Page 1


Exhibitors for 2014 - Welcome We would like to extend a warm welcome to all our exhibitors, both those of you who have been involved with us before and new exhibitors entering for the first time.

ONLINE ENTRIES CAN BE MADE AT www.tullamoreshow.com ONLINE ENTRIES CLOSE FRIDAY 18th JULY If you wish to enter on the enclosed entry forms, see notes below. HOW TO ENTER: • Select the class(es) you wish to enter. • Select the correct entry form(s) which accompanies this booklet. • Check the general rules, the section rules and the class rules. • Fill out forms accurately, giving all the required information incomplete forms may have to be returned.

• Deliver or post the completed hard copy entry form(s), together with full remittance to the Show Office, Church St., Tullamore to reach us on or before Friday 11th July.

• We are sorry but faxed or unpaid entries cannot be accepted and will not be processed.

• Exhibit cards will be posted to you a few days before the Show date. • On Show Day you may present your entries at the Showgrounds to the appropriate

• • •

section before 10.00 a.m., unless otherwise stated. Consult section rules regarding “entries on the day”. The Show site is located on the Birr Road, three miles from Tullamore town at Butterfield Estate, Blueball, Tullamore. Please use correct entrance gate - will be signposted. Please have correct admission fees ready at the entrance gates. One section of Exhibit cards will be displayed with exhibits for the indoor sections. The second section will be required to claim back the exhibits. In the case of animals, cards must be exhibited while classes are being judged. Prize money is posted out in weeks following the Show. Wishing you every success with your entries. If you have any queries, we would be delighted to help. Details from Freda Kinnarney, Show Office, Church Street, Tullamore, Co. Offaly. Tel/Fax: 353 - (0)57 93 52141 Email: info@tullamoreshow.com

Admission to Show

Web: www.tullamoreshow.com See details on entry forms


Welcome to the Butterfield Estate Last year has flown by and it's hard to believe that it's that time of the year again when we launch the 2014 Tullamore Show and the AIB National Livestock Show. Once again our main sponsor of the National Livestock Show is AIB and as always we are delighted to have them on board. I wish to extend and acknowledge our sincere thanks to AIB. It is the twelfth year of our association with them and we are very much looking forward to yet another successful year. Without our sponsors the Show could not proceed to such a high standard and we could not reward our prize winners to such an extent. Moreover we extend a huge 'thank you' to all of our valued sponsors for their continual support. Last year saw the introduction of our online system for entries and this is proving to be an extremely popular and user friendly. Entries can be completed online with ease and efficiency at www.tullamoreshow.com. I am very proud and happy to take on the role of Chairman for a second year running and I look forward to meeting and greeting both old and new acquaintances on the Butterfield Estate this August. Thanks to all sub-committee for the immense hard work they have put into preparing the Schedule of Classes. Finally I wish all exhibitors well in 2014 and hope you have a safe and enjoyable day. Looking forward to meeting you on the day!

Yours sincerely, Rodney Cox Chairman

1


- Show ExecutiveChairman: Vice-Chairperson: Secretary/Administrator: Asst. Secretary: Joint Treasurers: P.R.O.:

Executives:

Rodney Cox Brenda Kiernan (Cookery) Freda Kinnarney George Gill (Site Development) Pat Harnett (Signs) & Tom Maher Christy Maye

Vincent Bermingham (Dogs) Bobby Campbell (Power) Trevor Chadwick (Pedigree) Tony Colville (Safety) Austin Colton (Equestrian) Lesley Cox (Inventions) Leonard Dolan (Meat Village) Michael Dolan (Commercial Cattle) Seamus Dolan (Trade Stands) John Donoghue (Horticulture) Peter Donoghue (Sheep) Carmel Duffy (Entertainment) Tommy Finlay (Dairying) Vincent Keaveny (Sheep Dogs & Sheep Shearing) Tim Kruger (Poultry) Richard Langford (Rare Breeds) Joe Molloy (Car Parks) Phil Rigney (Crafts) Ann Sheerin (Art & Photography) Niall Sweeney (Sponsors Coordinator)

2


- Contents page Chairman's Welcome

1

Show Executive

2

Contents

3

Useful Information

4

Features at the Show

5

Entertainment Programme Artisan Food & Craft Pavilion

7 8

Sponsors 2014

9

Dairy Cattle

15

Pedigree Cattle

24

Commercial Cattle

47

Sheep

55

Sheep Shearing

68

Sheepdog Trials

69

Horses - Showjumping

71

Horse Showing

74

Entertainment Classes

85

Dogs

86

Horticulture & Farm Produce

89

Cookery & Food

102

Crafts & Needlework

110

Art & Photography

114

â‚Ź2,000 National Inventions Competition 2014

117

Poultry

118

Qualifiers - Rules & Regulations

122

General Rules & Regulations

131

Livestock Issues

136

3


USEFUL INFORMATION Catering on Show Day All your catering needs will be provided on the Showgrounds on Show Day by

BENSON FOOD COMPANY First breakfast will be served at 8.00 a.m.

Early Online Entry Draw We would be delighted to receive early online entries a Special Draw for â‚Ź100 will be held for people who have made their entries online on or before Friday 4th July 2014 See www.tullamoreshow.com to enter.

Safety at Shows We all want to have a successful, enjoyable show but also a safe and accident-free occasion. To ensure this, the co-operation of all is vital, including exhibitors, spectators and organisers. A few guidelines to note in relation to safety are as follows: - Please observe signs - especially those relating to caution in livestock areas. - Please do not exhibit animals that are unsuitable with regard to safety e.g. hard to control. - All animals must be led by a competent handler. - Animals should not be tied to trailers. - Dogs should be on a lead and under the control of the handler. - Caution and care should be exercised at all times.

So, come early and have a safe and enjoyable visit to the Tullamore Show on August 10th 2014 4


FEATURES AT THE SHOW Macra na Feirme All-Ireland Farm Skills Competition Each year Macra hold their All Ireland Farm Skills Competition at our Show. They are very welcome and we also acknowledge the support they get from FBD Insurance for the Competition. It brings a particular buzz to that part of the Showgrounds. Macra plan for an even greater presence this year. Six clubs from around the country take part and it involves very practical and appropriate skills for present day young farmers.

Rare Breeds & Pets Corner Always of great interest to children and adults alike, the unusual animals and birds make a very attractive display. Nowadays, with such a high percentage of our children reared in urban settings, it is very important for them to be able to come close to animals and birds, be they rare or common. All pets and rare breeds will be under the watchful eye of Richard Langford (086 070 0053).

Loy Digging Championships 2014 The All Ireland Loy Digging Championships for Under 14 and Under 16 age groups will be held at the Show this year. There will be separate competitions for Boys and Girls and the winners will be presented with beautiful plaques. See classes 695 to 698. The competition runs from 2.30pm to 5.30pm. Entries will be taken on the field, close to the Horticultural Marquee. 5


Forestry & Sustainable Living Exhibition The further expansion to the Forestry & Energy Village will progress the very successful programme which has now become a very big attraction at the show. The section is being located in the main trade stand area this year and will have plenty to interest everyone. Liam Kelly of Teagasc is our Section planner. He can be contacted on 087 909 0495.

Vintage This section has been growing steadily since its introduction. Made up mainly of vintage machinery and under the steady eye of Joe Clancy, it is a crowd puller every year and is a big hit with the more mature members of our attendance. If you're interested in exhibiting in this section, contact Joe Clancy on 087 259 1164. Sponsors: Clancy Recovery, Tullamore, Co Offaly Callington Limited, Tullamore Hynes Driving School, Tullamore

Trade Stands Online trade applications now available on http://www.tullamoreshow.com Closing date for Trade stands: 27th June 2014 In excess of 650 Trade & Machinery Stands will be exhibited at the Tullamore Show and AIB National Livestock Show on Sunday 10th August 2014. They will include all the main categories of Businesses. The facilities include indoor and outdoor stands with an increase in the total area allocated to this section. 6


ENTERTAINMENT PROGRAMME 1. Best Dressed Lady Sponsors: Bridge House Hotel, Tullamore, Reveal, Catriona McMorris, O’Moore Street, Tullamore, Rose Finlay Pharmacy, Main Street, Tullamore, Co Offaly, My Style, Mucklagh,Tullamore, Annabrook House Hotel, Mullingar, Co Westmeath 2. Best Dressed Man Voucher for an outfit from Galvins for Men, Tullamore, Co Offaly 3. Glamorous Granny Sponsor: Tony Cahill Jewellers, Patrick St Tullamore, Co Offaly 4. Little Mr. Offaly Sponsors: Menarys Jumpin Jacks, Tullamore 5. Little Miss Offaly Sponsors: Menarys Jumpin Jacks, Tullamore 6. Bonny Baby Competition Sponsors: Menarys Joe Sullivan Photography, Tullamore 7. Traditional Farmer Sponsor: €200 J&M Douglas Jewellers, Tullamore All entries are taken on the field on Show Day. Other Activities • Children's Amusements & Monster Bouncing Slides • Children's Fun Games • Music All Day on the Stage • Lots to see and do 7


Artisan Food & Craft Pavilion Sponsors: Local Enterprise Office Offaly Offaly Local Development Company We have a pavilion dedicated to local food & craft. The Artisan Food Market will stock delicious, locally produced food while in the Craft Market you will find custom made furniture, handmade jewellery, soft furnishings and gift items all showcasing the diverse and artistic talents of Offaly Enterprise. The Artisan Food & Craft Pavilion is sponsored by the Local Enterprise Office Offaly and Offaly Local Development Company Ltd. to give local food & craft entrepreneurs the best opportunity available to promote and sell their produce. This is one of a number of initiatives designed to help people setting up or growing their business. For further information on the Local Enterprise Office Offaly, check out http://www.localenterprise/offaly and for information on Offaly Local Development Company Ltd, check out http://www.offalyldc.ie Further information on the Artisan Food & Craft Pavilion from: Pauline Hoctor, Offaly Local Development Company - Tel: 057 9322850 Orla Martin, Local Enterprise Office Offaly - Tel: 057 9357480

8


Our Generous Sponsors for 2014 Show

 5%(/)<

&&)</)-;%12527)/



52+)15)/%1(

5)/%1(7(

++5).25/-0-7)(

+5-/2<(-0-7)(

+5-))(6

+5-7)',

  %1.

-(%1 8'./)<

//721)

//7)'

1+86 ))*5/-0-7)(

1-0%;

11%+,%59)<48)675-%1)175)

11)&522.286)27)/

17,21<'%//<2-1)5<

5()148)675-%128175</27,-1+

5-=21% 

55%&%:1223

#

%1%+,)55)'%6721'5)7) ))',-// 8/&6 )+/-)9)78( )/'/%5),))32'-)7< )/7);,))32'-)7< )11-)/2:)56 25( -% 25( -% 29%)1)7-'6 5-(+))175)%1%+)0)17 5-(+)286)27)/%1()-685)   5%1', 527,)517)51%7-21%/ 8'./)<683)50%5.)7 8++<22(6 <51)%6)< 662'-%7)6 250)< 87',)56 %*>  5)9-//) 506 %,-//):)//)56 %//-1+721-0-7)( %67/)/2:)56 )/7-')%-1)5%/6 )175% )175%-/&)++%1 ,%5/)9-//)67%7) /%1'<)'29)5< /21%+,)(-+5)))5(6 /<()6(%/)256)2'-)7<

2/7212725625( 21'5)7)8%55<1+-1))5-1+%18*%'785-1+)59-')6 21(521-60%17/)56 2112//<)(0-//6 22/025)78( 2:20*257%<2%76 2:'%5)<67)06 5266 +5-'8/785%/1+-1))5-1+7( %/<%1(6'%3-1+ %9-(%5.)5 %:1)%76 )%9%/7( )'/%1)//< ))5-1+856)5-)6 )1-62<1)622*'%5) )59-//)2/%1 ''2817%176 -+-5-176 2/%1%50833/-)6 21%/<1',! 212,8)%548))6 22/)<"22/6 22/-16)59-')7%7-21 276)5 29)%)1)7-'6 875-7-217( 81&-% 811)6725)6 !21()//7( %0211%6)<5%'7256 (-1&85+,87(225/27,-1+203%1< 852+)1) )59-')6 %50%1(/%17 %50! %50()%/-) %50-1+1()3)1()17  1685%1') ))(%//-)7))()56 )5+%/%11)5<!-()252(8'7-216 -1+)5&2%5(-//-1+7%7-21 -1/%<'2-7 -7=3%75-'.6%5%+)5283 /<11))(6 )1'-1+ %/9-16)16:)%5 %/:%<,))3 5))()56 662'-%7-217( )25+)5%,%0,))3,)%5-1+ )528+,/%1%50833/-)6 )50-1%/))(6 -&1)<7))/52(8'76 -29%11-%5'%5)//-

9


/%1&-% /)1-6.-0-7)( /)1125)<8036 /)1:22( 5%66/%1( +52 5))19%/) 1-0%/))(6 %%121125%50))(6 5)11%1 87',)56 857))12//)+) ! %&-0-7)( %-5/%-5 %11-+%15-**-1! %59)<2+)56,272+5%3,< %<()1/%17-5) )<)672 -'.)<1+-1))5-1+ 2)<)11-1+ 26)<5%-/)56 855-'%1)%77/)%5) <1)65-9-1+',22/ %02/-1 

  1-6,)&&/)203%1< 5-6, &)5())1 1+86 662'-%7-21 5-6, 1+86%77/)2'-)7< 5-6, 8&5%'%77/)2'-)7< 5-6, )/+-%1 /8)%77/)2'-)7< 5-6, /21(( 48-7%-1) 5))(2'-)7< 5-6, 86-1)66<67)06 5-6,,%52/%-6%77/)2'-)7< 5-6,,%52//%-6,))32'-)7< 5-6,;%0-1)5 5-6,%50)562851%/ 5-6,)5)*25(5-0) 5-6,)5)*25(2'-)7< 5-6,2/67)-15-)6-%1 662'-%7-21 5-6,%'2&,))32'-)7< 5-6,-0286-1%77/)2'-)7< 5-6,2-/)(%77/)2'-)7< 5-6,%57,)1%-6)%77/)2'-)7< 5-6,85)5-)6-%1/8& 5-6,%5) 5))(62'-)7< 5-6,28+)()/8)67,))32'-)7< 5-6,,257,251-/.-1+/8& 5-6,-00)17%/%77/)2'-)7< 5-6,);)/,))32'-)7< 28+/%621 5)11%1216  80/)<21-0-7)(

)11<6-7',)1 )56)<%77/)2'-)7<2*5)/%1( )7"%6,7( )735-17 5-17/86 %18*%'785-1+ 2)8//-9%1,272+5%3,< 2,1)%9<)175% 2,1225)! 803-1%'.6 /2:)56 ))/%+,%1",2/)6%/))%76 )11<<216 662'-%7)6 5',-7)'76 )3%.-/&)++%1 -)5%1800-16! -)51%1-//-1+ -7$285-7',)1 %.)/%1(%-5-)6 %0&)6-/ %2-6%1(**%/<(8'%7-215%-1-1+ 2%5( )/<5)/%1( -%052+%1 8'7-21))5!%/8)5 -%02'725)*5-+)5%7-21 2+-'20 <1%0%5()1851-785) <15)%-0-7)( )%/-215%'7256 %,21-/ %816)//6281+),)",-7)286) '%186 526 '21%/(6)67%85%17</))175) )1%5<6 )5-%/35-1); -',%)//-9)5/%1%+%1 -',%)/ <51)! -(5)-+,7,-33-1+-0-7)( -(/%1(!)7)5-1%5<7( -(/%1(-/255-&-/ -(/%1(%(-2

-//&522.22(6 -/1):<)5 2//-167%7)6 8'7-21))56 2//2<5)'%6721'5)7) 21%+,%1%552// 8-/()56 2<9%//<)%767( 55620811) 2/87-216 8//-1%,21)223 <7</) </)6,257,%// %7-21%/!)+)7%&/)2'-)7<2*5)/%1(

10


.2(%5)/%1( 287,2*5)/%1( 5%1',8**2/.,))32'-)7< 35-1+62*7<67)06-0-7)( 7%1/)<1+-1))5-1+)59-')6 721)'5%*7 78(-21) 83)59%/8257%5/-1+721 7%1(-6, ",)/),%1 )%+%6'**%/< ))025)1+-1))5-1+ ,) 5):)5<%3 ,)2**))/8& ,)**-'))175) ,)/(%5&285 %5 ,20%6%1(6'%3) 17)51%7-21%/ 20%57-1/)'75-'%/ 2022/)-0-7)( 20'%//< 233)'))( %/%1')56 251%(2"-5) 277)1,%0-0&)5 5%160&5<26 5-%') 52<6 &%772-5 8//%025) +58//%025)285727)/ 8//%025)8)/6 8//%025)%5()1/2:)5 55%1+-1+/8& 8//%025)%5(:%5) 8//%025))%76223 8//%025))7%50 8//%025))67)3%-5)175) 8//%025)5-&81) 8//%025)!)7)5-1%5</-1-' !%1-//% )%1 %.)5< !-1')172527,< )50-1+,%0 !2/%' ",%: "%/6,))%/)<2 ''2817%176 "%762165%-/)56 "-//-%0,)-/ "5</-1-1+ $281+6%5%+)

%785%/72'.%5) ):721/%17-5) 2)/-/))1)-// 2)/)'58-70)17 87+529)%1(5%9)/ 876 &287)76 %.(%/)856-1+20) (/806 212,8)6 %.)5< 2129%11+-1))5-1+ **%/< )).))3)56 66 **%/< 20081-7<285-60 **%/<2'%/ 87,25-7-)6 **%/<2'%/)9)/230)17203%1< **%/<8%/-7<%0&52(8')56223 8//%025)2:1281'-/ //-)%57-1%'28+,/-17 %-(/%1(<+-)1) )-//")-+,-1+<67)06 6021(6 5266!)73,%505283 -7',)//2-0-7)( %(5%-+ 57,85 6662'-%7)6 %(6*25%:6 %/*-1+)5 %//%622(6 %8/-+1)<! )%.)%-5<)59-')6 )(-+5))%77/)-) )5'<,-//)1()11%1 %5281+) *-=)5 1-0%/)%/7, ,%59)75)/%1(-0-7)( -3)9-):78( )%9<2/<7811)/67( 27%72)',1-'%/)59-')6 52+5)66-9))1)7-'6 8-5.)6)(-'%/%// %9)1,-//285-)56 )9)%/ -',%5())1%127( 26)-1/%<,%50%'<  212+,8) %/)5%77/)2'-)7< %0-//-0-7)( '%//<5)'%67 ,257,2512'-)7<  -+16 <)6-+1 -+162*7,)8785) -/."22( -1+/)26) //5)/%1( /%1)<22(617)51%7-21%/

11


DATE FOR THE DIARY Networking Event for Livestock Industry The Show is hosting a Networking Opportunity in a relaxed atmosphere, for all involved in the Livestock industry, on Saturday the 9th August the evening before Show day. It will be held on the showground's of the Butterfield Estate, Blueball, Tullamore. Forum Theme - The Future Programme to Include: Key Speakers, followed by Questions and Answers from the floor.

Admission to Show Exhibitors allowed Credits (see below) against entry fees and everyone to pay at the gate. No free passes will be issued but their value may be credited against entry fees, at the time of making entries and before the closing date of 18th July. THE FOLLOWING DEDUCTIONS MAY BE MADE: Entries valued €20 – Entries valued €40 – Entries valued €60 and over –

Deduct €15 from entry fees (Cost of admission for 1) Deduct €30 from entry fees (Cost of admission for 2) Deduct €45 from entry fees (Cost of admission for 3)

Tullamore Show Society are delighted to welcome AIB as our main sponsor of the National Livestock Show. This is the Premier Livestock Show in Ireland and attracts breeders of quality cattle and sheep from all over the country. We very much appreciate this assocation with AIB and look forward to working together again. Affiliated to I.S.A., S.J.I., I.P.S. & Clydesdale Society 12


Attention All Horse Owners Important Information Needed On Show Day ¢ ¢ ¢

¢

ALL HORSES & PONIES MUST BE ACCOMPANIED BY THEIR PASSPORTS ALL HORSES & PONIES REGISTERED AFTER 1ST JULY 2009 MUST BE MICROCHIPPED ALL HORSES & PONIES MUST COME FROM A REGISTERED EQUINE PREMISES & HAVE THEIR PREMISES REGISTRATION NUMBER WITH THEM & ON THE ENTRY FORM. NAME & ADDRESS OF OWNER/PERSON RESPONSIBLE FOR HORSE/PONY

New Competition / Event FANCY DRESS DOG COMPETITION OPEN TO ALL DOGS. ENTER ONLINE CLOSING DATE 18 JULY. NO ENTRIES TAKEN ON THE DAY.

SENIOR MANAGER IN CHARGE AT THE TULLAMORE SHOW IS:

MR. TONY COLVILLE ******** EXHIBITORS PLEASE NOTE******** Special horse-lanes will be in operation again. In the interest of spectator safety, exhibitors are asked to co-operate with Stewards & use these lanes

CANCELLATION OF CLASSES The Committee reserve the right to cancel any class(es) due to insufficient entries 13


Artisan Food & Craft Pavilion Sponsors: Local Enterprise Office Offaly Offaly Local Development Company We have a pavilion dedicated to local food & craft. The Artisan Food Market will stock delicious, locally produced food while in the Craft Market you will find custom made furniture, handmade jewellery, soft furnishings and gift items all showcasing the diverse and artistic talents of Offaly Enterprise. The Artisan Food & Craft Pavilion is sponsored by the Local Enterprise Office Offaly and Offaly Local Development Company Ltd. to give local food & craft entrepreneurs the best opportunity available to promote and sell their produce. This is one of a number of initiatives designed to help people setting up or growing their business. For further information on the Local Enterprise Office Offaly, check out http://www.localenterprise/offaly and for information on Offaly Local Development Company Ltd, check out http://www.offalyldc.ie Further information on the Artisan Food & Craft Pavilion from: Pauline Hoctor, Offaly Local Development Company - Tel: 057 9322850 Orla Martin, Local Enterprise Office Offaly - Tel: 057 9357480

14


DAIRY CATTLE 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP (QWU\)HHbрнА XQOHVVRWKHUZLVHVWDWHG

5XOHV &RQGLWLRQVIRU'DLU\6HFWLRQ 7XOODPRUH6KRZ6RFLHW\DUHDGRSWLQJWKH,+)$6KRZLQJ5XOHVLQDOO)ULHVLDQFODVVHV $&HUWLILFDWHRIUHJLVWUDWLRQLVUHTXLUHGIRUDOO3HGLJUHH&DWWOHDQGLWVKRXOGEHDYDLODEOHLI UHTXLUHGRQ6KRZ'D\WK$XJXVW $OOFODVVHVH[FHSWWKHFRQILQHGFODVVHVZLOOEH1DWLRQDO/LYHVWRFN&ODVVHV )LUVWSUL]HZLQQHUVLQ1DWLRQDO&ODVVHVZLOOUHFHLYHD5RVHWWHDQGVSHFLDOO\FRPPLVVLRQHG 1DWLRQDO/LYHVWRFN6KRZ0HGDOOLRQLQDGGLWLRQWRDFDVKSUL]H 7KH&KDPSLRQRIHDFK%UHHGZLOOUHFHLYHD6DVK5RVHWWHDQGWKH*ROG0HGDO7KH5HVHUYHRI HDFK%UHHGZLOOUHFHLYHD5RVHWWHDQGWKH6LOYHU0HGDO 2YHUQLJKWDFFRPPRGDWLRQLVRQO\DFFHVVLEOHIURPSPRQ)ULGD\WK$XJXVW :DVKLQJIDFLOLWLHVDUHDYDLODEOHRQVLWH6KRZJURXQGVRSHQIURPDP 2Q6KRZ'D\OLYHVWRFNPXVWEHVWDOOHGXSLQWKHGHVLJQDWHGDUHDVDQGQRWOHIWLQWUDLOHUVQRUWKH RYHUQLJKWVKHG ([KLELWRUVZKRVHDQLPDOVUHPDLQLQWKH2YHUQLJKW6KHGDIWHUDPRQ6KRZ'D\ZLOOIRUIHLW WKHLUSUL]HPRQH\ LIDSSOLFDEOH  $QLPDOVPXVWEHKDOWHUWUDLQHG $OO&KDPSLRQVDQG5HVHUYH&KDPSLRQVPXVWWDNHSDUWLQWKH3DUDGHRI&KDPSLRQV DWSP DSSUR[ ZKHQWKH3UHVHQWDWLRQRIWKH*ROG 6LOYHUPHGDOVWDNHVSODFH3UL]HPRQH\PD\EH IRUIHLWHGLIH[KLELWVDUHQRWSUHVHQWHG ,PSRUWDQW1RWLFHWR$QLPDO2ZQHUVLQYROYHGLQ6KRZLQJ$QLPDOV 7KH,ULVK6KRZV$VVRFLDWLRQZRXOGDGYLVHDOODQLPDORZQHUVWRKDYHWKHLUDQLPDOVLQVXUHGDQGWR KDYHWKHLQVXUDQFHFRYHUH[WHQGHGWRFRYHUWKHPZKLOHVKRZLQJDQLPDOVDW6KRZV:HXQGHUVWDQG WKDWLWFRVWVYHU\OLWWOHRUQRWKLQJDWDOOGHSHQGLQJRQZKRP\RXKDYHLQVXUDQFHZLWK 1%3OHDVH1RWH/LYHVWRFN,VVXHVLQVLGHWKH%DFN&RYHUDQG*HQHUDO5XOHVDWWKHHQGRI WKH6FKHGXOH 3OHDVHQRWHWKDWGXHWRRXUUHVWULFWHGIDFLOLWLHVLQWKHOLYHVWRFNDUHDDWWKLVVWDJHZH DUHXQIRUWXQDWHO\XQDEOHWRDFFRPPRGDWHOLYHVWRFNWRZKLFKWKH([SRUW+HDOWK 5HJXODWLRQVDSSO\ 6HHEDFNRI6FKHGXOH

&ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\ 1RHQWULHVDFFHSWHGRQ6KRZ'D\

DATE FOR THE DIARY Networking Event for Livestock Industry The Show is hosting a Networking Opportunity in a relaxed atmosphere, for all involved in the Livestock industry, on Saturday the 9th August the evening before Show day. It will be held on the showground's of the Butterfield Estate, Blueball, Tullamore. Forum Theme - The Future Programme to Include: Key Speakers, followed by Questions and Answers from the floor.

15


DAIRY CATTLE JERSEY -XGJLQJFRPPHQFHVDWDPLQ5LQJ $OODQLPDOVPXVWEHSHGLJUHHUHJLVWHUHGZLWKFHUW (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHVLQFOXGLQJWKHрлБSDLURIDQLPDOVрлВ FODVVHV2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHGb

&ODVV5HJLVWHUHG3HGLJUHH-HUVH\+HLIHU&DOI %RUQLQ

6SRQVRUV $JUL1HHGV%LUU&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ-HUVH\<RXQJ+DQGOHURIWKH <HDU 6SRQVRUV $JUL/OR\G)LQJODV'XEOLQ 7XUORXJK+HUG&ROOLQV1HZFDVWOHZHVW 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV5HJLVWHUHG3HGLJUHH-HUVH\0DLGHQRU,QFDOI+HLIHU 6SRQVRUV 'RYHD*HQHWLFV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV5HJLVWHUHG3HGLJUHH-HUVH\+HLIHU,QPLON 6SRQVRUV -RKQ0RRUH05&967XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV5HJLVWHUHG3HGLJUHH-HUVH\&RZ,QPLON 6SRQVRUV -HUVH\&DWWOH6RFLHW\RI,UHODQG 3UL]HV VWрнАQGрнАUGрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ5HJLVWHUHG3HGLJUHH-HUVH\ &KDPSLRQ 6SRQVRUV 6FDOO\3UHFDVW.LOEHJJDQ&R:HVWPHDWK 1RSUHHQWU\

&ODVV%HVW8GGHUIURP&ODVVHV  6SRQVRUV 6FDOO\3UHFDVW.LOEHJJDQ&R:HVWPHDWK 3UL]HV VWрнА

16


&ODVV%HVW3DLURI5HJLVWHUHG-HUVH\&RZVRU+HLIHUV 6SRQVRUV )O\QQ)HHGV0XOOLQJDU&R:HVWPHDWK 3UL]HV VWрнАQGрнАUGрнА

SHORTHORN -XGJLQJFRPPHQFHVDWDPDSSUR[LQ5LQJ $OODQLPDOVPXVWEHSHGLJUHHUHJLVWHUHGZLWKFHUW (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHV2WKHUZLVHHQWULHVZLOOEH GLVTXDOLILHGb

&ODVV5HJLVWHUHG3HGLJUHH6KRUWKRUQ+HLIHU%RUQLQ 6SRQVRUV &RZ&RPIRUW 0D\R0DWV

3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ'DLU\6KRUWKRUQ<RXQJ+DQGOHU RIWKH<HDU 8QGHU\HDUV

6SRQVRUV ,ULVK6KRUWKRUQ0LONLQJ&OXE (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнАWKрнА 7KHDLPRIWKLVFRPSHWLWLRQLVWRHQFRXUDJH\RXQJSHRSOHWREHFRPHPRUHLQYROYHGLQ WKHPDQDJHPHQWQXWULWLRQDQGVKRZLQJRIFDWWOH 5XOHVDQG&RQGLWLRQV (QWUDQWVPXVWEHXQGHU\HDUVRQVW-DQXDU\3URRIRIGDWHRIELUWKZLOOEH UHTXLUHGRQ6KRZ'D\ 7KHHQWUDQWVFDQH[KLELWDQ\SHGLJUHH5HJLVWHUHG'DLU\6KRUWKRUQDQLPDOERUQ RQDIWHU 7KHFODVVZLOOEHMXGJHGXQGHUWKHIROORZLQJFDWHJRULHV D *URRPLQJDQGSUHVHQWDWLRQRIDQLPDORQ6KRZ'D\ E 6KRZPDQVKLSDQGKDQGOLQJVNLOOVLQWKHVKRZULQJ F *HQHUDONQRZOHGJHTXHVWLRQVRQDQLPDOKXVEDQGU\RIWKH6KRUWKRUQEUHHG

CANCELLATION OF CLASSES The Committee reserve the right to cancel any class(es) due to insufficient entries 17


&ODVV5HJLVWHUHG3HGLJUHH6KRUWKRUQ+HLIHU%RUQLQ 6SRQVRUV $UUDEDZQ'DLULHV1HQDJK 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ<RXQJ+DQGOHURIWKH<HDU  $JHWR

6SRQVRUV 6KRUWKRUQ6RFLHW\8. (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнАWKрнА 7KHDLPRIWKLVFRPSHWLWLRQLVWRHQFRXUDJH\RXQJSHRSOHWREHFRPHPRUHLQYROYHGLQ WKHPDQDJHPHQWQXWULWLRQDQGVKRZLQJRIFDWWOH 5XOHVDQG&RQGLWLRQV (QWUDQWVPXVWEHIURP\HDUVRQDIWHUQG-DQXDU\WRXQGHU\HDUVRQVW -DQXDU\3URRIRIGDWHRIELUWKZLOOEHUHTXLUHGRQ6KRZ'D\ 7KHHQWUDQWVFDQH[KLELWDQ\SHGLJUHH5HJLVWHUHG'DLU\6KRUWKRUQDQLPDOERUQ RQDIWHU 7KHFODVVZLOOEHMXGJHGXQGHUWKHIROORZLQJFDWHJRULHV D *URRPLQJDQGSUHVHQWDWLRQRIDQLPDORQ6KRZ'D\ E 6KRZPDQVKLSDQGKDQGOLQJVNLOOVLQWKHVKRZULQJ F *HQHUDONQRZOHGJHTXHVWLRQVRQDQLPDOKXVEDQGU\RUWKH6KRUWKRUQEUHHG

&ODVV5HJLVWHUHG3HGLJUHH6KRUWKRUQ+HLIHU,QFDOI 6SRQVRUV 0XOOLQDKRQH&RRS 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV5HJLVWHUHG3HGLJUHH6KRUWKRUQ+HLIHU,QPLON 6SRQVRUV 'RROLQ V6HUYLFH6WDWLRQ.LOFRUPDF 7RP3RROH /LPLWHG5RVHQDOOLV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3HGLJUHH5HJLVWHUHG6KRUWKRUQ-XQLRU&RZ&DOYHG7ZLFHRU 7KUHH7LPHV 6SRQVRUV /DNHODQG'DLULHV 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV5HJLVWHUHG3HGLJUHH'DLU\6KRUWKRUQ&RZLQ0LON 6SRQVRUV 0ROOR\3UHFDVW7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

18


&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ'DLU\6KRUWKRUQ&KDPSLRQ 6SRQVRUV &RUULE 0LGODQG2LO%LUU&R2IIDO\ 1RSUHHQWU\ 3UL]HV *ROG0HGDO6DVKVW3HUSHWXDO&XS

HOLSTEIN FRIESIAN CONFINED

+2/67(,1)5,(6,$1&21),1('

-XGJLQJFRPPHQFHVDWDPLQ5LQJ $OODQLPDOVPXVWEHSHGLJUHHUHJLVWHUHGZLWKFHUW (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

VW QGSUL]HZLQQHUVLQ&ODVVHVWRTXDOLI\WRFRPSHWHLQWKHUHVSHFWLYHFODVVHVLQWKH 1DWLRQDO/LYHVWRFN&ODVVHV1RHQWU\IHHVDUHUHTXLUHGIRUWKHVHTXDOLILHUV 1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHV2WKHUZLVHHQWULHVZLOOEH GLVTXDOLILHG

&ODVV5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ+HLIHU%RUQLQ &RQILQHGWR/DRLV2IIDO\:HVWPHDWK%UHHGHUV

VWDQGQGSUL]HZLQQHUVIURPWKLVFODVVTXDOLI\WRFRPSHWHLQFODVV

6SRQVRUV *XUWHHQ&ROOHJH$JULFXOWXUDO6HFWLRQ&R7LSSHUDU\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнА

&ODVV5HJLVWHUHG3HGLJUHH+ROVWHQ)ULHVLDQ+HLIHU%RUQRQ EHWZHHQ  &RQILQHGWR/DRLV2IIDO\:HVWPHDWK%UHHGHUV

VWDQGQGSUL]HZLQQHUVIURPWKLVFODVVTXDOLI\WRFRPSHWHLQFODVV

6SRQVRUV *UHHQYDOH$QLPDO)HHGV 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ+HLIHU%RUQRQ EHWZHHQ  &RQILQHGWR/DRLV2IIDO\:HVWPHDWK%UHHGHUV

VW DQGQG SUL]HZLQQHUVIURPWKLVFODVVTXDOLI\WRFRPSHWHLQFODVV

6SRQVRUV &HOWLF6HD0LQHUDOV&R&RUN 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

19


&ODVV5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ,Q0LON+HLIHU &RQILQHGWR/DRLV2IIDO\:HVWPHDWK%UHHGHUV

VWDQGQGSUL]HZLQQHUVIURPWKLVFODVVTXDOLI\WRFRPSHWHLQFODVV

6SRQVRUV 6HDQ2 %ULHQ5DWK $JULWHFK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ&RZ&DOYHG7ZLFHRU PRUH &RQILQHGWR/DRLV2IIDO\:HVWPHDWK%UHHGHUV

VWDQGQGSUL]HZLQQHUVIURPWKLVFODVVTXDOLI\WRFRPSHWHLQFODVV  ZKLFKHYHULVUHOHYDQW

6SRQVRUV 3HDNH'DLU\6HUYLFHV0RXQWPHOOLFN 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ<RXQJ6KRZPDQVKLS&KDOOHQJH  8QGHU

6SRQVRUV .LHUQDQ0LOOLQJ*UDQDUG&R/RQJIRUG (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWK рнАWKрнАWKрнАWKрнА 5XOHV &RQGLWLRQV 7KLVFRPSHWLWLRQLVRSHQWRER\VDQGJLUOVXQGHU\HDUVRQ $QLPDOVLQWKLVFRPSHWLWLRQPXVWEHGDLU\W\SHERUQRQRUDIWHU 7KLVFODVVZLOOEHMXGJHGDVIROORZV D *HQHUDONQRZOHGJHRIWKHEUHHGDQGWKHDQLPDOLWVHOIbbbbbbbbbbbbbb E 1XWULWLRQDOUHTXLUHPHQWVZKLOHEHLQJSUHSDUHGIRUWKH6KRZbbb F $ELOLW\WRKDQGOHDQGSUHVHQWDQLPDOWRLWVEHVWDGYDQWDJHbbbbbb G 3UHVHQWDWLRQRIKDQGOHUbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb -XGJLQJWDNHVSODFHLQ5LQJDWDPDSSUR[

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ<RXQJ6KRZPDQVKLS&KDOOHQJH  \HDUV

6SRQVRUV ,ULVK+ROVWHLQ)ULHVLDQ$VVRFLDWLRQ (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWK рнАWKрнАWKрнАWKрнА 5XOHV &RQGLWLRQV 7KLVFRPSHWLWLRQLVRSHQWRER\VDQGJLUOVIURP\HDUVRQDIWHUQG-DQXDU\WR \HDUVRQVW-DQXDU\ $QLPDOVLQWKLVFRPSHWLWLRQPXVWEHGDLU\W\SHERUQRQRUDIWHUVW-DQXDU\ 7KLVFODVVZLOOEHMXGJHGDVIROORZV D *HQHUDONQRZOHGJHRIWKHEUHHGDQGWKHDQLPDOLWVHOIbbbbbbb E 1XWULWLRQDOUHTXLUHPHQWVZKLOHEHLQJSUHSDUHGIRUWKH6KRZbbb F $ELOLW\WRKDQGOHDQGSUHVHQWDQLPDOWRLWVEHVWDGYDQWDJHbbbbbbb G 3UHVHQWDWLRQRIKDQGOHUbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb Judging takes place in Ring 1 at 11.50am approx.

20


PURE FRIESIAN

385()5,(6,$1

-XGJLQJFRPPHQFHVDWSPDSSUR[LQ5LQJ $OODQLPDOVPXVWEHSHGLJUHHUHJLVWHUHGZLWKFHUWDQGPXVWEH3XUH)ULHVLDQ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHV2WKHUZLVHHQWULHVZLOOEH GLVTXDOLILHG

&ODVV,ULVK3XUH)ULHVLDQ-XQLRU&RZ 6SRQVRUV ,ULVK3XUH)ULHVLDQ&OXE (DPRQ&DVH\7UDFWRUV 3RUWDUOLQJWRQ&R/DRLV 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV,ULVK3XUH)ULHVLDQ6HQLRU&RZ,QPLON 6SRQVRUV 2VPRQG V&URVVSKDUP*URXS 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ,ULVK3XUH)ULHVLDQ&KDPSLRQ 6SRQVRUV )LW]SDWULFN*DUDJHV 1RSUHHQWU\

HOLSTEIN FRIESIAN

+2/67(,1)5,(6,$1

-XGJLQJFRPPHQFHVDWSPLQ5LQJ $OODQLPDOVPXVWEHSHGLJUHHUHJLVWHUHGZLWKFHUW (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHVLQFOXGLQJWKHрлБIDPLO\ FKDPSLRQVKLSрлВb2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHGb

&ODVV5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ+HLIHU%RUQLQ VWDQGQGSUL]HZLQQHUVIURPFODVVTXDOLI\WRFRPSHWHLQWKLVFODVV

6SRQVRUV 9RODF.LOOHVKDQGUD&R&DYDQ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWKрнА

21


&ODVV5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ+HLIHU%RUQ2Q EHWZHHQDQG VWDQGQGSUL]HZLQQHUVIURPFODVVTXDOLI\WRFRPSHWHLQWKLVFODVV

6SRQVRUV

$JUL/OR\G/WG)LQJODV'XEOLQ

3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWKрнА

&ODVV5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ+HLIHU%RUQRQ EHWZHHQDQG VWDQGQGSUL]HZLQQHUVIURPFODVVTXDOLI\WRFRPSHWHLQWKLVFODVV

6SRQVRUV

$%63URJHQ,UHODQG '31XWULWLRQ&R.LONHQQ\

3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнА

&ODVV5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ+HLIHU,QFDOI%RUQ RQEHWZHHQDQG 6SRQVRUV (XURJHQH$,6HUYLFHV 0ROOLQ(VWDWHV$XFWLRQHHUV 7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ-XQLRU+ROVWHLQ)ULHVLDQ'DLU\ &KDPSLRQ 6SRQVRUV ,ULVK+ROVWHLQ)ULHVLDQ$VVRFLDWLRQ 1RSUHHQWU\

&ODVV%HVW3DLURI5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ+HLIHUV %\WKHVDPHVLUHERUQRQDIWHU &HUWVZLOOEHFKHFNHG

6SRQVRUV

)LQOD\(FRILW7XOODPRUH

3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV3HGLJUHH+ROVWHLQ)ULHVLDQ+HLIHU,QPLON%RUQRQDIWHU  6SRQVRUV -*UHQQDQ 6RQV5DWK&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА 1RWH$QLPDOVLQWKLVFODVVPD\DOVREHHQWHUHGLQ&ODVV

&ODVV6XSHUрнА1DWLRQDO+ROVWHLQ,QPLON+HLIHU VWDQGQGSUL]HZLQQHUVIURPFODVVTXDOLI\WRFRPSHWHLQWKLVFODVV

6SRQVRUV

*ODQELD )RUHIURQW%HWWHU:HHG&RQWURO

3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWK рнАWKрнА 5XOHVDQG&RQGLWLRQV 7KLVFRPSHWLWLRQLVRSHQWR5HJLVWHUHG3HGLJUHH+HLIHUV,QPLONPLQLPXP +ROVWHLQ 'LUHFW(QWU\WR7XOODPRUH6KRZ $Q\LQIULQJHPHQWRIWKH5XOHVZLOOGLVTXDOLI\ 2EMHFWLRQVPXVWEHORGJHGZLWKWKH6KRZ6HFUHWDU\ZLWKDIHHRIрнАZLWKLQKRXU RIWKH&ODVVEHLQJMXGJHG

22


&ODVV3HGLJUHH+ROVWHLQ)ULHVLDQ&RZ,QPLON&DOYHG7ZLFH VWDQGQGSUL]HZLQQHUVIURPFODVVPD\TXDOLI\WRFRPSHWHLQWKLVFODVV

6SRQVRUV 3URJUHVVLYH*HQHWLFV -)&0DQXIDFWXULQJ7XDP 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVVрнА$,%1DWLRQDO/LYHVWRFN6KRZ6HQLRU&RZ,QPLON VWDQGQGSUL]HZLQQHUVIURPFODVVPD\TXDOLI\WRFRPSHWHLQWKLVFODVV

6SRQVRUV 5LFKDUG.HHQDQ &R)HHGHUV 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА 5XOHVDQG&RQGLWLRQV 7KLVFRPSHWLWLRQLVRSHQWR5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ&RZVFDOYHGWKUHH WLPHVRUPRUHDQG,QPLON

&ODVV5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ1DWLRQDO%UHHGLQJ &RZ)DPLO\&KDPSLRQVKLS 6SRQVRUV /HO\,UHODQG (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнА 5XOHVDQG&RQGLWLRQV &RSLHVRI5HJLVWUDWLRQ&HUWLILFDWHVIRUDQLPDOVH[KLELWHGLQWKLVFODVVPXVWEHVHQW ZLWKHQWU\IRUP 7KH%UHHGLQJ&RZ)DPLO\*URXSRIDQLPDOVPXVWFRQVLVWRIPDWHUQDOVLVWHUVRU GDPZLWKGDXJKWHU

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ6HQLRU+ROVWHLQ)ULHVLDQ &KDPSLRQ 6SRQVRUV /DNHODQG'DLULHV 1RSUHHQWU\

&ODVV%HVW8GGHU 6HOHFWHGIURPDQLPDOVZLWKWKHEHVWXGGHULQ&ODVVHVLQFOXVLYH

6SRQVRUV +)DE/LPLWHG 1RSUHHQWU\ 3UL]HV VWрнА

&ODVV%HVW*URXSRI7KUHH 5HJLVWHUHG3HGLJUHH+ROVWHLQ)ULHVLDQ$QLPDOVPXVWEHRZQHGE\WKHH[KLELWRU

6SRQVRUV 'H/DYDO/WG&ORQGDONLQ&R'XEOLQ &RZ&DUH 6\VWHPV 3UL]HV VWрнАQGрнАUGрнАWKрнА

23


PEDIGREE CATTLE 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP (QWU\)HHà­&#x20AC;XQOHVVRWKHUZLVHVWDWHG 1%12/,9(672&.$//2:('29(51,*+7$&&2002'$7,21b217,(83/,1(6 5XOHV &RQGLWLRQVIRUWKH3HGLJUHH&DWWOH6HFWLRQ $OOSHGLJUHHDQLPDOVHQWHUHGLQWKLVVHFWLRQPXVWEHUHJLVWHUHGZLWKWKHUHOHYDQW%UHHG6RFLHW $OOSHGLJUHHFHUWLILFDWHVPXVWEHSURGXFHGRQWKHGD\ $Q\DQLPDOQRWSUHVHQWHGSURSHUO\PD\EHUHIXVHGHQWU\WRWKHLUFODVV HV  $OOFODVVHVH[FHSWWKRVHFRQILQHGDUH1DWLRQDO/LYHVWRFN6KRZ&ODVVHV 7KHTXDOLI\LQJFULWHULDIRUFODVVHVFRQILQHGWR/DRLV2IIDO\:HVWPHDWKZLOOEHWKHDGGUHVV DSSHDULQJRQWKH3HGLJUHH&HUWLILFDWH ([KLELWRUVHQWHULQJLQFODVVHVFRQILQHGWR/DRLV2IIDO\:HVWPHDWKPXVWKDYHHQWHUHGLQDWOH RQHRWKHUFODVVLQWKH6HFWLRQ :DVKLQJIDFLOLWLHVDUHDYDLODEOHRQWKH6KRZJURXQG6LWHRSHQIURPDP VW3UL]HZLQQHUVLQWKH1DWLRQDO&ODVVHVZLOOUHFHLYHDVSHFLDOO\FRPPLVVLRQHG1DWLRQDO/LYHVW 6KRZ0HGDOOLRQSOXVSUL]HPRQH\ $OO&KDPSLRQVDQG5HVHUYH&KDPSLRQVPXVWWDNHSDUWLQWKH3DUDGHRI&KDPSLRQV DWS DSSUR[ ZKHQWKH3UHVHQWDWLRQRI*ROGDQG6LOYHUPHGDOVWDNHVSODFH3UL]HPRQH\PD\EH IRUIHLWHGLIH[KLELWVDUHQRWSUHVHQWHG 3OHDVHQRWH/LYHVWRFN,VVXHVLQVLGHWKH%DFN&RYHUDQG2YHUQLJKW$FFRPPRGDWLRQDQG*HQH 5XOHVDWWKHHQGRIWKH6FKHGXOH 7KH,ULVK6KRZV$VVRFLDWLRQZRXOGDGYLVHDOODQLPDORZQHUVWRKDYHWKHLUDQLPDOVLQVXUHGDQGWR KDYHWKHLQVXUDQFHFRYHUH[WHQGHGWRFRYHUWKHPZKLOHVKRZLQJDQLPDOVDW6KRZV:HXQGHUVWD WKDWLWFRVWVYHU\OLWWOHRUQRWKLQJDWDOOGHSHQGLQJRQZKRP\RXKDYHLQVXUDQFHZLWK 7KHUHDVRQIRUWKLVDGYLFHLVWKDWLI\RXUDQLPDOODVKHGRXWDQGLQMXUHGVRPHRQHRUGDPDJHG VRPHRQHà«&#x201A;VSURSHUW\DQGLWZDVHVWDEOLVKHGWKDW\RXUDQLPDOZDVRXWRI\RXUFRQWURODWWKDWWLPH \RXPD\EHKHOGUHVSRQVLEOHRUSDUWO\UHVSRQVLEOHIRUDQ\LQMXU\RUGDPDJHFDXVHGDQG\RXPD\ HQGXSSD\LQJDOORUSDUWRIDQ\VHWWOHPHQWUHDFKHG 3OHDVHQRWHWKDWGXHWRRXUUHVWULFWHGIDFLOLWLHVLQWKHOLYHVWRFNDUHDDWWKLVVWDJHZH DUHXQIRUWXQDWHO\XQDEOHWRDFFRPPRGDWHOLYHVWRFNWRZKLFKWKH([SRUW+HDOWK 5HJXODWLRQVDSSO\ VHHEDFNRI6FKHGXOH

1%3OHDVH1RWH/LYHVWRFN,VVXHVLQVLGHWKH%DFN&RYHUDQG*HQHUDO5XOHV &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\ 1RHQWULHVDFFHSWHGRQ6KRZ'D\

Early Online Entry Draw We would be delighted to receive early online entries a Special Draw for â&#x201A;¬100 will be held for people who have made their entries online on or before Friday 4th July 2014 See www.tullamoreshow.com to enter. 24


DATE FOR THE DIARY Networking Event for Livestock Industry The Show is hosting a Networking Opportunity in a relaxed atmosphere, for all involved in the Livestock industry, on Saturday the 9th August the evening before Show day. It will be held on the showground's of the Butterfield Estate, Blueball, Tullamore. Forum Theme - The Future Programme to Include: Key Speakers, followed by Questions and Answers from the floor.

IRISH MOILED CATTLE -XGJLQJFRPPHQFHVDWSPDSSUR[5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

3UL]HVVWрнАQGрнАUGрнАWKрнАb

&ODVV,ULVK0RLOHG%XOO&DOI%RUQDIWHU 6SRQVRUV ,ULVK0RLOHG&DWWOH6RFLHW\ &ODVV,ULVK0RLOHG%XOOERUQEHIRUH 6SRQVRUV ,ULVK5DUH%UHHGV &ODVV,ULVK0RLOHG&RZLQ&DOIRUZLWK&DOIDWIRRW 6SRQVRUV 6LU'DYLG'DYHV &ODVV,ULVK0RLOHG+HLIHU0DLGHQRULQ&DOI 6SRQVRUV 6LU'DYLG'DYHV &ODVV$,%1DWLRQDO/LYHVWRFNVKRZ,ULVK0RLOHG&KDPSLRQ 6SRQVRUV ,ULVK5DUH%UHHGV 3UL]HV VW&KDPSLRQ5RVHWWH&KDPSLRQ*ROG0HGDO&KDPSLRQ6DVKQG 5HVHUYH&KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ6LOYHU0HGDO

BEEF SHORTHORN

%(()6+257+251

-XGJLQJFRPPHQFHVDWDP5LQJ $OODQLPDOVPXVWEHSHGLJUHHUHJLVWHUHGZLWKFHUW (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

25


3UL]HVVWрнАQGрнАUGрнАWKbрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHV2WKHUZLVHHQWULHVZLOOEH GLVTXDOLILHGb

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ%HHI6KRUWKRUQ<RXQJ+DQGOHU RIWKH<HDU \HDUV 7KHDLPRIWKLVFRPSHWLWLRQLVWRHQFRXUDJH\RXQJSHRSOHWREHFRPHPRUHLQYROYHGLQ WKHPDQDJHPHQWQXWULWLRQDQGVKRZLQJRIFDWWOH 5XOHVDQG&RQGLWLRQV (QWUDQWVPXVWEHEHWZHHQ\HDUVIURPQG-DQXDU\DQGEHXQGHU\HDUVRQ VW-DQXDU\3URRIRIGDWHRIELUWKZLOOEHUHTXLUHGRQ6KRZ'D\ 7KHHQWUDQWVFDQH[KLELWDQ\SHGLJUHH5HJLVWHUHG%HHI6KRUWKRUQDQLPDOERUQ RQDIWHU 7KHFODVVZLOOEHMXGJHGXQGHUWKHIROORZLQJFDWHJRULHV D *URRPLQJDQGSUHVHQWDWLRQRIDQLPDORQ6KRZ'D\ E 6KRZPDQVKLSDQGKDQGOLQJVNLOOVLQWKHVKRZULQJ F *HQHUDONQRZOHGJHTXHVWLRQVRQDQLPDOKXVEDQGU\RUWKH6KRUWKRUQEUHHG 3UL]HVVWWK0HUFKDQGLVH

6SRQVRUV

%RYD*HQHWLFV

(QWU\IHHRIрнА

&ODVV3HGLJUHH6KRUWKRUQ%HHI&RZRU&DOYHG+HLIHU &DOIDOORZHGLQULQJZLWKFRZEXWFDOIQRWMXGJHG

6SRQVRUV

/\QUHD&ORQDVOHH&R/DRLV

&ODVV3HGLJUHH6KRUWKRUQ%HHI%XOO%RUQ%HIRUH 6SRQVRUV &URVV(QJLQHHULQJ5DWKDQJDQ&R.LOGDUH &ODVV5HJLVWHUHG3HGLJUHH6KRUWKRUQ%HHI+HLIHU0DLGHQ%RUQ RQEHWZHHQDQG 6SRQVRUV 2 1HLOO:HLJKLQJ6\VWHPV/LPLWHG*UDLJXHQDPDQDJK &ODVV3HGLJUHH6KRUWKRUQ%HHI+HLIHU&DOI%RUQRQDIWHU  6SRQVRUV )DUP797XOODPRUH&R2IIDO\ &ODVV3HGLJUHH6KRUWKRUQ%HHI%XOO&DOI%RUQRQDIWHU 6SRQVRUV 7ULDFH)HUPR\&R&RUN &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ%HHI6KRUWKRUQ&KDPSLRQ 6SRQVRUV $JUL/OR\G/WG)LQJODV'XEOLQ 1RSUHHQWU\ 3UL]HV &KDPSLRQ*ROG0HGDO&KDPSLRQ6DVK&KDPSLRQ5RVHWWH5HVHUYH &KDPSLRQ6LOYHU0HGDO5HVHUYH&KDPSLRQ5RVHWWH

26


SIMMENTAL 7KHVW1DWLRQDO6LPPHQWDO6KRZ -XGJLQJFRPPHQFHVDWDPVKDUS5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHVLQFOXGLQJWKHрлБSDLURIDQLPDOVрлВ FODVVHVb2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHG

&ODVV6LPPHQWDO<RXQJ0HPEHUV&ODVV 2SHQWRDOOEHWZHHQWKHDJHVRI\HDUVRQ6KRZGD\DFFRPSDQLHGE\DDGXOWb

6SRQVRUV )%',QVXUDQFH (QWU\IHHRIрнА 3UL]HV 0HUFKDQGLVH

&ODVV6LPPHQWDO<RXQJ0HPEHUVFODVV 2SHQWRDOOEHWZHHQWKHDJHVRI\HDUVRQVKRZGD\

6SRQVRUV )%',QVXUDQFH (QWU\IHHRIрнА 3UL]HV 0HUFKDQGLVH

&ODVV6LPPHQWDO+HLIHU&DOIERUQRQDIWHU 6SRQVRUV &HQWUD.LOEHJJDQ&R:HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV6LPPHQWDO+HLIHU&DOI%RUQRQEHWZHHQDQG  6SRQVRUV $QLPD[ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO6LPPHQWDO:HDQOLQJ+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV %DQDJKHU3UHFDVW 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO6LPPHQWDO<HDUOLQJ+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV 1RUEURRN/DERUDWRULHV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO-XQLRU6LPPHQWDO+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV 1RUEURRN/DERUDWRULHV 3UL]HV VWрнАQGрнАUGрнАWKрнА

27


&ODVV1DWLRQDO,QWHUPHGLDWH6LPPHQWDO+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV 1RUEURRN/DERUDWRULHV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO6HQLRU6LPPHQWDO+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV &ORQDJK3HGLJUHH+HUGV3RUWODRLVH&R/DRLV 3UL]HV VWрнАFDVK-HQQD6WRQH3HUSHWXDO7URSK\QGрнАFDVKUGрнА FDVKWKрнАFDVK

&ODVV1DWLRQDO-XQLRU6LPPHQWDO&RZ,QFDOI+HLIHU%RUQ RQEHWZHHQDQG 6SRQVRUV 1RUEURRN/DERUDWRULHV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO6HQLRU6LPPHQWDO&RZ%RUQRQEHIRUH 6SRQVRUV ,ULVK6LPPHQWDO6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ6LPPHQWDO)HPDOH&KDPSLRQ 6SRQVRUV &URVV(QJLQHHULQJ5DWKDQJDQ&R.LOGDUH 1RSUHHQWU\ 3UL]HV VW&KDPSLRQ5RVHWWHQG5HVHUYH&KDPSLRQ5RVHWWH

&ODVV%HVW6LPPHQWDO%XOO&DOI%RUQRQDIWHU 6SRQVRUV .LHUDQ&XPPLQV05&960RXQWPHOOLFN&R/DRLV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV6LPPHQWDO%XOO&DOI%RUQRQEHWZHHQDQG  6SRQVRUV .HHODJKDQ V:KROHVDOH0HDWV$VKERXUQH&R0HDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO6LPPHQWDO:HDQOLQJ%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV 0LFKDHO%\UQH'RYHJURYH6LPPHQWDOV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO6LPPHQWDO<HDUOLQJ%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV -*UHQQDQ 6RQV5DWK&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO-XQLRU6LPPHQWDO%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV 1RUEURRN/DERUDWRULHV 3UL]HV VWрнАQGрнАUGрнАWKрнА

28


&ODVV1DWLRQDO6HQLRU6LPPHQWDO%XOO%RUQRQEHIRUH 6SRQVRUV )%',QVXUDQFH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ6LPPHQWDO0DOH&KDPSLRQ 6SRQVRUV %DQDJKHU3UHFDVW 1RSUHHQWU\ 3UL]HV VW&KDPSLRQ5RVHWWHQG5HVHUYH&KDPSLRQ5RVHWWH

&ODVV1DWLRQDO-XQLRU6LPPHQWDO3URJHQ\3DLU%RUQRQDIWHU  6SRQVRUV (GLQEXUJK2XWGRRU&ORWKLQJ&RPSDQ\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO6HQLRU6LPPHQWDO3URJHQ\3DLU%RUQRQEHIRUH  6SRQVRUV (GLQEXUJK2XWGRRU&ORWKLQJ&RPSDQ\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ6LPPHQWDO&KDPSLRQ 6SRQVRUV *UDVVODQG$JUR'XEOLQ 1RSUHHQWU\ 3UL]HV &KDPSLRQ*ROG0HGDO&KDPSLRQ6DVK&KDPSLRQ'RQHJDO&KLQD3HUSHWXDO &XS&KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ6LOYHU0HGDO5HVHUYH &KDPSLRQ5RVHWWH

CHAROLAIS

&+$52/$,6

-XGJLQJFRPPHQFHVDWDPVKDUS5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHVLQFOXGLQJWKHрлБSDLURI DQLPDOVрлВDQGрлБJURXSрлВFODVVHVb2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHG 1RHQWULHVWDNHQRQ6KRZ'D\b

&ODVV&KDURODLV<RXQJ%UHHGHUV6KRZLQJ&ODVV \HDUVROG

$QLPDOVPXVWEH3HGLJUHH&KDURODLVOHVVWKDQ\HDUROG

6SRQVRUV ,ULVK&KDURODLV6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

29


&ODVV&KDURODLV<RXQJ%UHHGHUV6KRZLQJ&ODVV WR\HDUV ROG

$QLPDOVXVHGPXVWEH3HGLJUHH&KDURODLV

6SRQVRUV ,ULVK&KDURODLV6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV&KDURODLV&RZLQFDOIRUZLWK&DOIDWIRRW%RUQEHIRUH  6SRQVRUV ,ULVK&KDURODLV6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV&KDURODLV)HPDOHLQFDOIRUZLWK&DOIDWIRRW%RUQSULRUWR  6SRQVRUV 0\OHV6KRUWKDOO7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV-XQLRU&KDURODLV+HLIHU%RUQRQEHWZHHQDQG  6SRQVRUV ,ULVK&KDURODLV6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV&KDURODLV+HLIHU%RUQRQEHWZHHQDQG  6SRQVRUV %RYD*HQHWLFV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV&KDURODLV+HLIHU%RUQRQEHWZHHQDQG  6SRQVRUV 7XOODPRUH)XHOV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV&KDURODLV+HLIHU%RUQRQDIWHU 6SRQVRUV ,ULVK&KDURODLV6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1DWLRQDO&KDURODLV+HLIHURIWKH\HDU%RUQLQ 6SRQVRUV 7 -6WDQGLVK6DZPLOOV5RVFUHD&R7LSSHUDU\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&KDURODLV)HPDOH&KDPSLRQ 6SRQVRUV (9&RQGHOO3RUWODRLVH&R/DRLV 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

30


&ODVV&KDURODLV%XOO%RUQEHIRUH 6SRQVRUV ,ULVK&KDURODLV6RFLHW\ 3UL]HV VWрнАQGрнАUGрнА

&ODVV&KDURODLV%XOO%RUQRQEHWZHHQDQG 6SRQVRUV +XUULFDQH&DWWOH&DUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV&KDURODLV%XOO%RUQRQEHWZHHQDQG 6SRQVRUV )%',QVXUDQFH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV&KDURODLV%XOO%RUQRQDIWHU 6SRQVRUV ,ULVK&KDURODLV6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3DLURI$QLPDOVPRQWKVRIDJHDQGXQGHURQ6KRZ'D\ 7KHSURSHUW\RIWKHVDPHH[KLELWRU

6SRQVRUV ,ULVK&KDURODLV6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3DLURI$QLPDOV2YHUPRQWKVRIDJHRQ6KRZ'D\ 7KHSURSHUW\RIWKHVDPHH[KLELWRU

6SRQVRUV ,ULVK&KDURODLV6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV%HVW&KDURODLV&RQILQHG &RQILQHGWRb/DRLV2IIDO\:HVWPHDWK%UHHGHUV

6SRQVRUV (9&RQGHOO3RUWODRLVH&R/DRLV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&KDURODLV0DOH&KDPSLRQ 6SRQVRUV ,)$7XOODPRUH 1RSUHHQWU\ 3UL]HV *ROG0HGDO&KDPSLRQ&KDPSLRQ5RVHWWH6LOYHU0HGDO5HVHUYH &KDPSLRQ5RVHWWH

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&KDURODLV&KDPSLRQ 6SRQVRUV -*UHQQDQ 6RQV5DWK&R2IIDO\ 1RSUHHQWU\ 3UL]HV *ROG0HGDO&KDPSLRQ&KDPSLRQ5RVHWWH6LOYHU0HGDO5HVHUYH &KDPSLRQ5RVHWWH

31


LIMOUSIN 7KHWK1DWLRQDO/LPRXVLQ6KRZ $OO([KLELWRUVPXVWDGKHUHWRWKH5XOHVDQG5HJXODWLRQVRIWKH,ULVK/LPRXVLQ&DWWOH6RFLHW\ -XGJLQJFRPPHQFHVDWDPVKDUS5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

3UL]HVVWрнАQGрнАUGрнАWKрнАWKbрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHV2WKHUZLVHHQWULHVZLOOEH GLVTXDOLILHGb

&ODVV1DWLRQDO/LPRXVLQ%XOO%RUQRQEHIRUH 6SRQVRUV 5DFNHW+DOO+RWHO5RVFUHD&R7LSSHUDU\ &ODVV/LPRXVLQ%XOO%RUQRQEHWZHHQWR 6SRQVRUV /DPEH V2LO7XOODPRUH &ODVV1DWLRQDO/LPRXVLQ%XOO%RUQRQEHWZHHQDQG  6SRQVRUV *UDVVODQG$JUR'XEOLQ &ODVV1DWLRQDO/LPRXVLQ%XOO%RUQRQEHWZHHQDQG  6SRQVRUV ,ULVK/LPRXVLQ&DWWOH6RFLHW\ &ODVV1DWLRQDO$OO,UHODQG/LPRXVLQ%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV /DPEH V2LO7XOODPRUH &ODVV1DWLRQDO$OO,UHODQG/LPRXVLQ%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV 1DWXUDO6WRFNFDUH &ODVV1DWLRQDO$OO,UHODQG/LPRXVLQ%XOO%RUQLQ 6SRQVRUV &RQQROO\5HGPLOOV*RUHVEULGJH&R.LONHQQ\ &ODVV-XQLRU/LPRXVLQ0DOH&KDPSLRQ 6SRQVRUV %RYD*HQHWLFV 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

32


&ODVV6HQLRU/LPRXVLQ0DOH&KDPSLRQ 6SRQVRUV +XUULFDQH&DWWOH&DUH 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ/LPRXVLQ0DOH&KDPSLRQ 6SRQVRUV %ULGJH&HQWUH0DQDJPHQW7XOODPRUH 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

&ODVV1DWLRQDO/LPRXVLQ6HQLRU&RZ,QFDOIRULQPLON%RUQ RQEHIRUH FDOIDWIRRWPXVWEHERUQRQDIWHU

6SRQVRUV 0XQVWHU/DEHOV &ODVV1DWLRQDO/LPRXVLQ-XQLRU&RZ,QFDOIRULQPLON%RUQ RQDIWHU FDOIDWIRRWPXVWEHERUQRQDIWHU

6SRQVRUV 3HGLJUHH&DWWOHLH &ODVV1DWLRQDO/LPRXVLQ8QFDOYHG6HQLRU+HLIHU%RUQRQ EHWZHHQDQG 6SRQVRUV )LQJOHWRQ3HWHUV 7\UHOO &ODVV1DWLRQDO/LPRXVLQ+HLIHU%RUQRQEHWZHHQDQG  6SRQVRUV :HDWKHUE\ V,UHODQG &ODVV/LPRXVLQ+HLIHU%RUQRQEHWZHHQ 6SRQVRUV 'RQRKXH0DUTXHHV &ODVV1DWLRQDO/LPRXVLQ+HLIHU%RUQRQEHWZHHQDQG  6SRQVRUV )%',QVXUDQFH &ODVV1DWLRQDO/LPRXVLQ+HLIHU%RUQRQEHWZHHQDQG  6SRQVRUV )56)HQFLQJ5RVFUHD&R7LSSHUDU\ &ODVV1DWLRQDO$OO,UHODQG/LPRXVLQ+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV *UHHQYDOH$QLPDO)HHGV 3UL]HV VWрнАFDVKрнА*UHHQYDOH9RXFKHUQGрнАFDVKрнА *UHHQYDOH9RXFKHUUGрнАFDVKрнА*UHHQYDOH9RXFKHUWKрнА FDVKрнА*UHHQYDOH9RXFKHUWKрнА*UHHQYDOH9RXFKHUWKрнА *UHHQYDOH9RXFKHU

33


&ODVV1DWLRQDO$OO,UHODQG/LPRXVLQ+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV %XFNOH\ V6XSHUYDOX%LUU&R2IIDO\ &ODVV1DWLRQDO/LPRXVLQ+HLIHU&DOI%RUQLQ 6SRQVRUV ,ULVK/LPRXVLQ&DWWOH6RFLHW\ &ODVV7KH,ULVK/LPRXVLQ1DWLRQDO&KDPSLRQVKLS7RS([KLELWRU $ZDUG 6SRQVRUV ,ULVK/LPRXVLQ&DWWOH6RFLHW\ 1RSUHHQWU\ 5XOHV &RQGLWLRQV 7KHDLPRIWKLVFRPSHWLWLRQLVWRUHZDUGHQWULHVDQGSHUIRUPDQFHLQWKH6KRZ5LQJ 7KHFRPSHWLWLRQLVEDVHGRQDSRLQWVV\VWHPDVIROORZV (QWULHVLQDFODVVSRLQW $GGLWLRQDOSRLQWVIRUSODFLQJVLQDFODVV

VWSODFHSRLQWV QGSODFHSRLQWV UGSODFHSRLQWV WKSODFHSRLQWV WKSODFHSRLQWV WKSODFHSRLQW

&ODVV-XQLRU/LPRXVLQ)HPDOH&KDPSLRQ 6SRQVRUV %RYD*HQHWLFV 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

&ODVV6HQLRU/LPRXVLQ)HPDOH&KDPSLRQ 6SRQVRUV $OO6WRQH&DUORZ 1RSUHHQWU\

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ/LPRXVLQ)HPDOH&KDPSLRQ 6SRQVRUV )%',QVXUDQFH 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

&ODVV1DWLRQDO$OO,UHODQG3DLURI/LPRXVLQ 2QO\DQLPDOVPDOHIHPDOHRUPL[HG

6SRQVRUV ,ULVK/LPRXVLQ&DWWOH6RFLHW\

CANCELLATION OF CLASSES The Committee reserve the right to cancel any class(es) due to insufficient entries 34


&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ/LPRXVLQ&KDPSLRQ 6SRQVRUV $JUL/OR\G)LQJODV'XEOLQ 1RSUHHQWU\ 3UL]HV &KDPSLRQ*ROG0HGDO&KDPSLRQ6DVK&KDPSLRQ5RVHWWH5HVHUYH &KDPSLRQ6LOYHU0HGDO5HVHUYH&KDPSLRQ5RVHWWH

BELGIAN BLUE

%(/*,$1%/8(

-XGJLQJFRPPHQFHVDWDPVKDUS5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

3UL]HVVWрнАQGрнАUGрнАWKрнА XQOHVVRWKHUZLVHbVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHV2WKHUZLVHHQWULHVZLOOEH GLVTXDOLILHG

&ODVV%HOJLDQ%OXH)HPDOH%RUQRQEHIRUH ZLWKZLWKRXWKHURZQFDOIDWIRRW 6SRQVRUV 7HHPRUH(QJLQHHULQJ &ODVV%HOJLDQ%OXH)HPDOH%RUQRQEHWZHHQDQG  6SRQVRUV &URVV(QJLQHHULQJ5DWKDQJDQ&R.LOGDUH &ODVV,ULVK%HOJLDQ%OXH%UHHGLQJ+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV 'RQRKXH0DUTXHHV &ODVV%HOJLDQ%OXH)HPDOH%RUQRQEHWZHHQDQG  6SRQVRUV )%',QVXUDQFH &ODVV%HOJLDQ%OXH)HPDOH%RUQRQDIWHU 6SRQVRUV ,ULVK%HOJLDQ%OXH6RFLHW\ &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ%HOJLDQ%OXH)HPDOH &KDPSLRQ 6SRQVRUV 3HGLJUHH&DWWOHLH 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

35


&ODVV<RXQJ+DQGOHUXQGHU\HDUVRQ6KRZ'D\ /HDGLQJD%HOJLDQ%OXHFDOIERUQRQDIWHUDFFRPSDQLHGE\DQDGXOW

6SRQVRUV ,ULVK%HOJLDQ%OXH6RFLHW\ 3UL]HV 0HUFKDQGLVH

&ODVV<RXQJ+DQGOHUEHWZHHQDQG\HDUVRQ6KRZ'D\ /HDGLQJD%HOJLDQ%OXHFDOIERUQRQDIWHU

6SRQVRUV ,ULVK%HOJLDQ%OXH6RFLHW\ 3UL]HV 0HUFKDQGLVH

&ODVV,ULVK%HOJLDQ%OXH6HQLRU%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV 'HQLV)R\QHV+RRIFDUH&ORQDVOHH&R/DRLV &ODVV%HOJLDQ%OXH-XQLRU%XOO%RUQRQEHWZHHQDQG  6SRQVRUV 'HQLV)R\QHV+RRIFDUH&ORQDVOHH&R/DRLV &ODVV%HOJLDQ%OXH%XOO%RUQRQEHWZHHQDQG  6SRQVRUV 2 1HLOO:HLJKLQJ6\VWHPV/LPLWHG*UDLJXHQDPDQDJK &ODVV%HOJLDQ%OXH%XOO%RUQRQDIWHU 6SRQVRUV 7XOODPRUH0HDWVFRRS &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ%HOJLDQ%OXH0DOH&KDPSLRQ 6SRQVRUV 7RUQDGR:LUH3RUWDUOLQJWRQ&R/DRLV 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ%HOJLDQ%OXH&KDPSLRQ 6SRQVRUV %ULGJH+RXVH+RWHODQG/HLVXUH&HQWUH7XOODPRUH&R 2IIDO\ 1RSUHHQWU\ 3UL]HV *ROG0HGDO&KDPSLRQ&KDPSLRQ5RVHWWH6LOYHU0HGDO5HVHUYH &KDPSLRQ5RVHWWH

Early Online Entry Draw We would be delighted to receive early online entries a Special Draw for â&#x201A;¬100 will be held for people who have made their entries online on or before Friday 4th July 2014 See www.tullamoreshow.com to enter.

36


ANGUS -XGJLQJFRPPHQFHVDWDPVKDUS5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

3UL]HVVWрнАQGрнАUGрнАWKbрнАb 8QOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGIRUDOOFODVVHVLQFOXGLQJWKHрлБSDLURIDQLPDOVрлВFODVVHV 2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHG

&ODVV$QJXV&RZZLWK&DOIDWIRRW%RUQRQEHIRUH 6SRQVRUV ,ULVK$QJXV&DWWOH6RFLHW\/WG &ODVV$QJXV&RZRU+HLIHU%RUQRQEHWZHHQDQG  6SRQVRUV 0ROOR\3UHFDVW7XOODPRUH &ODVV$QJXV+HLIHU%RUQRQEHWZHHQDQG 6SRQVRUV $QJXV%HHI,UHODQG/WG &ODVV$QJXV-XQLRU+HLIHU%RUQRQEHWZHHQDQG  6SRQVRUV 7UDQVHPEU\R%DOOLQDVORH&R*DOZD\ &ODVV$QJXV+HLIHU&DOI%RUQRQDIWHU 6SRQVRUV 3IL]HU$QLPDO+HDOWK &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ$QJXV)HPDOH&KDPSLRQ 6SRQVRUV $QJXV%HHI,UHODQG/WG 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

&ODVV$QJXV6HQLRU%XOO%RUQSULRUWR 6SRQVRUV ,ULVK$EHUGHHQ$QJXV$VVRFLDWLRQ &ODVV$QJXV,QWHUPHGLDWH%XOO%RUQRQEHWZHHQDQG  6SRQVRUV ,ULVK$EHUGHHQ$QJXV$VVRFLDWLRQ

37


&ODVV$QJXV-XQLRU%XOO%RUQRQEHWZHHQDQG  6SRQVRUV ,ULVK$QJXV&DWWOH6RFLHW\/WG &ODVV$QJXV%XOO&DOI%RUQRQDIWHU 6SRQVRUV ,ULVK$QJXV&DWWOH6RFLHW\/WG &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ$QJXV0DOH&KDPSLRQ 6SRQVRUV 7XOODPRUH&RXUW+RWHO7XOODPRUH&R2IIDO\ 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

&ODVV$QJXV3DLU2I$QLPDOV 7KHSURSHUW\RIWKHVDPHH[KLELWRUDQGH[KLELWHGLQWKHDERYHFODVVHV

6SRQVRUV ,ULVK$EHUGHHQ$QJXV$VVRFLDWLRQ &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ$QJXV&KDPSLRQ 6SRQVRUV $QJXV%HHI,UHODQG/WG 1RSUHHQWU\ 3UL]HV &KDPSLRQ*ROG0HGDO&KDPSLRQ6DVK&KDPSLRQ5RVHWWH5HVHUYH &KDPSLRQ6LOYHU0HGDO5HVHUYH&KDPSLRQ5RVHWWH

&ODVV4XDOLILHUIRU$%3$OGL$OO,UHODQG,ULVK$QJXV%XOO&DOI &KDPSLRQVKLS%RUQIURPWR 6SRQVRUV $%3$OGL ,ULVK$QJXV&DWWOH6RFLHW\ (QWU\IHHRIрнА 6HH5XOHV 5HJXODWLRQV6HFWLRQ

&ODVV4XDOLILHUIRU$%3$OGL$OO,UHODQG,ULVK$QJXV%XOO&DOI &KDPSLRQVKLS%RUQIURPWR 6SRQVRUV $%3$OGL ,ULVK$QJXV&DWWOH6RFLHW\ (QWU\IHHRIрнА 6HH5XOHV 5HJXODWLRQV6HFWLRQ

HEREFORD

+(5()25'

7KH1DWLRQDO+HUHIRUG6KRZ -XGJLQJFRPPHQFHVDWDPVKDUS5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

38


3UL]HVVWрнАQGрнАUGрнАWKbрнАWKbрнА 8QOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGIRUDOOFODVVHVLQFOXGLQJWKHрлБSDLURIDQLPDOVрлВFODVVHV 2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHGb

&ODVV+HUHIRUG<RXQJ([KLELWRU+DQGOLQJ&ODVV 2SHQWRDOOEHWZHHQWKHDJHVRIRQVKRZGD\

6SRQVRUV ,ULVK+HUHIRUG6RFLHW\ 3UL]HV VW:LQQHUUHFHLYH:-7RUPH\0HPRULDO7URSK\ +HUHIRUG0HUFKDQGLVH QGWK5RVHWWH

&ODVV1DWLRQDO3HGLJUHH+HUHIRUG&RZ,QFDOIRUZLWKKHURZQ QDWXUDOFDOIDWIRRW%RUQRQEHIRUH 6SRQVRUV 3DOODV)RRGV1HZFDVWOHZHVW&R/LPHULFN &ODVV1DWLRQDO3HGLJUHH+HUHIRUG&RZRU+HLIHUERUQRQEHWZHHQ DQG 6SRQVRUV 'RQRKXH0DUTXHHV &ODVV1DWLRQDO3HGLJUHH+HUHIRUG+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV ,ULVK+HUHIRUG6RFLHW\ &ODVV1DWLRQDO3HGLJUHH+HUHIRUG+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV ,ULVK+HUHIRUG6RFLHW\ &ODVV1DWLRQDO3HGLJUHH+HUHIRUG+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV 6ODQH\)RRGV5\ODQG5RDG%XQFORG\&R:H[IRUG &ODVV1DWLRQDO3HGLJUHH+HUHIRUG+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV ,ULVK+HUHIRUG3ULPH/LPLWHG &ODVV1DWLRQDO3HGLJUHH+HUHIRUG+HLIHU%RUQRQDIWHU  6SRQVRUV 7 -6WDQGLVK6DZPLOOV5RVFUHD&R7LSSHUDU\ &ODVV1DWLRQDO+HUHIRUG+HLIHURIWKH<HDU &RQILQHGWRVWUGSUL]HZLQQHUVLQFODVVHV

6SRQVRUV $%3 1RSUHHQWU\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWK рнА

39


&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ+HUHIRUG)HPDOH&KDPSLRQ 6SRQVRUV 7XOODPRUH$JUL 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

&ODVV1DWLRQDO3HGLJUHH+HUHIRUG%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV ,ULVK+HUHIRUG6RFLHW\ &ODVV1DWLRQDO3HGLJUHH+HUHIRUG%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV -*UHQQDQ 6RQV5DWK&R2IIDO\ &ODVV1DWLRQDO3HGLJUHH+HUHIRUG%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV 0LOOEURRN)RRGV2OGFDVWOH&R0HDWK &ODVV1DWLRQDO+HUHIRUG%XOO&DOI%RUQRQDIWHU 6SRQVRUV 0ROOR\3UHFDVW7XOODPRUH &ODVV1DWLRQDO+HUHIRUG%XOORIWKH<HDU &RQILQHGWRVWUGSUL]HZLQQHUVLQFODVVHV

6SRQVRUV $OOWHF 1RSUHHQWU\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWK рнА

&ODVV1DWLRQDO6HQLRU%XOO%RUQEHIRUH 6SRQVRUV 7HHPRUH(QJLQHHULQJ &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ+HUHIRUG0DOH&KDPSLRQ 6SRQVRUV $%3 1RSUHHQWU\ 3UL]HV &KDPSLRQ5RVHWWH5HVHUYH&KDPSLRQ5RVHWWH

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ+HUHIRUG&KDPSLRQ 6SRQVRUV $UL]RQD)$50686$ 1RSUHHQWU\ 3UL]HV &KDPSLRQ*ROG0HGDO&KDPSLRQ6DVK&KDPSLRQ5RVHWWH5HVHUYH &KDPSLRQ6LOYHU0HGDO5HVHUYH&KDPSLRQ5RVHWWH

40


&ODVV%HVW3HGLJUHH+HUHIRUG([KLELWHGE\/DRLV2IIDO\ :HVWPHDWK%UHHGHU 6SRQVRUV 6DP*LOO/WG$796WRUHV%OXHEDOO7XOODPRUH&R 2IIDO\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3DLURI$QLPDOV 7KHSURSHUW\RIWKHVDPHH[KLELWRUDQGH[KLELWHGLQWKHDERYHFODVVHV

6SRQVRUV %\UQH&DVH\ $VVRFLDWHV7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

SALERS

6$/(56

-XGJLQJFRPPHQFHVDWDPVKDUS5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

3UL]HVVWрнАQGрнАUGрнАWKрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGRQWKHHQWU\IRUPIRUDOOFODVVHVLQFOXGLQJWKHрлБSDLURIDQLPDOVрлВ FODVVHVb2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHG

&ODVV3HGLJUHH6DOHUV6HQLRU&RZ $Q\DJHLQFDOIRUZLWKFDOIDWIRRW

6SRQVRUV &URVV(QJLQHHULQJ5DWKDQJDQ&R.LOGDUH &ODVV3HGLJUHH6DOHUV-XQLRU&RZ%RUQRQDIWHU 6SRQVRUV *LRYDQQL0DUFDUHOOL05&963RUWDUOLQJWRQ&R/DRLV &ODVV3HGLJUHH6DOHUV6HQLRU+HLIHU%RUQEHIRUH 6SRQVRUV .LHUDQ&XPPLQV05&960RXQWPHOOLFN&R/DRLV &ODVV3HGLJUHH6DOHUV-XQLRU+HLIHU%RUQRQDIWHU 6SRQVRUV 6DP*LOO/WG$796WRUHV%OXHEDOO7XOODPRUH&R 2IIDO\ &ODVV3HGLJUHH6DOHUV%XOO $Q\DJH

6SRQVRUV 6DOHUV&DWWOH6RFLHW\

41


&ODVV3HGLJUHH6DOHUV0DOH&DOI%RUQRQDIWHU 6SRQVRUV 6DOHUV&DWWOH6RFLHW\ &ODVV3HGLJUHH6DOHUV)HPDOH&DOI%RUQRQDIWHU &ODVV4XDOLILHUIRU$OO,UHODQG6DOHUV1DWLRQDO&DOI&KDPSLRQVKLS %RUQRQDIWHUKHLIHUFDOYHVDQGEXOOFDOYHVWRTXDOLI\

6SRQVRUV 6DOHUV&DWWOH6RFLHW\ &ODVV%HVW3DLURI$QLPDOV 7KHSURSHUW\RIWKHVDPHH[KLELWRUDQGH[KLELWHGLQWKHDERYHFODVVHV

6SRQVRUV /\QUHD&ORQDVOHH&R/DRLV &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ6DOHUV&KDPSLRQ 6SRQVRUV )LW]SDWULFN*DUDJHV 1RSUHHQWU\ 3UL]HV *ROG0HGDO&KDPSLRQ6DVK&KDPSLRQ5RVHWWH6LOYHU0HGDO5HVHUYH &KDPSLRQ5RVHWWH

AUBRAC

$8%5$&

-XGJLQJFRPPHQFHVDWDPDSSUR[5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

3UL]HVVWрнАQGрнАUGрнАWKbрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGIRUDOOFODVVHVLQFOXGLQJWKHрлБSDLURIDQLPDOVрлВFODVVHV 2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHG

&ODVV3HGLJUHH$XEUDF%XOO&DOI%RUQRQDIWHU 6SRQVRUV 0XQVWHU$XEUDF*URXS &ODVV3HGLJUHH$XEUDF+HLIHU&DOI%RUQRQDIWHU 6SRQVRUV 6RXWK/HLQVWHU$XEUDF*URXS &ODVV3HGLJUHH$XEUDF0DLGHQ+HLIHU%RUQRQDIWHU 6SRQVRUV 1RUWK:HVW&RQQDXJKW$XEUDF*URXS

42


&ODVV3HGLJUHH$XEUDFLQ&DOI+HLIHU $Q\DJH

6SRQVRUV -RKQVWRZQ$XEUDFV &ODVV3HGLJUHH$XEUDF+HLIHU&RZZLWKFDOIDWIRRW $Q\$JH RIMXGJLQJWRPRWKHUDQGMXGJLQJWRWKHFDOI

6SRQVRUV (GGLH:DOVKDQG6RQV &ODVV%HVW3DLURI$QLPDOV 3URSHUW\RIWKHVDPHH[KLELWRUDQGH[KLELWHGLQWKHDERYHFODVVHV

6SRQVRUV 3IL]HU$QLPDO+HDOWK &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ$XEUDF&KDPSLRQ 6SRQVRUV 7RP3RROH/7'&ORQDVOHH&R/DRLV 1RSUHHQWU\ 3UL]HV *ROG0HGDO&KDPSLRQ6DVK&KDPSLRQ5RVHWWH6LOYHU0HGDO5HVHUYH &KDPSLRQ5RVHWWH

BLONDE DтАЩAQUITAINE

%/21'(' $48,7$,1(

-XGJLQJFRPPHQFHVDWDPDSSUR[5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

3UL]HVVWрнАQGрнАUGрнАWKрнА 1%$QLPDOGHWDLOVPXVWEHSURYLGHGIRUDOOFODVVHVLQFOXGLQJWKHрлБSDLURIDQLPDOVрлВFODVVHV 2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHGb

&ODVV3HGLJUHH%ORQGHG $TXLWDLQH0DOH)HPDOH%RUQ RQEHWZHHQDQG 6SRQVRUV ,ULVK%ORQGHG $TXLWDLQH6RFLHW\ &ODVV3HGLJUHH%ORQGHG $TXLWDLQH0DOH)HPDOH%RUQ RQEHWZHHQDQG 6SRQVRUV ,ULVK%ORQGHG $TXLWDLQH6RFLHW\

43


&ODVV3HGLJUHH%RQGHG $TXLWDLQH0DOH%RUQRQEHWZHHQ DQG 6SRQVRUV ,ULVK%ORQGHG $TXLWDLQH6RFLHW\ &ODVV3HGLJUHH%ORQGHG $TXLWDLQH0DOHRU)HPDOH%RUQ RQEHIRUH 6SRQVRUV $OO6WRQH&DUORZ &ODVV$,%1DWLRQDO/LYHVWRFN6KRZ%ORQGHG $TXLWDLQH&KDPSLRQ 6SRQVRUV -*UHQQDQ 6RQV5DWK&R2IIDO\ 1RSUHHQWU\ 3UL]HV *ROG0HGDO&KDPSLRQ6DVK&KDPSLRQ5RVHWWH6LOYHU0HGDO5HVHUYH &KDPSLRQ5RVHWWH

PARTHENAISE

3$57+(1$,6(

-XGJLQJFRPPHQFHVDWSPDSSUR[5LQJ (QWU\)HHрнА XQOHVVRWKHUZLVHVWDWHG

3UL]HVVWрнАQGрнАUGрнАWKрнА XQOHVVRWKHUZLVHVWDWHG

1%$QLPDOGHWDLOVPXVWEHSURYLGHGIRUDOOFODVVHVLQFOXGLQJWKHрлБSDLURIDQLPDOVрлВFODVVHV 2WKHUZLVHHQWULHVZLOOEHGLVTXDOLILHGb

&ODVV3HGLJUHH3DUWKHQDLVH%XOO+HLIHUFDOI%RUQRQDIWHU  6SRQVRUV -HW:DVK/7' &ODVV3HGLJUHH3DUWKHQDLVH)HPDOHFDOI%RUQRQEHWZHHQ DQG 6SRQVRUV 0LGIUHLJKW6KLSSLQJ7XOODPRUH &ODVV3HGLJUHH3DUWKHQDLVH%XOOFDOI%RUQRQEHWZHHQ DQG 6SRQVRUV :LOOLDP6KLHO$EEH\OHL[ &ODVV3HGLJUHH3DUWKHQDLVH+HLIHU&RZZLWKFDOIDWIRRW RIMXGJLQJWRWKH0RWKHUDQGWRWKHFDOI

6SRQVRUV ,ULVK3DUWKHQDLVH6RFLHW\

44


&ODVV3HGLJUHH3DUWKHQDLVH+HLIHU%RUQRQEHWZHHQ DQG 6SRQVRUV $QWKRQ\6FDOO\7\UHOOVSDVV&R:HVWPHDWK &ODVV3HGLJUHH3DUWKHQDLVH%XOO%RUQRQEHWZHHQ DQG 6SRQVRUV 7RP6FDOO\6NLKRDG5RDG%ODFNURFN&R&RUN &ODVV%HVW3DLURI3HGLJUHH3DUWKHQDLVH0DOHRU)HPDOH $Q\DJHWKDWKDYHH[KLELWHGLQDERYHFODVVHV

6SRQVRUV 3DXO5LJQH\05&96.LOFRUPDF&R2IIDO\ &ODVV$,%1DWLRQDO/LYVWRFN6KRZ3DUWKHQDLVH&KDPSLRQ 6SRQVRUV ,ULVK3DUWKHQDLVH6RFLHW\ 1RSUHHQWU\ 3UL]HV &KDPSLRQ*ROG0HGDO&KDPSLRQ6DVK&KDPSLRQ5RVHWWH5HVHUYH &KDPSLRQ6LOYHU0HGDO5HVHUYH&KDPSLRQ5RVHWWH

BEEF STOCKPERSON

%(()672&.3(5621

-XGJLQJDWDPLQ5LQJ (QWU\)HHрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ<RXQJ3HGLJUHH%HHI 6WRFNSHUVRQRIWKH<HDU 6SRQVRUV 0LFKDHO 2OLYHU)ODQDJDQ0R\GUXP&DVWOH3HGLJUHH +HUGV$WKORQH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWKрнА WKрнАWKрнАWKрнА 5XOHV &RQGLWLRQV 7KLVFRPSHWLWLRQLVRSHQWRER\VDQGJLUOVZKRKDYHQRWUHDFKHGWKHDJHRI\HDUV E\VW-XO\3URRIRIDJHZLOOEHORRNHGIRU $QLPDOVLQWKLVFRPSHWLWLRQPXVWEHSHGLJUHHEHHIW\SHERUQRQRUDIWHUVW-DQXDU\  7KLVFODVVZLOOEHMXGJHGDVIROORZV 30 D *HQHUDONQRZOHGJHRIWKHEUHHGDQGWKHDQLPDOLWVHOIbbbbbbbbbbbb 30 E 1XWULWLRQDOUHTXLUHPHQWVZKLOHEHLQJSUHSDUHGIRUWKH6KRZb 30 F $ELOLW\WRKDQGOHDQGSUHVHQWDQLPDOWRLWVEHVWDGYDQWDJHbbb G 3UHVHQWDWLRQRIKDQGOHUbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb 10 100 bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb 7KLV&ODVVZLOOWDNHSODFHDWDPDSSUR[LQWKH%HOJLDQ%OXH5LQJ

45


Admission to Show Exhibitors allowed Credits (see below) against entry fees and everyone to pay at the gate. No free passes will be issued but their value may be credited against entry fees, at the time of making entries and before the closing date of 18th July. THE FOLLOWING DEDUCTIONS MAY BE MADE: Entries valued €20 – Entries valued €40 – Entries valued €60 and over –

Deduct €15 from entry fees (Cost of admission for 1) Deduct €30 from entry fees (Cost of admission for 2) Deduct €45 from entry fees (Cost of admission for 3)

Safety at Shows We all want to have a successful, enjoyable show but also a safe and accident-free occasion. To ensure this, the co-operation of all is vital, including exhibitors, spectators and organisers. A few guidelines to note in relation to safety are as follows: - Please observe signs - especially those relating to caution in livestock areas. - Please do not exhibit animals that are unsuitable with regard to safety e.g. hard to control. - All animals must be led by a competent handler. - Animals should not be tied to trailers. - Dogs should be on a lead and under the control of the handler. - Caution and care should be exercised at all times.

So, come early and have a safe and enjoyable visit to the Tullamore Show on August 10th 2014

Show Date 10th August 2014 46


COMMERCIAL CATTLE 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP (QWU\)HHà­&#x20AC;XQOHVVRWKHUZLVHVWDWHG 5XOHV &RQGLWLRQVIRUWKH&RPPHUFLDO&DWWOH6HFWLRQ &RPSOHWHDQLPDOWDJQXPEHUDQGGDWHRIELUWKPXVWEHHQWHUHGRQWKHHQWU\IRUPIRU DOOFRPPHUFLDOFDWWOHFODVVHVWRJHWKHUZLWKKHUGQXPEHU $OODQLPDOVPXVWEHOHGE\DFRPSHWHQWKDQGOHUDQGPXVWEHKDOWHUWUDLQHG 6SHFLDOO\FRPPLVVLRQHG*ROG0HGDOVDUHEHLQJDZDUGHGWRWKH6HFWLRQ&KDPSLRQVDQG6LOYHU 0HGDOVWRWKH5HVHUYH&KDPSLRQV $OO&KDPSLRQVDQG5HVHUYH&KDPSLRQVPXVWWDNHSDUWLQWKH3DUDGHRI&KDPSLRQV SP DSSUR[ ZKHQWKH3UHVHQWDWLRQRIWKH*ROG 6LOYHU0HGDOVWDNHVSODFH3UL]HPRQH\PD\EH IRUIHLWHGLIH[KLELWVDUHQRWSUHVHQWHG $OOFODVVHVLQWKLVVHFWLRQDUH1DWLRQDO/LYHVWRFN&ODVVHVH[FHSW4XDOLILHUV VWSUL]HZLQQHUVLQHDFK1DWLRQDO/LYHVWRFNFODVVUHFHLYHD6SHFLDO0HGDOOLRQ $QLPDOVLQWKH&RPPHUFLDO&DWWOH6HFWLRQFDQHQWHUDOOUHOHYDQWFODVVHV+RZHYHUZKHQDQ DQLPDOZLQV[VW3UL]HVWKLVDQLPDOLVWKHQH[FOXGHGIURPDOORWKHUUHOHYDQWFODVVHVRQWKHGD\ ,QUHODWLRQWRUXOH  DERYHWKLVGRHVQRWDSSO\WRFODVVHV $QLPDOSDVVSRUWVPD\EHFKHFNHGIRUEUHHG;FODVVHV 1REUDQGLQJDGYHUWLVLQJDOORZHGRQDQLPDOVEHLQJH[KLELWHG $QLPDOVUHJLVWHUHGZLWK%UHHG6RFLHWLHVFDQQRWEHH[KLELWHGLQWKH&RPPHUFLDO&DWWOH6HFWLRQ 1RODWHHQWULHVDFFHSWHG 1HZ 7KLV\HDUZHKDYHDGGHGWZRQHZ/LPRXVLQ;FODVVHV7KHVHFODVVHVRIIHUD/LPRXVLQ0DOH;FDOI ZHLJKLQJXSWRNJDQGD/LPRXVLQ)HPDOH;&DOIZHLJKLQJXSWRNJ à«&#x2039;:HDOVRKDYHD\RXQJVWRFNSHUVRQRIWKH\HDUIRUWR\HDUVRQVKRZGD\ à«&#x2039;&ODVVHVIRUIDFWRU\W\SHDQLPDOVDUHDOVRLQFOXGHGWKLV\HDUDVWKHIRFXVLVQRZFHQWUHGRQ DQLPDOVVXLWDEOHIRUWKHFXUUHQWPDUNHWUHTXLUHPHQWV à«&#x2039;$OODQLPDOVH[KLELWHGLQWKHVHFODVVHVPXVWEHIURPSURGXFHUVFHUWLILHGXQGHUWKH%RUG%LD4XDOLW\ $VVXUDQFH6FKHPH à«&#x2039;7ZRULQJVZLOORSHUDWHPRVWRIWKHGD\ à«&#x2039;&ODVVIRU%HVW%HHI$QLPDORIWKH)XWXUHIRUDOOKHLIHUFDOYHVXSWRNJDQGPDOHFDOYHVXSWR NJ à«&#x2039;7KLV\HDUWKH3DUWKHQDLVH;PDOHRUIHPDOHXSWRNJ à«&#x2039;7KLV\HDUWKH%ORQGHGà«&#x201A;$TXLWLDLQH;PDOHRUIHPDOHXSWR.J à«&#x2039;7KHPD[LPXPZHLJKWIRUFDOYHVLQEUHHG;FODVVHVLVNJH[FHSWFODVV à«&#x2039;1DWLRQDO/LYHVWRFN6KRZ&DOI&KDPSLRQDQG5HVHUYHIURPVWSUL]HZLQQHUVLQWKHFDOIFODVVHV à«&#x2039;1DWLRQDO/LYHVWRFN6KRZ6HQLRU&KDPSLRQDQG5HVHUYHIURPVWSUL]HZLQQHUVLQWKHVHQLRU FODVVHV à«&#x2039;,QWKH%HHI&KDPSLRQVKLSVDQDOWHUQDWHMXGJHZLOOMXGJHWKHVHFODVVHV 3OHDVHVKRZFRXUWHV\WRVWHZDUGVDQGMXGJHV 1%3OHDVH1RWH/LYHVWRFN,VVXHVDQG*HQHUDO5XOHVDWWKH%DFNRIWKHVFKHGXOH 7KH,ULVK6KRZV$VVRFLDWLRQZRXOGDGYLVHDOODQLPDORZQHUVWRKDYHWKHLUDQLPDOVLQVXUHGDQGWR KDYHWKHLQVXUDQFHFRYHUH[WHQGHGWRFRYHUWKHPZKLOHVKRZLQJDQLPDOVDW6KRZV:HXQGHUVWDQG WKDWLWFRVWVYHU\OLWWOHRUQRWKLQJDWDOOGHSHQGLQJRQZKRP\RXKDYHLQVXUDQFHZLWK 7KHUHDVRQIRUWKLVDGYLFHLVWKDWLI\RXUDQLPDOODVKHGRXWDQGLQMXUHGVRPHRQHRUGDPDJHG VRPHRQHà«&#x201A;VSURSHUW\DQGLWZDVHVWDEOLVKHGWKDW\RXUDQLPDOZDVRXWRI\RXUFRQWURODWWKDWWLPH \RXPD\EHKHOGUHVSRQVLEOHRUSDUWO\UHVSRQVLEOHIRUDQ\LQMXU\RUGDPDJHFDXVHGDQG\RXPD\ HQGXSSD\LQJDOORUSDUWRIDQ\VHWWOHPHQWUHDFKHG

47


COMMERCIAL CATTLE 3OHDVHQRWHWKDWGXHWRRXUUHVWULFWHGIDFLOLWLHVLQWKHOLYHVWRFNDUHDDWWKLVVWDJHZH DUHXQIRUWXQDWHO\XQDEOHWRDFFRPPRGDWHOLYHVWRFNWRZKLFKWKH([SRUW+HDOWK 5HJXODWLRQVDSSO\ VHHEDFNRI6FKHGXOH

-XGJLQJVWDUWVDWDPLQ5LQJV  $OOFDOIFODVVHVLQ5LQJ :HLJKLQJRI$QLPDOVIRU&DOI&ODVVHVDQGUHOHYDQW%HHI&KDPSLRQVKLS à«&#x2039;2QO\RQHZHLJKLQJSHUDQLPDOZLOOEHDOORZHG à«&#x2039;$QLPDOWREHKDQGHGRYHUWRWKH6KRZ6WHZDUGIRUZHLJKLQJDQGWKHQFROOHFWHGRXWVLGHEDUULHU à«&#x2039;&DOYHVLQLQFRUUHFWFODVVZLOOEHUHHQWHUHGLQWRWKHFRUUHFWFODVV à«&#x2039;:HLJKLQJVWDUWVDWDPDQGILQLVKHVDWDP &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\ 1RHQWULHVDFFHSWHGRQ6KRZ'D\

&ODVV%HVW%XOORFNZLWK1R3HUPDQHQW7HHWK 6SRQVRUV *HUPLQDO6HHGV+RUVH -RFNH\&R7LSSHUDU\ 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;WK à­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;

&ODVV%HVW%XOORFNZLWKQRWPRUHWKDQ3HUPDQHQW7HHWK 6SRQVRUV 'RQDO/\QFK05&967XOODPRUH 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;

&ODVV4XDOLILHUIRUWKH1XWULDV$QLPDO)HHG%HHI%XOORFN$OO ,UHODQG&KDPSLRQVKLS )LQDO$OO,UHODQG%HHI%XOORFN&KDPSLRQVKLSDW6WURNHVWRZQ6KRZRQ

6SRQVRUV $XULYR%DOODJKDGHUUHHQ&R5RVFRPPRQ (QWU\IHHRIà­&#x20AC; 6HH5XOHV 5HJXODWLRQV6HFWLRQ

&ODVV%HVW%XOORFN$OO$JHV 6SRQVRUV *907XOODPRUH 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;

&ODVV4XDOLILHUIRU*UHQQYDOH$QLPDO)HHGV&KDPSLRQVKLS )LQDO$OO,UHODQG%HHI+HLIHU&KDPSLRQVKLSDW6WURNHVWRZQ6KRZRQ

6SRQVRUV *UHHQYDOH$QLPDO)HHGV (QWU\IHHRIà­&#x20AC; 6HH5XOHV 5HJXODWLRQV6HFWLRQ

48


&ODVV&RPPHUFLDO5HSODFHPHQW%UHHGLQJ+HLIHU 8SWR\HDUVROGRQGD\RIVKRZ

6SRQVRUV 6SULQJVRIW6\VWHPV.LOEHJJDQ&R:HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV%HVW%XWFKHU V+HLIHU :HLJKWLQJXSWRNJb

6SRQVRUV *UHQQDQ V%XWFKHUV7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWKрнА

&ODVV'XQELD$OO,UHODQGрнА&RPPHUFLDO6WHHU&KDPSLRQVKLS 6WHHUVIURPNJWRNJ

6SRQVRUV 'XQELD (QWU\IHHRIрнА 3UL]HV VWрнАFDVK5RVHWWH6DVK3HUSHWXDO&XSQGрнАFDVKUG рнАFDVKWKрнАFDVKWKрнАFDVKWKрнАFDVKWKрнА FDVKWKрнАFDVKWKрнАFDVK 5XOHVDQG&RQGLWLRQV  2SHQWRVWHHUVIURPNJWRNJ  $QLPDOVH[KLELWHGPXVWEHXQGHUPRQWKVDQGPXVWKDYHFRPSHWHGLQDUHJXODU EHHIFODVVRQ6KRZ'D\  ([KLELWRUVPXVWEHFHUWLILHGXQGHUWKH%RUG%LD4XDOLW\6FKHPH

3OHDVHOLVW+HUG1XPEHURQWKH(QWU\)RUP $QDOWHUQDWHMXGJHZLOOMXGJHWKLVFODVV

&ODVV%HVW+HLIHUZLWKQR3HUPDQHQW7HHWK 6SRQVRUV ,)$7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWK рнАWKрнАWKрнАWKрнА 6HH5XOHV 5HJXODWLRQV6HFWLRQ

&ODVV%HVW+HLIHUZLWKQRWPRUHWKDQ3HUPDQHQW7HHWK 6SRQVRUV )56)HQFLQJ5RVFUHD&R7LSSHUDU\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV%HVW+HLIHU$OO$JHV 6SRQVRUV /LDP*URJDQ$XFWLRQHHU&URJKDQ&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

49


&ODVV%HVW%ORQGH' $TXLWDLQH;&DOI )HPDOH:HLJKLQJXSWRNJ

6SRQVRUV

,ULVK%ORQGHG $TXLWDLQH6RFLHW\

3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;

&ODVV%HVW%HOJLDQ%OXH;&DOI PDOH

:HLJKLQJXSWRNJ

6SRQVRUV

*LEQH\V6WHHO3URGXFWV2OGFDVWOH&R0HDWK

3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;

&ODVV%HVW3DUWKHQDLVH;&DOI 0DOHRU)HPDOH:HLJKLQJXSWRNJ

6SRQVRUV

$OO,UHODQG'UDLQDJH1HWZRUN'XEOLQ %DOO\VKDQQRQ&DWWOH6DOHV&R2S/7' 0F6KHD%URWKHUV5HVHHGLQJ%DOO\VKDQQRQ

3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;

&ODVV%HVW&KDURODLV;&DOI 0DOHRU)HPDOH:HLJKLQJXSWR.J

6SRQVRUV

-RKQ/HDY\&HQWUD+HQU\6WUHHW7XOODPRUH

3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;

&ODVV%HVW%HOJLDQ%OXH;&DOI IHPDOH

:HLJKLQJXSWRNJ

6SRQVRUV

2 'RQRYDQ(QJLQHHULQJ&RDFKIRUG&R&RUN

3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;

&ODVV%HVW/LPRXVLQ;&DOI)HPDOH 6SRQVRUV ,ULVK/LPRXVLQ&DWWOH6RFLHW\ 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC; 5XOHVDQG&RQGLWLRQV  )HPDOH:HLJKLQJXSWRNJ  &DOIPXVWEHVLUHGE\D/LPRXVLQ  /0;PXVWDSSHDURQ&DOI3DVVSRUW  &DOIWREH'1$ GDWWLPHRIZHLJKLQJ  3UL]HVPRQH\ZLOOEHSDLGDIWHU'1$UHVXOWVDUHFRQILUPHG

DATE FOR THE DIARY Networking Event for Livestock Industry The Show is hosting a Networking Opportunity in a relaxed atmosphere, for all involved in the Livestock industry, on Saturday the 9th August the evening before Show day. It will be held on the showground's of the Butterfield Estate, Blueball, Tullamore. Forum Theme - The Future Tullamore Show â&#x20AC;&#x201D; Class Structure & Schedule Programme to Include: Key Speakers, followed by Questions and Answers from the floor.

50


&ODVV%HVW/LPRXVLQ;&DOI0DOH 6SRQVRUV ,ULVK/LPRXVLQ&DWWOH6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА 5XOHVDQG&RQGLWLRQV  0DOH:HLJKWLQJXSWRNJ  &DOIPXVWEHVLUHGE\D/LPRXVLQ  /0;PXVWDSSHDURQ&DOI3DVVSRUW  &DOIWREH'1$ GDWWLPHRIZHLJKLQJ  3UL]HVPRQH\ZLOOEHSDLGDIWHU'1$UHVXOWVDUHFRQILUPHG

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ<RXQJ6WRFNSHUVRQRIWKH <HDU WR<HDUV

&RPPHUFLDO&DWWOH<RXQJ6WRFNSHUVRQ

6SRQVRUV

2OOLH 0DUWLQD0F/RXJKOLQWD0LGODQG+\JLHQH

(QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWKрнА WKрнАWKрнАWKрнА 7KHDLPRIWKLVFRPSHWLWLRQLVWRHQFRXUDJH\RXQJSHRSOHWREHFRPHPRUHLQYROYHGLQ WKHPDQDJHPHQWQXWULWLRQDQGVKRZLQJRIFDWWOH 5XOHV &RQGLWLRQV  <RXQJKDQGOHUPXVWEHFDSDEOHRIKDQGOLQJWKHDQLPDOXQDFFRPSDQLHG  0LQLPXPDJHLV\HDUVWRD0D[LPXPDJHRI\HDUVROGE\WKH3URRI RIDJH PXVWEHDYDLODEOHIRULQVSHFWLRQRQWKHGD\  $QLPDOVIRUWKLVFRPSHWLWLRQPXVWEHERUQRQRUDIWHUVW-DQXDU\  7KLVFODVVZLOOEHMXGJHGDVIROORZV 30 D *HQHUDONQRZOHGJHRIWKHEUHHGDQGDQLPDOLWVHOIbbbbbbbbb 30 E 1XWULWLRQUHTXLUHPHQWVZKLOHEHLQJSUHSDUHGIRUWKH6KRZbbb 30 F $ELOLW\WRKDQGOHDQGSUHVHQWDQLPDOWRLWVEHVWDGYDQWDJHbbb 10 G 3UHVHQWDWLRQRIKDQGOHUbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb 100 bbbbbbbbbbbbbbbbbbbbbbb

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ<RXQJ6WRFNSHUVRQRIWKH <HDU WR<HDUV

&RPPHUFLDO&DWWOH<RXQJ6WRFNSHUVRQ

6SRQVRUV

*HUPLQDO6HHGV+RUVH -RFNH\&R7LSSHUDU\

(QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWKрнА WKрнАWKрнАWKрнА 7KHDLPRIWKLVFRPSHWLWLRQLVWRHQFRXUDJH\RXQJSHRSOHWREHFRPHPRUHLQYROYHGLQ WKHPDQDJHPHQWQXWULWLRQDQGVKRZLQJRIFDWWOH 5XOHV &RQGLWLRQV  0LQLPXPDJHLV\HDUVROGDQGWKH0D[LPXPDJHLV\HDUVROGE\WKH 3URRIRIDJH PXVWEHDYDLODEOHIRULQVSHFWLRQRQWKHGD\  $QLPDOVIRUWKLVFRPSHWLWLRQPXVWEHERUQRQRUDIWHUVW-DQXDU\  7KLVFODVVZLOOEHMXGJHGDVIROORZV b D *HQHUDONQRZOHGJHRIWKHEUHHGDQGDQLPDOLWVHOIbbbbbbbb 30

30

b E 1XWULWLRQUHTXLUHPHQWVZKLOHEHLQJSUHSDUHGIRUWKH6KRZb 30 b F $ELOLW\WRKDQGOHDQGSUHVHQWDQLPDOWRLWVEHVWDGYDQWDJHbb 10 100 b G 3UHVHQWDWLRQRIKDQGOHUbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

51


&ODVV%HVW0DOH&DOI:HLJKLQJXSWRNJ 6SRQVRUV 6LJQVE\'HVLJQ7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV%HVW0DOH&DOI:HLJKLQJEHWZHHQNJ.J 6SRQVRUV 7XOODPRUH7ULEXQH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV%HVW)HPDOH&DOI:HLJKLQJXSWRNJ 6SRQVRUV 7RUQDGR:LUH3RUWDUOLQJWRQ&R/DRLV 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV%HVW)HPDOH&DOI:HLJKLQJNJ.J 6SRQVRUV 0DXQVHOOV/RXQJH 7KH:KLWH+RXVH 7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV%HVW&RPPHUFLDO6XFNOHU&RZ :LWKFDOIDWIRRW

6SRQVRUV ,ULVK)DUPHUV-RXUQDO 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнА

&ODVV.(3$.&KDPSLRQVKLSIRUWKH%HHI)DFWRU\$QLPDORIWKH )XWXUH 6SRQVRUV .(3$. (QWU\IHHRIрнА 3UL]HV VWрнАFDVK5RVHWWH6DVKQGрнАFDVKUGрнАFDVKWK рнАFDVKWKрнАFDVKWKрнАFDVKWKрнАFDVKWKрнАFDVK WKрнАFDVKWKрнАFDVK 5XOHVDQG&RQGLWLRQV  2SHQWRIHPDOHFDOYHVXSWRNJDQGPDOHFDOYHVXSWRNJ  $QLPDOVH[KLELWHGPXVWKDYHFRPSHWHGLQDVXLWDEOHUHJXODUFDOIFODVVRQ6KRZ'D\

&ODVV'DZQ0HDWVрнА)DFWRU\+HLIHU&KDPSLRQVKLS +HLIHUV:HLJKLQJIURPRYHUNJWRNJ

6SRQVRUV 'DZQ0HDWV (QWU\IHHRIрнА 3UL]HV VWрнАFDVK5RVHWWH6DVKQGрнАFDVKUGрнАFDVKWK рнАFDVKWKрнАFDVKWKрнАFDVKWKрнАFDVKWKрнА FDVKWKрнАFDVKWKрнАFDVK 5XOHVDQG&RQGLWLRQV  2SHQWR+HLIHUV:HLJKLQJIURPRYHUNJWRNJ  $QLPDOVH[KLELWHGPXVWEHXQGHUPRQWKVDQGPXVWKDYHFRPSHWHGLQDUHJXODU EHHIFODVVRQ6KRZ'D\  ([KLELWRUVPXVWEHFHUWLILHGXQGHUWKH%RUG%LD4XDOLW\6FKHPH  3OHDVHOLVW+HUG1XPEHURQHQWU\IRUP

52


&ODVV0R\YDOOH\0HDWV&RPPHUFLDO%HHI3DLUV&KDPSLRQVKLS 0DOHRU)HPDOH:HLJKLQJIURPNJWRNJ

6SRQVRUV 0R\YDOOH\0HDWV/WG (QWU\IHHRIà­&#x20AC; 3UL]HV VWà­&#x20AC;FDVK5RVHWWH6DVKQGà­&#x20AC;FDVKUGà­&#x20AC;FDVKWK à­&#x20AC;FDVKWKà­&#x20AC;FDVKWKà­&#x20AC;FDVKWKà­&#x20AC;FDVKWKà­&#x20AC;FDVK 5XOHVDQG&RQGLWLRQV  2SHQWR0DOHRU)HPDOHDQLPDOVRUPL[HGSDLU  :HLJKLQJIURPNJWRNJ  $QLPDOVH[KLELWHGPXVWEHRZQHGE\WKHVDPHH[KLELWRU  $QLPDOVH[KLELWHGPXVWEHXQGHUPRQWKVDQGPXVWKDYHFRPSHWHGLQDUHJXODU EHHIFODVVRQVKRZGD\  ([KLELWRUPXVWEHFHUWLILHGXQGHUWKH%RUG%LD4XDOLW\6FKHPH  3OHDVHOLVW+HUG1XPEHURQHQWU\IRUP

&ODVV6WRFNPDQ V&KDOOHQJH 7KHDLPRIWKLVFRPSHWLWLRQLVWRUHZDUGH[KLELWRUVIRUWKHLUSDUWLFLSDWLRQLQWKH &RPPHUFLDOFDWWOHFODVVHVDW7XOODPRUH6KRZ $,%1DWLRQDO/LYHVWRFN6KRZ

6SRQVRUV 7RUQDGR:LUH3RUWDUOLQJWRQ&R/DRLV 1RSUHHQWU\ 3UL]HV VW5RVHWWH:LQQHUV7URSK\QG5RVHWWH5XQQHUXS3ODTXH 5XOHVDQG&RQGLWLRQV  2SHQWRDQLPDOVLQDOOFODVVHVH[FHSW4XDOLILHUV<RXQJ+DQGOHUFODVVHVDQGFDOI FKDPSLRQVKLSDQGVHQLRUFKDPSLRQVKLS  7ZR3RLQWVIRUHDFKHQWU\UHFHLYHGE\FORVLQJGDWH  )RUHDFKFODVVWKHSRLQWVDUHDZDUGHGDVIROORZV VW3RLQWV QG3RLQWV UG3RLQWV WK3RLQWV WK3RLQWV  7KH:LQQHUDQG5XQQHUXSZLOOEHWKHH[KLELWRUZLWKWKHPRVWSRLQWVDFFXPXODWHGLQ WKHFRPPHUFLDOFODVVHV  ,QWKHHYHQWRIDWLHRQSRLQWV7KHQXPEHURIKLJKHUSODFLQJZLOOEHWDNHQLQWR DFFRXQWb

Early Online Entry Draw We would be delighted to receive early online entries a Special Draw for â&#x201A;¬100 will be held for people who have made their entries online on or before Friday 4th July 2014 See www.tullamoreshow.com to enter.

53


&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&RPPHUFLDO&DOI &KDPSLRQVKLS &RPPHUFLDO&DWWOH&DOI&KDPSLRQDQG5HVHUYH

6SRQVRUV 3KDUYHW7DOODJKW'XEOLQ 1RSUHHQWU\

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&RPPHUFLDO&DWWOH6HQLRU &KDPSLRQVKLS &RPPHUFLDO&DWWOH6HQLRU&KDPSLRQDQG5HVHUYH

6SRQVRUV 7XOODPRUH+DUGZDUH 1RSUHHQWU\

Catering on Show Day All your catering needs will be provided on the Showgrounds on Show Day by

BENSON FOOD COMPANY First breakfast will be served at 8.00 a.m.

Trade Stands Online trade applications now available on http://www.tullamoreshow.com Closing date for Trade stands: 27th June 2014 In excess of 650 Trade & Machinery Stands will be exhibited at the Tullamore Show and AIB National Livestock Show on Sunday 10th August 2014. They will include all the main categories of Businesses. The facilities include indoor and outdoor stands with an increase in the total area allocated to this section.

54


SHEEP 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP (QWU\)HHà­&#x20AC;XQOHVVRWKHUZLVHVWDWHG 3UL]HV3UL]HPRQH\DVRXWOLQHG )LUVW3UL]HZLQQHUVDOVRUHFHLYHDVSHFLDOO\FRPPLVVLRQHG0HGDOOLRQ 5XOHV &RQGLWLRQVIRUWKH6KHHS6HFWLRQ $OOSHGLJUHHDQLPDOVHQWHUHGLQWKH6KHHS6HFWLRQPXVWEHUHJLVWHUHGZLWKWKHUHOHYDQWEUHHG VRFLHW\RUDVVRFLDWLRQ $OOVKHHSPXVWEHWDJJHGDQGKDYHDFRPSOHWHGGLVSDWFKGRFNHW 5HFRUGRI0RYHPHQWPXVWEHUHFRUGHGRQRZQHUV GLVSDWFKGRFNHWV 6KHHSIURPERWKVFUDSLHDQGQRQVFUDSLHPRQLWRUHGIORFNVDUHSHUPLWWHGWRDWWHQG $QLPDOVEHLQJH[KLELWHGLQWKH&RPPHUFLDO6KHHS6HFWLRQFDQQRWEHH[KLELWHGLQWKH3HGLJUHH FODVVHVRQ6KRZ'D\ 2QO\FDWDORJXHGHQWULHVFDQEHH[KLELWHGRQ6KRZ'D\ $OODQLPDOVPXVWEHFRUUHFWO\WDJJHG 1RWH'HSDUWPHQW5XOHVDWWKHHQGRIWKH6FKHGXOH

7KH,ULVK6KRZV$VVRFLDWLRQZRXOGDGYLVHDOODQLPDORZQHUVWRKDYHWKHLUDQLPDOVLQVXUHGDQGWR KDYHWKHLQVXUDQFHFRYHUH[WHQGHGWRFRYHUWKHPZKLOHVKRZLQJDQLPDOVDW6KRZV:HXQGHUVWDQG WKDWLWFRVWVYHU\OLWWOHRUQRWKLQJDWDOOGHSHQGLQJRQZKRP\RXKDYHLQVXUDQFHZLWK7KHUHDVRQ IRUWKLVDGYLFHLVWKDWLI\RXUDQLPDOODVKHGRXWDQGLQMXUHGVRPHRQHRUGDPDJHGVRPHRQHà«&#x201A;V SURSHUW\DQGLWZDVHVWDEOLVKHGWKDW\RXUDQLPDOZDVRXWRI\RXUFRQWURODWWKDWWLPH\RXPD\EH KHOGUHVSRQVLEOHRUSDUWO\UHVSRQVLEOHIRUDQ\LQMXU\RUGDPDJHFDXVHGDQG\RXPD\HQGXSSD\LQJ DOORUSDUWRIDQ\VHWWOHPHQWUHDFKHG 1%,IH[KLELWRUVUHTXLUHUDLOVWRGLYLGHSHQVZHDGYLVHWKDWWKH\VKRXOGEULQJWKHLU RZQVWRFN -XGJLQJVWDUWVDWDP &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\ 1RHQWULHVDFFHSWHGRQ6KRZ'D\

DATE FOR THE DIARY Networking Event for Livestock Industry The Show is hosting a Networking Opportunity in a relaxed atmosphere, for all involved in the Livestock industry, on Saturday the 9th August the evening before Show day. It will be held on the showground's of the Butterfield Estate, Blueball, Tullamore. Forum Theme - The Future Programme to Include: Key Speakers, followed by Questions and Answers from the floor.

55


SHEEP TEXEL (QWU\)HHрнА

&ODVV7H[HO5DP 7ZR6KHDU 8SZDUGV

6SRQVRUV ,ULVK7H[HO6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV7H[HO6KHDUOLQJ5DP 6SRQVRUV ,ULVK7H[HO6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV7H[HO5DP/DPE 6SRQVRUV ,ULVK7H[HO6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV7H[HO(ZH 7ZR6KHDU 8SZDUGV

6SRQVRUV ,ULVK7H[HO6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV7H[HO6KHDUOLQJ(ZH 6SRQVRUV &KDUOHYLOOH(VWDWH7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV7H[HO(ZH/DPE 6SRQVRUV &KDUOHYLOOH(VWDWH7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ7H[HO&KDPSLRQ 7H[HO&KDPSLRQ

6SRQVRUV $JUL/OR\G/WG)LQJODV'XEOLQ 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

56


VENDEEN (QWU\)HHрнА

&ODVV9HQGHHQ5DP7ZR6KHDU 8SZDUGV 6SRQVRUV +D\GHQ3ODQW+LUH&ORRQDJK7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV9HQGHHQ6KHDUOLQJ5DP 6SRQVRUV )O\QQ)HHGV0XOOLQJDU&R:HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV9HQGHHQ5DP/DPE 6SRQVRUV )O\QQ)HHGV0XOOLQJDU&R:HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV9HQGHHQ(ZH 7ZR6KHDU 8SZDUGV

6SRQVRUV )O\QQ)HHGV0XOOLQJDU&R:HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV9HQGHHQ6KHDUOLQJ(ZH 6SRQVRUV ,)$&7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV9HQGHHQ(ZH/DPE 6SRQVRUV *HU&RXJKODQ)DUP6XSSOLHV.LQQLWW\&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ9HQGHHQ&KDPSLRQ 9HQGHHQ&KDPSLRQ

6SRQVRUV )O\QQ)HHGV0XOOLQJDU&R:HVWPHDWK 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

&ODVV*URXSRI)HPDOHV 5DP $Q\DJH

6SRQVRUV ,)$&7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

57


SUFFOLK (QWU\)HHрнА

&ODVV6XIIRON5DP6KHDUOLQJ 8SZDUGV 6SRQVRUV 0F0DQXV%URWKHUV%HOPRXQW%LUU&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV6XIIRON5DP/DPE%UHGE\([KLELWRU 6SRQVRUV 8QLEORFN 9RODF 9LVWDYHW 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV6XIIRON(ZH6KHDUOLQJ 8SZDUGV 6SRQVRUV 0F0DQXV%URWKHUV%HOPRXQW%LUU&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV6XIIRON(ZH/DPE 6SRQVRUV 8QLEORFN 9RODF 9LVWDYHW 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ6XIIRON&KDPSLRQ 6SRQVRUV 8QLEORFN 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

CHAROLLAIS (QWU\)HHрнА

&ODVV&KDUROODLV5DP 6KHDUOLQJ 8SZDUGV

6SRQVRUV 2VPRQGV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV&KDUROODLV5DP/DPE 6SRQVRUV 2VPRQGV 3UL]HV VWрнАQGрнАUGрнАWKрнА

58


&ODVV&KDUROODLV(ZH 6KHDUOLQJ 8SZDUGV

6SRQVRUV 'RODQ)DUP6XSSOLHV$WKORQH 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;

&ODVV3DLU&KDUROODLV3HGLJUHH (ZH/DPEV

6SRQVRUV 'RODQ)DUP6XSSOLHV$WKORQH 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&KDUROODLV&KDPSLRQ 6SRQVRUV )56)HQFLQJ5RVFUHD&R7LSSHUDU\ 1RSUHHQWU\ 3UL]HV VWà­&#x20AC;QGà­&#x20AC;

ROUGE de lâ&#x20AC;&#x2122;QUEST (QWU\)HHà­&#x20AC;

&ODVV5RXJHGHO 2XHVW5DP 6KHDUOLQJDQG8SZDUGV

6SRQVRUV ,)$7XOODPRUH 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;

&ODVV5RXJHGHO 2XHVW5DP/DPE 6SRQVRUV 73:KHODQ 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;

&ODVV5RXJHGHO 2XHVW(ZH 6KHDUOLQJDQG8SZDUGV

6SRQVRUV ,)$7XOODPRUH 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;

&ODVV5RXJHGHO 2XHVW(ZH/DPE &KDPSLRQVKLS

6SRQVRUV (ODQFR 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;WKà­&#x20AC;

59


&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ5RXJHGHO 2XHVW&KDPSLRQ 6SRQVRUV 7KH2IILFH&HQWUH7XOODPRUH 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

&ODVV3DLURI&URVVEUHG(ZH/DPEV 6SRQVRUV ,ULVK5RXJHGHO 2XHVW6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

GALWAY (QWU\)HHрнА

&ODVV*DOZD\5DP 6KHDUOLQJDQG8SZDUGV

6SRQVRUV *DOZD\6KHHSEUHHGHUV$VVRFLDWLRQ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV*DOZD\5DP/DPE 6SRQVRUV *DOZD\6KHHSEUHHGHUV$VVRFLDWLRQ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV*DOZD\(ZH 6KHDUOLQJDQG8SZDUGV

6SRQVRUV *DOZD\6KHHSEUHHGHUV$VVRFLDWLRQ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV*DOZD\(ZH/DPE 6SRQVRUV *DOZD\6KHHSEUHHGHUV$VVRFLDWLRQ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ*DOZD\&KDPSLRQ 6SRQVRUV *DOZD\6KHHSEUHHGHUV$VVRFLDWLRQ 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

60


BELTEX (QWU\)HHрнА

&ODVV%HOWH[6KHDUOLQJ5DP 8SZDUGV 6SRQVRUV %HOWH[6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV%HOWH[5DP/DPE 6SRQVRUV (ODQFR 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV%HOWH[6KHDUOLQJ(ZHDQG8SZDUGV 6SRQVRUV 2 'RQRYDQ(QJLQHHULQJ&RDFKIRUG&R&RUN 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV%HOWH[(ZH/DPE 6SRQVRUV -*UHQQDQ 6RQV5DWK&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ%HOWH[&KDPSLRQ 6SRQVRUV -*UHQQDQ 6RQV5DWK&R2IIDO\ 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

JACOB (QWU\)HHрнА

&ODVV-DFRE5DP 6KHDUOLQJDQG8SZDUGV

6SRQVRUV ,ULVK-DFRE6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV-DFRE5DP/DPE 6SRQVRUV ,ULVK-DFRE6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

61


&ODVV-DFRE(ZH 6KHDUOLQJDQG8SZDUGV

6SRQVRUV ,ULVK-DFRE6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV-DFRE(ZH/DPE 6SRQVRUV ,ULVK-DFRE6KHHS6RFLHW\ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&KDPSLRQ -DFRE&KDPSLRQ

6SRQVRUV 3-/HDY\3RO\WXQQHOV7XOODPRUH 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

BELCLARE (QWU\)HHрнА

&ODVV%HOFODUH5DP 7ZR6KHDUDQG8SZDUGV

6SRQVRUV 9RODF 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV%HOFODUH6KHDUOLQJ5DP 6SRQVRUV 9RODF 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV%HOFODUH5DP/DPE 6SRQVRUV 9RODF 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV%HOFODUH(ZH 7ZR6KHDUDQG8SZDUGV

6SRQVRUV 9RODF 3UL]HV VWрнАQGрнАUGрнАWKрнА

62


&ODVV%HOFODUH6KHDUOLQJ(ZH 6SRQVRUV 9RODF 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV%HOFODUH(ZH/DPE 6SRQVRUV 9RODF 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ%HOFODUH&KDPSLRQ 6SRQVRUV 9RODF 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

WELSH LLEYN 1DWLRQDO&KDPSLRQVKLSV (QWU\)HHрнА

&ODVV/OH\Q5DP 6KHDUOLQJ

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV/OH\Q(ZH 6KHDUOLQJ

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV/OH\Q5DP/DPE 6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV/OH\Q(ZH/DPE 6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

63


&ODVV/OH\Q(ZH 7ZR6KHDUDQG8SZDUGV

&ODVV/OH\Q5DP 7ZR6KHDUDQG8SZDUGV

&ODVV/OH\Q*URXSRI6KHDUOLQJ(ZHV -XGJHGLQ3HQ

&ODVV/OH\Q*URXSRI )HPDOHDQG0DOH

&ODVV-XQLRU+DQGOHU /OH\Q6KHHS6KRZHGE\D6RQRU'DXJKWHURID5HJLVWHUHG%UHHGHU8QGHU\HDUVRI DJH

6SRQVRUV 'DYLG'DUNHU2OG3DGGRFN%OHVVLQJWRQ&R:LFNORZ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&KDPSLRQ /OH\Qb1DWLRQDO&KDPSLRQ

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

ZWARTBLES (QWU\)HHрнА

&ODVV=ZDUWEOHV5DP 6KHDUOLQJ 8SZDUGV

6SRQVRUV )LW]SDWULFN*DUDJHV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV=ZDUWEOHV(ZH 6KHDUOLQJ 8SZDUGV

6SRQVRUV )LW]SDWULFN*DUDJHV 3UL]HV VWрнАQGрнАUGрнАWKрнА

64


&ODVV=ZDUWEOHV5DP/DPE 6SRQVRUV 6WDQOH\(QJLQHHULQJ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV=ZDUWEOHV(ZH/DPE 6SRQVRUV 6WDQOH\(QJLQHHULQJ 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ=ZDUWEOHV&KDPSLRQ =ZDUWEOHV&KDPSLRQ

6SRQVRUV )LW]SDWULFN*DUDJHV 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

BORDER LEICESTER (QWU\)HHрнА

&ODVV%HVW%RUGHU/HLFHVWHU5DP 6KHDUOLQJ 8SZDUGV

6SRQVRUV ,QLVK3HEEOH&RPSDQ\.LOPRUH4XD\&R:H[IRUG 3UL]HV VWрнАQGрнАUGрнА

&ODVV%HVW%RUGHU/HLFHVWHU(ZH 6KHDUOLQJ 8SZDUGV

6SRQVRUV ,QLVK3HEEOH&RPSDQ\.LOPRUH4XD\&R:H[IRUG 3UL]HV VWрнАQGрнАUGрнА

&ODVV%HVW%RUGHU/HLFHVWHU(ZH/DPE 6SRQVRUV ,QLVK3HEEOH&RPSDQ\.LOPRUH4XD\&R:H[IRUG 3UL]HV VWрнАQGрнАUGрнА

&ODVV%HVW%RUGHU/HLFHVWHU5DP/DPE 6SRQVRUV ,QLVK3HEEOH&RPSDQ\.LOPRUH4XD\&R:H[IRUG 3UL]HV VWрнАQGрнАUGрнА

65


&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&KDPSLRQ %RUGHU/HLFHVWHU&KDPSLRQ

6SRQVRUV ,QLVK3HEEOH&RPSDQ\.LOPRUH4XD\&R:H[IRUG 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

STOCKPERSON (QWU\)HHрнА

&ODVV-XQLRU6WRFNSHUVRQIRU6KHHS6HFWLRQ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWKрнА WKрнА 5XOHV &RQGLWLRQV ([KLELWRUVPXVWH[KLELWDSHGLJUHHRUFRPPHUFLDOVKHHS ([KLELWRUVPXVWEHRUXQGHURQWKHGD\RIWKH6KRZ 3URRIRIDJHPXVWEHDYDLODEOH

COMMERCIAL (QWU\)HHрнА

&ODVV3HGLJUHH5DP 7ZR6KHDUDQG8SZDUGV

6SRQVRUV &DIH8%ULGJH&HQWUH*UHYLOOH$UPV0XOOLQDJDU&R :HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3HGLJUHH5DP/DPE 6SRQVRUV &DIH8%ULGJH&HQWUH*UHYLOOH$UPV0XOOLQDJDU&R :HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

66


&ODVV3DLU(ZHV 1RQSHGLJUHH

6SRQVRUV &DIH8%ULGJH&HQWUH*UHYLOOH$UPV0XOOLQDJDU&R :HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3DLU6KHDUOLQJ(ZHV 1RQSHGLJUHH

6SRQVRUV &DIH8%ULGJH&HQWUH*UHYLOOH$UPV0XOOLQDJDU&R :HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3DLU(ZH/DPEV 1RQSHGLJUHH

6SRQVRUV &DIH8%ULGJH&HQWUH*UHYLOOH$UPV0XOOLQDJDU&R :HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3DLURI%XWFKHU V/DPEV 6SRQVRUV 7UR\V$EEDWRLU7\UUHOOVSDVV&R:HVWPHDWK 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3DLU6WRUH/DPEV 6SRQVRUV 2IIDO\4XDOLW\/DPE3URGXFHUV&R2S ,&0&DPROLQ &R:H[IRUG 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV3DLURI)DFWRU\/DPEV&KDPSLRQVKLS 6SRQVRUV 2IIDO\4XDOLW\/DPE3URGXFHUV&R2S ,&0&DPROLQ &R:H[IRUG 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнА

&ODVV$,%1DWLRQDO/LYHVWRFN6KRZ&RPPHUFLDO&KDPSLRQ 6SRQVRUV &DIH8%ULGJH&HQWUH*UHYLOOH$UPV0XOOLQDJDU&R :HVWPHDWK 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

Catering on Show Day All your catering needs will be provided on the Showgrounds on Show Day by

BENSON FOOD COMPANY First breakfast will be served at 8.00 a.m. 67


SHEEP SHEARING 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\ (QWU\)HHрнАSHUHQWU\ $/LPLWHGQXPEHURIHQWULHVPD\EHWDNHQRQVKRZGD\EXWSUHVKRZHQWULHVDUHDGYLVHG6KHHS DYDLODELOLW\ZLOOGHWHUPLQHb

&ODVV&RQILQHG&ODVV'HWDLOVODWHU 6WDUWVDW30

%ODGH6KHDULQJ &ODVV%ODGH6KHDULQJ 6SRQVRUV 0F0DQXV%URWKHUV%HOPRXQW%LUU&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнА

0DFKLQH6KHHS6KHDULQJ &ODVV0DFKLQH6KHDULQJ-XQLRUFODVV 6SRQVRUV 6HDPXV'RROH\'RROH\:RROV 3UL]HV VWрнАQGрнАUGрнА

&ODVV0DFKLQH6KHDULQJ2SHQ&ODVV 6SRQVRUV 0F0DQXV%URWKHUV%HOPRXQW%LUU&R2IIDO\ 3UL]HV VWрнАQGрнАUGрнА

68


SHEEPDOG TRIALS 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP 7KLVFRPSHWLWLRQWHVWVERWKWKHVSHHGDQGVNLOORIWKHKDQGOHUDQGWKHGRJ,WWDNHVSODFHLQDQ DUHQDPHDVXULQJ[\DUGV7KHKDQGOHUPXVWFRPSOHWHZLWKRXWHUURUDSUHVFULEHGFRXUVH DJDLQVWWKHFORFN7KLVFRXUVHFRQVLVWVRIGULYLQJWKHVKHHSDURXQGWZREDUUHOVLQDILJXUHWKHQ WZLFHWKURXJKD0DOWHVH&URVVDQGILQDOO\LQWRDSHQ ,QWKH2SHQ&ODVVWKHHLJKWIDVWHVWUXQVJRWKURXJKWRWKHILQDO 6WDUWWLPHV2SHQ&ODVVрк╝DP <RXQJ+DQGOHUVSP (QWU\)HHрнАSHUGRJ 'HPRQVWUDWLRQ $GHPRQVWUDWLRQRIWKHVNLOOVLQYROYHGLQWUDLQLQJDIDUPGRJZLOOEHJLYHQE\(DPRQ(JDQ7HDJDVF &R5RVFRPPRQ(DPRQKDVWUDYHOOHGZLGHO\LQWKH8.YLVLWLQJWRSKDQGOHUVDQGVWXG\LQJWKHLU WHFKQLTXHV 'HPRQVWUDWLRQWLPHVDP SP 7LPHWDEOH DP'HPRQVWUDWLRQE\(DPRQ(JDQ DP2SHQFODVVFRPPHQFHV SP<RXQJ+DQGOHUVFODVVFRPPHQFHV SP2SHQ&ODVV)LQDO SP'HPRQVWUDWLRQE\(DPRQ(JDQ

&ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\ (QWULHVZLOOEHWDNHQRQ6KRZ'D\DVZHOODVSUHHQWULHV

&ODVV6KHHSGRJ7ULDOV2SHQ&ODVV$UHQD 6SRQVRUV +RH\ 'HQQLQJ6ROLFLWRUV7XOODPRUH (QWU\IHHRIрнА 3UL]HV VWрнАFDVK*ROG0HGDOQGрнАFDVKUGрнАFDVKWKрнА FDVKWKрнАFDVKWKрнАFDVK

&ODVV6KHHSGRJWULDOV<RXQJ+DQGOHU$UHQD 6SRQVRUV +RH\ 'HQQLQJ6ROLFLWRUV7XOODPRUH (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнА

69


Attention All Horse Owners IMPORTANT INFORMATION NEEDED ON SHOW DAY ¢ ¢ ¢

¢

ALL HORSES & PONIES MUST BE ACCOMPANIED BY THEIR PASSPORTS ALL HORSES & PONIES REGISTERED AFTER 1ST JULY 2009 MUST BE MICROCHIPPED ALL HORSES & PONIES MUST COME FROM A REGISTERED EQUINE PREMISES & HAVE THEIR PREMISES REGISTRATION NUMBER WITH THEM & ON THE ENTRY FORM. NAME & ADDRESS OF OWNER/PERSON RESPONSIBLE FOR HORSE/PONY

Admission to Show Exhibitors allowed Credits (see below) against entry fees and everyone to pay at the gate. No free passes will be issued but their value may be credited against entry fees, at the time of making entries and before the closing date of 18th July. THE FOLLOWING DEDUCTIONS MAY BE MADE: Entries valued €20 – Entries valued €40 – Entries valued €60 and over –

Deduct €15 from entry fees (Cost of admission for 1) Deduct €30 from entry fees (Cost of admission for 2) Deduct €45 from entry fees (Cost of admission for 3)

70


HORSES SHOWJUMPING (QWULHVIRU6KRZMXPSLQJWREHPDGHLQWKH(TXHVWULDQ2IILFHRQ6KRZ'D\ $OODQLPDOVWKDWSDUWLFLSDWHLQWKHVKRZDFWLYLWLHVPXVWFRPSO\ZLWK(8DQG1DWLRQDOOHJLVODWLRQDQG EHIURPUHJLVWHUHGSUHPLVHV&KHFNVZLOOEHPDGH 1%0HPEHUVKLSRIWKH6-$,LVUHTXLUHGWRHQWHU6KRZMXPSLQJFODVVHV7HPSRUDU\ PHPEHUVKLSFDQEHWDNHQRXWRQWKHGD\ 1%'HSWRI$JULFXOWXUH )RRGUHTXLUHPHQWVLQUHODWLRQWRKRUVHVDQGRWKHUHTXLQHV 7KHUHJLVWUDWLRQQXPEHURISUHPLVHVIURPZKLFKWKHKRUVHVFRPHWRJHWKHUZLWKWKH SDVVSRUWQXPEHURIWKHDQLPDOPXVWEHJLYHQDWWLPHRIPDNLQJHQWU\ &UHGLW6OLSV $OOH[KLELWRUVWRSD\DGPLVVLRQIHHV&UHGLWVOLSVZLOOEHLVVXHGWR6KRZMXPSLQJFRPSHWLWRUVDW HQWU\JDWH7KHVHFDQEHFUHGLWHGWRZDUGVHQWU\IHHVIRUVKRZMXPSLQJRQWKHIROORZLQJEDVLV

1%7KH&RPPLWWHHUHVHUYHVWKHULJKWWRDOWHURUDPHQGWKHVKRZMXPSLQJVFKHGXOHWR IDFLOLWDWHWKHVPRRWKUXQQLQJRIWKH6KRZ &ODVVHVPD\EHPRYHGWRRWKHUDUHQDV &RXUVH'HVLJQHUV ,YDQ0F'RQDJK (GGLH,JRH &KDUOLH0XUSK\ (QTXLULHVWR5RVLH0HDOLIIHRU7RQ\+LFNH\ 1RWH3OHDVHIROORZVLJQVIRUHTXHVWULDQYHKLFOHSDUNLQJ

DATE FOR THE DIARY Networking Event for Livestock Industry The Show is hosting a Networking Opportunity in a relaxed atmosphere, for all involved in the Livestock industry, on Saturday the 9th August the evening before Show day. It will be held on the showground's of the Butterfield Estate, Blueball, Tullamore. Forum Theme - The Future Programme to Include: Key Speakers, followed by Questions and Answers from the floor.

71


HORSE SHOWJUMPING +RUVH$UHQDVWDUWVDWDP (QWU\IHHрнА

&ODVVFP 6SRQVRUV +LFNH\(QJLQHHULQJ7XOODPRUH &ODVV3UL]H)XQGрнА

&ODVVFP 6SRQVRUV /LDP+RFWRU5HIULJHUDWLRQ7XOODPRUH &ODVV3UL]H)XQGрнА

&ODVVP 6SRQVRUV 1XWJURYH6DQG *UDYHO5RVHQDOOLV&R/DRLV &ODVV3UL]H)XQGрнА

&ODVVP 6SRQVRUV 6NRGD,UHODQG &ODVV3UL]H)XQGрнА

&ODVVP 6SRQVRUV 1XWJURYH6DQG *UDYHO5RVHQDOOLV&R/DRLV &ODVV3UL]H)XQGрнА

&ODVVP 6SRQVRUV 6NRGD,UHODQG &ODVV3UL]H)XQGрнА

SENIOR MANAGER IN CHARGE AT THE TULLAMORE SHOW IS:

MR. TONY COLVILLE ******** EXHIBITORS PLEASE NOTE******** Special horse-lanes will be in operation again. In the interest of spectator safety, exhibitors are asked to co-operate with Stewards & use these lanes

CANCELLATION OF CLASSES The Committee reserve the right to cancel any class(es) due to insufficient entries 72


PONY SHOWJUMPING 3RQ\$UHQDVWDUWVDWDP (QWU\IHHрнА

&ODVV1HZFRPHUV 6SRQVRUV $UGHQ(TXHVWULDQ$WKORQH 3UL]HV *RRGVLQ.LQG

&ODVVFPFP 6SRQVRUV 6NRGD,UHODQG &ODVV3UL]H)XQGрнА

&ODVVFPFP 6SRQVRUV 7RWWHQKDP7LPEHU6FUHJJDQ7XOODPRUH &ODVV3UL]H)XQGрнА

&ODVVFPP 6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH &ODVV3UL]H)XQGрнА

&ODVVFPFP 6SRQVRUV 6NRGD,UHODQG &ODVV3UL]H)XQGрнА

&ODVVFPFP 6SRQVRUV /DPEH V2LO7XOODPRUH &ODVV3UL]H)XQGрнА

&ODVVFPP 6SRQVRUV /RJLFRP&RPPXQLFDWLRQV7XOODPRUH &ODVV3UL]H)XQGрнА

&ODVVFPFP &ODVV3UL]H)XQGрнА

6SRQVRUV

/DPEH V2LO7XOODPRUH

&ODVVFPP 6SRQVRUV 6NRGD,UHODQG &ODVV3UL]H)XQGрнА

&ODVVFPP 6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH &ODVV3UL]H)XQGрнА

73


HORSE SHOWING 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP $OOULQJVFRPPHQFHDWDPVKDUS 7KH2UJDQLVHUVUHVHUYHWKHULJKWWRDPDOJDPDWHRUFDQFHODFODVVZLWKLQVXIILFLHQW HQWULHVLQDOOULQJV 1%'HSWRI$JULFXOWXUH )RRGUHTXLUHPHQWVLQUHODWLRQWRKRUVHVDQGRWKHUHTXLQHV 7KHUHJLVWUDWLRQQXPEHURIWKHSUHPLVHVIURPZKLFKKRUVHVFRPHWRJHWKHUZLWKWKH SDVVSRUWQXPEHURIWKHDQLPDOPXVWEHJLYHQRQWKHHQWU\IRUP &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOO2QOLQHHQWULHVLV)ULGD\WK-XO\ 1RHQWULHVDFFHSWHGRQ6KRZ'D\

1217+2528*+%5('0$5( )2$/ 5LQJb1RQ7KRURXJKEUHGઽ0DUH )RDO%UHHGHUà«&#x201A;V&KDOOHQJH,ULVK'UDXJKW1RQ7KRURXJKEUHG ઽ<RXQJ6WRFN 6WDUW7LPHDPVKDUS (QWU\)HHà­&#x20AC; XQOHVVRWKHUZLVHVWDWHG

&ODVV1RQWKRURXJKEUHG%URRG0DUH \HDUVROGDQGRYHUZLWKRUZLWKRXW)RDODWIRRWVW QGSUL]HZLQQHUVDUHHOLJLEOH IRUWKH6XSUHPH&KDPSLRQ,Q+DQG+RUVH

6SRQVRUV 0RQDJKDQ &DUUROO%XLOGHUV7XOODPRUH 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;

&ODVV1RQWKRURXJKEUHG&ROW)RDO &DOFXODWHGWRPDNHDTXDOLW\+XQWHURU6SRUWKRUVH

6SRQVRUV 7RWWHQKDP7LPEHU6FUHJJDQ7XOODPRUH 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;

&ODVV1RQWKRURXJKEUHG)LOO\)RDO &DOFXODWHGWRPDNHDTXDOLW\+XQWHURU6SRUWKRUVH$OVRD4XDOLILHUIRUWKH$%URZQH )LOO\)RDO$OO,UHODQG&KDPSLRQVKLSV)LQDOLQ0RDWHRQUG$XJXVW

6SRQVRUV 0DKRQ2LO7XOODPRUH 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC; 6HH5XOHV 5HJXODWLRQV6HFWLRQ

74


&ODVV&ROWRQ0RWRUV)RUG%UHHGHUV&KDOOHQJHIRU 1RQWKRURXJKEUHG0DUHDQG)RDO 7REHMXGJHGIRU0DUHV)RDOV

6SRQVRUV &ROWRQ0RWRUV)RUG7XOODPRUH (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнА

,5,6+'5$8*+7 (QWU\IHHрнАXQOHVVRWKHUZLVHVWDWHG

&ODVV5,'$,'%URRG0DUH\HDUVROGDQGRYHUZLWKRUZLWKRXW )RDODWIRRW VW QGSUL]HZLQQHUVDUHHOLJLEOHIRU6XSUHPH&KDPSLRQ,Q+DQG+RUVH $OVR4XDOLILHUIRUWKH3HJXV$OO,UHODQG%UHHGHUV&KDPSLRQVKLS)LQDODW:HVW&RUN+RUVH %UHHGHUV6KRZRQVW$XJXVW6HH5XOHVDQG5HJXODWLRQV6HFWLRQ

6SRQVRUV *OHQZRRG7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV)RDORXWRI5,'$,'0DUHDQGE\DSSURYHG5,'6WDOOLRQ 6SRQVRUV *OHQZRRG7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV)RDO&KDPSLRQVKLS VW QGSUL]HZLQQHUVIURP&ODVVHV DUHHOLJLEOHWRFRPSOHWH &KDPSLRQ 5HVHUYH&KDPSLRQDUHHOLJLEOHIRU6XSUHPH&KDPSLRQ,Q+DQG+RUVH

6SRQVRUV *OHQZRRG7XOODPRUH 1RSUHHQWU\

&ODVV,ULVK'UDXJKW\HDUROGILOO\ 7KLVLVDTXDOLILHUIRUWKH,')LOO\&KDPSLRQVKLSLQ/LPHULFNVKRZRQUGDQGWK $XJXVW

(QWU\IHHRIрнА 6HH5XOHV 5HJXODWLRQV6HFWLRQ

75


1217+2528*+%5('<281*672&. (QWU\)HHŕ­&#x20AC;

&ODVV1RQ7KRURXJKEUHG<HDU2OG&ROWRU*HOGLQJDQG<HDU 2OG*HOGLQJ 6SRQVRUV &ROWRQ0RWRUV)RUGV7XOODPRUH 3UL]HV VWŕ­&#x20AC;QGŕ­&#x20AC;UGŕ­&#x20AC;

&ODVV1RQ7KRURXJKEUHG&KDPSLRQ<RXQJ+RUVH VW QG3UL]H:LQQHUVLQ&ODVVDUHHOLJLEOH&KDPSLRQ 5HVHUYH&KDPSLRQDUH HOLJLEOHIRU&ODVV6XSUHPH&KDPSLRQ,QKDQG+RUVH

6SRQVRUV .HHODJKDQ V:KROHVDOH0HDWV$VKERXUQH&R0HDWK 1RSUHHQWU\

&ODVV6XSUHPH&KDPSLRQ,QKDQG+RUVH 7KHIROORZLQJDUHHOLJLEOHVW QG1RQ7KRURXJKEUHG%URRG0DUH&KDPSLRQ 5HVHUYH&KDPSLRQ)RDO&KDPSLRQ 5HVHUYH&KDPSLRQ1RQ7KRURXJKEUHG<RXQJ +RUVHVW QG,ULVK'UDXJKW%URRG0DUH

6SRQVRUV 6NRGD,UHODQG 1RSUHHQWU\

Safety at Shows We all want to have a successful, enjoyable show but also a safe and accident-free occasion. To ensure this, the co-operation of all is vital, including exhibitors, spectators and organisers. A few guidelines to note in relation to safety are as follows: - Please observe signs - especially those relating to caution in livestock areas. - Please do not exhibit animals that are unsuitable with regard to safety e.g. hard to control. - All animals must be led by a competent handler. - Animals should not be tied to trailers. - Dogs should be on a lead and under the control of the handler. - Caution and care should be exercised at all times.

So, come early and have a safe and enjoyable visit to the Tullamore Show on August 10th 2014

76


$,5&5,''(1&/$66 5LQJ5LGGHQ&ODVV5LGGHQ+XQWHUV&REV&RORXUHG+RUVHV 6WDUW7LPHDPVKDUS (QWU\)HHрнАXQOHVVRWKHUZLVHVWDWHG

&ODVV$,5&0HPEHUV5LGGHQ&ODVV 5LGGHQ&ODVVIRUPDUHVDQGJHOGLQJVH[FHHGLQJFPVXLWDEOHIRUDQGULGGHQE\ FXUUHQWPHPEHUVRIWKH$VVRFLDWLRQRI,ULVK5LGLQJ&OXEV&XUUHQW$,5&0HPEHUVKLS &DUGVPXVWEHSURGXFHG([KLELWVZLOOQRWEHULGGHQE\WKHMXGJH

6SRQVRUV $;$,QVXUDQFH 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнА

5,''(1+817(56 +RUVHVPXVWEH\HDUVROGDQGRYHU (QWU\)HHрнАXQOHVVRWKHUZLVHVWDWHGb

&ODVV5LGGHQ+XQWHU3RQ\&ODVVQRWH[FHHGLQJFP 5LGHUDJHGRURYHURQWKH

6SRQVRUV 3DWULFN0LWFKHOO &R7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV5LGGHQ6PDOO+XQWHU 2YHUFPEXWQRWH[FHHGLQJFP

6SRQVRUV 7RWWHQKDP7LPEHU6FUHJJDQ7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV5LGGHQ/LJKWZHLJKW+XQWHU :HLJKWXSWRNJ

6SRQVRUV &ROWRQ0RWRUV)RUGV7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV5LGGHQ0HGLXP +HDY\:HLJKW+XQWHU :HLJKWIURPNJDQGRYHU

6SRQVRUV &ROWRQ0RWRUV)RUGV7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

77


&ODVV5LGGHQ&RORXUHG+RUVH0DUHRU*HOGLQJ $Q\W\SHRYHUFP

6SRQVRUV %ULGJH&HQWUH0DQDJHPHQW7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV5LGGHQ&RE 2YHUFPEXWQRWH[FHHGLQJFP

6SRQVRUV 6NRGD,UHODQG 3UL]HV VWрнАQGрнАUGрнА

&ODVV&KDPSLRQ5LGGHQ6KRZ+RUVH VW QG3UL]H:LQQHUVIURP&ODVVHVDQGDUHHOLJLEOH

6SRQVRUV 6NRGD,UHODQG 1RSUHHQWU\

&ODVV6XSUHPH5LGGHQ&KDPSLRQ &KDPSLRQ 5HVHUYH&KDPSLRQ5LGGHQ6KRZDQG&KDPSLRQ 5HVHUYH&KDPSLRQ :RUNLQJ+XQWHUDUHHOLJLEOH

6SRQVRUV 6NRGD,UHODQG 1RSUHHQWU\

5$&(+256(725,',1*+256( (QWU\IHHрнА

&ODVV5DFH+RUVHWREH5LGLQJ+RUVH &RQWURO 2EHGLHQFH

2SHQWRDOO7KRURXJKEUHG+RUVHVZKLFKKDYHUDFHGRQWUDFNRU3WR35LGHUVPXVWEH DJHG\HDUVRUROGHURQ$GGLWLRQDOSUL]HVPD\EHDZDUGHGIRU%HVW 7XUQHG2XWDQG%HVW3ODFHG9HWHUDQ+RUVH DJHG\HDUVRURYHU

6SRQVRUV 6NRGD,UHODQG 3UL]HV VWрнАQGрнАUGрнА

:25.,1*+817(5321,(6 5LQJb$OOULQJVFRPPHQFHDWDPVKDUS:RUNLQJ+XQWHU3RQLHV :RUNLQJ+XQWHU+RUVHV +RUVHV3RQLHVPXVWEH\HDUVROGRURYHU (QWU\)HHрнА

78


&ODVV2SHQ:RUNLQJ+XQWHU6WDUWHU6WDNHV )RU3RQLHV0DUHVRU*HOGLQJVQRWH[FHHGLQJFPVXLWDEOHIRUDQGWREHULGGHQE\ ULGHUVZKRKDYHQRWDWWDLQHGWKHLUWKELUWKGD\RQ)HQFHVDSSUR[FP

6SRQVRUV 7RP0DUWLQ(OHFWULFDO7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV1RYLFH:RUNLQJ+XQWHU3RQ\ ([FHHGLQJFPEXWQRWH[FHHGLQJFPVXLWDEOHIRUDQGWREHULGGHQE\ULGHUVRI FRUUHFWDJH VHHRSHQFODVVHVEHORZ )HQFHVDGMXVWHGWRSRQ\KHLJKWZLWKSRQLHVXSWR FPMXPSLQJILUVW)HQFHKHLJKWVFPDSSUR[

6SRQVRUV 7RP0DUWLQ(OHFWULFDO7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV2SHQ:RUNLQJ+XQWHU3RQ\&ODVV )RU3RQLHV0DUHVRU*HOGLQJVH[FHHGLQJFPEXWQRWH[FHHGLQJFPVXLWDEOH IRUDQGWREHULGGHQE\ULGHUVZKRKDYHQRWDWWDLQHGWKHLUWKELUWKGD\IRUSRQLHVXSWR FPDQGE\ULGHUVZKRKDYHQRWDWWDLQHGWKHLUWKELUWKGD\RQIRU SRQLHVFPFPSRQLHVWRMXPSILUVWZLWKIHQFHVDSSUR[FPFPSRQLHV FP

6SRQVRUV 6NRGD,UHODQG 3UL]HV VWрнАQGрнАUGрнА

&ODVV5HJLVWHUHG&RQQHPDUD3RQ\:RUNLQJ+XQWHU \HDUVDQGRYHUIHQFHVDSSUR[FP

6SRQVRUV 6NRGD,UHODQG 3UL]HV VWрнАQGрнАUGрнА

&ODVV&KDPSLRQ:RUNLQJ+XQWHU3RQ\ VW QG3UL]H:LQQHUVIURP&ODVVDQGDUHHOLJLEOH

6SRQVRUV 'RQRKXH0DUTXHHV 1RSUHHQWU\

:25.,1*+817(5+256(6 6WDUW7LPH1RWEHIRUHSP (QWU\)HHрнА $OOULGHUVPXVWEHDJHG\HDURUROGHUDVDW

79


&ODVV1RYLFH:RUNLQJ+XQWHU0DUHRU*HOGLQJ ([FHHGLQJFPQRWWRKDYHZRQDILUVWSUL]HLQDQ\ZRUNLQJKXQWHUFRPSHWLWLRQFODVV SULRUWRWKH)HQFHVDSSUR[LPDWHO\FP

6SRQVRUV 5DYHQKLOO&RXULHUV7XOODPRUH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV2SHQ:RUNLQJ+XQWHU0DUHRU*HOGLQJ ([FHHGLQJFP)HQFHVPDSSUR[LPDWHO\

6SRQVRUV 7RSVSHF(TXLQH/LPLWHG 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV&KDPSLRQ:RUNLQJ+XQWHU+RUVH VW QG3UL]H:LQQHUVIURP&ODVVHV DUHHOLJLEOH &KDPSLRQ 5HVHUYH&KDPSLRQDUHHOLJLEOHIRUWKH6XSUHPH&KDPSLRQ5LGGHQ+RUVHWR EHKHOGLQWKH:RUNLQJ+XQWHU5LQJ

6SRQVRUV &ROWRQ0RWRUV)RUGV7XOODPRUH 1RSUHHQWU\

&/<'(6'$/(:25.+256( 5LQJbDPVKDUS &O\GHVGDOH0LQLDWXUH+RUVH 3RQ\ (QWU\IHHрнА 7KH6KRZ6RFLHW\UHVHUYHVWKHULJKWWRDPDOJDPDWHRUFDQFHODQ\FODVVHVGXHWRLQVXIILFLHQW HQWULHV

&ODVV$Q\+RUVH6XLWDEOHIRU)DUPZRUN 1R&+65HJ&O\GHVGDOHDOORZHG

6SRQVRUV 7XOODPRUH3HW)DUP 3UL]HV VWрнАQGрнАUGрнА

&ODVV5HJLVWHUHG&O\GHVGDOH0DUHZLWKIRDODWIRRW 6SRQVRUV 6NRGD,UHODQG 3UL]HV VWрнАQGрнАUGрнА

80


&ODVV5HJLVWHUHG&O\GHVGDOH)RDO 6SRQVRUV &O\GHVGDOH+RUVH6RFLHW\RI,UHODQG 3UL]HV VWрнАQGрнАUGрнА

&ODVV5HJLVWHUHG&O\GHVGDOH<HDU2OG 2YHU 6SRQVRUV &RROPRUH6WXG 3UL]HV VWрнАQGрнАUGрнА

&ODVV5HJLVWHUHG&O\GHVGDOHWR<HDU2OG&ROWRU)LOO\ $6RFLHW\6KLHOGWREHDZDUGHGWRWKH%HVW4XDOLI\LQJ<HDUOLQJRU7ZR<HDU2OG)LOO\ SUHYLRXV6KLHOGZLQQHUVH[FOXGHG

6SRQVRUV &O\GHVGDOH+RUVH6RFLHW\RI,UHODQG 3UL]HV VWрнАQGрнАUGрнА

&ODVV&KDPSLRQ&O\GHVGDOH VW QG3UL]H:LQQHUVIURP&ODVVHVDQGDUHHOLJLEOH 1RSUHHQWU\ 3UL]HV VW7URSK\E\0V+HDWKHU%DLOH\)HWKDUG&R7LSSHUDU\

0,1,$785(+256(6 321<,1+$1' (QWU\)HHрнАXQOHVVRWKHUZLVHVWDWHGb

&ODVV0LQLDWXUH-XPSLQJ 6SRQVRUV 7XOODPRUH3HW)DUP 3UL]HV *RRGVLQ.LQG

&ODVV<RXQJ+DQGOHUV$JHGWR\HDUV 1RVWDOOLRQVDOORZHG

6SRQVRUV 7XOODPRUH3HW)DUP 3UL]HV *RRGVLQ.LQG

&ODVV0L[HG6KHWODQG3RQ\&ODVVXSWR $Q\DJHQRVWDOOLRQVDOORZHG

6SRQVRUV %HJOLHYH6WXG 3UL]HV VWрнАQGрнАUGрнА

81


&ODVV0LQLDWXUH6WDOOLRQ  XQGHU<HDUV 8SZDUGVUHJLVWHUHGZLWKDQ\UHJLVWHU

6SRQVRUV 3DGUDLJ$UWKXU4XDQWLW\6XUYH\RU7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV0LQLDWXUH%URNHQ&RORXU  XQGHU$Q\DJHQRVWDOOLRQVDOORZHG

6SRQVRUV 3DGUDLJ$UWKXU4XDQWLW\6XUYH\RU7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV0LQLDWXUH6ROLG&RORXU  XQGHU$Q\DJHQRVWDOOLRQVDOORZHG

6SRQVRUV 7XOODPRUH7HVW 5HSDLU&HQWUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV0LQLDWXUH*HOGLQJ $Q\DJH

6SRQVRUV 'LJL3ULQWV7XOODPRUH 3UL]HV *RRGVLQ.LQG

&ODVV0LQLDWXUH<HDUOLQJ)LOO\ 6SRQVRUV &RQGURQ'LVPDQWOHUV7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV0LQLDWXUH<HDU2OG)LOO\ 6SRQVRUV 7XOODPRUH7HVW 5HSDLU&HQWUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV0LQLDWXUH<HDUOLQJ&ROW 6SRQVRUV 3DXO%HOO7KH%UHZHU\7DS7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV&KDPSLRQ0LQLDWXUH+RUVHRU3RQ\ VW QGSUL]HZLQQHUVIURPFODVVHVWRDUHHOLJLEOH

6SRQVRUV 3DXO%HOO7KH%UHZHU\7DS7XOODPRUH 1RSUHHQWU\

82


)$0,/<321<6(&7,21 (QWU\)HHрнАXQOHVVRWKHUZLVHVWDWHGb

&ODVV3RQ\&OXE 3RQ\QRWH[FHHGLQJFP\HDUVROGDQGRYHU0DUHRU*HOGLQJVXLWDEOHIRUDQGWREH ULGGHQE\DFXUUHQWPHPEHURIWKH,ULVK3RQ\&OXEZKRKDVQRWDWWDLQHGWKHLUWK ELUWKGD\RQOHDGUHLQQRWSHUPLWWHG &XUUHQWPHPEHUVKLSFDUGVPXVWEH SURGXFHG

6SRQVRUV $QQDKDUYH\(TXHVWULDQ&HQWUH 3UL]HV *RRGVLQ.LQG

&ODVV%HVW7XUQHG2XW)RUULGHUVDJHGWR PD\EHOHDG

3RQLHVQRWH[FHHGLQJFP

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV *RRGVLQ.LQG

&ODVV%HVW7XUQHG2XWIRUULGHUVDJHGWR 3RQLHVQRWH[FHHGLQJFP

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV *RRGVLQ.LQG

&ODVV/HDG5HLQ3RQ\ 1RWH[FHHGLQJFP3RQ\DQGULGHUFRPELQDWLRQZLWKQR,36SRLQWVULGHUVDJHGWR \HDUVVQDIIOHEULGOHVRQO\

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV *RRGVLQ.LQG

&ODVV)LUVW5LGGHQ3RQ\ 1RWH[FHHGLQJFP3RQ\DQGULGHUFRPELQDWLRQZLWKQR,36SRLQWVULGHUVDJHGWR \HDUVVQDIIOHEULGOHVRQO\

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV *RRGVLQ.LQG

&ODVV5LGGHQ3RQ\ FPRURYHUEXWQRWH[FHHGLQJFPSRQ\DQGULGHUFRPELQDWLRQZLWKQR,36 SRLQWVULGHUVZKRKDYHQRWDWWDLQHGWKHLUWKELUWKGD\

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV *RRGVLQ.LQG

83


&ODVV<RXQJ+DQGOHUDJHGWR\HDUV ,Q+DQG WREHMXGJHGRQWKHKDQGOHU VDELOLW\FRQWURODQGVKRZPDQVKLS3RQ\QRW H[FHHGLQJFPEXWVXLWDEOHIRUKDQGOHU

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV *RRGVLQ.LQG

&ODVV%HVW3RQ\ 5LGHULQ)DQF\'UHVV 0D\EHOHDG DJHG

6SRQVRUV 0LGODQG9HWHULQDU\7XOODPRUH 3UL]HV *RRGVLQ.LQG

&211(0$5$ (QWU\)HHрнА $OO\RXQJVWRFNPXVWEHHOLJLEOHIRUUHJLVWUDWLRQZLWKWKH&3%6

&ODVV5HJLVWHUHG&RQQHPDUD%URRG0DUH <HDUV2OGDQG2YHUVWLQWHGZLWK)RDODW)RRWLVDOVRD4XDOLILHUIRUWKH8OVWHU &RQQHPDUD3RQ\%UHHGHUV$VVRFDWLRQ 8&3%$

6SRQVRUV 1RHO (LOHHQ2 1HLOO.LOEHJJDQ 3UL]HV VWрнАQGрнАUGрнА

&ODVV&RQQHPDUD<HDUOLQJ &ROW*HOGLQJRU)LOO\

6SRQVRUV &ROWRQ0RWRUV)RUGV7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV&RQQHPDUDRU<HDU2OG*HOGLQJRU)LOO\ 6SRQVRUV &ROWRQ0RWRUV)RUGV7XOODPRUH 3UL]HV VWрнАQGрнАUGрнА

&ODVV&KDPSLRQ&RQQHPDUD3RQ\ VW QG3UL]H:LQQHUVIURP&ODVVHV DUHHOLJLEOH&KDPSLRQ 5HVHUYH &KDPSLRQDUHHOLJLEOHIRU6XSUHPH&KDPSLRQ,Q+DQG3RQ\

6SRQVRUV 1RHO (LOHHQ2 1HLOO.LOEHJJDQ 1RSUHHQWU\

84


ENTERTAINMENT COMPETITIONS &ODVV%HVW'UHVVHG/DG\ 6SRQVRUV %ULGJH+RXVH+RWHODQG/HLVXUH&HQWUH7XOODPRUH&R 2IIDO\ 5HYHDO7XOODPRUH&R2IIDO\ 0\6W\OH0XFNODJK7XOODPRUH&R2IIDO\ 5RVH)LQOD\3KDUPDF\7XOODPRUH&R2IIDO\ $QQHEURRN+RXVH+RWHO0XOOLQJDU &ODVV%HVW'UHVVHG0DQ 3UL]HV VW2XWILWIURP*DOYLQVIRU0HQ7XOODPRUH

&ODVV*ODPRXURXV*UDQQ\ 3UL]HV VW7RQ\&DKLOO-HZHOOHUV7XOODPRUH

&ODVV<RXQJ0U2IIDO\ 3UL]HV VW-XPSLQ-DFNV7XOODPRUH рнА0HQDU\VYRXFKHU

&ODVV<RXQJ0LVV2IIDO\ 3UL]HV VW-XPSLQ-DFNV7XOODPRUH рнА0HQDU\V9RXFKHU

&ODVV%RQQ\%DE\ 3UL]HV VW3RUWUDLWZLWK-RH2 6XOOLYDQ3KRWRJUDSK\7XOODPRUH рнА0HQDU\V 9RXFKHU

&ODVV7UDGLWLRQDO)DUPHU 3UL]HV VWрнА- 0'RXJODV-HZHOOHUV7XOODPRUH <RXPD\HQWHURQOLQHDQGHQWULHVZLOOEHWDNHQRQVKRZGD\DOVR 2WKHU$FWLYLWLHV &KLOGUHQ V$PXVHPHQWV 0RQVWHU %RXQFLQJ6OLGHV &KLOGUHQ V)XQ*DPHV 0XVLF$OO'D\RQWKH6WDJH /RWVWRVHHDQGGR

85


DOGS 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP 6SRQVRUV 6KRZLQJ&ODVVHV bbbbbbbbbbbb1XWV$ERXW3HWV bbbbbbb+ *9HWHULQDU\ bbbbbbb0LNH'DO\/DQGVFDSLQJ bbbbbbb7XOODPRUH9HWHULQDU\&OLQLF bbbbbbb3DGV)RU3DZV 2EHGLHQFH&ODVVHV bbbbbbb+DLU)ODLU7XOODPRUH &KDPSLRQVKLS bbbbbbb'RURWK\ 9LQFHQW%HUPLQJKDP 3UL]HV )RUDOO6KRZLQJ&ODVVHV7URSK\ 'RJ)RRGWR:LQQHUV'RJIRRGIRUSODFLQJV )RU2EHGLHQFH&ODVVHV7URSK\ 'RJ)RRGWR:LQQHUV'RJIRRGIRUSODFLQJV &KDPSLRQ3HUSHWXDO&XS 5RVHWWH 5HVHUYH&KDPSLRQ5RVHWWH (QWU\)HHрнАSHUDQLPDOSHUFODVV 1R(QWULHVWDNHQRQ6KRZ'D\ 5XOHV &RQGLWLRQV -XGJLQJ&RPPHQFHVDW1RRQVKDUS $OOGRJVPXVWEHOHGDQGUHPDLQRQDOHDGLQWKH6KRZJURXQG (DFKGRJFDQRQO\HQWHULQWRDPD[LPXPRIFODVVHV (QWULHVWDNHQRQOLQHRUWKURXJKWKH6KRZ2IILFHVHHEHORZIRUFORVLQJGDWHV $SXSS\&ODVVFRQILQHGWRGRJVRYHUPRQWKVDQGXQGHU\HDUROG$OO&ODVVHVFRQILQHGWR GRJVRYHUPRQWKV &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\ 1R(QWULHVDFFHSWHGRQ6KRZ'D\

New Competition / Event FANCY DRESS DOG COMPETITION OPEN TO ALL DOGS. ENTER ONLINE CLOSING DATE 18 JULY. NO ENTRIES TAKEN ON THE DAY. 86


2EHGLHQFH 6SRQVRUV+DLU)ODLU7XOODPRUH

&ODVV%HJLQQHUV2EHGLHQFH &ODVV1RYLFH2EHGLHQFH

6KRZLQJ 6SRQVRUV3DGVIRU3DZV + *9HWHULQDU\ 0LNH'DO\/DQGVFDSLQJ 1XWV$ERXW 3HWV 7XOODPRUH9HWHULQDU\&OLQLF

&ODVV*XQGRJ*URXS &ODVV:RUNLQJ*URXS &ODVV7HUULHU*URXS &ODVV8WLOLW\*URXS &ODVV%HVW)DPLO\3HW /DUJHGRJ

&ODVV)DQF\'UHVVHG'RJ+DQGOHGE\DSHUVRQXQGHU\HDUVRI DJH &ODVV5HJLVWHUHG'RJ &ODVV+DQGOHGE\/DG\ &ODVV5HVFXH'RJV $OOW\SHV

&ODVV&URVVEUHG*URXS &ODVV+DQGOHGE\*HQW &ODVV3XSS\6WDNHV DOOW\SHVRYHUPRQWKV

&ODVV+RXQG*URXS

87


&ODVV7R\*URXS &ODVV6PDOO+RXVH3HW &ODVV4XDOLILHUIRUWKH*DLQ'RJ)RRG $OO,UHODQG7R\RU0LQLDWXUH'RJ&KDPSLRQVKLS)LQDODW&ORQDVOHH6KRZRQWK 6HSWHPEHU 6HH5XOHV 5HJXODWLRQV6HFWLRQ

&ODVV4XDOLILHUIRU*DLQ'RJ)RRG$OO,UHODQG/DUJH'RJ &KDPSLRQVKLS )LQDODW&ORQDVOHH6KRZRQWK6HSWHPEHU 6HH5XOHV 5HJXODWLRQV6HFWLRQ

&ODVV4XDOLILHUIRUWKH$OO,UHODQG*XQGRJ&KDPSLRQVKLS )LQDODW%HOWUD6KRZRQWK6HSWHPEHU 6HH5XOHV 5HJXODWLRQV6HFWLRQ

&ODVV&KDPSLRQ'RJRI7XOODPRUH6KRZ 6SRQVRUV 'RURWK\ 9LQFHQW%HUPLQJKDP 1RSUHHQWU\

Admission to Show Exhibitors allowed Credits (see below) against entry fees and everyone to pay at the gate. No free passes will be issued but their value may be credited against entry fees, at the time of making entries and before the closing date of 18th July. THE FOLLOWING DEDUCTIONS MAY BE MADE: Entries valued â&#x201A;¬20 â&#x20AC;&#x201C; Entries valued â&#x201A;¬40 â&#x20AC;&#x201C; Entries valued â&#x201A;¬60 and over â&#x20AC;&#x201C;

Deduct â&#x201A;¬15 from entry fees (Cost of admission for 1) Deduct â&#x201A;¬30 from entry fees (Cost of admission for 2) Deduct â&#x201A;¬45 from entry fees (Cost of admission for 3)

88


HORTICULTURE & FARM PRODUCE 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP 0DUTXHH6SRQVRUHGE\&$0D\H%ULGJH&HQWUH7XOODPRUH 7KHFRQWLQXLQJVXFFHVVRIWKH+RUWLFXOWXUHDQG)DUP3URGXFH6HFWLRQVLQFHLVGXHWRWKH XQIDLOLQJVXSSRUWRIRXUH[KLELWRUVZKRDUULYHbDWRXUPDUTXHHORDGHGGRZQZLWKQXPHURXVHQWULHV RIDVXSHUEVWDQGDUG:HRZHWKHPDQHQRUPRXVGHEWRIJUDWLWXGH7KLV\HDUWKHUHDUH FODVVHVDVZHOODVWKHIROORZLQJIRXU$OO,UHODQGV $OO,UHODQG4XDOLW\3RWDWR&KDPSLRQVKLS 1R'LUHFW(QWU\  bbb&ODVV6SRQVRUHGE\%RUG%LD $OO,UHODQG&ROOHFWLRQRI9HJHWDEOHV&KDPSLRQVKLS 'LUHFW(QWU\  bbb&ODVV6SRQVRUHGE\%ULGJH+RXVH+RWHODQG/HLVXUH&HQWUH7XOODPRUH

6LQJOH5RVH$OO,UHODQG 'LUHFW(QWU\  bbb&ODVV6SRQVRUHGE\0UV%O\+XWWRQ%XU\7XOODPRUH $OO,UHODQG)ORZHU$UUDQJHURIWKH<HDU 'LUHFW(QWU\  bbb&ODVV6SRQVRUHGE\&DVWOH)ORZHUV0RDWH&R:HVWPHDWK ([KLELWRUVPD\VXEPLWH[KLELWVRQ6DWXUGD\HYHQLQJWK$XJXVWIURPSPWRSP DQGRQ6XQGD\PRUQLQJWK$XJXVWIURPDPWRDPRQO\ -XGJLQJVWDUWVDWDP ([KLELWVUHWXUQHGDIWHUSP ([KLELWVGLVSOD\HGDWRZQHUà«&#x201A;VULVN (QWU\)HHà­&#x20AC;H[FHSWZKHUHRWKHUZLVHVWDWHG /DWH(QWU\)HHà­&#x20AC;RQ6KRZZHHNHQGb 1R/DWHHQWULHVDFFHSWHGDIWHUDPRQ6KRZ0RUQLQJ 1R/DWHHQWULHVDFFHSWHGIRU)ORUDO$UW&ODVVHV 3UL]HVVWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;WKà­&#x20AC;H[FHSWZKHUHRWKHUZLVHVWDWHG 7RPDNHWKH+RUWLFXOWXUHDQG)DUP3URGXFH6HFWLRQPRUHLQWHUHVWLQJIRUWKHSXEOLF HDFKHQWU\VKRXOGEHQDPHGZKHUHSRVVLEOH,QWKHHYHQWRIDWLHQDPLQJZLOOFRXQW &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\

89


HORTICULTURE & FARM PRODUCE )UXLW &ODVV6WDONVRI5KXEDUE &ODVV7UXVVRI7RPDWRHV &ODVV'HVVHUW$SSOHV &ODVV7RPDWRHV

9HJHWDEOHV &ODVV%ULGJH+RXVH-XQLRU7UD\RI9HJHWDEOHV %HVWFROOHFWLRQRINLQGVRIYHJHWDEOHV RIHDFK &RQILQHGWR\RXQJSHRSOHXQGHU \HDUV 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV%HVW([KLELWLQ&ODVVHVLQFOXVLYH 1RSUHHQWU\ 3UL]HV 1DWLRQDO9HJHWDEOH6RFLHW\2I,UHODQG6LOYHU0HGDO

&ODVV:KLWH7XUQLS &ODVV&DUURWV/RQJ 7KHWRSVVKRXOGEHWULPPHGWRFPDSSUR[1RRLORUSROLVKWREHXVHG

&ODVV%ODQFK/HHNV &ODVV&DUURWV6WXPS5RRWHG &ODVV3DUVQLSV &ODVV2QLRQVXQGHUJUDPPH &ODVV3RGVRI3HDV

90


&ODVV2QLRQVRYHUJUDPPH &ODVV%HHWURRW &ODVV&RXUJHWWHV $SSUR[FPLQOHQJWKDQGFPLQGLDPHWHU

&ODVV5DGLVKHV &ODVV3RGVRI%URDG%HDQV &ODVV6KDOORWV &ODVV3RGVRI5XQQHU%HDQV &ODVV6FDOOLRQV &ODVV+HDGVRI&HOHU\ &ODVV9HJHWDEOH0DUURZ /HVVWKDQFP

&ODVV&DXOLIORZHUV &ODVV6WDONVRI3DUVOH\ &ODVV+HDGVRI/HWWXFH &ODVV+HDGVRI&DEEDJH &ODVV([KLELWRI+HUEVRQD7UD\ VSHFLHVQDPLQJWRFRXQW

&ODVV%DVNHWRI6DODG9HJHWDEOHV &ODVV7UD\RI9HJHWDEOHV &RQILQHGWRH[KLELWRUVZKRKDYHQRWZRQVWQGRUUGSUL]HLQWKHSDVWVKRZVLQ WKH%ULGJH+RXVH$OO,UHODQG&ROOHFWLRQRI9HJHWDEOHVFRPSHWLWLRQ 1RPRUHWKDQW\SHVRIYHJHWDEOHVSDUVOH\FDQEHXVHGDVD'HFRUDWLRQ7UD\VL]HQRW ELJJHUWKDQFP[FP

&ODVV7KH%ULGJH+RXVH$OO,UHODQG&KDPSLRQVKLSIRUD&ROOHFWLRQ RI9HJHWDEOHV 'LUHFW(QWU\

6SRQVRUV

7KH%ULGJH+RXVH+RWHO7XOODPRUH

(QWU\IHHRIрнА 3UL]HV VWрнАFDVK3OXV%ULGJH+RXVH7URSK\QGрнАFDVKUGрнА FDVKWKрнАFDVKWKрнАFDVKWKрнАFDVK 6HH5XOHV 5HJXODWLRQV6HFWLRQDWWKHEDFNRIWKH6FKHGXOH

91


)DUP3URGXFH 6SRQVRUV3-/HDY\3RO\WXQQHOV7XOODPRUH

&ODVV%HVW([KLELWLQWKH)DUP3URGXFHVHFWLRQ &ODVVHVLQFOXVLYH

6SRQVRUV 0+HDOLRQ7UDFWRUV$UGHQ7XOODPRUH&R2IIDO\ 1RSUHHQWU\ 3UL]HV рнА

&ODVV6ZHGHV 7RSFPORQJDSSUR[

&ODVV6KHDIRI)HHGLQJ%DUOH\ /HQJWKbFPFLUFXPIHUHQFHFPQDPLQJWRFRXQW

&ODVV6KHDIRI:KHDW /HQJWKFPFLUFXPIHUHQFHFPQDPLQJWRFRXQW

&ODVV6KHDIRI2DWV /HQJWKFPFLUFXPIHUHQFHFPQDPLQJWRFRXQW

&ODVV6DPSOHRI+D\ NJDSSUR[LQPHVKEDJRURQLRQEDJ

3RWDWRHV 6SRQVRUV2OLYHU&KRLVHXO3RWDWR6HUYLFHV7XOODPRUH

&ODVV)LUVW(DUO\3RWDWRHV &ODVV%ULWLVK4XHHQV &ODVV5HFRUGV &ODVV.HUU V3LQN &ODVV5RRVWHU &ODVV6HHG3RWDWRHV &ODVV&RRNHG3RWDWRHV

92


&ODVV3RWDWRHV$Q\WUDGLWLRQDO1RQFRPPHUFLDOZKLWHVNLQQHG YDULHW\ 7R%H1DPHGb

&ODVV3RWDWRHV$Q\WUDGLWLRQDO1RQFRPPHUFLDO&RORXUHGRU 3DUWFRORXUHG9DULHW\ 7R%H1DPHG

&ODVV%RUG%LD$OO,UHODQG4XDOLW\3RWDWR&KDPSLRQVKLS)LQDO 1R3UH(QWU\HQWHUWKURXJKTXDOLI\LQJVKRZVRQO\

6SRQVRUV %RUG%LD 3UL]HV VWрнАFDVK%RUG%LD7URSK\DQG5HSOLFDQGрнАFDVKUGрнА FDVKWKрнАFDVKWKрнАFDVKWKрнАFDVK 6HH5XOHV 5HJXODWLRQV6HFWLRQ

7XUI &ODVVVRGVRI0DFKLQH:RQ7XUI 3UHVHQWDWLRQWRFRXQWRQDWUD\QRWH[FHHGLQJFP

6SRQVRUV 'HUYLOOH'RODQ$FFRXQWDQWV7XOODPRUH &ODVV6RGVRI+DQG:RQ7XUI 3UHVHQWDWLRQWRFRXQWRQDWUD\QRWH[FHHGLQJFP

&XW)ORZHUV 6SRQVRU%HQQLH V)ORZHUV7XOODPRUH ([KLELWRUVPD\XVHWKH6RFLHW\ VYDVHVLIWKH\ZLVK 3UHVHQWDWLRQZLOOEHWDNHQLQWRDFFRXQWZKHQEHLQJMXGJHG 1DPHYDULHW\ZKHUHSRVVLEOH (QWULHVPD\EHOHIWLQWRWKH+RUWLFXOWXUDO0DUTXHHIURPSPRQ6DWXUGD\WK$XJXVWDQGRQ 6XQGD\PRUQLQJWK$XJXVWIURPDPWRDP

&ODVV%HVWH[KLELWLQWKH&XW)ORZHU6HFWLRQ &ODVVHVLQFOXVLYH

6SRQVRUV .)ORZHUV7XOODPRUH 1RSUHHQWU\ 3UL]HV рнА

93


&ODVV+HUEDFHRXV)ORZHUV 3HUHQQLDO 0L[HG9DULHW\VWHPV YDVH WREHQDPHGZKHUHSRVVLEOH

&ODVV+HUEDFHRXV)ORZHUV 3HUHQQLDO 2QH9DULHW\VWHPV YDVH WREHQDPHGZKHUHSRVVLEOH

&ODVV)ORZHULQJ6KUXE 2QH9DULHW\YDVH H[FOXGLQJ+\GUDQJHD

&ODVV+\GUDQJHD 7KUHH%ORRPVYDVH

&ODVV$QQXDOV 2QH9DULHW\YDVH H[FOXGLQJVZHHWSHD

&ODVV6ZHHW3HD7HQ6WHPVPL[HGYDULHWLHVYDVH &ODVV6ZHHW3HD7HQ6WHPVRQHYDULHW\YDVH &ODVV*ODGLROL 2QHVSLNH

&ODVV3DQV\ )LYHbEORRPV

&ODVV)ORULEXQGD5RVH 2QHVSUD\YDVH

&ODVV+\EULG7HD5RVHV 7KUHH%ORRPVYDVH

&ODVV%RZORI5RVHV (LJKW+\EULG7HD0L[HGRURQH9DULHW\

&ODVV/LOLHV H[FOXGLQJ$UXP/LOLHV

VWHPV9DVH

94


&ODVV7KH6LQJOH5RVH$OO,UHODQG&KDPSLRQVKLS 'LUHFW(QWU\6HH5XOHVDQG5HJXODWLRQVDWWKHHQGRIWKHVFKHGXOH

6SRQVRUV 0UV%O\+XWWRQ%XU\%URRNILHOG7XOODPRUH (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнА

'DKOLDV 6SRQVRUV%HHFKLOO%XOEV ([KLELWRUVPD\XVHWKH6RFLHW\ VYDVHVLIWKH\ZLVK 3UHVHQWDWLRQZLOOEHWDNHQLQWRDFFRXQWZKHQEHLQJMXGJHG 1DPHYDULHW\ZKHUHSRVVLEOH

&ODVV0LGODQG'DKOLD&KDPSLRQVKLS YDVHV'DKOLDVDQ\FODVVLILFDWLRQWKUHHEORRPVHDFKYDVHYDULHW\SHUYDVH 3UL]HV VWрнАFDVK,ULVK'DKOLD6RFLHW\3HUSHWXDO&U\VWDO7URSK\QGрнА FDVKUGрнАFDVKWKрнАFDVK

&ODVV%HVW([KLELWRI'DKOLDV ,QFODVVHVLQFOXVLYH 1RSUHHQWU\ 3UL]HV %HHFKLOO%XOEV$QQXDO3ODWH

&ODVV0LQLDWXUH'DKOLDDQ\FODVVLILFDWLRQ 7KUHH%ORRPVYDVHPD\EHPL[HG

&ODVV0HGLXP'HFRUDWLYH'DKOLDV 7KUHH%ORRPVYDVHPD\EHPL[HG

&ODVV6PDOO'HFRUDWLYH'DKOLDVDQGRU%DOO'DKOLDV 7KUHH%ORRPVYDVHPD\EHPL[HG

&ODVV0HGLXP&DFWXVDQGRU6HPLFDFWXV'DKOLDV 7KUHH%ORRPVYDVHPD\EHPL[HG

95


&ODVV3RPSRQ'DKOLDV 7KUHH%ORRPVYDVHPD\EHPL[HG

&ODVV6PDOO&DFWXVDQGRU6HPLFDFWXV'DKOLDV 7KUHH%ORRPVYDVHPD\EHPL[HG

&ODVV6LQJOH*LDQW'DKOLDDQ\FRORXU &ODVV$%DVNHWRI'DKOLDV $QDUUDQJHPHQWRIGDKOLDVLQDEDVNHWWREHMXGJHGIRUHIIHFW1RWPRUHWKDQ EORRPVDUUDQJHPHQWQRWWRH[FHHGFP

1RYLFH,QWHUPHGLDWH'DKOLD6HFWLRQ b&RQILQHGWRWKRVHZKRKDYHQRWZRQDSUL]HLQWKH'DKOLDVHFWLRQLQWKHSDVW\HDUV

&ODVV3RPSRQ'DKOLDV 7KUHH%ORRPVYDVH9DULHWLHVPD\EHPL[HG

&ODVV'HFRUDWLYH'DKOLDVDQGRU%DOO'DKOLDV YDVH

&ODVV&DFWXV'DKOLDV YDVH

3RW3ODQWV &ODVV%HVW2YHUDOO([KLELWLQWKH3RW3ODQW6HFWLRQ &ODVVHVLQFOXVLYH

6SRQVRUV 7KRPDV/DQGVFDSH7XOODPRUH 1RSUHHQWU\ 3UL]HV VWрнА

96


&ODVV%RQVDL $Q\W\SHSODQWSHUSRW

&ODVV)XFKVLD $Q\W\SHSODQWSHUSRW

&ODVV*HUDQLXPRU3HODUJRQLXP SODQWSHUSRW

&ODVV,PSDWLHQV %XV\/L]]LH

SODQWSHUSRW

&ODVV$Q\SRWSODQWLQEORRPH[FHSW)XVFKLD*HUDQLXPRU ,PSDWLHQV SODQWSHUSRW

&ODVV)ROLDJHQRQIORZHULQJ SODQWSHUSRW

&ODVV&DFWXVH[FOXGLQJ0DPPLOODULD SODQWSHUSRW

&ODVV0DPPLOODULD SODQWSHUSRW

&ODVV6XFFXOHQW SODQWSHUSRWb

)ORUDO$UW 6SRQVRU6WXGLR2QH7XOODPRUH

([KLELWVPD\EHVWDJHGLQWKH+RUWLFXOWXUDO0DUTXHHIURPSPRQ6DWXUGD\WK$XJXVWDQGRQ 6XQGD\PRUQLQJIURPDP 3OHDVHQRWHWKDWODWHHQWULHVZLOOQRWEHDFFHSWHGRQ6DWXUGD\RU6XQGD\ $OOH[KLELWVPXVWEHVWDJHGZLWKLQWKHVSDFHSURYLGHG$OOPHDVXUHPHQWVDUHDSSUR[LPDWH %DFNJURXQGVRUGUDSHVLIXVHGPXVWEHIUHHVWDQGLQJ1RWKLQJPD\EHDWWDFKHGWRWKHVWDJLQJ LQDQ\FODVV 7KHXVHRIDHURVROFDQVLVQRWSHUPLWWHGLQVLGHWKHPDUTXHH$OOH[KLELWVPXVWEHWKHXQDLGHG ZRUNRIWKHH[KLELWRU $OOH[KLELWVZLOOEHMXGJHGLQDFFRUGDQFHZLWKWKH1$)$6&RPSHWLWLRQ0DQXDO bbQG(GLWLRQ $EODFNEDFNJURXQGLVSURYLGHGIRUDOOH[KLELWV

97


&KLOGUHQ Vb&ODVVHV &ODVV-DP-DU $QDUUDQJHPHQWRIIORZHUVDQGIROLDJHLQD-DP-DU

&ODVV0LQLDWXUH*DUGHQ &ODVV$:HLUGDQG:RQGHUIXO$QLPDORU,QVHFW 0DGHIURPIUXLWDQGRUYHJHWDEOH

1RYLFH&ODVVHV &RQILQHGWRFRPSHWLWRUVZKRKDYHQRWZRQDVW3UL]HLQ)ORUDO$UWLQWKH3DVW7XOODPRUH6KRZV

&ODVV)URPWKH*DUGHQ $Q([KLELWLQD%DVNHWWR,QFRUSRUDWH*DUGHQ)ORZHUVDQG)ROLDJH 6SDFH$OORZHGFPZLGHFPGHHSKHLJKWRSWLRQDO

&ODVV&XSDQG6DXFHU b$Q([KLELWLQD'HFRUDWHG&XSDQG6DXFHU 6SDFHDOORZHGFPZLGHDQGFPGHHS

*HQHUDO&ODVVHV &ODVV%HVW2YHUDOO([KLELW ,QFODVVHVLQFOXVLYH

6SRQVRUV 7XOODPRUH*DUGHQ&OXE 1RSUHHQWU\ 3UL]HV VWрнА

&ODVV)XQZLWK&RORXU $Q([KLELW6SDFH$OORZHGFPZLGHFPGHHSKHLJKWRSWLRQDO

98


&ODVV5HF\FOHG $Q([KLELWWRLQFOXGH5HF\FOHG2EMHFWRU2EMHFWV 6SDFH$OORZHGFPZLGHFPGHHSKHLJKWRSWLRQDO

&ODVV0XVLFDO $Q([KLELW6SDFH$OORZHGFPZLGHFPGHHSKHLJKWRSWLRQDO

&ODVV1XUVHU\5K\PH $Q([KLELW6SDFH$OORZHGFPZLGHFPGHHSKHLJKWRSWLRQDO

&ODVV$XWXPQ0HORG\ $Q([KLELWWRLQFOXGH)UXLWDQGRU9HJHWDEOHV 6SDFH$OORZHGFPZLGHFPGHHSKHLJKWRSWLRQDO

&ODVV$OO,UHODQG)ORZHU$UUDQJHURIWKH<HDU 7KHPHb'RZQWKH*DUGHQ3DWK $Q([KLELW 6SDFH$OORZHGFPZLGHFPGHHS 'LUHFW(QWU\b

6SRQVRUV &DVWOH)ORZHUV0RDWH&R:HVWPHDWK (QWU\IHHRIрнА 3UL]HV VWрнАFDVK)ORZHU$UUDQJHURIWKH<HDU7URSK\DQG&HUWLILFDWHQG рнАFDVKUGрнАFDVKWKрнАFDVK $OO(QWULHVZLOOUHFHLYHD0HPHQWR

+RQH\ 6SRQVRUV&HFLO/XPOH\0HPRULDO)XQG7XOODPRUH 2IIDO\%HHNHHSHU V$VVRFLDWLRQ

&ODVV6HFWLRQVRI+RQH\ &ODVV&RQWDLQHUVRI&XW&RPE+RQH\ 0LQLPXPZHLJKWJHDFK

99


&ODVV2QHIUDPHRI&RPE+RQH\VXLWDEOHIRUH[WUDFWLRQ &ODVV[J-DUV/LJKW+RQH\ &ODVV[J-DUV0HGLXP+RQH\ &ODVV[J-DUV/LQJ+HDWKHU+RQH\ &ODVV[J-DUV&KXQN+RQH\ &ODVV[J-DUVRI&UHDPHGRU1DWXUDOO\*UDQXODWHG+RQH\ &ODVV[J-DUV5XQ+RQH\ &RQILQHGWRPHPEHUVRI2%.$

&ODVV1RYLFH&ODVV[J-DU+RQH\ DQ\W\SH

2QO\WKRVHZKRKDYHQRWZRQDSUL]HIRUKRQH\DWDQ\VKRZDUHHOLJLEOH 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV1RYLFH&ODVVEDUIUDPHRIFRPEKRQH\VXLWDEOHIRU H[WUDFWLRQ 2QO\WKRVHZKRKDYHQRWZRQDSUL]HIRUKRQH\DWDQ\VKRZDUHHOLJLEOH

&ODVV'HFRUDWLYH'LVSOD\RI[J-DUV+RQH\ VDPHW\SH

ODEHOOHGZLWKWKHSURGXFHUVQDPHDQGDGGUHVV 7KHVL]HPXVWQRWH[FHHGFP[FP7RJHWKHUZLWKTXDOLW\WKHH[KLELWZLOOEHMXGJHG IRURULJLQDOLW\DQGDUWLVWU\

&ODVV[J%ORFNV%HHVZD[ &ODVV0DWFKLQJ%HHVZD[&DQGOHV &ODVV+RQH\&DNH3ODLQ 0DGHZLWKJVUIORXUJ,ULVKKRQH\JEXWWHURUPDUJDULQHHJJVSLQFKRI VDOW%DNHLQFPFLUFXODUWLQ

&ODVV+RQH\&DNH)UXLW 0DGHZLWKJVUIORXUJ,ULVKKRQH\JEXWWHURUPDUJDULQHJVXOWDQDV HJJVSLQFKRIVDOW%DNHLQFPFLUFXODUWLQ

100


&ODVV%RWWOH'U\0HDG &ODVV%RWWOH6ZHHW0HDG &ODVV%HVWRYHUDOOH[KLELWLQWKHKRQH\VHFWLRQ &ODVVHVLQFOXVLYH 1RSUHHQWU\ 3UL]HV VWрнА

&ODVV6XSUHPH5XQ+RQH\ )URPFODVVHV 1RSUHHQWU\ 6SHFLDO3UL]HVDZDUGHGLQ &ODVVb7KH7KRUQH7URSK\ &ODVVb7KH2IIDO\2LO&XS &ODVVb7KH8OVWHU%DQN7URSK\ &ODVVb7KH%DQNRI,UHODQG&XS &ODVVb7KH'HQWRQ$SLDULHV7URSK\ &ODVVb7KH/HH'HQWRQ&KDOOHQJH&XS &ODVVHV7KH&HFLO\5DLQVEHUU\7URSK\ZLOOEHDZDUGHGWRWKH%HVW2YHUDOO([KLELWLQ WKHVH&ODVVHV &ODVVHV7KH-LP'XII\&KDOOHQJH7URSK\IRUWKH%HVW2YHUDOO([KLELWLQWKHVH&ODVVHV

/R\'LJJLQJ 3UL]HVVWQG UG3ODTXHV (QWULHVZLOODOVREHWDNHQRQWKHGD\

&ODVV%HVW/R\'LJJLQJE\ER\XQGHU\HDUV &ODVV%HVW/R\'LJJLQJE\JLUOXQGHU\HDUV &ODVV%HVW/R\'LJJLQJE\ER\XQGHU\HDUV &ODVV%HVW/R\'LJJLQJE\JLUOXQGHU\HDUV 7KHFRPSHWLWLRQVWDUWVDWSPDQGZLOOEHORFDWHGFORVHWRWKH+RUWLFXOWXUDO0DUTXHH

101


COOKERY & FOOD 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP *HQHUDO*XLGHOLQHVIRUWKH&RRNHU\ )RRG6HFWLRQ (QWULHVVKRXOGEHPDGHRQOLQHDWbZZZWXOODPRUHVKRZFRPE\SRVWRUGLUHFWWRWKH6KRZ2IILFHb VHHEHORZIRUFORVLQJGDWHV ([KLELWVPXVWEHUHFHLYHGEHIRUHDPRQ6KRZ'D\DQGZLOOEHUHWXUQHGQRWHDUOLHUWKDQb SPDQGQRWODWHUWKDQSPRQWKDWGD\ $WWHQWLRQLVGUDZQWRWKH5XOHVJRYHUQLQJH[KLELWVDQGH[KLELWRUVDWWKHHQGRIWKH6FKHGXOH HVSHFLDOO\5XOH ([KLELWVPD\EHVDPSOHG 0$548((23(1$7$0216+2:0251,1*0$548((&/26('$0$0)25 -8'*,1* (QWU\)HHрнАSHUH[KLELWLQDOOFODVVHVH[FHSW4XDOLILHUVDQGZKHUHRWKHUZLVHVWDWHG (QWULHVZLOOEHDFFHSWHGRQ6KRZ0RUQLQJZKHQWKHHQWU\IHHZLOOEHрнАSHUHQWU\ (QWULHVZLOOEHDFFHSWHGRQVKRZPRUQLQJXSWREXWWKHHQWU\IHHZLOOEHрнА 1R DGPLVVLRQVFUHGLWVDOORZHG b 3UL]HVVWрнАQGрнАUGрнАWKрнАH[FHSWZKHUHRWKHUZLVHVWDWHG &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\

&ODVV0RVWHQWULHVHQWHUHGE\WKHDQGH[KLELWHGRQ VKRZGD\ 6SRQVRUV 2GOXPV 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

&ODVV$OO,UHODQG+RPH%DNLQJ&KDPSLRQVKLS 1R'LUHFW(QWU\(QWHUWKURXJK4XDOLI\LQJVKRZV6HHUXOHVDQGUHJXODWLRQVDWWKHHQG RIbWKHVFKHGXOH

6SRQVRUV 2GOXPV 3UL]HV VWрнАFDVK*RRGVLQ.LQGQGрнАFDVK*RRGVLQ.LQGUGрнА FDVK*RRGVWKрнАFDVKWKрнАFDVKWKрнАFDVKWKрнА FDVKWKрнАFDVK

See Rules and Regulations Section

102


COOKERY & FOOD %UHDGDQG6FRQHV 6SRQVRU2GOXPV &ODVV7UDGLWLRQDO%URZQ6RGD%UHDG &ODVV7UDGLWLRQDO:KLWH6RGD%UHDG &ODVV+L)LEUH/RDI%UHDG OEWLQ

&ODVV%DQDQD%UHDG &ODVV&ROG7HD%UDFN 5RXQGWLQ

&ODVV6SRWWHG'LFN :KLWH6RGD)UXLW%UHDG

&ODVV)UXLW6FRQHV &ODVV6SHOW%UHDGOEORDIRUJ &ODVV%URZQ6RGD6FRQHV &ODVV&KHUU\6FRQHV &ODVV'HFRUDWHG&KRFRODWH9LFWRULD6DQGZLFK&DNH 3UL]HV VWрнАQGрнАUGрнАWKрнА

2GOXPV3RUULGJH2DWVVHFWLRQ 6SRQVRU2GOXPV &ODVV*UDQRODSUHVHQWHGLQJODVVMDU

103


&ODVV:LOG%HUU\ $SSOH&UXPEOH &ODVV&KRFRODWH)ODSMDFNV &ODVV+HDOWK\6QDFN%DUV

3DVWU\6DYRXU\ 6SRQVRU2GOXPV &ODVV5KXEDUE7DUW &ODVV$SSOH7DUW &ODVV%DNHZHOO7DUW &ODVV$OPRQG6OLFHV &ODVV4XLFKH &ODVV0DFDURRQV &ODVV4XDOLILHUIRUWKH&KRFRODWH&RRNRIWKH6KRZ 4XDOLILHUWR0RDWH6KRZRQWKHUG$XJXVW 6HH5XOHV 5HJXODWLRQV6HFWLRQ

&RQYHQLHQFH%DNLQJ 6SRQVRU2GOXPV &ODVV2GOXPV4XLFN&RRNLHPL[ &ODVV2GOXPV4XLFN)DUPKRXVH%URZQ%UHDG &ODVV2GOXPV4XLFN6RGD%UHDG &ODVV2GOXPV4XLFN7RPDWR +HUE%UHDG &ODVV2GOXPV4XLFN)UXLW6FRQHV &ODVV2GOXPV4XLFN&KRFRODWH%URZQLHV

104


7HHQDJHUV6HFWLRQ 8QGHUDQGRYHU

6SRQVRU2GOXPV &ODVV0RVW(QWULHVHQWHUHGLQ7HHQDJH6HFWLRQ %\WKHDQGH[KLELWHGRQVKRZGD\ 1RSUHHQWU\ 3UL]HV VWà­&#x20AC;

&ODVV%URZQ6RGD%UHDG &ODVV6KRUWEUHDG%LVFXLWV &ODVV%DQDQD%UHDG &ODVV'HFRUDWHG&XSFDNHV &ODVV'HFRUDWHG&KRFRODWH&DNH &ODVV&KRFRODWH%LVFXLW&DNH &ODVV/LJKW)UXLW&DNH &ODVV$SSOH7DUW &ODVV&KRFRODWH0XIILQV &ODVV7KH2GOXPV<RXWK$OO,UHODQG+RPH%DNLQJ&KDPSLRQVKLS 'LUHFWHQWU\WR7XOODPRUH6KRZEHIRUHWK-XO\ 6HH5XOHV 5HJXODWLRQV6HFWLRQDWWKHEDFNRIWKHVFKHGXOH

6SRQVRUV 2GOXPV (QWU\IHHRIà­&#x20AC; 3UL]HV VWà­&#x20AC;FDVK*RRGVLQ.LQGQGà­&#x20AC;FDVKUGà­&#x20AC;FDVKWKà­&#x20AC; FDVKWKà­&#x20AC;FDVKWKà­&#x20AC;FDVK

Early Online Entry Draw We would be delighted to receive early online entries a Special Draw for â&#x201A;¬100 will be held for people who have made their entries online on or before Friday 4th July 2014 See www.tullamoreshow.com to enter. 105


<RXWK6HFWLRQ 6SRQVRU2GOXPV &ODVV0RVW(QWULHVHQWHUHGLQWKH<RXWKVHFWLRQ %\WKHDQGH[KLELWHGRQVKRZGD\ 1RSUHHQWU\ 3UL]HV VWрнА

&ODVV3ODLQ6FRQHV &ODVV5LFH.ULVSLH%XQV &ODVV'HFRUDWHG*LQJHU%UHDG0HQ &ODVV&KRFRODWH%LVFXLW&DNH3LHFHV &ODVV&KRFRODWH0XIILQV

*OXWHQ)UHH6HFWLRQ 6SRQVRU2GOXPV &ODVV*OXWHQ)UHH6FRQHV &ODVV*OXWHQ)UHH%UHDG &ODVV*OXWHQ)UHH9LFWRULD6SRQJH &ODVV*OXWHQ)UHH3DVWD6DODG 1%0XVWXVH5RPDJOXWHQIUHHSDVWDDQGGLVSOD\WKHEDJZLWKWKHH[KLELW

3UHVHUYHV 8VHRQO\FHOORSKDQHbMDPFRYHUVZLWKEDQGQRFORWKVRUOLGV

6SRQVRU2GOXPV &ODVV6WUDZEHUU\-DP &ODVV*RRVHEHUU\-DP

106


&ODVV5DVSEHUU\-DP &ODVV%ODFNFXUUDQW-DP &ODVV5KXEDUE-DP &ODVV-HOO\-DP &ODVV-DPIURPDQ\VWRQHGIUXLW &ODVV-DPRIDQ\NLQGWKDWLVQRWFODVVHG &ODVV0DUPDODGH &ODVV)UXLW0DUPDODGH &ODVV/HPRQ&XUG &ODVV0LQFHPHDWOEMDU &ODVV-DURI&KXWQH\RI\RXUFKRLFH &ODVV-DU3LFNOHRI\RXUFKRLFH

6SHFLDOLW\&ODVVHV &ODVV%DFNWR6FKRRO/XQFK%R[ 7KLVVKRXOGLQFOXGHLWHPVRIWKHHQWUDQW VFKRLFHSUHVHQWHGLQDVFKRROOXQFKER[

6SRQVRUV 2GOXPV (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV<RJXUW/RDI 1%*OHQLVNFDUWRQWREHGLVSOD\HGZLWKH[KLELW

6SRQVRUV *OHQLVN<RJXUW (QWU\IHHRIрнА 3UL]HV VWрнАFDVK3UL]HQGрнАFDVKUGрнАFDVKWKрнАFDVKWK рнАFDVKWKрнАFDVK

107


&ODVV1RYHOW\&XSFDNHV 3UHVHQWDWLRQRI&XSFDNHV 'LVSOD\QRELJJHUWKDQ[+HLJKWLVQRWDQLVVXH

6SRQVRUV 9DQLOOD%HDQ%DNHU\'DLQJHDQ5RDG7XOODPRUH (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнА ZZZYDQLOODEHDQEDNHU\LH

&ODVV&HQWUD(YHU\GD\%DNLQJ&KDOOHQJH $SSOH7DUWDQG%URZQ%UHDG :UDSSHUIURP&HQWUD0DUJDULQHRU&HQWUD)ORXUPXVWEHGLVSOD\HG

6SRQVRUV %HQ6FDOO\ V&HQWUD$UGHQ5RDG7XOODPRUH (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнАWKрнА

&ODVV&KRFRODWH&RWWDJH&RQVWUXFWLRQ&KDOOHQJH %DUVRIDQ\FKRFRODWHHWFEHFUHDWLYHZKLOHXVLQJ\RXULPDJLQDWLRQb 'LVSOD\QRELJJHUWKDQ[

6SRQVRUV +H\3HVWR7XOODPRUH (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнА ZZZIDFHERRNFRP+H\3HVWR

&DNHV &ODVV&DUURW&DNH &ODVV3ODLQ6SRQJH PHGLXPHJJVMDPILOOLQJRQO\

&ODVV-DP6ZLVV5ROO &ODVV'HFRUDWHG&RIIHH9LFWRULD6SRQJH &DNHWLQ5RXQGRU6TXDUH

&ODVV%RLOHG)UXLW&DNH &ODVV/LJKW)UXLW&DNH &ODVV*LQJHU&DNH

108


&ODVV&KHUU\&DNH &ODVV+DUYHVW)UXLW/RDI &ODVV3RUWHU&DNH 5RXQG

&ODVV6HHG&DNH &ODVV&KRFRODWH0XIILQV &ODVV6KRUWEUHDG%LVFXLWV &ODVV+HDOWK\6QDFN%DUV &ODVV3UHVHQWDWLRQRI&DUDPHO6OLFHV &ODVV/HPRQ'HFRUDWHG&XSFDNHV &ODVV8QLFHG5LFK)UXLW&DNH 6SRQVRUV 2 'RQRKXH V%DNHU\ -HQQ\ V.LWFKHQ 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWKрнА ZZZIDFHERRNFRPSDJHV-HQQ\V.LWFKHQ ZZZRGRQRKXHVEDNHU\LH

&ODVV1RYHOW\6XJDUFUDIW&RPSHWLWLRQ 3UHVHQWDWLRQRQDEDVHQRELJJHUWKDQ[b6TXDUH

6SRQVRUV

.LW<RXU.LWFKHQ%ULGJH&HQWUH7XOODPRUH

(QWU\IHHRIрнА 3UL]HV VW9RXFKHUQG9RXFKHUUG9RXFKHU $OO9RXFKHUVFDQEHXVHGLQVWRUHRURQOLQHDWZZZNLW\RXUNLWFKHQFRP

'HVVHUWV 6SRQVRU2GOXPV &ODVV)UHVK&UHDP)UXLW*DWHDX[ &ODVV&KHHVHFDNH &RRNHG 3UL]HV VW/H&UHXVHW&DVVHUROH'LVKQG/H&UHXVHW3LH'LVKUG2GOXPV +DPSHU

&ODVV&KHHVHFDNH b8QFRRNHG 3UL]HV VW/H&UHXVHW&DVVHUROH'LVKQG/H&UHXVHW3LH'LVKUG2GOXPV +DPSHU

109


CRAFTS & NEEDLEWORK 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP 3UL]HVVWрнАQGрнАUGрнАWKрнАH[FHSW3DWFKZRUN 5XOHV &RQGLWLRQVIRU&UDIW 1HHGOHZRUN ([KLELWVSUHYLRXVO\DZDUGHGSUL]HVDW7XOODPRUH6KRZDUHQRWHOLJLEOH $OOHQWULHVPXVWEHWKHH[KLELWRU VRZQZRUNDQGEHUHFHQWO\FRPSOHWHG 1XPEHUVVKRXOGEHDWWDFKHGWRH[KLELWVZKHUHSRVVLEOH ([KLELWVPXVWEHUHFHLYHGLQWKH&UDIW0DUTXHHEHIRUHDPRQ6KRZ'D\6XQGD\WK $XJXVWDQGUHFODLPHGEHWZHHQSPDQGSP ([KLELWRUVPD\HQWHUXSWRDPD[LPXPRIHQWULHVLQWKLVVHFWLRQ 3UL]HPRQH\ZLOOQRWEHSDLGRQH[KLELWVUHPRYHGHDUO\RUQRWFROOHFWHG ([KLELWRUVDWWHQWLRQLVFDOOHGWRWKH*HQHUDO5XOHVDWWKHHQGRIWKH6FKHGXOH 7KHVHUXOHVDSSO\WRDOO&UDIW 1HHGOHZRUNFODVVHV 0$548((23(1$7$0216+2:0251,1*0$548((&/26('$0$0)25 -8'*,1*

(QWU\)HHрнАLQDOOFODVVHVH[FHSWZKHUHRWKHUZLVHVWDWHG /DWHHQWULHVрнАH[FHSW-XQLRUODWHHQWULHVDUHрнА 1R/DWHHQWULHVDFFHSWHGDIWHUDPRQ6KRZ0RUQLQJ &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\

-XQLRU&UDIWVXQGHU\HDUV 6SRQVRU7KH&RIIHH&OXE+DUERXU6WUHHW7XOODPRUH 3HUF\ 3KLO&OHQGHQQDQ%DU .LQQLWW\7XOODPRUH

&ODVV$Q\,WHPIURP/ROOLSRS6WLFNVRU0DWFKHV 1RWFORWKHVSHJV

&ODVV%HVW7R\'ROORU3XSSHW &ODVV%HVW,WHPLQ3OD\GRXJK)HPR&OD\RU3ODVWHU

110


CRAFTS & NEEDLEWORK &ODVV%HVW'HFRUDWHG:RRGHQ6SRRQ8QGHU &ODVV%HVW,WHPLQ3DSHUFUDIW &ODVV%HVW,WHPLQ1HHGOH&UDIW &ODVV%HVW'HFRUDWHG(JJ8QGHU &ODVV%HVW&ROOHFWLRQRI/HDYHV6L]H[ &ODVV%HVW3RVWHUPDGHRI&RPSXWHU 1RWJUHDWHUWKDQ$$XWXPQ6FHQH

&ODVV%HVW,WHPRI-HZHOOHU\

-XQLRU+DQGZULWLQJ 6SRQVRUV:2&'U\OLQLQJ7XOODPRUH

&ODVV-XQLRU+DQGZULWLQJWR\HDUV $Q\SLHFHRIWH[W

&ODVV-XQLRU+DQGZULWLQJWR\HDUV $Q\SLHFHRIWH[W

DATE FOR THE DIARY Networking Event for Livestock Industry The Show is hosting a Networking Opportunity in a relaxed atmosphere, for all involved in the Livestock industry, on Saturday the 9th August the evening before Show day. It will be held on the showground's of the Butterfield Estate, Blueball, Tullamore. Forum Theme - The Future Programme to Include: Key Speakers, followed by Questions and Answers from the floor.

111


3DWFKZRUN &ODVV3DWFKZRUN4XLOW 6SRQVRUV %URWKHU,QWHUQDWLRQDO (QWU\IHHRIà­&#x20AC; 3UL]HV VW%URWKHU6HZLQJ0DFKLQHQGà­&#x20AC;FDVKUGà­&#x20AC;FDVKWKà­&#x20AC; FDVK 3DWFKZRUNDORQHRUSDWFKZRUNZLWKDSSOLTX«LVHOLJLEOH &RQVLGHUDWLRQZLOOEHJLYHQWRWKHLPDJLQDWLYHXVHRIFRORXUDQGGHVLJQ 6L]HWRILWDVLQJOHRUGRXEOHEHG 4XLOWVZLWKDVOHHYHZLOOEHKXQJ ([KLELWRUVZKRKDYHZRQVW3UL]HLQWKLVFODVVWZLFHDUHH[FOXGHGIURPHQWHULQJLQ  7KHMXGJHà«&#x201A;VGHFLVLRQDWWKHFRPSHWLWLRQLVILQDO ([KLELWVDUHGLVSOD\HGDWWKHRZQHUà«&#x201A;VULVN 7KHVHUXOHVVKRXOGEHUHDGLQFRQMXQFWLRQVZLWKWKH,ULVK6KRZV$VVRFLDWLRQ5XOHVDQG WKH5XOHVDQG5HJXODWLRQVDWWKHHQGRIWKH6FKHGXOH

&ODVV6PDOO,WHPLQ3DWFKZRUN 6SRQVRUV %URWKHU,QWHUQDWLRQDO 3UL]HV VWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;

*HQHUDO&UDIWV 6SRQVRUV:DOVK.HHOH\ &R$FFRXQWDQWV7XOODPRUH *HU&RXJKODQ)DUP6XSSOLHV .LQQLWW\

&ODVV0RVW$WWUDFWLYH3LQ&XVKLRQ &ODVV%HVW&ROODJH,WHP &ODVV$Q\6RXYHQLU,WHP &ODVV%HVW,WHPIURP5HF\FOHG0DWHULDOV &ODVV$Q\+DQGFUDIW,WHP &ODVV%HVW'HFRUDWHG:RRGHQ6SRRQ$GXOW &ODVV%HVW6HDVRQDO,WHP &ODVV%HVW'HFRUDWHG(JJKDUGERLOHG$GXOWV &ODVV%HVW,WHPLQ0DFUDPH

112


.QLWWLQJ &URFKHW 6SRQVRUV,)$&

&ODVV%HVW*DUPHQWLQ$UDQ.QLWWLQJ &ODVV$Q\,WHPLQ%DE\ZHDU &ODVV$Q\&KLOG V*DUPHQWLQ)LQH:RRO &ODVV$Q\*DUPHQWLQ.QLWWHG&RWWRQ &ODVV%HVW6RIW7R\.QLWWHGRU&URFKHW&RWWRQ :RRO)DEULF &ODVV$Q\&URFKHWHGLWHPLQ:RRORU&RWWRQ &ODVV0RVW$WWUDFWLYH7HD&RV\$Q\0HGLXP &ODVV$Q\,WHP.QLWWHGRU&URFKHW6KDZO

1HHGOHZRUN 6HZLQJ 2OOLH 0DUWLQD0F/RXJKOLQWD0LGODQG+\JLHQH

&ODVV%HVW'UHVVHG'ROO &ODVV%HVW,WHPLQ&URVV6WLWFK &ODVV%HVW,WHPLQ:RRO&RWWRQ7DSHVWU\RQ&DQYDV &ODVV$Q\,WHPLQ&RORXUHG(PEURLGHU\ &ODVV$Q\,WHPLQ'HFRXSDJH &ODVV0RVW$WWUDFWLYH&XVKLRQ&RYHURU&XVKLRQ &ODVV%HVW,WHPLQ1HHGOHZRUNXQFODVVLILHG &ODVV7KULIWFODVVVRPHWKLQJQHZIURPVRPHWKLQJROG &ODVV.QLWWHG6FDUI %DJ &ODVV$Q\,WHPLQ+DLU3LHFHVRU)DVFLQDWRUV &ODVV.QLWWHG6RFNV0LWWHQV &ODVV%HVW,WHPLQ7UDSXQWR

113


ART & PHOTOGRAPHY 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP 5XOHV &RQGLWLRQVIRU$UW SKRWRJUDSK\ $OOHQWULHVPXVWEHH[KLELWRUV RZQZRUNDQGUHFHQWO\FRPSOHWHG 1DPH$GGUHVVDQG&ODVV1XPEHUPXVWEHVKRZQFOHDUO\RQWKHEDFNRIHDFKSLHFH (QWULHVPXVWEHIUDPHGRUPRXQWHGZLWKKRRNDQGVWULQJSURYLGHGIRUKDQJLQJ (QWULHVWKDWDUHQRWIUDPHGRUPRXQWHGRUZLWKRXWDVXLWDEOHPHDQVRIKDQJLQJZLOORQO\ EHDFFHSWHGDWWKHGLVFUHWLRQRIWKH&KLHI6WHZDUGRIWKH$UW 3KRWRJUDSK\6HFWLRQ (QWULHVPXVWEHEURXJKWWRWKH$UW3KRWRJUDSK\6HFWLRQEHIRUHDPRQ6KRZ'D\ (QWULHVZLOOEHDFFHSWHGRQ6KRZ0RUQLQJXSWRDPEXWDQH[WUDрнАZLOOEHDGGHGWRWKH HQWU\IHH 1RDGPLVVLRQFUHGLWVDOORZHG

$OOFODVVHVDUHRSHQ ([KLELWVPXVWQRWH[FHHGPP[PP ([KLELWVZKLFKPD\RIIHQGPD\QRWEHGLVSOD\HG (QWULHVPXVWEHFROOHFWHGEHWZHHQSPDQGSPRQWKHGD\RIWKH6KRZ 3UL]HPRQH\ZLOOQRWEHSDLGRQH[KLELWVQRWFROOHFWHG 0$548((23(1$7$0216+2:0251,1*0$548((&/26('$0$0)25 -8'*,1* &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\

No Late entries accepted after 9.30am on Show Morning

$UW

-81,25$57 6SRQVRU0F'RQDOG5HVWDXUDQW.\OH&HQWUH7XOODPRUH ,QGLYLGXDOHQWULHVRQO\:RUNPD\EHH[HFXWHGLQDQ\PHGLXP (QWU\)HHрнА 3UL]HVVWрнАQGрнАUGрнА

&ODVV7KHPH0\)DPLO\ 8QGHU\HDUV

114


&ODVV7KHPH'RZQRQWKH)DUP WR\HDUV

&ODVV7KHPH3RUWUDLW +XPDQDQGRU$QLPDOV

WR\HDUV

6(1,25$57 6SRQVRU+DUERXU%DU :RUNPD\EHH[HFXWHGLQDQ\PHGLXP (QWU\)HHà­&#x20AC; 3UL]HVVWà­&#x20AC;QGà­&#x20AC;UGà­&#x20AC;

&ODVV7KHPH/DQGVFDSH &ODVV7KHPH6WLOO/LIH &ODVV7KHPH3RUWUDLW +XPDQDQGRUDQLPDO

&ODVV7KHPH$EVWUDFW &ODVV4XDOLIHU)RUWKH)OHHWZRRG3DLQWV$OO,UHODQG$PDWHXU 3DLQWLQJ&KDPSLRQVKLS (QWU\IHHRIà­&#x20AC; 6HH5XOHV 5HJXODWLRQV6HFWLRQ

Admission to Show Exhibitors allowed Credits (see below) against entry fees and everyone to pay at the gate. No free passes will be issued but their value may be credited against entry fees, at the time of making entries and before the closing date of 18th July. THE FOLLOWING DEDUCTIONS MAY BE MADE: Entries valued â&#x201A;¬20 â&#x20AC;&#x201C; Entries valued â&#x201A;¬40 â&#x20AC;&#x201C; Entries valued â&#x201A;¬60 and over â&#x20AC;&#x201C;

Deduct â&#x201A;¬15 from entry fees (Cost of admission for 1) Deduct â&#x201A;¬30 from entry fees (Cost of admission for 2) Deduct â&#x201A;¬45 from entry fees (Cost of admission for 3)

115


3KRWRJUDSK\

-81,253+272*5$3+< 6SRQVRU2IIDO\9(& ,QGLYLGXDOHQWULHVRQO\(QWULHVLQ%ODFN :KLWHRU&RORXU (QWU\)HHрнА 3UL]HVVWрнАQGрнАUGрнА

&ODVV7KHPH)URPD&RXQWU\*DUGHQ WR\HDUV

&ODVV7KHPH3RUWUDLW +XPDQ$QLPDO%LUG

WR\HDUV

&ODVV7KHPH)URPWKH0RXQWDLQWRWKH6HD WR\HDUV

6(1,253+272*5$3+< 6SRQVRUV1RHO5HFUXLWPHQW1HZEULGJH&R.LOGDUH (QWULHVLQ%ODFN :KLWHRU&RORXU 3UL]HVVWрнАQGрнАUGрнА (QWU\)HHрнА

&ODVV7KHPH)DUPLQJ7KURXJKWKH<HDUV 3UL]HV VWрнАQGрнАUGрнА

&ODVV7KHPH/DQGVFDSH3KRWRJUDSK\ 3UL]HV VWрнАQGрнАUGрнА

&ODVV7KHPH3RUWUDLW3KRWRJUDSK\ 3UL]HV VWрнАQGрнАUGрнА

&ODVV7KHPH0DFUR3KRWRJUDSK\ 3UL]HV VWрнАQGрнАUGрнА

116


NATIONAL INVENTIONS COMPETITION 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP 6SRQVRUV7KH)DUPLQJ,QGHSHQGHQW :56KDZ5RVHQDOOLV&R/DRLV *OHQQJRUH\ 3XPSV/LPLWHG1HZEULGJH&R.LOGDUH (QWU\)HHрнА 1%,QYHQWLRQVDQGPRGLILFDWLRQVWRH[LVWLQJLQYHQWLRQVDUHHOLJLEOHDQGZHOFRPHWRHQWHU $OOH[KLELWVZLOOEHMXGJHGRQWKHVKRZJURXQGRQ6DWXUGD\WK$XJXVWIURPDP &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\

&ODVV,QYHQWLRQV,Q$JULFXOWXUH+RUWLFXOWXUH )RUHVWU\ 3UL]HV VWрнАQGрнАUGрнА

&ODVV%HVW6WXGHQW([KLELWLQ&ODVV 1RSUHHQWU\ 3UL]HV VWрнА

&ODVV,QYHQWLRQVLQ+RPH/HLVXUH %XLOGLQJ 3UL]HV VWрнАQGрнАUGрнА

&ODVV%HVW6WXGHQW([KLELWLQ&ODVV 1RSUHHQWU\ 3UL]HV VWрнА

&ODVV/DERXU6DYLQJ'HYLFHV 3UL]HV VWрнАQGрнАUGрнА

&ODVV%HVW6WXGHQW([KLELWLQ&ODVV 1RSUHHQWU\ 3UL]HV VWрнА

117


POULTRY 2QOLQHHQWULHVDYDLODEOHRQZZZWXOODPRUHVKRZFRP 3OHDVHQRWHWKDWDOOELUGVPXVWFRPHIURP5HJLVWHUHG3RXOWU\3UHPLVHV)ORFNQRWREHJLYHQRQ HQWU\IRUP6HHQRWHDWWKHEDFNRIVFKHGXOH &DJHVZLOOEHSURYLGHGIRUELUGVZKLFKPXVWEHFDJHGEHIRUHDPZKHQMXGJLQJ FRPPHQFHV %LUGVFDQQRWEHUHPRYHGEHIRUHSP 0DUTXHHRSHQVDWDP 6SRQVRUV6XSHUYDOX3RUWDUOLQJWRQ 6SRQVRUV&RQQROO\5HGPLOOV*RUHVEULGJH&R.LONHQQ\ 3UL]HVVWрнАQGрнАUGрнАWKрнА &ORVLQJGDWHIRUDOOKDUGFRS\HQWULHVLV)ULGD\WK-XO\ &ORVLQJGDWHIRUDOORQOLQHHQWULHVLV)ULGD\WK-XO\ 1R(QWULHVDFFHSWHGRQ6KRZ'D\

3RXOWU\ %UHHG&ODVVLILFDWLRQ

6HFWLRQ%DQWDP+DUG)HDWKHU$VLO,QGLDQ*DPH-XELOHH,QGLDQ*DPH.R6KDPR0DOD\ 0RGHUQ*DPH2OG(QJOLVK*DPH2OG(QJOLVK*DPH &DUOLVOH 5XPSOHVV*DPH6KDPR 6HFWLRQ%DQWDPV+HDY\6RIW)HDWKHU$XVWUDORUS%DUQYHOGHU%UDKPD&URDG/DQJVKDQ 'RUNLQJ)DYHUROOHV)UL]]OH0DUDQ1HZ+DPSVKLUH5HG2UORII2USLQJWRQ3O\PRXWK5RFN5KRGH ,VODQG5HG6XVVH[6XOPWDOHU7UDQVDOYDQLDQ1DNHG1HFN:\DQGRWWH 6HFWLRQ%DQWDPV/LJK6RIW)HDWKHU$QFRQD$QGDOXVLDQ$UDXFDQD$UDXFDQD5XPSOHVV )ULHVLDQ+DPEXUJK+RXGDQ.UDLHQNRSSH/HJKRUQ0LQRUFD3RODQG6FRWV'XPS\6FRWV*UH\ 6LONLH6SDQLVK6XPDWUD*DPH9RUZHUN:HOVXPHU<RNRKDPD 6HFWLRQ7UXH%DQWDP%HOJLDQ%HDUGHG%DUEXG $QYUV%DUEXG 8FFOH%DUEXG (YHUEHUJ%DUEX G :DWHUPDOH%DUEXG *UXEEH%RRWHG%DQWDP-DSDQHVH1DQNLQ2OG'XWFK3HNLQ5RVHFRPE 6HEULJKW7X]R 6HFWLRQ/DUJH)RZO+DUG)HDWKHU-XELOHH,QGLDQ,QGLDQ*DPH$VLO6KDPR 6HFWLRQ/DUJH)RZO+HDY\6RIW)HDWKHUHG$XVWUDORUS%DUQYHOGHU%UDKPD&RFKLQ &UHYH&RHXU&URDG/DQJVKDQ'RUNLQJ)DYHUROOHV)UL]]OH,[ZRUWK-HUVH\*LDQW/D)OHFKH0DUDQ 0RGHUQ/DQJVKDQ1HZ+DPSVKLUH5HG1RUIRON*UH\1RUWK+ROODQG%OXH2UORII2USLQJWRQ 3O\PRXWK5RFN5KRGH,VODQG5HG6XOPWDOHU6XVVH[7UDQV\OYDQLDQ1DNHG1HFN:\DQGRWWH 6HFWLRQ/DUJH)RZO/LJKW6RIW)HDWKHU$QFRQD$QGDOXVLDQ$SSHQ]HOOHU6SLW]KDXEHQ$UDXFDQD $UDXFDQD5XPSOHVV$XJVEXUJHU%UHGD%UHVVH&DPSLQH+DPEXUJK+RXGDQ.UDLHQNRSSH /DNHQYHOGHU/HJKRUQ0DUVK'DLV\0LQRUFD2OG(QJOLVK3KHDVDQW)RZO3RODQG5HGFDS 'HUE\VKLUH 6FRWV'XPS\6FRWV*UH\6LFLOLDQ%XWWHUFXS6LONLH6SDQLVK6XOWDQ6XPDWUD*DPH 9RUZHUN:HOVXPPHU<RNRKDPD

118


6HFWLRQ:DWHUIRZO$\OHVEXU\%DOL%OXH6ZHGLVK&DPSEHOO&D\XJD&UHVWHG+RRN%LOO,QGLDQ 5XQQHU0DJSLH0XVFRY\2USLQJWRQ3HNLQ5RXHQ5RXHQ&ODLU6D[RQ\6LOYHU$SSOH\DUG:HOVK +DUOHTXLQ 6HFWLRQ%DQWDP:DWHUIRZO%ODFN(DVW,QGLDQ&DOO&UHVWHG0LQLDWXUH$SSOH\DUG 6LOYHU 

3RXOWU\ 6SRQVRUV6XSHUYDOX3RUWDUOLQJWRQ 6SRQVRUV&RQQROO\b5HGPLOOV*RUHVEULGJH&R.LONHQQ\

&ODVV%DQWDP+DUG)HDWKHU0DOH &ODVV%DQWDP+DUG)HDWKHU)HPDOH &ODVV%DQWDP+HDY\6RIW)HDWKHU0DOH &ODVV%DQWDP+HDY\6RIW)HDWKHU)HPDOH &ODVV%DQWDP/LJKW6RIW)HDWKHU0DOH &ODVV%DQWDP/LJKW6RIW)HDWKHU)HPDOH &ODVV7UXH%DQWDP0DOH &ODVV7UXH%DQWDP)HPDOH &ODVV/DUJH)RZO+DUG)HDWKHU0DOH )HPDOH &ODVV/DUJH)RZO+HDY\6RIW)HDWKHU0DOH &ODVV/DUJH)RZO+HDY\6RIW)HDWKHU)HPDOH &ODVV/DUJH)RZO/LJKW6RIW)HDWKHU0DOH &ODVV/DUJH)RZO/LJKW6RIW)HDWKHU)HPDOH &ODVV%HVW/DUJH'UDNH &ODVV%HVW/DUJH'XFN &ODVV%HVW%DQWDP'UDNH &ODVV%HVW%DQWDP'XFN &ODVV%HVW*DQGHU%HVW*RRVH

119


&ODVV%HVW6WDJ7XUNH\%HVW+HQ7XUNH\ &ODVV%DQWDP0DOH([KLELWHGE\SHUVRQXQGHU &ODVV%DQWDP)HPDOH([KLELWHGE\SHUVRQXQGHU &ODVV/DUJH)RZO0DOH([KLELWHGE\SHUVRQXQGHU &ODVV/DUJH)RZO)HPDOH([KLELWHGE\SHUVRQXQGHU &ODVV:DWHUIRZO0DOHRU)HPDOH([KLELWHG%\SHUVRQXQGHU &ODVV&KDPSLRQ%DQWDP 5HVHUYH 1RSUHHQWU\

&ODVV&KDPSLRQ/DUJH)RZO 5HVHUYH 1RSUHHQWU\

&ODVV&KDPSLRQ%DQWDP'XFN 5HVHUYH 1RSUHHQWU\

&ODVV&KDPSLRQ/DUJH'XFN 5HVHUYH 1RSUHHQWU\

&ODVV&KDPSLRQ*RRVH 5HVHUYH 1RSUHHQWU\

&ODVV&KDPSLRQ7XUNH\ 5HVHUYH 1RSUHHQWU\

&ODVV6XSUHPH&KDPSLRQ 5HVHUYH 1RSUHHQWU\ 3UL]HV VWрнАQGрнА

&ODVV7KH5HGPLOOV$OO,UHODQG3RXOWU\&KDPSLRQVKLS&RQQROO\ 5HGPLOOV*RUHVEULGJH&R.LOONHQQ\ 'LUHFW(QWU\

6SRQVRUV &RQQROO\5HGPLOOV*RUHVEULGJH&R.LONHQQ\ (QWU\IHHRIрнА 3UL]HV VWрнАQGрнАUGрнАWKрнАWKрнАWKрнАWKрнА 6HH5XOHV 5HJXODWLRQV6HFWLRQ

120


(JJV 6SRQVRUV6XSHUYDOX3RUWDUOLQJWRQ b&RQQROO\5HGPLOOV*RUHVEULGJH&R.LONHQQ\ 3UL]HVbVWŕ­&#x20AC;QGŕ­&#x20AC;UGŕ­&#x20AC;WKŕ­&#x20AC; (QWU\)HHŕ­&#x20AC;b

&ODVV+HQ(JJV%URZQ&RORXU &ODVV+HQ(JJV:KLWH&RORXU &ODVV%DQWDP(JJV%URZQ&RORXU &ODVV%DQWDP(JJV:KLWH&RORXU &ODVV'XFN(JJV

Safety at Shows We all want to have a successful, enjoyable show but also a safe and accident-free occasion. To ensure this, the co-operation of all is vital, including exhibitors, spectators and organisers. A few guidelines to note in relation to safety are as follows: - Please observe signs - especially those relating to caution in livestock areas. - Please do not exhibit animals that are unsuitable with regard to safety e.g. hard to control. - All animals must be led by a competent handler. - Animals should not be tied to trailers. - Dogs should be on a lead and under the control of the handler. - Caution and care should be exercised at all times.

So, come early and have a safe and enjoyable visit to the Tullamore Show on August 10th 2014

121


RULES & REGULATIONS RULES & REGULATIONS FOR QUALIFIERS ALL IRELANDS Class 177 Qualifier for the ABP/Aldi Prize Bonanza All Ireland Irish Angus Bull Calf Championship born 01.09.13 to 31.12.13 at Iverk Show on 23.08.2014 Rules and Conditions 1. Breeder/exhibitor must be a member of the Irish Angus Cattle Society. 2. Calf must be registered in the herd book of the Irish Angus Cattle Society in order to participate in a qualifier. 4. Breeder/exhibitor may only qualify two animals for the final and only one handler may accompany each one into the ring for the final at the Iverk Show. 5. A minimum of 3 calves must be entered and be present in the ring at a qualifier or the class will be deemed void. 6. Entry fee for the Qualifiers: 20 7. Entry Fee for the Final: 15 8. Judgeâ&#x20AC;&#x2122;s Decision is final. Prizes for Qualifying Show: Winner- 200, Runner Up- 100. Prize Fund for Grand Final: 1st-2000; 2nd-1000; 3rd-500; 4th- 250; 5th-150; 6th- 150; 7th - 100; 8th - 100 Note: The Prize money for the qualifying show will be payable on presentation of the calf at Iverk. Class 178 Qualifier for the ABP/Aldi Prize Bonanza All Ireland Irish Angus Bull Calf Championship born 01.01.14 to 30.04.14 at Iverk Show on 23.08.2014 Rules and Conditions 1. Breeder/exhibitor must be a member of the Irish Angus Cattle Society. 2. Calf must be registered in the herd book of the Irish Angus Cattle Society in order to participate in a qualifier. 4. Breeder/exhibitor may only qualify two animals for the final and only one handler may accompany each one into the ring for the final at the Iverk Show. 5. A minimum of 3 calves must be entered and be present in the ring at a qualifier or the class will be deemed void. 6. Entry fee for the Qualifiers: 20 7. Entry Fee for the Final: 15 8. Judgeâ&#x20AC;&#x2122;s Decision is final. Prizes for Qualifying Show: Winner- 200, Runner Up- 100. Prize Fund for Grand Final: 1st-2000; 2nd-1000; 3rd-500; 4th- 250; 5th-150; 6th- 150; 7th - 100; 8th - 100 Note: The Prize money for the qualifying show will be payable on presentation of the calf at Iverk.

122


Class 242 Nutrias Animal Feed All Ireland Beef Bullock Championship Sponsored by: Aurivo Ballaghaderreen Co. Roscommon Rules and Conditions 1. Qualifying animals to have no more than 4 permanent teeth on the day of final. 2. One Steer may qualify from each selected show; if the standard is insufficient no steer may be chosen. 3. All animals must be led by a competent adult 4. These rules should be read in conjunction with the Irish Shows Association Rules Entry Fee: To Qualifying Show: 7. To Final: 12 Prizes: 1st 1000; 2nd 600; 3rd 400; 4th 200; 5th 100; 6th to the end of line 50. Final: Strokestown Show Saturday 13th September 2014 at 3pm approx.

Class 244 The Greenvale Animal Feeds All Ireland Beef Heifer Championship Sponsored by: Greenvale Animal Feeds Rules and Conditions 1. Qualifying Animals to have no more than 2 permanent teeth on the day of Final. 2. One Heifer may qualify from each selected show; if the standard is insufficient no heifer may be chosen. 3. All animals must be led by a competent adult. 4. All animals must be certified not in Calf at the Final. 5. These rule should be read in conjunction with the Irish Shows Association Rules. Entry Fee: To Qualifying Show: 7 To Final: 12 Prizes: 1st 800; 2nd 400; 3rd 250; 4th 125; 5th to end of line 50. Final: Strokestown Show Saturday 13th September 2014 at 2pm approx. Class 383 The A. Browne Filly Foal All Ireland Championship Part of the Horse Sport Ireland National Showing Championship series. Sponsored by: A. Browne Limited Prize Fund: 2,500 Rules and Conditions 1. Entries are confined to Foals eligible to be registered if not already registered in the I.H.R with the breed codes ISH, or ID; 2. Foals must be Sired by a Stallion that is classified in the Irish Sport Horse Stud Book as either: Approved/Preliminary Approved/Supplementary Approved/Recognised/Preliminary Recognised /Not Approved 1 (NA1) or a Stallion that is classified in the Irish Draught Stud Book as either Class 1/Class 2/RID (GB)/ RID (Can)/ Grade 2 (GB) 3. The class is also open to Weatherby's registered animals, progeny of Weatherby's Thoroughbred Stallions that are not classified in the I.H.R. as Not Approved 2 (NA2)

123


g pp ( ) 4. One foal from selected shows may qualify, provided the judges and the I.S.A. agree the standard is high enough. 5. Foals must be led at all times. 6. Exhibitors to both the qualifier and the final must have the mare's passport ready for inspection prior to entry to the judging ring 'if the Foal's passport is not to hand'. Failure to comply with this rule will lead to immediate disqualification. 7. Passport & (Micorchips if applicable) should be read by a Vet at the Final. 8. Foals qualified for Final are not eligible to enter any other class at the show in which the final is held other than qualifying classes for other Finals. 9. Those rules should be read in conjunction with the Irish Shows Association Rules. Entry Fee: To Qualifying Show 10 to Final 20 Prizes: Champion: 1000; 2nd 500; 3rd 400; 4th 250; 5th 200; 6th 150; 7th-to end Horse Sport Ireland will provide premiums of 50 each. Final: Moate Show Saturday 23rd August 2014

Class 385 All Ireland Breeders Championship The aim of the class is to give recognition to Breeders who breed suitable mares to produce top quality foals with performance potential. Rules & Conditions. 1.Entries are confined to Mares, 8 years old and under registered in the Irish Horse Register with the breed codes ISH,RID or ID; and MUST have sire and dam recorded on their passport; 2.Mares must be sired by a stallion that is classified in the Irish Sport Horse Stud Book as either: Approved /Preliminary Approved/Supplementary Approved/Recognised/Preliminary Recognised Not Approvecd (NA1) or a Stallion that is classified in the Irish Draught Horse Studbook as CLASS 1/ CLASS 2/RID (GB) / RID (CAN) / Grade 2 (GB) 3.

4.

5. 4.

6. 7. 8. 9.

The class is also open to Weatherby’s registered animals, progeny of Weatherby’s Thoroughbred Stallions that are not classified in the Irish Horse Register as NOT APPROVED 2 (NA 2) All mares must have a foal at foot by a stallion that is classified in the Irish Sport Horse Stud Book as either: Approved /Preliminary Approved/Supplementary Approved/Recognised/Preliminary Recognised Not Approvecd (NA1) or a Stallion that is classified in the Irish Draught Horse Studbook as CLASS 1/ CLASS 2/RID (GB) / RID (CAN) / Grade 2 (GB) The class is also open to Weatherby’s registered animals, progeny of Weatherby’s Thoroughbred Stallions that are not classified in the Irish Horse Register as NOT APPROVED 2 (NA 2) Each Mare & Foal will be judged as a Unit (Mare 40% Foal 60%) The Mare’s passport will be inspected before judging commences at both the qualifiers and the Final & the Foal’s I.D. Cert at the Final. Exhibitors failing to produce a Passport will be debarred from competing. Two Mares & Foals may qualify if the judges and the I.S.A. agree that the standard is high enough. All Foals must be led at both the qualifiers and the Final. Mares & Foals qualified for Final are not eligible to enter any other Classes at the Show other than a qualifying Class for other Finals. These Rules should be read in conjunction with the Irish Shows Association Rules.

124


Entry fee: To Qualifying Show 10. To Final: 20. Prizes: Champion 500 and “Pegus” Perpetual Cup and Sash. Reserve Champion 300. 3rd 200,4th 100,5th 60.All other competitors who attend 40. A Prize will be presented for Combination of Best Turned out Mare & Foal And Most Suitably Dressed Handler. Final: West Cork Horse Breeders Show, Sunday August 31st 2014 at 2.00 p.m. Class 388 The Irish Draught 2 Year Old Filly Championship Part of the Horse Sport Ireland National Showing Championship series Rules and Conditions 1.Entries are confined to: Two Year Old Fillies registered in the Irish Horse Register with the breed codes I.D.; Fillies must be sired by a stallion that is classified as Class 1/ Class 2/RID (GB)/RID (Can)/ Grade 2 (GB). Fillies must have both sire and dam on their passport. 2. Exhibitors to both the qualifier and the Final must have their animal’s passport available for inspection prior to entry to Judging Ring. Failure to comply with this rule will lead to immediate disqualification. 3. Passports & Microchips should be read by a Vet at the final. 4. Two Animals in each qualifying class may be selected to compete in the final provided the judges and the I.S.A. agree the standard is high enough. 5. One of the judges at the qualifying show must be a qualified Irish Draught Horse Judge. 6. Animals qualified for Final are not eligible to enter any other class at the show in which the final is held These rules should be read in conjunction with the General I.S.A. Rules. Entry fee to qualifying show 10 To Final 20 Prizes: 1st 500; 2nd 300; 3rd 250; 4th 200; 5th 150; 6th 100; from 7th to end 50. See www.limerickshow.com for further information Final: Limerick Show Sunday 23rd August 2014

Class 547/548 The Gain Dog Food All Ireland Championship Sponsored by: Gain Foods Prize Fund: 500. Rules and Conditions 1. Toy or miniature dog any breed to be handled by a child under 15 yrs. 2. Large dog any breed to be handled by teenager or adult. 3. One dog from each class to qualify. 4. Dogs in final not eligible to compete in other classes at Clonaslee show. 5. These rules should be read in conjunction with the Irish Shows Association Rules Entry Fee: To qualifying Show 3. To Final 6 Prizes: 1st 100 2nd 50 3rd 30 4th 20 (in each class) A Trophy will be presented to the overall Champion Dog Gain Dog Food Product will be presented to each finalist. Final: Clonaslee Show - Sunday 7th September 2014

125


Class 549 The All Ireland Gun Dog Championship Sponsored by: Tireragh Gun Club, Cecil Whiteside & Beltra Show Society Prize Fund: 400 Rules and Conditions 1. Gun dog, any variety—dog / bitch. 2. Dog must be handled by person over 16. 3. Dogs in final not eligible to compete in other classes at Beltra Show. 4. These rules should be read in conjunction with the Irish Shows Association Rules Entry Fee: To Qualifying Show 3. To Final 6 Prizes: 1st: 150; 2nd: 100; 3rd:75; 4th 50; 5th 25; Perpetual Cup to 1st Prize winner. Final: Beltra Show Saturday 6th September 2014 Class 857 The Fleetwood Paints All Ireland Amateur Painting Competition Sponsored by: Fleetwood Irelands Paint Company Rules & Conditions 1. Paintings must be the sole work of the exhibitor who must have amateur status. 2. Paintings to depict an Agricultural or Rural setting. 3. Paintings must measure no more than 26”X 20” not including the frame. 4. All Paintings must be ready to hang, that is framed and with a hanging cord attached. 5. The Judges decision will be final 6. All entries to be exhibited at owners risk 7. All entries to have amateur status as defined by the following. a. Not to have had a commercial solo exhibition b. Not to have exhibited in a commercial gallery. c. Not to be teaching or have taught art in any form. 8. These rules should be read in conjunction with the I.S.A Rules Entry Fee: To qualifying Show 3. To Final 6 Prizes: 1st: 300, 2nd: 200, 3rd: 100, 4th: 50. FINAL VIRGINIA SHOW – Wednesday 20th August 2014 Class 722 Chocolate Cook of the Year Sponsored by: J & M Digan LTD. Londis Athlone Road Moate Rules and Conditions 1. Each exhibitor will bake/make 3 items. (a) Decorate Chocolate Victoria Sandwich Cake (b) 6 Chocolate Butterfly Cakes (c)6 Chocolate Chip Oatie Biscuits 2. The items to be displayed as one exhibit on a base of 2ft X 2ft approx.

126


3. Points will be awarded for texture, taste and presentation suitable for Afternoon Tea. 4. Competition is open to amateurs male or female and one tray to qualify per exhibitor. 5. All items to be home made by the exhibitor. 6. A special qualifying class will be held at selected shows. Two trays may qualify for the Final if the Judges agree the standard is high enough. 7. Judges decision will be final at all stages of the competition. 8. Exhibits are displayed at ownerâ&#x20AC;&#x2122;s risk. 9. These rules should be read in conjunction with the Irish Shows Association Rules Entry Fee: To qualifying Show 3. To Final 6 Prizes: 1st 300 2nd: 200. 3rd: 100. 4th: 60. 5th: 50. 6th: 40. Each of the successful qualifiers will receive a memento on appearance at the Final. Final: Moate Show â&#x20AC;&#x201C; Saturday 23rd August 2014 Class 603 The Bridge House Hotel Collection of Vegetables All Ireland Sponsored by: The Bridge House Hotel, Tullamore, Co. Offaly. Direct Entry to Tullamore Show Rules and Conditions 1. The vegetables exhibited should be home grown, by the exhibitor. 2. The collection may contain five (5) kinds of vegetables, three (3) of each kind, apart from beans, peas and potatoes which should have five (5) of each. 3. Cut greenery from the garden, including parsley may be used and will be classified as decoration. The space required is at the discretion of the exhibitor. 4. Points will be awarded for uniformity of size, quality, freshness and artistic appearance of exhibit. 5. Exhibits must be in place by 10.00am on Show Day, Sunday 10th August. 2014 6. Marquee open from 7.00am on show morning and will be closed for judging at 10am sharp. Marquee will open to the public at 12 noon. 7. Exhibits cannot be removed before 5.00 pm. 8. 1st prize winners from 2012 & 2013 are not eligible to enter this year. 9. No Late entries accepted after 9.30 on Show Morning. Entry Fee: 6 Prizes: 1st 150 plus Bridge House Trophy: 2nd 125; 3rd 100: 4th 50: 5th 30; 6th 25. Direct postal entry to Secretary, Tullamore Show, Church St. Tullamore by the 11th July 2014. Online Entries through. www.tullamoreshow.com by the 18th July 2014. Final: Tullamore Show & AIB National Livestock Show on Sunday 10th August 2014 Class 620 The Bord Bia All Ireland Quality Potato Championship Sponsored By: Bord Bia Rules and Conditions 1. In this competition the produce must be the property of and be grown by the exhibitor 2. Each exhibit is to consist of the following: A dish of 6 potatoes of any variety. The variety to be correctly named. Each tuber should be free from skin blemishes, be true to type, and weigh approximately 6 ozs. (170g). 3. Two exhibits to qualify at each show.

127


4. This being a quality championship, the adjudicators will favour floury, high dry matter varieties, which are popular with the Irish customer. 5. These rules should be read in conjunction with the Irish Shows Association Rules. 6. Marquee open from 7.00am on show morning and will be closed for judging at 10am sharp. Marquee will open to the public at 12 noon. 7. Exhibits cannot be removed before 5.00 pm. Criteria for judging potatoes available from the Secretary, Tullamore Show. Tel; 057 93 52141. Entry Fee: To Qualifying Show 3. To Final 6 Prizes; 1st 250 & Bord Bia Perpetual Trophy & Replica. 2nd 150; 3rd 100; 4th 75; 5th 50; 6th 25. All qualifiers will receive a special Bord Bia Plaque.

Final: Tullamore Show & AIB National Livestock Show Sunday 10th August 2014. Class 700 The Odlums All Ireland Home Baking Championship Sponsored by: Odlums Rules & Conditions: 1. Each competitor will bake the following items using Odlums products: a. Decorated Chocolate Cake (Loaf, Round or Square tin) b. 3 Egg sponge sandwich with butter icing and jam (7” or 18cm) c. Bakewell Tart N.B. All recipes can be found on the Odlum's website. Own recipes may also be used. 2. Items to be displayed on individual plates and each exhibitor will be allotted their own space (trays optional) on a base 24” Square 3. Points will be awarded for taste, texture, appearance and presentation of baked items 4. The competition is confined to amateurs, both male and female, with one entry per exhibitor at the final. 5. The items must be fresh and home baked by exhibitor 6. A special class will be held at each qualifying show. Two entries may qualify from these shows for the final, if judges agree that the standard is high enough. The Qualifiers from each of these shows will go forward to the final, to be held at the Tullamore Show, on Sunday August 11th. 7. All items will be cut and/or sampled at the final. 8. Each of the successful qualifiers will receive a hamper containing Odlums products, on appearance at the final 9. Certificates will be awarded to the finalists. 10. The judge’s decisions at all stages of the competition, IS FINAL. 11. Exhibits are displayed at owner’s risk 12. These rules should be read in conjunction with the Irish Shows Association Rules 13. Marquee open from 7.30am on show morning and will be closed for judging at 10am sharp. Marquee will open to the public at 12 noon and exhibits may not be removed before 5.30pm. Entry Fee: To qualifying show: 3 To Final: 6 Prizes: 1st 300+ Trophy, Goods in kind, 2nd 200 plus Goods in kind, 3rd 100 plus Goods in kind, 4th 60, 5th 60, 6th 60, 7th 60, 8th 60 Final: Tullamore & AIB National Livestock Show Sunday 10th August 2014.

128


Class 739 The Odlum's Youth All Ireland Home Baking Championship Sponsored by: Odlums This is a Direct Entry All Ireland Championship. Rule & Conditions: 1. Each exhibitor will bake all items listed below using Odlum's products: (a) 6 Decorated Cupcakes (b) 6 Caramel Slices (c) 6 Brown Scones N.B. All recipes can be found on the Odlum's website. Own recipes may also be used. 2. The items to be displayed on individual plates and each exhibitor will be allotted their own space. On a base not more than 24” Square. 3. Points will be awarded for texture, taste, appearance and presentation of baked items. 4. Competition is opened to youths 18 years & under both male and female, with one entry per exhibitor at the show. 6. The items must be fresh and home baked by the exhibitor 7. All items will be cut and sampled on the day. 8. Judges decision will be final at the competition. 9. Prizewinners will be presented with a certificate and relevant prize. 10. Exhibits are displayed at owner’s risk. Prizes: 1st: 100 and Goods in Kind, 2nd: 75, 3rd: 50, 4th, 5th & 6th 25. Marquee open from 7.30am on show morning and will be closed for judging at 10am sharp. Marquee will open to the public at 12 noon and may not be removed before 5.30pm. Direct postal entry to Secretary, Tullamore Show, Church St. Tullamore by the 11th July 2014. Online Entries through. www.tullamoreshow.com by the 18th July 2014. Final: Tullamore & AIB National Livestock Show Sunday 10th August 2014. Class 991 The Redmills All Ireland Poultry Championship Sponsored By: Connolly Redmills, Goresbridge, Co. Kilkenny. Tel: 059-9775800 PRIZE FUND: 500 Direct Entry to Tullamore Show Rules & Conditions 1. The competition is open to large fowl, heavy soft feather, female. 2. Exhibits must be pure bred (confined only to the following breeds: Australorp, Barnvelder, Bramah, Cochin, Croad, Langshan, Dorking, Faverolles, Frizzle, Marams, Orpington, Plymoth Rock, Rhode Island Red, Sussex, Wyandotte. Also the following rare breeds: Houdans, Ixworth, Jersey Giants, La Fléche, North Holland Blue, Norfolk Grey, Orloff and Transylvanian Naked Neck. These are the only breeds of birds accepted. No Bantams & No Waterfowl. 3. Only two entries per person allowed in final. 4. Exhibitors must declare the breed, variety, colour and sex on entry form. 5. Exhibits must be owned by the exhibitor at the time of show. 6. Exhibits in this class may not enter any other classes on day of final. 7 Cages will be provided at the final. 8. Each finalist will receive product on appearance at the final. 9. Judges decision is final. 10. Exhibits cannot be removed before 5.30 pm. 11. These rules should be read in conjunction with the Irish Shows Association Rules.

129


Prizes: 1st 150, 2nd 100, 3rd 50, 4th 25, 5th 25, 6th 25, 7th 25 Direct postal entry to Secretary, Tullamore Show, Church St. Tullamore by the 11th July 2014. Online Entries through. www.tullamoreshow.com by the 18th July 2014. Final: Tullamore & AIB National Livestock Show Sunday 10th August 2014 Class 639 The Single Rose All Ireland Sponsored By: Mrs. Bly Hutton-Bury, Brookfield, Tullamore This is a Direct Entry All Ireland Championship. Rules & Conditions Each exhibit should consist of the following: 1. One single rose 2. Conditions of stem and foliage to be taken into account. 3. Exhibitor must use vases provided by the Show Society 4. In this competition, the exhibit must be the property of and be grown by the exhibitor. 5. Marquee open from 7.00am on show morning and will be closed for judging at 10am sharp. Marquee will open to the public at 12 noon. 6. Exhibits should not be removed before 5.00pm. Direct postal entry to Secretary, Tullamore Show, Church St. Tullamore by the 11th July 2014. Online Entries through. www.tullamoreshow.com by the 18th July 2014. Prizes: 1st - 100, 2nd - 50,3rd - 25 Final: Tullamore Show & AIB National Livestock Show Sunday 10th August 2014.

Class 674 The All Ireland Flower Arranger of the Year Sponsored By: Castle Flowers, Moate, Co Westmeath 0906481582 Rules and Conditions 1Theme ‘Down the Garden Path’ 2.Space 70 cms wide, 60 cms deep. 3.An Exhibit 4.A special qualifying class will be held at selected shows 5.Two exhibits may qualify for the final at each show, if the judges agree that the standard is high enough. 6.Judges decision will be final at all stages of the competition. 7.Exhibits are displayed at owner’s risk. 8.The qualifying exhibits may be staged at Tullamore Show, Horticulture Marquee on Saturday 9th August from 6-9pm and on Sunday 10th from 7-10am. Exhibits may not be removed until 5.00pm. Prizes. 1st 150 & ‘Flower Arranger of the Year’ Trophy & Certificate. 2nd 100, 3rd 50, 4th 25. All qualifiers will receive a memento. Entry fee; to qualifying Show 3, To Final 6.

Final: Tullamore & AIB National Livestock Show Sunday 10th August 2014.

130


GENERAL RULES FOR 2014

Specific Requirements Horses & Other Equines As from 1st May 2012, any premises (which includes shows, fairs and markets) where horses or other equines are gathered must be registered with the Department of Agriculture. Owners/persons in charge of such gatherings are required to submit a completed application form for registration and to keep records of movements on/off their premises. Records must be retained for at least 3 years as they may be required by the Department for the purposes of tracing disease. It is important therefore that Show organisers should contact their local District Veterinary Office in advance so that consideration can be given to compliance with the requirements. Any further information on the requirements for moving of horses and equines to shows will be provided on the Department's website www.agriculture.gov.ie/animalhealthwelfare/animalidentificationmovement

Eligibility of Shows: Shows wishing to participate in the 2014 Championships and be eligible to hold qualifiers must have collected the Championship Fund (currently 5%) from Horse, Pony, Cattle & Sheep. Class prize money for the year 2013 and forwarded the amount so collected, in full to the Irish Shows Association within the stipulated period of not more than 30 days from the date of the show. Alternative methods of meeting this obligation are not acceptable. Any show or competitor in breach of the Rules set out below will be disqualified from participating or competing in these Championships. These General Rules and those relating to individual championships (where applicable) should be published in the show schedule and catalogue of the partipating shows and must be strictley observed.

Qualifying Rounds: (Qualifiers) Qualifying rounds will take place at shows designated by the Irish Shows Association.

Responsibility of Shows holding qualifying rounds: 1. Selected Shows should hold a separate class for each qualifier from which the highest placed animals will qualify. 2. The Qualifier class should be held as the first (1st) class in the relevant section of the show. 3. Shows must ensure that the qualifiers are held strictly in accordance with the relevant Rules. 4. No other sponsor maybe involved in qualifying classes.

131


5. Shows may charge an entry fee for each qualifying class. The I.S.A. will award a rosette to the successful animal(s) on appearance at the final. 6. No show hosting a Championship Final may hold a qualifying class for that championship on the day of the final other than by agreement with the Irish Shows Association. However Shows who hold qualifiers for Horses, Ponies & Cattle may ask exhibitors to enter the exhibit in at least one other class at their show on the day. 7. Animals qualified for finals are not eligible to enter in any other show class where the final is held, other than a qualifying class for anothe Championship. 8. Shows should appoint competent, well briefed persons to act as stewards, who must ensure that only animals (or other exhibits) which are eligible to compete and whose documentation is in order, are allowed to proceed to the judging ring. 9. Animal Passports & 'Micro chips where applicable' should be read by a Veterinary Surgeon appointed by the show. 10. On completion of judging, Stewards must inform the successful competitors to visit the Secretary's Office at the show within one hour, and complete the necessary arrangements for entry to the final. 11. The show must appoint a well briefed officer who will be available at the Secretary's Office to assist exhibitors to complete the entry cards for participation in the final and collect the entry fee. 12. Show Secretaries must forward completed result cards, together with appropriate fees to the Irish Shows Association within three days following the holding of the show. 13. NB. Shows must return results card marked "No Competition" for any or all of the events for which no animal (or exhibit) has been selected.

Responsibility of Exhibitors: a. Exhibitors accept that the Judges decision is final in all cases. Any abuse of Judges will not be tolerated. Where a dispute or case for complaint arises, the matter should only be dealt with under 6. below. b. Winners of Qualifiers are themselves responsible for entering their qualifiers (or exhibits) for the final in accordance with 10 & 11 above, within one hour of qualifying. c. Winners of qualifiers will compete in the final. d. The Irish Shows Association in conjunction with the sponsor reserve the right to alter or amend the rules of the competition as may be necessary where appropriate. e. Shows and competitors must contact the ISA for details of any championships and not the sponsor involved. f. Objections must be lodged in writing with the I.S.A. representative at the show and the Show Secretary within half an hour following the completion of judging, together with a fee of 50, or other stated fee, which is refundable in the event of the objection being upheld. g. Any exhibitor who makes a false declaration or misrepresents a fact regarding themselves or their exhibit are liable to disqualification and/or forfeiture of any prizes awarded.

Responsibilities of Shows hosting Championship Finals: a. A deduction of 5% of the prize money will be collected by the show and forwarded to the I.S.A. within 30 days of the Final. b. Championship finals must start not later than 2pm on the day of the show and the advertised time must be adhered to as far as possible. If necessary, other show classes should be either posponed or relocated to allow for this.

132


NOTICE OF INTEREST TO CHAMPIONSHIP PARTICIPANTS Irish Law(EU Directive) Under Irish Law, all horses moving from one location to another must be accompanied by their passports. It is in your own interest to ensure that this is the case. Failure to do so is an offence under Irish Law and is liable on summary conviction to result in a fine of up to 3,000. All passports must be registered with the name of the current owner. •

Embryo Transfer: Where a foal is produced by this method, the dam's passport must bear a declaration dated, stamped, and signed by the stallion owner (or accredited practitioner where AI is involved) stating the date on which the dam was last covered (or inseminated) and the name of the covering stallion. The owners of Champions and Reserve Champions are invited to submit the animals' passports to the ISA head office where the placing will be endorsed and officially stamped with the seal if the ISA as a permanent record. It is in the interest of shows hosting championship finals that photographs and results are forwarded to the Irish Farmers Journal immediately following judging.

Notification Cattle Movement Important Information for Organisers of Show's & Exhibitors of Cattle 2014. The following changes are being introduced for exhibitors/keepers of bovine animals who wish to show cattle - these changes apply for the 2014 showing season. Exhibitors/Keepers of cattle are now required to obtain a Certificate of Compliance prior to the movement of an animal to a Show. Cetificates of Compliance can be obtained online from the Animal Identification & Movement (AIM) system through the website www.agfood.ie facility or from the Cattle Movement Notification Agency. When applying for a Certificate of Compliance, keepers should not specify a destination herd. On the day of the Show, the Certificate of Compliance should be presented to the Show Secreatary along with the bovine passport for the animal. The Exhibitor/Keeper & the show secretary sign the movement notification section of the Certificate which will then be sent to the the local DVO for recording on the AIM system. Please note that only cattle for which a valid Certificate of Compliance is provided to the Show Secretary will be allowed to be shown on the day of the show. These Certificates will replace the previously used CMMS 4 forms. RECOMMENDATION FOR CATTLE CLASSES After a number of submissions from affiliated shows on the judging of calves and the need to have them judged by weight rather than by age at Shows. The Irish Show Association Cattle Sub Committee have put forward the following recommendation on use of live weight for calf classes eg Calves under 12 months not to exceed 460kg; Autumn born claves and calves under 6 months should not exceed 320kg. Another suggestion is to use no more than 1.7kg live weight gain per day from the birth date to the show date. This proposal would also be suitable for interbreed pedigree calf championships.

133


Special Notice to Calf Exhibitors 2014 Suckler Welfare Scheme. Suckler exhibitors should forward receipts of attendance conformation at shows to the department. Once department have got conformation the suckler welfare grant will be reissued.

Specific Requirements - Sheep Identification All sheep must be individually identified with plastic ear tags issued on accordance with the requirements of the National Sheep Identification System (NSIS). Movement Documentation All consignments of sheep being moved must be accompanied by the completed dispatch document. Individual details of each sheep in the consignment must be recorded. Sheep from non-restricted flocks only can be moved to shows. In the case of flocks restricted following diagnosis of scrapie, sheep possessing the ARR/ARR genotype only may be exhibited. The movement of these ARR/ARR genotype sheep must be accompanied with the relevant movement permit (SCR/10), which can be obtained from the Local District Veterinary Office in the county where the flock is located. AIM Notification The movement of sheep to and from an Agricultural Show within the State must be recorded on AIM. This is done using a copy of the owners dispatch document as follows: 1. The Owner/Keeper presents the signed and completed dispatch document to the show secretary who checks it to ensure that it is completed in full. 2. The Show Secretary fills in the MART section of the dispatch document with (i) the show number; (ii) the date of the move back to the source holding; (iii) stamps is with the show stamp; (iv) signs the dispatch document. 3. The Show Secretary then forwards the completed pink section of the dispatch document to the local DVO within 7 days of the show movement. 4. The Show Secretary keeps the white copy for his/her records, 5. The source/destination keeper keeps the bottom yellow copy to enter it into their flock registry. 6. Ultimate responsibility for fulfilling this requirement lies with the Show Secretary. Flock Register All movements of sheep to and from shows must be recorded in your flock register. Exports (to Member States of the European Union including Northern Ireland All sheep must be accompanied by TRACES intra community trade certificate for ovine animals. A TRACES message, corresponding with the TRACES certificate, will be sent for each animal or consignment being dispatched to the show (this will be performed by Department officals of the DVO). Exhibitors are advised to contact their Local District Veterinary Office & the show society in Northern Ireland well in advance of any show where sales may take place to determine the suitability of the show for exports (e.g. premises and sheep status), availability of veterinary staff for export certification and to have the necessary arrangements out in place. Attendance of sheep from scrapie monitored flocks at shows and sales in 2014

134


Shows between 1st May and 30th September Sheep from scrapie monitored flocks will be permitted to attend agricultural shows taking place between May 1st and September 30th without restriction or separation from other categories of sheep. Shows outside that period For shows taking place before May 1st or after September 30th, sheep from scrapie monitored or probationary flocks must be separated from other sheep as follows: a. There must be complete separation of monitored/probationary sheep from other categories of sheep at the show. Ideally, this would mean a separate entrance and exit for each group, separate loading and unloading areas, separate penning areas for each of the two groups. b. In locations where all of the above may not be possible, the minimum requirement would be the separate loading and unloading and also of penning areas. The two areas should be separated by a sheep-free alleyway, at least 12 feet wide. If only one showing is available, the sheep from the scrapiemonitored flocks must be shown first.

Safety at Shows We all want to have a successful, enjoyable show but also a safe and accident-free occasion. To ensure this, the co-operation of all is vital, including exhibitors, spectators and organisers. A few guidelines to note in relation to safety are as follows: - Please observe signs - especially those relating to caution in livestock areas. - Please do not exhibit animals that are unsuitable with regard to safety e.g. hard to control. - All animals must be led by a competent handler. - Animals should not be tied to trailers. - Dogs should be on a lead and under the control of the handler. - Caution and care should be exercised at all times.

So, come early and have a safe and enjoyable visit to the Tullamore Show on August 10th 2014

135


IMPORTANT INFORMATION FOR ORGANISERS OF AND EXHIBITORS AT LIVESTOCK SH O WS, 2013 GENERAL Show organisers should notify the SVI at their local DVO of the intention to hold a show and provide the location and proposed dates of the show. Keeper herd numbers for Agricultural Shows must be obtained in advance from AIM Division, Administration Building, Backweston Laboratory Campus, Backweston, Celbridge, Co Kildare - Telephone (01) 5058600. Exhibitors should apply in good time to the Show Secretary to check any requirements specific to that show. C ODE OF PRACTICE – BIOSECURITY Livestock Marts, Meat Plants, Showgrounds, Co-operatives, Agricultural Premises In general movement and mixing of animals presents the greatest risk of the spread of most animal diseases. For that reason the operators of marts, meat plants, livestock shows etc., have a key role to play in ensuring that the disease risks associated with their premises and operations are kept to a minimum. Specific legal requirements apply in relation to bio-security arrangements. Adherence to these bio-security arrangements and the guidelines outlined below can have a significant impact on reducing the opportunities for disease transmission.

Acceptance of animals •

All keepers must be registered appropriately if presenting animals (cattle, sheep, goats, pigs horses and poultry).

Under no circumstances should animals that are identified improperly or documented improperly be accepted.

136


Cl eaning / disinfection •

All areas where animals have been in contact should be washed down thoroughly and disinfected with an approved disinfectant at the end of each day at a minimum.

Keep drinking/feeding troughs clean and free of animal waste or other contaminants.

Cleaning and disinfection facilities should be available on site for all transport vehicles delivering/collecting animals. Shows should enforce the use of these cleaning and disinfection facilities at all times.

Ensure that clients, when visiting the premises, wear waterproof footwear (e.g. wellington boots) that can be cleaned and disinfected easily.

Provide foot-baths with suitable approved disinfectant at appropriate locations on the premises.

Provide facilities for hand washing with liquid soap and for washing down footwear.

Provide signs on premises reminding people of the need to minimise the risks of disease transmission and the availability on-site of washing facilities for vehicles and persons.

Identification, docume ntation and record keeping •

Retain a record of the registration number of each vehicle delivering/collecting each consignment of animals.

Maintain a register, in readily accessible form, of all vendors/buyers, including numbers and types of animals involved in each transaction.

Ensure compliance with all requirements in relation to record keeping and retention of records.

Forward completed Certificates of Compliance in respect of bovines and Sheep or Goat Dispatch Documents to the local District Veterinary Office (DVO) to ensure that the cattle, sheep and goat movement details are recorded on the Animal Identification and Movement (AIM) database.

Suspicious/unusual transactions or movements •

Report any suspicious or unusual transactions or movements involving livestock to the Department of Agriculture, Food and the Marine or the Garda Siochana (such information can be provided on a strictly confidential basis).

137


SPECIFIC REQUIREMENTS - CATTLE Animal Health Status T.B. All animals must come from herds, which are Officially TB free (OTF) (i.e. not restricted) and the herd and relevant animals must have had a clear test within the previous twelve months – this test must be recorded on the Department’s Animal Health Computer System (AHCS). No premovement test is required for T.B. However, it is recommended by the Department that a 30day pre-movement test for TB should apply to all Shows.

Brucellosis All animals must come from herds which are Officially Brucellosis free (OBF) (i.e. not restricted). Certain animals (i.e. females aged 24 months and over and bulls aged 24 months and over) must have passed a test for Brucellosis within the previous 60 days and this test must be recorded on the Department’s Animal Health Computer System (AHCS). Identification All cattle must bear two plastic tags with the same number (one in each ear) as issued under the Department’s identification system. They must be accompanied by their passports. Bul ls for A.I. Stations In addition to the T.B. and Brucellosis tests, bulls destined for A.I. stations must be tested for I.B.R. (Infectious Bovine Rhynotracheitis), E.B.L. (Enzootic Bovine Leukosis), B.V.D. (Bovine Virus Diarrhoea) and Johnes Disease, within 30 days prior to movement into such stations.

AIM Notification The movement of cattle to and from an Agricultural Show within the State must be recorded on AIM. Keepers who plan to move animals to a Show must obtain a Certificate of Compliance prior to the movement of animals. No destination should be nominated when the keeper is applying for a Certificate. At the Show, the Movement Notification section of the Certificate should be completed by the keeper and the Show Secretary who should clearly indicate the Show Number on the form. Ultimate responsibility for fulfilling this requirement lies with the Show Secretary. Completed forms should be sent by the Show Secretary to the local DVO within 7 days of the Show.

138


Imports from Northern Irela nd It is very important that any proposal to import cattle to a show is made known to the local District Veterinary Office well in advance so that consideration can be given to compliance with the requirements outlined below.

Premises The Show premises at which the cattle will reside for the duration of their stay must either be an assembly centre approved for exports or of such a standard as being capable of being approved for such a purpose temporarily. A fundamental requirement for such premises is that they have surfaces that are capable of being cleaned and disinfected, and have adequate cleaning and disinfection facilities. Adequate segregation facilities may be required also (see under â&#x20AC;&#x153;Status of Animalsâ&#x20AC;? below).

Status of Animals Cattle from Northern Ireland being moved to a show must be certified in accordance with the normal requirements for intra-community trade in breeding animals including having passed a TB test (export interpretation) during the 30 days prior to export and a brucellosis test in the case of eligible animals (females and entire males over 12 months) during the 30 days prior to leaving the herd of origin.

To comply with eligibility requirements for re-importation into Northern Ireland after the show, cattle must not mix with any cattle of a lesser health status whilst at the show. This can be achieved in one of two ways: (i) either the imported animals are kept segregated fully from other cattle at the show which have not been tested, or (ii) all cattle attending the show must have been TB (export interpretation) within 30 days and all cattle from Northern Ireland attending the show must have been brucellosis tested within 30 days as set out above.

Documentation Cattle imported to a show from Northern Ireland must be accompanied by an original breeding animal intra-trade health certificate (known as a TRACES certificate) and a passport for each animal. A TRACES message, corresponding with the TRACES certificate, will be sent for each animal or consignment being dispatched to the show (this will be performed by officials in the dispatching country). For the return journey, this original certificate must be endorsed by the signature of the official veterinarian of the Department at the show, together with the official stamp of the competent authority and date of endorsement. A TRACES message will be sent for the return journey also (this will be performed by Department officials attending the show).

In addition, a non-comminglement certificate must be issued by the official veterinarian for the show at or before return, stating that the animal shows no clinical signs of disease and has not been in contact, during its stay at the show/event, with animals of a lesser health status. The passport must accompany the animal on the return journey also.

139


The Show Secretary should complete a CMMS 5 form in respect of animals imported to take part in the Show. The owner of the imported animal(s) is required to sign the form also when the animal arrives at the Show and provide his/her herd number. Following the Show, the official veterinarian should complete the bottom portion of the CMMS 5 form also confirming that he has stamped the official Health Certificate and that he has issued a Non-Comminglement Certificate.

The completed CMMS 5 form (available from local DVOs or from the Cattle Movement Notification Agency, Clonakilty, Co Cork) should then be forwarded to AIM Division, Administration Building, Backweston Campus, Backweston, Celbridge, Co Kildare to enable recording of the movement. A carbon copy of the form will be provided for the Show Secretary, the official veterinarian and the herd keeper of the animal(s).

Exports to Northern Ireland Cattle moving from Ireland to a Show in Northern Ireland must be recorded on AIM. When the intra-community-trade Certificate is being issued by the local DVO, they will arrange to have the export movement for the animal(s) recorded onto AIM. All cattle must be accompanied by an official TRACES intra-community-trade certificate for bovine animals. A TRACES message, corresponding with the TRACES certificate, will be sent for each animal or consignment being dispatched to the show (this will be performed by Department officials in the DVO).

Cattle for Breeding and Production

Valid identity card/passport

-

all animals

Negative TB test (export interpretation) -

all animals aged over 42 days within 30 days prior to export

Negative Brucellosis test

female animals and bulls aged 24

-

(serum agglutination or ELISA)

months or over during the 60 days prior to leaving the herd of origin

140


Export of cattle to an agricultural show within the EU other than to Northern Ireland Agreement for the movement and immediate return of cattle to a Show in another country or vice versa currently applies for movements between Ireland and Northern Ireland only – it does not apply for movements to Great Britain or further afield. Requests for cattle from Ireland to attend shows in countries other than Northern Ireland, will be dealt with on a case-by-case basis. Before the movement of cattle from Ireland to a Show in parts of the EU other than to Northern Ireland takes place, it is imperative to establish that the Competent Authority of the destination country has agreed to put in place the same system for the processing of the documentation as applies to exports to Northern Ireland. Therefore exhibitors who wish to show cattle at an EU Show other than in Northern Ireland should contact the local DVO at least one month prior to the Show. Where the export of cattle from Ireland is agreed with the destination country, the movement of such cattle must be recorded on AIM. When the official intra-community trade Certificate for bovine animals is being issued by the local DVO, they will arrange to have the export movement of the animal(s) recorded onto AIM. Following the show, the original Health Certificate is endorsed and stamped by the official veterinarian at the Show and a non-Comminglement certificate will be issued also. When the animal returns to the home farm, the keeper presents these Certificates to the DVO along with a completed CMMS 6 form (available at DVOs) stating that the animal has returned from the show. The DVO can record the import movement back to the keeper’s holding on the AIM system then.

SPECIFIC REQUIREMENTS – SHEEP Identification All sheep must be identified individually with appropriate ear tags issued in accordance with the requirements of the National Sheep Identification System (NSIS). Movement Docume ntation All consignments of sheep being moved must be accompanied by a completed dispatch document. Individual details of each sheep in the consignment must be recorded on the document. Sheep from non-restricted flocks only can be moved to shows. In the case of flocks restricted following diagnosis of scrapie, sheep possessing the ARR/ARR genotype only may be exhibited1 . The movement of these ARR/ARR genotype sheep must be accompanied by the relevant movement permit (SCR/10), which can be obtained from the local District Veterinary Office in the county where the flock is located. AIM Notification The movement of sheep to and from an Agricultural Show within the State must be recorded on AIM. This is done using a copy of the owners sheep dispatch document as follows: 1. The owner/keeper presents the signed and completed dispatch document to the show secretary who checks it to ensure that it is completed in full. 2. The show secretary fills in the MART section of the dispatch document with (i) the show number, (ii) the date of the move back to the source holding (iii) stamps it with the show stamp and (iv) signs the dispatch document. 3. The show secretary then forwards the completed pink section of the dispatch document to the local DVO within 7 days of the show movement. 1

ARR (Alanine, Arginine, Arginine) homozygous for alleles 136, 154 and 171 of the sheep’s prion protein.

141


y 4. The show secretary keeps white copy for his/her records. 5. The source/destination keeper keeps the bottom yellow copy to enter it into their flock register. Ultimate responsibility for fulfilling this requirement lies with the Show Secretary. Flock Register All movements of sheep to and from shows must be recorded in the keeperâ&#x20AC;&#x2122;s flock register. Exports to Northern Ireland All sheep must be accompanied by a TRACES intra-community trade certificate for ovine animals. A TRACES message, corresponding with the TRACES certificate, will be sent for each animal or consignment being dispatched to the show (this will be performed by Department officials of the DVO). Exhibitors are advised to contact the show society in Northern Ireland well in advance of any show to determine the suitability of the show for return of animals (e.g. premises and sheep status), and whether the authorities will have officials and veterinary staff present to supervise and process documentation for animals returning to origin. Agreement for the movement and immediate return of sheep to a Show in another country or vice versa currently applies for movements between Ireland and Northern Ireland only â&#x20AC;&#x201C; it does not apply for movements to Great Britain or further afield. Movements to shows other than Northern Ireland, will be dealt with on a case-by-case basis and you should contact your local District Veterinary Office at least one month prior to the Show.

Attendance of she ep from scrapie monitored flocks at shows and sales in 2014 Shows between 1 st May and 31 st October Sheep from Scrapie Monitored Flocks 2 will be permitted to attend Agricultural Shows taking place between 1 st May and 31 st October, without restriction or separation from other categories of sheep. Shows outside of the 1 st May and 31 st October Period For shows taking place before 1 st May or after 31 st October, sheep from Scrapie Monitored or Probationary Flocks must be separated from other sheep as set down below. a. There must be complete separation of Monitored/Probationary sheep from other categories of sheep at the show. Ideally, this would mean a separate entrance and exit for each group, separate loading and unloading areas, separate penning areas for each of the two groups and separate sale rings for each of the two groups. b. In locations where all of the above may not be possible, the minimum requirement would be for separation of loading and unloading areas and also of penning areas. The two penning areas should be separated by a sheep-free alleyway at least twelve feet wide. If only one show ring is available, the sheep from the scrapie-monitored flocks must be shown first. Sales between 1 st May and 31 st October Sheep from Scrapie Monitored Flocks will be permitted to attend sales taking place between 1 st May and 31 st October, without restriction or separation from other categories of sheep. Sales outside of the 1 st May and 31 st October Period For sales taking place before 1 st May or after 31 st October, sheep from Scrapie Monitored or Probationary Flocks must be separated from other sheep as set down below. 2

These flocks are flocks either accredited (full member) or in the process of accreditation (probationary member) for exporting sheep (that might not possess ARR/ARR genotypes).

142


1. There must be complete separation of the two categories of sheep at the sale (monitored animals including probationary monitored animals and non monitored animals). Ideally, this would mean a separate entrance and exit for each group, separate loading and unloading areas, separate penning areas for each of the three groups and separate sale rings for each of the three groups. 2. In locations where all of the above may not be possible, the minimum requirement would be for separation of loading and unloading areas and of penning areas also. A sheep-free alleyway should separate the two penning areas at least 12 feet wide. 3. If only one sale ring is available the procedures set out in the following two options must be adhered to. a. The sheep from the Scrapie monitored flocks must be offered for sale first, followed by non-monitored animals or b. The ring can be divided by gates into two sections to ensure that each of the two categories of animals is confined to a unique part of the sales ring.

SPECIFIC REQUIREMENTS – POULTRY Restrictions on the movement of poultry and captive birds may vary in 2013 depending on the international and local situation with regard to Avian Influenza. Therefore Show organisers should contact the local DVO prior to organising an event to confirm whether any restrictions are in place at the time of the show.

Further information is available at http://www.agriculture.gov.ie/avian_influenza/informationonshowsexhibitionsraces/

SPECIFIC REQUIREMENTS – HORSES AND O THER EQUINES Premises Registration As from 1 May 2012, any premises (which includes shows, fairs and markets) where horses or other equines are gathered must be registered with the Department. Owners/persons in charge of such gatherings are required to submit a completed application form for registration and to keep records of movements on/off their premises.

Records must be retained for at least 3 years as they may be required by the Department for the purposes of tracing disease. Records required are

• • •

The name and address of the owner/person in charge of the premises from which the equine came; The premises registration number from which the equine came and Passport number/UEL number of the animal

143


It is important therefore that Show organisers should contact their local District Veterinary Office in advance so that consideration can be given to compliance with the requirements outlined above.

Equine Identification All Equines (which include horses, ponies and donkeys) must be identified in accordance with EU and national legislation. • •

Possession of an unidentified equine is an offence under the legislation. Passport must be issued by approved Passport Issuing Organisations [PIOs] within the calendar year of birth [by 31 December in the year of birth] or within six months of birth [whichever is later] and is valid for the lifetime of the animal. A list of the PIOs is set out in Appendix 1. Microchip - all equines issued with a passport after 1 st July 2009 must have a corresponding microchip implanted by a veterinarian which is recorded in the passport and creates a link between the passport and the animal.

A Keeper must • • •

Have an equine registered with a PIO Have a passport issued in accordance with EU and national legislation Comply with the provisions of the legislation whereby a passport must accompany the equine whenever it is moved to events such as shows, sales and to slaughter plants, etc.

Posters and leaflets can be supplied and further information on stud book equines is available by contacting Livestock Breeding, Production and Trade Division, Dept. of Agriculture, Food and the Marine, Farnham St, Cavan (Phone +353 49 4368200) or in relation to non-registered equines further information is available from Animal Identification and Movement Division, Dept. of Agriculture, Food and the Marine, 2nd Floor, Administration Building, Backweston Complex, Celbridge, Co. Kildare (Phone +353 1 5058881) Department of Agriculture, Food and the Marine February 2013

DATE FOR THE DIARY Networking Event for Livestock Industry The Show is hosting a Networking Opportunity in a relaxed atmosphere, for all involved in the Livestock industry, on Saturday the 9th August the evening before Show day. It will be held on the showground's of the Butterfield Estate, Blueball, Tullamore. Forum Theme - The Future Programme to Include: Key Speakers, followed by Questions and Answers from the floor.

144


LIVESTOCK ISSUES 1. Overnight Accommodation can be provided at â&#x201A;Ź15 per animal. 2. Access to Overnight Accommodation for Cattle is only available from Friday 8th August at 3.00pm (limited availability). All animals must be in place by 8.00 p.m. on Saturday 9th August 2014 due to Department restrictions, late arrivals will not be allowed into the accommodation Due to big demand on Overnight Accommodation, only animals which are booked in 3. and fees paid will be accommodated. Passes will be issued. Accommodation not pre-booked will depend on availability. Strict control of facility will be practiced. 4. Shed must be vacated by 10.00 a.m. on the morning of the Show. Exhibitors whose animals remain in the shed after that time will forfeit their prizemoney, if awarded. 5. Please note that due to our restricted facilities in the livestock area, at this stage we are unfortunately unable to accommodate livestock to which the Export Health Regulations apply. 6. DEPARTMENT OF AGRICULTURE & FOOD REQUIREMENTS (All animals will be inspected at entry to showgrounds)

CATTLE TB:

1. 2. 3. 4.

All animals must have passed a test within the last 12 months Accompanying Passports must have correct record of in date test Identification - animals must have tags in both ears Animals movement to show must be recorded on AIM. A Certificate of Compliance must be presented at the show - available from website: www.agriculture.gov.ie In Addition BRUCELLOSIS: 1. Females, 24 months and over must have passed a blood test within 60 days. 2. Bulls, 24 months and over must have passed a blood test within 60 days.

SHEEP 1. Each sheep must be individually tagged. 2. Each consignment of sheep must be accompanied by a Dispatch Document. 3. Sheep from Scrapie Monitored Flocks may attend and be exhibited without restriction.

HORSES/EQUINES 1. Must list Premises Registration No. and Passport No. when filling out Entry Form.

POULTRY Flock Number required when filling out Entry Form.

7. Animals should be safely led by a competent handler and be halter trained. 8. All bovines must be correctly tagged. Documents and animals must be correct and will be inspected by Department of Agriculture officers before entry will be allowed. 9. Livestock exhibitors should have insurance on their animals to include cover for exhibiting at the Show. 10. Bibs/Arm Bands for display of exhibit numbers in Livestock and Horses will be available for purchase on site.


Tullamore show aib national livestock show 2014  

Schedule of classes - Sunday August 10th 2014

Read more
Read more
Similar to
Popular now
Just for you