amerika Serikat (AS) dilantik pada 4 Maret, kecuali Zachary Taylor yang semestinya dilantik untuk menggantikan James K. Polk pada 4 Maret 1849. Dia menolak dilantik pada hari Sabat. Oleh karena itu, seperti dikutip dari laman History, Taylor dan wakilnya baru dilantik pada 5 Maret 1849. Persoalannya adalah, siapa yang harus menjabat sebagai presiden selama 24 jam sebelumnya. Akhirnya David Rice Atchison ditunjuk untuk menjabat sebagai presiden ke-12 AS. Senator Demokrat pendukung perbudakan dari Missouri itu dilantik menjadi presiden sementara oleh Senat pada 2 Maret. Pelantikan Atchison itu sesuai dengan undang-undang 1792, yang mengatur bahwa pemimpin Senat berada di urutan ketiga garis suksesi, bila presiden dan wakil presiden berhalangan. Perdebatan yang muncul dari kalangan ahli hukum hingga saat ini adalah, penunjukkan Atchison sebagai presiden karena posisinya di Senat. Namun periode pertamanya sebagai senator berakhir pada 4 Maret.(vv/wan)

„ Para Miliarder Ini Minta Maaf „ Terkait Rencana Pemotongan Dana Pendidikan Laporan : DP/NET, Australia MILIARDER asal Australia, Clive Palmer, akhirnya meminta maaf kepada Perdana Menteri, Tony Abbot. Sebelumnya, Palmer menyuruh agar Abbot bunuh diri setelah pemerintah mengusulkan pemangkasan dana untuk universitas, mengutip The Sydney Morning Herald, Rabu (4/3).

 Jagat Unik

Sentuh Dada Wanita, Biksu Dikecam

F:NET

SEORANG biksu Buddha di Thailand mendapat banyak kecaman, setelah beredarnya foto biksu itu sedang menyentuh payudara seorang wanita, yang belakangan terungkap sebenarnya adalah waria. Dilansir dari Daily Mail, Selasa, 3 Maret 2015, foto diunggah pada media sosial Facebook pekan lalu, memicu kemarahan ratusan ribu orang yang melihatnya, menuduh biksu itu telah melanggar sumpah selibat. Tapi wanita pada foto itu, akhirnya bersuara untuk membela sang biksu. Dia mengatakan bahwa dirinya terlahir sebagai pria dan sedang menjalani terapi hormon, sehingga biksu itu sepenuhnya tidak bersalah. Pada wawancara dengan Morning News, waria itu mengaku telah menjalani terapi hormon yang membuat payudaranya membesar, namun belum melakukan operasi alat kelamin dan implan payudara. Dia mengatakan bahwa seseorang yang lahir dalam tubuh wanita, tidak akan pernah dapat mendekati seorang biksu menurut kepercayaan Buddha, serta tidak akan menginginkannya. Disebutkan bahwa biksu itu berasal dari sebuah kuil di Kamboja, yang memimpin upacara pemberkatan pada rumah keluarganya di Bangkok, di mana penulisan pesan pada tubuh termasuk sebagai bagian dari acara. Pesan untuk pria ditulis pada bagian dada, sementara bagi wanita akan ditulis pada kening. Namun karena masih memiliki tubuh laki-laki, maka waria itu memutuskan untuk bergabung dengan para pria.(vv/wan)

Dumai Pos Semangat Riau Pesisir

Diterbitkan Oleh: PT. DUMAI INTERGRAFIKA PERS.

Kemarin, Palmer yang juga politisi dari Palmer United Party itu menolak rencana pemerintah yang akan memotong anggaran pendidikan tingkat perguruan tinggi. Pemerintah menyarankan agar perguruan tinggi menarik biaya kepada mahasiswa.

Clive Palmer

F:NET

JAKARTA(DP)- Kubu Agung Laksono pada hari ini, sekira pukul 12.00 WIB, berencana merekomendasikan hasil Mahkamah Partai Golkar ke Kementerian Hukum dan Hak Asasi Manusia (Kemenkumham). Menanggapi hal itu, Bendahara Umum Partai Golkar Bambang Soesatyo mengatakan agar lembaga yang dipimpin Yasonna Laoly itu tak gegabah menerima klaim dari kubu Agung Laksono. “Menkumham harus baca dulu amar putusan Mahkamah Partai. Sebab, Mahkamah Partai Golkar dalam amar putusannya menyatakan menerima eksepsi para termohon (Aburizal Bakrie cs) untuk sebagian,” ujar Bambang kepada

Okezone, di Jakarta, Rabu (4/3). Sekretaris Fraksi Golkar di DPR tersebut menambahkan, hasil Mahkamah Partai juga menyatakan permohonan para pemohon (Agung Laksono cs) tidak diterima. Sebab dalam pokok perkara, Mahkamah Partai menyatakan tidak dapat mengambil keputusan, karena tidak tercapai kesepakatan di antara empat hakimnya. “Hakim Andi Mattalatta dan Djasri Marin menyatakan Munas Ancol (Jakarta) yang sah, tapi harus mengakomodasi tokoh-tokoh dari Munas Bali. Sementara Hakim Muladi dan Natabaya punya pendapat yang berbeda dengan Andi dan Djasri. Muladi dan HAS Natabaya berpendapat, karena termohon Aburizal cs kasasi atas putusan sela PN Jakarta Barat, maka pihak ini menghendaki penyelesaian masalah melalui pengadilan,” paparnya. Oleh karena itu, Muladi dan Natabaya tidak mengemukakan pendapat munas mana yang sah. “Karena hakimnya ada empat dan ada dua pendapat berbeda yang masing-masing didukung dua hakim, maka sidang tida bisa ambil keputusan alias deadlock dalam menyelesaikan perselisihan internal Partai Golkar,” tegasnya.(fid/oz/wan)

Ajukan PK Praperadilan Komjen BG JAKARTA(DP)—Mantanpenasihat Komisi Pemberantasan Korupsi, Abdullah Hehamahua akan mendorong Pimpinan KPK untuk mengajukan Peninjauan Kembali atas putusan praperadilan Budi Gunawan. Abdullah mengakui bahwa pen-

gajuan PK tidak akan untuk mengambil alih membatalkan eksekusi kembali kasus itu,” kata pelimpahan perkara terAbdullah di Gedung KPK, sebut dari KPK kepada Jakarta, Rabu (4/3). Kejaksaan. Namun jika A b d u l l a h PK tersebut dikabulkan, mengungkapkan, KPK makamenurutAbdullah, sebagai lembaga penegak KPK akan berpeluang hukum bisa saja untuk mengambil alih mengajukan PK. Menurut kembaliperkaratersebut. dia, pihak Kejaksaan juga “Kalau keputusan PK sudahpernahmengajukan m e n g a b u l k a n Abdullah Hehamahua PK. permintaan KPK, munPresiden Joko Widodo gkin saja kemudian KPK berwenang sebelumnya meminta KPK tidak hanya

„ DEWAN REDAKSI: Sutrianto (Ketua), Mhd Darwis, Dawami Bukitbatu, Genta Mukaram, Bambang Rio, Yon Rizal Solihin,Miswanto, Syarifah Dian Eka Sari, Kaharuddin. Redaktur Pelaksana Miswanto, Syarifah Dian Eka Sari, Kaharuddin. Koordinator Liputan: Irmen Sani. Ass. Koordinator Liputan: Eriyus Amran. Redaktur: Fitriani, Rukiah Anita,Iwan Iswandi. Reporter Dumai: Defi Putri, Yandi, Nanang Juanda, A Rahmad D Tasa, Duri/Pinggir: Soleh, Ira Widana, Andika Maratona. Bengkalis: Taufik. Siak: Fitriadi (Koto Gasib). Perawang/Minas/Pekanbaru: Rinaldi, Sungai Pakning: Sapri, Meranti: Pauzi,Dewi Safitri Rokanhilir: Suparmin. Sekretaris Redaksi : Rio Dewilita

:

H Makmur SE. Ak. MM

Direktur

: :

Ngatenang H Sutrianto

General Manager/Pemimpin Umum

:

H Sutrianto

Deputy GM / Pemimpin Perusahaan

:

Mhd Darwis, SE

„ DEPARTEMEN LAYOUT DAN PERWAJAHAN : Joko Triatmo (Kadep), Chairil Habibie Psrb (Kabag), Elvia Susanti, Tria Viki, Dita Sari, Rahmat Fauzi, Edo Permata, Mardianto, Sasben Maulana, Okky Adhitya. „ BAGIAN PRACETAK dan MOUNTASE: Jefrizal (Plt Kabag) , Margono, Wan Rhomadi.

REDATUR: MISWANTO

:

Kambali

:

Genta Mukaram

:

Amirudin

Manager Iklan

:

Mirwan Jaafar

JAKARTA(DP)— Salah satu terpidana mati Raheem Agbaje Salami berwasiat agar dimakamkan di Madiun, Jawa Timur. Selain itu WN Spanyol ini berharap ketika dieksekusi tanpa penutup mata. “Dia lebih tegar menghadapi semuanya. Ia yakin bahwa imannya akan menguatkan dia sehingga tidak takut eksekusi. Bahkan, apabila diizinkan Raheem ingin menjalani hukuman mati tanpa harus ditutup matanya sambil berdoa,” kata pendamping rohani Raheem, Titus Tri Wibowo kepada wartawan di Madiun, Jawa Timur, Rabu (4/3). Permintaan terakhir itu ditulisnya sebanyak tiga lembar tertanggal 2 Maret 2015. Surat permohonan itu juga ditujukan kepada Kejaksaan Tinggi Jawa Timur, Kejaksaan Negeri Madiun, Kedutaan Besar Nigeria di Jakarta, kuasa hukumnya Utomo Karim, dan arsip. “Semua permintaan terakhir itu sudah diketik dan ditujukan kepada jaksa pelaksana eksekusi di Nusakambangan,”ungkapTitus. Raheem merupakan narapidana kasus narkoba yang dilayar dari Lapas Porong, Sidoarjo ke Lapas Madiun pada 2007. (cob/mrc/wan)

Mantan Penasihat Dorong KPK

Komisaris

Pemimpin Redaksi

konvensional maupun jejaring sosial, polemik soal itu terus bergulir. Tetapi, pengusaha batu bara itu akhirnya meminta maaf. Melalui akun Twitter-nya, @CliveFPalmer dia menyatakan, “Saya sengaja menggunakan istilah bunuh diri pada @TonyAbbottMHR, yang saya maksud adalah bunuh diri politik. Saya minta maaf atas pelanggaran yang terjadi.” (ren/wan)

Kubu Ical Minta Permintaan Terpidana Mati Raheem Menkumham tak Gegabah

Komisaris Utama

Wakil Pemimpin Redaksi Manager Pemasaran

Pada konferensi pers, Palmer mengatakan, “Ada jutaan siswa butuh pendidikan tinggi di negeri ini.... Kamu bunuh diri saja, Tony Abbot,” ujar Palmer kepada wartawan. Pernyataan Palmer tersebut langsung memicu polemik. Baik melalui media

„ BIRO PERWAKILAN DAERAH Kepala Biro Perwakilan Bengkalis: Taufik, Kepala Biro Perwakilan Siak: Rojikin, Kepala Biro Perwakilan Rokan Hilir: Eka Susila, Kepala Biro Perwakilan Meranti: Asy’ari Mahmud, Kepala Biro Perwakilan Duri: Yusrizal. „ TIM OMBUDSMAN : Syamsul Bahri Samin (Ketua), Moeslim Kawi, Akmal Famajra.

„ DEPARTEMEN IT, PORTAL ONLINE & JARINGAN : Vica Fitjuniery (Kadep), Chairil Habibie Psrb, Handoko, Rian Ardiansyah. „ DEPARTEMEN KEUANGAN/ADMINISTRASI DAN UMUM : Mhd Darwis (Manager), Hari Astuti (Kadep, Umum, Adm dan Personalia), Verra Susanti (Pjs Kadep Keuangan, Accounting & Fisikal), Dina Refika (Bendaharawan/Kasir), Indra Mahyuddin ( Kabag Umum), Agustami, Afriady.

fokus pada kasus Budi Gunawan saja, tapi juga harus memberikan perhatian pada korupsi di sektor maritim, pangan dan energi. Saat disinggung mengenai adanya arahan seperti, Abdullah menyebut bahwa Presiden Jokowi tidak mengerti Undang-Undang KPK. Menurut dia, Undang-Undang KPK sudah diatur mengenai skala prioritas. “Itu skala prioritas bisa saja, tapi petugas KPKitulimamenurutUndang-Undang. Nah,beritahudongPresiden,Andabaca dong UU KPK,” ujar dia. (ase)

„ BAGIAN PEMASARAN : Santi Degisca (Kadep Pemasaran), Arif Azmi (Koord Adm & Piutang

Koran) , Masdi (Kabag Pengembangan Koran Duri), Umaro Alfi (Pjs Kadep Langganan), Iwan Iswandi (Pjs Kadep Eceran), Surwandi (Kabag Penagihan), Roby Afrianto (Kabag Asongan), Ekki Juliadi (Kabag Ekspedisi)

„ BAGIAN IKLAN: Wizelmi (Kadep Pengembangan Iklan & EO), Lini Warzah ( Koord Adm & Personalia) Wihartanti (Kasir Iklan), Juwair (Koord Design Iklan), Afriansyah, Agustriadi (Koord Pengembangan Iklan)

„ TARIF IKLAN: Hitam Putih (B/W) Umum Display Rp 25.000,-/mm kolom/terbit. Iklan keluarga/duka cita Rp 6.000/mm kolom/terbit. Ucapan Selamat Rp.7.500/mm kolom/terbit. halaman muka Rp 45.000/ mm kolom (Max 7 klm X 100 mm). Iklan berwarna (spot colour, maks 2 warna) Rp 30.000/mm kolom. Iklan berwarna full colour Rp 35.000/mm kolom. Harga ditambah PPN 10 persen. Harga langganan Rp65.000/bulan (dalam Kota Dumai, luar kota tambah ongkos kirim) „ ALAMAT REDAKSI DAN SURAT-SURAT: Jalan MH Thamrin/Dock Yard Dumai, Telepon (0765) 34172, Jalan KH Ahmad Dahlan No. 14, Telepon (0761) 46749 „ BANK : Syari’ah Mandiri Nomor 095-000-3002a/n PT DUMAI INTERGRAFIKA PERS „ DICETAK PADA : PT Riau Pos Grafika. Isi diluar tanggungjawab percetakan Redaksi menerima tulisan karya asli,terjemahan, atau saduran (dengan menyebutkan sumber asli bagi karya terjemahan dan saduran). Panjang tulisan antara empat sampai enam halaman, diketik dengan spasi rangka dan menyertakan identitas diri. Naskah yang dimuat diberi imbalan.Redaksi berhak menyunting selagi tidak mengubah isi tulisan. „ Wartaawan Dumai Pos dilarang menerima uang maupun barang dari sumber berita. „ Wartaawan Dumai Po s dibekali dengan kartu pers/ surat keterangan ketika menjalankan tugas. „ Jika ada kejanggalan baik tentang identitas atau tindakan wartawan, dapat menghubungi sekretariat Redaksi Dumai Pos. TATA LETAK: JOKO


PENGUMUMAN

KAMIS 5 MARET 2015

3

Dumai Pos

Nama - nama Calon Peserta JKN di Kecamatan Dumai Kota KEL. RIMBA SEKAMPUNG NO 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360

NAMA

REDAKTUR: KAHARUDDIN

NO

RT

KASMAN CAN NURZAHERNI NONI HANDAYANI RIO SAPUTRA RIRI ANTIKA SARI BAYU FIRDAUS M. NOVRIYANDI RMDN KASWANDI AMIR AHMAD LILY PUSPASARI M. FAISHAL AHDA’U M. FARAOUQ EMIR FADIAH NAJA ZARIFAH M. FAIZ AL HARITZ FATMA NAWWAR RAFAA ROHANI M. HARIYANTO ZARINA ISMAIL NURSIAH MAHARANI M. RIZKI RAMADHAN BUR MARZANI AGUSRA EFENDI NIA MAYA SARI SIUL LIDIA ARLINI RISMA MELATI LAURA ULFIANTI MUHAMMAD NABIL NAYLA ULDIA PUTRI ZAHEDI. M ERITA HELMI DOLLI OKTIA WIJAYA PRIORITA OKTIA WIJAYA MUHAMMAD FIKI WIJAYA FAUZIA SUCI WIJAYA NURBIMA ASRUL OSNELY ZULMAN ANTONI YURIZAL YETRI DAWATI MUHAMMAD RINALDI NURNADILA NUR SAFITRI RAHMADANI M. RIZKI DARMAWAN RIZKA NURMALA YANDI PINTO HENDRA WATI NUR ANNISA NUR HALIMAH MUHAMMAD ZULFIKRI WAGIMIN TUMIYEM FERI WIRANATA MEGA RANI AFTIA MEILIA OKTAPIYANI JUNALDI MEIRINDA ANDRIANI NAUMAR JUSNI HENDRA GUNAWAN HENDRI GUNAWAN DESVA HENDRI NILA JULITA ADZIKRA FATHUR MUNTUM KHAIRU YOSFIDER GUMANTI YULENDRA YENI SABIM IRYANTO G. GILANG RAMDHAN D ROBBY MARDA D YOSYFA MEDICA PUTRI YUDASRIL YANTI RIDHO ADHA MUHAMMAD AFRIYANTO OEMAR SUNOTO SYAH AMALIATY NURSIAH/RT 01 ADE JULIAN SATRIA TUHERMAN PUJIASTUTIK REYNALDI HERMANSYAH ALIA LOVYANA M. ALIEF MURTAZA YETTI OKTAVIA APRITA NINGSIH ZULKARNAIN MURSIYAH NINGSIH ANGRAINI APRI ALWINA WIDIATRI WULANDARI TYOGI ADITYA SAPUTRA DJENDAKITA GINTING LIANA SEKARTARI A. SUPINAH SINDY RIZKIA JANUAR RAHMAT HAYATA AQILA RIZKIA SUPIYANTO SUHATSYAH ZURYENI REGINA MAHARANI ZAINAB LIANG HENG LINA JUNIFER SETIADI CHINTYA SHINTA SITI RASYIDAH RASKHA FITRIA NINGSIH NURMILAH IRMANSYAH IMRONI IKMAL TAUFIK HIDAYAT KAMIYEM INDAH NURSANTI JUNEIDI ELVI DEWI AFRIANI SUHARTI TALITHA RAHMA AMELIA MUHAMMAD ANNUR WASIYATI M. SYA’BANNUR ABROOR LUTHFIYYAH NUR’ATHIFAH M. ALI HANAFIAH SAFRIDA ASNIATUN HARRY SAPUTRA INTAN SAFITRI M. HAFIZ MAULANA ARIS SUDARNO DWI KOGAMAN SUKATMI DIO ALDI NOVALDI SASTRA WINARDI AGUSMANIAR ANDI WARDANA RIO FENANDA YOLA PRAVITA ASARI LEGIMAN ROSLAINI PURYONO SYAHRUL TOIMAN YELFITA RIFKI MAULANA FACHDINI AULIA FUTRI M. HANAFI ETI ATMAWATI FAIZ NURRAHMAN JONNAIDI DESI SUARNIS HANIFA SYAH PUTRI M. YASIN GUSMARNI M. YAMIN. D M. YUSNI. D MHD. NURHIDAYAT DAENG MUFRIZAL YUSNIZAR AL HADI AHMAD ZULFA HENDRA MARIA ULFA HERMITA NOVRIAN RAMADHAN YUSRIZAL YETRIDAWATI MUHAMMAD RINALDI NURNADILA NUR SAFITRI RAHMADANI M. RIZKI DARMAWAN RIZKI NURMALA SISMITA M. RASYID FADLO ARJUNA AHMAD MAHZAREHAN MUHAMMAD ALFIAN SITI YAMARI AKIRRUDIN NURAIDA FERI SATRIA RIKO JUNAIDI RABAINI ARDIANTO MISDAR ASNI IRMA SURYANI M.BASRI INTAN APRILA RIDHO KURNIAWAN DESMARIANI ILENG PUTRI YENI ADE SURYADI SYAMSIDAR BIMA PUTRA SURYADI DEA PUTRI SURYADI DESI NOVITA RIZKY PERDANA HASANUL ARIFIN ROSMIATI RAFIQURRAHMAN M. SALAN ALFARISI HABIBI SYAHRUL R. HAMZAHAL HASAN UWAIS ALKARANI RAHIMAH ROSMINI ERMAWATI AISYAH KHUMAIROH ABDILLAH KHUMAIROH RUSDIANTO LUSI YANTI ABDULLAH AMMAR ABDULLAH AMIR DEVI SAVITRI SYAFRIL MUSNI RAHMAD HIDAYAT NOVALDI UMAR SUSIANTI MUHAMMAD ZAHRAN S ABD RAHIM ASNI YORI SAPUTRA PRESTI MAILANI PUTRI MUHAMMAD AL NASRA ANNIK OKTARIANI NURBAITI MASRIZAL WAHYU HENDY ERIYANTO MIXPAL OTORITA FITRY HERMAN SARIFAHANIM DINI ELVIRA HERMAN SAHRUAN KARTINA PUTRI ZAHRA ZAHIDAH MHD. FADLI BILTER PARDEDE RENI BR LUMBAN BATU SANDHY SILVIA DEBORA P ADI MURPHY PARDEDE MARIO RAFFLES PARDEDE ANGGITRI YOHANA MAYER PARDEDE ARIS SETIAWAN DEWI ASTUTY MAHAKA DIEGO HAFSA MAHAKA KAKA A. SALMAH MARNI WIYONO/LPMK BAINAH INDRA SAFTA ISRA AB. M. BAYU DWI JATMIKO SUWARDI/RT SRIATIN JUPRI ERNA YOGI SARIANTO TYOGA PUTRA AGUNG PRIYOLANA HAZZAH PRIYOLANAH HERMANTO IRTI DANEL SRI WAHYUNI MUHAMMAD DENI NADILA TIWAN JOKO SUMANTO ROBI MANSRA RILA MAYANGSARI KAMARUDIN ROSMINA RISCA DAMAYANTI FITRIANA EVA DEWINATA EVI ASTUTI KARTINI FARIANTONI AWALUDDIN SURIYATI AYU SYAH PUTRI ANDIKA SATRIA DIMAS SANJAYA TIWAN JOKO SSUMANTO ROBI MANSRA RILA MAYANG SARI HERMAN ESMIWATI DESMITA SARI REFIKA SARI MUHAMMAD PEBRI IKHSAN ASSMIDAR RAIHAN ARRAFI ADDIN SALAFI MASRIZAL FITRIYANI MEISHA ZAHRA ASSIFA SYIFA NUR FADILA DELFIYANTO MERITA SIREGAR NAJWA ABRORY JIBRAL TAR NIBROS GHEITSHA JIBRON ALBATHUL HAFSAH S. WASITO WARISAH NURLITA OKTAVIANI NURA’EN LESTARI UWAS NURLAINI MUHAMMAD IBRAHIM RAMADAYANI JASWANDI KOMIATUN EKO SISWANTO WULANDARI TRIA RAHAYU MUHAMMAD RISKI ADRISON SRI MAHYANI SABRINA ADRIYANA SITA ZAHARA OKTAVIA RAKHEL KHAIRUN NISA JOHAN ELI SUSANTI SURYADI JAHARI ERNITA SURYA AKBAR ABDUL RAIHAN ALVINO AL AZHAR RUSLI ROSNETI ENJEL WAL PUTRA MELFINANETRI LUKMAN DESNI ELFIRA FESRIANDA AFRIYONAL JULI ANDRE ILFA RAHMI IWAN SETIAWAN EKA FITA DIAWINDARTI CINDY AMANDA ANUAR IBRAHIM ZULHERMAN LASTRI MUHAMMAD IDRUS

1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3

361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721

NAMA YUSRI YUSRO NURMAN BASIR SOLIKHIN/RT SALBIYATUN AHMAD FATHUROHMAN AZHARI SOBIRIN TEGUH SUROSO RAHMA QURRATA A’YUNI M. DAFA AL PIRANSYAH TJUN HO PIPIN HERAWATI WIJAYA EFENDI MERIA FINAWATI HERMAN ELI SUSANTI YEYEN PUSPITA DEWI ATRI YULIA NINGSIH PINDO LISMAN IMANUEL RAMADANI MUHAMMAD RIDWAN SHINTA RAMA YANI ROBI MUBARAG KAM ISAR DESMANIAR FAUZIAH APRILIA DESKA AKBAR FAUZAH ATIKAH MAHARANI ALMADRI INDRA WANI YODI PUTRA PRATMA YOMI ALMASARA YOPI ALMA CANDRA AFRIZAL SEL FITRIANI PUTRI ANJELI ALDO PRAYOGA HERWAN MEGAWATI DONI MONARDO NEVI SEPTIANA IRDAM HANAFI SYAMSUL BAHRI MILAH SULVIA RIZKY ROBBY ILHAM MAUDY NARULITA UMAYRA MILANI MUHAMMAD DENI SUSILA DEWI YANI PURWIYATIE DELLA WIDYA WATIE MUHAMMAD RIDWAN YUSIAR JANUAR ADE IRMA SURYANI SYARIFAH NUR ATIQAH M. HAFIZH NUR RAHMAN M. HADI AL FARRAS SUKANDI SUWARDI YULIANA ASIFA YULIA PUTRI JOHAN ELI SUSANTI SURYADI YOSFIDER GUMANTI YULENDRA YENI SABMIRIYANTO GUMIANTI GILANG RAMADHAN G. ROBBY MARDA DILLA G. YOSYFA MEDICA PUTRI ALI MUSTAFA ROBI MUBARAQ YANDI SHINTA JUWITA SARI ARYA PRATAMA SASKIA SAHFITRI WIRDA BUDIMAN MUSTAKIM PURWATI AULIA MUSTIKA AYZAH NELSAFIA PANGERAN AHMAD RAHMAT SYAH DALVIANDRES NATARI RICO AFENDI RANI PUTRI ANTI SYAFI’I ADI SOFYAN SUSI RESNAWATI SURYANTO SUMARNI FEBRI ANDRIAN SUCI MEGA LESTARI SYAQINAH ZAYUNDA S. SAFRIALDI YETRA SUYENTI MUHAMMAD RAFLI HERSYIFA JUNIA SUMARIA NENI SUARNI TITIN MARTINA BUDI SYAHRIL LIDIA NATALIA RESTI ILUNA AZZAHRA RIDHO BUDYASYAH SUPARTI KUSNUL KHOTIMAH TRI WIDODO HADI WINARNO HERRY WARSITO SUHARTATI LISA HARIYANI NIA FERA FITRI JASRI. M BASTIAH ELFIRAYANTI WENDERI HELMI FERRY IRAWAN EVARINA CYNTHIA SILVANDI TANTY ARIANTY M. RAFIF ALFATTAH ARIFA UMAIRAH ABDUL GANI AMINAH FATIMAH M. KARIMIN NURMANI ROSISKA NURI MUHAMMAD AFRONI BOBI KURNIADI JUMANGIN TUSIRAH AMIRUDDIN YUSLI MARNI RINDU BELLA SUKMA MUHAMMAD ILHAM M. FAIZ ALFARIZI SYARIANTO JUMIATUN NOVI MURIANA BAGUS ADE KURNIAWAN TOTOK HARIANTO DEWI SULASTERI JANICIA DIMAS ADITIA HASAN HABIBAH PANDU WINATA AURELLYA IKEN LIANA NURAZMAN MUHAMMAD RAMAINI MELIVIA FEBY MAILIZA VISKA ANGGRAINY MOHD. IKBAL RAMADAN RAHMAN SANDRA DEWI KEVIN LIE VALENCIA LIE RAHMAH TUKIZEM ROSMALI HUDRIYANTI IRMA SURYANI ACHMAD ISHAK MARIANA BOYANI ROSINA TRI SUSILO MUHAMMAD SYAIFUL SULASTRI MAIZAR KARMAWATI JULI ASTUTI NIA MAIYANTI NOVATRI MARTONO JAYA RIKI SATRIA PUTRA ROSMALADEWI IQBAL DEXA RIMALSYAH ZARA NADIA AKHYAR M. SYAHRIL NADILA MAHARANI SYUIB AL HADI NUR WINDA ZAMZAMAH HENDRI INEP APRIL LINEFF SAFITRI ZAINAMIR SAMNELIS RICO SAMZA ARIFAL SUBHAN RIDHO ROZE SAPUTRA SUHARMA NURHAIDA EMI SYAFRIZAL YUSNAR RESTI JUWITA DWI HARTATI YUMISA PUTRI SYAMSI ISMAIL ROSMERI IHAN PUTRA BAHRI CALVIN WILLYANDA EMELIA SANTIKA RAHMAT AL FADHIL HENDRI FADLI SUMIATI ADLI HAZIMUL FIKRI NATASYA NAJLA MUTHIA WASDI HERMAN ASMITA MUHAMAD NAUFAL ROSMIANTO JUNAWATI RAZAN M. IHSAN SUTRIMO SUHAIMI ABRAL KHAIRA JUFRINI BINTANG RAMADHANI KAYLA UMAYROH ABRANI ABRIAN AUFA ASRIL SITI YULEHA ASRILA YUMITA ERWANDI RAHMANIAR M. BAGUS WIRADHINATA NURHANIS SAKHBANIAH JAKA KURNIAWAN MUHAMMAD SYAHRIL F. ERYANTO ALMIRA YULIANA MUHAMMAD REZA AL. RIZAN ADY KATMINI ADRIANI S. IRGA NURMIZA I. SUBANDI EKO CAHYONO ASWIL NURAIKA NADIA WILCANTIKA NURUL SAHDATUL UMI ZULKIFLI ROSLIYAR RAFLI ZUL AKHIYAR SYIFA DWI SYAFINA ABD. AZIZ YUSNIDAR IIN FEBRI AZRICO ASMAH HALIMAH ZAHARA M. NUR IKHSAN SITI MASYITAH RIFA’I SITI FATILAH SYIFAA AZ ZAHRAWAANI TABRANI BIRMAWATI SUMARDI TUIBAH BUSRI LILI KARTINAWATI MAIGINI BUSRIYANTI DEPRITA BUSRIYANTO MONA JUNITA DESPIKA WIRANDA WINDA MEICINDA KATI KATINAM JURIAH WARNI JOKO WAHONO JONI RIKA SUSANTI PUTRI ASMAUL HUSNA HABIBURRAHMAN HANIFA PUTRI RIDWAN ARMIYANTI M. FARHAN RA IBRO MAULANA REBI JUANDA DEWANDA RAJASYA ZAHARI YUSNIDAR ANNISA AMELIA DAMURI POSMARITA SITUMEANG ERINNA NAIBAHO ARDINA NAIBAHO DAHLAN/ KADER/RT SUT JIATI GITA LESTARI DANDY JOKO KUSUMO DERI EKO SULISTIO SUCI RAHAYU DODI ISKANDAR DIDI WAHYUDI NUZRAL HADI ROSDA ULFA ANDRI WIRA HADI ADE ARMAYANI INDRA DERMAWAN ERINDA ELSA MUHAMMAD ALWIN ASNIAR SUGIHARTO NURYANTI NADIYA ZAKY FARHANT NAUFAL HARITS SHOFIYA QHISTINA RONI JUMAIDIL TUTI SAFIRA M. AFGAN SYAFRONI M. MELGIAN SAPUTRA KARDI ZALOGO SAMARINA GOWASA DIKY SEPRIANTO Z. DANIEL SYAPUTRA Z. DAVID HARIYADI Z. USNI AFZAIN YUSMARNI WAHYUNI AFRIA PUTRI IRVAN MAIRULLAH MAIZAL AFWANDI CHAIRUL NASRI RITA WIRASNI RISKA AMELIA RIRIN FERNANDA RADITHIA YULIANDRI TRISMAN SUSANTO AZMA WATI BENNY ANSHOR R.. RENGGI MARANDHIKA VANNY AGUSTIANAS IKAL ELMI SOFYAN AZHURI NOVRIS TUENTY M. FARID AZHURI FANI ZAKINA AZHURI DENI ARDIAN SURYA DEFRIANTO SRI SUSANA ANDRI JULIO SAPUTRA ASENG YASMI YANTI KEKE HARMIA SURYADI BETTI NAINGGOLAN TASYA MASTURA

RT

NO 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082

NAMA

RT

HALIMAH JULIARNI REDFIANDI YUMLIZAN NEFWATI DITO HARI PUTRA DWIFA HIJRIYAH WINDI AHMAD HAYATI WIDIA AYUNIPUTRI AISHA BILQIZ KEILINE JASNIWAS MASRINUTI LIHANA JESMA JESSIKA SHARI YODHIA AUGUSTIANI JENAD ILHAM RAHMAN EFENDI/KADER RISKE MURI NAZWA ANNISA DEDI HARTANTO ASMARIYAH ERMANTO DEFFI SYOFIAN RAHMAD ANUGRAH ZULKIFLI LISA YULIANA NIA YULIANI HENDRA SAPUTRA KASNI RIZZIQ IRSYAD ABDILLAH FAIZAL YUSNIDAWATI ANDI MELAYU IRA FAZIRA FANISA AZIRA FATIMAH DEBY YUNITA JONI HAYADI JUMARTOYO ROZITA. J NURUL KHUMAIRA ERI NUGRAHA SUMINA JUITA MHD DAVA PERDANA P. MUHAMMAD ISHAK SALIMAH ANISA ADE SAPUTRA ALBUSRI SUSI HENDRIANI NATASYA RAIHAN MARDIANSYAH MUHAMMAD LUFI T. SETRI RIKA WAHYUNI M. HAIKAL MUALIF M. HAIKEL MUALIF ZAINAL ARIFIN HELMAWATI RINDI ARIFIN NURI DEDEK HELFIN TWOSRA ASRIL YARNELIS RISA SUSANTI JEFRI ADE PUTRA SIEN IRNA NINGSIH CANDA IRMANINGSIH ARIFIN MURNI RAJESTONI CANDRA KRISSANDI KATRA KURNIAWAN MUHAMMAD ROKKI ADRIYAN SYAPUTRA FRETMON DWI PAYANA K TUSDIANTIKA A. PRATAMA KAHIKING GUSMA SANTI VITRIYAH KATI ZURAIDA RIFFIQ KURNIAWAN ARLEN ZULBAIDAR DIAN PRINANDA S. REZKI AFRINALDY WAHYU RAMADIANTO SAPRIYAL SASNIWATI ANGGA NOFRIYALDI MELSA MUHAMMAD RANDA APRIJONODI SYAMSIMAR VIKI TERNANDO M. ILHAM DARULSYAH NURAINI NORGAYAH PEMIL EDEPRIN MARIANA M. IQBAL NORFIYANTO NURUL LUVITA DEWI JUNAEDI NADRATUL AZMI RICKY YACOB MAULANA IBRAHIM SENA SAFITRI SUCIPTO SUSI SUSANTI ANDIKA KERIN JUNAEDI NADRATUL AZMI RICKY YACOB MAULANA IBRAHIM SENA SAFITRI MARIANA M. IQBAL NOFRIYANTO NURUL LUVITA DEWI NG KIM SENG HONIWATI YANTO A HUAT SATIAM LI ANDY LI YENNI NOVITA SARI RIDWAN SUPRANA JOKO DARMONO TAUFIQ NUGROHO YUSUF NUR SYAHBANI HARSOYO AHUN BASTIANTO EDI SUSANTO HENDRY ALAI LENG HA BUDI SETIAWAN ANGELLA KASNO TAMBIRIN NYONIK LUSIANA YOANNA PANGSHA L. MUTHIA SABRINA P. IBRA KARIM BENZEMA SUJANTO SANTI LUCKY WIJAYA DESNI AHAI IKUT ALI SUPRIADHI SUMARNI DWIE SETYA NINGRUM ASTRIE MILLENIA AGUS BUDIONO WARTINA JANGIOK RUSLI BUDIMAN BUN BENG A. ENG MARTINUS HARIS SURYADI RUDI EFENDI YOGI MONALIZA PRISKA MONIKA BEJO SUYATI RAHMADI KATIMIN SULISTIANI SITI RAHMA SARI NAFISA HALIMATU SA’DIAH RAHMAT SYAIFUDDIN PE E INDRAWATI AGNES OKTAVIA STEVEN LEE STEVANIE STEVALLYNE SUKAMTO. S SUNARTI KARTIKA NURWANI IRZA FITRI TRIA ISMINA KOK HONG RUSTINA EDISON HENDRI JAYA YULIANTO CYNTHIA ALIANG SO HUI NOVALIA VENITA JOHAN IRAWAN SERLY VERONICA HADI UNTONO ELSYE PIAY DENNY BOYKE OLYVIA HALINE SILVIA APRILIA OCTAVIA JULIANA U. TJUN HOK SIU LE MEIDY DESI HANS ANDERSON ALIANTO MUTIAH JANGEN LEA PERDANA FREDY LEA WIJAYA MESSY LEA LESTARI IVAN LEA SANJAYA THAN HOA IAM KUL WIDI SARINETI FIRLISIA LAURA PETRISIA LAURA ANTJO JUMI HERMAN ALIAS APONG BIGUAT HERY CHANDRA HERICK SONJAKA HELSHI KASTURY BUJANG PENG TJAIUW AI TIE EDDY ATAN MORIDA MUKTAR ALIAS P. YULLY SARTIKA YUNITA SARTIKA JACKSON SEPTIAN ROHANI ENG SUAN AIE JUMATDI KEVIN JUWANTO LOLI DOYOSI NADYA JUWANTO PUTRI AFDAL AFWAN SRI YUNENGSIH AHMATONOS LINA MERYILIA DESTIVIA ARIFIN SITI ABSAH AHMAD RIDHO ZULKARNAIN ANWAR ASNIDAR NASRULLAH ALI BAHAR RAIMAH AZMI M. RAIS SARI AZURA SURYADI DAHNIAR FENI NOFRIANTI INTAN SILVIA BASRI DAHLIA SEFRI SILVIA N. AGNES MONICA SYA’BA RONIZA T.S ABDUL LATIF SUMINI TENGKU SAI M. RIFAI TENGKU SAID IMRAN A. MUHAMMAD JAFAR SURYATI SHYNTIA WULANDARI FEBRIANTI FANNIA NUR JANNAH NUR JANNITA APRIZAL MARIA MAULAN ISAQ ALHAKIM AZUAN KAMISNAH ANDIKA ROHANI SUGIONO SUDARTI ANDRISYAH PUTRA RIRIN WIDYA NINGSIH DEDEK INDAH M. SULASMI SUPONO KARYANTO/ KADER DARMIATI KARTIKA SUGENG SULISTYA MUHAMMAD IQBAL L. IRWANSYAH PUTRA KANTIKA MESWARY KEIRA DEWI AQILAH MOHAMMAD IRFAN F. WAN DIAN LAILA NASUARDI SUMARTINI TEGUH SUMARDI S. RAMADHAN CAHYO S. YAMIN RITA WAHYUNI BUCHORI MUSLIM NIA KURNIASIH NIUR FITRI SRI W. BAMBANG SUPRAPTO WIWIK HANDAYANI ARISETA WIYAN GINTARI DIMAS PUTRA P. SYAMSURIATI SYAKIAH DAROJAT MUHAMMAD ALI N. AHMAD DASYUKI AYDIBA ALGOFARI AHMAD JUFRI YULIANI SARI DONGORAN RAIDIL AHMAD PUTERA RAIS AHMAD PUTERA RAISHA AHMAD PUTERI SYOFYAN RAENI MUHAMMAD FADILLAH RAHMAN PANJAITAN MIRA FEBRIANA KAYSELLA ROSALINDA P. GLADY’S MAHESWARY TALITA ZAKIA SAKI ARIFIN DM TITIN AGUSTINA OKTAVIANTT MELDA YANUARTY VIRDA AGUSTINA WANDA AGUSTIA RESKY AGUSTIA RAMLAN NURVIANTY RADA AGUSTIA RAHMAT AGUSTIA AL’AMIN SEPVIANTY QAIRUN A. GUSVIANTY NURIKLIMAH AGUSTIA ILHAM AGUSTIA AL GHIVARY TURUT BOINEM SUMARMI DINI PITA SARI NURUL DIAN SAPUTRI SUKATDI MULYATI YUSRIANA

NO

NAMA

RT

1083 SRI AMINI 1084 NOVADRIAL 1085 SUSI ELFITA 1086 ELVANNIE 1087 M. HAFIY DANI 1088 AULIA ZIKRI 1089 SUSILO 1090 SUGIATI 1091 EKO NANDA SAPUTRA 1092 DINDA LOLA VERONIKA 1093 TRIASTI NINGRUM 1094 MAYLISA AZZAHRA 1095 SUPARNO 1096 NGA TIYEM 1097 ELISABETH RATNAEATI 1098 DENI RIO SAPUTRA 1099 DERI WAHYU WIBOWO 1100 AGUS SALIM 1101 SITI KUNBUDIATI 1102 MAHFUD ASHARI 1103 SAID HUZRI 1104 RAHMAN RIYADI 1105 IMAM GHOZALI 1106 NURUL SUBEHKTI 1107 RIFKI FADILAH ANHAR 1108 ROSMAWATI 1109 AYU KRISNA 1110 LINA MAYA 1111 ASRILZAM 1112 NURHAYATI 1113 FATMA ASNUR 1114 NADIA SEPTINA 1115 ELFISON 1116 WITRA 1117 YUSNA 1118 MUHAMMAD FIQRI 1119 BEN AFRIKA SOGI 1120 M.. FEBRIANSYAH RAMBE 1121 ADLI SYAHPUTRA 1122 JULI TANIA 1123 ALFIAN PUTRA 1124 RIZKI PERDIANSYAH 1125 NURHAYATI 1126 RIONALDI 1127 FITRIA ALIA 1128 RAMALIUS ROMEL 1129 PITRI WIJATI 1130 DELFITA 1131 SHINTA ZAHARA 1132 SUTOMO 1133 KAMARIAH 1134 ARBAI’I 1135 JANUARDI 1136 ZUL FADLI 1137 SUYETNO 1138 SUSAN 1139 YOVANKA RAMANIA 1140 S. MILIANO SYAHPUTRA 1141 M. HAFIS NAZWA 1142 ARIZAL 1143 RISNAWATI 1144 PUTRI ZARINA 1145 AMBRI HARAHAP 1146 AZLINDA 1147 M. ALFARISIH HARAHAP 1148 ADRIAN 1149 ABDULLAH UMAR/ RT 1150 MARATUS SOLICHA 1151 MUHD. HIKMAH 1152 ZAINAB 1153 MUHD. SHOLIHIN 1154 MONA KHUZAIMA 1155 HALIM TRINANTA 1156 WAHYU AFANDI 1157 SURYANI 1158 SURYA FATUWINDY 1159 SURYA LAKSA ANDANU 1160 NETRIAWATI 1161 SYAIFUL AMRI 1162 DESWATI 1163 MUHAMMAD TAUFFIQ A 1164 RAMADAN AMRIANSYAH 1165 JENI SYAHLA DESPIANTI 1166 YEYEN AISYAH PUTRI 1167 YULIANA 1168 MERRY RAHAYU 1169 TRI HANDAYANI 1170 HENDRIK PRANATA 1171 MAS’UD GANIE 1172 JUSMAWATI 1173 SOENIECHO MAULANA 1174 M. NURUNG 1175 FARIDA 1176 YANTI NELITA 1177 EKA NOVITA 1178 OGI ALKUSAIRI 1179 ADE SURYA IRAWAN 1180 M. RIZKI CANDRA F. 1181 USMAN 1182 ROSMIAH 1183 ROMI RUSMAN 1184 RUDY RUSMAN 1185 ANDI ARNI SUSIANTI A. 1186 ARDIANTO 1187 RINITA 1188 RIAN FIRDAUS 1189 ARIE PRANATA 1190 FATIA AYESA SALSABILA 1191 ARDIE RHAMADAN 1192 SA’DIAH SALSABILA 1193 ROHANI 1194 MARWANTO 1195 UMI KALSUM 1196 ANDI SYAHPUTRA 1197 JUNAIDI 1198 TUTI SURYANI 1199 HASBI ASHIDDIKI 1200 ARBI ALFARISI 1201 YOGI FIRMANSYAH 1202 SECI 1203 ALUAN 1204 SUDIRMAN 1205 MARTINI 1206 MEILINA 1207 MUHAMMAD FAISAL 1208 NILA VAMILA 1209 ASSYIFA HUSNA 1210 HAFIZ FARIZY 1211 ZAMHARIL 1212 YURNA 1213 JAMAL 1214 YENTI 1215 YULI ANGGI SAPUTRA 1216 MAYERIK SUSANTO 1217 ARSYAD DM/RT 1218 ZURAIDA 1219 INDRA SYAHRIL 1220 LINA MARIANA 1221 MUHAMMAD ARIEF 1222 NAJLA ARZAMEIDA 1223 SYAHRIZAL 1224 ELI ROYANI NST 1225 NUR ANNISA PUTRI Z. 1226 RISKI ADITIYA AKBAR 1227 DARUWIS 1228 ELNI MARUSDA 1229 M. SOBRI DARWIS A. 1230 SITI SHAKIRA 1231 M. RANGGA SAPUTRA 1232 EFRIANTO 1233 RINI SUSANTI 1234 EFVAN SAPUTRA 1235 DAVI AL BUKHARI 1236 HENDRA ZULHIJA 1237 DUMAYANI 1238 TAHTA REFINDO Y. 1239 DWINNA YENDRA 1240 FADILAH YENDRA 1241 NIKI BUANA 1242 IKHSAN MUFAZA 1243 HENDRAWATI 1244 NURHENDRIAN 1245 SAMSUL BAHRI 1246 ZAWIYAH 1247 JUNAIDI SAPUTRA 1248 M. RIDWAN SLAMAT 1249 M. KHAIRUL ANUWAR 1250 SITI HAJAR 1251 RABELLA RAHMADHANI 1252 HERMAN 1253 RAHAYU AZIZAH 1254 SUCI RAMADHANI 1255 NURUL ARIFAH 1256 PRAYOGO 1257 SITI DEWI 1258 M. SADDAM HUSEIN 1259 M. KADAFI 1260 WAN ZULKIFLI 1261 WAN FITRIYANI 1262 WAN ISMAIL 1263 WAN ISKANDAR 1264 WAN ANUAR 1265 WAN BAHARIAH 1266 SUTARMAN 1267 PURWANTI 1268 CINDI KARTIKA SARI 1269 AISYAH SUCI RAHMADANI 1270 JISMAN SAMOSIR 1271 ERIDAR 1272 ZAMZAMI 1273 SITI HAWA 1274 ALIF HADHARI FAHZILAH 1275 MURSYID IBRAHIM 1276 W. SURYATI 1277 AGUSTIAN 1278 SUCI AMALIA RISKI 1279 NURHAYATI 1280 HJ. SUMIATI 1281 KAMARUDDIN/LPMK 1282 RANI 1283 DINA YUDHIANI 1284 HARDIANSYAH 1285 ULVA SARI 1286 MUHAMMAD IRAWAN 1287 HARI KURNIAWAN 1288 NURIAH 1289 RIKA SAPUTRA 1290 NORMALA 1291 ZULAYKA 1292 FAHRI SAPUTRA 1293 ATAN 1294 VIVI NURYANTI 1295 CHARLIE 1296 RICO 1297 VERONIKA 1298 RICKY CHEN 1299 AHE 1300 CANDRA 1301 ZULFAN EFFENDI SIREGAR 1302 SITI NILAM 1303 B. KURNIADI SULAIMAN 1304 SAFWAN RASYID S. 1305 SULAIMI 1306 PERMATA SARI 1307 FAIS ISLAMI IDZAKWAN 1308 RAKI FATIH ISLAMI 1309 MUSTHOFA 1310 DEWI RAHIMA 1311 SHOFIA NURIANDINI 1312 ABDUL HAYYAL M. 1313 NURHAIDA 1314 AYUNI HARIATI 1315 DIANOFITA 1316 VIDYA RAMADHANY 1317 DIVA AUDEANY 1318 EKO SUSANTO 1319 SITI ROHANI 1320 EKA JULIANI PUTRI 1321 RIZKY PRATAMA PUTRA 1322 MARSINAH 1323 JULIA MESRIA 1324 SYAHRONI 1325 MUHAMMAD HAMDANI 1326 KAMARUDIN 1327 WAGIMUN 1328 MUGINEM 1329 PAINO 1330 SETYA HARYANTO 1331 SETYA HARYADI 1332 SUYATNI 1333 MARNI 1334 ADITYA PRATAMA 1335 KATIMUN 1336 MISKIYEM 1337 YUANTO 1338 LASIMAH 1339 MUHAMMAD EFENDI 1340 MUHAMMAD RAJIMIN 1341 MUHAMMAD JUNAIDI 1342 CHAIRUL/KADER 1343 SAFRIDA NINGSIH 1344 LIZA MARIA 1345 JISMAN SAMOSIR 1346 ERIDAR 1347 PATAR 1348 KASIMIN ALIMURTO 1349 MINI 1350 HARIS 1351 SRI SURYANINGSIH 1352 DINI SAPUTRI 1353 DANI AKBAR 1354 ADE TRI PURNOMO 1355 DEVI SRI HARSIH 1356 DIMASARI 1357 YANDRI 1358 JAMHARI. H/RT 1359 AGUSTIN 1360 QESTHI AL MALIK 1361 MUHAMMAD RAZAK FADHLA AL MALIK 1362 BAYU NUGRAHA AL MALIK 1363 RUSYDINA MALIKA 1364 SUPRIHATIN 1365 AIDA 1366 NUR PURNAMA SARI 1367 TIAN PEBRIANTO 1368 APRIANDI SUKAMTO 1369 MASANDRA AYU SAPITRI 1370 SUFIAH 1371 SUMARTI 1372 IDHAM 1373 NURSIDA 1374 SALSABILA IDHAM 1375 SAFINAH ANNAJA IDHAM 1376 SURYATI 1377 SRI AYU RAMDAHANI 1378 HETTI RATNA SARI 1379 SYAHRIAL 1380 THEOVANNI YOLANDA E. 1381 Y. GERALDINE KURNIAWAN 1382 HOWRINE RIZQA DELARPZY 1383 H. LUQMANO ATHAREZQI 1384 ABDULLAH 1385 HALIMAH 1386 JULIA 1387 SUMMA NURIZA 1388 CUT LATIVA ZAHARA 1389 ANDI WIJAYA 1390 YENI RITA 1391 NURUL JANNAH ANDINI 1392 UMAR DANI 1393 SYAIDAH 1394 INDRA BUDIMAN 1395 HARDIMAN 1396 RAHMI RIDHA 1397 FERDIMAN 1398 KHOIZAIMAH 1399 M. WAHYU IRWANSYAH 1400 KAMARUDDIN 1401 PURWATI 1402 SUWARTI 1403 ISTIAH 1404 KATIRAH 1405 T. ZUL AKBAR/KADER. 1406 RINI RIDUAN 1407 T.S. ASY’ARI AKBAR 1408 T.S. ALVI AKBAR 1409 SUTOMO THOYIB 1410 SUNAR SEHARTI 1411 NURLAILA MARDIAH 1412 PONCO AHMAD RIDHO 1413 M. MIFTAHUL HUDA 1414 SUTRISNO 1415 ENI PAWESTRI 1416 TEGUH SANTOSO 1417 NANDA PUTRI FEBRIYANI 1418 CINDY RAMADHANI 1419 RAMUS 1420 MUSNI YENTI 1421 VINA ALVIONITA 1422 KELVINDO 1423 REI CAHYA RANI 1424 NAFISAH 1425 ARAS MUHAMMAD 1426 ZULFA ALFITRA 1427 AISYAH FITRI 1428 RESKI LATIF 1429 SUHARNI 1430 NURHAYATI 1431 YUNITA ZAHARA RIQIANI 1432 MISERAN 1433 SABARUDDIN 1434 JAHRI 1435 HOTMAIDA 1436 SOPIYAN SAPUTRA 1437 NURUL HASANAH 1438 M. SYAHRUL IQBAL 1439 FAHRUL RIDHO 1440 SUKOCO 1441 SANIAH 1442 MISIEM

NO 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803

NAMA JARDI SUPRIHATIN LANGKIR WARSITO DAHNIZAR BAGUS ADITYA WARDANA RESKI ILAHI DAMIEM MUSTAFA SALEH NURUL KHAIRIAH NURUL HAFIZAH TITIK ASMURTININGSIH HENDRA GUNAWAN H. EMMY WILSON HIDAYAT IRAL SRI AGUS AMELIANI NUR PARIZA AM INUR FARIZA SOFIAN/RT TENGKU RIZAWATI INTAN SAFURA ALIF SOFIAN SUTIYONO SUTINI MUSTIKA RATI HASAN BASRI ERDINAWATI RANGGA PERDANA PUTRA ANDHIKA AKILA HAZMI RIZKI BINTANG R. RAFI ABQORI FAID NUR AINI AFDAL RIZKI ALI MUDIN LATANDA YAN BASTIAN RAHMAT MAULANA FIKRI NORDIN SANIAH MUSLIADI SYAFRIZAL IDA YANI KHAIRUDI LISA APRILIANI HERMAN VITRIANI FIRMAN AL FADRI ULFA MUTIAH M. SALMAN ALFARISI LUKY RAMADANI SIMSON WAN ASSEL M. PITTA SIAGIAN PORM IN MALAU EKO MALAU JONTRISNO MALAU GOPINDO MALAU JENI MALAU ADITIA WARMAN YUNI UFITRI LIVIA RAHMADANI JALONTA PANGGABEAN ANNE HUTAPEA WILMA PANGGABEAN FANDRY HAHOLONGAN ELSYA YOLANDA DEO FELIKS P KROSBIN PANGGABEAN LINDUNG ARI DWI PRASETYO RIZKY REGITA AMALIA AGUS SUWANTO TINUR SUGIANTO LINA HARTATI ELSA SHOFIA ARDANA SUCI IRMA AGUSTINA KADIR KHOLIJAH MUHAMMAD RANDYKA PUTRI KURNIA SARI SISWOYO SRI LESTARI GIWA JES SANDY MUHAMMAD PRAYOGA MUHAMMAD SALEH ZAM ZAMI MUHAMMAD HAFIZAN ARIF FADILLAH SYAHWANI FITRI NORA FADILAH ZULFA NURAINI AKMAL PUTRA MIRA ADLI HAQQI REVINA MARISKA M. RUSLI YULFALINA AHMAT ZULFI M. IRFAN RIZKI LINDAWATI/KADER M. HAMDANI AKMAL M. AIDIL SYAHFITRA M. ABIB ANUGERAH M. ADIB ANUGERAH SUDIRMAN ERMISWITA DONA YULIA SARI RISKI APRIA PUTRA SYAFRIANTO ELIANTI HAFIZ HISYAM FADLU R. ROSMI AFRIZON JONI WARDI/KADER NELA WATI ANNISA FEBRIANTI FATMA AULIA PUTRI EFFENDI SIMATUPANG IRMANIDA HENDRI KURNIAWAN RUDI ASNAH RIO STEVEN RINDI CAROLIN DYON STEVEN ANDRI BASUKI SUKAMTI REHAN ADITYA N. YUSNAITI ALIAS TJIE R. K. ARYA PUTRI KIRANA IBRAHIM DJALIL/RT MARIANA NOVARIANI SUBAGIO HENI MAILINA GILANG YUDISTIRA IQBAL DWI PRASETYO SUTIYEM TUMADI FERATIKO TUTI ANDAYANI SISKA SELPIYANI DWI VIOLANDARI R. BRONSON HUTABARAT JUNITA HUTAGALUNG P. SALOMO HUTABARAT SEPTIAN RAY JUNIOR H. CHRISTIAN VALENTINO Y. ALIAS TJIE RUSTAM BOY FERDINAND KARMILA ARYA PUTRI K. ROSNAINI RUSTAM NIK FARIDA HANUM IR. SONTA WISESA YENNI HARTATI ABAS ROWI SUNARSIH SUPRIHATIN HARYONO DIANA M. JUNED ALFIAN SITI WIDAYANTI SUWARNO SRI SUHARTINI RIFKYANA WULANDARI WAN RINALDI NANIK INDAH YANTI RISWANDI NONI SUSANTI RISA ELYSIA SYUHADA FAHRIN ALVIAN SYUHADA SAINEM NANANG RIKI RAKASIWI KHOLIFAH NINGSIH REVY AULIA PUTRI BEJO LANWIR YENTI DESI LENDRA DEWI YOGI SAPUTRA AGUNG RENALDI MEGARIA NIKE KHAIRUNNISA SRI WIYONO ENDANG DIAN PERIADI TRIANA PUSPITA DEWI KAMEL IDAM IKLHAS SANTOSO RENI ASTUTI NUR TASIH SANTOSO HENDRI ENNI ERAWATI BNURUL BADIAH AHMAD RIDHO AHMAD ROBI KHOMARUDIN WATI KHUSNUL KHOTIMAH M. RAMADHAN ARNELIS PERI SOLINDA JUDI PRAYOGA M. THAMRIN PARIDA NELLA SARI M. BAMBANG IRANDA KURNIA SARI M. CHANDRA MAULANA AISYAH AZIWIRLISNI MIMI EFENDI CALISTA FITRI WAHYUDI MUHAMMAD FADHIL MALIK HANDIKA SUKRISTINI SITI ZULAIKA LINDA OKTAVIA LILIS OKTAVIONA SUGIYONO UMI HANI IMAM HABIBI ARIF RAHMAN PRIHADI AULIA DIAN RAHAYU MURYANTO ROJIAH JULIADI CHAIRUL SYAMSIR SARI REJEKI DADANG SUHERI FARIDA ARYANI AISYAH VILARA ROSANAH M. FAISAL RATNA DENI ORYZA SYATIVA NAZARUDDIN ROBYADI SURYA K. ZULDERISMAN MERYANA D. PERDANA ALAMSYAH M. HAFIZ ALAMSYAH RAJIB TRIA RIFKI NORIZAN VANNY NOVELIZA FERDI SAPUTRA FIONA PUTRI JENETI ANDRIZAL FARHAN RAHUL BATISTA IBNU HIBAN ROSMIATI ALMA’IDAH NAMIRA MELTON PRIMA ECA MANDASARI KEYSHA ADHA PRIMA KELVIN PRIMA SEPTA HERY SUSANTO SULASTRI TRIO ANANDA ADI S. TUMADI MUNDIASRI MALIKI SUPRIHATIN CANDRA NATA WIJAYA PURWANTIN FITRI AYU AZWAR NOVRI AZWAR M. DIMAS PRAYOGA CINTA KIRANA PRATIWI SUBIRIN/KADER YUSNITA NURUL DWI FEBRI YANTI M. ARDIANSYAH AISYAH DIDIT SISWANTO ISNIWATI NABILA NURRIZKY M. DIVI SISWANTO P. BUJANG IRAWATI MIRNAWATI JULIA PUTRI BUSRA ANANDA PUTRA IRAWATI NIA DANIATI M. FAIZALKALIFI AKILA NUR NAJWA MUSLIM FARIDA SILFIA JUNAIDI MUSFA HARISMAN ZAHARI ARFAH EFENDI SRI WAHYUNI FITRIA KUMALA DEWI RANGGA HAMDHANI S. WAGIMIN PRATIWI AGUS SANTOSO NOVIA KARTIKAWATI SUNARDI SASTRA WINDA RAFAL PRATAMA RIFKI ARDIAN SARI WIBOWO KUNTARI GALIH NUGROHO NETTI HARDI BEMMO YUNI HARTI JHONY MANDRA MARIZA FHADLI JUNIZA PUTRA DHEA JUNIZA PUTRI MUHAMMAD SAIFUSSIN SITI ROHANI OCTAVIA RAMADHANI APRI SAEPPUTRA RIZKY SAEPPUTRA SABARUDDIN SITI FATIMAH SYAHRUDI YAHYA DEDY DARMA EIRAWAN DEWI OKTAVIA RAHMA S. ERNITA YUSUF MAHENDRA NURIZAM/RT NELRITA INGGI KHAIRANI NOVIARIZAL VERAWATI GILANG RAMADHANI NATASYA WULANDARI KHANSA ALIFA SAMSUL BAHRI MEWI HARTATI RAHMAT ZIKRIAL QUSARI AZUAR SUTINI ANNISA ANDINI HAMIDAH M. KHAIRONI FATMAWATI MUHAMMAD SALEH RODIAH SAFRIZAL EFENDI REVAN NOVRIANTO CHOZAIMAH ZULKARNAEN MASRI SUSANTO FITRI MEIRA ENJELIKA SASADILA REZZA SAPUTRA MUHAMMAD DIMAS ARIL SUWARDI SITI ASMINI

RT

NO 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164

NAMA

RT

AHMAD FAIZAL ARIF M. BAGUS RAMADHAN M. REZA SETIAWAN BURSAK ROHANI SUHARDI SYAKILA SITI ROBIAH RITA WATI ROMI HANAFI DENI AGUS SETIAWAN SANTI RENDI RAMADA SASTI S. RIZWAN ANUGRAH S. HELMI SYAMSIDAR FAISAL NIA LESTARI RIVALDO RAHMAT NAFSIAH ANDRI NURHAYATI INDRA GUNAWAN RISNA SHINDY PUTRI GUNAWAN NAJWA SALSABILA G. BACHTIAR SYAMSIAR RIA FARISKA UTAMI SUKATMIN SURATMI SUDOMO LUGIWO WIDODO WIJAKSONO SHERLI SAPUTRI AGUS SISWANTO P. TIARA SEPTIANI RIZKI RAMADONA ARIFIN TESAN MARYATI ZULFIKAR ARIFIN WAHYUNI ARIFIN YULIANA ARIFIN SYAKIDAH ARIFIN BASRI ERNAWATI ELISA PUTRI FITRYA RAMADANI M. DENI ADRIANSYAH ABU SOFYAN SRI BANUN HERMANSYAH WANIJEM JUANDA ANDIKA W. DELVIADINDA DWI S. KANIA TRI AMANDA MAKMUR ZAHANA LILIK SUTRISNO YULIANA FADHIL RAMADHAN SAFRIL JURAINI M. PUJA DESKI AKBAR DWI MAULANA M. SOLEHAN BADRIAH MISKIRAH MISTUN SUTARMAN SABAR ANTO ROIMAH MAHDIANA OKTAVIA SELVIA RAHMA YANTI BASIRUN ASNIMAR SAWIRA MISRIANI IKHTIARI HANANIA ERIN EKA SAPUTRA RAMLAH SUJIATON ZARAH OKTAFIANI SYAIFUL.B WAHYU PUTRA BAHRI AMIR SRI WAHYUNI ALZEN MARLINDA FITRI AIDIL MUMTAZA ARKAN MUBAROK ATHALIA MASYHURAH HASAN BASRI/LPMK JURIAH ERA DINI AULIA SARI JOHAN HABSI SYAHPUTRA BOE YATIM.S NUR AINI SRI WILASIH WULAN D. NUR KOMALA SARI MHD, LAILATUL QODRI NUR DELA AFRILIA KHOIRUDIN BOETY OKTARIA SARI JAHRA TUSSITA EDI SETIAWAN NURMA SITI FADILA RAFIMA HENRI SHOFIYAH JAHIRAH M. YUNUS HAFSAH INDAH YUSDANISA YUHARDI ABDILLAH DEWANGGI SANTI YULIANI DARWENI NURHABIBAH ZAKRI HIDAYAT M. SARIF TAMBUNAN YUSNIMAR M. SALEH SUMIATI ZAVIA MIMY SAFITRI MAULIDINI LESTARI MAULI MARDIANSYAH SAFRIN ZURAINI M. PUJAR REZKI AKBAR DWI MAULANA MUHAMMAD SOLEHAN SAMSUL HADI/LPMK MAIHAFNI M. HUSNUL HUDA M. FAROUK AL RHIZKY ABDUL GANI/RT RUSLAINI RINI ASTUTI AGUS HARTONO YOHANTI PUTRI GUSNAINI FAZRIL YOGA SAPUTRA FAZLAN ZAHY ALTAF KATIMAH EDY PRAYETNO MAIDI USDI ROSMANITA AGUS HALDI NOFRIDAWATI YANTIMAI MUHAMMAD FADLI ELFIS MARDALENA MENTARI EKA FITRI ELMA TANIA ZEIN M. ARIFIN GUNAWAN ABDULLAH TIBIAH AGUSMAN KAMSIAH BAWOK TUIYEM FEBRIANTI EKA JULIATI M. ALI AKBAR NADIA ISMAIL MISRI SUPRIADI BAMBANG PRIYANTO MAMMET RIADI RAMADANI SAFRUDIN SIEL IMEL HENDRA MANSURDIN ERNAWATI PANDRI SRI WAHYUNI MUMFARID SALMAH AGUS PRIYONO SEPTA AGUSTIKA UJANG ALI USMAN IGUS RANDI IRWANDI RANI RAMADHANI SINDY CLAUDIA FITRI YANI EDISON GUSTATI RAHMAN MALIK SUKMA WIRANDANU ZAINAL ABIDIN ERNA WATI MUHAMMAD APRIADI M. ADE HERMANSYAH FATUR HAIKAL ZAIWA HABIBITULLAH R. SARI ISMANTO NELLY WAHYUDI BIMO SENO PUSPA INDAH SARI HAMDAN HARYONO OKI LYANA SATRIA WIBOWO KATIRAH SURYANTO ROMADONA PINARTI M. SALEH. HS ROHANI RINALDI ISKANDAR EKO SUSANTO TRI NOVIANTI RMADHAN WIRDANINGSIH SUBARI MULYADI ASMANIAR NURUL FAHMI WIWIN SAPUTRA AGUS MULYADI NUR ISYANI IRFAN MAULANA ASRUL YUDIANA RIZKY REZA SAPUTRA IQBAL DWIKIANDA ADRIAN FAZRUL VANISA URUL KAYLA DJULIANTO SUWARNI HENDRI YULIANTO AYU PORWONINGSIH ROLLI YULIATI M. FIKRI YURI SAFIRA ULFI YURI M. RAIHAN YURI MUJIONO SRI LESTARI NITA PUJIASTUTI PUJI LESTARI M. ROSYID SITI NILA LESTARI EDWAR NURHAYATI YUNI NURMALA RIZKY MADI PUTRA MUKHTAR SUNA SYAIFUL SAPRIZAL JULIANA NOVELINA NURJANI JAJAT SUDRAJAT DESWITA EKA NURLINA WINA DWI ANGGRAINI RYAN SUKMARA SUTAN PANJAITAN SUPARTI RAHMAD. R.P REZKY SAFITRI SEKAR ASIH . P APRI. W.P M.FADILLAH EKAWATI NURUL EFA PUTRI EMBUN SAHARA KAMARZUKI ASMIATI IKHLASUL GHAZA AL-AMRY KAMARIAH KADIMAN/KADER KARSINAH SOERATMI/KADER ANDI APRIANSYAH RAMADHANI SAPUTRA SYAFRIZAL NURMIDES CANDRA WADI SRI RAMADANI ALWI SYAHPUTRA AHMAD GAZALI YANTI NEFA SOFINA FAHMA NAZRIM HARZA NAFA RONA MUTU NADINE ALYA MUHAMMAD NABIL DJESRIWAS MAERINETI DJESICA SHARI YODHIA GOESTIAH JEAN SAPUTRA EDI SUSANTO MARDYATI EKA PUTRI JAYATI DWI ANGGRENI TRI SAVITRI HENDRIK IRWAN DIANA JASRI GUNAWAN PUTRA B. JHOWANDA IRDANA B. M. AL FAQHROZI GUNAWAN DEWI SUSANTI ZIKRI SURODINATA SUARNO DEWI INDRIA HERANNY APRILIANI PUTRI LESTARI BAYU SAPUTRA FAZLI HIDAYAT NOCI SEPRARIA NUR HASANAH NADHIRAH FILZAH NAINA AMALIA MEYSHIKA ULDIANTO MARIA SAFITRI ANGELINA SABILLAH M. GIBRAN ADE PUTRA DONI ALIF DERLINA WIDIYA OLIFYA NAYLA DWISKA PUTRI NURHAYATI KASMAWATI LILI SOPIAN WAGINI MELATI LIWA MIRAWATI PRASETIO PITRIA SARI DIMAS APRANDI SAMIDI AMILIA JUSPILA ANDIKA MARDIANA KARDILA DIANA KARTIKA SARI SUHENDI ROSPITA SUGENG LILYANTI ARNANDO ANDI FEBRIANTO MARYADI SUGIANTO SUHENIS

NO 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525

NAMA

RT

TEDY PRATANA SANDI LIDIA SUSANTI JUJUR SAMOSIR DUMA YUNITA ZULKIFLI ERNITA FEBRI BIANTIKA RANI MARSHANDA JEFRI SANY ZURAIDA M. ZULFAHMI ENY WULANDARI RIZQYA RIFAH BAQIYA SHALIHA ELVA EDISION SITI FATIMAH AGUS NALDI SENI WIJAYANTI FRENKY NASUTION ERLINA PERAWATI ZAHRA ALYA SYAKIRA DWI ALYA SYAKIRA AGUS SALIM ZULKIFLI RAMAIYATI ARIF FIRMAN DEVI ZULRAINI TAUFIK HIDAYAT ARDIAN MAULANA BAGAS PERMANA YUSRIL LUSI SAFRINALTI SRI MARDI YANTO ERNI PURWANTI CAHYO KENCONO RAHMAT AKBAR JUNIDI LILIK HANIPAH DHIKA SAFRIANDI ROSDIANA GULTOM MARIA ROITO MARGANDA KATERINA HANNA ROTUA THERESIA SIMANJUNTAK WORDALIS PATMAWATI GAMAL ABDUL NASIR ALIS WANDI SADDAM ADHA ROKYAH NIHWAN BAHRUMSYAH RISANTI DEWI M. REZA FAHLEFI CINDY RUWIENA PUTRI JEFRIANTO INDRA ROSMINI YUSMINAR M. TAUFIQ KURNIAWAN M. FIKRI DIKA M. RIZKI NANDA MAIMANAH MUKHRI EMA MARIANA REFIYANTI HARDIYANTO ZARINA HARNILAWATI SITI ZAHIRA TAMIN PAKPAHAN MINTA ROMA SIREGAR PARMAN PAKPAHAN JABUHARI PAKPAHAN KHOLIZAH ALMUKNI AGUS AFRI YANTI ALEK NOFRIADI RENDI PRANATA SAPUTRA MILA YULIA SARI MISMAN PONILAH SIGIT SUGIANTO DIANA MAYA SARI ISKANDAR AGUSTINI JERRI ARYANDA ROMADHANI DESRIYANI MHD. SYAKBANI AWALUDDIN SUJARI SRIYATIN HADIRIFAIN ASEP NUROHMAN FEBRI TRIWANSYAH JHON HENDRI NIARTI SA’ADIAH MAIMUNAH LAODE RAMADAN RIVAL LAODE AHMAD SHIDDIQ HARDIN NAPIL NAZAR RUDI PUPUT SEPTRIOZA AFROL RUDIO PUTRA SUYONO YUSNIDAR SARTIKA RAIHAN FADILAH NABILAH AZ-ZAHRA SARDIAH DALIANA DEKI SYAFRIADI PENI SYARIANI BENY ANGGARA ANTONI NURHALIZAH SARUDDIN SIREGAR ROSMINI RITONGA RAHMAD SAIR IRWAN MARITO RANI ERLINA S INDRAWATI JEFRIANTO ADI SAPRI YURNI AGUS MIRA ERNA YUSNITA SUPRI YANTO JUMRIADI ARIF PAKRI AGUS YENI AGUNG ADI PRATAMA HENDRA PRANAMA AGUS MELTA RIANI REZKI SURYA RAMADHAN AHMAD AFRIZAL IRWANDI YUSUF NAUFAL AL’AFIF RIZAL MUKLIS TONGGORIA FITRI APRIALIS SABRINA JOKO SUPRIANTO SLAMET SUPRIANTO SURIA YENI SELVIA ZASKIA AMANDA MUHAMMAD AMIN SUHARTI ALIFA LUTFIA GASSANA MISKAM SUPIAH RACHMAT SUBAKTI PAIMAN MARKISAH JOHAN DIAN SAPUTRA MUHARDIANTO NABILA RAMADANI ELIYANA ENDRA CHANDRA ERIC CHANDRA RINA CHANDRA RAMLI MENONG ABDUL HARRIS ZALINA M. HARINALDI AWSHA AULIA FITRI DINDA PUTRI KAUT S. M. PAZA ALMAGRIRAH HASNAWI ENDANG SUSANTI NABIL NASRULLAH HS BASUKI RATNA SARI RESTIKA UTAMI RESKI RINALDO RISKI JULIANI RISKI RIPALDO AMIRUDDIN HALIZA AMIRA ANANDA ABU BAKAR MAYA TULADI YEYEN WAHYUDI ALDI SAPUTRA RIKI RAMADHAN HADI SUGIONO TUMINAH DODI USPEN MIRA NOVITA SILVA FEBRI ANDIRA NABIL KAYSAN ANDIRA RIZAL YULIANTI BEJAN S SUMIATI DWI HARSONO AHMAD ZEKI DARWIS ISKANDAR MAZNA MUHAMMAD ZIKRI MUHAMMAD ZAHRI SYOFYAN/RT ERNI HARTATI ALPIAN DELNI ANGGRAINI SLAMET RIYADI NURAINI ALDIANSYAH SAPUTRA M.YASID NASUTION ZURAIDA M. WAHYUDIANSYAH MISSUHARTI IBNU AHMAD RAYSA MUTIARA APDELIA PONIMAN PUJI LESTARI DAFFA IHSAN PUTRA YARDI EMELDA TITO RIMANDA NOVA RAHMAH KARUNIA RAHMAT HARYANTO JAMILATIN RANI EKA PUJI LESTARI K. DWI WULANDARI SUNARDI WAHYUNI LISTYANTO WAHYU ADHI REZA KHORUL ARAF HARTO SUPARNO PONIYEM WAWAN TUGIARTO SUMIYATI MUJIMIN SUKASMI RANI RISKI FATIMAH INAYAH RAHMA DANI NIK AZIZI/ RT SAWIYAH WAHYUONO SRI DARTI INTAN ROHALI HANDY KURNIAWAN NURHAYATI SIMAMORA JESSICA ANGELINA JOSHUA ALVIANO YOSE MUNAWAR SITI AMINAH ANOM ATIKASURI MUHAMMAD RIZKY SOINEM SOLIKIN AHMAD YANI SADINI SIGIT RIYANTO DWI ISKANDAR PITRIANA SURYANI KHAIRUNNISA PUTRI YANI LISBEN PANDAPOTAN S. RIRIS HUTAPEA DEWI RIANTA SINODE KRISTIAN SIAMSIWAR ROSMANIDAR ARMAN DWATRA MISMAN WIYANTO SRI WAHYUNINGSIH SUPRIYONO BUDI SURYANI PUJI KURNIAWATI AGUNG SEDAYU FAIZ BIMA ZAKI ZUL AZMAN NURHAIDA SHAZIA AZZALEA CHANDA ERFAN EFFENDI RIEKA HANDRIANI NIK M. FATIH WILDAN NIK NAUFAL ATHMAR H. SAHAT HASONANGAN RISMA TAMPUBOLON GRACEA DUMA ARTHA CHANDRA ERLIANA ATIQAH KHANZANIA P. HARMI PUJI LESTARI KHAIRUL BARIAH ERNIWATI EKAWATI ERWANDI ZULKIFLI AHMAD NST ELI MISRIYANTI YUCHRIANA YEAR HADI KURNIAWAN CHAIRUL DARMAWATI AGUNG GUMELAR IBNU YUSAHAWAN AHYAR SABRI SUMIATI KAFINY KHAIRA GUSTAMI NURUL MAYA FAIZA YULIZA TAMI SIGIT SWANDI TAMI SHERY SHEFTIANI TAMI ROZALLY JAIS LISDIAWATY ANGGARA PUTRA MELATI SANTI SARTIKA SADARI SUHARNI AGUS SAPUTRA HENDRAYADI VERA MISDALENA ALDO VERDINANDI H. ALDI VERNANDO H. DEAJENG ALMIRANDA JAMILAH JONI ISKANDAR RIKI HARIADY ISNAWATI SAFRINA SAFRIZAL MAYOR NAINGGOLAN SANTI NADEAK VERRY TOMAULA N. ROBERTO NAINGGOLAN HERMANSYAH NETTY TRIYA SUSANTY DIAH MURTIANI AMIRUDDIN SUGIARTI YASSER ALDYANNUR ULFA NURJANNAH FIKRI ARDYANSYAHNUR ANISA NADRAH NELLY SUTINAH/RT NURMASLAN NAINGGOLAN ZUBAIDAH SIAGIAN TUA PARULIAN ASMIRA ZULKIFLI POHAN ANNISA DEWI KUMALA P. BUDIMAN ARMAICI BUNGA ARMANDA RAFA OKTOMANSA LAY SUI KIANG JUITA RUDY LESMANA HARY LESMANA NASRULLAH GANI ROMLAH

NO 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886

RT

NO

MUHAMMAD RIZKY M. DEDE SABRIANSYAH AHMAD AMBIYAKI AHMAD AULIYADI PENAPOTAN ERTI SUNARTINI MERY ANJELI FERONICA KELVIN RICKY HUTAGALUNG TUTI ARNA SIREGAR ROTUA DESTI AYU H. ANDERSON PERNANDITO ARROYO CLAUDYA SANTO HUTAGALUNG USMAN BEE HIE JOHNY JEFFRISON RICHARDO PATRISE CALVIN RICHARD BAMBANG SUTEJO UMIZAR RANGGA AULIA RAHMAN R. DINAR MANNA W. RABIATUL ADAWIYAH P. AMIRUDDIN ANIZAR OKI NOFRIANDI RIZKI AIDEL FITRA WAHYU WARDIMAN MULYADI SYOFYAN IMELDA NATASYA AULIA PUTRI NUR AINI PUTRI IRWANDI RAIS RONI SUHENDRA NURDIANA/ KADER DEWI SRI WAHYUNI HAIDI ADIAN JUNAIDY IRWANTARA JANNY CAROLINA UPIK LUSI LISNA WIDYA ARI ISWANTO ADE CANIAGO NENI HAFRIL YANTI DAHLAN DEWI NADEAK FEBRYOLA CRISTY DAVINAH BASTIAN MATIO GABE SUKATNI UCAH MULYADI SETIO HIDAYAT SANTI DESI NURHASANAH NELARIA NAINGGOLAN BACHTIAR ERMANENI RISKI YARDI SISKA TOMMY SAPUTRA MUHAMMAD NOFRIYAN ABDUL HADI DELIANUM EDON RAHMADAN MUHAMMAD IBRAHIM UMMI SALAMMAH AMINAH MATONDANG AMIRUDIN ELFIANA BAHAR ARFADINA CAHYANA M. ANDRI BASUKI SUKAMTI REHAN ADITYA NUGROHO ZULKIFLI JUNASIH ZULFAN AFANDI JUNAIDI ZULKIFLI NANANG JUANDA ILHAM KURNIAWAN AJU ENI FERNANDO ANITA WIJAYA MULYADI SYOFYAN IMELDA NATASYA AULIA PUTRI NUR AINI PUTRI IRWANDI RAIS RONI SUHENDRA ANTON ASNAH RITA NOVITA HENDRY SUSANTO LIEHA PRISLIANA ENNY PRATHAMA VIVI ANNISA PRATHAMA RIZKY PRATHAMA FRANKY WIJAYA P. KAMARUDIN AMINAH RIFQI RIYANTO FHAIZ WIJAYANTO FHARIZ WICAKSONO SAHAT SILABAN ROSMAWATI NOVIA ADENITA SILABAN NIKE ROSANA. S UNTUNG SUALMI SITI FATIMAH ROSIANNA. S M. YUSFAN INDRA YUSNILADEVI HETTI. S NEYSHA KIENNA BAMBANG KURNIAWAN SITI SYARAH M. MIRZA SYAZANI ROSMIATI SONY WIANDANY IISRESTIANA SARI DARHAN FAUZI MUTAQIN PUTRI NUR FITRIANI SLASABILA WIYANDASARI M. ARRAYAN SYAHRIL MANJUNG RITAWATI RIWA AMANDA F. BENG SUI NURAINI ANTONI WIJAYA WENNY OKTAVIA NURHAYATI SYAMSUDDIN MARIAMAH SAMIA MAYA PUTRI TAKSIAH JUNAEDI NADRATUL AZMI RICKY YACOB MAULANA IBRAHIM SENA SAFITRI ZAINAL ABIDIN/LPMK KATIJAH FENDRY PERDANA FITRI RAHMASARI PUTRI NUR HAFIZAH ARIZAL NOVI YANI O. PRATAMA RAMADHANI NADA M. MAULANA RAJA WASANA AKBBAR AZWAR/RT SANIATI M. ARIO SAPUTRA M. RIDWAN NURUL JANNAH TAMRIN. M KARTINA ROZALI SUKATMI SITI NUR FATIMAH SYAWAL HIDAYATUL AMIN ALI KOHARI SUKATI SUBANGKIT NASRUDIN SALMAN SAHURI KHOLID SARMADAN TITI WURI ANDANI BAGUS SULARSO LASTRI MAIMUN GHOZIYAH FITRIYAH MUJAHID SALIM SURADI HARTINI SUHENDRO HARYONO SYARIFUDDIN SURATIN NAUFAL FIKRI SANTOSO HAFIZ SIDDIQ JAZWA ALYA MAYOR NAINGGOLAN SANTI NADEAK VERRY TOMAULA N. ROBERTO NAINGGOLAN ISA WINARTI ASRI YENNI SUSANTI DONI EKA PUTRA MORA DELVIANTI AFDHAL ZIKRI ZAKI AZZAM TENGKU SUHANA HERAWATI FITRI YANI HARIS RAHMAN ARIF GUNAWAN HUSNA HAYATI ISMAUL FAJRI ASPAMI MISKAWATI ASRI SUSANTI JAMARAN KARTINA AGUS RIDAR MASTATAKTUM NURAINI IRSAYDUL WAHYU STABBU AFDAL MAHATHIR MUHAMMAD INTAN SEPTIANI SUWARNO MISNAWATI ARIF WAHYU PRANATA SAWIYAH ZASKIA PUTRI NAFISAH ARIF HASWINDA A. SYAFIQ MUSYAFFA A. SYUKRI MUSTHAFA A. SYIHAB MUHANAA A. SYAKIB MURTAJAA ANTONO YASNI AZIZAH SITI SARAH RAHMA DILLAH WAHYUDIN KUNTUM KHAIRUNI RONTO NURAIDA MUHAMMAD QORDAWI SAKRIP SARTI DARIYONO SAMSUL BAHRI MISNAN BINTORO MULYO MAIRIZAL KALIMAH AYU LESTARI ANDRI PRASETYO AFRIZAL FERNANDO GUNAWAN RUSTINI RENANDA SALSADILLA W. LANGGENG AYU S. RUSDI ANIS DODI NOFI RESI FAISAL SIIN ASRIL FITRI WIDIA NINGSIH MALFIRA WILDA SHAFIYAH SUHERMON NELIWARNI ANNISA RAHMAH WINNA DWI PUSPITA WENNY DWI ANGGRAINI HADIA SUPRIANTO SUSIATI AHMAD FAHRI PERMANA FARAH FADILLAH B. INDRA GUNAWAN HARTINI HARTIKHA GUNAWAN AHADILLA GUNAWAN HABIB MUZAMMIL G. SURYATI SRI AYU RAMADHANI HETTI RATNA SARI POSMARITA SITUMEANG ERINNA NAIBAHO ARDIHA NAIBAHO TENGKU MEXALINAN SABARIAH TENGKU NURFITRIANI TENGKU MUHARNI AFIZA TENGKU RIDUAN TENGKU NISA DESTIANA MOHAMMAD NASIR NURHAYATI SEKAR NURSYAHIDAH U. SARAH NURHALIMAH MHD. YUSUF ABIMANYU SYAQILA RAGIL NAIRA FATIMAH TENGKU SALMAH T. CHOLIJAH SYAMSUL BAHRI. SY A. BAI HARTONO HERI YANTO DOALIM SITORUS SUHENDANG WINDA MARIA SITORUS TIARA CELSIA SITORUS CINTERENI PUTRI TERANI HAPPY SRI RAHAYU BR S. PUTRA PARULIAN S. SUSENO EVANI WARTI SYARIF FATAHILLAH AQIDAT UL’IZZA MUHAMMAD ASH S. HARUN AL RASYID SUTEJO MOYO CICIH AGUS SUPRIADI HERI SUPRAPTO BETRI ELVI SUSANTI FAREL PRATAMA GHEA NATASYA PUTRI ASRIL FITRI WIDYA NINGSIH MALFIRA WILDA SHAFIYAH SUMI SUHARYANTO JAMALUDDIN NELI DEWI SARTIKA FATIMAH FIRDAUS MURNIATI SHINDY AUDIA FM IMAM FIRDAUS INDAH PERMATA MURFI M. FAHRI FIRDAUS M. FAUZI VIVI ELFIA SUSANTI RYAN DHARMAWAN FEBRIAN JULIADI DIANA TRIANI AISYAH NUR RAMADHANI MULIATER SIMANJUNTAK LINDA CHRISTINA H. SUKMA PERMATA S. YESSI MUTIARA S. AMELIA ROMAITO S. SAHAT MARTUA RAYMOND SIMATUPANG DEBORA JUNITA ANDRIA ESTER MARGARETH S. PETRUS RONALDO S. ROSTINUR SILITONGA HENDRI HERNI HAURA NABILA NINDRI

NAMA

2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956 2957 2958 2959 2960 2961 2962 2963 2964 2965 2966 2967 2968 2969 2970 2971 2972 2973 2974 2975 2976 2977 2978 2979 2980 2981 2982 2983 2984 2985 2986 2987 2988 2989 2990 2991 2992 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067 3068 3069 3070 3071 3072 3073 3074 3075 3076 3077 3078 3079 3080 3081 3082 3083 3084 3085 3086 3087 3088 3089 3090 3091 3092 3093 3094 3095 3096 3097 3098 3099 3100 3101 3102 3103 3104 3105 3106 3107 3108 3109 3110 3111 3112 3113 3114 3115 3116 3117 3118 3119 3120 3121 3122 3123 3124 3125 3126 3127 3128 3129 3130 3131 3132 3133 3134 3135 3136 3137 3138 3139 3140 3141 3142 3143 3144 3145 3146 3147 3148 3149 3150 3151 3152 3153 3154 3155 3156 3157 3158 3159 3160 3161 3162 3163 3164 3165 3166 3167 3168 3169 3170 3171 3172 3173 3174 3175 3176 3177 3178 3179 3180 3181 3182 3183 3184 3185 3186 3187 3188 3189 3190 3191 3192 3193 3194 3195 3196 3197 3198 3199 3200 3201 3202 3203 3204 3205 3206 3207 3208 3209 3210 3211 3212 3213 3214 3215 3216 3217 3218 3219 3220 3221 3222 3223 3224 3225 3226 3227 3228 3229 3230 3231 3232 3233 3234 3235 3236 3237 3238 3239 3240 3241 3242 3243 3244 3245 3246 3247

NAMA

RT

HAIFA NUR FADILA HAZIM NABIL ALFITRIYANSAH RENTA MARPAUNG SANTI HOTWIDIANA S. BERNAT PARLAGUTAN DODI PARDOMUAN S. SRI ARYUNI DEWI S. ERNI GENTINA S. JENAH RENAIDA S. RAHMAD ANDI WIJAYA MAHMUDAH ZAKIYA LUTFIANDI WIJAYA MAIZAMRI DESI ARIANI MAYA IKHSANIA M. KHAIRUL RIJAL M. FAJRI RAMADHAN KHAIRUL TITIN WENDI KURNIA WIDIYA KHAIRIYANTI ADITYA SAPUTRA GITO/RT SULASTRI MUJADID MIRA MASKUROH MAULIDA MAYORET MASKUR KHAN UCOK SIHOTANG KONIANTA MUNTHE RAMADAN TUA SIHOTANG JULIANA SIHOTANG JUNAIDY NAZHIF RAHMAD RISKI SIHOTANG NASRUL ELZA FITRI RIZQA ASRARUS SYIFA CHALISHA FADHILATUN N. R. NASYWA ATHAYA ROSPIANI HARAHAP HENDRA SIREGAR LISNA SARI SIREGAR RIKO SIREGAR M. SYUKUR SAPUTRA SANTI AGUSTINA FEBBY NUR’ANI INDRY DWI YANA M. JEFRI AGUSMAN YASNIMIATI YAHYA PRANATA SUCI GUSMIATI RAFIF ARRAISYAIDI ADEK ASRUL SUHENDRA AGUSTINA GIO SATUN ABDUL GAFUR SRI KODARSIH SUTRISNO SUWARNINGSIH SANTRI AYU PUJI K. AZURA DWI JANNAH JUANDA IRAWAN TRI ZUHERMANSYAH ELI ARTATI HERLI THERESIA P. NUR AISYAH PUTRI SUYOTO/KADER REFLIZARNI LUTHFIYA NURIZQANI WAFIQA ‘ADANI MULYADI/ KADER IDAWATI SUPRAPTO YUSTIKA MANALU JANURI WISRIJAYA MASTADI YULIANI SARI DONGORAN RAIDIL AHMAD PUTERA RAIS AHMAD PUTERA RAISHA AHMAD PUTERA SAULINA BR. TAMPUBOLON HASAN BASRI EFRIDA NURHAYATI EDHI PRATONDO MEIDY MIRANTI SETIONO NINING SUHANINGSIH KATINEM TUKIRIN SURATMI SELAMET. R SITRA PURWANINGSIH ENDANG ERNAWATI RAHMAD MARDIANTO KARNI AGUS MAWARDI TRI SUYATMI AFRI ANTONI SISKA RAHMA DANIS SUCI MEYSA PUTRI RAHMAT FADLI EKA PUTRA SURYANI SYOFYAN ABDURRAHMAN ARSIL SYOFYANI MUDZALIFAH HADI MASBUQIN ELTAMIZUL KOTO LUKMAN HAKIM YATIMAR RAMADHANI YELVI SAVIRA BAMBANG SOEROTO DEDE ROHANI ASRI WULAN SAKTIA NOVRIAN ANUGRAH A. AJI SUKMA PRABOWO MUHAMAD DAVA TRI SETIA HANDAYANI AGUNG PAMUJI FITRI ELIANA SARI ROSALINDA TURBA DONGORAN ELLY RUSMIATI RUSNI ADRIANI. D ULFAH FADILLAH. D L. BR. HARIANJA SABAR FRIKTON P. GONFRIT PAKPAHAN JESSI LUCYANTY P. JONFITER NOMENSEN P. HERAWATI HARAHAP RISKA EFRILDA CHANDRA FAUZIAH TISCHA FAUZAN ZULFIKAR MISRIHENI VIVIE CARLINA ANDRI DORKAS RIONG SILALAHI ZOAN FIRMANSYAH ERWIN AFRIANI ADRI WIDIYATAMA NAZIA WIDI RESTIANANDA KASIYEM MARULI NOFA EKALESTARI DARMAWAN SAHARUDDIN ELVI METTRIA M. ZIQKRA ELWADI SYAHRIL SURYA DINATA SURYA JULIANA SURYA FEBRIANI SURYA BISMIHAYATI SUMIATIN MULYADI IDAWATI GIO SATUN ABDUL GAFUR SRI KODARSIH SUYOTO REFLIZARNI LUTHFIYA NURZQANI WAFIQA’ADANI SURATIN HARI SANTOSO RANDI HARNANDI MERY RARA ANGGELA DZICKO AHZA HARNANDI IDRIS SUKADI SRIYATI PUJI SETIYO HATI BAYU KURNIAWAN IRWANSYAH PUTRA KANTIKA MESWARY KEIRA DEWI AQILAH MOHAMMAD IRFAN F. WAN DIAN LAILA NURHAYATI M. JEFRI S. SIREGAR ALFRED MARIHOT POHAN ANITA OLIVIA POHAN JANTRI WASITO HASIBUAN IKA MEI ROMAITO BERWYN PREDERIK H. HASIHOLAN TAMBUNAN ASMELI WULANDA TAMBUNAN PAWOLD JEREMIA T. BENI NOVRIALDI SUCI MASHAYUNI AUREL AKIFA BIBIT SITI ASRUL ADEK SUHENDRA AGUSTINA BAMBANG SUPRAPTO WIWIK HANDAYANI ARIESTA WIYAN GINTARI DIMAS PUTRA PENGESTU SUKADI SUDARTI HADRATUL MAULANA M. RIZKI SAPUTRA AHMAD FARIZTRIADI ZAINAL BY APUK ROSMAINI SYAFRIANTO DESI VOASRA AYU ADELYA DESMARITA ZALYA DESMARITA M. FAHRY FRANSISKO LISA APRILIANI SIMAN LILIS SUWARNI ZAINANI WAHYUDI APIOLOKA ANDI SUSILAWATI AZHILLA YASMINE ZULKIFLI ITNIYANTI TENGKU HARUN R. TENGKU RAFI AHMAD AL ITNIYANTI SITI AMINAH ANOM ATIKASURI MUHAMMAD RIZKI ERIZAL AGUSNI GUSTETI WIRATNI WINA AMELIA YOSINDA MARDAN RITA M. ARIYA M. ARIYO ANIYUS DIAN RAHMADI DINA RAHMAWATI EDISON ZUBAIDAH RICK JAKSON AYU ANDIRA MUHAMMAD REVAL RIZKI AFRIZAL TANJUNG NETRAWATI FITRI ELIZA SYAHRONI HASBULLAH HARTINI SYAHRUL RAMADHANI M. MISBAKHUL ANAM QAHHAR MUDZAKAR ANDRIZAL MISNAWATI RIO ANELDI AFRI YANDRI SIHOL HUTABARAT MALIA BR. SIHOMBING ONLY HUTABARAT NURLINA HUTABARAT AYU FENI WIDYASTUTI AGIB AL BAMA ONDRI RATNA NETTI SUSANTI MAJID FAKHRI FANY ATTIFA SYAIFUL KHER. B NURNALIS EKO CIPTA PAHREVI ROMY HIDAYAT FATWA HIDAYATILLAH. S SITI AISYAH YULIANTI. S EVI YONZORA SYAFRUL EVA FIDRAYANTI HAFIZHA NUR FITRI MUHAMMAD RAZHIF M. RAIBUL TSANI DIAN FADILLAH JULIADI ASMAWATI MUHAMMAD FADLI M. FALIH HIBATULLAH MUHAMMAD FAHREZA DONY ISKANDAR ROZA SRI AYU FATTAN ARIF FAISAL NADHIRA HUSNAYA TASWIL BAINAR ALDI ELYA WATI GIO ALGIANSYAH ARIF AL AZARI MUHARIWAN LAYLA SHOIMA MARHAMAH RAJAINI BIN JAMIN HELMI BIN SYAMSUDIN LISWARTI AZWAR ANAS THAMRIN NURMAINIS ADE SATRIAWAN GUSTARANDA MANIWARTI M. ARIFANI YELLI GUSNI IYET TELANI KUAT RAHARJO JULIYEM YUNITA SARI TRI LESTARI AGUNG RIZKI YAFRIZAL LUSMAWATI YAHYAN SUTISNO INA KUSMINA PUTRI PAULINA RUSLIADI FITRIA REZIKA AUFA MAHARANI MOZA SALSABILA ALDI MUSTRI DESI RINA DIVALYA ALWINA HILLERINA ALWIENDY ERIZAL SARI BULAN DEVRISA NOVIARNI RICA WAHYUNI NABILA PUTRI DESWITA RAUDHA PRATIWI SUPARDI/LPMK MASRAH PHOJA SASMITA JANUARDI TRI MAHYUDI DEDI CHANDRA FITRIA RIKA MARDANIS DIA AFRINA JULI AFRIANTI MAYSARA ANDI SETIAWAN JASWAN ELFA SUSANTI

NO 3248 3249 3250 3251 3252 3253 3254 3255 3256 3257 3258 3259 3260 3261 3262 3263 3264 3265 3266 3267 3268 3269 3270 3271 3272 3273 3274 3275 3276 3277 3278 3279 3280 3281 3282 3283 3284 3285 3286 3287 3288 3289 3290 3291 3292 3293 3294 3295 3296 3297 3298 3299 3300 3301 3302 3303 3304 3305 3306 3307 3308 3309 3310 3311 3312 3313 3314 3315 3316 3317 3318 3319 3320 3321 3322 3323 3324 3325 3326 3327 3328 3329 3330 3331 3332 3333

NAMA

RT

NURIL AIN INTAN JIHAN FADILLAH SYAKIRATU SYITA JASMIR YAHYA MARLIN MARDIANI RAHMI WANDRA. M ARSESWITA RANTILKA YULIANDA S. ROZA DESWITA FADLI GUNTUR MODAL GINTING ELVRYTA SORTA S. TESALONIKA ADELINA G. MAWARDI NURHENI ZAHID MAULANA ASYIFA NUR AISYAH SUDIRMAN ARNETI ANTON SUPARDI SESILIA SAWAL LUKMAN ZULKARNAIN NOVITA SETYO RANI AZZAHRA ZIVA AZZURA QAYLA FITRI SYAFRIZAL NURSYAM NURIZA METBA SAFIRA ELI PITRIANTO DESMANIAR SEI RAHMADANI TRI DEWI ANA ANDRE SAPUTRA ZAINIR DEDI SURYA HENDRA GUNAWAN YENI KASMIRA ISWANDI JAFRIZAL DONI SAPUTRA TATI ANDRIANI DESI RAMADHANIS THABRANI M. ALI SURI HANIVA HENDRI DINATA JIFRI HAMDANI MAULINA NOVERA ANDRY ELFIAN SIREGAR NUR’AINY LUBIS YORDI ARIGHI SIREGAR RAEHAN ANDIKA S. DAFA RAQHI ABRAR. S NAZLA FATIA ANIQA. S M. REFENLU NURHAYATI MIFTA URISKA W. SADZA FITRIYATUL H. DHAMINDRA DELITA SANDRA TIARA DHAMIA PUTRI RAFFA DIU ARRASYID MUHAMMAD SYAHRIL MARIANI MASTURAH SYAHIRAH MUHAMMAD SYAROOL MHD. RAHMAD R. NURUL AFIKAH FADHILAH SAKINAH SYAFRIUL MANTO FAJAR ABDILLAH SAIFUL AMRI TONI JOSE RIZAL LENNY MASTIUR BR. H. YEHEZKIENDONIWELLDY YOSUA FRANSISKUS YOHANA LAURA YANSEN KURNIA SYAFRIZAL SUJARWATI WIRA ADI KA M

NO

NAMA

RT

NO

NAMA

M

M M

M

M

M

M

M

M

M M M W

W W

M

M

W

M

M

M

M

M

W

M

M

M

M W

MM

M

M M

M M

M

W

M M

M

M

M

M M M

M M

M

M

M W

M

W M W

M

W M

M

W

M

M M

M

M

MM

M M

M

M

M

M M M

M

M M

W

M

M

M

M

M

M

M

M

M

M M W M

W

M M

M M M M

M W

W M

W W W

M

W M

W

M MM

M

MM

M

M

M

M

M

M

M

M M

M

M

M

M

M

M M

M M

M

W

M M

W

M

M

M M

M

W

W

M

M M M W

M

M M

W

M

M

M

M

M M

M

MM

M W

M M

M M

M

W

W M

M

W M

M

M M M M

M

W

M

M W

M W

M

M

M

M

W

M

M M

M

M W M M

M

W

M M M

M

W

MM

W

M

M

W

MM

M

W

W W

M

W

M W M

W

W M

W

M

M M

M

M

W

W

M

W

W

W M W

M

W

M

M

W MM

M

W

W

W

M

M

W

M

W

M

M

M M

MM

W M

M

M

M

W

M

M W

M

RT

W

M

M W

M M

M

M

M M

W

M

W

M W M

MM W

M

M M

M

M

M

M M M

M

M M

M

M

M

M

M

M

M

M M M M M M M

M

M

M

M

M

M

M

M

M M M

W

W M W

M

M MM

M

W M W M M

M

M M

M

M

M

M

M

M

M

M

M

M

M

WW M W M M

M

M

M

W W

M M WW

M

M M

W W

M

M

W W

M M

W M

W

MM

W

M

M

M

M

M W

M

M

M

M M

M M

M M

M

M MM W

M

M

M

M

W

M

M

M

M

M MM M M M W M M

W

M W

M M W

M

M

M M

M W

W W W

M

M

W W M

M M

W

M

M

W M M M M M

M M

M M M

M M

W

M

W

M

W

M

W W

M

M MM M

W

M

M

M

W

M M

M

W

M M

M

M

M

W

W

W

M

M

M

M

MM

M M

M

M

M M M M

M M

M

M

W

M M

M

M

MM

M

M M

M W W

M

M

M M M

M

M M M

M

M

M

W

M

M

M W

M

M

W

M

MM M W

W

M

M

W

MM M M W W

MM

M M M M M MM M M

M

M

M

W

M

MM

M M

M

M M

W MM

M

W M W

M M M

M

W

W

M

M

M

M M

W

W

M

W M M

M M

M

M

W

M M

M

M

M

M

M

M

W M

M

M M W

W W

W

M M M M M

M M W

M

M

MM M

M

M

M

M M

M

M

W

M M

W

M

M

W

M TATA LETAK: ANTO


4

Dumai Pos KEL. RIMBA SEKAMPUNG NO 4331 4332 4333 4334 4335 4336 4337 4338 4339 4340 4341 4342 4343 4344 4345 4346 4347 4348 4349 4350 4351 4352 4353 4354 4355 4356 4357 4358 4359 4360 4361 4362 4363 4364 4365 4366 4367 4368 4369 4370 4371 4372 4373 4374 4375 4376 4377 4378 4379 4380 4381 4382 4383 4384 4385 4386 4387 4388 4389 4390 4391 4392 4393 4394 4395 4396 4397 4398 4399 4400 4401 4402 4403 4404 4405 4406 4407 4408 4409 4410 4411 4412 4413 4414 4415 4416 4417 4418 4419 4420 4421 4422

NAMA

RT

SUTRISNO 23 23 SULISTIYANI 23 SURATMAN 23 SUJILAH 23 ABD. MANAH 23 CHOTIMAH BANGET PARULIAN BR S. 23 23 ALBERT SITOHANG 23 BERNAT SITOHANG 23 RUT DAMAYANTI S. 23 JOSUA SITOHANG 23 JOSEP SITOHANG 23 MARDI 23 JINNAH 23 SITI FATIMAH 23 SUFIAH 23 FAIRUS 23 JASMA 23 FEBRIAN AKIR 23 SUPADMO 23 SIWAINI 23 SONI FEDDI 23 HALIMAH TUSA’DIAH M. FARHAN FEDDIANSYAH 23 ASYIFA AQILA SALSABILA 23 ATHIFA AQILA SALSABILA 23 23 JUMADI 23 SUMINI 23 ROMA DHONI 23 RAMADINI FITRIA 23 KAMBALI 23 SRIYATI 23 EDDY 23 ERMAL INDASARI 23 ALYA AZZAHRA 23 ALIF NOUVAL 23 BUDIANTO 23 SUNARTI SYAHMUDIN PULUNGAN 23 23 NURHIDAYAT 23 ZAHRANI DIL FITRI 23 JARKHI KHASARI P. 23 ANTONI 23 DORI ASPIKA CANDRA 23 AMIRUDDIN 23 HERNITA HASIBUAN 23 FADIL FATIH EL DIN 23 RUSLAN 23 MARIANI 23 SITI NUR AISYA 23 M. RIZKY SAPUTRA 23 BILQIS FARAH QANITA 23 JUMAINI 23 LIA MULDARIA 23 SHALSYA NURFADILA 23 LAILATUL RAHMANIAH 23 JUANTO 23 LISNAWATI 23 RAHMAH QAULAN S. 23 JULIADI HARAHAP 23 RITA AGUSTINA 23 SITI AZHARA HARAHAP 23 AGUS MISWANDI/RT 23 SUPARIDA ALFAHRI DHIKA RAHARJA 23 23 TSAQIF FARRAS P. 23 GIBRAN PRAMUDYA R. SUSENO 24 KHUSNOL KHOTIMAH 24 CHIARA ELYSIA SUSKHO 24 24 ANNISA AQILA DWI S. BONAR TAMBUNAN 24 RAMARIANTA PURBA 24 24 NOK MINUK ARTA T. BINTANF OKTAVIA BR. T. 24 24 OKTA MARULI TUA T. SUGINO/KADER/RT 24 NAPSIAH 24 BUNARI 24 DENI SAPUTRA 24 RAHMA YULIANA 24 RADITYA WARMAN 24 BUDI HARTONO 24 EVI SUSANTI 24 RIFKY ARAHMAN 24 VIVI CLAUDIA RAMADHANI 24 24 SHERIN NAJWA GIMAH 24 HARYONO 24 ARIFIN 24 HARINI 24 NOVITRIANA 24

KEL. SUKAJADI NO 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263

NAMA

RT

YANZI DONI HARYANDA BAYU KURNIA YANDA VIONA CHINTIA YANDA MUKMIN ARISUWANDI NADYA CITRA YANDA MEISYA HABSARI ADAM FIKRI WIJAYA AYUNAH DWI DAMAYU TRIA UTARI PRI HARTINA FATIMAH SYAMSUL ANWAR ARDISON NANDA ARISTA AULIYA ROHMAN HANIVA NURBATRISYA NURANA F. ROSMALI MISNILAWATI DESMIYATI IKA FITRIYANI DENA SUMIRAT POLTER PAKPAHAN HENDRIK ERIKSON ALPINER MARULI TOMAN JONNEDY PIATER NOVIAN IRAWAN JEFRIYANTO PAKPAHAN MAHADIN YUSUF S. AWI RUBEN PRIO SIMATUPANG PIERE DAYAKA ALWI CHOLIJAH ANDI HIDAYAT ANDI JUMARI SUMINAH NAZAHAH AUFA M. SYAMSIR Y IRMAWATI ZEFRIANSYAH AULIA AGNESYA PUTRI MAULIDIN SATRIA PERWIRA ASNITA PANE ANNISA ERIANA SANY YULIA NINGSIH DESI TRIANA ADE LESTARI IDRUS HAKIMI ERIMAYANTI NADA SYIFALUQYANA HAKIM IHSANUL HAKIM EDI HARIANTO MURDIANI ARYO ADI PRASETYO NIA DWI PRATIWI MUHAMMAD NAHRUDIN SYAMSINAR TEGUH IMAM COKRO W. DINA FITRIA HANDAYANI MARTINA FAIZIM MUHADI AMAR TANJUNG DESMAWATI RAHMAT RAMADHAN SUKRIZAL TENGKU SALIMAH SRI ENDANG SUMIATUN MAHDIAH SRI UMAIRA ZAINUDDIN FITRIA MAYENI HENDRI ZAINUR NURSALINA YESI NURMILASARI SADRI ZAINUR RUDI ZAINUR NURHAYATI FITRI ZAHAYU DINAH TRI JULAIDI AYU TENOVRE. KD SUARDI RAMADIAN WIRJAYA NURSIHA RITA ANGERIANI BAMBANG IRIANTO RUDI WANTORO EVA TRIYANTI PINA APRIYANTI ALIF FIAMA TASYA DIVA MARYANI ADRIL. B MURNIWATY ANSON/ KADER ROSMANIAR LIE BANG ROHANA ANI ANGGA RIAWAN JULIANA SINTIANA SUSANTO LILI ANDESPA SONI HENDRI KUSUMA YULIANTI MARSHANDA SYARIFA K. DONI ANSON/ KADER LINCE MARDIANA NADIA PERMATA SARI M. WAHYU RAMADHAN RAHMAH NURAINI SALMAH KHAIRUNA ELZA MONALISA FIONA NATASHA ANGELINA FELICIA NOVITA ANGELINE ELYSABET MARGARETHA FRANS NICHOLAS FREDRICK NOAH TUKIMAN SARSIYEM SONY ZULIYANTO NADA NABILA ANTHON MIZWAR ESLY ROSALINDA SILALAHI ERICK MICHAEL EVA MARIA CHRISTINA NAZARUDDIN AZIDAR WANDA KURNIAWAN SICHI AGUSTINA FITMAWATI YESI FEBRINA SARI RAFIKA DURI RIKI FERNANDO HENDRI SANI PUTRA HENDRO SANI PUTRA SOFFIA FITRI YANI SYARIFUDDIN NANI AGUSTINA RINII ATIKA DEWI MUHAMMAD FARHANSYAH M. RIZQI RAMADHAN PUGER KAM ANDOKO ROSINAH NIRO MAILIANO ZARA AGUSTIARA SITI PURWONINGSIH DWI SUKAR WATI SUHARNO SAIDAH SATRIANDRI YOSKAVIA RISKA ANDRIANTI FERY IRAWAN. S SUJONO SURIYANTI RESKI ANNISAA ADAM YUDHA MUHAMAD YUDHO ALI AMRAN MANDAHILING DESNIMAR JAMBAK DEWI SAHARA RAHMI PADRIA YUSNIMAR BACHTIAR/ KADER SITI HARISAH NUUR FAAT HIR MUHAMMAD HAKIM RAFII PUTRA RAMLI DARPIS/ KADER MAIMUNAH YUNUS UJANG RISWANDI ADEK EFENDI RITA YUSNITA SUJIONO/ KADER SURIYANTI RESKI ANNISAA MUHAMMAD YUDHO ADAM YUDHA SUMARNO/ RT SURIATI MIA KHALFIA RIZKY AUDINA RIZKY LUTFIA MELANI KEYLA RIZKY MEILANDRI RUSDIANTO ROSLAINI YUSNIATI SYAHRIAL MUHD. HIKMAH ZAINAB MUHD. SHOLIHIN MONA KHUZAIMA HALIM TRINANTA WAHYU AFANDI M. RIDHA HIDAYAT JASMINI MUHAMMAD RIZKI ARIF HALIMATUS SA’DIYAH MUHAMMAD THOHA ADE IRAWAN M. YUSUF PURBA PARLIANA ALIAS LINA MUHAMAD HAFIS PURNAMA NINGSIH MOHD PAIZAL MOHD ISLAHUDDIN FITRI ANNISA ISKANDAR SYAH NENENG AMBALIKA SYAHANAVA A. ABDULLAH SALAFIZAN ALI RUDI HARTONO TETI WARDANI SATRIA MAULANA DEDY IRAWAN SY. HALIMAH MUHAMMAD NABIL SYIFA NAJIHA SULUNG/ RT NURHAYATI SYAHRIAL FADILLAH MUHAMMAD RAIHAN ILAHI MISRO YADI MARDANI RAHMAD DANEL RAHMAD HIDAYAT KASRIL MAITY JULI PERMATA SARI BIMA ARIFIN AYULIANA M. FAUZAN FADDILLAH MUHAMMAD FIQRY AULIA M. FAIZ FADRU MAULANA WARISON LASNAWATI SALSABILA DESRA LASONDA M. HABIBI LASONDA EKO ANARKI VICO MAY FANHALEN ANNA TRIANA BINTANG PERMANA MUHAMMAD SABIRIN ANAS RIZAL HARWENI DELTA REZKI RAHMA DANI KURNIA YOSSI ALLATIFAH YOLANDA ALFITRIANI ADINDA ALTRIANA HIJRIAH ALWAN ATMA FATANAH ANISAL ARNIATI VIVI JULIASARI DARIAH

REDAKTUR: KAHARUDDIN

NO 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624

NAMA

PENGUMUMAN

KAMIS 5 MARET 2015

Nama - nama Calon Peserta JKN di Kecamatan Dumai Kota RT

YULIA ANGGRAINI MIRANTI UTAMI AMAR MAHRUZ MUHAMMAD YASIN DAPRITA YULIZAR DESRIYANTI FATMARIKA FITRI HERIANTO SALAMIN SYAMSI GHAZALY MARNILA WATI SYAFIRA FAZILA USMAN NOOR DAHSIMAR YUSMAR YANTI SYAHYUTI ALIA RAHMA WATI AL FIQRI PRATAMA SRI WAHYUNI HAMDANI ARSYAD RATNA SURYA DEWI NADILA OKTAFIANI CANDRA KELANA LUBIS IRMAYA HASAR RENDI SUPPATRA M. RASYID RIDHO NOVIRA SARI SAGALA RIZKINA HASAR NURJANNAH HASAR ZAKARIA WINDI LESTARI MAWARDI SUPRIYOTO/ KADER SULASTRI DINA PUTRI UTAMI SILBIA PUTRI ANGGREINI DINO SYAHPUTRA SAMSUMAR DERMAINIS RENO WELDES REZI MELDES AMINAH YUSUF NABOURJU NAULY NABOURJU DELRIANTI LENI FITRIANI USMAN JASMANI YETMA WATI RUDI USMAN FATIMAH ZAHORA MULYADI ASNINA MIRA RUSYADI HARI RUSYADI RIKI RUSYADI MUTIA SAFITRI META SARI IBRAHIM WATI KHAIDIR FAHMI AMRI NORASIAH JULIANA BINTI IBRAHIM MUHAMMAD SHAFRIZAL ABHIZAL KASILAH RANOL HUSRACITA FIFIT SYAFRIMA RAHMAT FITRAN ALGHANY ANARA SYAKIRAH SYAMSUNIAR NENENG SURYANI YUDHA LAKSAMANA ILDHA APRIREZI DJT. GULTOM T. SIHOMBING SAMBUJO LAILA FITRI RETNO WULANDARI SALSADILA SAFITRI YULENDRI MARLAINI AZMI YUNANDA BUDIMAN AGUNG PERMANA AMALIA TRI RAHMAH RAHMAD FARDIAN MUSLIM NURHAIDA AGUS RAHMAN IRA MUSTIKA RIO GUSHANDAYANI SURYA HASMULYANI YUNI MUSTIKA DELVI NOVITA RAHMAT KURNIAWAN MARALI ALI JASMATIAS AGUS FITRI GUNAWAN RAHMADONI MUHAMMAD ARIFIN IBNU AFFAN ALFADLI PUTRI HANDAYANI YULI ANTHONI ADE MUTIA INDAH SHOLEHA PUTRA MAHARAJA ROMA RENI NOVALIA KEVIN HIDAYAT IRMAN HARMA YULIS RESTI YUNANDA ANISA OKTAVIANI HASAN BASRI WISNI PUTRI SUCI RAMADHANI DINI NURHASAN ANWAR SALBIYAH M. RAFA ALHAFIZ SAHNAN ABDUL MAJID NURMALIZA DODDY IRAWAN SRI UTAMI AISYA ALIFA RAHMADANI ROSIAH DARWIN NUR MASRUROH NURUL YULINDA RALIJAR RAHMAWATI RESTU M. ZHAFRAN RESTU SITI FADILLA RESTU M. FADLAN AFRIZAL MARDIATI FEBI MARDIA NINGSIH M. HADI ALHAKIM NOFIARDI SAMSIMAR SAM SAUNAN LINA HARTATI SITI AISYAH ANGGUN FITRIANA NADHRAH ARRUFFATI MULIA SITI RAHMAHDANI MUHAMMAD SETIAWAN SAMSUDIN ZAHARUM RAHMAH ABDUL ARIZ SRI HERYANTI AZRA AMELIA DEWI A. BIMA M. ARSYANPUTRA CYLA DESRIANTISARI A. ICASNI NESA PURNAMASARI YENNY TRI UTAMI AAM MUHAEMIN ROHIMAH NENG RISMA ELSA MASBUPAH ULPAH MAULIDA ARIL ABDUL LATIF RAHMADI PUTRA PUSPA MAYA KHAIRUNNISA AGUSTINA ADITYA FEBRIANSYAH ASMAR KAMSINAR DAVID AGUSMAR RISKA ARISANDI AYU ANDIRA SALFIT MARCOS LILLA OKTRIYENNORA AGUNG KURNIA SAFA SALSABILA SUTARMI PARLAN WATI NURI AGUSTINA FITRI MIN SAPUTRA MUHAMMAD SALIM ALVIAN RAMADHAN RISNALDI ERMAWATI VIA NORITA ILHAM SAPUTRA MUHAMMAD RAFANDI DIMAS ADI PUTRA DARWIN YUSNAH MAULANA HADY SYUKRI KHUZAIMAH HOK SUN AGUAT JALENA SUPRIYADI KRISTIAN MARIANI LILI APRILIANTI YURMAN NURZA INDRA SEKMA INDRA DELVIRA SUSANTI DIANA SILVIA M. RIDWAN IRWAN ZAHIR LINDA YULIZA REZI IRLINDIA FAZRI IRWANDA LILAYIL MUYAZAM MARLIANA DAFA GUNAWAN DONI SARTIKA T ECI SUSANTI IHSANI RISQI FIONA DONECI PUTRI LIONEL PANDESI DEDY IRAWAN SY. HALIMAH MUHAMMAD NABIL SYIFA NAJIHA RIO SYAHPUTRA RESMAWATI M. RIDWAN SYAHPUTRA M. REZKY SYAHPUTRA M. RANDIKA SYAHPUTRA NURMIA MUHAMMAD ZAILANI FAHRUL RAHMAN TASLIM TANJUNG SUBANDIAH SYAIFUL BAHRI SOLIHIN SEPHIA HALIFA BARIZAH SUTRISNO TANDO YUSMA YENTI YULIANTI TND SEPRI NALDO SHEILA APRILIA HUZAIFAH SYAFARILA MAIZAL DUSWIYAR MUHAMMAD FARHAN SYAFRINO MUNGINAH MUHAMMAD HAIKAL ULFAH AZZAHRA SAMAINI BAKRI SIROM M. TAUFIK HIDAYATULLOH ISKANDAR SUPRIYANI ROY RANDY DEVI KEMALA WINTA JUNITA LESTARI SALSA KWITA BIRA NABILLAH MAIFAL MUSDALIFAH HAFIZH RAMADHANI DINI MUHARRAMAH METRIZAL YULINAR JEFRI METRIZAL MEGA APRINA JUMIYARTI JANUARDI M ZULKIFLI MISLANI SITI AMINAH ASTUTI LISTIA NINGSIH WIDYA WAHYUNI YUHARTONO SUSHERLINA YUDHA ARDIANSYAH ALDI DWI NOFRIANSYAH ATIKA PRATIWI FATIMAH A. NADHAR NURANI SITI RAHMAH AL-FATHA ABDUL JUNED AL-JUFRI SALSABILLA GANIA DARLIS/ KADER MAWARNIS FAHIRA NILA MAUFIRA SYIFA HAYATUL HUSNA DASRI BAGUS CHAIRUNISA P. BAMBANG HERMAWAN SUPRATMAN SITI ZALEKA MUHAMMAD RASYID RAIHAN DANY KURNIAWAN DIVA AULIA ABDUL KHOLIK PANE SYARIPAH HATIKA RAKHA SYAHNAUFAL PANE ADE FIRMANSYAH PANE YUFRIZAL NOVA LINDA JIHAN FAADHILLAH RUSI HANDRA FIFI AMELIA M. ARFA FIANDRA ST. MUSLIM TANJUNG YULASMI ELITA MUHAMMAD IQBAL RINI PUTRI MULIATI NURHAIDA SIREGAR SYAMSUL BAHRI SURATMAN ELVIRA IRVAN HAFIS SARNI/ KADER/ RT SUPARTI M.FARIS MUSADDIQ SYAHRUL/ KADER NUR ASNIDA RIDWAN SAPUTRA INDRA WAHYUDI HASANUDIN/ KADER DETRI YANTI RAHMAD HIDAYAT HENDRI HIDAYAT HESTRI ANGGRAINI RHASIKAH THAIRAH A. ROMMEL ANTHONIUS RAHMADANIS ANDRO ALDINO PRATAMA ALDIRA FERNANDO RIFQI GALANG RAMADHAN RAFIF ARXNIO SUDARMIUS RAJO NAN KAYO NURTIAH KHAIDIR ARMALINDA KHAIRUL JASMAN SYURA RAMADANISA SYILFA NURHIJAH MUHAMMAD AL FATTAH MEDIA KUSNIDI SUMDEWITA LAZAILA A’ISYATUR RADIAH HANIF MUMTAZ RAMADAN SYHAZIEF AZRIANDI SYAHRIL TOGONG KIM KUAN HINDRA CELVIN DANUARTA PB

NO 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985

NAMA

RT

ZULFAN HENDRA MONICA SHERLY AMIRUDDIN YAHYA UNJIATIN RIDHO HARYANI FITRI YULIANA MUHAMMAD RIFA’I REZEKI SITI HADINI SEPTIA WULANDARI NASRIZAL M. TAWIR NURMHA LINDA WATI ANDHIKA WAN IRWAN MERY RAINIE YANG ANGELLINA YANG WAN EDI SUSWATI STENLY EKA WIJAYA NURJANAH ZAHARI SAFRIADI HARAHAP RINI FEBRIYANTI AFIF AHADI HARAHAP FIRDAUS ELDAWATI ZANUAR ZAITUN AZIZAN PUTRI FERIHAN CUT ZAZKIA ALMUNAWIN SATRIANA KHAIRANI JEFRY JAHJA DONDOKAMBEY RATNA WILIS EKA RAMA YENI DESY KURNIATY MAYA RATIH DESWANI ALVIAN ANGELO DONDO K. VEIBY ANGELIA DONDO K. AMILUS YURNELIS HARIYANTA SURYA AMILUS MULIADI SYAFRIZAL RADIT PRATAMA REZA DWI ANDIKA KARIMUNADI ERLINA NURHIDAYAH YUSRI NURMALINA AMANDA DIANTY ENI NOVALIA HARI KURNIAWAN BUVA S. DITA AULIASARI SIREGAR OKTARIZA YOLANDA S. NURWILIS YOSTIAN RUSKAM ALEN NASRUL GUSFIANTO ELVIA MALASARI FAUZIYAH ODELIA PUTRI RAFAEL GUSVIA PUTRA AF TANJUNG MASLAINI RAHMANDA AGUS SOFYAN ELI ASTUTI ARIEF PIANDRI BUDI MAULANA RISKA SARI NOVITA LESTARI ROSNIDAR SUNARDI ANTONI YULIANTI TND MUHAMMAD RASYID RIDHO ZULKIFLI BERNI IRMON ROY PIRMAN RUDI DURISMAN ABDUL RAHIM RAHMAT JAIS AISYAH KATMADI HALIMAH NURUL AINI SYAIFULLAH YURNITA AKMAL MA’RUF AMRI MELA EKA PUTRI MUHAMMAD RAFLI ADEL ISKOSA DARMAJA FITRI SUSANTI RADIFAL SATRIA W. TESYA DZAKIRA TALITA S. ARDINUS/ KADER DESMAWATI VEGHA AZMI ARDE SATRIO ARDE ANNISA ARDE RAHMATTUL HARBI UPIK ROSLI MERI SUPIANA EVI ARDIANTO MOH. SOEPARMIN S NELI RAFNILEAWATI S LIA AGUSTIN S NURHAMI HENKIE YN YULIYANTI MUHAMMAD IQBAL SUKATNO JUNIAR ABDUL RAHMAN ZUBIRMAN SARI BULAN ZULVERIENDRA LENA HIDAYATI INSANI PUTRA MASPERI WASNI FERY ALAMSYAH HIDAYAT FIFALDI ALAMSYAH HIDAYAT PONI SYAHPUTRA IMELDA ANGRAINI ALVIN REINALDI FITRI RAHMANELI FERDI RAHMAN SYAHPUTRA ZULFAHMI MARWINA WINDRA ZULFAHLIPI RIZKI RAHMADAN KAMIL ZAVIRA TUKINEM SYAHRUDIN SITI SALEHA SAHRUL ANUAR DIAN KHAIRANI FAHRIAH DITA DEFARANI M. FIQRI SYAHRURANI FATURRAHMAN SIDIQ WISMAR SITI ASMAH ISMAIL GUSWANDI TRI RAHAYU ADZROO NABILAH RAHMA SAFITRI RAUDATUL JANA NGAFIYAH SINGA RAJALI TAMBUNAN LAS SUDARTO TAMBUNAN RIKA FITRI YANI RAFA FEBRIAN TAMBUNAN FERI MARIANI ARFAN MAHENDRA IHSAN ABADI INDRA SAPUTRA LASRI SUSANTI ZULFA FEBRIAN ZIKRI AGUSSANI MUHAMMAD FAZRI BERRI FAHRIAN DIAN FEBRIANTI M. FARHAN FAUZHAN ROZALI HAMZAH DESSY ABDUL ROSYID RAHMA WATI MIRIN ROJUNA MARWAN ELESSAGAF NURUL MAIMUNA ARMI RATNA MAYAR ROSLAINI SIAN FAJRI MAIMUN KOYANI DENI RAHMAN SYAIFUL ZUWIRMA SUDIRMAN BETTY REVINA WATI VIORA NOVENI NURUL SAKINAH RIZKI ABDUL KHALIQ SYAHRIL PLAZA FIRDAUS NURHAYATI INDAH ROBIAHTUL H. EGI NURFIRMAN DARMAWAN PARMI ALY PARNI POERWANTO DERMAYANI YULDARNI SAIFUL EFENDI AGUSTINA IRA NOVIANI DEDI SAPUTRA RANI SAVITRI ADIT NOVRIANTO BUDI HARTONO RAMA FITRA HAYATI LUTHFIA SUHADA THALITA SURYA BAKTI LINDAWATI SAFITRI JANNAH JEHAN SAPUTRA MUHAMMAD DAFFA HAMIDI HEVI BOGIMIDIAS DEDI GUNAWAN ATRI MURNI DINALDO RAHMAT CINDI PUTRI GUNAWAN DEVITA AULIA SARI ERNA RONI CHANDRA ARI NANDA SONDANG IRIANTO T. DIANI MARIANI SIMATUPANG DENNY PRIANTO TAMBUNAN SHINTA NAULI TIO INDAH AGUSTIN T. HERLINA ROBEKA TAMBUNAN MASBUDI MESRAWATI ALIF MENDRA DENI BUDI WAHYUNI PUTRI AZHARI RAJIAH MAYLAN ERPINDO RASTA ALYA SYAFIRA AZZAH SYAKEILA ATHIFA SYARAH AMINUSIN SURYATI JON EFFENDI MARDIANA SYAHDAN RIZKI KURNIA AGUSTIAR ST PANGERAN DANIMAR GUSYANTI DEDI YANTO ANDI ALFIAN SUBAINIR NELLYWATY IRWAN ARNITA NURMA NINGSIH SOFIA SURYA DARMA SELAMAT SUGIARTO RIZKI FEBRIAN NURUL HIDAYATI SUMARNI ROSDIANA SUKARDI YURLENI YUERLIN MUHAMMAD ALDI IRFAN EDO SAPUTRA FIRDAUS SYAHRIAL MEDA RIMA HAYATI RIDWANUL HAKIM NINA WINDASARI APRILIANI M. SABBRI MARDIALIS LISA DIANA MY RIZKY FEBRYAN FAIZ ARDISA VELLY AMANDA MELDI ELMEN ELIA SOFIANA ZAHWA INARA ELMEN AZKA SYARIEF HAMIZAN MARLIS WIRDA RAHMANSYAH RISMAN DARLIS RONI CHANDRA YULIANIS MELYA SULFAN BATU BARA MURNIATI AZMIL KHOIRI RAHMAD ANZILIRRAHMAT DEDI CHANDRA AINI YUSNITA DENNI AGUS PRAYOGA MUHAMMAD REZKY SEPTIANDO AURA MEISYA KEYLA AWEL SANJAYA HELDALINA BUNGA HABIBAH SANJAYA DIDAD HADZIQ SANJAYA ANNISA AINUN ZAHARA JUSNI EFENDI ZENDRO NOFRIO RONNI FERNANDES MIMI ROSITA RAFIF MAULANA FADHEL MAULANA HIDAYATUR RAHMI AZIM JECKY K LENI ELFITA JENNIKA PUTRI CAHYANI EDELWISH RENDIKA PRANATA JUNAIDA WAN ZILABID WAN NURAINI WAN ASBULLAH WAN PURNAMA SARI MERI NASRIL MIRA KHUZA MERNAS SHUCI MERNAS ALMEKO MERNAS EMIE SASMI ERWINSYAH NASUTION PONIRAH ERBIANSYAH NASUTION WILDASYAH PUTRI INTAN AMBIAR YULINAR RIRI NOFRIANTI ESI APRILAYANI YUSKA YUSRI MELIA WAHYUNI RIFKI FEBRIAN PRATAMA VANESA GLORIA AGUSTINA YULFERA AZRANI ARDIANSYAH

NO 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346

NAMA

RT

JAMALIS TANJUNG NURLATIFAH DONI SAPUTRA ROZI YUSUF IRA ANDRIANI MOHAMMAD ROZA MELINIA SISCA SURIAYU AGUS PRIADI DELFITRANITA M. RAFIQ ALVIANDY M. ALIF HAMZAH HUSSAINI M. RIZAL AULIA/ LPMK ROSYA EFADILA M. ARYSAD ALBANJARI NAISYA ULFATUN ALZAHRA KAMARUDDIN ILYAS ANISMAWATI LOLITA NOVIA DEDDY IRAWAN NASUTION LENI MARLINA DENI KURNIAWAN NASUTION DASRIL EVA ZANIAR ARIANTI NINGSIH ERIANTO MELI SUMARTI ANNISA FITRI AZZAHRA MUHAMMAD FAZIL EKA PUTRA FADILLA AZARA ZAQIA NIZLA RATIFA ANDRI WIJAYA RONALDO ROSWITA JUNIARTI M. RIZAL AULIA ROSYA ELFADILA M. ARSYAD AL BANJARI NAISYA ULFATUN ALZAHRA NURBAI TANJUNG DELIMA YUNARDI BAYU SADELI PUTRA PRATIWI YUDHA PUTRI LITA WAHYUNI SELVI SETIAWATI INDAH RESI KURNIA NURJANA ALINUS YUSNITA DODI ERIANTO YESI FEBRINA MULIANI RITA NELVIA DINA ULFANI ROMI YULIANDI YUSRIZAL ERNAWATI ADI RAHMAN MERRY NOVIA KEHENG SUYUNG AGUSTIAN ARIFIN ERDAWATI ND ANDI CAHYADI FAUZIA RAHMI SYAFINAR OFRI NOFRIADI RORI FERNANDO NOFRITA SASNI CANDRA MASTURA RAFNIDA DAMANHURI MUTHIA HELMIA AZHARI RAMADANI ZULHERI KURNIAWAN DEWI GUSNIATY FEBRINA ANGGI MULYA SEPTIAN DIWANGKARA K. DASRIL YANTITA ALVIN SAPUTRA DEFIA LISA FEBRI NURMAN ROSNIWATI SITI DZURRAHMAH AHMAD RASYID NOFER AFNITA ANDIKA MAULANA BAIM HABIBI MAULANA MASRI BURHAN RASMI HAMDI JON HENDRI ROSNITA ADITYA KUNTARA DHANU DANOFAN M. WAHYUDI MAULANA M. FADDLY MAHENDRA DINDA FAZZIRA SHYUHADA ARMADANIS AGUS DISON ERVINA ADEK CAHNIA SYAFRUDDIN KASNIMAR SYAFRONI ABDURRAHMAN RAHMA YUNITA ANISA KARLINA M. RABI SARI WULANDARI M. WILHAMID ADHA SASONA NAYLA ZAHRANI S MAWARDI RAFNIDA DENI MURDANI JASMI YAZID HIDAYATI M. ANUGRAH RAMADHAN NURAFFA IBNU SAYIDINA AHMAD RIKA ASTORI HAFIZH ROMIKA PUTRA NADINE ROMIKA PUTRI WIRDA HENDRI BUDI SYAFRIZAL EFENDI MAINI PARIDA AGUS REZKI KURNIAWAN E. JACKY MAYLY EFENDI TRY YOLANDA SAPUTRA E. SYAFRI IZHA MAHENDRA P. DESVI ENGGRAINI PUTRI E. DESVA ENGGRAINI PUTRI E. JUMIAH ENGGRAINI PUTRI E. ANDRI NOFENDRA ZULFITRI MURNI SUSANTI ANANDA AULIA ALFIKRI ALYA ADRIANA FEBRIANTO PRATAMA ZULFAHMI WIRDAYATI ZURIATI FANDI ARIANTO ANCE NOVIANTI AJISMAR YUSMINAR JHONNY RIKI RIKO HARIANTO LUTHFIAH ALKHUSAINI ASBI DIAN EKA MUHARRANI DINDA PRATIWI MIA ULFA IQBAL ZIN ARMAN AGUSTAMI NURMAINI DEFI SURYANI ARIZOMI DELLA MUSTIKA SARI AZIMAH HENDRI M. RAFI M. RABI MANJU ARDILA HARTONO NURHAYATI MUHAMMAD REZA LARISA LARASATI TASARUDDIN MORAM RISWITA NOFRIADI HENDRI RISKA HAYATI RISKI ANANDA PUTRA MAULIL FAJRI YUDI ARDIANSYAH DANELLA ZANIAR WILFI NANDAR FIRDAUS AMINUSIN SURYATI JON EFFENDI MARDIANA SYAHDAN RIZKI KURNIA ABDI ANANDA HERIATI MELANI DIKI RAHMADANI ROSA LINDA AFNITA VEMI ROZA SURYA ADENITA PERDI SUPRIADI WAWAN SAPUTRA GUNAWAN RAHMADONI NOFRI MUSFIANDI HELENA INDAH FLORA FAEZA ZIKRI HANNA ASSYIFA SUPRIANTO ASNITA SHELLIN AYU PUSPITA SARI EKKO SAPUTRA MUHAMMAD ALDI IRFAN PRATISTA KURNIA MOZA RENDRA A SANIARTI ANTIH RACUNA NURANA SHEAZLA ANGGA SAPUTRA CITRA NANDA ISMAIL AHMADIYA ZULKARNAIN YASHIDEQ MUBARA’ JASMI RAHMA HAYATI FEBRIANDY SYAHPUTRA YOGA SYAHPUTRA ROSMI EFENDI ROSMA EKA FITRI MELANI ZULBAIDAH SANDRA YATRI MUSTAFA KAMAL ERMALINA BUNGA AMELIA KAMAL RIDHO AKMAL MAULANA DAFFA ANDIKA MARDIANA ODE KORNELIS HANDIKA BUDI HARUTI/ RT ROSMIATI GERAL RADHITTYA HARUTI DAFFA RADHITTYA HARUTI MARYAM M. PARLEN CASANOVA BAHTRA WARDANA ELVI RASYID NURBAITY ABRAR MURDANI AMELIA CHRISTINA ARNIE RASYIDI EMSUAR ASNIWATI MIFTAHUL JANNAH ALIM MUNIR MARTIAS HERMAN RAHMAD HIDAYAT RENDRA. A SANIARTI ANTIH RACUNA NURANA SHEAZLA ANGGA SAPUTRA CITRA NANDA ISMAIL AHMADIYA ZULKARNAIN YASHIDEQ MUBARA’ SULHAKIM KARMILA MUTIARA KHALISTIWA KALIMAH SAKTI RINJANI LANGITA GUMI SASAK KHASANAH BINTANG CANDRA GUNAWAN SYAMSIAR AHMAD NURFAH KARNIZON MUHAMMAD HAKIM ROSITA ROSINA PUTRI IRENNE CANDRINA VICKRY SYAHPUTRA THERAS ADELIYA CANDRINA JASRIYUL MENTI MEISI SRI RAMADANI NINDA RAMANIA SARI FAUZI NURHAKIM NONO PURWANTO RATNA MUSTIKA RATU ABDUL GHANI EVI ASRIATI ABDUR RAHMAN RAHMAT HIDAYAT YULIA ASTUTI M. ALIEF RAHMAT AL GHAFI FASMIL YADI TANDO KAMINAR M. RUDI EFFENDI DIAN CITAMI UCI NILAM SARI SHAKILA AKTIKA DEWI M. ANDRE SHAPUTRA SHARTIKA OCTHIARRA FHAREL ANDIKA NURLINAR AMRIZAL ALQADRI FIRMAN IRDAWATI BUDI HERMANTO RESY WULANDARI SILVY ANDINI YULIZAR NURHAMIDA FEBRI WAHYUDI RAMADANI IRHAS SYAFRI DONI ZULNELDI MARDIANIS DONI SAHPUTRA LUSI SUSANTI FAHRY FEBRYANDA PUTRA ASRAL ERNI BOBY ASFITRA RIDUAN UTIK ABDUL SAFRIANSAH HANJULI SYAHPUTRA MUHHAMAD SYAHRIZAL M. NASIR RAMNAH AHMAD NURIADI DARNA NINGSIH ADIESTYA HANUM IBNU SAYIDINA AHMAD SYAHRIAL YULIANI ROBY ANDIKA EGGY SYAHPUTRA ALLYA PUTRI WAHYUNI ALFIADI NOFRIYANTI ANJANI ASA PUTRI ALYA NATASYA MUHAMMAD RIDDIQ ZULFENDRA NENI GUSMAWATI SYAFINAR OFRI NOFRIADI RORI FERNANDO NOFRITA SASNI BENI RAHMAN MUSNI YATI

NO 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707

NAMA

RT

M. HAKIM RAHMAN M. FATHUR RAHMAN CECEP ELIKTOM ELVINA YENTI YUDA KELANA PUTRA RAFLI RESKI ELIKTOM ATIKA TRIPUTRI THAMRIN SUMARNI KONEK BEFI KARISTA RAHMAH YANTI SLAMET SOINEM SRI EKA AGUSTINA KATWADI KAMALUDDIN DAFID KHUFMAN ANI SITI MUNJIAT DANI SAPUTRA FITRI YANI NURJELITA CANDRA MAULANA SOEROSO HP SAMINAH APIT SULISTIANI M. NURHAMIM ROSITA DUI SETIAWAN BAMBANG TRI ATMOJO JUARIAH DEDI SUSANTO YULIA AKMASARI SUPARDIYANTO SIYEM ANDI RIYANTO SYAFRIZAL HERYTA RIZQI FURQOON RAMADHAN ANDERSON HARUN HENI MASRI YUDHA ANDERSON IRMA AFRIANI ANDERSON HANA NABILA ANDERSON SALSABILA PRAWINDA A. INDRA SUMIATIN INDRI RAHMAYANI ARIF MAULANA YURMAN NURZA INDRA SEKMA INDRA DELVIRA SUSANTI DIANA SILVIA M RIDWAN NELSON SIMANJUNTAK BERLIANA BR SARAGIH ESRA NOVIANTY S. DANIEL CORNELEUS S. NOVI YENDRA MUHAMMAD DAMSURI IRA SAIRA KHOIRUNNISA AZZAHRA M. SUMIOTO/ KADER AMBAR ASMORO WATI M. HAFIZUL AMIN M. HUSAMMUDDIN FAUZAH NUR SAIDAH M. ABDUL RASYID FATAHILLAH M. NABIL KHAIRI ENDANG HASTUTI RADITYA MEGANTORO DELMAN ELFINI ADELINI OKTOBERIA DIANA DELFIANANDA EDJANG AKBAR HERRY ANDEPRU SUTRIYANI TALITA SALMA ZAHRAN TALITA UFAIRA LUBNA RICKY GUPI DARUL UMI SITI ANISA GUPI HABIB NUGRAHA PRATAMA NUR ASYIFA EVA JANUALIS DANDI ALI PRATAMA AGUNG APRIADISYAH ALYA PUTIANEVA KAMSIR YURNI SYAHRIAL NURMAWATI EKO FERNANDO EDO FEBRIAN ENGKI FERNANDES ANGGUN ANGGRAINI ABDUS SOMAT ISMALINA ROBITH FARISY SYARIF HIDAYATTULLAH KIKI HARIYANTO EFRIZAL FEFI SUMARNI WINDI SALSABILLA DHEGO ANGGARA FERDHIKA OPINDRA DEBI RAMADANI JONI EFENDY JASMI RAFFI JEVINOF RIO FERDINAN CHELSEA OLIVIA SYAIFUL ANWAR YUSMA WAHID SYURYADI SETIA AKMAL JOHAR NANIK DIKI ISWANDY NABILA SYAHADA JON HENDRI SUSEDA IPIDRAL NADHIFA RAMADHANI AISYAH KHAYYIRAH M. BENI ALWIS IRNAYANI M. PADIL RIVA’I WULANDARI REHAN MAULANA PADRIT LADDIAR NOVARITA ANISAH HUSNAA HASAN NASUTION ERMIATI NURHIDAYAH MIFTAHUDDIN SAPUTRA AHMAD ROIHAN WINARNI MASEIWNDA NURJANNAH M. CAHYOSO GEMILANG ALI IMRAN AGUSNITA MUHAMMAD IRFAN SRI WAHYUNI ABDUR ROSYADI ZAIRAL EPENDI/ RT YETI MURNI RONI SOFIANDI YUSNA MURNI RAMADHAN AGUS SOFYAN SYABIRIN YENI MARLINA ABDUL HADI SARIPAH NUR AINI EMPI LINAWATI LUSI RAHMAWATI LIZA NOVITA REVAN EMRI TANJUNG YULIZON EMRI EKA PRASETYA PUTRA AGUSTINA UNTARI DEDEK BUDIMAN AULIA RAHMAH HENDRI DARMIZA FENI LISTIA DILA HANIFA ZAMRI IRWANDI DEWI MURNI NURLAILI MUIRASIH SHAHIDMAN RAHAYU MUIRSAH PUTRI ARDI MUIRSAH PUTRA ABU RANI JUNANI RONI BAHAR RMOMI SAPUTRA DAVID CHANDRA RITA SUSANTI ANTON SAHARMEN/ KADER YUNI ASTUTI HARDI SAPUTRA HAZURA PUTRI YANA JONEDI SOFINAR DUMRI HAYATI RONAL EFENDI RISA APRIYANI EMAN NELVIA MURNI RULLY VIADI RONY PUTRA NELY RAHMA MUSLIM CHANIAGO SALMADI ROSNAMAWARNI NINA ROSNA WATI DODI SALENDRA SELVIA ROSNAWATI KEVIN PRANATA RAJAB KAMINI MHAMMAD RIYADI M. RISZKY ILHAM RIKI PUTRA MELI HERLINA GITA PUTRI IRFANSURI FATAHILLAH SYAFRI NENAK DONI EFFENDI DEKI SAPUTRA PUTRA RAMADHAN MITA NOFITA SURIYA RIZAL ALBENIA DELVIA PASTIKA ASMARA HAMIRUL HAMID WIWIK YULNALDI WELDA ABDUL KHALIL AL’AZIZ KEILA BILQIS UMAIROH HASANUL ARIFIN ROSNIATI RAFIQURAHMAN M. SAMAN ALFARIZI HABIBI SAIRUL RAMADAN HAMZAH ALHASAN UWAIS ALKARAN EVANDA PUTRA/ LPMK AGUS NETI MUHAMMAD IBNU ARABI DIDIK HARIYADI LASMI ZULAIMA SALIM HUSEIN AL AKBAR SEKAR MELATI MEKRANI ENDON MANJASARI AFRIZAL SUPRIHATIN WIDIYANTI BAMBANG WAHYU KUSUMA HERLINDA OKTAVIA NINGRUM PUTRI A. IZZAT PUTRA DINDA JOYO RINI WATI HENDRI TANDIKA RICKY TANDIKA CIU HONG YENI MARLINA MUHAMMAD SATRIO ARIS WICAKSONO FATMAWATI ARIFNAL SARI WENI DEWI JAYASARI DELCO HARIYANTO NUR AINUN NAUFAL ARRAVI SALSABILA AURA SYIFA YUSLINAR SARIDESSIMEL YOSI SYOFIA HERRY MARIATI JAMAL FIRDAUS NURLAILA SURYA SYAPUTRA RUDI ANSYAH MARISA ANANDA PUTRI MUHAMMAD RIVAI AGUS DARMAWAN RIZQI SOLIHIN JARMI YANTI NUR SYAFIQA SUDIWIGOTO SUGIARTI IBRAHIM ZAITUN ZULKIFLI IBRAHIM AMRIZAL FADLY HAMDANI RAMA DHANU YUSRI RIKA ELIA PUTRI RITA ZAHARA ILHAM FARANTIO DEDE RENANDU BUDI PRIYANTO MAHDALENA NAFISHA BILA ABDUS SOMAT ISMALINA ROBITH FARISY SYARIF HIDAYATTULLAH KIKI HARIYANTO MANSYUR K DESSY ELFRISHANTI DEJA MARINA BASIR RUKMINI YULINDA RIOMANDA AKIONG HENNY SARTIKA WULANSARI ALFI SAPUTRI ASAN GUET HONG DESSY NOVYANTI TINI JULYANTI CALVIN CISCO NURHADI DEWI MARDINA TIKA WIDYA RAHMADHANI SHAFANA DEWI ADIVA SYAFRIZAL EVA MUSTAZA LATIFA IRVAN RIZALDI MUTHIA BESTARI HUSIN AGIOK EDI ANDY ROMIKO QURATUL AYUNI MUHAMMAD SHAMIR ALIF LAYYINAH PUTI HUMAIRA ROSNIWATI/ KADER EVI FEBRINA JASMAN EKA SUSANTI MAHARANI CAHYA G. RINDI SHAFITRI RIZKI ADITIA ZUBIRMAN ZAM ZAMI HENDRA SAPUTRA MULYADI IDES NOVITA ASMUR DESNITA SAFLIANA NURUL HABIBAH MUHAMAD AL ISRAQ SYAWAL HAMDANI ERUDEN NGAINI KHAIRUL IRWANSYAH NURMAINI JULIDARSIH SUPRIONO SUGIARTI PRASETYO NUGROHO DWI PUTRI HANDAYANI TRI IVON NUR UTOMO ANANDA SYAHPUTRA

NO 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068

NAMA

RT

ABDUL RAHMAN SRI RAHAYU AGIE SUHADA AYLA NADIRAH PUTRI AIFA NADIRAH PUTRI BENNY VIRGO SYAIFUL ARDI ROBBI HALHUDDA LIZA MURIANI RAFLIS MURNIS RAHMAT PUTRI DAHLIA ANDRI YUSUF ADE MARISKA M. ZULFAN SYAFRIDA GUNTUR SAPUTRA MELIDAYATI RAYHAN SASRYO RAMA JUANDA JUMIKO ASWAN ANI HARTINI CHRISTINA ANGGILIANI SAPUTRA APRIADI IRWANTO SOPIAH RAMBE ASMAR HASIBUAN RUDI HASIBUAN NUR’AINUN HASIBUAN ZAINAL ABIDIN DESI MARLIS DEWI SAFITRI ADITYO FARHAN RIFAL MAULANA REZA RENALDI GUSNAR SIREGAR ROSMA YENI PUTRI FEBRIANI SIREGAR SIFA AFRIANI SIREGAR JUANDRI RAHMA YUNITA ERIZAL ERNA FABIO JULIUS SAPUTRA TAZKIA DELLA AZHURI SUBANDIAH MUHAMMAD HAMZAH JAWANIS ARIS TOTEL M. YUNUS HALIMAH ASMUR DESNITA SAFLIANA NURUL HABIBAH MUHAMMAD AL ISRAQ SYAWAL HAMDANI JOKO SUPOYO/ KADER AJIMAR DWI FEBRIYANTI NOVA RAMADHANI RINALDI SARJITO/ LPMK SUNARTI SEPTIANTO WIBOWO FAJAR SEPTIAWAN SITI NUR AMMAH SITI NUR RAHMAH HARI HAGUS ANNISA AZURA HARISA BIMA HARISAPUTRA DARNANI NURJANI SYAFIRA DISKEFANI M. ISMI ASHIDDIQI ALI MUNIR RAMISAH M. YANI RAHMAN HENDRI PITRI YANTI ANIFAH IRSAN ZAHDI JUITA IRVABEL NUHANSYAH VASYA IRSANITA RUSMAN LILI KOMALASARI RUDI JUNAEDI RATIH YURDA NINGSIH RAHUL KUSWADINATA REYHAN ILHAM SAPUTRA SAHIRMAN MURAINI REFFY LESTARI MELLINI RAHMAWATI PUTRI ANA INATUN PUTRA BAGAS TANJUNG B. HARIAL ARASYID TANJUNG LIANA SOPIA MANDA ZULKIFLI KARTINI PLITA JAYA ZARA ADIKA ZULTY FAHREZI ALFIANDRY NADA FAJRIYAH SALSABILA BUKHARI/ RT HAYATUN NUPUS RIZKI KURNIAWAN M. ARIF SYUHADA NASWA HARIKA AHMAD TAUFIQ SUKASEH ANDI EKA PRASETYA MOH RIFKI SIRAJUDDIN PASMI YANTI RINO ANDESKA PUTRA M. ROZALI AKBAR M. ROMI SAPUTRA ROKI RAMADANI AGUSTI JOHAN KASMAWATI JETPRI FITRI ANI DESI SRIFELI DEFANTON BAMBANG SUGIARTO FITMAWATI MUHAMMAD ASRI MUHAMMAD IDRIS MUHAMMAD RIZKI DEVI PERMATA SARI SAFYORET DEFA RESNA SUCI NASYIRA RAMADHANI AFIFA LAIL MARDHIYYAH YANTO YUYUN TRIANA BAYU SAPUTRA K. AGUNG WARDHANA NAHAR SITI HAJAR INDRA SOLIKIN RODIAHTAN MARDIAH AWIS ALKARNI NURATIKA JOHAN MALIARTI DOPI ARASYID APIZUL HARISAL TANJUNG MARINGUN SUERNI YUSRI SURNIATI SYAHRUL FEBRIANSYAH YUNI ANNISA BENI HERIATI GUSRIANTON VINA LESTARI DEWI SARTIKA ANTONI ASNAH ZURMIATI ISMARULLAH SYAMSUL RIZAL CHODIJAH RASPATI HIDAYAT SYAHFITRI RAHMAH AMIRUDDIN ZAMAKHSYARI LAILATUL DARJAH WAHIDUL AKBAR AISYA NUHA ZAHIRA ROSNA YULIA FRANSISKA AFRIZAL FITRI SUSANTI HADIAN FITRA PRATAMA ZUL INDRAWAN GISTA HERLINDA YUDA APRILINDRA FELISE REYHANDRO AFFAN ZAFARINDRA WARTIK SUANDI MUHAMMAD M INDRA SAHIRMAN MURAINI REFFY LESTARI MELLINI RAHMAWATI PUTRI SURYA NINGSIH WAN NADIA ANDINI MARDIUS MURTI YAN HENDRIMAN M. HIDAYATULLAH AL AKHIYAR GAMAR/ KADER BUNATIN MARINGUN/ KADER SUERNI SYAFRIL SUFIYARNI ALDI SYAF PUTRA FREDI RINALDO RENDI ANDIKA ANISA SYAFNI MUHAMMAD HAFIZ HAYU SYAFNI KHAIDIR LENTAWANI TAMPUBOLON RENI ANGGRAINI RIRIN SAFITRI RISFA NUR ATIQAH YANTI OKTARI JULIANO SUSI RICHI FERNANDO AAK BIN KUNTJIR AFRIZAL IDA HERLINA FEBI VATIKA SARI FADHEL JUNIZA PUTRA SENEN SRI HARINI DONNI TRIAWANTO RONI P SUPRIHATIN AULIAN DEVAS ABDUR RAHIM ZULFITRI FAUZIL HUSNI LELDA SUMIYAM WINDA YANTI ZULMAIDAR AZWAR MAIZARNI RIKA ANGGRAINI LISA DERINA LILIANTI ARI MULYANDA RANGGA KURNIAWAN ZULHENDRI ARIYANTI DINA REFIKA DUHA HIDAYAT RAHMITA MAWADAH REFALDI ADRIAN SYAMSUL HIDAYAT MARIANI IDI RAHMAT ALEX SUMARSONO INTEN MARISYA SUPRIO PURNOMO TUMINAH MARGIONO JUNAIDI INDRA RINI CAHYANI DESRALDI YANTI IDARMAWATI PRAYUDA BAHARI PERDANA DWI ANDIKA SAPUTRA P. TRIYANDES RAMADHAN SOGIMIN SUPIYATI BUDIONO KRISMANTORO ANANDA NUR AI’SA SUPRIADI DIAN TRISNASANTI TOMI REX AFROL NITA M. AZAM KHAIRUNAS SYAHRUL EFFENDI ERMIATI ERISA LENGGOGENI FINA NURUL SELVIA MISYA UTARI NOLLA SAMIRA ZUL HAKIM RITA ELDINI NAYLA ALIYATUL IZZAH YUMNA FARIHA MARDIANI HERMANSYAH NOVELIA SARTIKA NURI AMELIANSYAH ISKANDAR RITA KUMALASARI NAYLA APRILIA HENDRA MULIANA NADIA SALSABILA RICKO DODIYANTO NUR EFNI MUHAMMAD EFRIAN AMELISA ZAHRA QAIREEN M. YANIS ROSNIDA DISMIARTI WIDIA RAHMAWATI DARREL RASYDAN AHNAF YASMAN ROSMIWATI SYAFRUDIN YURMI LIZA FITRI YURI ANDINO NETTY RIDAWATI DEDY IRAWAN ERNI LESTARI ASRIL NANIK AYU RIKA DENI ASRIL ANDRE ASRIL PUTRA RAMADAN ASRIL MARWAN IRAWATI DINA TANISHA FAIZAR ERNI ILHAM MUHAMMAD IQBAL AHMAD MUHAJIR UMINIH BOBY SANDRA AGUNG PRANOTO KURNIAWAN MANISAH T FADIL ARDIAWANSYAH HABIBI TAQWA SUDI YAN BASTIAN NOVI ARNY BASTIAN RINALDI DIVANI PUTRI ANDI BASRI/ KADER LENI PEBRINA M. RAFI AGUSTIAN YUFRIZAL MS/ RT RENI EFRIYANTI OLIVYA MAYORA NADIVA AULIYA FAUZEN ALI MURNIS RUSDI ZEN LILI FAUZANA KURNIA ILLAHI ZEN AFRIZA NANDANI PUTRI MAILI HABIBAH MHD. SABLI KARTIMAN NASRAL AZIZ NOVIA ROZA

NO 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429

NAMA

RT

HAYATI RINALDO ASRUL AZMI IKHSAN SAPUTRA LUBIS M. FARHAN TRI CAHYO AQILAH ULYA MASRI DESWATI FIRA MAYANTI RAHMADANI ROBI SAPUTRA MAHADI SARAGIH NURSARI M. MUFATZAL FAIZAL AFIF AL-AZHAR DAHLIAR MATSANI KUMALA MAI ASTARI ANDIKA SAPUTRA NISA SALSABILAH FIRMAN SYAPUTRA SRI WAHYUNI RAJUDIN YUNIMAR VONNY AULIA OCTAVIANNY BURHAN P ASMARANI BUDHI AIDIL FITRA TRIESNO ASBULLAH SYARAS HARYATIE YANI DEMI HARMAS ARMIAN RIKA SURYANI RISKI MAULANA EDWIN ELEN SAFRIDA M. SYAUQI REZVAN M. RIZKY RAMADHAN ERIZAL/ RT/KADER RENI SUSANTI RIYON FAJRI RIVALDI RIDHO AKBAR ARFENDI FITRIA JULIA KARTIKA KEYLA SYAFITRI LESMAN PURBA HERTA MARTALENA BR H. TAMA JUNITA PURBA ROY HARRI PURBA RANI FRANSISKA PURBA YONES RIMINGTON PURBA ESTER ERIKA PURBA ADRI ASMANIAR MIRA KARMILA DEFRI NALDI RIDWAN RIRIN ADRIANI JANUAR MARTOS YULIANA MUHAMMAD RIFAI SITI RAHMAH AHMAD BETI WARNI SRI AYUDINI SRI ANGGUN SRI WULANDARY MURNI MASNIAR HARIYANTO DEWI PURNAMA ANITA RAHIM MUHAMMAD DARWIS KATIMAH NOVI YANTI ABDAN SAKUR PUJIS CHANIAGO MARTINI PUTRI RAMADHANI MUHAMMAD FIRDAUS ELIZA NATALIA HASBI HON ZURTINI HASBULLAH FITRI NILAM SARI HALIMAH NAZAR LISWARTI DEDI NATALIA SYAFRIZAL HELMI MUHAMMAD FAJRI WAHDANA ALYA NOVINDA ZALMI ASMARA AZIZAH ISKANDAR SUPIYAN FERA KUSNADI SYAWANI GEWENG WIRDAWATI SARIYANTI MUHAMMAD NASRUL ZAHERMAN ENI FITRIA REYHAN ZAFITRA TANIA AMANDA PUTRI NASRUDIN TUTI HERMAWATI RIZKY SAPUTRA ASRIL SUARMAN LISMADEWI AULIA FITRIA HENDY ILHAM MIRA KESUMA MUHAMMAD CHADAFI RIRIN AULIA AMZAH NIL NURMA SAHARI SANDI REKA SUPRIANI SYAHRIAL SYAFRIZAL ASIAH ZUHARI JONIZAL JUMIATI CICI METRIATI DONI SAPUTRA MELANI SYAPUTRI KASMIRAWATI FEBI SHAM KHAILAH SARIANI ARIFIN MURNI ADAM MUKHLISAM RUSLI AUWIYAH HABIBURRAHMAN WANI MUHAMMAR AZURA HARISA NURADIAH AFRIYONO DESMA HENDRI MHD. PADILAH AFRI MAISAROH AFRI MUHAMAD NABILA TRI AFRI ANANDA RESKI AFRI SARING ERNAWATI APRIYANTO PITRI HARYANTI FEBRIANTO NOVI HIDAYANTI RISKI AGUSTIANTO SYAMSIR MAINI RIDHO CANDRA SYAHPUTRA RINTO FERNANDO ROBETRIANTO CN ROHID RENALDO SUCI LAURA TYSAH ZIGO ROBSON SIMORANGKIR EVI NATALIA MANALU LIONEL YEHEZKIEL EVAN S. RASIANDI SARTIKA AGUSMAN LIDYA CHANDRA DEWI YUNI ADILA LUNA OCTAVIA ALDI ROY MARTIA RAFIKA YULIANTI IVAN PERMANA HAFIZ ADITYA JAMES SIMORANGKIR ROBINA PANGARIBUAN NORA DEVI MARLINA ELLY SIMANJUNTAK AFDODI INDRA DESI SUSANTI TESHI AMELIA HAKILLA K. AZMAN ROZITA MUHAMMAD NAZRI SYAIFUL ERRIZAL FATMAWATY SRI WAHYUNI RUSDIYANTO RESMIANTI DESMIATI AGUS SALIM AMIR WANDI MERIZA YUSNITA ANDIKA PUTRA ARIA PUTRA ABIL PUTRA MARSAL SABIWARTI DESI SUARTATI EDI SURYADI YURLIDA FAJAR SURYA PRATAMA SURYANI WULANDARI CANTIKA MENTAKI SURYA FERRY WINDRA HERAWATI LUBIS DEDE FERDIANSYAH DIMAS AGUNG NUGROHO DINO HERMAWAN SIXRA GUSMAN HUSNA AINAN TAJRIAN EDO EKO SYAHPUTRA NARMA MARBUN NETANEEL NOE BERNADETH KEZIA NAULI AMOUREL LEON SIAHAAN FERDIANSAH NOVI ANGGRAINI SHEFA CINTA FADILLA VINO KHIAN PRATAMA ASMAH RAHMAT SARTIKA SARSINA SADDAM HUSIN SUCI SUSANTI SUCI RAMADHANI ASRIL YUSNAINI YENDRIK LENI SUSANTI KASMAWATI FITRIANI GUS PRIADI RENY SRI WAHYUNI SYAHRUDDIN ENHALENA OKTAVIANA JEFRI YANTO SITI AMINAH EDWIN SYAFRI SYARIFAH AINI BUSRA ENIM MHD. A. R PULDRI LISMAN YULIANIS ADE VEBRINANDES ISYATIN RODIAH RIZKY HIDAYAT ARDI YAHYA RIZALUL FIKRI AHMAD ZUHRI LAYA DT GINDO RAJO SYAHRIL YENI ALEX CHANDRA OSMAN ELDA ERRA PERMATA SARI M. TAUFIK SAPUTRA YENI YULIANA MURTI AYSAH PUTRI AMELIA ERIANTO MAISA NOLA FARANNISA SAKIRA FIKRY HAIKAL KAMAN RAMI GUSTIN RAHMANI YULITA WELLA PEBRIANI AISYAH IKHSANUR FIQRI SUDIRMAN NELSYAHNIATI SAM SYAHRA JIHAD SAM SYAH AISYAH SAM SYAHRAIS SYAHID SAM SYAH SYUHADA RAMAIN IPIN MUNIRICO DEDI CANDRA YUSRIZAL LINDA FITRI YANTI FITRI WAHYUNI YULIA SAFITRI MUHAMMAD ANDRE FRISKA APRILIA SYAFRIZAL HARMIZUL ALDIGA SRI YANA AULIANA ALDIGA SAPUTRA ALDIGA M. NASIR ASMANIAR ZIKO ASA PUTRA INGGIK MUZIARNI ARDINA PUTRA ENI INGGRIANI ENO SAFITRI NURHAIRANI PASARIBU NANDA MEI SAPUTRA PERDIANSYAH SATRIA SYAHRIZAL IDAH HIDAYAT M. ARIYO YOLA PALWAL DJANNAH RAHMADANNI RAHMADAN. D HASAN BASRI SURIATI MUHAMMAD HASIDIKO AISYAH SIFA SHARA MULYADI PERAWATI PUTRI MULYAWATI KEYLA MULYAWATI AZAN MULYA SAQ’BANI HERMAN OTRIANI NUR FITRIANI AIFA AL HADAWIYAH WIKI APRIMAL YENDRA WINDA NURFITRI DESRIMAL FITRIANI PINDO SEPTIAN WIDYA ANASTASYA ESSY ARIEF RAHMAN SATRIA APIPUDIN DEWI MARLINA BUSTAMI KARTINI NURHASLINA SELLY SINTA RINI RICKY WAHYUDI A. RAHMAN ASNIMAR ALI ASMI ALIZAR ASWARDI RAHMA JULIA YANI YUSRIL IZA MAHENDRA EKA YULIA FITRI SITI NURHALIMAH T. ERIZAL IMELDA RAMADIAN SAPUTRA SUCI ANGGRAINI SESNELI

NO 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790

NAMA

RT

JASFIA NELTY ABDUL AQIL ABDUL MUHAMMAD ISA SALIAH SUWARNI NOFRIYANTI WANDIGUS RAHMAT RENI RAMADANIS ANDI. CH AMINAH KEVIN LAKSANA SYAFRI YUR KEMALA DEWI RAHAYU APRILANI AMELLYA DWI SYAFRI ASPARINA VIQHI WAHYUDI BASSYA P. SAKINAH WAHYUNI B. MUTIARA BINTANG B. HAFIZAH RAIHAN BASSYA P. EKI ISWANDI EKA HANDAYANI ILHAM BENNY SRI ROZIAWATI TATA FEBRINA HARUN AL FIRMAN WIRDANIS ALFERDIANSYAH AL MUZAIDY SYAHPUTRA AL KAYLA NITRIYA RIZQI DEMOSRIL/ LPMK HARLINDA RILDA ENGGRIANI RILDA AMELIA M. RIDHO MUHAMMAD ILHAM RILDA NADINDS YUSNIDAR HAMDANI SANTI ZURAIDA ZAHARI RINI TIARA KUSUMA DEWI TASYA KUSUMA DEWI ALDI SAPUTRA JELMI HARTOPO UJI RASHID FAUZIAH RASYID BASRI NOFITA NAZRI HIDAYAT ANANG MAULANA SAHRI SAFRUDIN RENI RAHMAYANI SUARDI LAMBUK AKMAL MULYADI ZARDI ALFINDO RONI AGUS SAPUTRA AISYAH MELANI PUTRI MARVEL MULIADI RUSTAM EFENDI RATNA PANE RISKI AISYAH TANJUNG YOGI ARDIANSYAH EMMA SIREGAR ADISMAN HIRDA SUSANTI IRESTA ABELARD AZZAHRA RAHMI SARI MANSYAFRI/ KADER UFIT TRIANA LUQMAN NUL HAKIM ARNIS AFRI AYUSMAN RUDI ANDI CANDRA NURLIAR A. MARIHOT PANGGABEAN ROMAULI PASARIBU MONICA MARTALINA BR. P. ARDIN JACOB SEPTYAN P. ALBERT ALPINO P. TARMIZI SISWATI IBNU TAHER FAUZIAH LATIF KEVIN RAHMAT JULIANDRI NURHAYATI NOFRIZAL/ RT VERAWATI NADIA VERZA ROSA RANGGA TUARMAN VERZA ASYRAF KUMARA VERZA DAFFA RAMADHAN VERZA NASIRWAN SUPRIYATIN RIKI SYAFINDO RAMADANI DWI ANDIKA RAHMI MUTIARA ADID ILAHI IDRUS ST MUDO NURHAYATI ZURAIDA HERMAN PUTRA RIO PRAYOGA TOMY GUSRI ROZA ANDRE PRAYOGA AHMAD RAIHAN KEYSHA AULIA KHANAYA ZIEVHANEY E. ADELLA NURFADILLA AFRIZAL SRIYATI M. AZIA TIFALA PUTRA DIMAS DWI PRASETYO DISYA AULIA RIZKI ANANDA JULIANUN RAFLI RAMADHAN IRSAD BAKTI HASUGIAN LASROHA BR. SIPAHUTAR HENDRA HASIGUAN PUTRI MAI HASUGIAN ELIZABETH HASUGIAN FLORA HASUGIAN WILSON HASUGIAN MANATAP HASUGIAN PURBA LUMBA TOBING HERLINA PANGGABEAN SANTINUR LIANA TOBING KUMPUL NABABAN LUKERIA BR. SIAHAAN LOMAK HERMANTO N. ALEX FERNANDO NABABAN MAYUNAR/ KADER YUNA MEYSI PRATIWI ERMANSYAH ASMI ZAHARA ADRIAN RICCA NOVRYANY ZAHRA RYVA ADRIANY REVAN ADRYAN SUHENDRA ZAINAR ARIS SARIPIN MARLIYAWATI SUWARDI ELPI SUSANTI JEFRI DEDDY RAHMAN YANINA KRISMAN SIANIPAR SITI HITCA MARLISE BR. S. JAKARUDDIN RAMILI ERINATA ERNALIS AKMALIUS YULISMA ANISA RAMADHANI IRVAN SAPUTRA BETA MARDATILAH ABDUL AZIZ BUDIMAN JHON HENDRIANTO KOMARIAH BR. HASIBUAN ZACKY RADITYA PRATAMA ALICHA PATRICIA R. JHON HENDRI IREDAWATI AMELIA RAMADHANI ADHITIYO DWI ARIADI ALI NURDIN ERMI DAWATI REZA NURDIANSYAH MUHAMMAD FAIS CRISTIAN SITORUS DEWI ANGGRIANI EVAN SANDER S.T DHEA AMANDA S.T JUNERI MURNIATI M. YUSUF ASRIADI AYU ARTIKA PUTRI SAHARA PITRA MAULANA ADHITYA SHAPUTRA NUR INDAH AMIRA SINTYA PUTRI SUMARTO NUR’AIDA WIDYA RAHAYU BOBY SAPUTRA ADIT PRANATA MULYADI YENI MUHAMMAD FAUZAN ABEL ADHYASTA KAMAN JUNAIDI INTAN NADA SAGITA RANJES MIFTAHUL TRI BALQISTA YEMSI ERNALISWANTO HANAFI SINA ARIF ALHAFIS NURMAN HAMZAH BARA RESKY HATAMA DAFID KHUFMAN ANI SITI MUNJIAT DANI SAPUTRA FITRI YANI ASRIL CAN MARNI. T RINA SAFITRI RIKO PILIANDRA RAHMAT ASMARDI ROSSY SUNDARI PUTRI REZKY SATRIA PRATAMA FENDI DASIMAR PUTRI MARINI PUTRI DIANA FATIMAH SIBOB SITI AISYAH AMANDA PUTRI UTAMI BADURAKAN PIK RUMA KARSAPUTRA RATNAWILIS AMELIA PUTRI FATMA YENTI HENDRA FERI RIRI MADONA MELLY ANISA PUTRI REGINA DWY PUTRI M. SALEH SYAFRIL M. AFDAL ZIKRI NURUL FAJRI IKRAM AZRI SYALSABILA IRANI YELLI GUSNIDAR APRIOZA RIZKI IRANI RAMA KESATRIA FAJAR TRI WAHYUDI DIMAS ARYA SANJOHA SYAHRUL ROMADHON PUTRI CHOIRIN NISA SUKIRMAN NURLAINI ELVIRA ROSA REVIDA ROSA REVI NUR DILLA WELLY EKA SUKRI SITI NAZURAH SYAIPUL RAMAINI ALIARDI ERIYANTO YOBI EFENDI TAHER MAIWARIFDA WELI DIRVA ANITA GUSNETI RIZKI MARJONO HARTATI PUTRI ANGGRAINI YODHI PRAYOGA YANDRI FEBRIANTO DONNI PUTRA FEBRIANTO EMA HENDRA E. BUDIMAN BUTAR BUTAR S.A MARIANTI TAMPUBOLON OLIVIA MIRACLE IMANNUEL JAYA BUTAR B. MIKHAEL MORA BUTAR B. LUKMAN DARWATI ILHAM NOVA MARDIANA SUMARNI ALMUNHAIMIN. KS OLYADI MARJONI ELFA SUSANTI FIRMAN HIDAYAT MUHAMMAD FAUZAN EEN CANDRA RENITA YULIANA FHAHRI REENDRA SAPUTRA YARNI HENDRI MASRIZON SUMILASARI FINA RITA SARI EFRIJON MAINIZAR YANUARDI HIDAYAT FAISAL NURBA’I H. MAROLOP NAIBURHU RAJENI SIRAIT RONAL TAROMAR N. FITRI ELISABET BR. N. HAMDAN PUTRA WIJAYA RIDHA ANDINI APRIL NURDIN MISRAINI RENDY MAHENDRA DONNY SOFIAN THANIA PRAWITA UMAR ALI IRWADANI MULIADI MULIANA TAUFIK SUSANDRA SENI NOVALIZA VELY RIZONA M. FIRDAUS M. FIRMANSYACH ALI MUNIR/ LPMK ROSMANIAR NURMUFFIALDI HENDRIZALDI SAFRUDDIN HERLINA RYAN HARIANTO ARIF IRVANTRI HASAN BASRI ANIZAR FAHENDRI AMRIZAL SRI AYANI ERNAWATI SURYA NINGSIH RIZA ARIANI EDI CHAN RITA NILAWATI RESKY NOVERDILA RICKO QADILA REVIN FERDILA HAFIZUDDIN AGUSTI MURNI ARYA NURAGDI PUTRA IQBAL ARKAB AL GHOFUR ASRIL TURAH

NO 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886 2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956 2957 2958 2959 2960 2961 2962 2963 2964 2965 2966 2967 2968 2969 2970 2971 2972 2973 2974 2975 2976 2977 2978 2979 2980 2981 2982 2983 2984 2985 2986 2987 2988 2989 2990 2991 2992 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067 3068 3069 3070 3071 3072 3073 3074 3075 3076 3077 3078 3079 3080 3081 3082 3083 3084 3085 3086 3087 3088 3089 3090 3091 3092 3093 3094 3095 3096 3097 3098 3099 3100 3101 3102 3103 3104 3105 3106 3107 3108 3109 3110 3111 3112 3113 3114 3115 3116 3117 3118 3119 3120 3121 3122 3123 3124 3125 3126 3127 3128 3129 3130 3131 3132 3133 3134 3135 3136 3137 3138 3139 3140 3141 3142 3143 3144 3145 3146 3147 3148 3149 3150 3151

RT

NO

RAJU NUR. B PUPUT MELATI DINDA AYUNI AULIYAH PITRI AHMALIUS YULISMA ANISA RAMADHANI IRVAN SAPUTRA BETA MARDATILAH ABDUL AZIZ BUDIMAN RIANA GIRSANG MEI JEKSON HENDRA RODO LAMHOT H. HOTMA HUTAGALUNG TUMINDANG MANURUNG RUSLAN BR. SITORUS TIMBUL HILMAN P. SYAFIRA SUHADA WAHYU ILLAHI HALOMOAN PURBA HELDINER SINAMBELA PAGAR OLOAN PURBA ANWAR RANIAH AGUS SALIM MATLAUL ANWAR NURMALA MARSYIAH LINDA NOVITA BAHARI SAPUTRA BAYU PUTRA NURAIDA AFDANIL KAMRA MELITA SARI JIHAN PUTRI RAMADHAN WANDRA M ARSESWITA RANTIKA YULIANDA SARI ROZA DESWITA FADLI GUNTUR HUMINSA SIHAR M. ESRIDA SITUMORANG RANDY CHRISTIAN PARDEDE BOBBY ARIZS PARDEDE CHIKA VANESA PARDEDE HELFIRA WISMAWATI VANY AULIA HERLINAWATI WELYA SUSANTI ANDESPAHMICAN YUNIKA FITRI AYYIYAL AYSYAH ANANDA PUTRI MAIDESI SARTIKA RISMAN JOHAN ST P. ASLINDAWATI WURIMUDA NIRWANA WANPHONCHE. H WAHYU RIZKI GUSMAN SIMBOLON HERLINA BR. PANJAITAN JUNJUNGAN YOGA ADITAMA ANNA TIO PUTRI ROKIB DAENAH RIZKI HIDAYAT MARUNTUNG MARPAUNG HOTMIDA BR. HUTAGAUL JUNICO MARPAUNG NANCI VERONICA M. SYAIDAR ALFAJ RA’ADIN AULIA HUSNA FITRI YENNI SYAFIRA SUHADA WAHYU ILLAHI DASRIL OPET DRIANA PUTRI AULIA AZZAHRA ALIF RAHMAN KHAIRAN MAHYUDDIN DARNIS SYOFYAN KAF DEWI MAHDALENI DESI MARIANTI DEDI AZMAR DEVI YULIANA FEBRIAN TOMY NEWAN SAMSUL BAHRI SUKISMAN NURLAINI ELVIRA ROSA REVIDA ROSA REVI NUR DILLA WELLY EKA SUKRI SITI NAZURAH AGUS FITRIA FINA YONITA FAUZAN MAULANA FAIZ KENZIE ANDI FIRMAN LASMAWATI ALEX SANDER ANTONI SUCI ULAN DARI DIRA SEPTIANI NUR HAFIZAH HUMAIROH ARMEN YASMITA HARRYADI SAPUTRA YULIAR DWI NOVITA SARI PEBRI RAMADAYANTI NOVANDA RHAMADANI MASNIAR RIKA FEBRIANI MAISY INDAH SARI LENI DESMAWATI M. IKSAN NADIA SAFIRA NADILA SYAKIYA NURSIDA ARI MAJUDIN TOMI IRAWAN RINI NATASYA BURSA EL HARIS. B ELVI SUSANTI KHAIRA MAULIDA ERMAILIS SRI MULYATI ELVI SYAHRINA NADIA HANIFAH AINI ALISHA SAFIYA RAMADHANI SYAH FIRMA HARYATI IRDA EKA PUTRI FEBRIANSYAH YULIZAR ROSNIAR YUDI YULIANDRA YUDA SAPUTRA YALDI PRAYOGA SAHRIAL DARMANI ZULHAM EFENDI RAFLIS ERNI SRIYANTI ABDUL M. HALIM PUJA OKTAFIYALIS SYOFYAN BISMI JULI ALFITRI SELVI OCTAVIA CITRA ADINDA PUTRI LESTARI SYAMSIR EFENDI ASMANITA EDISON WATTI YEMRA VIDIATUL AMALIA J. AHMAD FAUZAN J. M. GUFRON HAWARI VINISA RAHMA JOWANDA KESYA EFENDI YUSRI LASMI ZULHENDRA AGUS JUSLIA MAINI RIDO JUSRIYANDI LISA RISDIANA JUFIT ASARI SYAMSUL BAHRI AL HAMRA MASRIADI NASRUL SYAHPUTRA AFRIANDI ARI ANGGARA PURWANTO SITI AISYAH RIZKI AFRIANSYAH IRSYAF DANISH ANISAH ROHIMATUL FAIZAH MUSNADI YUSMANIAR SONIA FEBRIANI RAHMAH HIDAYATI ALIF PRATANJUNG ROSLAINI ERWIN CHANIAGO RAHMAH M. NANADA BINTANG AL I. NAZWA ALYA LUMONGGA RATNA SARI DEWI MURNIWATI IBNU ABIDDUNYA AMRI FADHILLAH RATNA WULANDARI HARUN AL RASYID AWALUDDIN SYAMSIDAR RAHMADI SETIAWAN YULIA ARISANDI M. HARIANTO SUMIYATI SUARDI LISA SANDRA DEWI HUMAYROH RAHMADANI BOKAT SUHARYANI DIAN PURNAMASARI HERU KURNIAWAN SUGENG HARIYADI MUZANNY SURYANTI EKA SRI WAHYUNI AYU DIAH LESTARI AZMAN ERNAWATI DELVIA WATI NOVRIANDENDI MARIMAN SRI HOTMASARI ANA RAHMAWATI BAGUS AKBAR SUTRISNO SYIFA ULHASANAH NURAISYAH SITORUS RAHMATUSY SYIFA ABDUL GHOFUR. MC ARIES KURNIA AFIFAH KAMILATUN NISA ASYRAFUL AZMI KATENI SUMARNI ALEX RIO SAPUTRA LELA ANGGRAINI SRIYATIN HERMALINA HARTONO ERNAWATI YURI PRATIWI ANDINI PRIHANANTI PAULINA BR SIBARANI ESTER BINTANG MARPAUNG ERWIN RONALD MARPAUNG ERSON PAUL MARPAUNG AZMARISKO AMELIA ADITIA PRATAMA PUTRA TIARA FIORA PUTRI RISWANDI GOLANG PASARIBU ELPERIA BR HUTAHEAN GOPAS PASARIBU ROSITA PARLUHUTAN SAPRI INDRAWATI NADYA ROZA NAZIFA TSANIA NAFDILA HARFIA NASRUL RAMAILIS MIA RAHMAYANI WIDYA ASTUTI NISA WULANDARI ADE MARTHIO DAWAM ROKIAH NURHIDAYAH AHMAD RIDUAN MAULANA FIRDAUS SUDIRMAN SINURAT ERMAN HUTAJULU EKA PRASETIA SINURAT DWI PUTRA P. TRY MANDA SINURAT CATUR BENNARA SINURAT B.M PANDAPOTAN LUMBAN T. ORITA SIALLAGAN IRFAN HOT TUA LUMBAN T. NOVI YESSICA LBN TOBING WILLY SAPUTRA TOBING FRISKA GRACIELA BR TOBING ZULKIFLI AZIZ YULISMA FRENGKI SAPUTRA FEBRI HERU SANDI LIZA DILA FITRI AZ-ZURA HABIBINA JIBRIL HAMAS FATHIR APRILLIAN M. ARUAN REVI ULI A BUNGA ETIKA LEO HOTMA A SABAR HASIOLAN ACHMAD MARDIANA NURFATIMAH MAHADI SYAPUTRA ABDULLAH ERNAWATI ADNAN ALGHIFARI IRHAM SYAHRI SITI UMAIROH JANSEN PANGARIBUAN SERPI BE SIMANJUNTAK SUPRAPTO PANGARIBUAN SARIPUDDIN RUSDAWATI NANANG S SYAFITRI SARIPAH DUWI HARTONO MEI LINDA AL MUBARAKH DEA AGUSTINA DEWI TEZA PERMANA NAWIR DASWATI IRWANSYAH YENI MARLINA FATMAWATI YOGI WINANDA PUTRA GOVIN RAHMADANI KARMAN DAHNIAR RIA AGUSTINA S P. PINONDANG SIAGIAN ELFRIDA BR SIMANJUNTAK FERI ERIKSON SIAGIAN ELA SINTIA SIAGIAN JESSIKA APRIYANTI S. ROBI SUSANTO HERWANA M. ALIF AR’RASYID LUTFIAQIL RAZIQ MOES MEIDY MOESI GUSNI ARIANI MIRA YULITA M. KAMIL RUSMIATI WINDY NOVIANTI WANDA NOVADIANSYAH MURNI SYAFRIZAL WIWAILIS EVA YANTI M. ADISYAHPUTRA ROHI PONGKI PANJAITAN NETTI MAYAR BR P. WINNER PANJAITAN KHAIDIR BAIMAR EVA KASMAR ROZI INDRA NURAIDA MAILASARI ILYAS MARPAUNG ROFIAH ULINA MARPAUNG RIANA MARPAUNG

NAMA

3152 3153 3154 3155 3156 3157 3158 3159 3160 3161 3162 3163 3164 3165 3166 3167 3168 3169 3170 3171 3172 3173 3174 3175 3176 3177 3178 3179 3180 3181 3182 3183 3184 3185 3186 3187 3188 3189 3190 3191 3192 3193

NAMA

RT

NOVFIYANTO MARPAUNG NAHUM SIRAIT NEVOIDA TAMPUBOLON GIBSON PRATAMA SIRAIT AGNES SIRAIT REJEKI SIRAIT HENDRA SUPRIADI SRI MARTINI REIHAN HARDI RAKA DWI HARDIANSYAH M. IIM SUMIANI FADIA ANANDA ALIYA PRATIWI NURMALA WILSON SIMANJUNTAK LEONI OLIVIA ARUAN HARAPAN SIANTURI FRISKHA ERNAWATY S. NENY ANDRIANI FRANCUS HERYANTO JOHANNES AFRIZAL S YOSUA PARULIAN S PETRUA PARSAORAN S DEDI ELMANJA GOSNER SIBARANI MARINCE BR SIHOMBING ERNOL SIBARANI CANDRA SUTRISNO S. ELDISON SIBARANI CHARLES SIBARANI AMZAH LASIMAH SARJAN KHOIRUL IHSAN SYAMSUARDI MARLINDA DENI INDRA ERMANSYAH YULIANA SARI DEWI AHMADI HABIB JUM M

NAMA M

M

NAMA

RT

M

M M M

MM M

W M M

M M

M

W M

M

M M

M

M

W

M MM

W

W

M

M

M M

M M

M

M W M

M W

M M M

M

W M

M

M

M M

M

M

M

M W

M

MW M

M

W

M

M M M

M

M

M

M

M

M M

W

W

M

M

W

M

M

M

M

M

M W W

M W

W

M

M

M

M

M M

M M M

M

W

W

M

M

M

M

M

M

MM

W

M

M

W

M

M

W

M

NO

M M W

M

M

M

RT

M

M

M M

NO

M

M M

M

MM

M

MM

MM MM M

M M

W M

M

M

M

M

MM M M

M

M

W M

M

M

MM

M

M

W

M

W

M

M W

M

M

M

M

MM

M

MM

M M

M

M

M M

M

M M

W W

M

M

M

M

M M

M

M

M

M

M

M

W

M M

M

W

M

W W M

M

M

M

M

MM

M M M

M W

W M

W

W M

M

M

M M

M

M

M

M

M

W W

M

W MM MM

M M

W

M

M M M M M

M W

M M

MM

M M

M

M M

M

M M

M W

M M

M

MM M

M

M M W M

M

M

M M

MM MM

M

MM

W

M M M

M

M

M

M

MM M

M M

M M M M

M

M

W

M M

W

M

M M

MM

MM

W

W W

M

W M

M

M MM MM

M W

M

M

W

M M M

M

M

M

M W

M W

M

M

M

M

M M

M

M W

W

M

M

W

MM

M

M

M

W

M

M

M

M

W W M

M M

W W

M

W

M

W

W

M

M M

M M

MM M

M

M

M M

M MM

W

M

W

M M

W M

M

W

M M

M

W

M

M W

W W

M M

KEL LAKSAMANA NAMA

M

M M M M

M

M M M

M

M MM

W

W

W

WW

M

M

M

M M M M

M

M

M

M

W

M

W

M

M M M

M

M

W

M

M

M M

W M M MM

M

M

W W

W

M

M

W

M

M

M

W

M

M M

W

M

M

W

M

M

M

M

M

M

NO

W

M

M

M M

M M M M

MM MM

M

M

M

M

M

M

M M

M

M

M W

M

W

M M

W

W

M

M

M

W M W

M

W

M M

M M

M M MM M

MM M W

M

M

M

M M M

M

M M

M

MM MM

W

M

M

M

M W W M M

M M

M

W

M

M M M

M

M

M M

M M

M M

MM

M

W

M

M

M M

W

M M M

M

M M

W

M

M W W M

M

W MM

W

M W

M

W M

M

M

M

M M

M

M

M M M M

W M

W

M M

M M

M MM M

M

W

M

W

M

M

M M M W

MM M

M

MM

W

W

W

M

M M

M

M M W M

M

M

W

MM TATA LETAK: SUSAN


PENGUMUMAN

KAMIS 5 MARET 2015

5

Dumai Pos

Nama - nama Calon Peserta JKN di Kecamatan Dumai Kota KEL. LAKSAMANA NO 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167

NAMA

NO RT

ANGGRI FITRI WAHYUNI MUIS SAHATI YANDI SAPUTRA SARTIKA JUHARI ERNA WATI FITRI WAHYUNI FERI HIDAYAT SYAFUDIN ASRIYANI RISKA ANISA RISKI KURNIAWATI TAUFIQ HIDAYAT RAISYAH SUPRIANTO ASNITA SHELLIN AYU PUSPITA SARI EKKO SAPUTRA MUHAMMAD ALDI IRFAN RAZALI SITI FATIMAH ALIYA NABILA MUHAMMAD SAID WAWAN KURNIAWAN ELVA ROSANA NATASYA EWANDA ZULFAN HAHITA GIANA FAUZAN APRIZAL PRATAM SUPYANTO TRI MALINI UBAIDILLAH AHMAD RAZALI ELYANTI RIYANDA SEPTYAWAN RHENDRA OCTUJUWANDA ERLINDA JOSHIEANA RHADIT AGUSTYAWAN ERLIYANDRA SEPCA VIONA HENDRI YANTO RAMLAH MARYANI MUNIR KAMRIYANTO ARNELIS ROHIM MAULANA KARIYANTO NANDA AFRIANTO WINDA NOVITA SARI JULI EFRI HARYADI MAYA FIKA SAFITRI INDRA MULYANA IRMA YENI RAFISA SYASABILA SYAKIRANA INDRAWAN ISMAIL HARUN ROSLIZA TYA GUSNANDA M. ANDRE ISMARA MEISYA ISMIZA ATAN JAMILAH AJENG DIAH GB AJENG PUTRI MEIDINA USMAN SUHARTINI PUTRI WULANDARI FITRI NOVA YANTI TARMIZI ASIAH NATASYA AZ ZAHRA DAFFA MIFTAHUL RIZQI RAMLAH FAHRIZAL HENDRI AGUSTIAN ZULKIFLI JULIA RAHMADANI FATMAH MUHAMMAD RAFLI SUHERMAN ITA MAYSARAH SUCI SEKAR SARI ATAN IZHAR BUDI YANTO SULASTRI EKO HARYA PRADITA ONI AGUSTINA OGIAN SHAFILA AZURA DUMAYANTI MARISA HANUM HARUN RATNA MAYA SARI JUFRIZAL HENDRA SAPUTRA SIHITE SELVIA MONIKA ANDIKA PUTRA SIHITE EDI ISMANTO NURAIDA IRAWATI M. ISKANDAR SYAH INDAH PERMATA SARI NAZWA NURFA NABILA SUKATMAN YUSNIDAR NIKEN ARDITA SOLIDKHAN SAPUTRA TRYA FANNY SASTRO SALMAH ADI SOFYAN HADI PURNOMO BUDI EDO ROMANSAH ISKANDAR MOH. NURKHOLIS SITI AISYAH BURHANUDDIN AZIZAH LIAN SYAH RAMLAH MARYANI MUNIR SUTAMI SULASTRI ABDUL IKRAM DARNIWATI SITI ZULAIHA SRI REZEKI M. NASRUL WATION R. MASKURI TIWAR M. YUSUF LIDIA IIS DEWI SETIANI MUHAMMAD ILHAM AGNES TERI SAPTARA AMAT SODIK SUPRIATIN MUTTAQIN HAMID NUR MUHAMMAD SUTI TAMBIR PONIAH LAMAN ANI DEDE DIAN FIRMANSYAH MARZUKI PONATIN NANANG SURYONO SALWA AGIL SALSABILA JONI WINARNO NASRATUL HIDAYAH WIDIA AGUS ISMIYATI MUHAMMAD RIZKY WIDIA LUBNA IZZAH WIDIA RIONO TRIANA NANA ARDIANA SAFITRI AERIL JAKA WICAKSONO RYO ANGGARA PUTRA RIDWAN S SRI REZEKI HARI ANGGI SUSENA BIMA RESKI IRAWAN M. ARDIANSYAH MUHAMMAD YAMIN SAUDAH NUR FARADILLA OKTAVIANI FAISAL OKTAFANI WIDYA FAHIRA YASA NABILA SALSABILA JUNAIDI ERMI YUSNITA AHMAD FAJRI JUNAIDI ULUL ASMI QOLBU JUWITA SHYRA APRILIA K. MULYADI LENI LESTARI HALIMATUSSADIAH FAHRIZAL ARNELIA FAZILA SEPTIANI A. RAHMAN WINDI WULANDARI ASPEN PASGO SAPRAN PASGO NANDA PASGO SURITEM ABDULLAH FATIMAH ABDUL ALI SITI RAFI’AH SULAIMAN MAULANA YUSUF UMI FARIDA SYAFRIZAL SURYATI AINUN MARDIAH SHOFIAH FEBRIANI ULFA M. FAUZAN HIDAYAT M. FATHURRAHMAN HIDAYAT ASNIARTI READHO MAJESTHY RANDIAS RICHARD RESKI MAJESTY ROBBY MAJESTY RANDIAS T. MUSTAFA SRI MULYANI FANNY HARIBOWO HENI GRISTIANI GHATHFAAN RAZIQRI SALMAH/RT SYAMSUL BACHRI MAEGA WAHYUNI SB M. NOOR ICHSAN SB M. ADHLI TAWAKKAL SB ARNELI.A/LPMK FAHRIZAL FAZILA SEPTIANI BAHRUM ANDIKA RAHMAN SANTI KARMILA SARI ALI BASRI NURMIATI AFRIDAWATI ENDAH KOMALA SARI FAISAL LUBIS AURA BALQHIS LUBIS PUTRI VINIOLLA LUBIS OKTAVINUS SUMINI POPPY AGUSTINA DEWI HANDAYANI ICHSAN FREDY MASLINA NOPI ICAL KELANA FAISAL ABDA’U FENNY IDRIANI MARDIANTO SUGESTI OKTA PRATAMA MUHAMMAD TAUFIK DESNI FITRI OCHA ANGGRAINI GAOGI ABELLIO M. JUNAIDI LAMBAS H. SRI NELVA EFNITA RAHMAD DANY PRATAMA T. M. TAON NASUTION MUZNAH ABDI AFENDI NASUTION YUNUS MAHARANI MUHAMMAD REZKY JUNAIDI NILAM HARMIDI ELNELTI RAHMAT FITRAH ILHAM RAMADAN DARA ENDAH CANDRA KRISNA RISKI MULYA PRATAMA SUHARDIN ANDIKA RATNA DEWI MAHARANI MESSI ANDIKA HAIBAH MARYANI WATI SRI WAHYUNI EDI SAPUTRA HARIYONO ZULFAHMI SARTIKA MAULANI HADI YANNUR APRILLIA UTARI SHOFIAN HADI EMLYAWATI RIDHO HADI NASUTION SUDINI NURLELA RESTU HERLINA JHOHAN AL FADRI ANDIZAR MISLATIN WIDYA SARI RAFIQ MAULANA PUTRA SARMAN MARNIATI PAZMI FAJAR KHAIRANI OKTAVIANI NUR AISYAH TULAINI BAKRI ERNAWATI HARYANTI FADZILAH ANISA FITRI M. RAFLI ZAINAL FARIDA ZAMZAMI ASRI AGUS SALIM ABDUL WAHID/RT ZAINUN SYUGIANTO ADI SUSENO NIA WARNI AIDA SAFITRI SYAHRIAL MORIAH ABDUL RAZAK SUHENDRI SAMSUL RIZAL LINDA PRISKA DALMA YANTI RANDI DALMA PUTRA PRANDALMAYANTO FADLI GUSDALTO OLIF DALIANI RASTI ANJILINA ARI SUPRIACAM HIDAYAT RAIDAWATI ADRIANSYAH MUHAMMAD SYAFIL AZIZ BUJANG RAMLI PUTRI ADHA PERMANA KUSUMA SUHAIMI RUSMIYATI M. SAMSUL KHOMAR DESNIDAR AGUSTIN RAHMAWATI ARDIAN PUTRA FENIARTI DHIYA ZHALFA TRI R. DHIRGHAM MUMTA K. DEMAS DEWANTARA ERLIN JEMES DEWANTARA ERLINA SALIM HENNY WIENDY PUSPITASARI EDISON SYAMSIMAR MARDIANSYAH HARDIANTO HENDRI JANUAR ARNITA SYARIFAH MUNA ULFAH SAID FADLY KURNIAWAN ZURIATI AHMAD AFANDI MERI YURITA BENI SETIAWAN KELIAT HERIANTO AHMAD HUSAINI

REDAKTUR: KAHARUDDIN

3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7

1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298

NAMA RANI MUHAMMAD SUNEIL RAHIL BIMA PUTRA NATASYA CANDRA KRISNA RISKI MULIYA PRATAMA AHMAD SYAFI’I SAMSIAH SUKUR SAHRIYAL ALAM KURNIAWAN HARIATI LIJA HASNI MUZIAR EDI PUTRA SINAGA YUSLINAR EKA YUNANDITA SINAGA FITRA YANSANDI SINAGA M. YUNUS. M MASNAH USMAN BASTIAN NURSYAM HANAPI. YM MARDYA AGUS RAHMAT CHANIAGO YENI WULANDARI DWI ALFIRA GUSTINA JOHANDA SYAHPUTRA NAIFA PUTRI M. ALFIN FIRMANSYAH YUSLAILA NASUTION RANTO RYNALDO SAFRUDIN JARIAH RAUDI MARCO DEDE WAHYUDI SUCI RAHMADANY M. NASIR NORMA BUDIMAN RIA IRAWAN MUHAMMAD MULYADI RIKA TAHER ROIDA BAKRI SAPUTRA NISAP SAPUTRA MUSLIM RAMLI SARINAH HERLIS FIKRIANTO JULIS SUPRIADI RIZKI RAMADANI AMAN SAPUTRA IDES ALVIN PRATAMA ALDI SAPUTRA JEKKI NURMALA MUHAMMAD SOFYAN JELITA FANESA MAHADI LINDAWATI ANDRE SAPUTRA ARDIAN SYAHPUTRA ANGELICA SILVIANI ANDIKA RISKI RAMADAN MUHAMMAD IRWAN M. EGI JUANDA S. NURSHIRA HANAFI MEITRA WIRDUNA LAURA VIORENZA YUDHISTIRA JIMMY HENDRIX CINDY RIZKY SELVINA NURUL AINI SHASA NAYLA HUMAYRA FARMI YENITA FARREZ FERDIAN DESSYA HARAHAP FITRIA HARAHAP ALIMUDDIN ERMI YANIS ZIKRI ZULKARNAIN DESI EMILIA SARI ALMANSYAH PUTRA N. JULIANA ALFINNANDO NASUTION ALVINA SUKMA DEA L. N. SUCIPTO RAKOEM YULIANA ELFI NASUTION DUAN PUSPA KINANTHY OLIF SEKAR PRABASINI SENOPATI PAMUNGKAS MUCHDAR PRASETIO HERMANTO/RT SUPRIANTI ANNA MARCELINA RIZKY KUMBARAWAN MUHAMMAD REZA MUCHSIN NASUTION SITI MAHYUNI ANITA NASUTION KRISNA DEWI INDRA POLTAK DASRIL NOVA YENI RINDANG DASA PUTRA P. GILANG DASA PUTRA ERILVA DASA PUTRA RINALDI MONALISA SANDRI YENI GALIH FERDIANSYAH ZARA MORISYA SAFRI ENI JOKO YOGI HASAN BASRI ELFIANI VINA FEBRIANI KEVIN SAPUTRA YULIANA ELFI NASUTION SUCIPTO RAKOEM DUAN PUSPA KINANTHY OLIF SEKAR PRABASINI SENOPATI PAMUNGKAS MUCHDAR PRASETIO

RT 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7

KEL. DUMAI KOTA NO 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226

NAMA

RT

SUPARSIH 1 ZASKIA DELIA PUTRI 1 MUHAMMAD AKBAR 1 NUR AI’NI 1 SUPIONO 1 VIVI SUSANTI 1 RATU VANISAH 1 INDAH MARSANDAH 1 SYAHRIZAL 1 RINI 1 SYAHRIL 1 ALIFA LIANA BILAH 1 NAJUWA SYAHRINABILLAH 1 IWAN 1 TONY SUBANDA 1 PRIMADONA 1 M. ALIF PRAMUDYA 1 SYAHRIAL/ KADER 1 HELMI YUS 1 RISA OKTAVIANI 1 AIDIL RABBANI 1 SITI AISYAH 1 NAJIB HABIBULLAH 1 YAFI ALIFUDDIN 1 ASIS. B 1 MINAM 1 OTHMAN 1 WATI 1 RUCHMADI RISKI S. 1 NASRUL 1 YUSNIZAR 1 RANDI SUHANDA 1 ROSMAN 1 ISMANDA 1 SYAFRUDIN 1 JONNI 1 HENDRA 1 JUNAIDI 1 RAMADANI 1 ZURAINI 1 SUCI RATNA DEWI 1 M. ROBI CANDRA 1 NUR ARFAN 1 M. RIZKY APRIADI 1 SUTARLI 1 RAFEAH 1 SELLY FEBRI RAMAYANTI 1 ABD. AZIZ. U 1 ASNAWATI 1 RUSMINI WATI 1 ROHIMAH 1 MHD. NASIR ROZALI 1 YENNITA 1 YUCI ANDRIANI 1 NANDE SAPUTRA 1 M. ILHAM ROZALI 1 RIZA ADRIANI 1 FAHIZ KURNIA PRATAMA 1 FIRMANSYAH 1 SAILAHWATI 1 M. BAKRI 1 YUSNIAR 1 MUHAMMAD BAKRI 1 SUSILAWATI 1 ANDRE PERDANA 1 AIRIN FAZIRA 1 MOHD. ISMAIL MANURUNG 1 MEILANI 1 KENEDI MANURUNG 1 FEBRIAN MANURUNG 1 CINDY FEBBYOLA M. 1 IIS HERLINA MANURUNG 1 SUGINEM 1 SUGIYEM 1 SUPARLAN 1 SUSIYANTI 1 LIDIA SUHARTINI 1 RATNA 1 ROSMAINI 1 ZULHERY 1 NADIYARTI 1 YULITA SENTOSA 1 JEFRI ADITYAN 1 T. ZURAIDA 1 TENGKU HARFAN EFFENDI 1 SUPARMAN BASIR 1 SUHERLINA 1 SUHENDRI 1 NIA RAMADHANI 1 FIRMANSYAH 1 ZULKIFLI 1 SURYA DHARMA/KADER 1 MELIANA 1 HABIBI PUTRA PERDANA 1 QUTBHIE AL SYAKIEB 1 1 JUNAIDI 1 NURBAITI 1 M. DHAVA GILANG R. 1 M. ARYA AFREDHO 1 HERMAN 1 SRI HARTUTI 1 SILFIA HERLINA MARTA L. 1 RIZKY RAMADHANI 1 INDRA ALAMSYAH 1 ROSNI 1 CHANDRYES 10 ERMIATI 10 NUR FITRAH AINI 10 NURUL LATIFA 1 ZAINI NAZARUDIN 1 MAIMUNAH 1 SAHLAN SAH 1 SITI RIKIAH 1 SUARDI 1 SULAM ARIYANI 1 ANGLY PERMANA 1 DAKA SATRIA 1 IQBAL RAMANDA PURTA 1 NETLA FADILLAH PUTRA 1 ROZALI.A 1 SALMI.R 1 ZULFIKRI.R 1 MUHAMMAD FADLI.R 1 NASRUL 1 MAHDALISAMA 1 NANDA ALQLIDWAN 1 ADHA MAHENDRA 1 SILVA ANDIKA TRIHADISA PUTRA 1 1 NUR SALMI 1 PUTRA DEA AFRIYANI 1 FATHIRANINDYA SAPUTRA 1 NUR NAZWA AMIRA 1 T. MASYHUR 1 SUMARNI 1 T. HADI MANSYAH 1 T. NUR FATIMAH 1 T. DESI CHAITINA 1 TENGKU SALSABILA 1 DEPI FITRIYANI 1 MAYA SARI 1 ROBBY CAHYADI 1 MULYANI 1 BENI GUNAWAN 1 FRANGKY 1 AMELIA ROMADANI 1 ALI IMRAN 1 RANA KHAIRANI RASYAD ZIQRI IBRAHIM B. 1 1 ROZALIA 1 NAZRIL ILHAM 1 MOZA 1 SADIQ ABDULLAH 1 JULI KARNITA 1 SAID AHMAD 1 M. HIDAYATULLAH 1 FATIMAH AZZAHRA 1 ACEP SUDARTA 1 RINI SETIAWAN 1 NURMAN 1 ROREAH 1 SRI MURSIYANTI 1 JOHAN WAHYUDI 1 ANITA 1 MAYZULHEELIZA ELVA J. 1 NUR’AINI FAJIRA 1 AGUSRIANDI WAHYUDI 1 RAMLI 1 WIRA EKO IRWAN 1 YUCI ANDRIANI 1 MAULINA ZAHARA 1 PUTRI NURAZURA 1 DZURRIYAH NABILAH 1 YUSUF AGUSTIAR 1 INDAH ARIFEBRINAWATI 1 AFIFA FITIYA ZAHRA 1 WAN SYAHBANI 1 WAN ROHIMIN 1 WAN AMRAN 1 YUSNITA 1 WAN SYAHERI YURNIZAN 1 WAN SAHRUL YURNIZAM 1 WAN SRI WAHYUNI Y. 1 WAN SRI ANANDA M. 1 HENDRA FAHROZA 1 RAHMA YETTI 1 MUHAMMAD FAREL 1 IRA JUNA 1 RAFIKA SARI 1 JUANA CANTIKA MELANI 1 ZAHRA KASIH KINANTI 1 PRIMA SANDIEGO 1 ABDUL WAHID DARWIS 1 JUNAIDY RAMADHAN 1 KAHARUDDIN 1 ASTUTI BUDI NINGSIH 1 AMRUL TOHER 1 FITRIYANI NENGSIH 1 FIELZHA NABILA 1 FAKHRI ALFINO RAZIQ 1 MOHD. YUSUF 1 SITI AMINAH 1 CHAILINA HAMIM 1 WAN RAHMAT SOLEH 1 AULIA RAJALI 1 SRI WAHYUNI 1 SITI HAJAR KAREL STEPHEN HELWEND 1 1 SANTI MAHERA 1 KHAIRI M. AKHBAR 1 MARCOPOLO/KADER 1 MURZA HERAWATY 1 RIZKY AURELLIA STEFANY 1 DIVA DESFARIDA D. 1 ALEA TRICILIA CHANTIKA 1 SAILAWATI/KADER 2 M. SOLEH 2 NURJANAH 2 MARNI YANTI 2 HENDRA 2 APRINAL 2 NURSAL 2 UMAR 2 SITI NURASIA 2 NURAINI 2 IRWANTO

NO 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587

NAMA

RT

N. RAHMADANI. D.M.S WAN ZAMHUR SALU SINTIA NAYLA SANTIKA REY IBNU HAFIDZ CHAIRIN NASUTION ROHANA SURYA DARMA NASUTION HASAN ASARI HAMIDAH MUHAMMAD ZAQI ARYA RAHARTI EKA SARI AMERINA NASRUL DEWI KOMALA SARI SANDRA NOVITA SARI HERU SETIA WANDRI RAKA ANGGAWARI TENGKU AZHAR JUNAIDA TENGKU M. RAMDANI TENGKU NURAZLINA RAHMI RAJA DEDE PERDANA /RT FEBRA MUSYUSARI RAJA SAMY FAATHIY SITI HAJAT ABU BAKAR AMIR YANI SRI SUNDARI IMAM DESRIYANTO SERINA ANGGRAINI ANISA T.S. AHMAD ALGAFI EVI SUSANTI SYARIFAH FATMAZIRA KAMARUDDIN SYAMSIAH HERLIZA JEFRIDIN ROHANA TIARA UMARA SIRA YUSMANI MARUBA HUTAJULU DINAR SIAGIAN ANGGAT HUTAJULU SISKA HUTAJULU P. SIAGIAN ABDUL WAKHID SURIATI IKMAL KURNIAWAN FARIS DWI NAUFAL ABDUL RAHIM SRI RAHAYU HAJIRAH QALBIDAMAYANTI MUHAMMAD RAHID M. RUSZAN AL-MUBAROK M. DARTO ERMAWATI RAHMAD FIEDAUS GUNAWAN SURYA ADLLA AGUSMAN DARMAWAN REDO MUSTAKIM RIZKI RAHMAN HASFURIYAH SURYA HIDAYAT AHMAD RUYAT WULANDARI ZIKIRIA NUFUS MUTTIA AROFFA ANTONI TENGKU EFFENDI FATIMAH SYARIFAH PUTRI R. TENGKU FIRMANSYAH SYARIFAH DHEA AMANDA ROSLAN. AR NURLELA HENDRI BUDI HARTONO/KADER WAN LAILA HUSNA SHABRIANSYAH RAIHAN MAULANA FAA’IZ FAJAR AULADI HARDI YULFEDI DESI MAI ROZANITA IMRAN SYAHRIZA ALIEF IWAN SUHERMAN ENOK SURTINI RESA YUNISA SUDARNI HASANUDIN ERMAWITA MUHAMMAD HAMDAN MUHAMMAD RENDY. A BUDI SETIAWAN SUFATMI ZAHRA FIRANDA DAFFA HARIZMAN RAFIF SETIAWAN NURMA ZAHARMAN SITI ANISYAH WITH A HANDAYANI HERI FIRMANSYAH ALDI DELFIORA WAN AMINAH SITI ZAHARA FIKHADAR M. AL QHADRISYAM FATIN SALIMA NAZILA WAN AMIRUDDIN ALI WAN NURMIAH NUR CHAIDIR SOFIAH IRFANDI NICHA SILFIA NURLAN EFENDI WAN NURAINI ULFA ANGGRAINI WAN MOH ARIF DESMIDA SY. KASDIAR ROZALI SRI WANARSI M.RIZKY PRATAMA MUSLIM PURWATI ADININGSIH RIZKI RAMADHAN C. NURDIN T. ASNIMAR TENGKU AFNI TENGKU RIAN SAPUTRA YONG DERIANTO ELFI SUSANTI YOZYE AL FITRAH SELFIYOLA TANTIL REGAWATI MUSLIARDI HARNELIS MUHATHIR FARHAN ZAHID AL AVIS ABIL MUSHAR TENGKU ZUFRIDIN ETI KOMALASARI UMI RAVIKA NISA NAZHIRAH IWAN FEBRIYANTO PURWATI ADITYA PUTRA PRATAMA DWI ARYA PUTRA KUSNAN HARIADI BARIYANTI ANDRA YADI EKA PUTRA FELISIA PURTI ADIANTI AHZA AKBAR TRIYADI MUSLIHIN WILDA NOVALISA ISMAIL ROZITA M. GIBRAN RAMADHAN M. RIDHO ALFARISI NURHAIDA LIDIA NOVIANTI DELSA PUTRA WAN MARIAM WAN SYAHRIAL WAN SYAFRIL JANIMAR IRENE SISKA HELDA SUSANTI ZAHARA M. NUR IKHSAN SITI MASYITAH PRAMANA HILAL AL FAJRI MHD. PERMANA HAIKAL TRY SYAFIQA RAMADHANI T. DARMA HENDRA SARIFAH MARIAM TENGKU CANTIKA PUTRI TENGKU SAID ANDIKA M. SYARIFAH SARI BANUN T. ANDRIAN WIJAYA MUHAMMAD RAZKI TENGKU DARMA HENDRA MARLIS WAN EVA JUNITA RODIYATUL FITRIA ANNISA LUTHPIAH ZULKHAIRI ADI SYAHPUTRA NATASYA AULIA T. ABU BAKAR EVRI EMILIA T. SAID HADY KURNIAWAN WAN ROJIAH TENGKU ZULKIFLI SYARIFAH FATIMAH SAID MUHAMMAD ISMETH SYARIFAH SYUHADA SYARIFAH SYAHIDA SAID WARID IRFAN WAN NAZARUDDIN SUSILAWATI WAN AISYAH PURNAMA P. WAN JUNITA LESTARI WAN FAUZAN AL ROSYID M. RIDWAN SULASTRI MUALIM MUDIN NUR HALIMAH NUR AINUN NURLAILA CALLISTA ASHRI ZULLYANA DESI LESTARI HENRIHUL ANITA NVIALIE MARCELIA VANIA MARCELINA WAN ZAIYUN WAN NAJMI DESI LESTARI WAN ZALINA WAN SYAFARUDIN SYAFRIANDI.SJ JUNAINA VEBBYANA NURHALISYA VRENDY DWI RIANDANDA VREENA TRIANANDA H. RAMLI SUMARNI HARITS PRANATA M. RAFI HALIJAH ANDI MUHAMMAD RIZKY DAENG MAGATTA MAIRIZAL NELWARTI REDHO PRIADINATA REZA RAHMADANI RIYAN PRIADINATA RAFHA PRIADINATA WAN MARIAM WAN SYARIFUDDIN WAN AMIRUDDIN WAN MARYAM WAN SYAHRIAL WAN SYAFRI WAN AHMAD RIZAL WAN MUHAMMAD YUSUF SOPYAN WAN FADILLAH SUSANTI MARWAN SURGANDA M. HAICHAL SOPYAN USNATUN SALWA RAHMAT FHATIR LAIL WAN ARISA OKTA SILVIANI HASAN BASRI KURNIAWATI ABDULLAH AL HAASSYIR ABDURRAHMAN QOYYIM A. SHAFFYAH HUMAIROH F. RAHIMAH HAJJAR SITI KHODIJAH M. RIDHO AL QAZALI K. SALWA DHAWIYAH SYAFIQAH SAIFULLAH AKMALIA WAH ZURA ADELIA SHERIN NABILLA DWI M. AHYAN NABAWI BUKHAIRIL MUSTAQIN. S GHADA KHAIRUN NAJA IRWAN FATMA SYLVIANA FATHIR FI’LA HAFIYYANI TRI MAHARANI CHAIRREIHAN NISA ALYA AL KAUTSAR M. AZWAN IBRAHIM JULIANA ABDUL RAHMAN MUHAMAD SABRI WAN ROSNANI MAWADDAH MUHAJJIR ROMAS IMAM WARDAN WAN ABDURRHMAN/RT WAN YUSNIDAR AWAN M. HAKIM SYAFRIZAL HENDRI WAN EVI FITRIANTI ZULFIKAR ADITIA K. ADINDA QURATUL AINI RIFAI’I SITI FATILAH SYIFAA AZ ZAHRAWAANI ANDRIAN ESTRADA EMELIA NABILA EMIRA WAN ARIFIN/RT RASWATI WAN ARIF MAULANA WAN RAFLY RAMADANI WAN VITA ANANDA ZUL FAHMI TIA AVIANTI NAILA ALIFAH AMMIS HAMSI YENITRA SAPRIZAL AFRILENI EGI AFRIANDI TASYA KHOIRI ABDUL GAHUR DIVA RAMADANI DUTA PRASETYO EDI RAHMAN IMELDA LUKMAN HAKIM ALLIF AMZORI AZREL MELDIANSYAH WATI KAIRUL NISSAK SAHROL KIRAM ABDUL AZIZ HASPUL MIZAN ENDANG SURIATI ARIFIN FITRA DEWI NADIA FAZIRA ZAKI AL ABSHY M. NOER NORDIN EFENDI ONI PAIZAH MUHAMMAD RIZKI RANI LUVITA MUHAMMAD ARRAZI ROMA YANTI CHANDRA SAPUTRA ADE ILHAM PRATAMA ANWAR DEWI KHAIRUL ZULHAM EFENDI M. NATAR MOHD. HAZMI TAUFIK WIWIN KUNTARI HAZWIN MAHROH FAUZI FALAH MOHD BAKTI RAMADHAN HENDRI UPIK SAFRIADI MAYA SRI WIDAR SURYANTO SUPRIHATIN MUZDALIFAH NAYLA BALQIS

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 03 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5

NO 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948

NAMA

RT

WAN SYAIFUL ZULKARNAINI AMIRUDDIN WAN NORASMALAILI ERIKA SWANTO NORA NOOR MHD. NASIR ROZALI YENNITA NANDE SAPUTRA M. ILHAN ROZALI ASNAR RAMLI BACHTIAR MARWIYAH JULVIAN MERIANTI DESI WAHYUNI NUR HANIFA ZAHRA NUR NAZWA AMIRA CAHAYA MAHARANI ZULFAHMI TIA AVIANTI NAILA ALIFAH KAMARIAH SUBLI JULIAWATI MELINAWATI NOVIA YANTI M. YUSUF SYARIAH DEPI SUSANTI RATNA WILIS AGUSTIAN ANDRIZAL SABAN MAULANA ISKANDAR YUSMARNI FAUZIAH ALI AMRAN HASNAH MELDI ANDRIAN NURBAYA YUNIZAR PUTRI WISYA AZMI MUHAMMAD ZHAKI SARIFAH MUCHLIS. B SURYANI NOVRYANTO HADI JIBRA ROZA MUHAMMAD RAFI ROPAEI. A ELIYA WATI ASRUL LUBIS SOESANTY HAMZAH EVI YANI PUTRI SYAHRANI HAMZAH NABILA SHAFIRA HAMZAH M. RIFQIE ABDILLAH NURDIN HASNAH JUFRI/LPMK SUPRAPTI INDRIYANI FUAD AKBAR MUHAMMAD SYAWAL ARBANI SYAHPUTRA SAHRUL RAMADHAN SUCI RAMADHANI ASNAH RAMLAH AHMAD EDI RAHMAN IMELDA LUKMAN HAKIM ALLIF AMZORI AZREL MELDIANSHAH REFDAINUL SAMSIAH KAYLA NAIDA SARI ANUAR JUNIATI HARI HIDAYAT MELI RAMADANI IKMAL MAULANA M. IKHSAN WAN ARFAH DARMAWAN M. RISKI BERAMANTIO SJAFIAR CHAN AMMIS HAMSI YENITRA NORDIN EFENDI/LPMK ONI PAIZAH MUHAMMAD RIZKY RANILUVITA MUHAMMAD AR’RAZI ENDRY MUKHARRIZAL EKA SOSILA ZAZKA FARQAN PUTRA ANDIKA FATHUR RAHMAN SHELMA RAEFA ADORA DOEL SYAM/KADER WASINI ALI MUFIYANTO SITI ZULAIKHA RAMADHAN SALEH ERNAWATI WISLIN SALEH PILIANG WALDI SAPUTRA SONANG PANGIDOAN WULAN AZIZAH WAN ICHWAN MAS WAN FITRI YANI WAN USMAN WAN RIKSA ULANDARI WAN ILHAM WAN FAUZAN WAN NEJAWATI ZAINAB INDRA ASRY IDA RAMLAH AHMAD JANSEN EDI SUKAMTO WAN ROSITA MUHAMMAD NANANG. S MUHAMMAD VIRGANDA RINDU IKHLIMA SYAFRUDIN SUMARLIN WAN FAUZI NIKI RESKYA WAN M. FARESZA WAN M. FARIZQY. A WAN SITI ZULAIKHA ELFINA SUHARTI SYAFWAN HADI EVI DIANA SARI QISTY ASYAFVI PUTRI QIRANI ASYAFVI PUTRI SYAMSUL BAHRI HERFI LINDA MUHAMMAD ZULFIKAR SYAHFITRI RAHMADANI UJANG SAMSIAH MASNI ARFINUS WAN ROSITA ROBBY ARNOLD DIANA ROSALINA BACHTIAR EFENDI YULIANI WAHYU ILYASA PRATAMA RISKA KHAIRUNNISA RAYSHA SALSABILA IKHTIAR RAHMAT RIZOL ERMANITA SISCA RAHMA SHINTA RAHMANDA SAPUTRA ABDULLAH RAFLI ANTONI ASMITA LIA KHOLIJAH IRFAN FIRDAUS ALDO PRASYTIO RESTARIA MUHAMMAD JEFRI LISTIANI DIKI PORLIANDI PRITA LAURA ERIYANTO FARIDA WALDI KUSUMA ALAN KUSUMA SATRIAWAN ABD. RASYID WIDIYAWATI ILHAM AKBAR BAHARUDDIN YUSUF ZULKIFLI. R NURAINI NUR AFIFAH ALFINA SYAFRIZAL SUNARTI SITI SUBAIDA MUHAMMAD RAMADHAN RIDUAN YUS NENENG AHMAD IQBAL AHMAD FADLI ABDUL RAZAK NURIZAH RINA ASTUTI KURNIA SABIRIN NURIANI DEDY AFRIANTO MUHAMMAD JUNAIDI ABEN ANA HONGIYEM ZOHRAH JONNIFER/RT ROSITA SITI SRI WAHYUNI M. RISKI RAMADHAN M. ADE SAPUTRA MUHAMMAD ZULFAHMI SYAFRIZAL JASMAIDA WENNY SAFITRI ICHA INDRIYANI RENDI AFRIZAL AFDAL WAL INSAN FEBRIYANI ZULVIANTI ISKANDAR AFRIDA WISMADANI FEBRI ALGI SAHPUTRA AQMAL ARDIANSYAH IJON TIWI AMRI YANTO SRI BANUN AKMAL ADRI FAUZAN NABILA FAHIRA JOHANES YUSNI MHD. ALIMIN HASIAH YUNI FITRI YANI SAFITRI M. NURSAID YANTI LILY HANDAYANI FAJAR RAHADI M. ADITYA SYABAN ZAINUDDIN MARYANI SHANTI RUSTANA DEWI SHINTA FIFI FITRIANTI SYAFRI RINALDI MERZA MEFLIZA NELIZIA

5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6

WAN SARI BANI NUR AFNI PERMATA HATI M. ARAFAT NURWATI NOREEN AFNIKA MUHAMMAD ROMADHAN MUHAMMAD FADIL M. PUTRA WAHYUDI NABILLAH FATMAWATI KAMAR ZALI MARDIANA AGUS TRIANSYAH ZULFAHMI KELANA SUKMA REZA ADITYA PRATAMA MAYOSA AKHIRA RINALTHA TASLIFAH LOUDRY MARTA ZAMRI SYAPUTRA DASRIL MIRANTI MOHAMMAD RIZKI MASRIL MUSITA ITRAWATI HARIADI MASTA NILAWATI SISKA SYAMSU MARI ERNAWATI ZULKIFLI SAMSUL BAHRI SRI NIRWANA NIRWANSYAH SALWA DASMAN ARTATI AKHIYAR RAJALI HANIF JAUHARI SIDIK SUMI KHODIJAH JAMAL AHMAD MAHES SRIYANI FADLAN AHMAD MISWATI ADRIANSYAH RIDHO SYAHPUTRA M. JASAR TUTI ADEK OKTAVIANI NOVIARMAN FREDY DOUGLAS PARDEDE MARZIANA LOLYTA NATASHA GRISELLA P. S.M. PASARIBU RAHMAD MARLINDA WATI ALAN SASSRAREZA. B RISKA APRIANI MAULANA ARDIANSYAH ZAINAH AUZAR ZIKRUL ROSMAIDAR FITRI RAHMADANI RIDHO ISKANDAR AYANG ASIAH ANDRIA JAAFAR SUKMAWATI JAMALUDIN MUHAMMAD SYA’BAN PAINO ANIM PARIDA SUPARDIANTO OKTA VENDRA SAFARINA ALIF FIRDAUS HAIKAL SEPTIAWAN RAZIL MUZAKY RASIDIK NURHAYATI KAMARUDDIN ARWIN FENNY FLORENCE FARRAH DILLA WAN FIQQI ANDIKA PUTRA M. ALKAF YUSNAWATY MUHAMMAD RAY FAIZAL MUHAMMAD FIKRI M. NURUL HUDA M. AL QODRY IKHSAN TAJUDIN BURIAH NURHAYATI SULUNG SURIATI RIDWAN PASURINA RIZAL PASURINA RISMA WATI HENDY AZIDA SIDHARTY DYNDA RIESTA OKTAVIANI PUTRI OKTA PRAMADAHANI KARISSA ANGGRAENI DAHLIA DAHLAN TUKIAH SURATI M. AMIN SALMIATI M. NASIR RONILAWATI NAZWA ASYIFA ROSLI. MT ZULKIFLI

7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7

NO

NAMA

RT

7 949 SUSI SOFIANTI 7 950 NAUFAL ZAHAIR 7 951 ALIUMAR 7 952 NURAINA 7 953 APRIZAL 7 954 WENDRI 7 955 TONI CHANDRA 7 956 AYAHRIL 7 957 RIYANTI 7 958 ISMA BUDIANTO 7 959 MUHAMMAD ARIE EFENDI 7 960 RIFNAL HAMDANI 7 961 RIDHA NURSYAFUTRI 7 962 SURATI 7 963 M. HASBII/LPMK 7 964 INDRIYANI 7 965 A.SUGIANTO/RT 7 966 RATNAWATI 7 967 LILY JULIANINGSIH 7 968 HERRY PURWANTO 08 969 PARIANTO ARDO 970 POPY RYANI 08 971 NENGSIH AFRIANI A. 08 08 972 RAMADHAN SALEH 973 ERINAWATI 08 974 WISLIN SALEH PILIANG 08 975 WALDI SAPUTRA 08 976 SONANG PANGIDOAN 08 977 WULAN AZIZAH 08 08 978 SYAIFUL 979 MARIAH 08 980 YULI MARISA 08 981 RANDI ANDIKA 08 982 RIMA DESTI 08 983 NURHAYATI 08 08 984 NURMALIS 985 WAN LIZA NOVIANTI 08 986 WAN DANI GALANG A. 08 987 WAN SUM 08 08 988 KAMALUDDIN 989 SITI MARIAM 08 990 RAJA EKA 08 991 RAJA KAMARULLAH 08 992 RAJA RAFA 08 993 NURIAH 08 994 AMIRIN 08 995 FATIMAH M 08 996 AMIRUL RAMADHANU 08 997 MUHAMMAD FHAHMI 08 998 AMELIA FEBRIAN 08 999 FATIHA SYAFITRI 08 1000 TOLU 08 1001 SARIMAN WIJAYA 08 1002 JUMIYEM 08 1003 ERWIN 08 1004 SRI SUSANTI 08 08 1005 DETRIANTO 1006 SUPARTINI 08 1007 IKUN PURWANTO C. 08 08 1008 BUDIANTO 1009 NURAIDA 08 1010 DHITA ANDARA 08 1011 M. GALANG PRATAMA 08 1012 M. RIZKY RAYFAN 08 08 1013 NURHAYATI 1014 ARDILLA 08 1015 SYAFRIZAL 08 08 1016 MISNUR MALADEFI 1017 CANDRA RUSMI YULIANTO 08 1018 HENDRI 08 08 1019 RAUDAH 1020 OBIT PRANATA 08 1021 ANDUM PRANATA 08 1022 DINDA DINATA 08 08 1023 KAMARUDDIN 1024 ERNAWATI 08 1025 NITA ARISA 08 08 1026 MUHAMMAD SYARIF 1027 SUSILAWATI 08 1028 SASA FEBRIANI 08 1029 SYAKILLA INDRIYANI 08 08 1030 ALIBASYAH 1031 KHADIJAH 08 1032 MUHAMMAD ABBAS 08 1033 SYAFRIDA 08 08 1034 SURATNO 1035 ERNAWATI 08 1036 RANDANA PUTRA 08 1037 ANGGA PRIHATORO 08 1038 DANU BAGASKORO 08 1039 SUNAR ADE KANTARI 08 08 1040 SYAMSUDDIN 1041 NURYATI 08 1042 JERI AZZUMAR 08 1043 NOVIA ZAZILAH 08 1044 IKHSAN MUAMMAR C. 08 1045 SYOFYAN AHMAD HARBO 08 1046 SULTANAH 08 1047 DEWI ANDRIANI 08 1048 FATIMAH TUZAHARO 08 1049 AISYAH 08 1050 MASYITHAH 08 1051 MAISARAH .S 08 08 1052 BAYU KURNIAWAN 1053 SRI RAHAYU 08 1054 DIMAS FEBRIAN 08 1055 RAHMAT KURNIAWAN 08 1056 FADLAN SULAIMAN 08 1057 ADLIN 08 1058 YULIANA 08 1059 PUTRI AYU 08 1060 M.ARIF 08 1061 YIMMI FRIEDDY SIKUMBANG 08 1062 ARMA NELI 08 1063 M.NANDA DETAMA PUTRA 08 1064 M. RANDI ARMAN 08 1065 MUHAMAD FIRDAUS 08 1066 KETEH 08 1067 SUSANTI 08 1068 SUNARTI 08 1069 SULILIK 08 1070 JURIANTI 08 1071 JULIANTO 08 1072 RAHMAH 08 1073 AGUS SALIM 08 1074 CANDRA MEAIZA 08 1075 BACHTIAR AS 08 1076 HINDUN 08 1077 FAKHTIM SAIYAT 08 1078 SUPIYANTO 08 1079 ZURAIDA 08 1080 RIZKI SARTIKA KARIZ 08 1081 RIKA GUSTIARA KARIZ 08 1082 IQBAL NURULLAH KARIZ 08 1083 HASNA NABILA KARIZ 08 1084 RUKIAH 08 08 1085 ASUI 1086 YATI 08 1087 APIN 08 1088 YANSEN 08 1089 TRISYANTO 08 1090 AMELIA 08 1091 KIANG KIONG 08 1092 SAFI I 08 1093 FAUZIAH 08 08 1094 FIRDI SYAHPUTRA 08 1095 SURIADI 08 1096 M. BUDIMAN 08 1097 M. FAJAR SIDDIQ 08 1098 FIRMAN S 1099 AINUN MARDIAH 08 1100 MUHAMMAD WALI S 08 1101 MUHAMMAD SALEH S 08 1102 PARDAMAIAN SITOMPUL 08 1103 SUSANTO SITOMPUL 08 1104 HUSNA ZAHRA 08 1105 RAHMAD 08 1106 RAHMAH 08 1107 NELI JUNITA 08 1108 ABDUL RAUP 08 1109 PARIDA WANI 08 1110 ALDI SUKMA 08 1111 ADHA IKTA DINATA 08 1112 NAURA AFIQAH 08 1113 RUDI ARIANTO 08 1114 ACEP GANDAMANA 08 1115 IRDA WATI 08 1116 SARTIKA 08 1117 NINGRUM SARTINI 08 1118 PUTRA DJAYA KUSUMA 08 1119 UTRIYANA 08 1120 M. ROBBY 08 1121 NILA RAHMADANI 08 1122 ABDULLAH 08 1123 NURLELA 08 1124 MUSLIM 08 1125 ARMAN HADI 08 1126 AFNI SUSANTI 08 1127 ISMI AQILA 08 1128 AHMAD RIVALDI 08 1129 AHMAD YANI YUNUS 08 1130 ZAIDAH 08 08 1131 NOVRIZA 08 1132 M. FAIZAL AMIRULLAH 08 1133 M. ZAKI MAULANA 08 1134 M. IKHSAN 08 1135 ALFAIANTO 08 1136 LATIFAH 08 1137 ANISA MARDIANAN 08 1138 ASRUL SANI 08 1139 ARIA NANDA PRATAMA 08 1140 SITI ROHANA 08 1141 RIKA ARSULA PANJAITAN 08 1142 MHD. INDRA GUNAWAN 08 1143 ASMUAN 08 1144 HARNO SUSILO 08 1145 YENITA.A.R 08 1146 RUKIAH 08 1147 MUSNITA 08 1148 SHINTA INDRA YANI 08 1149 THESA OKTAVIANI 08 1150 NURHAYANI 08 1151 ARDILLA 08 1152 SYAFRIZAL 08 1153 MUDIAH 08 1154 ERLINAWATI 08 1155 YUNARSI.M 08 1156 MUHAMMAD TAUAH 08 1157 WIDI WIDAYAT 08 1158 SOFNI.D 08 1159 MUDARNI 08 1160 DARANA 08 1161 HINDUN 08 1162 MUHAMMAD EFFENDI 08 1163 YUNIDAR. D 08 1164 FIKARNELIS 08 1165 YUNITA.A.R 08 1166 SUHARNO 08 1167 WINDA SARI NINGSIH 08 1168 MUHAMMAD ANIS 08 1169 ERWIN SETIAWAN 08 1170 NURUL ULFA 08 1171 RIDUAN YUS 08 1172 NENENG 08 1173 AHMAD IQBAL 08 1174 AHMAD FADLI 08 1175 MUNDIAH 08 1176 THESA OKTAVIANI 08 1177 ISMAIL BANGUN 08 1178 SUKA HATI BR. GINTING 08 1179 AHMAD NIZAR BANGUN 1180 DWI TAQIYAH ZALFA BANGUN 08 08 1181 ASRIL DINGA BANGUN 08 1182 SAHDI PERANG N ANGIN 08 1183 BAMBANG HERMANTO S 08 1184 ROSMIANI 1185 PUTRA ANANDA PRATAMA 08 08 1186 M. GILANG MARDIANTO 08 1187 CAHAYA PERMATA 08 1188 T. RAHMAT 08 1189 JUMILAH 08 1190 TENGKU ANISA ADELIA 1191 TENGKU MUHAMMAD ISNALDI08 1192 NUR MUHAMMAD FADHLY 08 08 1193 SALMIATI 08 1194 ABDUL MALIK HADI 08 1195 ABDUL ALI HAZIQ 08 1196 SAID ISMAIL 08 1197 T. RAHMAH 08 1198 SYARIFAH ISMARANI 08 1199 SAID ZUL ARIFIN 08 1200 FAJRI 08 1201 NURMALA 08 1202 EKA SULISTIANA PUTRI 08 1203 FIRA AGUSTINA 08 1204 SYAHBANDI 08 1205 YUHARTI 08 1206 YUNISYA SY 08 1207 SYWITHA ANGGREANI SY 08 1208 M. ALFIEN BRIANYSAH SY 08 1209 ENCIK ANDREANSYAH SY 08 1210 PUAN FISTHAWANSYA SY 08 1211 DUDI JUNAIDI 08 1212 ELVIVIDRA 08 1213 TACHA SAPUTRI 1214 AGUNG RANGGA SUPRANA 08 08 1215 DINDA PUJA APRILIA 08 1216 RAMLAN MUSTAFA 08 1217 HASMATI 08 1218 NUR AFGITA WATI 08 1219 RIDO HANAFI 08 1220 WAHYU BUDIAWAN 08 1221 DINA AFRIANA 1222 NABIL MUHAMMAD SYAFIQ 08 08 1223 FAKHRULLAH AZHARI R. 9 1224 DENI SURKANI 1225 ROSDIANA 9 1226 APRILLA MAULANA 9 1227 ALVIRIZI MAULANA 9 1228 RIZKI PRAYOGA 9 1229 ERIYANTO 9 1230 ERNAWATI 9 1231 SITI SAKINA 9 1232 NURUL FARAH 9 1233 SOFHI SALSABILA 9 1234 SYAFIQ FATUR RAHMAN 9 1235 SYAQIB AL FAHRIZI 9 1236 MAISALMAH 9 1237 ZULKIFLI 9 1238 JULIAMAR 9 1239 DESI YULIANTI 9 1240 SENI NOVALIZA 9 1241 SYAFRIANTO 9 1242 SYARIFAH 9 1243 MIA ABRINA 9 1244 DIAN NUR HASANAH 9 1245 SAFRIDA NADIA 9 1246 DASRIL 9 1247 ERNAWATI 9 1248 HARI ANANDA. D 9 1249 ARI SAPUTRA 9 1250 FAUZAN AFAN 9 1251 M. ARIF AKRAM 9 1252 MASFAR 9 1253 ROSNI 9 1254 RAHMAD DURIMA 9 1255 FITO CHANDRA 9 1256 FEGYAL CHANDRA 9 1257 HARIZAL 9 1258 ASIAH 9 1259 JULIA ASTANTI 9 1260 LATIFFA ANISHA 9 1261 AMRI YANI 9 1262 SRI SUNDARI 9 1263 IMAM DESRIYANTO 9 1264 SERINA ANGGRAINI 9 1265 ANISA 9 1266 ZULKIFLI 9 1267 INTAN SUPIAH 9 1268 DEWI KARTIKA 9 1269 ANDINI 9 1270 NANDA RIZKI 9 1271 SABARIAH 9 1272 ISKANDAR 9 1273 YANI WARTI 9 1274 RIAN DANI 9 1275 NURIANA 9 1276 IRFAN SYAH 9 1277 INDAH FARWANA 9 1278 ZAILIS 9 1279 GUNTUR PUTRA 9 1280 ARFAN SYAH 9 1281 ELVI MARZILAWATI 9 1282 SYAFRIL 9 1283 ELIARNON 9 1284 IMAMUL KHAIR 9 9 1285 SUCI RAHMADHANI 9 1286 ZULFA HENDRA 9 1287 ABDUL AZIZ 9 1288 NABIL MAULANA 9 1289 HABIBAH 9 1290 SYAFARUDDIN 9 1291 ALI AKBAR 9 1292 NURBAITI 9 1293 SAMSIDAR YASIN 9 1294 ROSMANIDAR 9 1295 YOGIE PRATAMA PUTRA 9 1296 ALDITO PINUSSADEWA 9 1297 SYAIFUL BAHRI 9 1298 IRLINA 9 1299 JONI SAPUTRA 9 1300 HARIF HANAFI 9 1301 TRISNO 9 1302 NURHAYADI 9 1303 RAMLAH HAMID 9 1304 MARIATI 9 1305 SOFYAN SYAHRONI 9 1306 RIRIN SHINTA SARI 9 1307 HENNY PUSPITA SARI 9 1308 DINNI MALA SARI 9 1309 SYAFRI 9 1310 UPIT MISRAWATI 9 1311 SELVIANA AISYAH PUTRI 9 1312 RANGGA SYAHPUTRA 9 1313 VICTOR CHARLY SIRAIT

NO

NAMA

RT

1314 POLIDE SITUMEANG 1315 ELISMAN SIRAIT 1316 SRI BANUN 1317 HARI BUANSYAH PUTRA 1318 DINI ARDIANTI 1319 RUSLI NOER 1320 SITI MAHARANI 1321 PUTRA MAULANA 1322 WAHYUDI 1323 FITRI WULANDARI 1324 INDAH RAHMADANI 1325 ZULKIFLI 1326 JASTIN KRISTIANY 1327 SARAH ZULVIANTY 1328 DUWI ANDINY 1329 NATJUA AZURA 1330 GALANG ADITIA P. 1331 KAMIS 1332 YUSMANIAR 1333 HARI RAYANA PUTRI 1334 HARI RAYANI PUTRI 1335 YEYEN NADRA 1336 AZURA 1337 IDHAM 1338 SITI MUSRIFAH 1339 SITI HAMIDAR 1340 SITI WIRDUNA 1341 MUHAMMAD SURBANI 1342 MUHAMMAD ULUL AZMI 1343 WAN SAMSIDAR 1344 DEVITA DINATA 1345 DIDIT EDDY SASMITO 1346 ASNITA 1347 ADITYAS PRATAMA 1348 DIVA DWI SAPUTRA 1349 REKHA NURHAM IDAH P. 1350 HAPSARI YOGA SASMITA 1351 BAYU KURNIAWAN 1352 SRI RAHAYU 1353 DIMAS FEBRIAN 1354 RAHMAT KURNIAWAN 1355 ATRI RASUL 1356 INDAH JUNIARTI 1357 WULAN NOVIA FITRI 1358 WINNY NANDA PRATIWI 1359 INDRA 1360 ELVI 1361 DANANG 1362 DESTY AMBASARI 1363 GILANG PRABUANARGHI 1364 MALIN D 1365 ASNIDA 1366 AL MUAZIM 1367 ALKA CHANDRA 1368 LIVI MARLINDA 1369 TRIA OKTAFIANI MARLINDA 1370 REANDA 1371 ABDULLAH 1372 PENI SUSILAWATI 1373 SYAIRRANI 1374 M. RASYID HALIM 1375 RIZAWATI 1376 RITA FITRIANA 1377 SILVIA AGUSTINA 1378 ALI UMAR 1379 YULIDA 1380 GOPAL 1381 MUHAMMAD RAPHI 1382 ALI AMRI 1383 MURNI 1384 FITRIA HANDAYANI 1385 RIVAL RINALDO 1386 GALANG ALFARIZI 1387 ILYAS 1388 YULIANI 1389 WAN AHMAD THAMRIN 1390 NUNUNG INDRIYANI 1391 WAN CHINTYA PUTRI 1392 MAHMUD ETEK 1393 MISWARTI 1394 YOSIDA ANGGRAINI 1395 DEWI IRIANI 1396 HALIMAH 1397 WAN RISKYA ADYA MECCA 1398 DAHNIAR 1399 DESI ANDRIANI 1400 DEDI SUHARTONO 1401 PUTRI OKTAVIANI 1402 MUHAMMAD HASMED 1403 YANTI 1404 MAYA CAREEN WIGUNA I. 1405 HERMANTO 1406 YESI NOFRIANTI 1407 M. FAJRI HIDAYAT 1408 ASYIFA YULIASARI 1409 AL BIZAR 1410 ERIZA 1411 TISNA WITA 1412 HALRIZAL 1413 ALMANAR 1414 YURNALIZA 1415 ADE PERDANA PUTRA 1416 MURNIYANTI 1417 BUNGA PUTRI ANDINI 1418 M. BRYAN PAMUNGKAS 1419 AKMAL AL GHAZALI YUSUF 1420 MASRIN HASIBUAN 1421 YASKUR 1422 SYAFRUDDIN 1423 ARIS 1424 AMI KALSUM 1425 ADE INDRIARTO 1426 KIKI SURYA DINATA 1427 DECKY AFPRIAN 1428 NATASYA INDRIAYANI 1429 ANANDA TRI HANDIKA 1430 BUCHARI HASAN 1431 SUARNI UMAR 1432 BURHANUDDIN 1433 T. SAIYIDAH 1434 MAULANA IKHSAN 1435 M. NASIR LUBIS/RT 1436 ERNAWATI 1437 CHAIRUL SALEH 1438 ALI RIDWAN 1439 ARFAN ARIADI 1440 AUZAR N 1441 MAHZINAR 1442 DARMAWAN SYAH 1443 FAISAL 1444 IRWAN SUSANTO 1445 RIMA NINGSIH 1446 AUREL ADHA 1447 DIARARA ZADORA R. 1448 SYAFRI 1449 ADE HALIMAH TUSAQDIAH 1450 DEFIRA MAYSHELLA 1451 DIFIA TIARA IFANI 1452 DIFA METRIA YUNITA 1453 DEFRI RAMADHAN 1454 NURAINI 1455 KHAIRUL AMRI 1456 SYAFRIJAL 1457 YUDI SYAHPUTRA 1458 YUNI LESTARI 1459 HANS JOKO SIMAMORA 1460 DEWI RAHMAYANI 1461 M. FAUZAN SIMAMORA 1462 AMNA ARIRIA SIMAMORA 1463 HASAN BASRI 1464 YENNI HERLINA 1465 MUHAMMAD RAYHAN 1466 NATASHA PEBRIA SUSANTI 1467 MUHAMMAD RIVALDO 1468 SULBIYANTO 1469 EMELIA 1470 M. RAJIV FACHREZY 1471 INDAH KHAIRANI 1472 ANNISA FITRI 1473 FERI FADLI 1474 SUSANTI 1475 DIKI SAHPUTRA 1476 ANDRE ALFIANSYAH 1477 MUHAMMAD FADIL 1478 KASMADI 1479 SASLIANTI 1480 BELLA SASKIA PUTRI 1481 KEYLA SASMITA PUTRI 1482 HAIRUL TANJUNG 1483 ROSIMA ARITONANG 1484 MARINA ARFA OKTAVIA 1485 HANIS PELDA 1486 HAN’S PELRI 1487 HATETA HAIRO 1488 ARISWAN 1489 ZABUARNI 1490 KURNIA SASMITA 1491 M. HAFIZH ALHAADI 1492 BUJANG 1493 PUTRI RENI 1494 NILA PERMATA SARI 1495 VIVI SAFITRI 1496 MELISA ANGGRAINI 1497 ALVIRA PUTRI 1498 ARIF SUWANDI 1499 WILMAN EFENDI 1500 RIZAWATI 1501 ICHA CAHYATI 1502 RAYHAN RINALDI 1503 JUNAIDI 1504 ISNA MERRY 1505 RAFLI TIADI 1506 MUHAMMAD RENDI 1507 RIYAN RAMADHAN 1508 MUHAMMAD RISKI 1509 HENDRI APRIZAL 1510 ENNY 1511 NUR OKTAFIARI 1512 WAN VIONI SHAHPUTRI 1513 SAFPARIZAL 1514 WAN SASTRA WANTO 1515 NURMINA 1516 RAMLI 1517 NURMAWATI 1518 SRI WAHYUNI 1519 YETTI MUSTIKA 1520 SITI FATIMAH 1521 MISRIZAL 1522 HAFITPUDIN 1523 MULYANIS 1524 BUNGA MEILANI PUTRI 1525 LESTARI DWI PUTRI 1526 NOVAL TRI EKA PUTRA 1527 AHMAD YANI. N 1528 SALINA 1529 MUHAMMAD ARIF 1530 VERINA SOFIANI 1531 TRI SUGANDI 1532 ARMIATI 1533 CHENY AZURA 1534 JAMILAH 1535 KHAIRI YANI 1536 HAMDAN 1537 JUNAINA. A 1538 NATASYA ADMADANI 1539 FATIR BAYHAQI 1540 PONIDI 1541 ERA SAPUTRI 1542 SILVIA OKTAVIANI 1543 NURMA HARIANI 1544 SAPRI 1545 SITI KHOTIJAH 1546 MUHAMMAD RAVI 1547 SITI RASHIMA 1548 PRIJA RANI 1549 MUHAMMAD ALI AKBAR 1550 MAIYAR 1551 SAMSUARDI 1552 SAFRIZAL 1553 ANDRI HERLANTINO 1554 VANISA QORINASARI 1555 RIO ANDIKA 1556 IVAN MAHMUD 1557 RENI SUSANTI 1558 VIVIANA VANNY 1559 SHIFA MEIDI VANNY 1560 ZAHRA SUCI RAMADHANI 1561 ZAHIRUDDIN 1562 ASMANIAR 1563 ZIFRI GANI 1564 M. FAISAL AKBAR 1565 RAHMA RATU SOLEHA 1566 JUNAIDI 1567 AMINAH 1568 CICI FITRI OKTOVIANI 1569 FERDI PUTRA WAHYUDI 1570 SATRIA PUTRA ARDIANDI 1571 GILANG RIZKY AFRIADI 1572 DARWIN MD 1573 JAMILAH 1574 JANU SAPUTRA 1575 NATA SATRIA 1576 MAULIDA WATY 1577 DESPERNANDO 1578 NITA SOLFIA SARI 1579 ARPIS 1580 MARDALENA 1581 FITRI FEBRIANI 1582 RAFLI DWI JUMADIL 1583 RAINA 1584 ROHANA 1585 ISWANDI 1586 RITA FITRIA 1587 HAKIM AGUNG LAKSAMANA 1588 SRI INDAH PERMATA SARI 1589 MAHARANI MEGA MUSTIKA 1590 JEN HENDRA 1591 ANTO SOFYAN 1592 LAILA HAYATI 1593 ARI RAHMADHIKA 1594 NAYLA FADILLA PUTRI 1595 SYAFRUDIN 1596 LASMINAR 1597 RINA FITRI 1598 M. ZULKIFLI 1599 TAJUDDIN NASUTION 1600 MARYATI 1601 RESTU ADELLINA 1602 DEFRRI YANDI 1603 ARI SUHARDI 1604 RISEM 1605 RISNA JUNPAIWAL 1606 HERLIYAN SYAH 1607 SUMIATI 1608 M. AREF ZULFIKRIANSYAH 1609 SHAKILA AZ ZAHRA 1610 RIAN ERLANGGA 1611 NURSIAH 1612 SUHARJOKO 1613 HARYANI 1614 FIKRI ULFAYRAH 1615 WIRA DWI HARDI KUSUMA 1616 ROKIAH 1617 M. BADRUL HISYAM 1618 SYAFRI CARDO 1619 NELIA IRAWATI 1620 RIFALDO HADI PUTRA 1621 SYAMSUR 1622 SUMINI 1623 KISMAN 1624 DEWI SARTIKA 1625 DEWITA 1626 TRIA VIKI 1627 M. HUSNI 1628 UMAR. N 1629 ASNAH. K 1630 M. RIZKI FADILLAH 1631 BASRI 1632 DARMAWATI 1633 BANY EKA DHARMA 1634 WAHYU NARULLAH 1635 BUDI SULYANTO 1636 YETTI FAUZI 1637 NUR SAFIRA OKTAVINI 1638 FIRMAN 1639 MINAWAROH 1640 ERICA/LPMK 1641 EKA FFERONIKA 1642 FAZILA 1643 NUR ANNISA MARWAH 1644 ROZANA SAZURIKA 1645 SYAMSUL KAMAR/RT 1646 YUSSANA 1647 HALIMAH/ KADER 1648 WAN RISKYA ADYA MECCA 1649 IDAWATI 1650 MUHALIS 1651 ERNATI 1652 SYAMSUL 1653 DIANA NASUTION 1654 AFRIZAL 1655 ELVA NOVIA 1656 MELLY NORIANI 1657 CHINDY NOFRIA 1658 ALDY PRATAMA 1659 SYALSYA BILA 1660 M. ALQORY BOLQIAH 1661 KAFKA NAFISA 1662 SYAIFUL AMRI 1663 ARINA YANTI 1664 NADEEM FATIH AMRI 1665 KAMILLUDIN 1666 SUSI SUSANTI 1667 RIZAL GUSRIADI 1668 BIMA KRISALDI 1669 TIARA ANGGRA YANI KASIH 1670 RIDWAN 1671 FATIMAH 1672 ADINDA NURFAIZIN 1673 M. REVAND LUTVI 1674 ASMUI 1675 JAMAIYAH 1676 HASRIMA NOVARIZA 1677 NOVIAN AIDIL 1678 TENGKU ZALEK 1679 NURHALIMAH 1680 SYARIFAH ANNISA AULIA 1681 SAYED HUSAINI MUBARAK 1682 SYARIFAH BALKIS 1683 UMAR

9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11

NO

NAMA

RT

1684 ZAIDATUL AKMAL 1685 T.SAFUAN 1686 T.SAHENDRA PUTRA 1687 T.SAID KURNIAWAN 1688 SYARIFAH RODIAH 1689 SARIYONO 1690 RINI ADNAN 1691 M. DIMAS ARDIAN 1692 MAULANA MALIK IBRAHIM 1693 YANTO 1694 MARIYATI 1695 SHAFA ATIKAH FIRZANAH 1696 LUTFIR RAHMAN R. 1697 DESTI PUTRI SAHIRAH 1698 ABDUL JALIL 1699 NURHAYATI 1700 DIANA PUSPITA 1701 DEVI SAFITRI 1702 SUMIATI 1703 OKTAMI ALDI ANITA 1704 MUHAMMAD BAYU 1705 NILA SUKMA 1706 RIKI MAHENDRA 1707 DEDI ISKANDAR 1708 DINO KARNEDI 1709 NUR AFNI 1710 DARIUS NUR 1711 ISNAWATI 1712 ANGGI HARIANCE 1713 TENGKU ISKANDARSYAH 1714 SYARIFAH DARLINA 1715 SAYED M. GIBRANSYAH 1716 SYARIFAH ASYIFA SYAHIRA 1717 ELFINA 1718 AZLINDA 1719 M. AZWAN 1720 SITI MARYAM 1721 EFENDI 1722 YUSMA 1723 HERNI YUSTIKA SARI 1724 SYAMSUAR 1725 RUSNANI 1726 SUYARTOMO 1727 ILFA NERSI 1728 SYARIFAH HAFSAH 1729 SAID VARIZA HAMID 1730 SAID VERIZA HAMID 1731 SAID APRIANSYAH PUTRA 1732 SYAIFUL AMIR 1733 ARINA YANTI 1734 NADEEM FATIH AMIR 1735 ZULHERY 1736 ELFINA 1737 AZLINDA 1738 M. AZWAN 1739 M. YUSUF 1740 M. RIDWAN 1741 FIRDAUS 1742 RAHMAD SALEH 1743 FIRMAN 1744 M. FAIZAL 1745 DARMANSYAH 1746 JAMAL 1747 SUPRIATIN 1748 ASYISYIFA JEAMISHA Z. 1749 DEVIANA RACHAMANI F. 1750 AURELIA AMANDA FAHILA 1751 ARIFIN 1752 NAZIRAWATI 1753 RINO HASBI 1754 RISKI RAHMA WATI 1755 M. ARIS 1756 MUHAMMAD ALWI 1757 LAMIRUN 1758 IIS SUMIATI 1759 RESY KUMALA SARI 1760 RENY PUSPITA SARI 1761 RIDHO RAMADANI 1762 R. ALEX ACHAMAD 1763 MARDIAH AINUN MARIKAN 1764 R. ALMA FERIANTO 1765 R. SRI WAHYUNINGSIH 1766 R. RIDHO ALDI A. 1767 NADRAH 1768 AZHARI 1769 HARIANTO 1770 NURJAYA 1771 M. RIVAI 1772 DAENG NABELO 1773 RIZALI 1774 NILAWATI 1775 FITRI HANDAYANI 1776 EDI CANDRA 1777 MARLIANA 1778 AZKA FAYYADH A. 1779 DIAN BUDIMAN 1780 LASINAM SULISTA 1781 BELLA VABIOLA S. 1782 DHANDI SETIAWAN S. 1783 DHEBI RAMAYANTI S. 1784 HAMDIKA SYAHREZA S. 1785 NENENGSIH 1786 SYAPUTRA ALAMSYAH 1787 JUHERMAN 1788 JUARSIH 1789 ARDI KESUMA 1790 KAILA PUSPITA 1791 TENGKU ARIFIN 1792 TENGKU FAUZIAH 1793 TENGKU ANDRE P. 1794 TENGKU SAYED A. 1795 JAMAL UNNIZAM 1796 KAMELIA 1797 MUHAMMAD METARAZI 1798 MUHAMMAD ZAKY 1799 SAID ADI RESTU 1800 T. NURLAILI 1801 SYARIFAH ATIYYAH 1802 TENGKU NOOR ALIYAH 1803 KHOIRI 1804 RUSMINI 1805 KORIAH 1806 NURHAYATI 1807 DEDE CANDRA WIJAYA 1808 ASRAH 1809 ABRALIUS 1810 ANDI SEPTIUS 1811 RIZKY ANANDA 1812 YUDI SETIAWAN PUTRA 1813 ZULKIFLI 1814 RIDAWATI 1815 JEFRI AGUS 1816 HIDAYAT 1817 AFRINALDI 1818 YUWANDA 1819 KHAIRIL 1820 SYAFRIATI 1821 NADIAH KHAIRATI 1822 RAFI RAMADHAN 1823 NOFIELDI 1824 BUDI WATI 1825 EGI KURNIA 1826 ALI IMRAN 1827 UPIK SARJANI 1828 RANGGA JUNAIDI 1829 RYAN SEPTIA WAHYUDI 1830 RIKO RAHMANDA 1831 RENDI PRAYOGA 1832 HARTO 1833 HENDRY CHANDRA 1834 HENDRA CANDRA 1835 LUKMAN BATU BARA 1836 UPIK AMAH LUBIS 1837 DESRIANI BATU BARA 1838 SALMA BATU BARA 1839 ERISMAN 1840 SUMARDIYENTI 1841 BENI BAUL RISMAN 1842 ROBI MARIATUL FADLI 1843 ARFIS 1844 ELMA 1845 RIKI ALPIANSYAH 1846 RIKA ELPIANA 1847 RANI YULIANA 1848 RAUNAS 1849 ZAHHARI AHZAR 1850 WAHYUNI 1851 ICHA PREASTARYNI R. 1852 RAKA IRHADI DWIE P. 1853 MUSLIHAH 1854 RELEN GUNAWARNI 1855 ALI IMRAN 1856 BASYARIAH 1857 YESI APRIANTI 1858 MERRY ANGGREANI 1859 BUDI YANTO 1860 SAFRI 1861 MARLINA 1862 FAZIRA AINI 1863 RYAN HIDAYAT 1864 RAISYAH HANUM 1865 AMRES 1866 ROMEO. A 1867 HENDRY 1868 MEI HOA 1869 RONY ABDIANTO 1870 SULHARDI 1871 RAHMAWATI ZULKIFLI 1872 AVIKA MAHARANI S. 1873 FAIZAL 1874 FITRI YENI 1875 ESA PUTRA 1876 SUPRIYANTO 1877 ROSNIWATI 1878 DWI OKTAMI SRINIGSIH 1879 WOJI SANTOSO 1880 WIDANTO GUNAWAN 1881 SUHARDI 1882 JULIANA 1883 BAMBANG WAHYUDI 1884 FITRA RAMANDA 1885 ARUM SUHARDINI 1886 ARMEN 1887 MULYANI 1888 YANI ARMEDA 1889 MUHAMMAD ARIF 1890 ZULHAM 1891 DESMIROZA 1892 ANDRAYAN ZULHAM 1893 DWI RAMADHANI 1894 FAJARIANTO ZULHAM 1895 JONI PUJAKESUMA 1896 DEWI ERFIUS 1897 ALI IMRAN 1898 MULYADI 1899 JULIAN DANI 1900 SERGEY BRIN 1901 ADEX 1902 NURUL RAHMAH 1903 JIHAN MASYITAH 1904 IMRAN MALIQ FADHILAH 1905 MUCHTAR 1906 MARTINIS 1907 JIMMI NOVRIZAL 1908 DESMALIA 1909 M. IQBAL KURNIAWAN 1910 M. DZAKY KURNIAWAN 1911 ERMAN 1912 ERIYANTI 1913 RAHMI MERA ANDRIA 1914 EGA WILIANDA 1915 AGUNG MAULANA 1916 SOFHINATUR NAJAH 1917 AHMAD FADILLAH 1918 YUSNIATI 1919 NOVIKA AFDILLAH 1920 NADIA AFDILLAH 1921 HARRY WAHYUDI 1922 ILHAM MUNANDAR 1923 ANISA ASIANI 1924 NASRUL 1925 RENI FITRI 1926 IZHAR SYAFAM 1927 FAUZAN HANIF 1928 HIDAYATUL HUSNA 1929 WAN YUSNI 1930 TINA 1931 UJANG USMAN 1932 WAN AYU ASRINA 1933 ASYIFA ZAHRA 1934 PRIYA HERU CAHYONO 1935 WAN ERZA 1936 WINNIE AMELIAN H. 1937 WINNA AMELIAN W. 1938 TRI TEGUH KURNIAWAN 1939 HALIMAH 1940 SUHAIMI 1941 SAPARUDIN 1942 JUNELDI 1943 ROSNIATI 1944 PAZMA REZA 1945 SUCI RAHMA RENI 1946 BASRI 1947 YUNITA 1948 JUMADIL ZUHRI 1949 ALI NURDIN AHMAD L. 1950 DAHLIANA LUBIS 1951 REDY PRATAMA LINTANG 1952 CHYNTIA NURFAHIRA 1953 ILYAS 1954 ROSMALENA 1955 LUSI RASMA FITRI 1956 YONGKI YUANDA PUTRA D. 1957 ASMET 1958 GUSNITA 1959 HENI ERLIANA 1960 NOVITA SARI 1961 MUHAMMAD RYAN FAHRY 1962 AMRIL 1963 YUSNIMAR 1964 VANESSA AMAYURA 1965 ALYA SYAHDA AMAYURA 1966 M. FADIL DZAKWAN 1967 SAWALI 1968 YOGI HARIAN NANDA 1969 ASUARNI 1970 SYAMSUARNIS 1971 JEFRI TANJUNG 1972 SYAHRUL HUSIN 1973 DARWARIS 1974 RIANI ZAHARANI 1975 RIO SAPUTRA 1976 JUMARDALENA 1977 M. RAFI AZHAR 1978 M. RAFA AZHAR 1979 M. RISKI SAPUTRA 1980 JASRI/KADER 1981 ALFI. CH 1982 REHAN WILDAN 1983 AR. SUTANTO TEGEL 1984 RINI SUDARTI 1985 ICA JULIA 1986 NAUFAL AQIL 1987 EDISON 1988 ROSNIMAR 1989 RIMA MARDANI 1990 RAHMAT AKBAR PUTRA 1991 ROSTINI 1992 ALIZAR 1993 RATINAH 1994 NASRIZAL 1995 ALEX 1996 LINA 1997 SESE ELPIN/KADER 1998 NELLY YANTI 1999 NITA ANISA 2000 NOVIA ULFA 2001 AULIA FATMA 2002 RIDO PUTRA EFENDI 2003 ELVIRA ROZA 2004 M. ZACKY MAULANA 2005 WAGIMIN 2006 ZULHADA 2007 RENI MULYAWATI 2008 SARI RACHMAWATI 2009 ROSNITA 2010 WELLY ANDRI 2011 ANDIKA WISTA 2012 TRI HARIYANTO 2013 PUTRI YANI. A 2014 IBNU HARDIMAN 2015 RATNA DEWI 2016 SILVIA FADILA 2017 RAUDATUL JANNAH 2018 JARLIS 2019 NOVIAR 2020 ADI SATRIA 2021 RIFKI RAMADAN 2022 SAPARDI/KADER 2023 MARDIATI 2024 ZSA ZSA ARTIKA SHAVITRI 2025 DANDY FEBRIAN 2026 SHASKIA TRI AMANDA 2027 KAYLA EMBUN RAMADHANI 2028 ZULKARNAIN 2029 NILA SUKMA 2030 RIKI MAHENDRA 2031 DEDI ISKANDAR 2032 DINO KARNEDI 2033 NUR AFNI 2034 JAMILAH 2035 SYAHRIL HUSIN 2036 DARWANIS 2037 RIA ARIANI 2038 IRWANSYAH 2039 RIAN ZAHARANI 2040 DERI DARMAWAN 2041 M. ZULRIANTO 2042 ERNAWATI 2043 PUTRI HELMA SARI 2044 M. ABU BAKAR SIDIK 2045 MUJIB MUZAQIR 2046 MUCHLIS 2047 ZULKARNAIN 2048 DELFIA WATI 2049 FITRI RAMADHANI 2050 DIAN ANGGRAINI 2051 NURBAITI 2052 DEVIS 2053 ALWI PUTRA

11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13

NO

NAMA

RT

2054 ZAIDIN 2055 JOTRINA 2056 RIO RINALDI 2057 JHONI REKHA 2058 ANDOS MAYPUTRA 2059 AKURSANI 2060 YESI NOVIA 2061 SALSABILA AGUSVIANI 2062 ELMAWATI 2063 SYAFRONAL 2064 NOVA FITRIYANI 2065 RIYEN SAPUTRA 2066 RUSDI AS/RT 2067 YUSMAINI 2068 ABDILLAH 2069 TAUFIQ RAHMAN 2070 SALMAN AFARISI 2071 HASAN/KADER 2072 ZURAIDAH 2073 RINA KESUMA 2074 ALIASAH. PA 2075 ERNAWATI 2076 NURWAHANA 2077 ZUBIRMAN 2078 LASNI 2079 YURIZA DEVITA SARI 2080 BINTANG ZULFALIO A. 2081 AMIR. J/RT 2082 NURHAYATI 2083 MUHAMMAD DANIL 2084 MHD. ARAFAT 2085 HAYATUN NUKUS 2086 HCODIJAH 2087 AMELIA 2088 SUSILAWATI 2089 SAFRIZAL 2090 DIAN ANGGREANI 2091 ROBY AFDIANSYAH 2092 NANDA RIZKY FIRMANDA 2093 SALMAN ALFARIZI 2094 RIFTAHUL JANNAH 2095 MUHAMMAD HABIBI 2096 SURYANSYAH 2097 NIATUN WITRI 2098 M. SUBHANSYAH 2099 M. RAMADHANSYAH 2100 SYAFITRI AZURA 2101 ADE SONYA PUTRI 2102 M. AKBAR SYAH 2103 MELATI SYAFITRI 2104 EDY FIKRI ROZA 2105 NURBAITI 2106 PANCA SUBAKTI 2107 MAHYUDIN 2108 YENI NUR AMALIA 2109 YEGI PRATAMA 2110 M. FAIZAL CHAIRUL 2111 SITI FARA AZ-ZAHRA 2112 M. RAYHAND RACHMAN 2113 SITI AZAHWA 2114 M. YUSUF HATTA 2115 ANISA AYU AZAHRA 2116 EDI ISMANTO 2117 HIJRATUL HASANAH 2118 M. DAFA ALFARUJ 2119 NADHIRAH YAMINA F. 2120 ZAIRAH NISRIMA T. 2121 SATRIOGI 2122 MHD. RAFI 2123 YENI EFRITA 2124 MHD. YUSUF IRFANSYAH 2125 RAFIKA AMANDA PUTRI 2126 RAFIKA DANIA PUTRI 2127 INDRAWATI 2128 SETIYO PRAMUDI 2129 ERNITA. Z 2130 RESTHA SETIAWAN 2131 RENATA PUTRI 2132 ARDISON 2133 YASMAWATI 2134 ADRIAN PUTRA 2135 ARTIKI RAHMAN 2136 ARAUDA SALSABILA 2137 FERI FADLI 2138 SUSANTI 2139 DIKI SAPUTRA 2140 ANDRE 2141 MUHAMMAD FADLI 2142 ROY HENDRI 2143 NINA SILVIA 2144 GILANG RAMDHHAN 2145 GARUDA BAYU D. 2146 GUNTUR TRY BIHUWANA 2147 GEMA MULKI OLFARIZY 2148 GUFON 2149 INDERA 2150 SRI WAHYUNI 2151 RAYSA SAPUTRA 2152 MUHAMMAD MARSEL 2153 FAHMI RAMAPUTRA 2154 FAJAR SURYA 2155 ADE ISPAL 2156 YUSMIATI 2157 RIZKY PRATAMA 2158 AZAM RAMAHDAN 2159 BURKHAN 2160 HENI PERTIWI 2161 BRIMAS TANAKA 2162 SYAWALUDIN 2163 AIDA SYAFRI 2164 FITRI WILDA 2165 MIA AUDIRA WILDA 2166 TRI OKTAVIA WILDA 2167 SYAFNIL 2168 DARMANSYAH. SK 2169 RAMASITA 2170 SAYYID ALIIF AKBARSYAH 2171 ZUBIR 2172 NURHAINI 2173 ZAINUDIN 2174 YULIA SARI DEWI 2175 TAUFIK 2176 ROSNAILY 2177 RISKY SYUHADA W. 2178 MUHAMMAD HABIBI 2179 NAZARUDDIN 2180 UMI SALAMA 2181 RIO SAPUTRA 2182 ANHHA SAGARA 2183 P. ARITITONANG 2184 YULIA 2185 AUREL RAHMAN A. 2186 ICHA ANDIRA A. 2187 AYLIA RIZKY A. 2188 ERYANTO 2189 TINA HARIYANA 2190 ASWA NABILA 2191 DEWI FITRI RAMADHANI 2192 RAMLAN/KADER 2193 JUSMIWATI 2194 WINARTI 2195 NUR AFRINA SARI 2196 MUHAMMAD ARIEF 2197 INDRA GUNAWAN 2198 SARINAWATI 2199 NENENG WAHYURITA A. 2200 SUHADA MAULANA 2201 RIZKI TRIYANTO ABDELLA 2202 M. KURNIA SANDI 2203 SITI RAHAYU S. 2204 M. NASRUL IBRAHIM 2205 SY. DEWI MAHARANI 2206 M.MIZAN ANSORY 2207 AHMAD MUZAKIR 2208 SUMIATI 2209 MASKAR 2210 MUHAMMAD AL KAUSAR 2211 RAHMA AMALIA 2212 RUDI RAHMAT 2213 RIZAL AFFANDI/ KADER 2214 MARYATI 2215 TERA SEPTIAN 2216 M. RAJIB AKBAR 2217 CINTA HUMA AFANDI 2218 ZULKARNAIN 2219 SYAMSIDAR 2220 ABDI PERDANA PUTRA 2221 AYU PRATIWI 2222 KIKI AMELIA 2223 ISMAIL 2224 SURYANI 2225 ERWIN SAPUTRA 2226 ANANDA SETIAWAN 2227 YUSDI ANDRI 2228 ERVIZA 2229 M. HIDAYAHTUR RIFAI 2230 RAFA HIDAYAT ILHAM 2231 TRI PUTRA SHARIL 2232 SAID BUDI 2233 SYARIFAH RABIAH 2234 SYARIFAH AULIA SUHADA 2235 TENGKU SAID ZAINAL 2236 M. ARIF RAHMAN 2237 HELVI MARSINTA 2238 ASVIANTI SHINTA FITRIANA 2239 SONIA ARVIONA 2240 FADILA RAHMA SARI 2241 SAID SAIDI 2242 SYARIFAH KHODIJAH 2243 SYARIFAH NURLENA 2244 SARIPAH NURAINI 2245 KASMES 2246 SYARIFAH WARNIATI 2247 TENGKU KHAIDIR / RT 2248 SY. ZAMZIMAR 2249 T. SOPIYANA 2250 SAID M. SYAIFULLAH 2251 SYARIFAH KAMARIAH 2252 SYARIFAH MARDIYANTI 2253 HERMAN 2254 IBNU CHALIK 2255 RAHMA WATI 2256 ULFIA NELLI 2257 DINUL HAQ ICHAN 2258 AYI 2259 TILI 2260 LILIS RISMAWATI 2261 ANDRI YAWAN 2262 HADIN 2263 T. SYAHRIAL 2264 HARYATI 2265 TENGKU ADIF FAYZA 2266 TENGKU M. ARTA

13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151

NAMA

152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357

NAMA

M

M

M

NAMA

W

M

M

M

M

W M M

M

M M

W

M M M

W

MM

M M

M

M

MM M W

M

M

M

M

W

M

M MM

M

M

M M

M

W

M M M MM M M

M

M M

MW

M M

M

W

M M

W M

W

M

M W M MM M

M

M

W

W

M

M

M M

M M M

M

M

M

W

M M

M

M

M

M

M

M

M

W M

M

MM

M

M M

M

M

W

W M

M M

M

M M

M

M

M M

M

W

M M

M M

M

W

W W W MM MM W M M W

M M

M

M M

M W

M

M

W W

M M W

W

M W

W

M W

M M

M

M M

W

M

M M M

M M M

M

W M W

M M

W

W M

W

M

M

M M

M

M M

M

M

M

M M

M

M M

M

MM

M M

MM

M W M

M M M

W

M

M

M

M

M

W

W

W

M W

M

M

M

M

W

MM

M M

M

M W

W M

M W

M W

M

MM

M

M

W

M

M M M

M

M

M

W

M

M M M

M

W

MM M

W M

M W W

MM

M M

M

M M M

W

M

M M

M

M

W

W

M

M

M

M

M

M

M

M

W

M

M

M M

M

W

M

M

M

M

M

M

W M

M

W

M

M M M

M M M

M

M

M

M

M

M

M W M

M

M

M M M

M

MM

M

MM

M

M

W

M W

M M

M M M

M

M M M M

M W W

MM M

M

M M M

W

W

M

M

M M

M

M

M M M M

M

M

M W M

M

M M M

M M W

M

W

M W M

M

M

W

M M

M M

M M

M

M M

M

M

MM M

M

M

M M

M

M

W W M

M MM M W M M

M

M

M

W

M

M

W W

M

M M

W

W

M

M M

W

RT

M

M

M

W

W

M M

M

M M

W

W

W

M

M

M

M

M

M

M

MM

M

M

M

M W

M M

M

M

M

M W

M

W

W

M

M

M

M M

M W M

M

M

M

M

MM

M

M

M

M

M

M

M

M M M

M

MM

W

W M M

W

MM W

M M

M M

M

M

W

M

W W M W M M M M M

M

M

M M

M M

MM

MM MM

M

M

W

M W

M

M W

M

W

M

W

M M

M

W

M M

M

M

W W

M W M M

M

M

M

M

M

M

W W M W M W W

W

M

W W

M

M

M M

M

M

W

M

M

M W M

W

M M

M

M

W M

M

MM M

M

W M

M

M M M

W

M MM M

W

W

M M

M

M

M M

M

M

M

M

M

M

W

M W

M

M

NAMA

M

M

M M

M M

M

NO

W

M

M

M

RT

M

M

M

M

NAMA

M W

M

W

NO

M

M

M

RT

W

W

M

M

M

NO

M

M

RT

MARIN JASNI MARDIANTON CHANDRA RIKI PRANANDO METRI DWI HEPSARI CIA ANDIKA M. RAVIL SETIAWAN BURHANUDDIN ADRIYANI M. ATTHOTIQ MARZIFRI YOSE PRASEPTYO NUR AFIMAR RIFDHOL AULIA RICHI HASBIYADDIN ASRUL YUN REFNITA DAVID WALDY RAMADWIKA ILHAM DAVA RIZKI OCTRIZA MUHAMMAD ALFAJRI DAFFA SHIDIQI AL FAKHRY WENDRI SATRI YANTI INDRA SAPUTRA JOVANDRI GAUTAMA P. MELISA SAPUTRI UJANG S ELSAM GUSNAINI MAI WIYA LISA PUTRI MUHAMMAD IKHSAN NAJAMUDDIN/KADER DESMINAR MUHAMMAD HABIBI ARIF ALFA KHAIRA AMIRA ARIFAH ADAM USMAN/KADER RAMA DANIS ARLEO PERDANA SUTA MARDI ALEK KOMARISKI ROSNA PIMIN AHMAD FAHRUL ROZI AMRINIS DARMILIS HIDAYATUL DINA M. ARIF RAHMAN AINA TALITA ZAHRA RISWANDI SAFRINA ARUL AFANSYAH KARIJAN ROSNADAR ELMA HENDRI ERNAWATI ISMAWATI RIDUAN PRIBADI ANDY DARUSSALAM FIRMAN AFIS FIRDAUS ALRIDHA AFIS RAHMAD HIDAYAT ERNI WIRDATUL FAZIRA SYIFA RAUDATUL JANNAH IRSYAD FAUZIL ADHIM AJIAS MAWARNI PUTRA ALHADI JASMI ROSLIANA LASMI WIJAYANI HANIFAH ANGGRAINI IRWAN AFRIZAL JULIANA RICA PURNAMASARI MULYADI RINALDY DEWI SUSANTI FIQRI YASIN PUTRI AURELIA MUHAMAD ASRANI SALFANI JUPRI RENI SOLVIA GHINA NURLATIFA AFIQAH NURAINI BENI YUHENDRA KARTIKA SARI ILAN ROBEN RAMADHAN SAFIRA OKTAFIA SRI AYU MUHAMMAD HASDIKI NOVITA YENI T CERISCHA LAUDYZA ASDICKY IVOLLYN ARILLA ASDICKY FAKHIRAH SALSABILA ASDICKY YULIUS MEDI YOSI ANANDA ISLAMI SYUHADA HATTA ISLAMI SYUHADA JASMAN SUTINAH VINA AMELIA ADNAN SYAHADHA BILLAL GADHI ALVARO YASRI YANTI RINESTI PARAMITHA INDRI MUTIA ADHITYA RAHMAN ARVID SIKUMBANG YESSI ARISCA TIARA MONICHA WIDYA VERONICA KELVIN RISKI SAPUTRA SYAMSUAR ERLINDA NOPI GUSMAN EKA FITRIA ISMAIL SITI AISYAH BAHARUDDIN RATNA YON HENDRI NOVENDRA M. REDHO ILHAM RIZKI AFIQ RAMADHON KAMARUDDIN YUSNI NASRUL ERNIDA FITRI JUNIARTI YOSINA SABDANAS NIA DAYNESTI HUMAIRO SITI SHOLEHAT MARDIANTON CHANDRA ALEK KOMARISKI ROSNA PIMIN ASWAR MUNIR AGUSTINA FIRDAUS NIZAR IRMA SURYANI LISNA RENOVA LIDYA SAFITRI SYAIFUL BAHRI SRI DEVI RAYANTI SANIA PRATIWI ISMAWALDI FITRI HERAWATI M. ANANDA ZIKRI NADILA AZIZAH PUTRI DONI HIRAWAN

RT

DEWI SUSANTI REGA MAULANA DIFO RAHMADHANI SUSMITA AFRIZAL HIDAYATUL RAHMI SERINA SALSABILA YUSNA MAY ZAIRUL AMRI JAS/RT AFNITA RIDWAN SIKUMBANG ADRIAL SIKUMBANG EFENDI NURHANA SIKUMBANG MUSLIZAR ANASRUL KAMIDAR RUDI HIDAYAT ROSI MERLINDA LIDIYA FRANSISKA ERIZAL ERNAWATI FATMA ZUHURA LATIVA SEPTIANA SAKDIAH JONI SIJID NURBAINI NOFRIANTI YASRIANI ROBBI YANTO SISKA YOLANDA ZAHIRA PUJA ADZANI BAGINDA DARMASLI PARIDA MURNI RISKAL ELFI PERMATA BELLA SARI ARDISON GUSRI YANTI ANNISA DEVI ARESTY NABILA NURFADILLA EIRA SYAFARUDDIN ASNI WITA NILAMSARI ANNISA RAHMA M. RIZKY RAMADHAN BUYUNG J MAYULIS ADE SUHENDRI NURVITA SARI DEVI YANTO M. IQBAL YUNI DESTIANTI AZWAR NURLAINI MUHAMMAD RIDWAN BURMAN ZARLIS TARMIZI SUKMA IMRAN SARIANI BUSTAMI NOFRIZA HADYAL BIRKI M. HAFIZH MUHAROM SYAHRIAL YUSNAWATI AGUSPI CAN ARMAINI ARFI YENDI ZULFIARDI RANGGI ARFINO EDI YUSNIMAR DENI CANDRA BENI FEBRI DERRI DORES LIAM ONISA YULI ANISA RINI WAHYUNI NAZWIR NURBAITI DENI HENDRY CITI MUTIARA SOFYAN ASNIMAR DONNY DODI ANDIKA LOLI REFIKA RANTIKA WULANDARI JIMMI SIMARE MARE YENTI ERLINDA REONNIESA AMELINDA S. RAIHAN BAIHAKI SIMARE M. NUR LELAWATI SULAIMAN ADILAH ANDIRAHMAN NURMA YULIS M. ZAINIR SUSWARNI AAN FAUZIAH ROZANI REFIANDI/KADER YENI ELVI MUHAMMAD IRSHAD M. IHSAN SALSABILA ANDINI KHAILILA RUMAISHA IWAN/RT YULLI M. RIZKY RIANDI TRIA ANISA LIDYA ARDIMAL M. RANGGA ADITYA TASLIM HANAFI B KARTINI RIKA NOVITA RONI ALDI DIANA SARTIKA RIZALDI EFFENDI BOY PRIMA HERMANSYAH MAINI JONS STEVEN WELI SUARNI AYU ANIRA SUKMA JUNITA RIZKY NURMANSYAH AMRI MERI ZUARNI ARDISON ERIZAL SAHPUTRA RINA DESMIRA JUNAIDI IRWAN EFENDI MONASRIL MASNA DANIL FERI PEBRIYENI METRIZAL MASRIWATI ANHARIL FATHAN NIA RAHMAWATI ADRIAN JHON KENEDI RETNA WILIS DENIUS FIRLANDO CHARLES CIO VERLANDO ROSA KAMELIA PUTRI AZURA FAUZA CINTA LAURA MUHAMAD ALFINDO KOBOY ZULMAINI ENDRA BEMO INDRA YUDI AKIR SUHENDRA SARIPIN SOMAWATI NABILA PUTRI MUKHLIS FARIDAWATI SARI WAHYUNI ZAHRATUL JANNAH RUSDA ULFAH WASYIATUL ILMAH M. ALFAJRI SITI AISYAH DARMAWI REMITA SARTIKA SALSABILA DARMA PUTRI ARYA ADITYA DARMA P. AFIDA ZILVA DARMA PUTRI M. IQBAL AKROM AGUSMAN ETI SARLIWATI MUHAMMAD JUNAIDI ABDUL RAHMAN EDO GUSMAN EKA ELIZA NOFRI EKA SYAHPUTRA RIYAN ASRI SYAHPUTRA YENRI RODI DESLA DEWITA REYUNI HENDRIZAL LIDYAWATI MONTASIR ERVINA MALVIN GEOFANI MALVIN TIARA MALVIN DIEO WARDI MANSYAH HELDA MERI M. IBNU DEFRIANSYAH FAJAR AKBARSYAH MARWAN ASMAR LENI MARLINA RUSDI IRAWAN LILYANA BAGUS SULISTIO RANI SYARLI SYAHLA PUTRI FAISAL LUBIS AURA BALQHIS LUBIS PUTRI

M

KEL. BINTAN NO

NO

M W

M

M

M

M W

M

M

M M M

M

M M

M

M

M M M M

M

M M W

M

M

M

W

M

M W

M MW

M M W M

W M

M M M

M M

M

MM M

M

M

M

M

MW

W M W

M

M M

W

M

M

M

M

M M M

M

W M

M

M

M W

W

W

M

M M

W

M TATA LETAK: SUSAN


6

NASIONAL

Dumai Pos

KAMIS, 5 MARET 2015

Tebar Uang, Perampok Lolos

SOLOK (DP) - Perampokan dengan senjata api terjadi di kawasan Laingpasir Kecamatan Tanjung Harapan Kota Solok, Padang, Sumbar, Rabu (4/3) siang. Mereka lolos membawa lari uang ratusan juta rupiah setelah menebar sebagian uang hasil kejahatannya di jalanan.

Zulkifli, mengaku siang itu dia baru saja mencairkan uang sebanyak Rp280 juta di BNI Cabang Solok. Uang tersebut adalah hasil bisnisnya sebagai pedagang emas di daerah tersebut. Dengan mengendarai Toyota Kijang LGX BA 1511 A, pria 36 tahun

itu, melaju dari arah Solok menuju Sijunjung. Sesampainya warga Kabupaten Sijunjung ini di kawasan Laingpasir Kecamatan Tanjung Harapan Kota Solok, laju kendaraannya terhenti lantaran ban belakang kempis. “Saat turun mau ganti ban, seorang pria datang menghampiri mobil. Tiba-

86 Titik Api Baru di Riau SAMBUNGAN HAL.....................1 keseluruhan di Pulau Sumatera terdapat 96 ‘hotspot’, sedangkan yang terbanyak berada di Riau yakni berjumlah 86 titik,” kata Kepala BMKG Stasiun Pekanbaru, Sugarin. Pemerintah sejak Februari lalu telah menetapkan status Siaga Darurat Kebakaran karena potensi cuaca kering dan masih maraknya pembukaan lahan dengan membakar. Berdasarkan data Posko Siaga Darurat Kebakaran Riau, luas kebakaran sejak Januari hingga kini sudah lebih dari 379 hektare. Kebakaran terutama terjadi di wilayah Utara Riau seperti di Kabupaten Bengkalis, yang berdasarkan

pencitraan satelit ada 36 “hotspot”. Wilayah lainnya, Kabupaten Kepulauan Meranti terdapat 16 titik panas, Pelalawan ada 12 titik, Siak delapan titik, Kota Dumai tiga titik, Rokan Hilir enam titik, Rokan Hulu dan Kampar masing-masing dua titik, dan Indragiri Hilir satu titik. Di Pekanbaru sendiri, pemandangan pagi hari diselimuti oleh kabut asap tipis sisa kebakaran.Namun demikian, Sugarin mengatakan berdasarkan info Alat Pemantau PM10 terhitung Indeks Pencemar Udara masih dalam status baik. Terakhir untuk jarak pandang (Visibility), sambung Sugarin, kota Pekanbaru sekitar lima kilometer (haze), Dumai enam kilometer, Pelalawan empat kilometer (haze),

dan Rengat empat kilometer (haze). Sementara itu, kabut asap telah mulai menyelimuti Kota Bengkalis. Walau warga masih beraktifitas seperti biasa, namun mulai timbul keresahan akan bencana asap yang bakal terulang lagi. Badan Lingkungan Hidup (BLH) setempat melaporkan, dari data Indeks Standar Pencemaran Udara (ISPU) pagi tadi menunjukkan angka di 370. Artinya, kualitas udara di Bengkalis sudah sangat tidak sehat. Oleh karena itu, BLH juga menghimbau kepada masyarakat untuk mengurangi aktivitas di luar rumah. Dan BLH sejak kemarin telah membagikanmaskersebanyak8.000lembar untuk warga di 3 kecamatan, Bengkalis, Bukitbatu dan Siakkecil. (wan)

Biaya Haji Bisa Turun 3 Juta SAMBUNGAN HAL.....................1 terkait biaya haji. JAKARTA (DP) - Ini kabar gembira bagi para umat Islam yang ingin menunaikan ibadah haji. Pasalnya, biaya untuk berangkat ibadah ke tanah suci bisa berkurang hingga Rp 3 juta per orang. Setidaknya, itulah klaim Ketua Komisi VIII DPR, Saleh P Daulay. Dia mengatakan, Panitia Kerja Biaya Pelaksanaan Ibadah Haji (BPIH) sudah memulai penelitian

“Walaupun dolar naik turun, pemerintah akan berikan subsidi dari dana tak terduga kalau ada kekurangan. Idealnya, penurunan paling sedikit Rp 3 juta dari tahun lalu. Itu penting,” kata Saleh saat dihubungi, Rabu (4/3). Politikus PAN itu menyebutkan, pekerjaan Panja BPIH butuh ketelitian dan keseriusan sehingga bisa mendapatkan harga perjalanan haji yang pas. DPR juga berharap penurunan BPIH diikuti peningkatan kualitas pelayanan.

Dia menambahkan, penurunan BPIH yang diklaim pemerintah sebesar USD 26 belum memuaskan karena tahun lalu kurs dolar tak lebih dari Rp 10.500. Namun, sekarang rupiah sudah Rp 12.500 per dolar. “Kalau cuma turun USD 26 itu sangat tidak membantu. Justru dikonversi ke rupiah malah naik. Itu yang ingin diturunkan. Tidak semuanya jemaah orang kaya. Bahkan ada yang puluhan tahun menabung lalu berangkat haji. Kalau ada penurunan Rp 4-5 juta sangat bermakna bagi mereka,” tambah Saleh. (fat/jpnn)

Anak Priyayi yang Pakai Sepatu Lars Loak SAMBUNGAN HAL.....................1 belajar terus kalau di rumah,”ungman yang tidak terlalu luas. Tanpa pagar, di depan rumah itu terpasang papan nama Pimpinan Cabang Muhammadiyah (PCM) Umbulsari. Ya, di rumah itulah Badrodin lahir dan menjalani masa-masa kecil hingga memasuki usia remaja. Perempuan yang tengah mengepel teras musala tersebut bernama Solihatun. Dia adalah keponakan ibunda Badrodin. “Sepeninggal Haji Ahmad Haiti (ayah Badrodin), yang tinggal di rumah ini sekarang Pak Haji Lukman (Lukman Haiti, kakak nomor dua Badrodin), istri, menantu, dan Bu Sunar (kerabat keluarga Badrodin),”kata Solihatun. Petang itu, rumah keluarga Badrodin memang kosong. Sebab, Lukman dan istrinya tengah menunggui menantunya yang diopname di sebuah rumah sakit di Jember. Tetapi, Solihatun sempat menemui dan mempersilakan wartawan koran ini untuk masuk ke ruang tamu. Rumah orangtua Badrodin tergolong cukup sederhana. Bentuk pintu dan jendelanya khas arsitektur lama. Lantainya terbuat dari teraso kuning. Meja dan kursi ruang tamunya juga model lama. Di atas meja itu terdapat tumpukan buku serta majalah. Beberapa di antaranya majalah Suara Muhammadiyah. Ayah Badrodin, Ahmad Haiti, memang tokoh Muhammadiyah yang disegani di Kecamatan Umbulsari dan sekitarnya. Begitu pula kakak Badrodin, Lukman Haiti, yang kini menjabat ketua PCM Umbulsari. Meski berasal dari keluarga priayi, Badrodin kecil tetap bergaul dengan teman serta tetangga tanpa melihat status sosial. Samin, tetangga yang tinggal sekitar 50 meter dari rumah Badrodin, punya kenangan khusus dengan anak keempat di antara delapan bersaudara itu. “Waktu kecil, Din (panggilan Badrodin di keluarga, Red) suka wayang. Kalau nonton wayang, sering sama saya. Dia senang duduk di dekat dalangnya,”ujar Samin. Badrodin menghabiskan masa kecil dan remaja di Jember. Dia mengenyam pendidikan kelas 1-5 SD di Paleran. Saat kelas 6, dia melanjutkan sekolah di Wlingi, Blitar, tempat tinggal kakaknya yang pertama. Lulus SD, dia meneruskan SMP di Pondok Pesantren Baitul Arqom, Kecamatan Balung, Jember, yang berjarak sekitar 8 km dari rumahnya. Kelas 1 SMA, Badrodin bersekolah di SMA Muhammadiyah Rambipuji yang berlokasi sekitar 15 km dari rumah orangtuanya. Untuk menuju ke sekolah, dia rela mengayuh sepeda sejauh 30 km pergi pulang. Namun, memasuki kelas 2 dan 3, Badrodin dipindah orangtuanya ke SMA FIP (Fakultas Ilmu Pendidikan) Universitas Jember (Unej) di Kecamatan Tanggul yang saat ini berubah menjadi SMAN 2 Tanggul, Jember. Menurut Lukman Haiti, kakak Badrodin, adiknya itu tergolong anak rajin dan pintar. “Kerjaannya hanya REDATUR: GENTA MUKARRAM

kapnya ketika ditemui di rumah sakit tempat menantunya diopname. Teman-teman Badrodin di SMP juga mengakui bahwa Badrodin termasuk anak yang menonjol di kelas.”Dia termasuk kelompok anakanak pandai, sedangkan saya termasuk yang kelompok bawah,”kata Mastur, kawan kecil calon Kapolri itu. Meski saat SMA keduanya berbeda sekolah ‘Badrodin di SMA FIP Tanggul, sedangkan Mastur di SMA FIP Ambulu’ keduanya tetap akrab. “Lulus SMA, kami mendaftar Akpol bareng. Kami berangkat ke Surabaya juga bersama untuk tes. Bahkan, lantaran tidak punya saudara di Surabaya, kami tidur di musala,”ujar Mastur yang kini menjadi Kapolsek Pakusari, Jember. Tekad Badrodin untuk menjadi polisi terlihat sejak SMA. Saking terobsesinya menjadi polisi, Lukman sampai membelikan adiknya itu sepatu lars seperti yang biasa dipakai tentara. “Sepatu itu saya beli di pasar loak seharga Rp1.500,”ungkap Lukman. Walaupun berbeda jauh pangkat dan jabatan, Mastur menegaskan, Badrodin tidak pernah melupakan dirinya. Saat Badrodin menjabat Kapolda Sumut, Mastur sempat ditawari untuk pindah ke Medan. “Waktu itu, saya menjadi Kapolsek Ledokombo (Jember). Saat ditawari itu, saya jawab, wah kok adoh tenan (kok jauh sekali, Red),”ujarnya. Ketika Badrodin menjadi Kapolda Jatim, Mastur juga pernah ditelepon teman dekatnya tersebut. Saat itu, Mastur bertugas di Polsek Sukowono, Jember. “Dia sempat tanya, Sukowono itu sepi atau ramai? Ya saya jawab biasa saja, Jenderal,”kata Mastur yang saat itu mengaku kikuk untuk memanggil atasannya dengan panggilan Din seperti waktu SMP dulu. Rasa bangga atas pencalonan Badrodin Haiti sebagai Kapolri juga menyelimuti para tetangga keluarga Badrodin di Paleran. Pasalnya, jenderal bintang tiga yang berasal dari desa itu kini akan menjadi orang nomor satu di korps baju cokelat tersebut. Menurut Siam, salah seorang tetangga, hingga saat ini Badrodin tetap menjadi orang yang rendah hati dan tidak lupa akan kulitnya. “Kalau pulang kampung dan ketemu tetangga, dia tidak pernah menolak diajak foto bareng. Orang sekitar sini hampir semua pernah foto bareng dengan Din (Badrodin),”katanya. Badrodin juga meminta para tetangga tetap memanggilnya dengan nama panggilan saat kecil tersebut. “Dia lebih senang dipanggil Din saja daripada diberi embel-embel jenderal,”sambung Siam. Tapi, sejak menjadi orang penting di Polri, Badrodin jarang pulang kampung. “Waktu bapak dan ibunya masih ada, setiap Lebaran dia pasti pulang kampung. Tapi sekarang agak jarang. Kalau toh pulang hanya sebentar. Tiba magrib, subuh sudah balik lagi ke Jakarta,”ungkap Siam.

Sementara itu, pihak keluarga di Jember baru tahu Badrodin ditunjuk Presiden Jokowi sebagai calon Kapolri saat ditelepon seorang kerabat di Probolinggo. “Saudara dari Probolinggo menyuruh saya nonton breaking news di TV. Ada berita Badrodin ditunjuk menjadi calon Kapolri oleh presiden,”cerita Lukman. Mendengar kabar itu, Lukman mengucap rasa syukur adiknya mendapat kepercayaan dari presiden. Tapi, tantangan yang dihadapi sang adik memang sangat berat. Terutama mengatasi gesekan antara Polri dan KPK serta potensi konflik internal di Polri setelah Komjen Pol Budi Gunawan batal dilantik sebagai Kapolri. “Kelompok BG (Budi Gunawan) di dalam Polri pasti tidak diam,”tuturnya. Badrodin menamatkan pendidikan di Akpol pada 1982 sebagai lulusan terbaik. Dia pun mendapat penghargaan Adhi Makayasa dari Presiden Soeharto. Pada awal karirnya, Badrodin lebih banyak bertugas di jajaran Polda Metro Jaya meski sempat digeser ke Timor Timur (sekarang Timor Leste) pada 1985. Dia kemudian menjadi Kapolres Probolinggo dan Kapoltabes Medan. Karirnya mulai menanjak saat berdinas sebagai Direskrim Polda Jatim pada 2003. Dia lalu menjabat Kapolwiltabes Semarang sebelum mendapat promosi perwira tinggi sebagai Kapolda Banten. Tercatat, Badrodin pernah menduduki jabatan empat Kapolda. Dua di antaranya merupakan polda tipe A, yakni Sumut (2009-2010) dan Jatim (2010-2011). Dua lainnya polda tipe B, yakni Banten (2004) dan Sulteng (2006). Apabila ditotal, Badrodin berpengalaman menjadi kepala satuan wilayah sebanyak sembilan kali. Mulai Kapolsek (2), Kapolres/ Kapoltabes (2), Kapolwiltabes (1), dan Kapolda (4). Setelah menjadi Kapolda, Badrodin ditarik menjadi staf ahli Kapolri, dilanjutkan promosi eselon I-b menjadi asisten operasi Kapolri. Dia lalu promosi lagi ke eselon I-a menjadi Kabaharkam dan sempat masuk bursa calon Kapolri pengganti Timur Pradopo. Di era Sutarman, Badrodin dipromosikan menjadi Wakapolri menggantikan Komjen Oegroseno yang pensiun. Badrodin juga sempat diisukan memiliki rekening gendut. Tepatnya saat menjabat kepala divisi hukum Polri pada 2010. Harta kekayaannya pada 2008 dilaporkan senilai Rp2,09 miliar plus USD 4.000. Namun, Badrodin sudah mengklarifikasi hal tersebut kepada PPATK. Badrodin juga terbilang rajin melaporkan harta kekayaannya. Tercatat, ayah dua anak itu enam kali melaporkan harta kekayaannya. Kali pertama dia melapor pada 31 Mei 2001, saat menjadi Kapoltabes Medan, dengan nilai harta Rp 1.187.000.000 dan USD 4.000. Terakhir pada 2 Mei 2014 kala menjadi Wakapolri dengan total harta senilai Rp 8.290.211.160 dan USD 4.000. (byu/c5/c9/ari/jpnn/rbb)

tiba membuka pintu lalu mengambil tas saya. Temannya sudah menunggu di seberang jalan siap-siap kabur,” ujarnya. Sadar telah menjadi korban perampokan, Zulkifli pun berteriak minta tolong. Sejumlah pemuda di sekitar lokasi kejadian pun berupaya mengejar pelaku. Sekitar 4 km dari lokasi kejadian, di

kawasan Jembatan Terbakar Nagari Sei Lasi, warga yang mengejarnya berhasil memepet perampok. Namun, perampok menodongkan senjata api dan menebar uang hasil kejahatannya di jalanan. “Nyali saya langsung ciut lihat pelaku todongkan senjata. Pengejaran terhenti juga karena warga dan pengendara sibuk rebutan uang yang

ditebar perampok,” ujar Yunus, 26, yang ikut mengejar perampok. Waka Polres Solok Kota Kompol Noviardi Zein mebenarkan kejadian tersebut. “Kami belum dapat pastikan, apakah para pelaku gembong bandit lintas Sumatera atau tidak, tergantung hasil pengembangan lebih lanjut nantinya,” tegas Noviardi Zein. (jpnn)

Pemilik Rumah Makan BPK Tewas Ditikam Labuh Baru Barat Kecamatan Pay-

SAMBUNGAN HAL.....................1 ung Sekaki, Pekanbaru, Riau. menuju rumah sakit. Ia mengalami luka tusuk oleh orang tak dikenal (OTK) di bagian dada sebelah kiri, Rabu (4/3/2015) dini hari tadi sekitar pukul 01.30 WIB. Berdasarkan info dari pihak Polsek Payung Sekaki, peristiwa penusukan itu berawal saat korban yang sedang tidur pulas terbangun oleh suara gonggongan anjing yang diikat disamping rumah makan BPK khas Karo Berastagi miliknya di Jalan Arengka 2 Kelurahan

“Merasa curiga korban mengecek kearah belakang rumah makan miliknya dan memergoki pelaku.Sehingga pelaku yang tak ingin diketahui lalu menusuk dada sebelah kiri korban,” ujar Kapolesek Payung Sekaki AKP Usril SH, saat dikonfirmasi Riaupos. Mendengar suara gaduh ini lanjut Usril, suami korban bernama Semapa Tarigan, 40, terbangun dari tidurnya dan mendatangi asal suara. Didapati tarigan istrinya sudah roboh di lantai dapur dengan kondisi berlumuran darah.

Tariganpun berteriak minta tolong ke tetangga-tetangga dan langsung membawanya ke RS Ibnu Sina Pekanbaru. “Dalam perjalanan ke Rumah Sakit korban meninggal,” kata Usril. Setelah mengetahui kasus tersebut pihak kepolisan langsung mendatangi lokasi untuk melakukan olah TKP untuk mengetahui motif pelaku. “Dilokasi kita menemukan pisau yang digunakan pelaku untuk menusuk korban. Dugaan sementara motifnya pelaku hendak melakukan aksi pencurian. Karena aksinya diketahui pelaku lalu menusuk korban dengan pisau,” pungkas Usril.(jpnn)

Kejati Sita Ratusan Berkas Kasus Jembatan Pedamaran SAMBUNGAN HAL.....................1 Hilir, di Bagansiapiapi, Rabu (4/3). “Ini guna melengkapi berkas penyidikan,” kata Kasie Penerangan Hukum dan Humas Kejati Riau, Mukhzan, sebagaimana dikutip dari Antara. Tim Pidana Khusus Kejati Riau mulai melakukan penggeledahan pada Rabu pagi sekitar pukul 08.00 WIB yang dimulai dari ruang kerja Bupati Rokan Hilir (Rohil) Suyatno. Suyatno sempat terlihat menyambut tim penyidik yang dipimpin oleh Kepala Seksi Penyidikan Pidsus Kejati Riau Rachmat Lubis bersama perwakilan Kejaksaan Negeri Bagansiapiapi. Penggeledahan di kantor bupati berlangsung selama empat jam dan penyidik melanjutkan penggeledahan ke Kantor Dinas Pendapatan Daerah Rohil. Penyidik hanya sekitar satu jam di kantor tersebut dan langsung bergeser ke Kantor Bina Marga Rohil. Di tempat terakhir, penyidik memakan waktu 1,5 jam.

“Total ada 320 berkas yang dikumpulkan,” kata Rachmat Lubis. Ratusan berkas tersebut diangkut penyidik menggunakan tiga kardus besar. Mereka langsung meninggalkan Rohil sekitar pukul 15.00 WIB menuju Kota Pekanbaru. Rachmat menambahkan penggeledehan tersebut dilakukan guna mendalami penyidikan kasus itu yang diduga merugikan negara hingga Rp251,82 miliar dalam penambahan anggaran pembangunan jembatan tersebut. “Ini juga untuk mencari buktibukti keterkaitan pihak lainnya yang disangkakan bekerjasama dengan tersangka yang telah ditetapkan,” katanya. Kejaksaan juga mensinyalir korupsi proyek jembatan tersebut dilakukan secara bersama pada masa Bupati Rohil, Annas Maamun, yang kemudian menjadi Gubernur Riau dan kini nonaktif dan ditahan karena berstatus tersangka kasus suap oleh KPK. Indikasi dugaan korupsi dalam

pembangunan Jembatan Pedamaran I dan II itu awalnya sudah dianggarkan melalui APBD Rokan Hilir tahun anggaran 2008-2010 dengan total dana sebesar Rp529 miliar. Dasar hukum proyek adalah Peraturan Daerah No. 02 Tahun 2008 tentang peningkatan dana anggaran dengan tahun jamak pembangunan Jembatan Pedamaran I dan II. Namun, pada kenyataannya, tersangka IK dan kawan-kawan kembali menganggarkan kegiatan pembangunan untuk proyek yang sama tanpa dasar hukum yang jelas. Proyek tersebut kembali dianggarkan di APBD Rokan Hilir pada tahun 2012 sebesar Rp66.241.327.000 untuk Jembatan Pedamaran I. Kemudian, proyek Jembatan Pedamaran II dianggarkan lagi sebesar Rp38.993.938.000. Selain itu, proyek Jembatan Pedamaran II lagi-lagi dianggarkan pada 2013 sebesar Rp146.604.489.000. Dengan begitu, ada sekitar Rp25i miliar uang negara yang dikeluarkan tanpa dasar hukum yang jelas. (ant/wan)

Cuaca Panas Diperkirakan Berakhir Juni SAMBUNGAN HAL.....................1 tahun. JAKARTA (DP) - Kepala Badan Meteorologi Klimatologi dan Geofisika (BMKG) Andi Eka Satya memperkirakan elnino, gangguan iklim yang menyebabkan musim kering berkepanjangan, baru akan berakhir pada Juni dan Juli mendatang. “El Nino Osilasi Selatan atau ENSO yang banyak dikenal elnino saja ini berada pada kondisi normal dan diperkirakan bertahan hingga pertengahan tahun. Diperkirakan elnino ini tidak akan sampai mempengaruhi awal musim kemarau yang sebagaian besar diprediksi terjadi antara April-Juni 2015,” kata Andi di Jakarta, sebagaimana dikutip Antara, Rabu (4/3). Dengan lemahnya elnino itu akan membuat musim kemarau tidak akan berkepanjangan dan suhu di Indonesia tidak akan semakin kering pada pertengahan

Elnino sendiri diakibatkan oleh naiknya suhu permukaan laut (SPL) Samudera Pasifik sekitar khatulistiwa bagian tengah dan timur. Naiknya SPL tersebut mengakibatkan perubahan pola angin dan curah hujan yang ada di atasnya, termasuk Indonesia. Akibatnya, hujan banyak turun di Samudera Pasifik sedangkan di Australia dan Indonesia kering. Menurut Andi, elnino nanti akan lemah sehingga kekeringan berkepanjangan tidak akan terlalu mengancam Indonesia, terutama bagi ketersediaan air bersih dan sektor pertanian. Sementara SPL di Indonesia sendiri akan berada di posisi netral sampai Mei 2015. Dengan lemahnya elnino, BMKG memprediksi sifat hujan di sebagian besar wilayah Indonesia bersifat normal. Sementara itu, Andi mengatakan pergantian musim dari hujan menuju kemarau akan terjadi pada

periode Maret hingga Juni 2015. Pergantian musim menuju kemarau ini, masih kata Andi, ditandai dengan menurunnya curah hujan dengan skala kurang dari 150 mm. Terdapat daerah-daerah yang mulai mengalami transisi musim menuju kemarau pada Maret, seperti Sumatera bagian timur dan Kalimantan bagian utara. Selanjutnya pada April, pergantian musim terjadi di area Bali, Nusa Tenggara Timur, Nusa Tenggara Barat kemudian di sebagian Sulawesi tepatnya di bagian selatan. Sementara pada Mei, kemarau basah terjadi hampir merata di seluruh Indonesia. Kemarau basah sendiri merupakan fenomena musim keringyangterkadangdiselingihujantapi tidakderas. PadaJuni,lanjutdia,kemarauhampir melandaseluruhIndonesia.Tetapicurah hujan mulai naik di sebagian Sumatera terutama di sebelah utara dari garis katulistiwa.(wan/net)

Pilkada Serentak di Riau Dana Rp190 M, tapi Banyak Persoalan SAMBUNGAN HAL.....................1 menganggarkan Rp 20 Miliar. JAKARTA - Wakil Ketua Komisi II DPR Lukman Edy (LE), mengatakan KPU dan Bawaslu Daerah Provinsi Riau siap menyelenggarakan pemilihan kepala daerah (Pilkada) serentak Desember 2015, meski masih banyak persoalan di lapangan. Ini dipastikan dalam pertemuan dengan Bawaslu dan KPU Riau, di Pekanbaru, Rabu (4/ 3). “Provinsi Riau siap melaksanakan pilkada serentak Desember 2015 ini. Pilkada serentak akan dilaksanakan di sembilan kabupaten/kota se Riau. Total anggaran Pilkada di sembilan daerah itu mencapai Rp 190 Miliar,” kata politikus PKB itu saat dihubungi dari Jakarta. Menurutnya, untuk pelaksanaan Pilkada serentak di empat kabupaten/kota, yakni Kabupaten Bengkalis, Meranti, Indragiri Hulu dan Kota Dumai, masing-masing sudah menganggarkan dalam APBD 2015. Rata rata tiap kabupaten

Sisanya lima kabupaten lagi yakni Rokan Hulu, Rokan Hilir, Kuantan Sengingi, Pelalawan dan Siak akan diakomodasi melalui perubahan APBD Tahun 2015 ini. Namun demikian, dalam pertemuan itu juga dihimpun sejumlah persoalan menghadapi Pilkada serentak. Persoalan itu menurut LE, mulai dari tidak adanya anggaran KPU Riau untuk melakukan monitoring terhadap pelaksanaan pilkada di kabupaten/kota. KPU Riau tidak mendapat bantuan dari APBD Provinsi, sementara anggaran yang dimiliki melalui APBN hanya untuk honor dan gaji karyawan. Kemudian masalah validasi DPT di perusahaan perkebunan dan pertambangan yang mobilisasinya tinggi berakibat selisih DPT mencapai puluhan ribu suara. Lalu, masalah konflik desa di perbatasan, lima desa yang masih konflik antara dua kabupaten yaitu kabupaten Kampar dan Rokan Hulu yang pada pemilu lalu sempat diwarnai bentrok. “Masalah DPT di kecamatan

Mandau yang jumlah pemilihnya terlalu besar, memerlukan payung hukum 1 kecamatan boleh memiliki 2 atau lebih PPK. Selain itu logistik untuk daerah daerah sulit dan terpencil, sementara dukungan dana sama dengan daerah daerah yang biasa,” jelasnya. Karenanya mantan calon Gubernur Riau ini meminta Kementerian Dalam Negeri mencari solusi agar semua permasalahan tersebut bisa diantisipasi. Misalnya dengan memerintahkan kepada Kab/Kota yang belum menganggarkan dalam APBDnya untuk segera melakukan perubahan APBD. Solusinya berikutnya menyelesaikan sebaik mungkin soal kisruh DPT, melalui penyempurnaan e-KTP. Sebab, APBNP 2015 sudah menganggarkan tambahan Rp 1 triliun untuk penyempurnaan eKTP dalam rangka mendukung pelaksanaanpilkadaserentak. “KPU secepatnya menyelesaikan seluruh Peraturan KPU, yang mengatur lebihdetailpelaksanaanpilkadaserentak. Paling lambat bulan Mei harus sudah selesai, karena tahapan akan dimulai bulan Juni,” tukasnya. (fat/jpnn) TATA LETAK : JOKO


Dumai Pos

SPORT MANIA

KAMIS 5 MARET 2015

SETIA PADA MUNCHEN RENTETAN hasil buruk yang diperoleh Manchester City sepekan terakhir membuat nasib sang pelatih Manuel Pellegrini terancam. Sejumlah media Inggris mengabarkan, manajemen City siap mendatangkan pelatih baru jika Pellegrini tak segera menunjukkan tuahnya. Sejumlah nama yang digadang-gadang menjadi buruan City antara lain pelatih Bayern Munchen, Pep Guardiola, pelatih Real Madrid Carlo Ancelotti hingga juru taktik Atletico Madrid, Diego Simeone. Terkait rumor tersebut Guardiola sendiri mengaku masih betah melatih Munchen. Mantan pelatih Barcelona tersebut mengaku ingin menghabiskan kontrak bersama FC Hollywoodsebu-

tan Munchen. “Tentu saya akan tetap di sini. Saya tidak ada tawaran kontrak (dari klub lain) dan saya tidak menunggu kontrak dari siapapun,” ujarnya seperti dilansir Sky Sports, Selasa (3/3). “Saya ingin memenuhi kontrak saya dan melakukan tugas dengan baik, itulah yang saya pikirkan saat ini,” tambahnya. Sebelumnya City kalah 1-2 dari Barcelona dalam laga leg pertama babak 16 besar Liga Champions Eropa. Kemudian, Sergio Aguero dan kawan-kawan kalah dengan skor yang sama dari Liverpool dalam lanjutan Liga Primer Inggris. Hal ini membuat posisi City semakin jauh dari Chelsea yang kini memuncaki klasemen. “Saya masih punya kontrak satu setengah tahun. Kami kan duduk bersama musim panas ini dan kami akan lihat apa yang akan terjadi,” imbuhnya.(zul/jpnn/gen)

Aji Santoso Kerap Hentikan Latihan „ Secara Tiba-tiba

AJI Santoso memiliki dua fokus yang harus dipenuhi dalam masa 22 hari Training Center (TC), Timnas U-23. Pertama, harus memperbaiki

7

organisasi permainan dan kedua harus bisa bermain lebih tajam. Karena itulah, dalam sesi latihan Aji sampai turun langsung dan memberikan instruksi penuh dalam latihan. Bahkan, saat latihan berlangsung, sesekali pelatih asli Malang itu menyetopnya. Bukan apa-apa. Dia menghentikan latihan sejenak untuk memperagakan pergerakan yang diinginkannya.

Cara melatih Aji ini sangat berbeda dengan saat dirinya menangani tim Asian Games 2014 silam. Kini, Aji terlihat lebih aktif. Untuk memperkuat pertahanan, dalam sesi latihan sepekan ini Aji memaksimalkan flat back four. Pasalnya, ada gap performa lini belakang saat Hansamu Yama tak berpasangan dengan Manahati Lestussen. Peran Rudolf Yanto Basna, belum begitu terlihat dan masih sering salah komunikasi. “Saya ingin pemain fokus, membuat mereka terbiasa terorganisasi dengan rapi dalam bertahan, juga menyerang,” terangnya.

Bukan hanya dalam bertahan, Aji juga kerap menghentikan latihan sejenak, ketika ada momen bagus yang tak bisa dimanfaatkan para pemainnya. “Saya ingin pemain terbiasa kombinasi, pergerakan tanpa bolanya jalan nggak cuma diam. Saya ingin pemain lebih berani trough pass. Karena itu saya di tengah tadi, karena perlu saya terangkan ketika ada momen bagus,” ucapnya. Aji memiliki waktu sampai 6 Maret mendatang untuk mematangkan performa pemain. Dia ingin tim siap untuk menjalani uji coba melawan Vietnam pada 9 Maret mendatang di Hanoi. (dkk/jpnn)

Lin Dan Memburu Gelar Keenam SETELAH tiga tahun absen, Lin Dan kembali berkompetisi di All England 2015. Tahun ini, Lin akan berupaya untuk menambah koleksi gelar juaranya di turnamen ini menjadi enam. Penampilan terakhir Lin di turnamen yang sudah berusia 116 tahun itu adalah pada 2012. Tiga tahun lalu itu pula, Lin memenangi gelar kelimanya di All England setelah Lee Chong Wei yang jadi lawannya di final mundur di gim kedua. Di All England edisi kali ini, Lin yang kini berusia 31 tahun itu ditempatkan sebagai unggulan kelima. Salah satu kompetitor terberatnya untuk menuju gelar juara adalah kompatriotnya, Chen Long, yang merupakan unggulan teratas. Jika langkah Lin dan Chen

mulus, maka keduanya bisa bentrok di semifinal. Chen yang kini menempati rangking satu dunia itu merupakan juara edisi tahun 2013. Jika bisa merengkuh gelar juara di tahun ini, maka Lin akan menjadi orang keempat yang punya paling tidak enam titel tunggal putra All England. Sebelumnya, sudah ada Frank Devlin (enam gelar juara), Erland Kops (tujuh), dan legenda Indonesia Rudi Hartono (delapan). “Saya sudah bertanding di sini 12 kali dan memenangi lima gelar. Sejarahnya sangat spesial,” ujar Lin seperti dikutip Reuters. Namun sektor tunggal putra All England tahun ini digelar tanpa sang juara bertahan, Lee Chong Wei. Pebulutangkis Malaysia itu tengah

diskors menyusul dugaan kasus doping. “Dia tak sekadar lawan untuk saya, tapi juga teman yang baik. Semoga dia segera kembali,” sahut ‘Super Dan’ soal musuh bebuyutannya itu. Lin akan mengawali langkahnya di All England dengan menghadapi pebulutangkis Hong Kong, Wei Nan, di babak pertama, Rabu (4/ 3/2015) sore waktu setempat.(nds/din/net/ dtc/gen)

PAKAR PENGOBATAN ALAT VITAL SPESIALIS PELARIS DAN PENGASIHAN

BAPAK MAMAN SUBANDI DAN BAPAK YADIN Ditangani oleh Bapak Yadin Dari Pelabuhan Ratu Pantai Selatan IZIN KAZARI : NOMOR. B02/N.4.13/DSP.2/01/

BERGARANSI DISINI JADI AJANG PEMBUKTIAN & YANG GAGAL DI TEMPAT LAIN, KAMI MEMBERI BUKTI BUKAN JANJI, ALAT VITAL BESAR & PANJANG, NO SUNTIKAN, SISLIKON & KIMIA, MURNI TRADISIONAL RAMUAN ALAMI & DOA... DIJAMIN PATEN & PERMANEN, TANPA EFEK SAMPING, BEBAS PANTANGAN UNTUK SEMUA USIA, RAS & AGAMA.

BAGI PRIA : BESAR & PANJANG DISESUAIKAN DENGAN UKURAN YANG DIINGINKAN, PANJANG: 15CM DMT 3CM, PANJANG 17CM DMT 4CM & PANJANG 19CM DMT 19CM.MENJADIKAN ALAT VITAL KERAS, KUAT, & TAHAN LAMA, SANGGUP MELAKUKAN HUBUNGAN SECARA BERULANG-ULANG TANPA OBAT KUAT/ DOPING. MENYEMBUHKAN IMPOTENSI, EJAKULASI DINI, LEMAH SYAWAT, LEMAH KARENA DEABETES, DAN MEMBANTU KELUHAN PADA ALAT VITAL PRIA LAINNYA.

BAGI WANITA: MENAMBAH UKURAN PAYUDARA, MANDUL/INGIN PUNYA KETURUNAN, MENGHILANGKAN KEPUTIHAN DAN MENANGANI KELUHAN PADA WANITA LAINNYA.

* ASMARA BANGUN : UNTUK PASANGAN YANG BERPA LING/ RT YANG RETAK KEMBALI RUKUN * AZIMAH : UNTUK MENARIK REZEKI, BUAT ANDA YANG SUDAH KEMANA-MANA GAGAL HASIL HALAL, UNTUK SOAL ASMARA, RT DIUJUNG KERETAKAN, JODOH, CINTA, KHARISMA, BERKAH DAN BAROKAH WIBAWA, KECANTIKAN, KARIR TERSENDAT, USAHA BANGKRUT, EKONOMI SULIT, * JUGA MELAYANI : PENYEMBUHAN ASMARA TIDAK PERLU DIRAGUKAN, RIBUAN ORANG TELAH TERTOLONG & DIBERIKAN SEJENIS, (GAY, LESBI, BISEX, SOLUSI YANG TERBAIK UNTUK SEMUA AGAMA MENDAPATKAN KEBAHAGIAAN DAN HARAPAN TERCAPAI.

Pastikan ANDA berobat pada AHLI yang benar

Segera Hubungi: Pak Yadin. Praktek menetap di: Jl. Anggur No. 25 A Depan Toko Sharp Dunia Digital Dumai Hp: 0812 6865 3332,

„ REDAKTUR: KAHARUDDIN

HARI LIBUR TETAP DIJAMIN JOS!! „ TATA LETAK: OKKY


8

KAMIS

Sepirit Olahraga Kota Dumai

Dumai Pos

5 MARET 2015 SOUTHAMPTON vs

1

Laporan: NET, Southampton SOUTHAMPTON kembali ke jalur kemenangan di arena Liga Primer Inggris. The Saints menang tipis 10 atas Crystal Palace berkat gol semata wayang Sadio Mane. Southampton akhirakhir ini sedang menurun. Tim besutan Ronald Koeman itu cuma menang sekali dalam lima laga sebelumnya dan kalah tiga kali. Posisi mereka di papan klasemen pun perlahan-lahan melorot. Tapi, Southampton me-

njaga peluang mereka untuk lolos ke kompetisi Eropa musim depan berkat kemenangan atas Palace. Pada laga di St. Mary’s Stadium, Rabu (4/3/2015) dinihari WIB, mereka menang berkat gol Mane pada menit ke-83. Gol Mane tersebut tercipta lewat kerja sama yang apik dengan James WardProwse. Ward-Prowse yang mendapatkan umpan dari Mane melepaskan tembakan dari luar kotak penalti, tapi tembakannya bisa dimentahkan oleh kiper Julian Speroni. Bola muntah mengarah ke Mane, yang

langsung menyonteknya ke dalam gawang. Berkat kemenangan ini, Southampton naik ke urutan kelima klasemen sementara dengan koleksi 49 poin dari 28 pertandingan. Mereka berjarak satu poin dari Manchester United yang menempati posisi keempat. Usaha Southampton untuk merebut tiket ke kompetisi Eropa akan mendapatkan ujian berat pada laga berikutnya. Mereka akan bertandang ke Stamford Bridge dan menantang pimpinan klasemen Chelsea.(net/dtc/gen)

CRYSTAL PALACE

0

Saatnya Menangkan Sisa Laga BARCELONA (DP)- Sejak kehilangan puncak klasemen di pekan sembilan, Barcelona belum pernah lagi naik ke posisi teratas. Kini saat jarak dengan Real Madrid cuma dua poin, Luis Enrique berharap timnya bisa menyapu bersih kemenangan dan jadi juara. Barca kehilangan puncak klasemen di pekan sembilan setelah kalah 13 dari Madrid di Santiago

PT.DASATAMA CEMERLANG MOTORINDO DUMAI JL. JEND. SUDIRMAN DUMAI NO.TELP : 0765 – 37686, NO Hp 0823-9163-2000 ALAMAT EMAIL : dasatamacm_yamaha@yahoo.co.id. CABANG DAELER : 1. DASATAMA SUKAJADI JL.P.DIPONEGORO (EX.SUKAJADI) NO.65 A-B DUMAI NO.TELP : 0765-35241, NO. HP : 0852-6580-9929 2. DASATAMA BAGAN BESAR JL.SOEKARNO HATTA BAGAN BESAR NO.HP: 0853-6333-2574 3. DASATAMA RUPAT JL. SOEBRANTAS (SEI.INJAB) KEL.TERKUL KEC.RUPAT NO. HP : 0821-6989-3145

Bernabeu. Setelah itu The Catalans terus berada di posisi dua di bawah Madrid hingga hari ini. Selisih poin antara Madrid dan Barca terus naik dan turun dalam beberapa pekan terakhir. Kekalahan Madrid atas Atletico Madrid pada pekan 22 membuat Barca sempat berjarak satu sangka saja. Namun pil pahit kekalahan yang didapat Barca saat menjamu

Malaga dua pekan lalu membuat selisihnya kembali lebar ke empat poin. Kondisinya kembali berubah di akhir pekan kemarin. Hasil imbang yang didapat Madrid dengan Villarreal dan kemenangan Barca atas Malaga membuat kedua raksasa Spanyol itu cuma terpaut dua angka saja. Situasi itu membuat peluang Barca jadi juara kembali besar, pe-

rtimbangannya adalah El Clasico yang digelar di Camp Nou pada pekan ketiga Maret ini. Jika bisa menundukkan Rayo Valecano dan Eibar dalam dua pekan ke depan, maka kemenangan di El Clasicoi akan membuat Barca naik lagi ke puncak klasemen. Bisakah Blaugrana melakukannya? .(din/mrp/net/ dtc/gen)

CV. PRIMA YAMAHA NUSANTARA JL. SULTAN HASANUDDIN/ JL.OMBAK NO. 88 A-B TELP. (0765) 35250 FAX . (0765) 31789 CABANG DAELER : 1. CABANG DEALER BUKIT KAPUR JL. SOEKARNO HATTA KM 25 BUKIT KAYU KAPUR HP. 0853-5611-2354 2. CABANG DEALER BUKIT TIMAH JL. BATU BINTANG / CUT NYAK DIEN PURNAMA HP. 0812-686-2134 3. CABANG DEALER BUKIT TIMAH JL. RAYA BUKIT TIMAH KM 7 KEL.MEKAR SARI TELP. (0765) 439347 HP.0812-682-6111 4. CABANG DEALER RUPAT JL. DUSUN II HP. 0852-7138-9886 5. SANTANA JAYA MOTOR JL. RAYA NERBIT KECIL HP. 0853-6579-8000 / 0812-7640-0111

PT. CAPELLA DINAMIK NUSANTARA Jln.Jend Sudirman 371-373 Telp. (0765) 31095 Fax. 31095 Dumai PT.HONDATAMA MITRA CEMERLANG Jln.Ombak 21 A-B Telp.(0765) 32424 Dumai. TOKO "SUZ" HONDA Jln. Sultan Syarif Qasyim Telp.(0765) 31390 Fax. 31390 Dumai - Riau. „ REDAKTUR: GENTA

„ TATA LETAK: EDO PERMATA


METRODUMAI

‰ Dewi Sandra

JAUH Berbeda DEWI Sandra mengalami perubahan yang

BACA DI HAL

Dumai Menuju Kawasan Ekonomi Khusus

16

13.032 WARGA DUMAI KOTA CALON PESERTA JKN BACA DI HAL

BACA DI HAL

Petani Mulai KELUHKAN Pasokan Air DUMAI(DP)— Kondisi musim panas dan kemarau saat ini mulai terasa bagi para petani, dimana pasokan air sulit didapat dan terbatas. Hal ini dikeluhkan langsung petani Miswan, dimana dalam lakukan penananam di ladang saat ini dirinya sangat sulit untuk merawat tanamannya dikarenakan pasokan air menipis. Dan hal ini sangat menjadi dampak pertumbuhan tanamannya, karena selama ini pasokan air didapat dari sumur. Dan parit namun karena kondisi kering saat ini air pun tidak cukup untuk lakukan proses perawatan

9

Dumai Pos

KAMIS

5 MARET 2015

Ini Dumai wak!!!

WAKO: FORUM SKPD SANGAT PENTING

11

HAL

081268903058

Kami Nganggur Pak! Pak Walikota Dumai, tolonglah carikan solusi untuk kami pemuda pengangguran dah penat melamar ke perusahaan di Dumai ni tapi selalu ditolak, katanya banyak rekom pejabat jadi mana rekom untuk kami rakyat kecil ni. Mokasih pak.0812766xxx

12

Khairul Anwar Nyatakan Maju Pilkada

tanamannnya. Disamping itu juga salah seorang petani, Dite menyampaikan pada Rabu (4/3) dimana tanaman kacang yang ditanam sebelumnya subur dan mendapat hasil panen yang memuaskan. Kini hampir selama musim kemarau tanaman kacangnya menyusut dan tingkat hasil panennya tidak memuaskan alias berkurang. Petani berharap agar musim kemarau ini tidak berlangsung cukup lama, hal ini dikarenakan harapan dalam me

„ BACA PETANI KE HAL 10 F: IST

BPTPM Evaluasi

N: OKUME ul D N A K SERAH umai, H Khair an ta D Waliko H menyerahk S Anwar n pendaftaran i e dokum mimpin Duma e , m t a li kemba a r t a i D e m o k r P melalui bu (4/3). Ra

Seluruh Izin Hiburan DUMAI(DP)— Proses penerbitan izin hiburan malam tampaknya menjadi sorotan berbagai pihak, termasuk kinerja dari Badan Pelayanan Terpadu dan Penanaman Modal (BPTPM) sebagai pengeluar izin. Menanggapi itu, Kepala BPTPM Hendri Sandra berkata akan kembali mengkaji ulang dan mengevaluasi seluruh izin hiburan malam yang sudah dikeluarkan termasuk izin permainan anak terindikasi tempat perjudian. “Kita tetap evaluasi setiap izin yang dikeluarkan apalagi disaat proses perpanjangan yang dilakukan 1 kali dalam tahun. Dari situlah kita telaah apakah tempat tersebut mengikuti prosedur sesuai aturan atau tidak, apabila tidak maka akan dipermasalahkan, sehingga bisa mengarah ke pencabutan izin,’’ sebutnya.(dev)

Laporan: DEVI PUTRI, Dumai WALIKOTA Dumai, H Khairul Anwar menyatakan diri maju sebagai calon walikota Kota Dumai periode 2015-2010. Keseriusan Khairul itu dinyatakan saat mendaftarkan diri ke Panitia Penjaringan Bakal Calon Walikota DPC Partai Demokrat Kota Dumai, Rabu (4/ 3) kemarin.

“Saya pikir peluang saya untuk dicalonkan dari Demokrat sudah kandas, karena pendaftaran sudah ditutup. Begitu saya mendengar masih ada peluang dengan dibukanya pendaftaran kembali, saya langsung menghubungi panitia. Alhamdulillah hari ini saya menyatakan siap diusung oleh Demokrat,” ujar Khairul saat menyerahkan berkas pendaftaran ke panitia 7 Partai

Demokrat. Penyerahan berkas dilaksanakan di Gerai Yong Mude, Teluk Makmur. Berbeda dengan kandidat lain yang mendaftar ke Partai Demokrat, saat pendaftaran kemarin, Khairul hanya ditemani oleh beberapa orang timnya. Sementara dari Partai Demokrat, selain panitia penjaringan yang dipimpin oleh Heriyadi Suparlan, juga tampak

hadir sejumlah pengurus cabang dan seluruh ketua ranting Partai Demokrat se-Kota Dumai. Kepastian dirinya maju kembali pada Pilkada, menurut Khairul, baru ia putuskan beberapa minggu yang lalu. “Selama ini saya tidak memikirkan maju atau tidak. Yang paling utama bagi saya adalah

„ BACA KHAIRUL KE HAL 10

Komisi II Tinjau Harga

Barang di Pasar

F: RIAN

TINJAU PASAR: Anggota Komisi II DPRD Kota Dumai meninjau kenaikan harga kebutuhan pokok disejumlah pasar tradisional Kota Dumai, Rabu (4/3).

DUMAI(DP)— Anggota DPRD Komisi II Kota Dumai beserta rombongan dari Dinas Perdagangan dan Kantor Pelayanan Pasar Kota Dumai, turun lapangan (turlap) yakni kesejumlah pasar yang terdapat di Kota Dumai Rabu (4/3) sekitar pukul 09.00 WIB. Dalam kunjungan yang dilakukan Anggota DPRD Komisi II Kota Dumai beserta rombongan kali ini, bertujuan untuk mengecek langsung tarif harga penjualan sembako yang berlangsung di Kota Dumai, atas kenaikan tarif BBM yang dilakukan pemerintah pusat. Dari tinjauan yang dilakukan tersebut, untuk tarif sembako yang berlangsung di pasar-pasar tradisional Kota Dumai masih tergolong relatif standar, dan

masih dapat dijangkau oleh konsumen. Seperti yang disampaikan oleh Kepala Bidang Perdagangan Disperindag Kota Dumai Kamaruddin diselah-selah kunjungan yang berlangsung dipasar tradisional Kota Dumai pada Rabu (4/ 3), untuk tarif harga sembako yang berlangsung dipasar-pasar tradisional masih relatif standar, belum ada gejolak harga atas kenaikan BBM. Menurut Kamaruddin, kunjungan lapangan yang dilakukan, bekerja sama dengan pihak kantor pelayan pasar dan Anggota DPRD Komisi II Kota Dumai, merupakan bentuk antisipasi Pemerintah Kota Dumai atas kenaikan tarif BBM yang dilakukan oleh Pemerintah Pusat. “Untuk harga sembako yang

berada dipasar tradisional Kota Dumai, pasca kenaikan tarif BBM oleh Pemerintah Pusat, tidak mengalami perubahan tarif yang signifikan. dimana harga sembako yang diletakkan para pedagang masih relatif normal,’’ jelas Kamaruddin. Sementara itu Anggota Komisi II DPRD Dumai Paruntungan Pane menambahkan kunjungan kali ini juga bertujuan untuk memantau sejumlah harga barang, yang dikabarkan mengalami kenaikan. Namun disampaikan pane, selama kunjungan yang dilakukan pihaknya beserta rombongan tidak menemukan, isu tersebut dengan kata lain, harga masih normal. “Saat ini, kondisi harga

„ BACA KOMISI KE HAL 10

‰ Jalur Independen Menuju Pilkada Kota Dumai

Ahmad Maritulius Lirik Perwira Polisi DUMAI(DP)— Konstalasi politik jelang Pilkada Dumai 2015 terus meningkat. Sejumlah partai politik sudah mulai melakukan penjaringan terhadap bakal calon yang akan diusung nantinya. Diantaranya Partai Demokrat, Nasdem, PPP dan lainnya. Tidak hanya di tingkat partai politik, sejumlah nama yang bertekad maju melalui jalur independen juga tengah melakukan hal yang sama. Bedanya, penjaringan yang dilakukan yakni untuk posisi pendamping. Salah satunya seperti yang tengah dilaksanakan Ahmad Maritulius, SE yang bertekad maju pada Pilkada Dumai 2015 ini. ‘’Kita tengah menjaring sejumlah nama sebagai pendamping saya. Selain itu kita juga tetap membangun komunikasi dengan teman-te„ REDAKTUR: SYARIFAH DIAN EKA SARI

man di partai politik,’’ ungkap Ahmad Maritulius SE kepada Dumai Pos Rabu (4/3) siang kemarin. Menurut pengusaha media ini, pihaknya akan melibatkan Tim Pemenangan dan Relawan Ahmad Maritulius untuk memutuskan pendampingnya nanti. Sumbang saran serta masukan dari tim serta relawan sangat dibutuhkan. Apalagi, dalam perjuangan yang dilakukan tetap mengedepankan semangat kebersamaan dan kekeluargaan. ‘’Memang saat ini ada beberapa nama. Kita juga sudah berkomunikasi dengan salah seorang perwira di Mabes Polri. Dalam waktu dekat ini kita akan menggelar pertemuan kedua di Jakarta,’’ sebut Ahmad Maritilus yang merupakan putra pensiunan TNI Angkatan Darat ini.

Hanya saja, dia masih menutup rapat informasi tentang nama perwira Mabes Polri yang bakal digandengnya itu. Dari mulutnya hanya meluncur kalimat kalau bakal calon pendampingnya itu sangat mengenal Kota Dumai. ‘’Nama lengkapnya nanti saja, yang pasti dia tahu kondisi Dumai secara menyeluruh,’’ ujar Ahmad M. Kemudian menjawab pertanyaan sejauh mana langkah yang sudah dilakukan untuk maju melalui jalur independen, dikatakan Ahmad Maritulius dirinya sudah bergerak sejak 1,5 tahun lalu melakukan sosialisasi ke masyarakat akar rumput. Dari silaturrahmi dan komunikasi yang dilakukan, respon yang muncul sangat positif. Hal itu dibuktikan dengan terus bertambahnya dukungan serta relawan

yang saat ini sudah berjumlah ribuan. “ Saya bergerak sudah sejak satu setengah tahun lalu, ini bukti keseriusan saya maju di Pilkada Dumai. ‘’Alhamdulillah, mendapat respon cukup positif, terutama dari masyarakat yang tinggal di daerah pinggiran. Jumlah relawan yang awalnya hanya puluhan, sekarang sudah ribuan,’’ ujarnya Terakhir dikatakan Ahmad Maritulius, tekadnya maju sebagai walikota didasari nawaitu yang kuat untuk mengabdikan diri bagi kampung halamannya. ‘’Sebagai anak yang dilahirkan, dibesarkan dan menetap di sini, saya berhutang banyak dengan Dumai. Sekarang saatnya saya membayar dengan mewakafkan diri untuk kepentingan negeri ini,’ ujar dia.(dev) „ TATA LETAK: TRIA


METRO DUMAI

10 Dumai Pos

Dumai Kota - Dumai Barat - Dumai Timur - Dumai Selatan

KAMIS 5 MARET 2015

SBKD Ajak Buruh Berbenah „ Hadapi MEA 2015 Laporan : IRMEN, Dumai

FOTO BERSAMA:Pengurus SBKD berfoto bersama dengan para anggota, kemarin.

FOTO IRMEN

Khairul Anwar Nyatakan Maju di Pilkada Sambungan dari.......hal 9 menuntaskan program kerja yang masih tersisa. Walaupun saya sakit, saya terus bekerja. Bahkan harus bolak-balik ke Jakarta untuk memperjuangkan dana APBN agar mengucur ke Dumai,” papar Khairul. Selain program pembangunan, fokus kedua yang dia lakukan adalah masalah kesehatannya. “Alhamdulillah, sejak dua bulan terakhir sudah mulai membaik. Atas izin Allah, berkat doa masyarakat Kota Dumai serta pengobatan dan terapi rutin

„ REDAKTUR: FITRIANI

maka saya akan sembuh,” kata Khairul. Keinginan kembali maju memimpin Kota Dumai juga didasarkan pada pertimbangan sejumlah program pembangunan yang perlu kelanjutannya. Terutama pembangunan infrastruktur yang selama ini menjadi keinginan masyarakat untuk dilanjutkan dan dituntaskan. “Tentang apa yang telah dibuat dan dikerjakan selama kepemimpinan saya, biarlah masyarakat yang menilai. Tentulah masyarakat dapat merasakan perbedaan

kondisi Dumai saat ini dengan 4 tahun yang lalu,” kata Khairul. Dengan mendaftarnya Khairul ke Demokrat Dumai, dengan demikian hingga kemarin sudah 8 orang bakal calon walikota yang akan diseleksi oleh tim 7 Partai Demokrat. Mereka adalah Surianto, M. Ikhsan, Surya Irianto, Abul Kasim, Zulkifli As, Asmirin Usman, Agus Wiadayat dan Khairul Anwar. “Memang kemarin sudah ditutup. Namun berdasarkan hasil rapat di Batam beberapa waktu lalu, diptus-

kan untuk memperpanjang pendaftaran. Karena kami ingin membuka peluang seluas-luasnya. Sesuai keinginan kami agar Demokrat tidak kalah lagi,” ujar Ketua Tim Penjaringan Bakal Calon Walikota Dumai DPC Partai Demokrat, Hariyadi Suparlan. Tentang penilaian, Hariyadi menjelaskan bahwa patokannya adalah tetap pada popularitas dan elektabilitas. “Itu yang menentukan adalah hasil survey dari lembaga survey nasional yang ditunjuk DPP,” ujar Hariyadi.(des)

KETUA Umum Serikat Buruh kota Dumai (SBKD), Saiful Azhar mengajak seluruh buruh untuk mempersiapkan diri jelang pemberlakuan Masyarakat Ekonomi ASEAN (MEA) yang mulai diberlakukan akhir tahun ini. “Mau tidak mau kita harus terus membenahi diri, sebab dengan masuknya MEA persaingan dalam pembangunan ekonomi akan lebih kompetitif,” ujarnya. Wejangan itu disampaikan Syaiful dalam silaturrahmi bersama jajaran Pengurus Unit Kerja (UK) SBKD se-Kota Dumai di Hotel Comfort, Rabu (4/3) kemarin. Syaiful menjelaskan SBKD yang telah terbentuk sejak 3 tahun lalu, bertujuan untuk memperjuangkan hak-hak Buruh dan juga anak-anak tempatan

untuk mendapatkan peluang-peluang kerja yang ada di negeri sendiri. Dia juga meminta agar buruh dapat menyikapi pahit manis kehidupan sebagai pengalaman berharga untuk menjadi lebih baik. “Awalnya saya mulai sebagai buruh lapangan, kemudian bertahap menjadi mandor dan sekarang dipercaya sebagai Ketua SBKD. Tentu ada pahit manis namun semua itu dilalui sebagai pengalaman serta motivasi dalam hidup,” ungkap Sekretaris Komisi I DPRD Dumai ini. Sementara itu Ketua Panitia, M. Yunus Hasibuan, menyampaikan bahwasanya kegiatan silaturrahmi tersebut adalah berdasarkan hasil musyawarah Pengurus DPK SBKD beberapa waktu lalu. Tujuannya adalah agar sesama Pengurus baik di DPK

Maupun UK SBKD saling kenal, kompak dan solid satu sama lainnya. Disamping itu, melakukan pendataan ulang terhadap anggota ataupun Pengurus yang ada di tingkat UK SBKD. Kegiatan yang mengangkat tema ‘Mantapkan kekompakan, pembaharuan serta profesionalitas perburuhan guna terwujudnya ketahanan dan kesejahteraan dalam menghadapi globalisasi’ juga digunakan untuk sosialisasi kepesertaan program BPJS Ketenagakerjaan. “Tujuannya agar sesama Pengurus saling kenal dan kompak. Selain itu momen kegiatan ini juga untuk sosialisasi kepesertaan program BPJS Ketenagakerjaan, agar Buruh mengetahui pentingnya keselamatan kerja,” kata M Yunus yang juga sebagai Ketua I di DPK SBKD. (fit)

Komisi II Tinjau Harga Barang di Pasar Sambungan dari.......hal 9 pasar, masih stabil dan tidak ada harga barang yang naik dengan nilai tinggi,” ujar Pane.

Pantauan Dumai Pos di lapangan, kunjungan yang dilakukan oleh Anggota DPRD Komisi II Kota Dumai beserta rombongan dari pihak Disperindag dan Kantor

Pelayanan Pasar Kota Dumai mengunjungi 2 Pasar Tradisional Kota Dumai, yang berada di Pasar Senggol dan Pasar Bunda Sri Mersing.(ras)

Petani Mulai Keluhkan Pasokan Air Sambungan dari.......hal 9 menuhi kebutuhan perekonomian keluarganya dari hasil pertanian selama ini. Melihat kondisi lahan

pertanian dengan musim kemarau ini petani hanya pasrah dan lakukan sedaya upaya untuk memproduksi hasil panennya dikarenakan pereekonomian

saat ini agak macet dan melemah akibatnya berdampak terhadap masyarakat khususnya kalangan petani diwilayah ini.(rmd)

„ TATA LETAK: ANTO


METRO DUMAI Dumai Pos

11

Sungai Sembilan - Medang Kampai - Bukit Kapur

13.032 Warga Dumai Kota Calon Peserta JKN Laporan : RUKIAH ANITA, Dumai SAMA haklnya dengan tiga Kecamatan lain seperti Kecamatan Dumai Selatang, Medang Kampai dan Dumai Barat, setelah dilakukan tiga kali proses verifikasi, Calon peserta Jaminan Kesehatan Nasional (JKN) untuk Kecamatan Dumai Kota akhirnya diumumkan kepublik (lihat Halaman 35,red), dimana dari Lima yang ada, calon peserta JKN untuk Kecamatan Dumai Kota ini 13.032 jiwa. Hal ini disampaikan Kepala

Dinas Kesehatan Kota Dumai, H Kelurahan Sukajadi 3.422 jiwa, Paisal SKM MARS keKelurahan Laksamapada Dumai Pos, Rana 1.298 jiwa, Kelurabu (4/3). han Dumai Kota 2.266 ‘’Sebelum diumujiwa dan Kelurahan mkan kepublik, tim Bintan 1.621 jiwa sehtelah melakukan veriingga total 13.032 jifikasi sebanyak tiga wa,’’ rinci Paisal. kali yang melibatkan Dijelaskan Paisal, Ketua RT, Kelurahan Kepesertaannya di bahkan Kecamatan BPJS akan dibiayai agar diperoleh data oleh Pemko Dumai yang valid,”ujarnya. sharing Budget denH. Paisal Dari dua Kecamagan Provinsi, dimana tan tersebut Khusus Kecamatan untuk warga yang kepesertaan Dumai Kota, untuk Kelurahan JKN ditanggung Pemko ini akan Rimba Sekampung 4.425 Jiwa, mendapat fasilitas pelayanan

kelas III, sedangkan untuk Ketua RT, Kader, LPMK mendapat fasilitas di Kelas II,’’ terangnya. Karena, Kata Paisal data tersebut selain warga kurang mampu juga termasuk Ketua RT dan Kader kesehatan dimana nantinya data ini akan disingkronkan dengan BPJS kesehatan untuk dapatkan data yang benar-benar valid apakah warga yang terdata ini sebelumnya telah terdaftar di BPJS apa belum agar tidak terjadi tumpang tindih data. ‘’ Syarat warga yang menjadi peserta JKN ini harus memiliki KK dan KTP Elektronik jadi jika

warga yang telah terdata ini belum memiliki e-KTP harus segera mengurusnya di Disdukcapil untuk itu kami telah berkoordinasi dengan Disdukcapil,Saat ini Dinas Kesehatan sedang dalam tahap menyingkronkan data dengan BPJS,’’ ucapnya. Untuk itu sebelum keluarnya Kartu JKN, Masyarakat kurang mampu tidak perlu khawatir jika ingin berobatmasih bisa dengan cara menunjukkan KTP, Kartu Keluarga dan Kartu Miskin, namun jika data sudah final dan sudah ada Kartu JKN maka syaratnya harus menunjukkan kartu JKN tersebut. (rka)

F:RUKIAH ANITA

FOTO BERSAMA : Instsiawati Ayus, Gedang bersama sejumlah tokoh masyarakat dan pedagang pasar tradisional Gedang.

Instsiawati Ayus Resmikan Pasar Panglima Gedang „ Pedagang Diminta Tetap Solid

F:RUKIAH ANITA

Instsiawati Ayus saat meresmikan pasar Panglima Gedang DUMAI(DP)— Sejak beroperasi beberapa bulan belakangan ini, akhirnya Rabu (4/3) Pasar Panglima Gedang diresmikan oleh Intsiawati Ayus SH MH yang merupakan Anggota DPD RI.

Dikesempatan ini Pendirian Pasar Panglima Gedang H Awaluddin yang akrab disapa Gedang menuturkan bahwa awalnya pasar ini didirikan karena sebagai Putra melayu asli Dumai dirinya terpangggil

untuk membenahi dan mengambil langkah untuk membantu perekonomian Kota Dumai, terlebih lagi semua pedagang yang berdagang disini berasal dari pedagang Eks Pasar Dock. ‘’ Jelas saya dan pedagang sangat senang atas kedatangan instsiawati Ayus yang bersedia meresmikan pasar ini karena disela kesibukannya sebagai anggota DPD RI menyempatkan diri untuk meresmikan dan meninjau keberadaan pasar ini,’’ujar Gedang. Ditambahkan Gedang, pendirian pasar memang terus menuai kontraversi tetapi dirinya tidak gentar mengingat niatnya hanya ingin membantu perekonomian masyarakat Kota Dumai. Salah seorang Perwakilan pedagang pasar mengucapkan terimakasih kepada Gedang selaku pencetus pendirian

pasar ini, dengan adanya Pasar ini mampu menghidupkan perekonomian masyarakat. ‘’Keberadaan pasar ini sangat membantu pedagang pasca ditutupnya pasar dock, kedepannya diharapkan menjadi salah satu pasar yang ramai dikunjungi masyarakat Dumai,’’harapnya. Sementara itu Intsiawati Ayus menegaskan suka tidak suka, merestui atau tidak beberapa pihak terkait keberadaan pasar ini, keberadaan pasar ini hanyalah untuk sebuah kebutuhan ‘’Terkait status tanah pasar ini biarkan prosesnya berjalan, buat saya pendirian pasar ini hanya untuk sebuah kebutuhan, kebutuhan agar bisa bertahan hidup,’’ujarnya. Maka dari itu wanita Kelahiran Bengkalis ini meminta kepada pedagang untuk solid, tetap santun, menjaga ketert-

dan pendidikan agama, makanya saya berharap Kepala KUA yang telah dilantik

DUMAI (DP) - Pemuka masyarakat Kelurahan Ratusima, Irfan mendesak agar pihak kelurahan segera melakukan suksesi pemilihan Ketua Usaha Ekonomi Kerakyatan Simpan Pinjam (UEK SP) Ratusima yang baru menyusul terjadinya kekosongan jabatan pasca wafatnya ketua yang lama, Bahtiar. Irfan mengharapkan seleksi pemilihan yang dilakukan pihak kelurahan menjunjung azas transparansi, dilakukan secara terbuka dan dapat diikuti oleh seluruh warga yang berdomisili di kelurahan Ratusima. “Sudah saatnya pihak kelurahan membuka pencalonan ketua UEK SP Ratusima secara luas, terbuka dan transparansi, agar dalam menentukan Ketua UEK SP masyarakat tidak pilih ‘kucing dalam karung’,” ujar Irfan kepada Dumai Pos Rabu (4/3). Menurut dia pemilihan Ketua secara terbuka harus segera dilakukan agar pelaksanaan program ekonomi kerakyatan lewat kegiatan simpan pinjam kepada masyarakat pemanfaat tetap berjalan lancar, tertib dan kondusif. Dia juga meminta agar pihak kelurahan secepatnya mensosialisasikan secara luas ke masyarakat melalui Ketua RT . Menanggapi isu yang beredar bahwa pihak kelurahan akan menempati calon ketua UEK SP dari kalangan PNS, Irfan berpendapat seyogyanya calon ketua UEK SP tidak terikat secara kedinasan dan tidak melakukan rangkap jabatan. “Setidaknya calon itu bukan dari kalangan PNS, kalau udah rangkap jabatan, kinerjanya tidak akan maksimal. Siapa pun boleh tampil asal mampu dan mau serta memiliki visi yang jelas untuk mengembangkan UEK SP Ratusima ini,” tukasnya. Sementara itu, Lurah Ratusima, Dimas menjelaskan bahwa saat ini pihaknya belum melakukan pemilihan ketua UEK SP mengingat masih dalam suasana duka. “Ini bentuk kita menghargai jasa almarhum yang telah lama mengabdikan diri di UEK SP Ratusima makanya untuk sementara waktu ini pemilihan belum dilakukan,” ucap Dimas. Kendati demikian sambung Dimas, hal itu tidak mempengaruhi proses penyaluran dana bergulir kepada masyarakat pemanfaat. “Penyaluran pinjaman tetap terlaksana karena sebagian besar sudah diproses dan tinggal tahap pencairan,” ungkapnya. Terkait suksesi Ketua UEK SP ini, Dimas menerangkan pihaknya akan mengikuti aturan terkait pemilihan pengurus UEK SP sebagaimana ketentuan yang berlaku. Namun senada dengan Irfan, Dimas juga tidak sepakat jika pengurus UEK SP diisi oleh pegawai PNS. “Pemilihan ini terbuka karena siapa saja bisa menjadi pengurus UEK SP, pihak kelurahan hanya menentukan kriteria, sedangkan pemilihan dilakukan oleh Ketua RT dan perwakilan masyarakat, namun terkait waktu pelaksanaan akan kita rembugkan bersama LPMK, karena saat ini masih suasana berduka,” ungkapnya. (men)

bisa menjalankan tugas dan fungsinya dengan baik,’’ harapnya. (rka)

HAK ASASI MANUSIA RI, JALAN HR.RASUNA SAID, KAV 6-7 JAKARTA SELATAN DALAM WAKTU 60 HARI, TERHITUNG DARI TANGGAL PENGUMUMAN INI.----------------------------DIREKSI "PT.DUMAI MANDIRI TELEVISI"

AYO BERLANGGANAN IKLAN DI DUMAIPOS

12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901

camatan 2015. ‘’Saya telah melantik Surya Hudaya SAg SH sebagai KUA Dumai Kota dan HM Yunus SAg M SHI sebagai Kepala KUA Dumai Selatan,’’ujarnya. Dengan telah dilantiknya KUA Defenitif ini sebagai Garda terdepan dalam membangun keagamaan diharapkan Kepala KUA dapat melaksanakan tugas dan fungsinya. ‘’Yang perlu diketahui, Tugas dan fungsi Kepala KUA bukan saja soal menikahkan tetapi juga masalah haji, zakat, kemasjidan

Pemilihan Ketua UEK SP Ratusima Harus Transparan

iban dan keamanan. ‘’Dikesempatan ini saya tegaskan dan sampaikan bahwa saya akan menjadi pelindung Pasar Panglima Gedang ini, makanya saya minta kepada pedagang untuk tetap menjaga kekompakkan,’’ujarnya. Turut hadir dikegiatan peresmian Pasar ini tokoh masyarakat Zulkifli Ahad yang juga PENGUMUMAN Ketua DPD Golkar Dumai, Owner BERDASARKAN AKTE NOMOR : 39, TANGGAL 27 FEBRUARI Hotel Sri Kembar 2015,YANG DIBUAT DIHADAPAN H.ISMAIL,SH, NOTARIS DI H Nasir serta To- KOTA DUMAI,TELAH DIBUBARKAN PERSEROAN TERBATAS : -----------------koh lainnya, di- --------- "P.T. DUMAI MANDIRI TELEVISI"----------------kegiatan ini Inst- BERKEDUDUKAN DI KOTA DUMAI. ---------------------------siawati Ayus di- -SELANJUTNYA TELAH DIANGKAT SELAKU PENYELESAI dampingi Pangli- (LIKWIDATOR) MENGENAI PEMBUBARAN PERSEROAN ma Gedang juga TERSEBUT : ---------------berkesempatan TUAN TERISNO, BERTEMPAT TINGGAL DI JL. SULTAN SYARIF meninjau langsu- KASIM, NO.329, RT.003, KEL.SUKAJADI, KEC.DUMAI KOTA, ng pasar dan ber- KOTA DUMAI. KEBERATAN / SANGGAHAN PEMBUBARAN TERSEBUT DAPAT DIAJUKAN KEPADA MENTERI HUKUM DAN dialog dengan pe- HAK AZASI MANUSIA RI MELALUI DIREKTUR JENDERAL dagang. (rka) ADMINISTRASI HUKUM UMUM KEMENTERIAN HUKUM DAN

Ka Kemenag Lantik KUA Dumai Kota dan Dumai Selatan DUMAI(DP)— LT), namun pada Pasca terbentukRabu (4/3) Kenya Kecamatan pala Kantor KeDumai Kota dan menterian ADumai Selatan begama ( Ka Kemeberapa tahun lalu nag) Dumai meotomatis melantik Kepala mbuat sejumlah KUA defenitif Upika harus teruntuk dua Kecabentuk sama halnmatan tersebut. ya seperti Kantor Kepada DuUrusan Agama mai Pos, Ka KeDarawi (KUA). menag, H DaraDimana sebelumnya Ke- wi menuturkan terbentuknpala KUA Dumai Kota dan ya KUA di dua Kecamatan Dumai Selatan masih dijabat tersebut berdasarkan KMS Petugas Pelaksana Teknis (P- no 10/2015 tentang KUA Ke-

KAMIS 5 MARET 2015

„ REDAKTUR: RUKIAH ANITA

„ TATA LETAK: OKKY


12

DUMAI

KOTA KITA

Dumai Pos elamat Pagi Pembaca... S Para pembaca sekalian punya masalah? Apakah itu terkait pelayanan publik, keluhan mengenai listrik, air, telepon, pelayanan transportasi, pengurusan KTP, paspor, kamtibmas dan lain-lain. Silahkan SMS

0852-7801-8882

T

ELEPON

P

ENTING

Polres RSUD Patroli Samapta

0765-31007 0765-38367 081378594800

Sat Lantas

0765-31266

KAMIS 5 MARET 2015

Pemadam Kebakaran

0765-38208

Kodim 0303 Dumai

0765-31303

Penjagaan Dumai

0765-31110

PLN Dumai

0765-37123

Unit Lakalantas

085271227033

RS Bhayangkara Dumai

0765-36942

Polsek Dumai Barat

081378946000

Lanal Dumai

0765-31105

PMI

0765-37838

KPPP Dumai

0765-31690

Wako: Forum SKPD Sangat Penting Laporan: DEVI PUTRI, Dumai WALIKOTA Dumai H Khairul Anwar membuka secara resmi kegiatan forum Satuan perangkat Kerja Daerah (SKPD) tahun 2015, dalam rangka penyusunan rencana kerja pemerintah daerah tahun 2016, Rabu (4/3) kemarin. Walikota Dumai, H Khairul Anwar dalam sambutan singkat nya mengatakan, fo-

rum SKPD kota Dumai merupakan salah satu instrument penting, dalam alur mekanisme perencanaan pembangunan daerah, dalam penyusunan perioritas anggaran tahun 2016, dalam menentukan bentuk dan jenis penyelenggaraan tugas pokok dan fungsinya berdasarkan kebutuhan, partisipasi masyarakat dan aspirasi pemangku kepentingan lain. ‘’Dari musyawarah rencana pembangunan ditingkat

kecamatan dengan memperhatikan skala prioritas nantinya aka dibahas dalam musrenbang tingkat kota Dumai,’’ katanya. Menurutnya, arah pembangunan kotaDumai tahun 2016 mengacu kepada visi pembangunan nasional dalam RPJMN tahun 2015-2019 yakni terwujudnya Indonesia yang berdaulat, mandiri, dan berkepribadian berlandaskan dengan gotong royong. Pada RPJMN 2010-2014

pemerintah menjalankan 14 prioritas nasional, maka pada RPJMN pemerintah menjalankan 9 agenda pembangunan yang dilakukan melalui 3 dimensi yakni pembangunan manusia yang terdiri pendidikan, kesehatan, perumahan, dan karakter, sementara pembangunan sector unggulan yakni kedaulatan pangan, kedaulatan energy dan ketenaga listrikan, kemaritiman dan kedaulatan serta pariwisata dan industry

kemudian pemerataan dan kewilayahan, jelasnya. Dalam implementasi misi RPJMN lanjutnya, yakni mewujudkan keamanan nasional yang mampu menjaga kedaulatan wilayah, mwujudkan masyarakat maju, mewujudkan politik luar negeri bebas aktif dan memprkuat jati diri sebagai Negara maritime, mewujudkan bangsa yang berdaya saing, mewujudkan menjadi Negara maritime yang mandiri, maju dan kuat

dan mewujudkan masyarakat yang berkepribadian dan kebudayaan. Selain itu, kota Dumai diarahkan sebagai pusat kegiatan nasional dengan focus sebagai pusat administrasi pelintas batas yang berfungsi sebagai outlet pemasaran wilayah Riau bagian timur. Wako meminta kepada SKPD yang terkait langsung dengan kepentingan masyarakat agar secara sungguhsungguh mempertimbang-

kan semua usulan delegasi kecamatan yang menjadi skala prioritas dan memasukkan dalam rencana kerja SKPD tahun 2016. Delegasi kecamatan se Kota Dumai diharapkan dapat mengawal musrenbang kelurahan dan musrembang kecamatan, dan musrembang kota Dumai nantinya dapat dikawal kembali dengan memperhatikanskala prioritas masyarakat berdasarkan rapat pembahasan.(gen)

Mari Jaga Kehidupan Beragama Q Wujudkan Visi Kota Dumai

Walikota Dumai H Kharul Anwar menyampaikan pengarahan dalam kegiatan Forum SKPD tahun 2015 di Balai Sribunga Tanjung.

Dumai Segera Bangun Water Park DUMAI (DP)- Untuk men- sebab disana ada lahan yang Hektare, kata dia. vinsi mengenai ini. Dalam alnya usulan itu diajukan ingkatkan Pendapatan Asli dimiliki Pemko seluas 42 HekMengenai, DED sudah usulan kita menganggarkan awal Januari 2015 ini. KenDaerah ( PAD) Dumai dan tare. kita persiapkan konsepnya, sebesar Rp 26 Milyar , dan dati begitu mereka respon menjawab kegundahan mas“ Lahan tersebut seluas namun semua itu tentu bu- alhamdullilah mereka re- leboih cepat , pasalnta telah yarakat akan minimnya k- 42 Hektare, namun untuk tuh dana yang cukup besar, spon akan hal ini. “ Mudah, menghubungi kita dengan etersediaan tempat pariwi- pembangunan WaterPark maka itu saya telah menga- mudahan bisa terealisasi membawa angin segar.sata diDumai, Pemerintah dibutuhkan lahan seluas 20 jukan bantuan dana ke Pro- ditahun 2016 nanti,pas- (dev) Kota Dumai melalui Dinas Pariwisata dan kebudayaan( Disbudparpora) sedang menjemput bola ke Provinsi mengajukan bantuan dana terhadap perencanaan Lowongan KEHILANGAN DIJUAL LOWONGAN LOWONGAN SURYA NIAGA pembangunan WaTELAH HILANG SEBUAH DIJUAL RUMAH,SHM,3 KM.TDR,2 ter Park. PELUANG EMAS PELUANG EMAS JAYA BPKB A/N NURHAYATI Hal tersebut disKM.TDR,2 K.MANDI,1 DAPUR, BERKARIER DI CREW BERKARIER DI DUNIA Jl. Sultan Syarif Kasim DENGAN 1 R.TAMU, ampaikan KadisbudpMASKAPAI PENERBANGAN ANAK-ANAK UNTUK NO BPKB: I08017239D. arpora melalui bidang 1 R.KEL,1 R.MKN,2 TERAS,LISTRIK UNTUK LULUSAN LULUSAN HILANG SEKITAR pariwisata Dumai su900 WATT,FULL KERAMIK, MENJUAL SMU/SMK, ADA TRAINING SMU/SMK, DIDIDIK & JL.SUDIRMAN PAGAR KELILING, wandi kepada Dumai Alat-alat Tulis, Kantor, SINGKAT. DISALURKAN MENJADI DAN SULTAN SYARIF pos. Menurut dia, renADA 2 BUAH POLYTANK 2000 LT,1 HUB: P.ASHARI, GURU PAUD/ PG & TK. Kantor & Olahraga KASIM. cana pembangunan SANYO,PAGAR KELILING,UK TANAH JL.NURI NO.2 DUMAI HUB: P.ASHARI, BAGI YANG MENEMUKAN & Foto Copy 17 X 17 M2, Water Park akan dipuSILAHKAN HUB KE NO: TLP: 0812 6498 4183 JL.NURI NO.2 DUMAI satkan daerah keluraHARGA 400 JT(NEG0). Telp (0765) 31288 0811 750 2304 TLP: 0812 6498 4183 han Mudam kecamaMINAT HUB: 0812 7655 5541 (TANPA 0813 6497 6656 PERANTARA) tan Medang Kampai

DUMAI (DP)- Pemko Dumai nya, kehidupan beragama meruberkomitmen untuk menjaga pakan sesuatu yang mungkin didan mengembangkan kehidu- capai dan menjadi lebih baik. pan beragama agar Karenabelajarmerutetap hidup subur pakanlangkahpertadan tumbuh ma untuk berubah kembang dengan menjadi baik. baik mewarnai keLanjutnya, sesuai hidupan dan buhasil musyawarah daya masyarakat. dan mufakat beberaHal itu, untuk pa tokoh agama dan mewujudkan visi unsur Kemenag DuKota Dumai menmai bersama kepala jadi kota yang agaKUA se Kota Dumai mis dan maju. “Semerupakan penangH Asnam Kabag mentara komitmegungjawab kehiduKesra Setdako n pemerintah, mpan beragama. NaDumai enjaga dan mengemun demikian pembangkan kehidumerintah terus bahu pan beragama di Dumai yang membahu menjaga dan diterjemahkan dengan obyek dan mengembangkan kehidupan besubyek berupa memberikan ban- ragama. tuan hibah dan bansos,” kata KaMakanya untuk mewujudkan bag Kesra Setdako Dumai H As- impian tersebut akan dilaksananam, Rabu (4/3). kan studi banding ke salah satu Seperti bantuan untuk rumah daerah yang kehidupan beragibadah, guru-guru agama dan amanya bergerak dinamis yang TPQ, ormas keagamaan, pen- bisa diaplikasikan di Kota Dudampinganpemberangkatandan mai. Sedangkan yang akan dipejemputan jamaah haji, penga- pelajari soal, permasalahan jian rutin jamaah haji, pelatihan keagamaan dan dakwah, kopara imam, dan peningkatan ko- mitmen dan kebijakan pemermpetensi da’i. intah dalam menjaga kehiduKata mantan pejabat Bappe- pan beragama.(wan) da ini menambahkan, untuk meningkatkan kualitas kehidupan beragama di Dumai tentunya pemerintah Kota Dumai belum merasa cukup dengan apa yang dilakukan selama ini. Menurut-

LOWONGAN KERJA

)

Apakah Anda belum bekerja ? Kami sebuah perusahaan yang bergerak di bidang konsultan kesehatan membutuhkan beberapa orang untuk posisi : 1.Teknisi 2.Konsultan Kesehatan 3.Driver Dengan kualifikasi sbb : 1.Pria/Wanita 17-30 Tahun 2.Pendidikan Minimal SMA Sederajat 3.Mampu berkomunikasi dengan baik 4.Berpenampilan menarik dan serasi Fasilitas : 1.Gaji +Transport + Bonus 2.Income minimal 2 Juta 3.Tunjangan Training Rp 350.000 4.Pendidikan dalam dan luar Negeri Lux Bussines School dan Lux Akademi dengan biaya perusahaan 5.Bekerja menggunakan kendaraan dari perusahaan. Anda yang memenuhi syarat di atas langsung untuk interview dengan membawa surat lamaran lengkap ke alamat : PT. LUXINDO RAYA Jl. Jeruk No. 6 D Dumai Telp.0765.440705 Antar Lamaran Pada tanggal Tgl. 4, 5, 6 Maret 2015 Jam 09.00 s/d 12.00 WIB Up. Bpk. Ivan Naipospos Perhatian;Diberitahukan kepada seluruh costumer PT .Luxindo Raya .Tetap Waspada terhadap penipuan yang berkedok teknisi atau collector gadungan yang datang atau berkunjung ke rumah bapak/ ibu.

)

)

)

)

)

)

TRAVEL KAFILAH Armada INNOVA Tujuan : Dumai - Duri Pekanbaru (PP) Dumai : Jl. Nusantara 20 D Tlp : 0765-37059/7072609/ 081275329799 Pekanbaru : Jl.Perkutut No.007 (sukajadi) Tlp : 0761 - 0864554/3031633/ 081276141007 antar jemput bandara & charteran CV DUA PUTRA Armada : Kijang Innova Tujuan : Dumai-PekanbaruTembilahan Alamat : Jl. Sudirman No.2260 Telp : (0765) 7004411, HP 08527 8202002 / 082172032011 CV. KARYA MAJU Dumai-Pekanbaru” Jln. Jend. Sudirman No. 160 Dumai Telp.(0765) 35239- 37939 PT.CITRA SINAR AGUNG Dumai - Pekanbaru” Menerima Carteran & Rental Mobil Jl. Bintan NO 166 HP.082366673888(DUMAI), PO. SINAR RIAU (Bus & Travel) Jurusan:-Dumai-PekanbaruDumai-Airmolek-RengatTembilahan. Jl. Sudirman Telp (0765) 7008588 CV. Athirah Jaya Armada Kijang Innova DMI-PKU-BELILAS Alamat Dumai :Jl. Jenderal Sudirman (depan Hotel City) Hp 0812 68945027/ 085278337833 Telp 0765 7073555 Alamat Pekanbaru : Jl. Kasah (belakang AA Catering) Hp 0852 7165 6227 Telp 0761 8362227 PERMATA BUNDA TRAVEL Dumai - Pekanbaru Dumai ( Jln.Ombak Hp. 0812 7691 8989 ) PKU ( Jln. Kaswari Hp. 0812 7518 9868 ) Bagan Siapi-api ( Jln. Pahlawan Hp. 08527473 7844 )

TATA LETAK:EDO REDAKTUR: GENTA MUKARAM


13

Email: xschooldumaipos@yahoo.co.id dumaipos123@yahoo.com

Dumai Pos

KAMIS 5 MARET 2015

Pelajar Diminta Jangan Dekati Rokok

„ Kwarran Pramuka Dumai Barat Sosialisasi Bahaya Narkoba Laporan DEVI PUTRI, Dumai MENINDAK lanjuti kesepahaman kerjasama dalam memberantas bahaya narkotika di Kota Dumai dengan Badan Narkotika Kota (BNK), Kwartir Cabang (Kwarcab) Gerakan Pramuka Kota Dumai kembali melanjutkan kegiatan sosialisasi. Sosialisasi kali ini dilaksanakan Kwartir Ranting (Kwarran) Dumai Barat, tepatnya di aula kantor Camat Dumai Barat, Rabu (4/ 3). Selain BNK, Kwarcab juga menggandeng Sat Narkoba Polres Dumai untuk kelancaran kegiatan sosialisasi tersebut. Ketua Kwarcab Gerakan Pramuka Kota Dumai Amiruddin menjelaskan, bahwa sosialisasi narkoba ini dilaksanakan bertujuan untuk memberi penangkalan kepada para pelajaran khususnya mereka yang tergabung dalan organisasi kepramukaan. “ Kegiatan ini sudah dilaksanakan disejumlah Kwarran Pramuka yang ada di Kota Dumai. Dimana kegiatan perdananya dilaksanakan di Yayasan Pendidikan Budi Dharma (YPBD) Jalan Bintan pada pertengahan bulan Januari 2015 lalu. Dalam kegiatan ini para pelajar diberikan penyuluhan dan bimbingan yang intinya agar mereka menjauhi dan tidak mengunakan narkoba,” jelasnya. Menurutnya, usia setingkat SMP dan SMA sangat rentan terhadap pengaruh lingkungan dan salah satunya pengaruh penyalahgunaan Narkoba. Karena itu, Kwarcab Pramuka Kota Dumai bekerjasama BNK dan Sat Narkoba melakukan sosialisasi keseluruh Kwarran Gerakan Pramuka se-Kota Dumai dengan

mengajak pelajar yang tergabung diporamuka masing kecamatan. “Sosialisasi bahaya narkoba ini akan terus berlanjutan. Saya berharap kegiatan ini tidak hanya dilaksanakan oleh Kwarcab saja, tapi Kwartir Ranting yang ada di seluruh Kota Dumai juga ikut mensosialisasikan dampak dari bahaya Narkoba bagi generasi penerus bangsa,” harapnya. Sementara Ketua Kwarran Dumai Barat Drs Dian Dini mengatakan telah mengajak seluruh pelajar yang tergabung diPramuka seperti SMKN 1, SMA Binsus, SMPN 4, SDN 017 dan SDN PKL sesai. Dengan kegiatan ini berharap wawasan anak-anak bertambah banyak tentang bahaya Narkoba, menimbang keberadaan Narkoba sangatlah diwanti -wanti penyebarannya apalagi ditingkat pelajar yang kondisinya masih labil dan rentan. ‘’Mudah-mudahan materi yang dipaparkan pihak kepolisian dan BNK dapat diserap oleh anak lalu menshare keteman-teman setingkat agar menjauhi Narkoba yang dimulai dari jangan mendekati Rokok,’’ tutup Dian yang juga menjabat Ketua Tim Adiwiyata Mandiri SMKN 1 Dumai itu. Sesuai pantauan Dumai Pos, pihak BNK dan Kepolisian dalam pemaparannya, selalu mengatakan ‘ Say No To Drug’ tidak hanya itu bahkan mereka mengajak seluruh pelajar agar tidak mendekati Rokok, pasalnya awal dari Narkoba adalah ddari rokok. Itu bukan berarti yang merokok menggunakan Narkoba. Namun itulah awal dari penjerumusan kita untuk terjerumus ke barang haram itu, kata pihak BNK dan kepolisian dalam pemaparannya.(des)

X Ruang Kaca Pengubah Air Laut Menjadi Layak Minum TECHNO L O GY

KITA mengenal teknologi rumah kaca dalam budidaya tanaman. Ternyata, teknologi serupa dapat dimanfaatkan dalam proses pemurnian air laut menjadi air tawar. Tim kecil mahasiswa Institut Pertanian Bogor (IPB) memanfaatkan metode ruang kaca ini guna menyediakan persediaan air bersih dengan memanfaatkan air laut. Salah satu anggota tim, Prasetyo Zahara, menjelaskan bahwa inovasi ini lahir didasari meningkatnya kebutuhan akan air bersih di tengah keberadaan lautan yang mencapai 70 persen luas bumi. “Alat dengan teknologi double panel itu dibuat untuk mengubah air laut menjadi air tawar dengan bantuan sinar matahari,” ujar Prasetyo kepada Okezone di sela-sela acara Tanoto Student Research Award 2014 di Upper Room, Annex Building, Jakarta. Dalam membuat alat ini, Prasetyo bekerja sama dengan empat temannya yaitu Aditya Pamadan, Zahra Widi Damayanti, Andry Tiraska, dan Luzmi Malia Izza. Prototipe alat tersebut memperlihatkan dua segitiga besar yang dihubungkan dengan sebuah pipa. Pada salah satu segitiga, terdapat segitiga lebih kecil di

bagian dalam. Ini adalah sistem double panel yang dipakai tim Prasetyo guna memaksimalkan timbulnya panas dari sinar matahari. Prasetyo menjelaskan, air laut dimasukkan ke ruangan di dalam segitiga kecil tadi. Kemudian, sinar matahari yang menembus dua panel kaca menciptakan suhu panas dan menimbulkan proses penguapan. “Nantinya air tawar dan garam akan berpisah. Air tawar akan mengalir ke ruangan yang lainnya (di segitiga berbeda-red),” ungkapnya. Prasetyo menyatakan hasil penyulingan dengan alat buatan mereka layak minum sesuai standar kesehatan. Dia berharap inovasi ini dapat menjadi solusi memenuhi kebutuhan air bersih yang sangat tinggi. Ironisnya, kata Prasetyo, banyak warga Indonesia berburu air bersih padahal di sekelilingnya adalah laut. “Alat ini nanti akan dipasang di daerah-daerah pesisir. Dengan begitu masyarakat di sana bisa mendapat fasilitas air bersih dengan mudah karena alat ini tidak membutuhkan energi listrik dan memanfaatkan energi matahari sepenuhnya,” imbuh Prasetyo.(*/net)

F:DEVI

ANTUSIAS: Pelajar sangat antusias Kwarran Dumai Barat mendengarkan pemaparan BNK akan bahaya Narkoba.

SMAN 1 Tebingtinggi Kembangkan Adiwiyata SELATPANJANG (DP)— Guna memanfaatkan sampah yang tidak dipakai lagi, SMA Negeri 1 Tebingtinggi, Kepulauan Meranti, Selasa (3/3) pagi menggelar Sosialisasi Adiwiyata, yang dipusatkan di Aula SMA 1 Tebingtinggi, Jalan Pembangunan II, Selatpanjang. Sebagaimana diutarakan Pembina Pengembangan A-

diwiyata SMA Negeri 1 Tebingtinggi, Fadillah SSi mengatakan bahwa, kegiatan Adiwiyata ini merupakan kegiatan yang sangat penting, karena bagaimana cara memanfaatkan limbah sampah yang tidak dipakai lagi. Jadi, sampah yang awalnya menjadi masalah bagi sekolah, kini dapat dimanfaatkan dan menjadi

pembelajaran di sekolah. “Kegiatan ini merupakan persiapan untuk mengikuti Adiwiyata tingkat Provinsi, ada dua sekolah yang dinilai nantinya untuk mewakili Meranti, yakni SMA 1 Tebingtinggi, dan SMK 1,” ujar Fadillah. Dia juga menambahkan, persiapan untuk mengikuti Adiwiyata tingkat Provinsi

ini, secara sasaran sesuai dengan kemampuan, namun yang ditetapkan dari provinsi, yakni Grand House, Rumah sampah, dan ruang terbuka hijau, yang saat ini pihak sekolah tengah gencar melakukan pengembangan itu. “Komitmen sekolah sangat besar sekali, dukungan kepala sekolah, beserta pihak

sekolah sangat optimis, dan partisipasi dari warga sekolah sangat mendukung,” ungkap Fadillah. Tambah Fadillah, penilaian Adiwiyata yang ditetapkan provinsi adalah 64 point, jadi pihak sekolah optimis untuk mencapai itu. Menurut prediksi pihak sekolah sudah melebihi 64 poin yakni 70,1 poin.(gun)

Ayam Jantan Cerdik dan Rubah Licik SUATU senja saat matahari mulai tenggelam, seekor ayam jantan terbang ke dahan pohon untuk bertengger. Sebelum dia beristirahat dengan santai, dia mengepakkan sayapnya tiga kali dan berkokok dengan keras. Saat dia akan meletakkan kepalanya di bawah sayap-nya, mata nya menangkap sesuatu yang berwarna merah dan sekilas hidung yang panjang dari seekor rubah. “Sudahkah kamu mendengar berita yang bagus?” teriak sang Rubah dengan cara yang sangat menyenangkan dan bersemangat. “Kabar apa?” tanya sang Ayam Jantan dengan tenang. Tapi dia merasa sedikit aneh dan sedikit gugup, karena sebenarnya sang Ayam takut kepada sang Rubah. “Keluargamu dan keluarga saya dan semua hewan lainnya telah sepakat untuk melupakan perbedaan mereka dan hidup dalam perdamaian dan persahabatan mulai dari sekarang sampai selamanya. Cobalah pikirkan berita bagus ini! Aku menjadi tidak sabar untuk memeluk kamu! Turunlah ke sini, teman, dan mari kita rayakan dengan gembira.” “Bagus sekali!” kata sang Ayam Jantan. “Saya sangat senang mendengar berita ini.” Tapi sang Ayam berbicara sambil menjinjitkan kakinya seolah-olah melihat dan menantikan kedatangan sesuatu dari kejauhan. “Apa yang kau lihat?”tanya

sang Rubah sedikit cemas. tugas yang sangat penting yang ke bawah bulu sayapnya dan tidur, “Saya melihat sepasang Anjing dahampir saja saya lupakan.” Ayam karena ia telah berhasil mempertang kemari. Mereka pasti telah menjantan itu tersenyum sambil m- daya musuhnya yang sangat lidengar kabar baik ini. Tapi sang embenamkan kepalanya kembali cik.(net/des) Rubah tidak menunggu lebih lama lagi untuk mendengar perkataan sang Ayam dan mulai berlari menjauh. “Tunggu,” teriak sang Ayam Jantan tersebut. “Mengapa engkau lari? sekarang anjing adalah teman-teman kamu juga!” “Ya,”jawab FDUMAI(DP)— Pengurus Hi- Kota Dumai. baru tahun ini sebagaimana ox. “Tapi merempunan Pendidik dan Tenaga Dra Nurbaiti dalam samb- yang diamanatkan dalam Perka mungkin tiKependidikan Anak Usia Dini utannya menegaskan bahwa men No 160 tahun 2014,’’ dak pernah mIndonesia (HIMPAUDI) bek- disamping program 1 Desa 1 ujarnya. endengar beerjasama dengan Kelompok PAUD juga peningkatan kualiNarasumber yakni Ismiyanrita itu. SeKerja Kepala PAUD (K3P) Kota tas Pendidik PAUD adalah san- ti dari PAUD Education 21 Pelain itu, sDumai mengadakan Worksh- gat penting sebab sebahagian kanbaru yang baru mengikuti aya memop Implementasi Kurikulum mereka masih ada yang ber- MoT Kurikulum 2013 PAUD di punyai 2013 dilaksanakan pada kualifikasi Pendidikan Sekolah Jakarta. Peserta kegiatan ini bertanggal 21 sampai dengan Menengah. jumlah 120 orang terdiri dari 22 Februari 2015 di Dumai. Dia menyambut baik kegia- perwakilan 1 kepala PAUD dan Kegiatan ini dihadiri oleh tan tersebut karena merupa- 2 orang guru dari 40 lembaga Kepala Dinas Pendidikan kan salah satu indikator terca- PAUD. Materi workshop terdiri Kota Dumai yang di- painya APK PAUD Kota Dumai dari: Kebijakan Direktorat PAwakili oleh Kabid Pen- yang mencapai 89,8 persen UD/Dinas Pendidikan Kota Dudidikan Khusus dan PN- tahun 2014 di atas rerata Na- mai, Implementasi Kur 2013 F Dra Nurbaiti, Ketua HI- sional. ‘’ Saya juga menghar- PAUD, Penilaian dan Tugas MPAUDI Kota Dumai, apkan agar seluruh Pengelola Mandiri. Harapan peserta dan STORY Suardi SPd) beserta PAUD menerapkan Kurikulum pengurus semoga kegiatan ini Pengurus Cabang se- 2013 pada awal tahun ajaran berlanjut.(rls/des)

Himpaudi Taja Workshop Kurikulum 2013

X

Tidak Ada Nilai Minimum UN Masuk PTN JAKARTA(DP)— Standar kompetensi minimal nilai ujian nasional (UN) 2015 adalah 5,5. Namun UN 2015 tidak menentukan kelulusan siswa. Nilai minimal tersebut digunakan sebagai batas minimal bagi siswa yang ingin REDATUR: SYARIAFAH DIAN EKA SARI

mengulang UN jika nilainya hanya mencapai 5,5. Siswa yang mendapat nilai 5,5 dalam UN juga tetap bisa mengikuti Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN). Kepala Pusat Penilaian

Pendidikan (Puspendik) Kemendikbud, Nizam menegaskan, tidak ada nilai minimum untuk mengikuti SNMPTN atau masuk PTN. Nilai UN digunakan sebagai pertimbangan untuk masuk PTN melalui jalur SNMPTN.

‘’Penggunaannya sepenuhnya diserahkan kepada Panitia SNMPTN dan Rektor PTN yang bersangkutan,’’ ujarnya di Jakarta. Sebelumnya, dalam Dialog Publik UN 2014-2015 di Surabaya, Senin, (02/03/

2015), Nizam mengatakan meski tidak dijadikan syarat kelulusan siswa, hasil UN tetap dipakai untuk masuk ke jenjang pendidikan lebih tinggi. Untuk SMA/SMA/ MA, hasil UN akan menjadi acuan untuk bisa masuk ke

perguruan tinggi negeri (PTN). Hal tersebut juga menjadi kesepakatan antara Kemendikbud dengan Kementerian Riset dan Teknologi Pendidikan Tinggi (Kemristek-Dikti) yang tertuang dalam Su-

rat Edaran yang dikeluarkan pada 17 Februari 2015. Dalam Surat Edaran tersebut tercantum bahwa UN dijadikan pertimbangan untuk Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN).(*/net) TATA LETAK: DITA


14 Dumai Pos

PEKANBARU EKSPRES KAMIS 5 MARET 2015

F.YANDI

BERI SAMBUTAN: Walikota Pekanbaru, H Firdaus ST MT memberikan sambutan pada acara sosialisasi dan bimbingan teknis penyusunan rencana tenaga kerja Kota Pekanbaru, Rabu (4/3).

Andalkan SDM Teruji dan Berkualitas „ Walikota Buka Bimtek Penyusunan Rencana Tenaga Kerja Laporan YANDI, Pekanbaru

WALIKOTA Pekanbaru, H Firdaus ST MT membuka secara resmi Sosialisasi dan Bimbingan Tehknis Penyusunan Rencana Tenaga Kerja yang ditaja Dinas Tenaga Kerja Kota Pekanbaru di Alamanda Meeting Room Grand Central Hotel Pekanbaru, Rabu (04/03). Dalam sambutannya, Wako menyampaikan bahwa pembangunan ketenagakerjaan merupakan strategi yang sangat penting

dalam kerangka pembangunan Nasional, Regional daerah dan sektoral yang meliputi pembinaan kualitas angkatan kerja, pendayagunaan perlindungan dan peningkatan kesejahteraan pekerja. “Hal ini mempunyai sifat yang inklusif yang melibatkan berbagai pihak sebagai pemangku kepentingan atau stakeholders,” kata Wako. Selanjutnya Walikota menambahkan, Pekanbaru merupakan Ibu Kota Provinsi Riau

meliputi luas wiilayah mencapai 632,28 KM2, jumlah penduduk mecapai 1,1 juta jiwa serta letak geograf yang strategis. Oleh karenanya luas wilayah yang besar tersebut dapat di jadikan untuk pemerataan pembangunan, pencapaiannya lebih kurang 30 perse daerah yang terbangun. Oleh sebab itu, keunggulan dan potensi yang ada agar dimamfaatkan oleh seluruh komponen yang ada untuk menggerakkan roda pembangunan Kota Pekanbaru.

“Kepada semua agar tidak lagi menjadi masyarakat yang konsumtif yang hanya sifatnya memakai dan memanfaatkan saja tetapi tidak memikirkan dan menciptakan. Untuk itu, mari kita hijrah dari hal yang demikian kepada perubahan dengan mengandalkan SDA yang teruji dan berkualitas agar terhindar dari jajahan modernitas,” katanya lagi. Sementara itu Kepala Dinas Tenaga Kerja Kota Pekanbaru, Ir Jhony Sarikoen MT sebelumnya dalam sambutannya me-

ngatakan kegiatan sosialisasi ketenagakerjaan ini di lakukan adalah untuk mengetahui sekaligus memahami persoalan-persoalan yang ada dalam hal ketenagakerjaan khususnya di Kota Pekanbaru. “Bahwa hal ini adalah persoalan kita bersama baik penyelenggara negara maupun warga negara, sekalipun baru kali ini di lakukan tetapi hal ini akan belanjut di perkirakan yang 4 kali kegiatan lagi dengan waktu yang berbeda hingga tersusun-

nya rencana ketenagakerjaan Kota Pekanbaru,” kata Jhonny. Dalam acara ini hadir, KAPUS Ketenagakerjaan Republik Indonesia, Nurahman MSi, Kepala Dinas Tenaga Kerja Kota Pekanbaru, Kadis DKP Kota Pekanbaru, Kadis Pasar Kota Pekanbaru, Kepala BPTPM Kota Pekanbaru, Camat se-Kota Pekanbaru serta para pegawai Dinas Tenaga Kerja Kota Pekanbaru turut hadir Dekan Fakultas Ekonomi UIN dan UIR serta Perwakilan AKINDO.(des)

MUI: Palsukan Label Halal Disanksi Keras Lahan

PEKANBARU(DP)— Usaha makanan berlebel halal banyak ditemukan di Pekanbaru. Namun, lebel halal yang dipasang di tempat usaha tersebut dipertanyakan. Pasalnya, masih terdapat tempat usaha yang menjual makanan atau produk yang dipertanyakan kehalalannya. Menanggapi hal ini, Ketua Majelis Ulama Indonesia (M-

UI) Provinsi Riau, Mahdini kepada berjanji akan melakukan pengecekan di lapangan. Menurutnya, mendapatkan lebel halal itu ada aturannya. “Nanti kita cek dulu. Kita ketat mengeluarkan lebel halal itu, ada prosedur yang harus dilalui,” ungkapnya. ketika di konfirmasi melalui sambungan teleoponya wartawan Rabu (4/3) kemarin menangga-

pi beredarnya isu tersebut. Lanjutnya, untuk mengeluarkan sertifikat halal itu, MUI selalu berkoordinasi dengan dinas terkait, seperti Dinas Perindustrian dan Perdagangan (Disperindag) serta BPOM. “Pertama mengajukan permohonan, kita ke lapangan, ada empat tahap yang harus dilalui. Sebelum mengeluarkan itu pun, kita melakukan

musyawarah dengan majelis fatwa MUI,” jelasnya. Ditanya, adanya anggapan lebel halal bisa dibikin sendiri serta bisa diperjualbelikan, Mahdini menegaskan pihaknya tidak pernah memperjual belikan itu. Dia juga menegaskan, pemalsu lebel halal itu juga bisa dikenakan sanksi berat. “Kita tidak pernah memperjualkan belikan. Kalau ada

pemalsuan akan kita tuntut. Pertama tentu tarik dulu. Seterusnya pihak kepolisian menutup usahanya. Tanpa izin masak ada lebel halal. Kalau pengawasan memang kita terbatas anggota. Tapi, kita juga diam-diam akan lakukan pengecekan, apakah betul usaha yang memakai lebel halal itu, memang punya sertifikat,” katanya menambahkan.(oya)

Angkah HET Belum Belum Bisa Ditentukan „ Agen Dihimbau Awasi Pendistribusian PEKANBARU(DP)- Hasil rapat bersama yang di gelar oleh pihak Dinas Perindustrian dan Perdagangan (Disperindah) Kota Pekanbaru bersama PT Pertamina (Persero) Perwakilan Pemasaran Riau belum menyepakati Harga eceran Tertinggi terhadap elpijia tabung 12 KG. Belum di sepakati angka ini dimana tim belum menemukan jegolah perebdaan harga dalam pendistribusian. Demikian dikatakan Kepala Bidang (Kabid) Perdagangan Disperindag Kota Pekanbaru, Mas Irba Sulaiman ketika di konfirmasi Rabu (4/3) kemarin. Irba menjelaskan Dalam pertemuan tersebut

pembahasan tidak mengarah kepada Pnetapan HET melainkan upaya untuk mengantisipasi adanya pengalihan pengguna elpiji 12 kg ke elpiji tiga kilo. Irba menjelaskan pihaknya sudah sepakat untuk memerintahkan semua agen elpiji yang ada di wilayahnya bertanggungjawab atas proses distribusi sampai ke masyarakat pengguna. “Kesepakatan rapat bersama Pertamina, kita cenderung mengedukasi pelaku distributor untuk menjaga sistem penyaluran,” kata Irba Selanjutnya di tegaskan Irba, agen dan pangkalan sangat berperan setiap saat dalam pendistribusian elpiji baik 12

kg maupun tiga kilo. Jadi jika mereka lari dari sistem dan jalur distribusi pasti akan timbul masalah, baik itu kelangkaan, harga meningkat tidak sesuai HET, bahkan penimbunan. “Sehingga disini kita minta agen dan pangkalanlah yang harus bertanggungjawab atas distribusi yang mereka lakukan, karena memang mereka yang tahu siapa dan sampai kemana elpiji ini mengalir. Jadi mereka tidak hanya medistribusikan saja seperti yang dilakukan selama ini, tetapi juga diminta bertanggungjawab betul mengetahui siapa pembelinya sesuai dengan peruntukan elpiji tiga kilo. Tang-

gungjawabnya elpiji itu sampai ke masyarakat yang berhak mendapatkan, bukan pelaku usaha atau keluarga mampu,”tegasnya. Selain itu, agen juga diminta mengenali pangsa pasarnya untuk tidak asal mendistribusikan, tentunya sembari memberikan sosialisasi kepada masyarakat bahwa elpiji tiga kilo peruntukannya buat keluarga menengah kebawah. Irba meminta agar tidak tidak melayani pembelian dalam partai besar Hal ini dinilai upaya penekanan terhadap penimbunan. Jika agen dan pangkalan tiga kilo disiplin serta bertanggungjawab, maka tidak

ada hal yang perlu dikhawatirkan bagi pendistribusian elpiji tiga kilo. Hijrah pengguna 12kg juga tidak akan bisa terjadi. Sehingga quota yang disediakan oleh Pertamina tetap mencukupi. “Karena untuk Pekanbaru ada 134.200 tabung hijau beredar,” katanya. Berbicara pengawasan, pihaknya mengaku telah dan akan terus menurunkan tim memantau distribusi dan perdagangan elpiji hingga ke konsumen. Jika menemukan ada agen dan pangkalan yang nakal diakui dia, tidak akan segan-segan melakukan peneguran bahkan penyitaan ijin usaha untuk di bekukan. (oya)

Perubahan Status PD Pembangunan Ditolak

PEKANBARU(DP)— Rencana peralihan status Perusahan Daerah (PD) Pembangun menjadi Perseroan Terbatas (PT) tampaknya belum ada kejelasan. Hal ini buntut dengan telah di tolaknya oleh Kementrian Hukum dan Hak Azasi Manusia Republik Indonesia (Kemenkumham RI) tentang perubahan status Perusahaan Daerah Pembangunan (PD Pembangunan) milik Pemerintah Kota (Pemko) Pekanbaru. Penolakan ini disebabkan dengan belum lengkapnya persyaratan yang diajukan oleh pihak PD Pemban„ REDAKTUR: KAHARUDDIN

gunan, di antaranya tidak berlakunya SK Koperasi Pegawai Negri Sipil (PNS) Pemko Pekanbaru yang digunakan sebagai pemegang saham PT SPP. Alhasil, beberapa investor yang telah melirik perusahaan ini pun tak kunjung dapat melakukan kerja sama. Hal demikian diungkapkan Dirut PD Pembangunan Pekanbaru, Heri Susanto kepada wartawan di temui Rabu (4/ 3) kemarin. Heri mengatakan, perubahan status yang diajukan sudah berlangsung lama, terhitung November 2013 lalu. Namun hingga kini proses perubahan status belum terlaksana sesuai den-

gan yang diharapkan. “Memang sudah sangat lama. Perdanya (Peraturan Daerah,red) sendiri November 2013, sekarang sudah Maret 2015, prosesnya belum terlaksana. Syarat untuk merubah PD menjadi PT.SPP harus dua pemegang saham,” kata Heri. Selanjutnya persyaratan tersebut diantaranya pertama, pemegang saham adalah pemerintah daerah, karena yang mengeluarkan modal adalah Pemerintah Daerah. Kedua koperasi PNS. “Ternyata Koperasi PNS itu SKnya sudah tidak berlaku lagi. Kalau

tidak salah sejak 2008 atau 2009. Otomatis ketika kita mendaftar ke Kemenkumham ditolak. Diminta koperasi diperbaharui susunan kepengurusannya,” paparnya. Saat ini, menurut Heri pihaknya masih menunggu Pemko Pekanbaru untuk menggelar rapat tahunan koperasi dan menunjuk ketua koperasi yang baru. “Kami menunggu pemerintah melaksanakan rapat tahunan koperasi dan menunjuk siapa ketua baru, setelah itu di SK kan. Nah SK itu lah nanti yang digunakan untuk merubah status,” ujarnya mengakhiri.(oya)

Pemakaman di Wilayah Tenayan PEKANBARU(DP)— Untuk merealisasikan lahan pemakaman diseluruh penjuru Kota Pekanbaru (arah mata angin) untuk tahun ini Pemko kembali mendaptakan satu kawasan lagi untuk di jadikan lahan pemakaman umum, yakni dikawasan Tenayan. Lahan tersebut seluas 5 Hektar. Demikian disampaikan Kepala Dinas Sosial, Dr Mutia Eliza ketika di temui wartawan Rabu (4/3) pagi kemarin. Mutia menjelaskan dinas sosial dan Pemakaman Kota Pekanbaru terus berupaya mengadakan lahan pemakaman. Bahkan lahan pemakaman itu tersedia minimal ada di setiap penjuru mata angin di Pekanbaru. “Kali ini, lahan yang didapatkan cukup luas dan lahan tersebut aman dari sengketa karena laha tersebut memiliki sertifikat,” kata Mutia saat di temui wartawan saat meghadiri rapat bersama Walikota di Aula lantai III Kantor Walikota Pekanbaru Rabu (4/ 3) kemarin. Sebelumnya, Mutia menyampaikan pada 2014 lalu disos juga mengadakan penambahan lahan hanya saja luasnya 1 hektar lokasinya bersebelahan langsung dengan tempat pemakaman Umban Sari. Selanjutnya Pemko juga telah merealisasi lahan pemakaman di kawasan Kecamatan Tampan (Barat Kota Pekanbaru, red). Artinya, dari 4 arah penjuru mata angin yang rencananya akan di realisasikan lahan pemakaman tersebut hanya tinggal di wilayah Selatan Pekanbaru yang belum terealisasi untuk pengadaan lahan pemakaman umum tersebut. Namun ditegaskan Mutia, koordinasi bersama pihak pemerintah kecamatan dan kelurahan terus dilakukan untuk nantinya realisasi lahan di kawasan Bukit Raya itu.(oya) „ TATA LETAK: SASBEN


KAMIS

5 MARET 2015

„ Teuku Wisnu

Dumai Pos

15

Wortel

TINGKATKAN Kualitas Sperma

UNTUK Anda penyuka buah dan sayur, wortel mungkin bukan lagi hal asing untuk dikonsumsi. Selain rasanya manis dan renyah, bahan makanan ini juga mengandung banyak nutrisi yang baik bagi tubuh. Vitamin C, vitamin A, serta kebaikan lengkap lainnya, bisa kita peroleh jika bersahabat dekat wortel. Namun tahukah Anda, wortel itu memiliki satu kelebihan yang mungkin belum banyak diketahui orang. Faktanya, wortel adalah salah satu bahan makanan yang baik

Tolak Job AKHIR-akhir ini nama Teuku Wisnu ramai diperbincangkan nettizen setelah perubahan penampilannya yang lebih islami. Di berbagai media sosial terdapat pro dan kontra soal jenggot tebal dan celana cingkrang yang kini menjadi ciri khasnya tersebut. Memilih untuk mendalami agama, Wisnu tidak sama sekali meninggalkan dunia hiburan tanah air yang telah membesarkan namanya. “Kata siapa (saya berhenti jadi artis, Red.)? Pekerjaan saya masih jalan kok, walaupun memang saya juga lebih sibuk di bisnis. Tapi Alhamdulillah mengisi acara-acara religi di televisi,” kata Wisnu saat ditemui di kawasan Matraman, Jakarta. Pria berdarah Aceh ini mengaku hanya lebih selektif dalam memilih tawaran pekerjaan yang menghampirinya. Karena itulah, Wisnu kerap dinilai telah meninggalkan dunia hiburan. “Apa ya namanya lebih ke selektif saja sih pastinya ya soal pekerjaan tapi Alhamdulillah pekerjaan ada terus, jalan terus di dalam entertain ini,” ungkap Wisnu. Bahkan, adik ipar Irwansyah ini tak segan untuk menolak pekerjaan yang memintanya untuk mengubah penampilan yang telah terbentuk saat ini. (net/fit)

„ REDAKTUR: FITRI

bagi aktivitas seks manusia. Sebab, wortel memiliki kandungan betakaroten yang bisa meningkatkan kualitas sperma laki-laki. Female First menulis, kebaikan wortel juga bisa memperkuat stamina sperma saat berenang menuju sel telur. Kandungan vitamin A dalam wortel, selain baik untuk mata, juga berfungsi sebagai pengubah kolesterol dalam darah, menjadi hormon seksual yang bisa dialirkan ke seluruh tubuh, sehingga meningkatkan kadar libido dalam tubuh, yang bisa membuat seks lebih bergairah. Manfaat wortel bagi kehidupan seks sudah diyakini sejak

zaman romawi terdahulu. Bangsa yunani kuno, sering menjadikan wortel sebagai ramuan alami peningkat gairah bercinta. Mereka percaya, bahwa sayur mayur berwarna cerah ini bisa menjadi asupan penuh nutrisi dengan kelebihan yang baik bagi tubuh. Cara penyajian wortelpun sangat mudah. Anda bisa merebusnya, mengkukus, atau menjadikannya jus dengan campuran buah lain, seperti apel atau jeruk. Namun jika Anda ingin mendapat manfaatnya langsung bisa pula memakan wortel mentah. Tenang saja, rasanya akan tetap manis dan menggugah selera. Selamat mencoba. (net/fit)

Cegah Potensi Kanker Payudara BERDASARKAN penelitian terbaru, berat badan yang terus bertambah dalam jangka panjang pasca menopause, 33 persen memiliki resiko tinggi terkena kanker payudara. Penelitian yang dipublikasikan oleh jurnal online BMJ Open ini mengatakan bahwa penebalan lemak pada pinggang merupakan tanda yang sangat bahaya. Penelitian ini dilakukan terhadap 93.000 perempuan diatas usia 50 tahun. Mereka diminta memberi tahu ukuran rok yang mereka pakai saat ini, dan saat mereka berusia 20an. Tak lupa informasi rinci seperti faktor reproduksi, dan sejarah keluarga juga ditanyakan. Ternyata berat badan yang terus bertambah diket-

ahui sebagai salah satu faktor dari kanker payudara. Tetapi penebalan lemak di pinggang ternyata lebih berbahaya lagi. Karena hal tersebut menunjukan adanya tonjolan pada ulu hati. Naiknya satu ukuran pada rok tiap sepuluh tahun, dihubungkan dengan 33 persen resiko terkena kanker, dan naik dua ukuran rok, dalam rentang waktu 10 tahun, berarti resiko kanker payudara bertambah besar lagi. Yakni 77 persen. Para peneliti memperkirakan bahwa dalam lima tahun mendatang, resiko kanker payudara akan terus bertambah. Pinggang yang melebar juga dikaitkan dengan resiko kanker lainnya, termasuk kanker pankreas dan kanker serviks, yang diakibatkan oleh lemak

pada ulu hati dimana sangat berbahaya. Simon Vincent, selaku Assitant Director of Research di Breakthrough Breast Cancer menyatakan “Kita tahu bahwa 40 persen kanker payudara dapat dicegah dengan perubahan gaya hidup sehat seperti rajin berolahraga dan menjaga berat badan. Penelitian ini berkonsentrasi pada cara mudah memantau berat badan dari waktu ke waktu. Perempuan juga lebih mudah mengingat ukuran pinggang mereka saat muda, dari BMI mereka,” ujar Vincent. Ia juga

menyarankan para perempuan untuk rajin berolahraga. “Di sini, di Breakthrough Breast Cancer, kami mendorong semua perempuan untuk aktif dan mengurangi

resiko kanker payudara. Perempuan setidaknya perlu melakukan aktivitas fisik dengan intensitas sedang selama 3,5 jam dalam seminggu,” jelasnya. (net/fit)

„ TATA LETAK: TRIA


Selebritis

16

Dumai Pos KAMIS

5 MARET 2015

Novel (92) h a u b e S a y a h a C Bulang

Dari Kelang Garuda Terbang Setelah subuh, Bulang Linggi melepas tali dari dermaga pelabuhan Kelang. Angin utara sejak malam sudah turun kencang. Ombak memutih, membanting lambung Bulang Linggi. Mengangkat badan bahtera itu tinggi, dan kembali menghempasnya. Tinggi ombak lebih dari satu depa. ‘’Dekat dermaga, gelombang agak besar. Tapi, bila sudah ke tengah, ombak mulai pecah dan tidak terlalu tinggi,’’ jelas Raja Husin pada Djaafar, seakan memberi tahu keadaan cuaca hari itu. Husin tahu, meskipun Djaafar lama dibesarkan oleh laut dan gelombang, tapi sudah terlalu lama dia tidak lagi berlayar di laut lepas. ‘’Dayung ke tengah!’’ Daeng Ibrahim, nakhoda Bulang Linggi memerintah awak bahteranya. Dua puluh empat dayung berder-

ap mencecah laut, merengkuh gelombang, dan mengarak Bulang Linggi menjauhi pelabuhan. Djaafar berdiri di dekat pintu tenda bahtera yang berukir indah. Pucuk rebung. Bagian belakangnya, berpintu dua. Matanya memandang ke arah daratan, ke arah rumahnya yang sayup-sayup tampak menjulang di dini hari itu. Dia tak melihat sosok isterinya, Raja Lebar. Tapi, sebelum berangkat, dia memeluk ketat isterinya, dan berpesan agar menjaga baik-baik putera mereka, Raja Abdurrahman, yang belum setahun usianya. Dia mencium kening anaknya, dan membelainya. Tak ada kata-kata yang diucapkan, kecuali tatapan yang ngilu ke kedua mata kecil yang menatapnya di pagi dingin. ‘’Kakanda pergi. Sampaikan salam pada Yang Dipertuan

Choky Sitohang

HOBI Menembak PRESENTER Choky Sitohang rupanya gemar olahraga menembak. Sudah 4 tahun belakangan ini ia rutin setiap seminggu sekali latihan menembak di beberapa lapangan tembak yang ada di Jakarta. “Di sela-sela kesibukan, saya sempatkan seminggu sekali untuk latihan (menembak),” ujarnya saat ditemui di Mabes TNI AL, Cilangkap, Jakarta Timur beberapa waktu lalu. Bagi Choky, olahraga menembak berbeda dengan olahragaolahraga lain yang ia juga geluti, yakni melatih kesabaran. Tentu saja ini bukan hal yang mudah. “Menembak melatih emosi, kesabaran, melatih fokus, ingin menaklukan diri sendiri ketimbang menghancurkan sasaran. Lain dari olahraga saya lainnya kayak main basket, tentu di sana diperlukan ketangkasan dan stamina yang kuat. Menembak ini hampir mirip dengan golf, yang harus dikalahkan adalah diri sendiri,” kata pria kelahiran 10 Juli 1982 ini. Salah satu tantangan terberat pada awal latihan adalah mengalirkan pikiran dan tenaga ke tangan.(net/rka)

„ REDAKTUR: RUKIAH ANITA

Besar. Kakanda belum sempat memberi kabar,’’ lanjutnya sambil melangkah ke pintu, menuruni tangga, dan menghilang dalam kabut subuh. Setelah lebih kurang lima belas me n i t meninggalkan pelabuhan, Bulang Linggi membentang layar. Kecepatan bahtera yang berat lebih dari 100 ton itu meningkat karena tekanan angin pada layarnya. Haluannya membelah ombak besar. Kadang terdengar derak badan bahtera itu beradu gelombang, tapi lajunya seakan meniti puncak-puncak om-

bak, dan membuat pantai Kelang dalam sekejap sudah hilang, dan di sekitarnya kini hanya tinggal laut. Bergelora. ‘’Sudah lama beta tak berlayar. Agak ngeri juga,’’ kata Djaafar dengan suara datar pada Raja Husin. Sahabatnya itu mengajak Djaafar duduk di bangku membelakangi pintu tenda perahu. ‘’Abang Djaafar jangan berdiri terus. Kalau ada gelombang besar, Abang jatuh. Masih pandai berenang?’’ kelakarnya. Djaafar tersenyum.

Kebekuan sudah berangsur mencair. Djaafar mulai merasa keberadaan Husin mengembalikan lagi semangat cerianya. Kelakar-kelakar yang nakal, terkadang mulai membuat Djaafar tertawa. Dan akhirnya, percakapan mereka mulai masuk ke kehidupan Kerajaan RiauLingga. Suara mereka hilang-timbul karena bahtera itu terkadang oleng ke kiri, kadang ke kanan. Kadang melambung dan terhempas. Raja Husin tampaknya ingin membagi cerita yang lebih banyak tentang Riau Lingga, agar Djaafar tahu bagaimana perkembangannya dalam 5 tahun terakhir ini. Paling tidak untuk bekal Djaafar nanti, begitu dia memangku jabatan Yang Dipertuan Muda. ‘’Apakah Yang Dipertuan Besar benar-benar masih uzur? ‘’ tiba-tiba Djaafar

DEWI Sandra mengalami perubahan yang sangat drastis semenjak memutuskan untuk berhijab. Di masa lalu kita mengenal penyanyi tersebut sebagai sosok yang seksi dan begitu ekspresif di atas panggung. Namun sejak awal 2013, ia memutuskan untuk berhijab dan mengalami transformasi baik dalam penampilan maupun pembawaan. “Lagi-lagi menurut saya setiap orang punya level mas-

menanyakan kabar Yang Dipertuan Besar Mahmudsyah, setelah Husin banyak bercerita, ke hulu ke hilir. Sambil bertanya, Djaafar menepis tangannya, mengelak percikan ombak yang menyambar dari terpaan haluan Bulang Linggi. Djaafar sebetulnya sudah tahu serba sedikit tentang uzurnya Yang Dipertuan Besar. Juga kabar penyakitnya. Dia peroleh kabar itu dari beberapa sahabatnya sesasama saudagar, baik di Kelang, Malaka atau Selangor. Tetapi kalau dia sekalisekali singgah di istana Sultan Selangor, dia juga banyak mendapat kabar tentang keadaan di Riau. Termasuk cerita Yang Dipertuan Besar Mahmud yang uzur berat karena kononnya termakan racun. Raja Husin tertawa, terkekeh-kekeh, melihat Djaafar seperti orang bersi-

ing-masing. Saya kalau dibanding dua tahun lalu, tentu ini sekarang lebih baik. Orang punya progres. Kadang nggak bisa instant. Ada orang alhamdulillah dapat hidayah, ada orang-orang seperti saya butuh waktu untuk membiasakan,” ucap Dewi Sandra ditemui di Indonesia Fashion Week, JCC, Senayan pada Sabtu (28/2/2015). Saat ini Dewi Sandra juga membekali diri dengan terus belajar agama. Selain itu banyaknya selebriti lain yang juga berhijab bagi Dewi Sandra merupakan suatu yang layak untuk di-

lat, menangkis serangan air laut. Anak Raja Dilaut itu kini begitu takut disentuh ombak. ‘’Setahun terakhir ini memang semakin uzur. Jarang meninggalkanistana,’’kataHusin menjawab pertanyaan Djaafar. ‘’Hmm, tapi usianya belumlah begitu lanjut. Sakit apa baginda?’’ kataDajaafar pura-pura tak tahu berbagai desas-desus yang pernah didengarnya. ‘’Jalan lima puluh. Tapi tubuhnya dari hari makin susut. Kurang mau makan, dan banyak bermenung. Agak pemarah...’’ Husin mencoba menjelaskan kondisi terakhir Sultan Mahmud. Waktu memerintahkan dia pergi ke Kelang menjemput Djaafar, Sultan Mahmud, bicara dengan suara yang lemah. Wajahnya sedih, seperti kehilangan gairah. Ikuti terus lanjutan ‘Bulang Cahaya’ sebuah Novel karya Rida K Liamsi ini. ***

hargai. Setiap orang tentu berproses dan ingin menuju ke arah yang lebih baik. “Saya bukan orang yang suka mengagumi. Saya menghargai siapa pun itu. Mudah-mudahan suatu saat mereka yang belum berhijab dapat hidayah,” ucapnya. Saat ini Dewi Sandra kerap tampil dengan hijab yang elegan dalam berbagai acara. Hal itu tentu berpengaruh dengan image yang ia bangun. Meski sebenarnya ia adalah orang yang sangat ekspresif, kini image itu mulai berubah.(net/rka)

Cinta Laura

POSE CANTIK AKTRIS cantik Cinta Laura saat ini banyak menghabiskan waktu di Amerika demi mimpinya untuk bisa menjadi bintang Hollywood. Cinta yang sudah lulus dari S1 di Columbia University, memilih tinggal di LA untuk mengejar karirnya. Meski berada di luar negeri, kegiatan Cinta Laura selama di Amerika pun masih bisa ditelusuri melalui sosial media. Cinta terhitung cukup aktif untuk mengupdate instagram miliknya. Hal ini semakin mendekatkannya dengan para penggemar yang kepo. Seperti baru-baru ini ketika bintang cantik i t u tengah berada di Laguna Beach, California. Cinta tampak sibuk dengan map yang ia bawa, yang berisi lembar putih. Ia menulis caption singkat untuk mencintai apa yang kamu lakukan. Hmm apakah saat itu Cinta tengah menghafal naskah ya? Yang pasti penampilan Cinta di tepi pantai itu tampak cantik. Perpaduan baju merah dengan aksesori dua kalung berbentuk segitiga, dan kacamata hitam yang ia letakkan di kepala terlihat simple namun mempesona. Rambut Cinta pun tidak dibiarkan apa adanya. Rambutnya diberi sentuhan warna kecoklatan dan hal itu tampak kontras dengan kulit putih serta pulasan bibir merahnya. Selain itu Cinta juga menuliskan satu merk dari produk denim di postingan ootd (outfit of the day=baju hari ini) itu. Walau berada di Amerika, Cinta seolah masih tetap mendapatkan banyak tawaran baik untuk menjadi model maupun membintangi iklan. Sukses terus Cinta!.(net/rka)

„ TATA LETAK: EDO PERMATA


HALAMAN

17

PRO RIAU Dumai Pos

HOTLINE LANGGANAN/IKLAN

(0765) 34172 Sekarang

TELPON Langsung

RESPON

KAMIS 5 MARET 2015

Riau Bisa Lebih Maju dari Jakarta PEKANBARU (DP) — Bupati Kampar Jefry Noer mengatakan Provinsi Riau sebenarnya bisa menjadi daerah lebih maju dibandingkan Provinsi DKI Jakarta walau dengan Anggaran Pendapatan dan Belanja Daerah yang tidak begitu besar. “APBD Provinsi Riau yanga Rp10 triliun (tidak termasuk dana bagi hasil) memang tidak begitu besar, namun jika digabungkan dengan 12 kabupaten/kota lainnya, totalnya mencapai Rp40 triliun,” kata Jefry Noer kepada Antara di Bangkinang, Selasa. Dana sebesar itu menurut Jefry, jika disinergikan dan dijalankan dengan baik dan benar, maka akan mampu membangun Riau bahkan lebih baik dibandingkan provinsi lainnya termasuk Ibu Kota Negara. “Jika daerah atau sebuah kota tampak megah namun masih banyak anak jalanan, orang terlantar, kemiskinan dimana-mana dan rumah kumuh masih banyak ditemukan, maka daerah atau kota tersebut belum bisa dikatakan maju,” katanya. Jefry mengatakan, daerah yang maju adalah daerah yang terbebas dari kemiskinan, penangguran dan rumah kumuh. Bupati mengatakan, hal itu sejalan dengan Program Lima Pilar Pemkab Kampar yang bermuara pada “3 Zero”, bebas kemiskinan, penangguran dan rumah kumuh. “Kami targetkan, pada akhir 2016 nanti, Kampar sudah bebas dari kemiskinan, terkecuali bagi mereka yang tulang rusuknya panjang atau lebih dari pemalas. Sebenarnya hal serupa juga dapat dilakukan untuk Riau,” katanya.(ant/net)

FOTO PEMPROV

PIMPIN RAKOR: Plt Gubri Arsyadjuliandi Rahman didampingi Sekdaprov Riau dan Ketua DPRD memimpin Rakor Pelaksanaan Pembangunan Provinsi Riau di Gedung Daerah, Pekanbaru.

Tuntaskan Tapal Batas Plt Gubri Minta Bupati/Wako

PELAKSANA Tugas (Plt) Gubernur Riau H Arsyadjuliandi Rachman meminta kepada bupati dan walikota, untuk segera menuntaskan masalah perbatasan menjelang Pemilihan Kepala Daerah (Pilkada) serentak Desember 2015 ini. Setidaknya,

ada sekitar 18 segmen batas antar kabupaten/kota yang belum selesai. “Perlu perhatian Pak Bupati dan Walikota, dalam penyelesaian batas wilayah,” kata Plt Gubernur Riau H Arsyadjuliandi Rachman. Dipaparkan Plt Gubri, saat ini

ada 23 segmen batas di Provinsi Riau. Dari jumlah itu, dua segmen telah diterbitkan SK Permendagri dan tiga segmen dalam proses di Kemendagri. “Masih ada 18 segmen batas

antar kabupaten/kota yang belum diselesaikan. Diharapkan, kepada bupati dan walikota agar pro aktif untuk menyelesaikan kesepakatan batas antar daerah,” sebutnya. Apabila tidak juga bisa diselesai-

SOCIETY

kan, lanjut Gubri, maka penyelesaiannya akan diambil alih oleh Pemerintah Provinsi. Karena penyelesaian tapal batas ini, sangat penting untuk disegerakan menjelang Pilkada serentak. Seperti diketahui, Pilkada seren-

tak akan digelar di sembilan kabupaten/kota pada Desember mendatang. Antara lain, Kabupaten Kepulauan Meranti, Indragiri Hulu, Bengkalis, Dumai, Pelalawan, Rokan Hulu, Kuantan Singingi, Rokan Hilir dan Siak.(grc/net/ery)

Family Swalayan Bagi-bagi Hadiah „ Senilai Ratusan Juta Rupiah

Pemenang ketiga Mendapat hadiah sepeda motor Beat diperoleh oleh Kamalia

Pemenang kedua Yanto, mendapat hadiah sepeda motor Yamaha MIO diserahkan langsung oleh managemen Family swalayan

FAMILY Swalayan mengadakan penarikan undian berhadiah dengan hadiah utama satu unit mobil Daihatsu Ayla Rabu (3/3) di halaman Family Swalayan. Penarikan undian ini merupakan program bagi-bagi hadiah ‘Gebyar Idul Fitri 1435 H bagi pelanggan yang telah berbelanja miminal Rp 200.000 di Family Sawalayan Dumai. Acara ini bertujuannya untuk memanjakan pelanggan dan mempererat hubungan antar konsumen yang berbelanja di Family Swalayan. Hadiah disediakan ratusan juta rupiah, berupa mobil Daihatsu Ayla sebagai hadiah utama yang diperoleh oleh Ika Pramuri beralamat di Jalan Paus Gang Senangin No 2. Ika

merupakan salah satu pelanggan tetap belanja di Family Swalayan. “Ini merupakan kejutan dan suatu rezeki untuk saya bagi anak kedua saya yang baru lahir,” tutur Syahrial suami Ika saat dijumpai Dumai Pos di Family Swalayan. Sementara pemenang kedua Yanto, mendapat hadiah sepeda motor Yamaha MIO. Pemenang ketiga Mendapat hadiah sepeda motor Beat diperoleh oleh Kamalia. Pemenang ke empat satu buah Tablet Advan pemenangnya Jurine, Hadiah ke lima TV LED LG 24 inch pemenangnya Bistok, serta hadiah ke enam sebuah Black Berry dengan pemenangnya Rika Andriani, dan masih banyak hadiah lainnya yang diperoleh

Penarikan undian hadiah utama oleh Camat Dumai Kota

oleh konsumen Family Swalayan. Ade mewakili Family Swalayan mengungkap rasa terima kasih terhadap pelanggan yang telah mempercayai untuk berbelanja di family swalayan sekaligus mendukung terlaksana acara ini. “Semoga dengan dukungan dan doa bersama ditahun depan akan lebih ditingkatkan lagi” ungkap ade. Hadir pada acara bagi bagi hadiah bersama Family Swalayan tersebut, Camat Dumai Kota, Perwakilan Dinas Sosial, kepolisian, RT dan segenap para pelanggan Family Swalayan. *** „ Penjab : Agus Triadi „ Narasi : Agus Triadi „ Foto : Agus Triadi „ Tata Letak : Okky

Pengunjung dan konsumen Family Swalayan

Perwakilan dinas sosial, Camat Dumai Kota, dan Managemen Family Swalayan serta undangan

Hadiah utama berupa mobil Daihatsu Ayla yang diperoleh oleh Ika Pramuri beralamat dijalan Paus Gg senangin no 2 „ REDAKTUR: ERIYUS

„ TATA LETAK: OKKY


MERANTI EKSPRES

18

Menuju Kawasan Bandar Niaga yang Maju dan Unggul

KAMIS 5 MARET 2015

Dumai Pos

23.169 RTS Segera Terima Raskin ADVERTORIAL PEMKAB MERANTI

Laporan: ASYARI, Selatpanjang

TERIMA PLAKAT: Ketua Komisi C DPRD Meranti dan Rombongan menerima plakat dari Pemkab NTB saat kunker ke Lombok Barat NTB belum lama ini.

Meranti Perlu Belajar ke NTB SELATPANJANG (DP)- Kabupaten Kepulauan Meranti yang berusia memasuki enam tahun, tidak salah jika mau belajar ke wilayah Nusa Tenggara Barat yang dinilai sudah berhasil dalam pengembangan wisata di Lombok Barat yang difokuskan pada wisata pantai dan laut. ‘’ Kabupaten Kepulauan Meranti melalui Dinas Pariwisata dan Kebudayaannya masih belum terlambat untuk belajar ke daerah Nusa Tenggara Barat (NTB) jika mau mengembangkan potensi wisata pantai dan laut di daerah ini, kami sudah meninjau langsung dan mendapat masukan yang sangat berarti tentang strategi dalam pengembangan wisata di NTB tersebut,’’ ungkap Hafizan Abbas,

salah seorang anggota Komisi C DPRD kepulauan Meranti, Rabu (4/ 3). Dikatakannya, pemerintah Lombok Barat NTB dalam upaya pengembangan wisata guna meningkatkan PADnya , mereka memiliki Rencana Induk Pengembangan Pariwisata Daerah (RIPPDA). Mereka sangat serius mencari sumber Pendapatan Asli Daerah (PAD) dari pariwisata. Dalam pengembangan Pariwisata, pemerintah punya peran penting dalam mensenergikan hubungan antara industri dan masyarakat sehingga perkembangannya dapat memberikan hasil yang optimal bagi masyarakat Jelas Hafizan Abbas. Menurut dia, pengelolaan wisata

di Lombok dengan menggandeng investor lebih memiliki konsep yang jelas sehingga lebih menarik bagi pengunjung juga investor yang mau mengembangkan bisnis wisatanya,” ujar Anggota Komisi C DPRD Kepulauan Meranti ini Sebagian besar tempat penginapan untuk wisatawan yang ada di Lombok Barat seperti di sekitar Pantai Senggigi, lebih mengutamakan konsep kesederhanaan dengan nuansa alam yang masih terjaga baik jelas Hafizan. Bahkan di Gili Trawangan yang menjadi tujuan utama turis manca negara khususnya pada musim liburan di musim Juli sampai September, sengaja dilarang kendaraan jenis

apapun termasuk Sepeda Motor sehingga para turis maupun warga setempat hanya menggunakan angkutan andong yang disana disebut cidomo atau cikar dokar motor serta sepeda. “Pengembangan wisata di Kabupaten Kepulauan Meranti belum jelas fokusnya oleh Dinas Pariwisata dan Kebudayaan yang saat ini lebih mengutamakan kegiatan serimonial sementara pengembangan sarana prasarana penunjang pariwisata sangat minim, salah satu contoh pengembangan tasik nambus, sampai saat ini tidak pernah terwujud pembangunan jalan semenisasi apalagi tidak ada aliran listrik” ujarnya. Kedepan menurut mantan Poli-

tisi Demokrat Meranti ini, Dinas Pariwisata Meranti harus memikirkan pengembangan wisata pantai dan laut serta tasik di wilayah Kepulauan Meranti dengan konsep yang jelas serta mempersiapkan masyarakatnya Selain faktor masyarakat, hal lain yang perlu juga dijamin berkaitan dengan keamanan dan kenyamanan investasi. Hal itu dilakukan agar turis tertarik untuk berkunjung ke daerah ini. Sementara itu, Anggota Komisi C DPRD Kepulauan Meranti yang lainnya, Asrofi menambahkan, untuk pengembangan wisata di Kabupaten Kepulauan Meranti yang perlu ditingkatkan adalah promosi.(ari)

RENCANANYA tahun ini masyarakat penerima beras miskin (raskin) di Kabupaten Kepulauan Meranti masih tetap sama dengan tahun 2014 lalu. Demikian disampaikan oleh Kepala Bagian (Kabag) Ekonomi Sekretariat Daerah Kabupaten Kepulauan Meranti, Agus Yanto SSos MSi, Rabu (4/3). Diutarakannya, pada tahun 2015 ini ada 23.169 Rumah Tangga Sasaran (RTS) mendapat bagian raskin. sebagai bagian dari program pemerintah untuk meningkatkan perlindungan ketahanan pangan bagi keluarga kurang mampu. “ Dalam waktu dekat ini jatah raskin sudah akan disalurkan oleh pihak Badan urusan Logistik (Bulog),” ucapnya kepada Meranti Ekspres di Ruang Kerjanya. Dijelaskan Agus Yanto, tujuan dari program Raskin untuk memenuhi kebutuhan pokok dalam rangka menguatkan ketahanan pangan di rumah tangga serta mencegah terjadinya penurunan konsumsi energi dan protein yang menjadi kebutuhan sehari-hari. Salah satu langkah yang dilakukan sebelum penyaluran Raskin tersebut, kata Kabag Ekonomi Setda Meranti ini, akan dilakukan rakor dan Sosialisasi pendistribusian program raskin, sebagai implementasi dari pedoman umum Raskin tahun 2015. Menurut dia, program raskin bukan berarti pembagian secara gratis. Hanya saja harganya sudah disubsidi oleh pemerintah. Pihak Bulog sendiri bertindak sebagai penyalur yang bekerjasama dengan pemerintah desa setempat. Untuk mendapatkannya warga yang telah terdaftar sebagai penerima hanya diberikan harga yang rendah.(gen)

Warga Mulai Sulit Dapatkan Air Bersih SELATPANJANG (DP)- Pada musim panas, selain maraknya kebakaran, warga Selatpanjang juga mengeluh dengan sulitnya mendapatkan air bersih. Meski pembangunan sumur bor telah dilakukan di berbagai tempat di kota Selatpanjang dan sekitarnya, namun keberadaan sumur tersebut dalam memenuhi kebutuhan air bersih yang dibutuhkan sehari-hari oleh masyarakat masih terbatas. Sebagaimana yang disampaikan oleh salah seorang warga Selatpanjang Barat, PritPal Sing pada serangkaian acara pengambilan sumpah jabatan dan pelantikan ketua dan anggota BPD Desa Banglas, Desa Alahair, Desa Alair Timur dan Desa Sesap, Kecamatan Tebingtinggi Periode 2014- 2020, Sekaligus pembukaan musrenbang tingkat Kecamatan Tebingtinggi, Selasa (3/3) siang kemarin. “Memang di Dorak ada air bersih, akan tetapi harus di order terlebih dahulu, sudah di order harus menunggu satu minggu airnya baru sampai, jadi kapan mau mandinya,” ujar lelaki Untuk Berlangganan Nama Kota

Dumai Pos

Nama Biro

No Telp/HP

Fadil

081378262818

Selatpanjang

Kantor Bupati

: (0763) 434715

Polsek Tebingtinggi

: (0763) 32110

RSUD Selatpanjang

: (0763) 32006

Ambulance

: (0763) 700377

Koramil

: (0763) 32998

Imigrasi

: (0763) 31018

New Furama Hotel

: (0763) 32088

Lily Hotel

: (0763) 31155

Trio Hotel

: (0763) 31432

REDAKTUR : GENTA MUKARRAM

India itu. Menurut lelaki berkulit gelap itu pula, air bersih merupakan kebutuhan mendasar yang sangat dibutuhkan oleh masyarakat di Selatpanjang terutama di Kecamatan Tebingtinggi. Menanggapi hal itu, Bupati Kepulauan Meranti, Drs H Irwan Nasir MSi dalam kesempatan yang sama mengungkapkan bahwa sebelumnya telah dikaji terkait air bersih yang berada di Dorak itu, hanya saja untuk memperbaiki sumber air yang ada itu membutuhkan dana yang sangat besar. “Jika di perbaiki membutuhkan dana yang sangat besar, sehingga lebih baik membangun yang baru, tidak hanya itu masih banyak kendala yang lain lagi,” ucapnya. Namun demikian, lanjut Bupati Irwan, sebagai antisipasi telah dilakukan pembangunan sejumlah sumur bor. “Kita sedang mengakaji pembendungan sungai perumbi. Jika masyarakat masih mengeluh kesulitan air bersih, untuk sementara maka kita akan bangun sumur bor,”ungkapnya.(gun)

Warga Insit saat panen Udang Duri.

Kasatreskrim ‘Diserang’ Polwan SELATPANJANG (DP)Kasat Reskrim Polres Kepulauan Meranti, AKP Antoni Lumban Gaol SH MH, Selasa (3/3) siang lalu, di serang oleh sejumlah Polwan yang bersenjatakan kue Ultah. Brigadir Polwan angkatan Tahun 2014 dari SPN Jakarta yang baru tiba di Selatpanjang, Kepulauan Meranti, Minggu (1/3/2015) kemarin memberi surprise (kejutan) kepada Kasat Reskrim dengan mendatangi ruangannya dan membawa kue Ulang Tahun (Ultah) yang diatasnya bertuliskan angka 45 dan dihiasi dengan lilin yang telah dihidupkan. Kedatangan para Polwan

tersebut membuat Antoni jagi kaget, setelah mendapat ucapan Selamat Ulang Tahun, apalagi saat di suguhkan dengan kue ultah yang telah dihiasi dengan lilin itu. Dengan tiupan lilin,, Puuuuuhhhhhhhh”, Antoni pun melanjutkan dengan pemotongan kue yang disaksikan puluhan Polwan dan sejumlah stafstafnya. KBO Reskrim, Ipda Darmanto langsung menyalami dan memberikan ucapan selamat kepada Kasat Reskrim. begitu juga dengan Bripda Sari Ramadani dan Bripda Syarika Tamami dan sejumlah Polwan baru yang hadir saat itu.(gun)

SMPN 1 Tebingtinggi

Sumbang Koin Untuk Australia SELATPANJANG (DP)SMP Negeri 1 Tebuingtinggi, Kepulauan Meranti, ikut menyumbang koin untuk mengembalikan bantuan tsunami Aceh oleh Australia. Pengumpulan koin itu dilakukan tidak lain hanya semata-mata untuk mengembalikan uang Australia yang pernah diberikan untuk membantu Aceh semasa tsunami 2004 lalu. Demikian diungkapkan Kepala Sekolah Menengah Pertama (SMP) Negeri 1 Tebingtinggi, Ahmad Khudri SPd Selasa (3/3) siang kemarin. Dia

mengatakan bahwa bantuan ini merupakan partisipasi para siswa sebagai Rakyat yang berlambangkan bendera merah putih. “Ini merupakan partisipasi kita sebagai rakyat Indonesia,’ sebut Ahmad. Pengembalian bantuan Australia oleh Aceh ini karena tersinggung dengan pernyataan Perdana Menteri Australia yang mengungkit kembali bantuan tsunami yang telah diberikan itu, Sehingga kemurahan hati rakyat Australia itu diharapkan dapat menjadi pertimbangan untuk

menyelamatkan nyawa dua warga Australia yang sedang menunggu pelaksanaan eksekusi mati oleh aparat penegak hukum Indonesia. Pernyataan itu berawal pada 18 Februari 2015, Abbott meminta Indonesia tidak melupakan sumbangan yang diberikan rakyat Australia dalam jumlah sangat besar saat tsunami menerjang sejumlah wilayah di Indonesia pada 2004 lalu. Rakyat Aceh tidak terima atas pengungkitan bantuan itu, maka dari itu pula bantuan tersebut akan dikembalikan.(gun) TATA LETAK : SUSAN


PELALAWAN EKSPRES Tuah Negeri Seiyah Sekata

Dumai Pos

19

KAMIS 5 MARET 2015

ADVERTORIAL PEMKAB PELALAWAN

Bupati Buka Temu Teknis Penyuluh dan KTNA se-Kabupaten Pelalawan „ Tingkatkan Produktifitas Pertanian dan Ketahanan Pangan, PELALAWAN(DP) - Bupati Pelalawan HM Harris, Rabu (4/3) secara resmi membuka acara temu teknis penyuluh dan kontak tani nelayanan andalan (KTNA) tahun 2015 Kabupaten Pelalawan. Acara yang berlangsung khidmat di ruang rapat pembaharuan Kantor Bappeda Kabupaten Pelalawan dan kegiatan ini diikuti puluhan petugas penyuluh lapangan (PPL) se Kabupaten Pelalawan. Dalam kegiatan terlihat Bupati tanpak besemangat memberi masukan-masukan kepada para penyuluh, terhadap program pertanian yang dicanangkan, untuk menjadi Kabupaten Pelalawan swasembada pangan sesuai program yang dicanangkan Presiden Republik Indonesia Ir Jokowi. Kegiatan dihadiri oleh danramil wilayah Kabupaten Pelalawan yakni Danramil 09 Langgam Kapten Inf E Sihotang, Danramil 04 Pangkalan Kuras Kapten Inf Sardinus, Danramil 03 Bunut Kapten inf Suyanto, Danramil. 15 kapten Inf R Sipayung beserta perwakilan Babinsa dari Koramil masing-masing, Kepala Dinas Koperasi dan UKM Milyono SKM dan 80 tenaga penyuluh lapangan. Saat sambutan didepan hadapan petugas penyuluhan lapangan, Bupati Pelalawan HM Harris mengatakan, bahwa dengan diadakannya temu teknis ini diharapkan adanya respon yang positif bagi para penyelenggara pemberdayaan petani, kelembagaan petani dalam memecahkan permasalahan di lapangan, sehingga perogram pembangunan pertanian dalam mendukung peningkatan produktifitas pertanian dan ketahanan pangan dapat berkelanjutan. Kegiatan ini jangan hanya seremonial tetapi dapat meningkatkan kualitas dan manfaat bagi penyuluh dan masyarakat utamanya petani itu sendiri. “Dalam Undang-undang No 16 Tahun 2006 tentang sistem penyuluhan pertanian, perikanan dan kehutanan (SP3K), saya tegas-

kan bahwa penyuluhan pertanian, perikanan dan kehutanan adalah upaya mencerdaskan kehidupan bangsa khususnya bagi masyarakat tani dan nelayan. Sehingga penyuluhan merupakan pendidikan sepanjang hidup bagi petaninelayan dan keluarganya dalam menambah pengetahuan, meningkatkan ketrampilan serta membentuk sikap optimisme dalam meningkatkan dan mengembangkan usaha taninya,” ujar mantan Ketua Asosiasi DPRD Kabupaten se-Indonesia. HM Harris juga mengatakan, bahwa, untuk itu para penyuluh dituntut untuk memiliki kompetensi dan bekerja secara profesion-

al dalam mendidik petani. “Saya meminta kepada segenap penyuluh yang hadir pada kesempatan ini perlu diingatkan agar benar-benar bekerja serius, karena tugas kedepan semakin berat semua penyuluh harus mampu menyesuaikan tuntutan perkembangan teknologi, ekonomi dan sosial masyarakat petani, paradigma baru penyuluh yang telah diatur dalam undangundang harus benar-benar dimengerti untuk menuju swasembada pangan di Kabupaten Pelalawan yang sudah dicanangkan,” tegas Bupati. HM Harris menambahkan, untuk masalah kekurangan tenaga

penyuluh, tahun ini pemkab Pelalawan akan mengakomodir kekurangannya dan dalam pemilihan tenaga penyuluh, dirinya meminta kepada intansi terkait bisa memilih tenaga tersebut benar memenuhi kriteria yang diinginkan pemerintah. “Saya ingin meyampaikan kalau sampai saat ini, jumlah kelompok tani di Kabupaten Pelalawan sekitar 1486 kelompok tani atau dengan jumlah jiwa 30.518 jiwa. Dengan sebanyak itu jumlah kelompok tani,tidak sebanding dengan petugas penyuluh lapangan saat ini. Maka dari itu, untuk tahun ini Pemkab Pelalawan akan menambah PPL sebanyak 20 or-

ang untuk mencapai kwalitas padi yang bagus kedepannya,” jelasnya. Sementara itu, Kepala Badan Ketahanan Pangan dan Penyuluhan (BKPP) Kabupaten Pelalawan Raja Alkap SH MH mengatakan, dalam rangka mendukung keberhasilan program Pelalawan makmur yang dicanangkan pemerintah pusat sesuai peraturan pemerintah (PP) Presiden No. 154 tahun 2014 tentang kelembagaan penyuluhan pertanian, perikanan dan kehutanan akan ditindaklanjuti sampai ketingkat desa yanf bekerjasama dengan TNI AD yakni upaya khusus padi, jagung dan kedele ( UPSUS PAJALE).

F: DOK

JABAT TANGAN: Wakil Ketua Komisi I DPRD Pelalawan H Abdullah berjabat tangan dengan Perwakilan Persatuan Guru Republik Indonesia (PGRI) Pelalawan, usai Reses Perdana, beberapa waktu lalu.

Maka diperlukan penyuluh yang handal dan kapabilitas yang memadai, serta terjalinnya kerjasama yang baik dengan isntansi terkait. “Bahwa saat ini diperlukan persamaan persepsi dan komitmen untuk saling bersinergi antara satker terkait, agar program tersebut dapat terwujud sesuai harapan kita semua. Temu teknis penyuluh KTNA se Kabupaten ini dilaksanakan juga sebagai ajang silaturahmi antar penyuluh, KTNA dan satker di lingkungan pertanian, perikanan dan kehutanan. Sehingga diharapkan momentum ini bisa dimanfaatkan semaksimal mungkin untuk saling berbagi pengalaman dan pengetahuan dalam rangka meningkatkan SDM dan wawasan penyuluh dan KTNA dalam melakukan pendampingan bagi mensukseskan program pajele serta program lainnya,” paparnya. Raja Alkap juga mengatakan, tujuan teknis penyuluhan dan KTNA se Kabupaten Pelalawan diantara lain mensinergikan program kegiatan satker lingkup pertanian, perikanan dan kehutanan tahun 2015 yang memerlukan peran penyuluh dan KTNA dalam menindaklanjuti sampai kepada pelaku utama (kelompok tani) dan pelaku usaha, meningkatkan rasa tanggung jawab penyuluh dan KTNA dalam mendukung terselenggarakan program. “Selanjutnya, yang terakhir meningkatkan wawasan dan silaturahmi antar penyuluh dan KTNA dan satker lingkup pertanian, perikanan dan kehutanan se Kabupaten Pelalawan. Adapun penyelenggaraan temu teknis penyuluh dan KTNA se Kabupaten Pelalawan pada tahun ini dicanangkan selama satu harian. Dalam pertemuan kali ini jumlah peserta yang hadir terdiri dari pimpinan BP3K sebayaK 12 orang, PPL sebanyak 66 orang, KTNA sebanyak 40 orang, Dinas Pertanian, Perikanan, Kehutanan sebanyak 5 orang dan BKPP sebanyak 10 orang,” tutupnya.(naz)

Diskes Pastikan Pelalawan Bebas Penyakit Difteri Laporan : GRC/NET, Pelalawan DINAS Kesehatan (Diskes) Pelalawan memastikan wilayahnya aman dan bebas dari penyakit difteri. Hal ini terkait adanya Kejadian Luar Biasa (KLB) difteri yang terjadi di Padang, Sumatra Barat. “Alhamdulillah, sampai saat ini kita aman untuk penyakit difteri. Tapi kita tetap akan memantau melalui puskesmas yang ada,” terang Kepala Diiskes Pelalawan, dr

bawa kuman ke orang lain yang sehat. “Penyakit ini bisa juga ditularkan melalui benda atau makanan yang terkontaminasi. Tetapi tak jarang racun juga menyerang kulit dan bahkan menyebabkan kerusakan saraf dan jantung,” jelasnya. Difteri sendiri, sambungnya, termasuk penyakit saluran pernafasan bagian atas. Anak yang terinfeksi kuman Difteri setelah 2-4 hari biasanya akan mengalami gejala-

F: NANANG

Bunda Paud Pelalawan Hj Ratna Mainar Harris memotong pita pada Peresmian Puskesmas Rawat Inap Bersinar di Desa Simpang Tandun, Kecamatan Pangkalan Lesung, beberapa waktu lalu.

Endit RP melalui Kabid P2PL, dr Rafless, kemarin. Diungkapkan Rafles, pihaknya telah gencar mensosialisasikan pentingnya imunisasi bagi anakanak dan bayi yang baru lahir di ilayahnya. Rafless menjelaskan, difteri adalah suatu infeksi akut pada saluran pernafasan yang lebih sering menyerang anak-anak. Penularan difteri biasanya terjadi melalui percikan ludah dari orang yang mem-

gejala infeksi saluran pernafasan bagian atas. Diantaranya anak akan merasakan demam tinggi + 38 C, nyeri menelan, pusing, tampak selaput berwarna putih keabu-abuan atau pseudo membran serta terlihat bengkak pada leher. “Karena itu, bagi masyarakat yang sehat harus menghindari kontak langsung dengan penderita difteri atau karier (pembawa) difteri. Menjaga kebersihan diri dan lingkungan rumah dan untuk penderita Difteri atau karier agar menggunakan masker sampai sembuh,” ujarnya. Soal pencegahan penyakit ini, Rafless menjelaskan bahwa aktifnya posyandu serta gencarnya mensosialisasikan pentingnya imunisasi merupakan salah satu dari pencegahan wabah difteri pada anak-anak. Pasalnya, tiap anakanak akan diberi kekebalan dengan cara melakukan imunisasi DPT/HB untuk anak bayi. “Imunisasi ini diberikan sebanyak 3 kali yaitu pada saat usia 2 bulan, 3 bulan, dan 4 bulan. Kemudian imunisasi DT untuk anak usia sekolah dasar atau usia kurang dari 7 tahun yang diberikan diberikan satu kali. Lalu imunisasi dengan vaksin Td dewasa untuk usia 7 tahun ke atas,” tukasnya.(one)

Jumlah TPS di Pelalawan Bertambah 113 „ Untuk Pilkada Mendatang PANGKALANKERINCI(DP) - Jumlah Tempat Pemungutan Suara (TPS) di Kabupaten Pelalawan untuk Pemilihan Kepala Daerah (Pilkada) yang akan digelar Desember 2015 bakal bertambah. Berdasarkan data KPU Pelalawan, jumlah TPS menjadi 750. “Untuk Pilkada nanti, ada tambahan sekitar 113 TPS di Pelalawan,” sebut Ketua KPU Pelalawan, Nasarudin SU, Rabu (4/ 3). Dijelaskan Nasarudin, sebelumnya jumlah TPS pada Pemilihan Legislatif (Pileg) 2014 lalu hanya berjumlah 637. Namun pada pelaksanaan Pilkada mendatang, jumlah TPS akan menjadi 750. “Dengan adanya penambahan jumlah TPS, ada penambahan penyelenggara dan logistiknya,” jelasnya. Lanjut Nasarudin, hal ini karena jumlah pemilih bertambah, maka tempat pemilihan juga alami penambahan. Konsekwensinya jumlah petugas pengaman sipil juga bertambah. “Berdasarkan kroscek, logistik yang ada di gudang kita, masih bisa digunakan dan cukup untuk kebutuhan. Namun kita masih akan melihat secara menyeluruh lagi,” tandasnya.(grc/net)

Pemkab Serahkan Dua Ranperda ke DPRD PANGKALANKERINCI(DP) - Pemerintah Kabupaten (Pemkab) Pelalawan menyerahkan dua Rancangan Peraturan Daerah (Ranperda) ke Dewan Perwakilan Rakyat Daerah (DPRD), Rabu (4/3). Penyerahan Ranperda dilakukan melalui rapat paripurna DPRD. Ranperda diserahkan dalam sidang paripurna. Dua ranperda yang diusulkan oleh eksekutif terdiri dari, ranperda ten„ REDAKTUR: IWAN ISWANDI

tang Pemilihan Kepala Desa (Pilkades) dan Ranperda penetapan Desa Adat. Bupati Pelalawan, HM Harris dalam sambutanya yang dibacakan oleh Sekdakab Pelalawan, H Tengku Mukhlis menyebutkan, setidaknya ada dua ranperda yang diserahkan dalam paripurna. “Pemerintah kembali menyampaikan ranperda. Dua ranperda yaitu Ranper-

da Pemilihan Kepala Desa (Pilkdes) dan Ranperda penetapan Desa Adat,” sebutnya. Dijelaskan Sekda Muklis, pikades serentak adalah pilkades yang dilakukan di sejumlah desa dengan waktu yang bersamaan. Sebanyak 48 desa akan menggelar pilkades serentak. “Pilkades akan dibagi menjadi tiga gelombang. Untuk dilakukanya pem-

bahasan ranperda sangat penting agar pelaksanaan pilkades tidak mengganggu pilkada mendatang,” jelasnya. Imbuh Sekda Mukhlis, ranperda ke dua yaitu tentang penetapan desa adat. Ranperda ini akan mengatur tentang penataan desa adat di Kabupaten Pelalawan. “Sehingga penetapan desa adat ini nantinya benar-benar bisa diterima oleh

masyarakat,” tukasnya. Paripurna dipimpin langsung oleh Ketua DPRD Pelalawan, Nasaruddin SH. Dari 35 orang anggota DPRD Pelalawan, hanya 29 anggota DPRD yang hadir dalam paripurna. Anggota DPRD Pelalawan yang tidak hadir dalam paripurna yaitu, Imustiar SiP, Rinto, Reflita SPd, H Kasyadi SH, Habibi Hapri, T Khairil ST.(grc/net) „ TATA LETAK: TRIA


20

BENGKALIS EKSPRES Negeri Junjungan

Dumai Pos

KAMIS 5 MARET 2015

ADVERTORIAL PEMKAB BENGKALIS

EXPOSE: Plh Sekda Bengkalis, Amir Faisal saat memimpin expose penilaian piala Adipura 2.

„ Banyak Pekerjaan tak Selesai

Dewan Minta Disdik tak urus Proyek Fisik BENGKALIS (DP)- Bertujuan untuk meningkatkan mutu pendidikan di Bengkalis, ke depan DPRD Bengkalis berharap Dinas Pendidikan tidak lagi mengurus proyek fisik. Lagipula, sejumlah proyek fisik yang berada di bawah Dinas Pendidikan banyak yang tidak selesai. Penegasan tersebut disampaikan Wakil Ketua DPRD Bengkalis, H Indra Gunawan, Rabu (4/ 3). Dijelaskan, mulai tahun 2016, Disdik diharap fokus membena-

hi mutu pendidikan yang memang menjadi tugas utamanya, tidak lagi disibukkan dengan pekerjaan fisik yang sejatinya ada satker lain yang lebih berkompeten. “Kalau untuk membangun gedung sekolah, kan ada Dinas PU di Bidang Cipta Karya dan di Dinas tersebut ada tenaga teknisnya, sedangkan di Disdik tidak ada tenaga teknis. Oleh karena itu dengan berbagai pertimbangan ini, di tahun anggaran 2016 nanti, yang

membangun gedung sekolah biarlah Dinas PU, Disdik fokus mengurus mutu pendidikan saja, “terang Indra Gunawan. Menurut Ketua DPD II Partai Golkar Bengkalis ini, dewan sudah sepakat, Disdik Bengkalis tahun 2016, tidak lagi “bermain” proyek fisik sekolah, sebab dinilai proyek fisik di Disdik banyak yang gagal lantaran tidak ada tenaga teknis. “Kesepakatan ini kami sudah kami sampaikan ketika mengiku-

ti Musrembang pada hari Selasa lalu, dan kami saat itu mempertanyakan banyaknya proyek pembangunan ruang belajar baru yang dilaksanakan Disdik yang terbengkalai, ?tapi sayang jawaban Disdik kemarin mutar mutar yang jawabannya,”tambah pria yang akran disapa Eet. Selain itu, lanjutnya, rekanrekan dewan juga akan meminta detil proyek setiap SKPD termasuk anggaran di Disdik Bengka-

lis yang diusulkan, hal ini agar dewan dapat mengawasi peruntukan dan penggunaan anggaran tersebut nantinya. Keinginan agar Disdik fokus kepada mutu pendidikan dan tidak sibuk mengurusi proyek fisik sudah begitu lama. Desakan tersebut semakin kuat ketika melihat kenyataan banyaknya pekerjaan fisik yang tidak selesai dan pegawai Disdik yang “tidak pernah” ngantar karena sibuk mengurusi proyek.

“Sudah bukan rahasia umum, ada pegawai Disdik jarang masuk kantor bahkan muncul pameo di tengah masyarakat pejabat terkait kantornya di Pekanbaru. Ini fakta, pejabat terkait disibukkan dengan urusan proyek, lalu untuk urusan peningkatan mutu pendidikan bagaimana. Jangan heran kalau mutu lulusan kita selalu saja jeblok, karena memang mereka tidak fokus kepada peningkatan mutu,” ungkapnya.(auf)

Udara di Bengkalis Tidak Sehat T ERAS

„ Ribuan Masker Dibagikan

Ranperda Pembentukan Desa Adat tak Berujung

Laporan: TAUFIK, Bengkalis

BENGKALIS (DP)- Rancangan Peraturan Daerah (Ranperda) tentang pembentukan desa-desa adat di wilayah kabupaten Bengkalis sampai saat ini masih belum ada kejelasan untuk kelanjutan pembahasannya. Bahkan Panitia Khusus (Pansus) ranperda tersebut di DPRD Bengkalis, terkesan tidak melanjutkan lagi pembahasan sampai ada kejelasan sehingga draft Ranperda tersebut masih terlantar. Wakil ketua Pansus Ranperda Pembentukan Desa-Desa Adat DPRD Bengkalis, Irmi Sakip Arsalan yang dihubungi, Rabu (4/3) menyebutkan, bahwa saat ini memang pembahasan Ranperda itu dihentikan sementara sampai ada keptuusan dari Kementerian Dalam Negeri. Terlantarnya pembahasan itu tidak lain karena deadline (batas waktu,red) pengesahan Ranperda menjadi Perda sudah habis yaitu tanggal 15 Januari 2015. “Sampai sekarang kami masih menunggu instruksi dari Kemendagri untuk kelanjutan pembahasan Ranperda Pembentukan Desa-Desa Adat di kabupaten Bengkalis. Kita belum bisa melanjutkan, karena menyangkut juga masalah anggaran dalam pembahasannya, sehingga untuk sementara waktu kita pending dulu,”ungkap Irmi Sakip. Politisi muda Partai Kebangkitan Bangsa (PKB) itu mangatakan kalau tetap dilanjutkan, takut nanti memunculkan masalah, salah satunya dari sisi anggaran karena batas waktu telah habis. Setakat ini pansus DPRD terus berkoordinasi dengan Badan Pemberdayaan Masyarakat dan Pemerintahan Desa (BPMPD) kabupaten Bengkalis mengenai nasib ranperda tersebut. Disambung pria yang akrab disapa Ikip ini, Pansus bersama BPMPD sudah mengirim surat ke Pemprov Riau untuk diteruskan ke Kemendagri supaya waktu pembahasan hingga pengesahan Ranperda Desa Adat itu ditambah, minimal 2 sampai 3 bulan lagi. Hingga saat ini belum ada tindaklanjut soal tersebut dari Kemendagri.(auf) Berlangganan Dumai Pos Nama Kota

Nama Biro

Bengkalis

Madi

Sei Pakning

Adi

Kantor Bupati DPRD Polres Polsek Bengkalis Koramil Sungai Apit Kejaksaan Negeri Pengadilan Negeri RSUD PLN „ REDAKTUR: GENTA MUKARAM

Telp/HP 0813-72532582 081378743999

0766 21258 0766 70080 0766 23390 0766 21110 0766 51061 0766 21122 0766 21031 0766 21066 0766 21777

SELAMA musim kebakaran tahun 2015 ini, baru pagi Rabu (4/3) kemarin udara di pulau Bengkalis berkabut tebal. Selama ini asap dari dampak kebakaran yang terjadi di sejumlah kawasan di Bengkalis, memang belum pernah “singgah” di pulau di pinggiran Selat Melaka ini. Kondisi udara di Kota Bengkalis dan sekitarnya, Rabu kemarin berkabut tebal dan sudah sangat tidak sehat. “‘’Indeks ISPU pagi ini (pagi kemarin, red) menunjukkan angka 370. Artinya, kualitas udara di Bengkalis sudah sangat tidak sehat,’’ ujar Kepala BLH Kabupaten Bengkalis, H Arman AA ketika dihubun-

gi, Rabu (4/3). Mengingat kondisi udara sudah sangat tidak sehat ini, BLH mengimbau kepada masyarakat untuk mengurangi aktivitas di luar rumah. Di samping itu, mulai kemarin BLH juga membagikan masker sebanyak 8.000 buah yang disebarkan di 3 kecamatan, yakni di Bengkalis, Bukitbatu dan Siak Kecil. Selain BLH, BPBD Damkar Bengkalis juga melakukan pembagian masker sebanyak 5.000 buah yang juga disebar di 3 kecamatan tersebut. Kabid Damkar BPBD-Damkar Bengkalis, Suiswantoro ditemui ketika ikut membagikan masker di simpang 4 antara mengatakan, jarak pandang saat ini sekitar 500-1.000 meter sehingga pihaknya berinisi-

atif untuk membagikan masker. Ditambahkan Suis, saat ini ada 3 kecamatan di Kabupaten Bengkalis yang terbakar. Yakni di Kecamatan Bengkalis, Bukitbatu dan Siak Kecil. ‘’Kabut asap sudah mulai sejak kemarin dan hari ini cukup tebal. Jarak pandang sekitar 500-1000 meter. Tebalnya kabut asap hari ini, juga dipicu arah angin yang mengarah ke tempat kita,’’ ujar Suis. Dinas Kesehatan juga menyebar 2.000 masker kepada masyarakat pengguna jalan pagi kemarin. Pembagian dipusatkan di Jalan Jenderal Sudirman. “Ada 2.000 masker yang kita bagikan. Kita bagikan kepada pengguna jalan, setelah itu ke sekolah- sekolah,” ujar salah satu petugas Diskes Bengkalis,

Rina Komala di sela- sela membagikan masker kepada masyarakat. Kabid Pengendalian Masalah Lingkungan Dinas Kesehatan Kabupaten Bengkalis, Irawadi ketika dihubungi juga membenarkan kondisi udara di Bengkalis sudah tidak sehat. ‘’Akibat kabut asap, sudah ada masyarakat kita yang terdata mengalami ISPA,’’ ucapnya. Dibanding didaratan, kondisi kabut dilautan lebih parah. Jika didarat jarak pandang berkisar 500-1000 meter tidak demikian dilaut, jarak pandang lebih dekat dari itu. “Kalau dilaut lebih parah, maksimal hanya sekitar 500 meter,” ujar Atah Bon warga Pulau Padang Meranti. Rencannya, Atan Bon pagi

Rabu kemarin mengantarkan orang dari Pulau Padang ke Pakning, namun sampai di pertengahan jalan antara Pulau Padang-Pakning pompong yang dinakhodai Atah Bon dihadang kabut yang cukup tebal. Karena takut tersesat dan menghindari hal-hal yang tidak diinginkan terpaksa pompong diarahkan ke tebing pulau Bengkalis. “Saya terpaksa menyusuri tebing pulau Bengkalis, orang yang rencananya saya antar ke Pakning terpaksa saya turunkan di pelabuhan roro, biar menyeberang dengan kapal roro saja, karena jarak pandang di tengah-tengah antara Pulau Padang-Pakning sangat pendek, takutnya pompong menabrak beting,” ujar Atah Bon.(gen)

Kebersihan Tangung Jawab Bersama „ Expose Penilaian Adipura

F:SAPRI

Kepala Desa Lubuk Muda meninjau lahan padi di dusun beringin belum lama ini.

Lubuk Muda Menuju Swasembada Beras SIAKKECIL (DP)- Desa Lubuk Muda Kecamatan Siak Kecil Kabupaten Bengkalis saat ini sedang gencar-gencarnya menjalankan program menuju desa swasembada beras. Hal itu dikatakan Kepala Desa Lubuk Muda Mahmun Al Rasyid, Rabu (3/3).”Saat ini kita terus melakukan pembinaan kepada petanipetani padi yang ada di setiap dusun desa Lubuk Muda untuk terus meningkatkan produktivitas padi,” kata Mahmun Dalam melakukan pembinaan jelas Kades Lubuk Muda, pihaknya berkoordinasi dengan Badan ketahanan pangan maupun UPTD Pertanian dan Peternakan Siak Kecil. “Alhamdulillah saat ini ada beberapa dusun yang produktif seperti Dusun Sungai Bungkuk sudah memiliki lahan padi produktiv seluas 100 hektar, selain itu ada juga

beberapa hektar di dusun Beringin,” katanya. Menurut Mahmun tahun lalu Pemerintah Desa Lubuk Muda dan Badan Ketahanan Pangan Siak Kecil melakukan pengambilan ubinan (hasil Panen) dalam program Laboratorium Lapangan (LL) di lahan sawah padi produktif parit baru Dusun Beringin, ‘’Dari hasil pengambilan sampel ubinan diketahui bahwa hasil panen sawah padi di dusun beringin dan juga dusun lainnya adalah 3,9 sampai 4 ton perhektarnya, hasil panen ini akan dapat menopang perekonomian masyarakat kususnya bagi para petani terkait,’’ jelasnya. Lebih lanjut Mahmun Al Rasyid mengatakan bahwa pihaknya akan terus membantu para petani dalam berbagai hal untuk mewujudkan Lubuk Muda menjadi desa Swasembada Beras.(cr3/ery)

BENGKALIS (DP)- Pada tahun 2015 ini, Kota Bengkalis kembali berpeluang meraih piala Adipura untuk kategori kota kecil. Hal ini merupakan salah satu hasil expose penilaian tahap pertama dari tim Badan Lingkungan Hidup (BLH) Provinsi Riau, di lantai II Kantor Bupati Bengkalis, Rabu (4/3). ‘’ Untuk meraih penghargaan bergengsi bidang kebersihan lingkungan ini maka butuh kerja keras dan sinergitas. Tidak hanya tanggungjawab dinas terkait, namun seluruh masyarakat dan instansi terkait harus harus bersama-sama mewujudkan lingkungan hidup yang bersih,’’ ungkap Plh Sekretaris Daerah, H Amir Faisal. Pelaksanaan expose penilaian I (PI) dan pembahasan persiapan penilaian Adipura, program Adipura kategori kota kecil, dihadiri Kepala BLH Bengkalis, Arman AA, tim dari Badan Lingkungan Hidup, Achirunnas, Chandra Hutasoit dan Inamulyani. Turut hadir dalam expose utusan dari Camat Bengkalis, Jamaludin, Kepala Bidang Kebersihan Dinas Pasar dan Kebersihan,

Abdul Kadir, Dinas Perhubungan dan Informasi dan komunikasi, Puskesmas, Lurah dan sejumlah kepala sekolah. Meski berdasarkan dalam penilaian tahap pertama, kota Bengkalis berpeluang mendapatkan tiket meraih Adipura, namun tidak lantas terlena. Sebab bisa saja pada penilaian tahap kedua, nilai yang diraih tersebut bisa tergeser dengan kota lain yang terus berbenah. Untuk itu, Plh Sekda Bengkalis, meminta kepada seluruh stakeholder untuk gencar mensosialisasikan pola hidup sehat dan bersih. ‘’ Masalah kebersihan harus menjadi budaya hidup masyarakat. Untuk itu, kebersihan itu jangan hanya semata-mata untuk mengejar piala Adipura. Tapi bagaimana budaya bersih itu menjadi bagian dari kehidupan masyarakat kota Bengkalis dan Kabupaten Bengkalis pada umumnya. Tidak hanya di kota, namun kebersihan itu milik semua masyarakat, baik itu di desa dan kampung-kampung,’’ ujar Amir Faisal. Lebih lanjut Amir Faisal minta kepada instansi terkait, seperti Dinas Pasar dan Kebersihan, BLH, camat, lurah dan

kepala sekolah, untuk terus berkoordinasi dan giat melakukan sosialisasi tentang kebersihan ini. Begitu juga dengan pemilik toko, diminta untuk menjaga lingkungan depan tokonya, seperti memelihara dan menyiram tanaman atau bunga yang ada. Selain mengajak masyarakat untuk menjaga kebersihan, Amir Faisal juga minta kepada instansi terkait untuk menyediakan tempat penampungan sampah yang dipilah sesuai dengan jenis sampah. Langkah ini penting, agar masyarakat mudah untuk membuang sampah pada tempatnya. Pada kesempatan itu utusan dari BLH Provinsi Riau, Achirunnas, mengatakan, masalah kebersihan ini menjadi prioritas Pemerintah Provinsi Riau, karena jika 70 persen kota meraih piala Adipura, maka Provinsi Riau akan meraih penghargaan piala Adipura Praja. Terkait titik yang menjadi penilaian meliputi, pemukiman, jalan, pasar, kantor, pertokoan, sekolah, RSUD/Puskesmas, Tempat Pembuangan Akhir (TPA), Taman Kota, Bank Sampah dan Pelabuhan.(auf) „ TATA LETAK: DITA


SIAK EKSPRES

21

Merangkai Negeri Dengan Syarak

Dumai Pos

KAMIS 5 MARET 2015

ADVERTORIAL PEMKAB SIAK

WabupMintaKegiatanBelajarTetapBerlangsung SIAK (DP)-Wakil Bupati Siak, Drs H Alfedri MSi mengatakan sangat prihatin dengan kondisi SMAN 1 Tualang dan korban lainnya angin puting beliung yang melanda Kecamatan Tualang pada Selasa (3/3) kemarin sekiira pukul 16.30 WIB. Akibat kencangnya angin puting beling itu beberapa bangunan di SMAN 1

Tualang mengalami kerusakan terutama di bagian atapnya. “Kita sangat prihatin dengan kondisi yang terjadi pasca musibah terjangan angin puting beliung ini. Makanya kami datang bersama pihak terkait lainnya ke sini untuk melihat langsung kondisi yang ada dan juga untuk menyurvei apa kira-kira

tindakan yang bisa dilakukan oleh pemerintah untuk menanggulangi efek musibah yang baru dihadapi ini,” ujar Alfedri saat dimintai keterangannya di SMAN 1 Tualang disela-sela kegiatan pemantauannya. Turun bersama wabup ini Kepala Dinas Tenaga Kerja dan Sosial Kabupaten Siak, Drs H

Nurmansyah MSi, pihak Dinas Tarcip Kabupaten Siak, Sekretaris Disdikbud Siak, Drs Khaidir, Kepala BPBD Siak, Wan Abdu Razak, Camat Tualang, Zulkifli, Kepala UPTD Pendidikan dan Kebudayaan Tualang Zahroni MPd, Kepala Desa Perawang Barat, Faizal SHI, Kepala Desa

Tualang, Jufrianto, Kepala SMAN se Tualang dan lainnya. Khusus untuk gedung sekolah, wabup berharap dan meminta kepada pihak terkait untuk segera melakukan tindakan ril memperbaiki kerusakan yang ada atau melakukan penanggulangan darurat sehingga proses

belajar mengajar di sekolah tetap bisa dilaksanakan sebagaimana mestinya. “Setelah tanggab darurat ini

„BACA WABUP HAL 22

RAPAT: Wakil Bupati Siak, Drs H Alfedri MSi menggelar rapat terkait membahas soal puting beliung yang menghantam gedung SMAN 1, Selasa (3/3).

F.RINALDI

Masyarakat Diimbau Jaga Kebersihan N EGERI ISTANA

Baru 2 Bulan, UPZ Himpun Rp6 Juta Zakat Mal PERAWANG(DP)-Sebagai salah satu kampung yang ditunjuk sebagai Program Kampung Sakinah terus berupaya untuk mengkampanyekan berbagai program kampung sakinah diantaranya menggalakan pembayaran dan menunaikan zakat mal melalui Badan Amil Zakat (BAZ). Wujudnya hanya dalam dua bulan UPZ Kampung Tualang berhasil mengumpulkan dana zakat mal sebesar Rp6 juta lebih. Pada Selasa kemarin UPZ Kampung Tualang Kecamatan Tualang menyerahkan zakat mal yang terkumpul kepada Badan Amal Zakat (BAZ) Tualang. Penyerahan zakat dari Unit Pengumpul Zakat (UPZ) Kampung Tualang berlangsung di kantor kampung oleh Juprianto kepada ketua BAZ ust Zulhendri. Zakat yang telah terkumpul bulan Januari dan feb ini dari UPZ Tualang sebesar Rp.6.700.000. “Alhamdullilah, kita telah menyerahkan zakat dari UPZ Kampung Tualang kepada BAZ Kecamatan Tualang,” ujar Penghulu Kampung Tualang, Selasa (3/3). Dengan adanya penyerahan ini lanjut Juprianto, berharap dapat memotivasi umat agar berlomba-lomba membayar zakat demi terwujudnya masyarakat yang agamis dan saling tolong menolang diantara sesama. Juprianto menambahkan pihaknya akan terus melakukan sosialisasi kepada masyarakat Kampung Tualang agar lebih meningkatkan kesadaran membayar zakat. “Jika banyak yang membayar zakat kesulitan-kesulitan masyarakat yang dibawah garis kemiskinan dapat dibantu. Sehingga dapat meningkatkan taraf perekonomian ditengah umat,” paparnya.(rel)

„ Kabupaten Siak Songsong Penilaian Adipura Laporan: FITRIADI, Siak MENJELANG penilaian adipura, masyarakat Kabupaten Siak diminta untuk turut berpartisipasi dalam menjaga kebersihan disekitaran tempat tinggal mereka. Karena kebersihan yang ada disekitaran tem-

pat tinggal merupakan tanggung jawab masing-masing warga oleh karena itu masyarakat diimbau untuk turut serta menjaga kebersihan. Hal ini disampaikan secara langsung oleh Kepala Dinas Pasar dan Pertamanan Kabupaten Siak, Wan Ibrahim pada Rabu (04/03). Dirin-

ya mengatakan bahwasanya kebersihan kota siak sampai sejauh ini sudah cukup bagus. Mengingat bahwasanya di Siak memang sudah terkenal dengan kebersihannya, oleh karena itu disekitaran tempat tinggal warga yang kadang masih

„BACA MASYARAKAT HAL 22

Ratusan Warga Sakai Gelar Aksi Damai Semua yang datang ke sini, asli suku Sakai, pemilik lahan di KM 41- KM 47 Desa Rantau Bertuah Kecamatan Minas seluas 800 hektare. Atuk-atuk kami mengakui lahan mereka hanya dijual kepada AN alias Heri, tak ada ke yang lain. Setelah diolah menjadi kebun sawit, Pak AN memperkerjakan kami semua di kebun itu. Bahkan, sebagian besar dari kami dibuatkan rumah

Safinar (cucu alm M Yusuf) SIAK(DP)-Ratusan warga suku Sakai di Kecamatan Minas, Rabu (4/ 35) sekitar pukul 10.00 WIB, mendatangi kantor Kejaksaan Negeri (K-

ejari) Siak. Mereka dipimpin langsung kepala suku Sakai, Badi, Bomo dan Motik. Aksi mereka disambut langsung Kajari Siak Zainul Arifin di-

F.FITRIADI

Warga suku sakai menggelar aksi damai di Kantor Kejari Siak, Rabu (4/3).

dampingi Kasi Intel Robi H Siregar. Masyarakat suku Sakai tersebut, meminta kepada pihak kejaksaan untuk menuntut seadil-adilnya dan sesuai fakta persidangan atas perkara AN alias Heri yang didakwa memalsukan surat-surat tanah. Seperti yang diungkapkan Safinar (cucu alm M Yusuf) salah seorang pemilik lahan di Desa Rantau Bertuah) di hadapan Kajari Siak menjelaskan, kedatangan ratusan warga suku Sakai untuk menjelaskan fakta sebenarnya terkait kasus sengketa lahan antara Ernawati dengan AN alias Heri yang saat ini menunggu agenda penuntutan di Pengadilan Negeri Siak. Safinar berharap, fakta persidangan dan fakta yang terjadi di lapangan dapat disampaikan Kajari Siak ke Kejaksaan Agung, sehingga putusan persidangan tidak direkayasa. “Semua yang datang ke sini, asli suku Sakai, pemilik lahan di KM 41- KM 47 Desa Rantau Bertuah Kecamatan Minas seluas 800 hektare. Atuk-atuk kami mengakui lahan mereka hanya dijual kepada AN alias Heri, tak ada ke yang lain. Setelah diolah menjadi kebun sawit, Pak AN memperkerjakan kami semua di kebun itu. Bahkan, sebagian besar dari kami dibuatkan rumah,” ungkap Safinar. Selain itu, Safinar mengungkapkan bahwa orang Sakai tertib dan taat hukum, tapi kami tidak siap

Warga Sungai Apit Keluhkan Listrik Padam Oleh sebab itu, diminta kepada pihak PLN Kecamatan Sungai Apit, agar bisa bekerja lebih profesional. Tolong cari tahu, kenapa lampu PLN ini sering mati dan sampaikan penyebabnya kepada masyarakat, sehingga tidak terjadi mes comunication,

Warga Kelurahan Sungai Apit, Marhalim SUNGAI APIT(DP)-Perusahaan Listrik Negara (PLN) Cabang Kecamatan Sungai Apit yang acap kali mati dan hidup, dikeluhkan oleh masyarakat Kecamatan Sungai Apit. lampu penerang PLN Cabang Sungai Apit ini, tidak hanya sekali atau dua kali saja matinya, akan tetapi selama 24 jam menyala, lampu PLN Sungai Apit tersebut, sering kali matinya, dan ia berlangsung berkali-kali. Demikian keluhan ini disampaikan oleh warga Kelurahan Sungai Apit, Marhalim kepada wartawan. Katanya lagi, lampu penerang PLN cabang Sungai Apit, memang sudah menyusahkan masyarakat. Pasalnya, akibat sering matinya lampu PLN tersebut, tidak sedikit barang-barang elektronik milik masyarakat bisa menjadi rusak. “Oleh sebab itu, diminta kepada pihak PLN Kecamatan Sungai Apit, agar bisa bekerja lebih profesional. Tolong cari tahu, kenapa lampu PLN ini sering mati dan sampaikan penyebabnya kepada masyarakat, sehingga tidak terjadi mes comunication,” papar Marhalim. Disampaikan Marhalim, lampu PLN Cabang Sungai Apit ini, matinya sangat tidak beraturan, dan sering terjadi ka

„BACA RATUSAN WARGA HAL 22

„BACA WARGA SUNGAI APIT HAL 22

„ Termasuk Sungai Strategis Nasional ke-7 se-Indonesia

‘Sungai Siak Harus Diselamatkan’ SIAK(DP)-Pemerintah Kabupaten Siak terus berupaya menyelamatkan Sungai Siak dengan melakukan pembangunan turap sepanjang Sungai Siak dengan menggunakan anggaran APBD „ REDAKTUR: SYARIFAH DIAN EKA SARI

Kabupaten Siak secara beransur. Demikian di sampaikan oleh Bupati Siak, Drs H Syamsuar MSi saat meresmikan Pasar Seni di Kota Siak, kemarin. Dikatakannya, dalam menyelamatkan Sungai

Siak ini, berbagai cara terus dilakukan oleh Pemerintah Kabupaten Siak, salah satunya dengan membangun turap dan membangun beronjong pemecah gelombang. “Apalagi sungai Siak ini termasuk

salah satu sungai strategis Nasional yangadadi Riauini,dari 7Sungaiyang ada di Indonesia ini, jadi sayang sekali kalau tak diselamatkan,” katanya. Untuk menyelamatkan kondisi Sungai Siak ini perlu dilaku-

kan sesegera mungkin. Apalagi, kata Bupati, penyelamatan Sungai Siak ini mendapat dukungan dana dari APBN yang jumlahnya sangat besar sekali. “Jadi rugi rugi kalau tidak men-

faatkan dengan baik. Oleh sebab itu, turap yang kita bangun itu nantinya,bisa di jadikan sebagai objek wisata baru sebagai mana turap yang telah di bangun depan pasar siak lama,” ujarnya.(*/net) „ TATA LETAK: CH.PASARIBU


22

TUALANG-KANDIS-MINAS Dumai Pos

KAMIS 5 MARET 2015

JalanLubukDalam-MaredanTungguIzin „ Tahun Ini Dibangun 2 KM Laporan: */NET, Siak

matan Tualang telah dibuka Pemkab. Akses jalan sepanAKSES jalan dari Desa Sia- jang 19 Km ini, melintasi arlang Baru, Kecamatan Lu- eal HGU milik perusahaan buk Dalam-Maredan Keca- PTPN V dan PT AIP.

‘’Tahun ini dibangun 2 Km, sisanya dilanjutkan nanti, karena masih menunggu izin pinjam pakai PTPN V,’’ ujar Bupati Siak Drs H Syamsuar

MSi, menjawab pertanyaan warga atas kapan dimulainya pembangunan jalan tersebut. Menurutnya, pembukaan akses ini memperdekat jarak dan waktu bagi warga yang hendak bepergian keluar kota,

melalui jalur lintas timur tak seperti lewat jalur sekarang ini, yaitu melewati Koto Gasib baru masuk ke Meredan. ‘’Kalau dihitung, pengendara lebih hemat satu jam lebih sekiranya nanti melintasi jalan

tersebut,’’ jelasnya. Diakuinya, saat ini banyak sekali kendaraan antar kota antar provinsi yang melintasi Siak, dari jalur lintas timur. Mereka memasuki Siak untuk berbagai tujuan

seperti Sumut dan Aceh. Dengan adanya jalan tersebut mereka tak perlu masuk ke Pekanbaru, dari arah lintas Timur seperti daerah Pulau Jawa dan sekitarnya.(des)

Pengendara Motor Meninggal di Atas Jembatan Siak SIAK (DP)-Laka maut terjadi di Jembatan Tengku Agung Sultanah Latifah, Sebuah Truk colt disel No Pol BM 8114 FZ bertabrakan dengan sepeda motor Jupiter MX BM 6136 SQ, tragis, pengendara motor Maredwan meninggal di tempat, Selasa (3/3) sekitar pukul 16:30 WIB. Sepeda motor korban terpelanting dan rusak parah, tampak wajah korban hancur memar dan bagian mata keluar. Kondisi itu membuat keluarga korban merasa terpukul. Kapolsek Siak, Kompol Ahmad Rozali membenarkan adanya kejadian tersebut, dan saat ini pengendara mobil colt disel dan barang bukti telah diamankan di Mapolsek, sementara korban langsung dilarikan di RSUD Siak. Kapolsek menjelaskan, salah satu faktor penyebab kejadian adalah mobil colt disel yang mendahului kendaraan lain di atas jembatan, dengan mengambil haluan kananan badan jalan dari arah kedatangan. “Kronologisnya, pengendara Jupiter MX Maredwan datang dari arah Dayun menuju arah Siak, sesampainya di atas jembatan Tengku agung sultanah latifah, datang dari arah yang berlawanan Mobil Truck Mitsubishi Cold Diesel BM 8114 FZ yang mendahului kendaraan yang lain dengan kecepatan tinggi, pada bidang jalan menurun dan memakan badan jalan sebelah kanan. Karena jarak yang sudah dekat, tidak dapat dielakkan lagi, colt disel tersebut menabrak Sep motor sehingga terjatuh di badan jalan,” terang Ahmad Rozali. Informasi yang dihimpun bahwa korban adalah warga Balai Kayang II, Kota Siak. Bekerja sebagai penjual tiket speed Boad di dermaga Lasdp Siak. Suami dari Lussi yakni Kepala TK Bina Kasih. Istri korban saat dimintai keterangan enggan berkomentar, dan bahkan menangis histeris, dan berteriak, mengungkapkan bahwa korban merupakan tulang punggung keluarga. “Saya sangat terkejut, mendengar kabar, bahwa suami saya meninggal akibat tabrakan, di Jembatan Siak. Padahal suami saya ini, merupakan tulang punggung di keluarga kami,” ucapnya diiringi tangis. Menurut kapolsek, kerugian yang ditimbulkan akibat kejadian ini sekitar Rp3 Juta. Kapolsek mengimbau pada para pengendara untuk selalu mentaati peraturan lalulintas dan berhati-hati. Jangan biasakan mendahului kendaraan lain di lokasi yang jarak pandangnya terbatas, seperti di atas jembatan dan bukit.(adi)

F.RINALDI

TINJAU LAPANGAN: Wakil Bupati Siak, Drs H Alfedri MSi meninjau kondisi lapangan gedung SMAN 1 pasca dihantam angin puting beliung, Selasa (3/3) petang.

Pasar Seni Kesturi Sedot Anggaran Rp4,3 Miliar SIAK(DP)-Dinas Pariwisata Kabupaten Siak membangun pasar seni di Siak sebagai tempat perbelanjaan oleh-oleh dan tempat mendapatkan cinderamata khas Kabupaten Siak tidak dengan biaya yang murah. Sebab, Pembangunan Pasar Seni yang diambil dari

tahun anggaran 2013-2014 tersebut, angkanya mencapai Rp4,3 Miliar. Demikian dikatakan oleh Kadis Priwisata Kabuputen Siak, Drs Hendrisan MSi saat peresmian Pasar Seni di Kota Siak, kemarin. “Maksud tujuan di bangunnnya pasar seni ini di lokasi

strategis ini adalah sebagai tempat menyediakan oleh-oleh bagi pengunjung yang berwisata di Kabupaten Siak,” paparnya. Selain itu, pasar seni tersebut diharakan bisa mendukung pengembangan potensi kerajinan masyarakat

hingga bisa dipasarkan dengan skala nasional. “Sebab selama ini tidak ada tempat pemasarannya. Maka sebab itu, sasaran pasar dari karya buah tangan masyarakat tersebut, tak lain pengunjung yang datang ke Siak,” katanya.(*/net)

ULP Mulai Lelang 27 Paket Fisik „ Bernilai Ratusan Miliar SIAK(DP)-Kepala Unit Layanan Pengadaan (ULP) Pemkab Siak, Said Abidin mengatakan sejak dua minggu lalu pihaknya mulai

melaksanakan proses lelang tahap I terhadap 27 paket fisik/pekerjaan konstruksi. Bersamaan dengan itu, juga dilakukan pelelangan pengadaan barang dan jasa sebanyak 24 paket dan jasa konsultan 80 paket. “Untuk tahap I, proses lelang yang sudah kita tay-

ang di web lpse.siak.go.id, didominasi Dinas Bina Marga dan Dinas Pendidikan Siak,” kata Said. Said memprediksikan untuk proses lelang tahap I ini, paling lambat akhir bulan Maret 2015 sudah ada pemenangnya. Saat ini, prosesnya masih tahap penaw-

aran. “Bagi rekanan yang berminat mengikuti lelang, bisa masukkan secara online melalui website atau datang langsung ke kantor, kita punya layanan untuk membantu rekanan mengupload penawaran mereka,” ujar Said. Terkait adanya instruksi Bupati Siak untuk menunda

proyek pengadaan barang akibat berkurangnya Dana Bagi Hasil (DBH), Said mengaku, untuk lelang pengadaan diutamakan paket yang bersifat mendesak, seperti penyedian barang dan jasa untuk persiapan pelaksanaan MTQ tingkat Provinsi Riau yang digelar di Siak, pertengahan tahun ini. “Ada tiga paket pengadaan barang dan jasa yang kita akan diklasifikasi bantuan prioritaskan untuk tahap apa yang layak diberikan,” awal ini, terkait pelaksanaan MTQ Riau,” ujarnya. sebut Kadis. Bagi pemenang proyek, Ditempat lain Kepala Badan Penanggulangan Bencana Daerah Kabupaten Siak, Wan A Razak menyebutkan pihaknya akan menyerahkan bantuan makanan siap saji Sambungan dari.....Hal 21 kepada masyarakat yang kurang tetpantau agar terkena musibah ini.(rel) nantinya warga mau berperan serta dalam rangka menjaga kebersihan. “Kami minta kepada yang menanggani kasus ini. masyarakat agar mau aktif Apabila warga suku Sakai dalam menjaga kebersihan tak puas dengan putusan pekarangan rumah mereka pengadilan, silakan saja pasalnya nantinya juga akan sampaikan kepada penase- diadakan perlombaan hat hukumnya. Kan masih bisa banding hingga Mahkamah Agung. Saya berharap, warga Sakai bisa menjaga keamanan hingga putusan Sambungan dari.....Hal 21 ditetapkan hakim nantinya,” pan saja, untuk pagi ini jelas Zainul Arifin. Senin (3/3), matinya sudah Usai berdialog dengan mencapai hampir 7 kali. Kajari, perwakilan orang tua Belum menjelang malam, suku Sakai membubarkan jadi bagaimana masyarakat diri dengan tertib dan ber- mau nyaman. salam-salaman bertanda ‘’Parahnya lagi, ketika aksi damai memang da- muadzin sedang Adzan, mai.(adi) secara mendadak PLN

Wabup Minta Kegiatan Belajar Tetap Berlangsung Sambungan dari.....Hal 21 bisa dilaksanakan opnem untuk dilakukan rehab ringan melalui anggaran tambahan nantinya,” terang Wabup. Guna menanggulangi efek yang diterima warga, wabup intruksikan kepada instansi dan pihak terkait agar mendata kondisi warga sesuai

dengan berat atau ringanya efek yang mereka terima. Kepada masyarakat diimbauanya untuk tidak panik dan tetap beraktivitas sebagaimana mestinya. Kemudian saling bahu membahulah untuk menanggulangi yang dihadapi. Kepala Disnaker dan sosial Siak, Nurmansyah keti-

ka dimintai keterangannya menjelaskan untuk sementara data yang berhasil diperoleh warga masyarakat yang menjadi korban terjangan angin puting beliung ini sebanyak 38 rumah dan belasan dianytaranya tergolong rusak berat. “Data-data ini akan kita cek dulu untuk selanjutnya

Ratusan Warga Sakai Gelar Aksi Damai Sambungan dari.....Hal 21 kalau perkara ini tidak adil dan tak sesuai fakta di persidangan. ‘’Kami siap ke lapangan, untuk membuktikan fakta sebenarnya,” tegasnya. Selain itu, kepala suku Sakai, Bomo berharap kasus sengketa lahan yang sudah bertahun-tahun ini bisa diselesaikan dengan adil. “Kita yang datang ini, adalah suku Sakai asli, Sakai se SakaiSakainya, tak ada orang lain. Setahu saya, lahan kami itu hanya dijual ke Pak AN,” ujar Bomo. “Saya siap di„ REDAKTUR: SYARIFAH DIAN EKA SARI

tembak mati, lahan itu milik suku kami, saya pernah diancam postol di kening, saya tak takut, karena memang lahan itu milik suku Sakai,” tambah Bomo. Hal senada juga disampaikan Ketua suku Sakai lainnya, seperti Buyung L, Muslim, Firman, Motik dan Badi. Mereka merupakan saksi hidup yang mengetahui sejarah lahan suku Sakai yang awalnya seluas 1.000 hektare, hingga warga sepakat menjual lahan kepada AN alias Heri yang totalnya berkurang, dan menjadi 800 hektare.

Menanggapi aspirasi warga Sakai itu, Kajari Zainul Arifin menjelaskan tugas dan fungsi Jaksa hanya sebatas tuntutan. Perkara sengketa lahan di Desa Rantau Bertuah ditanggani oleh Kejaksaan Agung, sehingga dua Jaksa Penntutu Umum (JPU) yang menanggani kasus ini dari Kejagung. “Kasus ini sudah menjadi perhatian pusat, saya sudah lama sampaikan masalah ini kepada Kajagung. Intinya jaksa hanya sebatas menuntut saja sesuai fakta persidangan, saya sudah berkomunikasi dengan JPU

lanjut Said, segera melakukan penandatanganan kontrak ke masing-masing satuan kerja, agar langsung memulai pekerjaan. “Untuk proses lelang tahap II, direncanakan tanggal 6 Maret 2015 ini,” pungkasnya. Pantauan di website lpse.siak.go.id, sejumlah paket proyek yang nilainya cukup fantastis berada di Dinas Bina Marga. Seperti peningkatan jalan Simpang Kualian-Fery Belantik (Aspal), nilai HPS paket Rp27,3 miliar. Peningkatan jalan poros

Sungai Rawa-Futong (Aspal 1 KM +Base C 0,8 KM + timbunan 4 KM), nilai HPS paket Rp25,2 miliar. Kemudian, peningkatan jalan poros Sungai NyiurKoto Ringin (Aspal) nilai HPS paket Rp24,8 miliar. Peningkatan jalan Siak-Tumang (DAK dan pendamping DAK),nilai HPS paket Rp22, 3 miliar. Selain itu, juga terlihat puluhan paket proyek peningkatan jalan yang nilainya di atas Rp10 miliar di Dinas Bina Marga Siak.(*/net)

Masyarakat Diimbau Jaga Kebersihan penilaian kebersihan pekarangan rumah,” ujar Wan. Selanjutnya dirinya menambahkan bahwasanya untuk penilaian kali ini Kabupaten Siak optimis meraih juara satu. Karena kini Siak sendir sudah semakin cantik dan indah dengan telah dibanginya turap turap yang baru yang tentunya semakin memberikan nilai tambah

bagi Siak ini sendiri. Selain itu juga, Wan Ibrahim menuturkan perbaikan lampu-lampu penerangan yang sebelumnya mengalami kerusakan juga tengah dilakukan perbaikan secara bergantian katena ini juga salah satu upaya untuk menambah penilaian adipura yang akan datang.(des)

Warga Sungai Apit Keluhkan Listrik Padam tersebut langsung mati sehingga suara adzan sebagai pemanggil atau memberi tahu orang untuk sholat tidak kedengaran lagi, peristiwa inilah yang kami rasakan selama ini,” keluhnya. “Maka, kami minta kepada instansi terkait, agar dapat melakukan cros cek di lapangan.

Kami tidak ingin kejadian ini (mati lampu-red) terus berulang, kalau sekali-kali kita bisa maklum, tapi kalau sudah sering. Tentu ada yang tidak beres, karena itu kepada pihakpihak terkait harus dapat mentelaah terhadap kejadian ini,” tutup Marhalim.(*/net) „ TATA LETAK: ANTO


Dumai Pos

MANDAU - PINGGIR

23 KAMIS 5 MARET 2015

Mandau Lumbung Suara Terbesar Pemilukada P ETROPOLIS Tarif Parkir Kendaraan Dikeluhkan DURI (DP)—Warga Duri memprotes tarif parkir kendaraan yang dipungut juru parkir dilapangan. Tanpa ada karcis tarif pungutan parkir sebesar Rp2.000,-. Padahal retribusi parkir kendaraan ditetapkan untuk kendaraan roda dua sebesar Rp1.000,-. Protes dan keluhan ini disampaikan warga karena juru parkir dilapangan tidak dibekali karcis dan atribut yang lengkap. Potensi dari retribusi parkir belum tergarap secara maksimal dan diduga masih banyak terjadi kebocoran. “Dinas dan pengelola parkir harus menertibkan juru parkir yang tidak patuh dengan peraturan. Ambil uang parkir seenaknya tanpa ada atribut. Jika ini terus dibiarkan menjadi ajang pungutan liar,” ujar warga, Arman (39) kepada Dumai Pos, Rabu (4/3) dengan nada agak kesal terhadap pengawasan parkir masih lemah. Disebutkan pungutan parkir kendaraan sebesar Rp2.000,- dilakukan disejumlah titik. Baik Jalan Sudirman maupun Jalan Hang Tuah. Pungutan parkir lebih tertib di Ramayana dan Mall Mandau City. Karena ada karcis dan dapat dipertanggungjawabkan kendaraan parkir dalam waktu sehari. “Retribusi parkir untuk pemasukan Pendapatan Asli Daerah (PAD). Tapi pelaksanaan dilapangan tidak tertib. Juru parkir tidak ada dibekali karcis. Mestinya ada karcis yang bisa dipertanggungjawabkan,” tandasnya. Warga lain mengeluhkan hal yang sama. Karena mencapai Rp2.000,- sangat mengejutkan. Apalagi jika tidak diberi uang pecahan Rp1.000,- makan juru parkir akan memungut Rp2.000,-. “Tarif parkir sudah ditentukan. Tapi tidak boleh memungut sembarangan tanpa karcis. Persoalan ini merupakan tanggungjawab dinas terkait untuk mencari solusi terbaik,” ujar Pardede (53) menduga omset parkir di Duri perhari dapat mencapai puluhan juta rupiah. Kendaraan yang parkir dipinggir jalan atau tempat bisnis dan usaha mencapai puluhan ribu. Karena kendaraan roda dua dan empat di Duri terus bertambah banyak. Kepala UPTD Perhubungan dan Komunikasi Kecamatan Mandau, Hendri Budiman ketika dikonfirmasi perihal tersebut melalui ponselnya sedang diluar jangkauan. Sehingga belum memberikan penjelasan terkait pungutan parkir sebesar Rp2.000,-(ole).

Kawasan Kota Langganan Banjir DURI (DP)—Warga risau dengan kondisi kawasan kota Duri Kecamatan Mandau, Bengkalis rawan banjir. Diguyur hujan lebat selama tiga puluh menit banjir. Buruknya sistem drainase menjadi penyebab utamanya. Debit air hujan yang tinggi tidak tertampung lagi. “Letak kawasan jantung kota didataran tinggi. Tapi rawan banjir. Inilah yang membuat kita heran. Kondisi ini sudah bertahun-tahun. Tapi sayangnya belum ada solusinya,” ujar warga, Mustarudin (52) kepada Dumai Pos, Rabu (4/3) dengan nada setengah menyindir program pembangunan dalam kawasan kota Duri terabaikan. Menurutnya, persoalan banjir sudah dikeluhkan banyak pihak. Genangan air hujan meluap dan menggenangi ruas jalan protokol. Sehingga sangat menganggu kelancaran arus lalu lintas. “Kondisi dan bentuk drainase dalam kawasan jantung kota tidak layak. Harus ditata ulang dan dibenahi secara total. Kalau dinormalisasi sifatnya sementara saja. Karena air tidak dapat mengalir ke tempat yang rendah,” paparnya.(ole)

Kantor Camat Mandau Hotel Susuka Jamsostek Duri Makoramil Mandau Telkom Duri Grand Zuri PLN Ranting Duri Hotel Chitra Duri PDAM Duri Hotel Fajar Indah Duri Hotel Surya Duri RSUD Duri REDAKTUR: FITRI

0765 91344 0765 598888/598777 0765 598133/92187 0765 91032 0765 91162 0765 598899 0765 91667 0765 92333/92334 0765 595332 0765 91276/91966 0765 597555/597556/ 5975867 & 597588 0765 5507245

Laporan : SOLEH, Duri MASYARAKAT Mandau dihimbau agar lebih bijak dan cerdas dalam menyalurkan hak pilihnya dalam pemilu kada Kabupaten Bengkalis jelang akhir tahun ini. Dengan jumlah suara terbanyak, menjadi barometer kemenangan bagi calon bupati dan wakil bupati Bengkalis mendatang. Elit politik menyebut Mandau lumbung suara terbesar dari tujuh kecamatan di wilayah Kabupaten Bengkalis.

“Dari Mandau saja sekitar 200 ribu pemilih tetap. Rangking kedua kecamatan Pinggir, hampir 100 ribu pemilih. Setiap dalam pesta demokrasi banyak Golput atau tidak menyalurkan hak pilihnya. Karena itu, masyarakat Mandau harus bangun dari tidur panjangnya. Lalu siapa yang akan merubah daerah ini, jika tidak orang Mandau sendiri, “ kata Politisi Partai Hanura, Zulkifli Ikep SE kepada Dumai Pos, Rabu (4/3). Anggota DPRD Kabupaten

Bengkalis Dapil Mandau ini, mengatakan suara terbesar jangan disia-siakan. Meskipun dalam pesta demokrasi ada menang dan kalah. Sebagai perbandingan dengan kecamatan lain, wakil rakyat dari Dapil Mandau sebanyak 19 orang. Potensi Mandau untuk menang dari pasangan yang jagokan terbuka lebar. “Pemilukada dilaksanakan serentak Desember 2015 mendatang. Waktu terus berjalan cepat. Bakal calon bupati dan wakil bupati sudah menebar

pesona untuk mencari simpatik dari masyarakat, “ jelasnya. Dia yakin masyarakat sudah semakin kritis menyikapi perubahan peta politik. Sebagai suara terbesar, jangan sampai terbelah. Apalagi terbawa arus politik uang. Demokrasi yang bagus adalah menyalurkan hak suara sesuai dengan hati nurani masingmasing. “Dari Mandau sudah muncul calon bupati dan wakil bupati Bengkalis. Hanya saja ting-

gal menentukan pasangan dan koalisi partai politik pengusung. Sampai saat ini, belum ditetapkan siapa saja yang bakal maju bertarung dalam pemilukada mendatang, “ tukasnya. Masyarakat Kabupaten Bengkalis umumnya dan Mandau khususnya harus menyatukan tekad dan solid untuk memilih calon pemimpin kabupaten Bengkalis bersih, jujur, amanah, pro rakyat dan berjiwa membangun. Sehingga daerah ini berkembang pasat dan maju dalam segala sektor. (fit).

RESMIKAN: Bupati Bengkalis Ir H Herliyan Saleh menghadiri peresmian RM Gombak Pauh dan duduk bersama Anggota DPRD Bengkalis dr Fidel Fuadi dan Abi Bahrun.

Menu Ikan Kari Andalan RM Gombak Pauh DURI (DP) - Lembaga Nazif Wakaf (LNW) Ibadurrahman membuka Rumah Makan Gombak Pauh di jalan Sudirman sebelum Mapolsek Mandau dengan menu khas Ikan Kari. Camat Mandau H Hasan Basri membuka secara resmi rumah makan tersebut, Rabu (4/3). Peresmian RM Gombak Pauh ditandai dengan pengguntingan tali balon oleh Camat Mandau itu dan didampingi

wakil DPRD Propinsi Riau, sejumlah DPRD Bengkalis, Direktur LNW H Khairul Umam LC dan pejabat daerah lainnya. “Rumah Makan yang teletak di jalan lintas Sumatra ini akan banyak pengunjung khususnya yang dari lintas propinsi. Ditambah lagi kota Duri akan dijadikan kota transit, dimana mereka yang lewat akan singgah dan menginap dikota Duri

sembari mencicipi kuliner kota Duri,”kata Camat Mandau, H Hasan Basri pada sambutannya saat grand opening RM Gombak Pauh ini. Sementara itu, Manager RM Gombak Pauh Aris Munandar mengatakan tujuan membuka rumah makan dengan menu khas ikan ini salah satu usaha untuk mendukung program pemerintah yang saat ini tengah menggalakan masyarakat

untuk memakan ikan. “Selama ini pemerintah selalu mengkampanyekan agar masyarakat memakan ikan. Rumah makan pauh ini akan berpartisipasi mensukseskan program tersebut. Hasil dari penjualan ini setiap harinya juga akan di wakafkan, sesuai kerja sama yang sudah disepakati bersama dengan pihak pendana,”kata Aris Munandar didampingi Direktur LNW, H

Khairul Anwar LC. Dalam grand opening RM Gombak Pauh yang ditutup dengan makan siang bersama itu tampak hadir Bupati Bengkalis, Ir H Herliyan Saleh beserta SKPD Pemkab Bengkalis, Upika Mandau, sejumlah anggota DPRD Bengkalis, tersebut hadir, pimpinan bank di Mandau, pimpinan perusahaan di Mandau dan tokoh masyarakat. (ira)

12 Siswa SMKS Korpri Ikuti Remedial DURI (DP) - Masa Ujian Nasional (UN) 2015 hanya tinggal hitungan hari saja. Pihak SMKS Korpri Duri melakukan berbagai persiapan agar siswanya dapat lulus dengan nilai terbaik. Sebanyak 12 siswa dari 107 peserta UN SMKS Korpri Duri yang mengikuti ujian kopetensi akhir pekan lalu dinyatakan tidak lulus dengan nilai yang diharapkan sehingga harus mengikuti remedial. “Sabtu ini yang tidak lulus ujian kopetensi akan mengikuti remedial. Ini bentuk keseriusan pihak sekolah untuk memacu semangat anak didik untuk lebih matang dalam mempersiapkan diri mengikuti ujian nasional 2015,”kata Kepala Sekolah SMKS Korpri Dra Yusmiaty pada Dumai Pos diruang kerjanya, Rabu (4/3). Dijelaskannya, ujian kopentensi dilakukan selama dua hari

berturut-turut Sabtu (28/2) dan Minggu (1/3) , dengan naskah soal berasal dari Pusat. Sebagai tim pengujinya, pihak sekolah sudah menndatangkan dunia usaha, diantaranya dari PT Dimas Drillindo, PT Verina Tri Sejahtera dan PT Swalayan TBk Duri. Yusmiaty menjelaskan jika total siswa yang terdaftar sebagai peserta UN 2015 mencapai 107 orang dengan mengikutsertakan tiga jurusan. Masing-masing jurusan itu adalah Teknik Komputer Jaringan (TKJ,Red), Akutansi dan Tata Niaga. “Nilai UK ini akan digabung nantinya dengan nila UN yang bakal dilaksanakan pada 13-16 April mendatang, sebagai penentu kelulusan siswa. Dan kita juga sudah melakukan 2 kali tryout dan dalam waktu dekat juga akan dilaksanakan sekali lagi,”pungkasnya. (ira)

F: DIKA

Kemacetan yang terjadi di Desa Semunai disebabkan adanya kendaraan yang rusak.

Mobil Rusak Picu Kemacetan DURI (DP) - Akibat dikarenakan kurangnya pemeliharaan terhadap kendaraan yang akan dibawanya sehingga menimbulkan kemacetan dijalan lintas sumatera tepatnya didesa semunai kecamatan Pinggir kaupaten bengkalis. Kemacetan yang dipicu oleh kerusakan salah satu kendaraan yang tak

diketahui nomot polisinya. Menurut salah seorang masyarakat Pinggir Naldo kepada Dumai Pos, Rabu (4/3) mengatakan. Memang benar ada kemacetan didesa Semunai disebabkan oleh kerusakan kendaraan yang datang dari arah duri menuju pekanbaru.

“Kemacetan kendaraan sekitar 2 jam lamanya sempat memicu kendaraan yang padat menjadi harus antri dengan menggunakan sistem buka tutup, “ujarnya. Setelah adanya penarikan oleh kendaraan lain dan kemacetan bisa teruraikan kembali. (dik)

Honor Guru Komite Perlu Peningkatan DURI (DP) - Kesejahteraan guru adalah merupakan faktor pendukung dalam melaksanakan tugas sehari hari di dalam kelas untuk mencerdaskan bangsa. Dan jika hal itu tidak terwujud pesimis seorang professi guru terutama guru honor komite dapat mentransfer ilmu kepada anak dapat

berjalan sesuai dengan harapan. Ketua Komisi IV DPRD Bengkalis H Abi Bahrum mengakui sudah banyak mendapat keluhan atas minimnya honor yang diterima guru honor komite. Jumlah tersebut sangat memprihatinkan. Untuk itu kedepan hal ini

akan menjadi perhatian. Setidaknya sesuai dengan UMR atau setara dengan guru honor daerah (Honda) tanpa harus tergantung terhadap dana BOS. “Kita sudah sampaikan kepada Pemkab Bengkalis untuk dapat perhatian dari pemerintah, karena guru mempunyai kebutuhan yang begitu besar

untuk menunjang pengetahuannya untuk lebih maksimal. Maka harapan negera mencerdaskan anak bangsa akan tercapai,jika masih dibawah UMR tentunya sulit mengharap lebih banyak. Padahal seorang guru dituntut pendidikan S1. Kita akan usulkan payung hukumnya melalui Perbup,”kata H Abi

Bahrum. Ditambahkan bahwa apa yang menjadi harapan tersebut diperkirakan akan dapat terealisasi di tahun 2016. “Kita perkirakan tahun 2016 mendatang hal ini sudah bisa terwujud. Saat ini kita masih melakukan usulan dan berbagai kajian,”pungkasnya (ira) TATA LETAK: SUSAN


24 Dumai Pos

ROHIL EKSPRES Membangun Bersama Masyarakat

KAMIS 5 MARET 2015

Bupati Pertanyakan Perpanjangan Izin PT Diamond Raya Timber S INGKAT ROHIL Warga Kesal e-KTP tak Kunjung Siap MERANTITIMUR(DP)Setiap warga negara indonesia yang berusia 17 ke-atas wajib memiliki identitas kependudukan atau yang lebih dikenal dengan sebutan Kartu Tanda Penduduk Elektronik (E-KTP) namun ironisnya masih ada saja warga yang seakan dipersulit dalam kaitannya untuk memperoleh E-KTP. Seperti disampaikan Hendri Siahaan (50) kepada Dumai Pos 3/3, warga Meranti Makmur ini merasa kesal karena E-KTP yang diurusnya sejak 1,5 bulan yang lalu tidak kunjung selesai, “Padahal saya sudah melengkapi semua persyaratan yang dibutuhkan untuk ngurus KTP, tapi entah dimana salahnya hingga sampai hari ini belum juga selesai, “kesalnya. namun kata Hendri yang mengherankan dirinya adalah kenapa kalau pengurusannya tanpa melalui kantor penghulu bisa lebih gampang, “ kalau calo yang menguruskan cepat tapi kalau warga yang mengurus kok dipersulit, jadi apa gunanya ada kantor penghulu, “ujarnya. Sementara itu Penghulu Meranti Makmur Dini Desiany ketika ditemui Dumai Pos, 3/3 di ruangan kerjanya di Kantor Kepenghuluan Meranti Makmur dirinya membenarkan bahwa warganya tersebut memang benar ada melakukan pengurusan identitas kependudukan, “Sudah hampir 1,5 bulan Pak Hendri mengurus KK dan KTP, namun sampai hari ini belum selesai juga, semua persyaratan sudah dipenuhi dan berkasnya sudah diserahkan ke kabupaten entah di mana masalahnya, saya juga sudah mencoba menghubungi fihak disdukcapil untuk mempertanyakan hal itu, tapi belum ada hasil, “ujar Dini. (cr4)

Laporan : EKASUSILA, Bagansiapi-api BUPATI Rohil H Suyatno, menegaskan Pemerintah Kabupaten Rokan hilir memprotes Menteri Kehutanan Republik Indonesia dikarenakan telah memperpanjang izin HPH PT Diamond Raya Timber. Padahal izin perusahaan yang menebang dan menjual kayu hasil hutan itu sudah berakhir pada tahun 2019 mendatang. Hal itu diungkapkan Bupati Rokan Hilir H Suyatno, saat menyambut kedatang anggota

DPR RI di Bagansiapiapi belum lama ini. “Kita berencana tidak memberikan rekomendasi perpanjangan izin, bahkan tahun 2019 mendatang sudah berkahir, namun akhir tahun lalau kami terkejut tiba-tiba izinnya sudah diperpanjang,” kata Bupati. Tidak diresponnya perpanjangan izin ini menurut orang nomor satu di Rohil ini merupakan keluah kesah dari masyarakat yang merasa selama ini haknya telah direnggut selama puluhan tahun. “Kasihan masyarakat kita semua terkendala dan

tidak bisa memanfaatkan hasil alam lokal karena dikelola oleh perusahaan,” kata Bupati. Suyatno menambahkan, ditambah lagi perpanjangan izin diberikan selama 55 tahun sejak tahun 2019. ini sama saja dengan mencederai hak-hak normatif masyarakat Rokan Hilir. “Kita akan mengeluarkan segala daya upaya agar izin ini ditinjau ulang kembali,” kata Suyatno. Di jelaskannya lagi, memang secara undang-undang apabila pemeritah daerah tidak memberikan rekomendasi perpanjangan izin maka bsia lang-

sung meminta izin ke kementerian. “kita menduga mereka lobi ke pusat dan akhirnya perpanjangan iziin dikeluarkan, namun perlu diketahui rumah ini masih ada tuannya,” kata Bupati memberikan perumpamaan. Bahkan, dengan adanya PT yang membidangi Izin Pemamfaatan Hasil Hutan Kayu (IUPHHK) banyak memberikan kemudharatan kepada masyarakat lokal. “Sama-sama kita ketahui bahwa ita ada indutri kapal kayu yang dipesan orang luar negri, saat ini sangat kesulitan bahan baku dan banyak

yang memesan dari luar,” kata Bupati. Meskipun dalam peraturan tertera bahwa kayu dari PT Diamond boleh dijual kepada masyarakat lokal dengan bobot 5 persen dari total kayu yang ada. Namun kerap kali harga yang di jual ke masyarakat tinggi dan menurut masyarakat ini berat.“Intinya kita pertanyakanlah, kita tidak mau izin ini diperpanjang lagi, kita mau dikelola oleh masyarakat kita bukan oleh perusahaan yang tidak ada kontribusi apa-apanya,” pungkas Suyatno.(rka)

April, Gerindra Mulai Penjaringan Balon Bupati UJUNGTANJUNG(DP)-Dewan Pengurus Cabang (DPC) partai Gerindra kabupaten Rokan Hilir masih menunggu petunjuk pelaksanaan dan petunjuk teknis tentang pengajuan bakal calon bupati Rohil ke Komisi Pemilihan Umum Daerah (KPUD) dari DPP Gerindra pusat. “Kami DPC Gerindra Rohil siap dengan perhelatan politik pemilukada kita yang dipercepat pelaksanaannya pada Desember tahun ini, tapi kami masih menunggu juklak dan juknis tentang pengajuan calon dari DPP,” kata ketua DPC Gerindra Rohil Jufrizal SSos, Selasa (3/2) di Ujung Tanjung. Akan tetapi lanjut Jufrizal, segala persiapan penjaringan dan sebagainya secara internal maupun eksternal sudah dipersiapkan. “Gerindra biasanya membuka penjaringan bakal calon (balon) terbuka untuk umum. Kami berharap Gerindra pada musim pilukada kali ini dapat mengusung balon dari putera-puteri Rohil yang terbaik. Agar ke depan kabuputen kita lebih baik dan bermartabat baik segi ekonomi maupun birokrasi,” katanya. Jufrizal menambahkan beberapa hari sebelumnya DPC telah berkordinasi dengan DPP dimana diterangkan dalam waktu dekat seluruh DPC yang ikut pemilukada segara dipanggil ke pusat untuk mendapatkan Juklak dan Juknis. “Kami rasa pada akhir bulan ini ataupun awal April sudah di buka penjaringan dari partai Gerindra,”pungkas Jufrizal.(eka)

Sekretaris Daerah

(0767) 24567

Sekretariat DPRD

(0767) 24567

Ambulance

(0767) 21040

Pemadam Kebakaran Polsek Bangko

(0767) 21130 (0767) 21110

Kantor Kecamatan Bangko (0767) 21010 Dinas Kesehatan

(0767) 24381

Dinas Kehutanan Dinas PMD

(0767) 21710 (0767) 24284

Dinas Pendidikan Dinas Kimpraswil

(0767) 23277 (0767) 24385

Dispenda

(0767) 22061

Bawasda

(0767) 24960

Bappeda Bapedalda

(0767) 24928 (0767) 24928

KPDE Dinas Pertanian

(0767) 24998 (0767) 24184

Dinas Perhubungan PLN

(0767) 24330 (0767) 21280

REDAKTUR: GENTA MUKARRAM

F: EKA

SAMBUT: Menyambut malam cap go mei kamis malam warga Tionghua Bagansiapiapi telah sibuk dengan berbagai agenda kegiatan seperti terlihat dalam gambar,berbagai tradisi dilakukan jelang perayaan terang bulan.

ADVERTORIAL PEMKAB ROHIL

Warga Serahkan Bantuan Cangkul kepada Penghulu BAGANBATU(DP)— Salah satu efek dari kegiatan gotong-royong yang rutin digelar di Bagan Batu ini adalah dengan ditandai semakin tingginya tingkat kesadaran masyarakat untuk berpartisipasi di tengah-tengah masyarakat seperti halnya dilakukan oleh warga Bagan Batu, Pdt P Siregar yang memberikan bantuan sejumlah alat kerja berupa cangkul yang diterima oleh Penghulu Bagan Batu, Mukhtar Waslin di kantor Penghulu Bagan Batu, Rabu 4/3. “Ini tidak seberapa, namun inilah yang bisa saya berikan untuk kepenghuluan Bagan Batu, semoga bisa bermanfaat, “ujar Pdt. P. Siregar SE. usai menyerahkan bantuan secara simbolis

Penghulu Bagan Batu Mukhtar Waslin saat menerima bantuan berupa cangkul dari warga Bagan Batu Pdt P Siregar SE Rabu (4/3).

kepada Penghulu Bagan Batu. Penghulu Bagan Batu ketika ditemui di ruangan kerjanya mengaku bersyukur dan terharu atas partisipasi yang diberikan salah seorang warganya tersebut, “saya atas nama masyarakat mengucapkan terima kasih yang sebesar-besarnya kepada Pak Siregar atas bantuan ini, “kata Waslin. Lanjut Waslin dirinya juga mengajak sejumlah fihak untuk terus aktif menjaga kebersihan lingkungan, “marilah sama-sama kita menjaga kebersihan lingkungan kita masing-masing agar kita semua sehat dan terhindar berbagai penyakit, apalagi ini kan musim pancaroba,”pungkas Waslin.(cr4)

Buang Sampah Sembarangan, Warga Harus Diberi Sangsi BAGANSIAPI-API(DP)— Melihat saluran air pinggir jalan atau drainase yang tersumbat akibat banyaknya sampah, menjadikan Pemerintah Kabupaten Rokan Hilir (Pemkab Rohil) tergerak untuk meminta seluruh Camat, Kepala Desa (Kades), Kepala Dusun (Kadus) dan RT RW selaku kepala wilayah di daerahnya untuk menegur warganya yang membuang sampah sembarangan sehinga, sampah itu banyak masuk ke drainase. Dan bila perlu kepala

daerah itu memberi sanksi sosial terhadap pembuang sampah. “Jangan buang sampah ke sembarang tempat, apalagi ke dalam selokan, kebiasaan itu harus segera dihentikan karena akan banyak membawa kesusahan seperti, susah bernafas karena bau, susah melihat yang jorong dan otomatis susah dalam segi kesehatan yang harus menghirup udara yang sudah campur dengan bau limbah,” kata Bupati Rohil, H Suyatno AMP,

wartawan Rabu (4/3) di Bagan Siapiapi. Selain menyebabkan saluran tersumbat dan bau, kondisi itu akan membuat banyak jentik nyamuk bersarang di sana, bila sudah seperti itu maka akan mengancam kesehatan masyarakat. “Intinya. banyak masalah jika kita membuang sampah sembarangan. Perangkat Kecamatan dan Perangkat Desa memiliki peran sangat penting dengan tidak henti hentinya mengimbau warganya, agar selalu menjaga

kebersihan lingkungan,” ujarnya. Lanjut Bupati lagi, dirinya mengharapkan budaya gotong royong di setiap kecamatan terus dilakukan. Karena, dengan gotong royong, kekompakan dari satu instansi ke instansi lain bisa dihat sejauh mana sinkronisasi yang di lakukannya. “Seperti gotong royong di Bagan Sinembah beberapa hari lalu, kehadiran PNS ikut terlibat diharapkan menjadi motivator bagi warga dalam menjaga kebersihan.

Sebab, kegiatan gotong royong ini bagian penting bagi gampong agar bisa hidup sehat,” ucapnya. Lebih jauh Bupati mengatakan, kebersihan lingkungan tidak bisa ditawar tawar lagi. Karena kebersihan lingkungan bagian penting bagi hidup sehat. “Perangkat Camat dan Desa harus mengajak masyarakat untuk membantu pemko dalam menciptakan lingkungan bersih. Apalagi saat ini banyak penyakit yang sudah ditimbulkan akan hal itu,” terangnya. (cr4) TATA LETAK: SUSAN

Profile for Dumai Pos

Dumaipos 5 maret 2015  

Pertama dan Terbesar di Riau Pesisir

Dumaipos 5 maret 2015  

Pertama dan Terbesar di Riau Pesisir

Advertisement