Page 1

c m y

NOVISAD*

SREDA9.NOVEMBAR2011.GODINE

GODINALXIX BROJ23253 CENA30DINARA * 0,50 EUR

Internet: www.dnevnik.rs * e-po{ta: redakcija@dnevnik.rs

NASLOVI

SVEVI[EGRIPOZNIHPOAMBULANTAMATRA@ILEK

Politika

Do antibiotika samo uz recept

3 Ustav alibi za politi~ku elitu

Ekonomija 4 Du`nicima opomene, a ne obave{tewa 5 Vlada prekr{ila zakon, a Srbija prezadu`ena

Poqoprivreda 6 Paori ~uvaju poqoprivredu, politika je kvari

str. 13

Dr`avni vrh nije pritiskao Vuka

JU^E U VLADI VOJVODINE

Foto: N. Stojanovi}

INTERVJU: ALEKSANDARJUGOVI],DIREKTORSPO-a

str. 3

Vojvodina 11 Uz olak{ice ide i dru{tvena odgovornost

ZAVR[ENAIZGRADWATEHNOLO[KOG PARKAUVR[CU

Posao za hiqadu Bana}ana

NoviSad 7 Med zasladio De~je selo 7 Cisterne i prodavnice ugasile `e| 8 Ra~uni umaweni mnogo~lanim porodicama 9 Partije Toplani duguju {est miliona

Reporta`e 12 Moba javna, ali recepti ostali tajna

Dru{tvo

str. 4

Uru~ene nagrade „Dr \or|e Nato{evi}”

str. 13

13 Vojvodina godi civilnom sektoru 13 @ene treba da spasavaju naciju

Crna 14 Zapleweno 225 kila pile}ih bataka 15 I katedrala na meti lopova

JU^EPO^ELIRADOVI UPETROVARADINU

Park dobija novo lice

MRE@AZARESTITUCIJUZAHTEVA PROMENUPROPISA

str. 7

Za oteto treba novi zakon

str. 5

Sun~ano i toplo

JESEWIIZLOVRIBENANAJVE]EM SLATKOVODNOMRIBWAKU

Najvi{atemperatura16°S

SPORT

str. 16 – 21

n PO^ELASPENSOVALIGA MALIHfUDBALSKIH[AMPIONA

Bar nam {arani ne fale n VOJVODINASENADAPOBEDIPROTIV[PANDAUA

n „DNEVNIKOV”[AHSREDOM

str. 6


2

POLiTikA

sreda9.novembar2011.

dnevnik

Tadi}: Ne odustajemo od EU Predsednik Srbije Boris Tadi} izjavio je ju~e da je Srbija, za raz li ku od mno gih drugih zemaqa, uspela da o~uva razvojne poten ci ja le upr kos svet skoj eko nom skoj krizi i da bi za desetak godina mogla biti veoma dinami~na zemqa. Tadi} je, prilikom po se te [ap cu, podsetio na to da su strani eksperti ovih dana u medijima izneli stav da Srbija u nared nih de set go di na mo`e u}i me|u dvadeset zemaqa s najve}im razvojnim potencijalima. On je ukazao da

je to zasad samo {ansa i da je da je [abac grad s izuzetnim za ostvarewe tog ciqa neoprazvojnim potencijalima. hodno da se zna ekonomski i Obra}aju}i se novinarima politi~ki pravac u kojem ide posle obilaska mlekare, Tadr`ava. di} je istakao da je na{a ze– U narednih deset godina, mqa i u uslovima ekonomske ako ne budemo pravili gre{ke krize, koja je po~ela 2008, usi ako bu de mo pe la da sa ~u va sma wi li tro raz voj ne po ten {kove dr`ave i cijale, za razliAko ne budemo jav ni sek tor ku od mno gih gre {i li, bi }e mo predamo privatdru gih ze ma qa. dinami~na zemqa nom menaxmentu, Po wegovim re{to nas o~ekuje ~ima, Srbija ne po sle iz bo ra, bi smela da proSr bi ja mo `e po sta ti ve o ma pusti {ansu, te da je za to neodinami~na zemqa – procenio phodna jasna ekonomska i poje Tadi}. li ti~ ka stra te gi ja. U tom On je ju~e u [apcu obi{ao smislu, istakao je predsednik kompaniju Mlekara „[abac„ Ta di}, ne ma od u sta ja wa od AD, ko ja po slu je u sa sta vu evropskih integracija jer bi „Farmakoma„, i konstatovao to bilo pogubno.

Stefanovi}: Re{ewe nakon stava Skup{tine [ef pregovara~kog tima Vlade Srbije BorislavStefanovi} izjavio je da }e re{ewe za prelaze Brwak i Jariwe biti poznato ~im Skup{tina Srbije da svoj stav o procesu razgovora s posrednikom EU u dijalogu s Pri{tinom Robertom Kuperom. – Va`no je da Skup{tina Srbije da stvoj stav o tom procesu i svim koracima. Nakon toga, siguran sam da }emo ne samo oti}i u Brisel i nastaviti dijalog ve} }emo mo}i da informi{emo Srbe o mogu}im re{ewima i nakon toga objavimo {ta je prihvatqivo re{ewe za Srbiju – kazao je Stefanovi} agenciji Beta.

On je naveo da }e to „re{ewe obezbediti na{e su{tinske nacionalne i dr`avne interese, a pre svega gra|ana na severu Kosova”. – Re{ewa za Kosovo i Metohiju s pozicija o~ekivawa na{ih gra|ana i svega {to smo, kao narod i dr`ava pro{li u posledwih 20 godina ne mogu biti idealni od 1999. godine. Ona su samo u okvirima mogu}eg i onoga {to nam okolnosti u svetu i odnos snaga u svetu dozvoqava – rekao je Stefanovi}. On je kazao da je beogradski pregovara~ki tim u stalnoj komunikaciji s posrednikom u dijalogu Robertom Kuperom i zvani~nikom

Stejt departmenta FilipomRikerom i da je upravo zavr{io jedan od tih razgovora. – Upravo sam zavr{io video-konferenciju s Kuperom i mogu da ka`em da se stvari stvarno odvijaju u pozitivnom pravcu – kazao je Stefanovi}, i dodao da zna da je vi{e puta najavqivao da }e re{ewe za prelaze biti brzo. – Znam da smo to vi{e puta najavqivali, gra|ani teba da imaju strpqewe i veru da idemo u dobrom pravcu. Stefanovi} je dodao da pisawe pri{tinske {tampe o Kuperovom predlogu o zajedni~kom integrisanom upravqawu granicom izme|u Srbije i Kosova ne bi komentarisao.

Bramerc o jatacima i svedocima Glavni ha{ki tu`ilac Ser` Bramerc i srpski tu`ilac za ratne zlo~ine Vladimir Vuk~evi} razgovarali su ju~e u Beogradu o jatacima ha{kih begunaca i problemima u za{titi svedoka, izjavio je portparol srpskog tu`ila{tva BrunoVekari}. Posle sastanka koji je trajao vi{e od sat vremena, Bramerc je, prema re~ima Vekari}a, kazao: „Nastavqamo borbu zajedno”. „Naravno, bilo je re~i o ovim operativnim stvarima, dakle o jatacima, o nekim problemima koje smo imali u me|uvremenu u procesuirawu odre|enih drugih predmeta u za{titi svedoka”, rekao je novinarima Vekari}. Bramerca su zanimali i neki posebni slu~ajevi, rekao je Vekari}, navode}i da ne mo`e da

ka`e vi{e detaqa, ali da postoji Akcioni plan. On je kazao da je ju~era{wi sastanak

Bramerca i Vuk~evi}a bio „profesionalni” sastanak na kojem se razgovaralo o predme-

tima pred Ha{kim tribunalom i doma}im sudovima. Vekari} je dodao da je bilo re~i i o protokolu o saradwi BiH u ustupawu dokaza. Bramerc koji je ju~e po~eo posetu Beogradu treba da razgovara sa {efom Nacionalnog saveta za saradwu Srbije sa Tribunalom Rasimom Qaji}em i predsednikom Srbije Borisom Tadi}em. Glavni ha{ki tu`ilac dolazi u posetu Beogradu uo~i podno{ewa redovnog polugodi{weg izve{taja Savetu bezbednosti UN o saradwi Srbije za tu`ila{tvom u Hagu. Posle posete Beogradu, Bramerc }e sredinom novembra uputiti izve{taj Savetu bezbednosti UN, koji }e u Wujorku predstaviti pred Savetom po~etkom decembra.

REKLI SU

Markovi}: ^ista la` Predsednik Jedinstvene Srbije DraganMarkovi}Palma okvalifikovao je ju~e kao „~istu la`” tvrdwe gej-ak ti vi ste Predraga Azdejkovi}a da ga je fizi~ki napao prilikom snimawa emisije na TV „Pink”. Mar ko vi} je ob jasnio da je, 15 minuta pre snimawa emisije „Magazin in” sedeo u „Pinkovom„ kafi}u i potom je, kada se pojavio Azdejkovi}, rekao voditeqki Sawi Marinkovi}: „Niste mi rekli da }e i on biti gost u emisiji”, nakon ~ega je ona gej-aktivistu pozvala za sto. „Pitao sam tada Azdejkovi}a za{to mi je pretio, citiram: ‘Palma, odra}u ti ko`u s le|a’, i rekao sam da mi se zbog toga izvini. Tako|e sam naveo da sam osu|en jer sam govorio istinu”, nagla{ava Markovi} u pisanoj izjavi. On dodaje da je, na konstataciju i pitawe da li zna da je homoseksualnost devedesetih godina pro{log veka bila na listi bolesti Svetske zdravstvene organizacije, Azdejkovi} odgovorio potvrdno. „Niti sam ga dotakao, niti vikao, {to je i TV „Pink„ potvrdio u svom saop{tewu”, tvrdi Markovi}.

Grubje{i}: O izborima samo s Qaji}em

Krkobabi}: Niko ne}e nare|ivati PUPS-u

Potpredsednica Ujediwenih regiona Srbije Suzana Grubje{i} najavila je ju~e da }e ta stranka u nedequ, 13. novembra, u „Beogradskoj areni„ predstaviti program koji }e sadr`ati predloge za reforme u poreskoj politici, za smawewe birokratije, dvostruko ve}i buxet za poqoprivredu i decentralizaciju. Ona je ocenila da nema nikakvog razloga da izbori budu pre zakonom utvr|enog roka – na prole}e slede}e godine, da Vlada ima {anse da izdr`i ceo mandat, kao i da je potrebno da se zavr{e zapo~eti infrastrukturni poslovi i da Srbija dobije kandidaturu za ~lanstvo u EU 9. decembra. Po wenim re~ima, jedina stranka s kojom URS razgovara o predizbornoj koaliciji je SDPS, stranka RasimaQaji}a, a u Vladi ne bi mogla da bude sa SRS-om i SNS-om, „dok u praksi ne doka`u da su se zaista promenili”. Suzana Grubje{i} je ukazala na rezultate istra`ivawa javnog mwewa po kojima 70 odsto gra|ana smatra da se „Srbija kre}e u pogre{nom pravcu”.

Predsednik PUPS-a Jov an Krk ob ab i} izjavio je u Lazarevcu da stranka ne}e dozvoliti da se ono {to je postignuto u obla sti so ci jal ne politike vrati unazad, a potpredsednik stranke Milan Krkob ab i}, po vo dom iz bor nih kal ku la cija, da PUPS-u niko ne}e nare|ivati s kim }e i}i u koalciju. Krkobabi} je rekao na skupu u Lazarevcu da politika zemqe hramqe u mnogo ~emu i treba je popravqati. – Nisam zadovoqan onim {to smo do sada postigli, ali ako ho}emo da uradimo vi{e, moramo se vi{e i potruditi. Vlast i sloboda se ne dobijaju na tacni i zato nas mora biti {to vi{e. Ne obra}am se samo penzionerima ve} i mladima koji su na{a budu}nost – rekao je Krkobabi}. On je ocenio da se politika mora mewati, da se organizacija dr`ave mora popraviti i da o~ekuje da naredna vlada u~ini sve da se dr`ava pravno uredi i da se zakoni primewuju.

poslAni~ke teme

Hvala ministru Parlament je ju~e razmatrao amandmane na zakone o pomorskoj plovidbi i o obligacionim i osnovama svojinskopravnih odnosa u vazdu{nom saobra}aju. Slika u sali bila je ista kao i prethodne dve nedeqe – od predstavni ka opo zi ci je samo poslanici SRS-a. Ministar infrastrukture Milutin Mrkowi} najavio je da }e cena izgradwe mosta kod Be{ke biti utvr|ena do 25. decembra.

– Tada }e javnost znati koliko je stvarno utro{eno za „Be{ku„. Nije cifra koju ste vi rekli, gospodine Markovi}u, ali sigurno je da }e cena biti ve}a od prvobitno planirane jer je glavni projekat zavr{en u toku gradwe – kazao je Mrkowi}. Radikali su ministra pitali “da li }e ih metar mosta kod Be{ke ko{tati koliko i metar mosta na Adi ciganliji u Beogradu”. Cena radova bi, po ugovoru, trebalo da iznosi 33,7 miliona evra.

Gde je more Radikal MomirMarkovi} “pohvalio” je “vizionarstvo” ministra za infrastrukturu Milutina Mrkowi}a jer on “jedini u ovoj vladi zna da }e se ostvariti san SRS-a o velikoj Srbiji i liniji Karlovac–Ogulin–Kar lo bag–Vi ro vitica” . – Hvala {to verujete u ideju SRS-a da }emo ostvariti veliku Srbiju i iza}i na more – rekao je Markovi}. – Ovaj zakon je, ~ini mi se, preurawen, hajde da ostvarimo prvo ideju, stvorimo veliku Srbiju, iza|emo na more koje nam sleduje, pa ga tek onda donesemo. Ministar Mrkowi} je objasnio da je razlog za dono{ewe zakona o pomorskoj plovidbi u podizawu

nivoa za{tite prava srpskih dr`avqana koji rade na pomorskim brodovima strane zemqe i stvarawe zakonodavnog okvira za pri-

vla~ewe stranih brodovlasnika da upisuju delove svoje flote u jedan od srpskih upisnika. Srbija, po posledwim podacima, ima vi{e od 5.000 pomoraca koji rade u drugim dr`avama.

Vlast za {iri dogovor Deklaraciju o Kosovu i Metohiji Vlada Srbije mogla bi Skup{tini uputiti sutra da bi sednica bila odr`ana u subotu, 12. novembra. To je potvrdila i potpredsednica DS-a JelenaTrivan, najavquju}i konsultacije u parlamentu ”jer to pitawe tra`i {iri konsenzus nego {to je prosta ve}ina”. A gde }e vlast na}i ve}inu za Vladinu deklaraciju o Kosovu i Metohiji jo{ uvek se ne zna, po{to, osim opozicionih SRS-a, DSS-a i LDPa, taj dokument ne}e dobiti ni glasove SPO-a, izuzev ako se wome “Srbi sa severa Pokrajine pozovu na uklawawe barikada, da se obezbedi sloboda kretawa, da budu primeweni svi dogovori postignuti u dijalogu Beograda i Pri{tine, kao i da se zahteva hitan nastavak dijaloga”.

DSS „protiv” Stefanovi}a Demokratska stranka Srbije zatra`ila je ju~e od Vlade da smeni {efa pregovara~kog tima Beograda Borislava Stefanovi}a jer su, kako je u okviru poslani~kih pitawa konstatovao Zoran Nikoli}, pregovori s Pri{tinom do`iveli apsolutni slom, a politika Vlade Srbije pokazala se kao “politika }orsokaka”. Istovremeno, potpredsed-

nik DSS-a, nekada{wi ministar za KiM SlobodanSamarxi} predao je u proceduru predlog deklaracije o obnovi dr`avotvorne politike o Kosovu i Metohiji, koji polazi od “su{tinske stvari da je najva`nije prekinuti dijalog s Pri{tinom jer su oni plod promene politike Vlade Srbije, kada je EU na velika vrata uvedena u ovaj proces”.

KPS oduzeo „Veliku Srbiju” Radikali su ju~e negodovali zbog toga {to je predsednika Skup{tine zajednica op{tina Kosova i Metohije RadovanaNi~i}a na putu za Gra~anicu zaustaviio KPS, pretresao mu auto, oduzeo promotivni materijal, me|u kojim je bio i ~asopis radikala „Velika Srbija”. Ni~i}u je, tako|e, s automobila uklowena oznaka SRB. – Da bismo eventualno podr`ali novu deklaraciju o KiM, insistiramo na tome da se suspenzuju

svi takozvani sporazumi takozvanog pregovara~kog tima, da se otka`e gostoprimstvo Euleksu i da se ceo problem re{avawa pitawa KiM se vrati u SB UN. Za nas je definitivno da svaka politika prema KiM mora da bude zasnovana na Ustavu, Rezoluciji 1244 i da se jedino mo`e razgovarati o modelu autonomije u sastavu Srbije – rekao je zamenik {efa poslani~ke grupe SRS-a Aleksandar Martinovi}.

Pretwa evropskoj budu}nosti Lider LDP-a ^edomir Jovanovi} upozorio je na to da je “deklaracija na kojoj radi vladaju}a ve}ina najve}a pretwa evropskoj budu}nosti Srbije od 5. oktobra 2000. do danas” jer se tu radi “o odbrani politike koja je definitivno pora`ena, {to je o~igledno i onima koji deklaraciju pi{u”. On je dodao da je potrebna deklaracija koja }e pre svega voditi ra~una o Srbima na Kosovu i Meto-

hiji, Srbima koji su „`rtva beogradske politike, koji su izvedeni na barikade i koji su taoci nemo}i vlasti na promenu kursa dru{tva”. LDP nije do sada glasao ni za jednu deklaraciju o KiM, “ne zbog toga {to nam je mawe stalo do Kosova, ve} {to nam je jasno da se od 2007. godine zlopupotebqava i postaje tu`ni izgovor za nesposobnost onih koji vode ovu zemqu”.

Osmeh za Divca Da i politi~ari imaju svoje idole svedo~i ju~era{we pojavqivawe u parlamentu legendarnog ko{arka{a VladetaDivca. Nakon sednice Odbora za omladinu i sport, na kojoj se razgovaralo o informaciji Olimpijskog komiteta i pripremama za Olimpijadu 2012. godine, iz sale je iza{la grupa ozarenih parlamentaraca vlasti i opozicije, uredno se „pore|ala“ ispred znaka Skup{tine i dr`avne zastave, na mestu ozvani~enom za obra}awe poslanika i ministara... I taman kada su se mediji za~udili i zapitali da li }e se Divac obratiti sa „zabrawenog mesta“, svenuli su blicevi, osmeh... „samo“ ovekove~en susret s ko{arka{kim asom. S. Stankovi}


c m y

politika

dnevnik

PET GODINA OD USVAJAWA, USTAV ZREO ZA PROMENE

Alibizapoliti~kuelitu Iprepetgodina,kadjeusvajan Ustav Srbije, i neki politi~ki akteri koji su u~estvovali wegovom kreirawu izra`avali su rezrevu prema pojedinim re{ewima najvi{eg pravnog akta. Tako su u Demokratskoj stranci tvrdili da Ustav nije savr{en, ali da je rezultat tada{weg politi~kog kompromisa, a kao pozitivnu stranu navodilisutodajepojednostavqenaprocedurazawegovupromenu. O ustavnim promenama u posledwih pet godina pri~a se tek sporadi~noiuskladusdnevnopolit~kim potrebama. Ustav je, s druge strane, ~esto slu`io za izgovorpoliti~kojelitizazastoju politi~kimiekonomskimreformama,ili,pak,zaodlagaweprocesadecentralizacijevlasti. Zanimqivo je, me|utim, da danas ustavne promene, iz ovih ili onih razloga, zagovaraju prvenstvenovladaju}estranke,dokopozicija, izuzev Liberalno-demokratske partije, brani postoje}a ustavnare{ewa,presvegaonakojaseti~ustatusaKosova. Sdrugestrane,pravnistru~waci ukazuju na velike mawkavosti najvi{egpravnogakta,apojedini ~akdovodeupitawewegovlegitimitet. O legalitetu je, pak, bilo dosta polemike pre pet godina zbog na~ina na koji je sproveden ustavnireferendumkojijetrajao dvadana. Profesor beogradskog PravnogfakultetaStevanLili} upozorioje,naime,natodaseUstav Srbijepetgodinaodusvajawasuo~ava s pitawem legitimiteta, a kaojedanodnajve}ihproblemanaveojepreambuluoKosovuiMetohiji.OnjeoceniodaVladaSrbijenijebilaovla{}enailegitimnadapredla`eUstav,ve}eventualno samo wegove izmene. Lili}

ukazujeinatodaUstavSrbijenijeuspeousvojojosnovnojnameri,a tojedasesa~uvasuverenitetiintegritet dr`ave jer je Kosovo u me|uvremenu proglasilo nezavisnost.

jeidajeproblemati~noto{toje najvi{ipravniaktformalnoiznadme|unarodnihdokumenatakao {to su Poveqa UN i Evropska konvencija o qudskim pravima, alidajerealnostdruga~ija.

iMeothiji,kojanepo{tujerealnost,ko~idaqeevropskeintegracijezemqe”. Zvani~nici SRS-a poru~uju da nije trenutak za promenu Ustava Srbije dok traje „intenzivna diplomatska i politi~ka borba za KosovoiMetohiju„.Zamenik{efaposlani~kegrupeSRS-aAleksandarMartinovi} oceniojeju~e da oni koji se zala`u za ustavne promene zapravo `ele da skrenu pa`wujavnostisproblemakojisu

DSS: Ne dirati

–Zbogtogasemo`ere}idaovaj ustav nije ni do`iveo svojih pet godinajerjewegovasu{tinabila odr`avawecelovitostisuvereniteta i teritorijalnog integriteta–napomiweon. Dodaojedaprepetgodina,kada je Ustav donet, Kosovo nije proglasilonezavisnost,alidajepo-

U vladaju}oj Demokratskoj strancioustavnimpromenamagovore na~elno, kao o ne~em {to treba dobro odvagati, te kao o procesukojipredstojiunekojbudu}nostikadseosvimotvorenim pitawima postigne {iroki konsenzus. Funkcioner te stranke Vlatko Ratkovi}, ina~e i pred-

Mo`esere}idaovajustavnijenido`iveosvojih petgodinajerwegovasu{tinajebilaodr`avawe celovitostisuverenitetaiteritorijalnog integriteta(StevanLili}) tomtou~iniloidatrenutno„stawenapapiruneodgovararealnosti”. Lili} isti~e i da aktuelni Ustav nije proistekao iz naroda ve}izvladaju}ihstruktura,{to, powemu,stvaraproblemwegovog su{tinskog legimititeta. Naveo

LSV: Prepreka evropskom putu Liga socijaldemokrata Vojvodine jedina je stranka iz aktuelne vladaju}ekoalicijekojajeprepetgodinavodilaaktivnukampawu zabojkotustavnogreferenduma,nezadovoqnana~inomnakojijenajvi{impravnimaktomre{enstatusAPVojvodine.Ovastrankaod tadazagovaraiustavnepromene,atajzahtevzasnivaina~iwenici dava`e}iUstavnijedobiove}inskupodr{kugra|anaVojvodine. PortparolkaLSV-ainarodnaposlanicaAleksandraJerkov ocenilajeju~edasupojedineustavneodredbedirektnapreprekaevropskimintegracijama,tedajeUstavuneskladusrealno{}uipotrebamadru{tva.OnajekazaladajeLSVprepetgodinabiousamqenu pozivunabojkotustavnogreferenduma,alidasedanaspokazujedaje Ustav„lo{zagra|aneSrbije,VojvodineiKosova”.Tako|e,navela jeidajeustavnaodredbaukojojseka`edaseuSrbijimoguprimewivatisamoaktime|unarodnogpravakojisuratifikovaniuzemqi direktna prepreka evropskim integracijama, budu}i da se najve}i brojakataEUprimewujedirektnobezratifikacije. –Tozna~idaSrbijanebimoglapostati~lanicaEUdokjeovaj ustavnasnazi–ukazalajeona.

sednik Zakonodavnog odbora Skup{tineSrbije,oceniojeju~e daustavnimpromenamatrebapristupiti nakon slede}ih izbora, i daonetrebadaomogu}edecentralizacijuive}aovla{}ewalokalnih samouprava i autonomnih pokrajina. – O~ekujem da }e {iroka javna raspravaupogledupromeneUstavakrenutive}posleizbora–veruje Ratkovi}. A uz promene koje se ti~u decentralizacije, po wegovimre~ima,„trebaijasnijedefinisati odnos me|unarodnog i unutra{wegpravakojinijenanajsre}niji na~in normiran”. Tako|e,smatradajednaodtemakoje}e seotvoritiuustavnimpromenama mo`ebitiipozicijaparlamenta, odnosnobrojnarodnihposlanika. USrpskompokretuobnoveovih dana najglasniji su zagovornici ustavnih promena. U toj stranci smatraju da najvi{i pravni akt ko~ireformskeproceseievropske integracije, pre svega zbog preambule o Kosovu. Poslanik SPO-a Aleksandar Jugovi} oceniojeju~euizjavinovinarimada „besmislena preambula o Kosovu

PotpredsednikDSS-aSlobodanSamarxi}izjaviojeju~e danetrebamewatiUstavSrbije. Samarxi} je novinarima urepubli~komparlamenturekao da Ustav sadr`i sve elemente koje treba da sadr`i najvi{ipravniaktidaseto naro~itoodnosinaodredbeo KosovuiMetohiji. –Najvi{eseatakujenapreambulu.Wunetrebamewati– rekaojeSamarxi}. bitniza`ivotgra|ana.OnjenaveoidajeUstavdonetnabazipoliti~kog konsenzusa politi~kih stranaka koje su u tom trenutku bileparlamentarneidasenemo`e mewati bez konsenzusa „kojeg sadao~iglednonema”. Predsednik Ujediwenih regionaSrbijeMla|anDinki} izjavio jeju~edatrebamewatiUstavSrbijedabisenovimtekstomomogu}iladaqadecentralizacijairegionalizacijazemqe,alidadotadatrebau~initisvedasepostoje}iustavdoslednoprimewuje,ane dabude„mrtvoslovo”napapiru. – U praksi se ne primewuje ni ono{tojedobroupostoje}emdokumentu – rekao je Dinki}. – U Ustavu se govori o ravnopravnostigra|ana,a`eneuSomborune primajuistunaknaduzaporodiqskoodustvokao`eneuBeogradu. Lider Nove Srbije Velimir Ili} smatra,pak,dasuunekimdelovima potrebne promene Ustava Srbije,alinikakokadjere~oodredbamakojeseodnosenaKosovo iMetohiju. –Ustavtrebapromenitiiprilagoditiganekimsavremenimorganizacionimodredbamakojegra|ani `ele, a pre svega u pogledu izboragradona~elnika–rekaoje Ili}novinarima. OnjeistakaodaUstavomtreba definisatidirektnobirawegradona~elnika,aliitoda„Vladane mo`e da prenese nadle`nosti na odre|ene delove teritorije, poputVojvodine”. B. D. Savi}

sreda9.novembar2011.

3

INTERVJU ALEKSANDAR JUGOVI], DIREKTOR SPO-a

Dr`avnivrhnije pritiskaoVuka –Neistinajedasupredstavnici vrha dr`ave tra`ili od predsednika SPO-a Vuka Dra{kovi}a da sprovodi dr`avnu kosovskupolitikuili}eusuprotnom morati da napusti Vladu–tvrdiuizjaviza„Dnevnik“direktortestrankeAleksandar Jugovi}, demantuju}i medijskespekulacije. – Ceo dan vrte na jednoj TV-stanicidajedr`avni vrh imao sastanak s liderom na{e stranke i da je od wega zatra`eno da vodi dr`avnu kosovskupolitikuili }e morati da napusti Vladu. To jela`!Nijebilo takvog sastanka, niti takvog zahteva,jerjetobesmislenopo{to biVladautomslu~ajutra`ila sama svoj pad jer bi izgubila parlamentarnuve}inu. l Odakle onda dolaze takvespekulacije? – Dolaze verovatno od stranaka iz vlasti, ili partija opozicije koje `ele da destabilizuju Srbiju pred 9. decembar,kadaSrbijao~ekujekandidaturuza~lanstvouEU.Tikojisuplasiralineistinu,`ele da ugroze evropski put Srbije nasvakimogu}ina~in,daseantievropskoraspolo`eweiantievropska histerija {iri po Srbiji. l Jo{ uvek nije glasano o (ne)poverewuministruSr|anu Sre}kovi}u, da li se to

mo`da dr`i u nekoj rezervi dapromenitestav? – SPO je 2008. godine na listi ZES-a dobio podr{ku gra|anazaevropskiputinikakoi nikadatajistiputne}eugroziti. Smatramo da je stabilnost Vladeveomapotrebna,asve{to radimo u posledwe vreme i te na{erazlikeuveziskosovskom

politikom,jesupomo}Vladida nastavievropskeintegracije. l Zna~i li to da verujete da}epro}imi{qeweVlade vezano za interpelaciju radikala, da Sre}kovi} radi pozakonu? –Verujemdanepostojive}ina da na bilo koji na~in ne bude usvojenizve{tajVladeoraduministarstvazadijasporu.Smatram da do 9. decembra ni SPO, niti bilo ko u Srbiji ne sme na bilo kojina~inugrozitisamuvladaju}u koaliciju, odnosno Vladu Srbije,jerbitobiojasansignalda suantiervopskesnageodnelepobeduida9.decembardo~ekujukao dankoji}enasvratitiudevedesetegodinepro{logveka. S. Stankovi}

Subotica:Dinki} obe}avairazre{ava LiderURS-aMla|anDinki}jerekaoda}e,zahvaquju}iZakonu ofinansirawulokalnesamouprave,narednibuxetgradaSubotice iznositipetmilijardidinara,tojedosadarekord.Dinki}jenajavioida}euskorostranekompanije,„Kontinental”,„Kalcedonija”i„Svarovski”,kaoisuboti~ki„Alpak”dobitipodsticajezazapo{qavaweiotvoritinovih2.000radnihmesta.Dinki}jeuSuboticipredstaviosvojpoliti~kiprogramirekaodaje„zboglo{e komunikacije”jo{predesetdanaizstrankeiskqu~enNemawaSimovi},kojije~lanGradskogve}azadu`enzasport,omladinuiturizam.Nije`eleodetaqnodarazla`ezbog~egajeiskqu~en,samo jekratkorekao„imamonekolikorazloga,jedanje{tonijebiou komunikacijisministarstvima”. Prvi~ovekURS-ajerekaoida}enosilacnalistizagradskeizboreuSuboticibitidirektorsuboti~kebiblioteke DraganRokvi}. S. I.


4

ekonomija

sreda9.novembar2011.

ZAVR[ENAIZGRADWATEHNOLO[KOGPARKA UVR[CU

POKRAJINSKIOMBUDSMANANIKOMU[KIWA-HAJNRIHOPORESKIMDUGOVAWIMA

Du`nicima opomene, a ne obave{tewa

Posao za hiqadu Bana}ana UVr{cujeju~ezvani~nozavr{ena izgradwa Tehnolo{kog parka koju su finansirali Evropska unija, op{tina Vr{ac,„Elektrovojvodina„,Telekomidrugifinasijeri.Po onome{tojeuovomprojektuzacrtano, ovde }e u periodu od pet godinauindustrijskimpogonimabitiobezbe|enposaozaoko hiqadu,mahomkvalifikovanih radnikaizovoggradairegiona ju`nogBanata.

`ila2,7milionaevrazavodnu, kanalizacionuiputnumre`uu parku,VladiSrbijeiPokrajini na pru`enoj pomo}i. „Elektrovojvodina„jeuizgradwitrafoa ulo`ila 200 milona dinara,aop{tinajeulo`ila1,3milion evra u opremawe elektro, gasnim i telekomunikacionim sistemom. – Ovaj projekat predstavqa politi~ku podr{ku Evropske unijestvarawuuslovazaulazak

dnevnik

@iteqiVojvodineiovusedmicu}eprovestiupoku{ajimadarasvetlesvojastaraporeskadugovawa.PokrajinskiombudsmanAniko Mu{kiwa-Hajnrih obja{wava da je umesto obave{tewadu`nicimatrebaloposlatiopomene. Obave{tewanisupredvi|enapropisimakojiseodnosenaporeskeobavezegra|ana.Opomene,pak,jesu,ipropisimajeregulisanodanakon westrankaimapetdanadaizmirisvojeobaveze. U tom roku mo`e se obratiti Poreskoj upraviitamoraspravitisvaspornapitawavezanazavrstuiiznosporezakojisudospelina naplatu.

U kancelariji ombudsmana smatraju da bi opomenebileboqere{ewejertadanebibilo bespotrebnezabuneiuznemiravawa. Preokodvenedeqe,dapodsetimo,naadrese gra|ana stigla su obave{tewa o nepla}enom porezu. Regionalni centar „Novi Sad„ PoreskeupraveSrbijeposlaoihjena260.000adresa.Timaktimaobveznicisuinformisanioduguiodwihjetra`enodaizmiresvojeobaveze jerbislede}ikorakporeznikatrebalodabude opomenaire{eweoprinudnojnaplatiipotom plenidba stvari radi naplate poreskog duga. Najvi{eprimedbigra|anisuimalinatp{to suobave{tavaniodugovimakojesuodavnopla-

tiliilisuzastareli.Posebnosubilipotresenionikojisudobiliopomenunaimepreminulih~lanovaporodice. D.V.

UPOZOREWEIZEKONOMSKOGINSTITUTA

Nema znaka srpskog privrednog oporavka Gradise iprvafabrika Ju~e supotpisaniiugovorioprodajilokacijauTehnolo{komparkukojesukupiledoma}eistranefirmezaizgradwu svojihpogona,apolo`enjeikamentemeqaczaizgradwu prvefabrikeitalijanskekompanije„Lampist„. Vlasnik ove kompanije Enriko Vi}enci je rekao da oni ve}imajuobezbe|enotr`i{tezasvojeproizvodeu „Hemofarmu“,zakoji}eproizvoditialuminijumskuambala`uza lekove,aliiuinostranstvu. Lokacije u Tehnolo{kom parku su jo{ kupile i firme „FreseniusMedicalCare“izNema~ke,kaoibeogradskekompanije„Roster“i“Escadelight“. Predsednik Vlade Vojvodine Bojan Pajti} je izrazio zadovoqstvo{to }eovdena}iposao hiqaduradnika izVr{ca,alii iz  ~etiri op{tine ju`nog BanatakojesuistovremenonajnerazvijenijeuVojvodini.Naglasiojedaje{iromVojvodineizgra|eno15tehnolo{kihparkova,aposebnojezna~ajno{tose ovdeve}ustartupotpisujuugovorioizgradwi~etirifabrike,idodaodane morajudabudu uspe{nesamoindustrijskezone krajvelikihkoridora,kakavje Koridor 10. Predsednik op{tine Vr{ac ^edomir@ivkovi} zahvaliose DelegacijiEUkojajeovdeulo-

Srbije u EU, a prvenstveno za otvarawehiqaduradnihmestau ovom tehnolo{kom parku. Pomogli smo realizaciju brojnih projekataidustrijskih zona{iromSrbije svi{eod 200milionaevraipostalinajve}idonatoruSrbiji.Onesukonkretan dokaz opredeqenosti EU za to daSrbijapostane ~lanicaito se ~ini da bismo bili ja~i, ostvarili ve}u proizvodwu i ostvarili ve}u vrednost u dru{tvu –tosuna{iciqeviupripremiSrbijeza~lanstvo uEU– rekaojeizme|uostalogzamenik {efa Delegacije EU u Srbiji AdrianoMartins. R.Jovanovi}

„Fijatov” kooperant u Sremskoj Mitrovici Italijanska kompanija „Lames„ s.p.a, kooperant „Fijata„ koji }e u Sremskoj Mitrovici graditi fabriku podiza~a automobilskih stakala i u woj zaposliti 250 radnika, uveliko se priprema za po~etak proizvodwe. Stimuvezi,sutra}euprivremenom pogonu „Lamesa„, u industrijskojzonigradanaJara~kom putu, biti potpisana dva dokumenta, re~eno je ju~e Tanjugu u Gradskoj skup{tini. Prvi dokument se odnosi na podsticajna sredstvaodpo7.000evrapozaposlenom radniku u mitrova~kom

pogonutekompanije,koja}ebiti obezbe|enaizrepubli~kogbuxeta, dok }e drugim „Lamesu2 biti odobreno besplatno ustupawe gra|evinskeparcelezaizgradwu novefabrikeunovoformiranoj IndustrijskojzoniSever2. Nadle`niisti~udajefabrika „Fijatovog„ kooperanta trenutno najve}a grindfild investicija na gradskom podru~ju Sremske Mitrovice, koja treba daserealizujeunaredne~etiri godine. Na obuku je ve} upu}eno prvih50budu}ihradnika,kojisu izabrani u konkurenciji gotovo 1.000prijavqenih.

KURSNA LISTA NARODNE BANKE SRBIJE Zemqa EMU Australija

Valuta evro dolar

Va`iza 1 1

Kupovni zadevize 100,1526 75,0938

Sredwi Prodajni Kupovni za za za devize efektivu efektivu 102,1965 76,6263

104,5470 78,3887

99,8460 74,8639

Kanada

dolar

1

71,6758

73,1386

74,8208

71,4564

Danska

kruna

1

13,4507

13,7252

14,0409

13,4095

Norve{ka

kruna

1

12,9614

13,2259

13,5301

12,9217

[vedska

kruna

1

11,0688

11,2947

11,5545

11,0349

[vajcarska

franak

1

80,6317

82,2772

84,1696

80,3848

V.Britanija

funta

1

116,8233

119,2074

121,9492

116,4656

SAD

dolar

1

72,8648

74,3518

76,0619

72,6417

Kurseviizovelisteprimewujuseod08.11.2011.godine

Stru~waciEkonomskoginstitutaocenilisuju~edasenemo`e uo~iti oporavak privredne aktivnostiuSrbijiidanemarazlogazaoptimizamjerjerastindustrijskeproizvodwevrloskroman, a opadawe izvoza je izrazitije nego opadawe uvoza. Oni su ocenili da }e se inflacija na krajuovegodinekretatiurasponuodosamdodevetposto,arast brutodoma}egproizvodaprognozira se na nivo od dva do 2,5 posto. Urednik ~asopisa „Makroekonomske analize i trendovi” (MAT)VladimirVu~kovi} istakao je da se prera|iva~ka industrija ne oporavqa, a pozitivan rezultatunekolikowenihoblasti odra`ava samo nadoknadu prethodnog izuzetnog pada. Kada je re~ o spoqnotrgovinskoj razmeni,usporenajedinamikaizvoza,awegovoposustajawejeposledicapadavrednostiizvoza`itarica, gvo`|a, ~elika i obojenih metala,dokpreostaliindustrijski izvoz i daqe bele`i dobre rezultate, naveo je on. Vu~kovi} jeukazaonatodabi,ukolikobi se obistinile pesimisti~ne prognoze u vezi s radom „Ju-Es stila” u Smederevu, to zna~ilo jo{ lo{ije rezultate proizvodwe i izvoza Srbije. Po wegovim re~ima,akoseprojektujuvrednostidokrajagodinenaosnovusada{wih trendova i prema optimisti~nim pretpostavkama, procewujeseda}eu2011.rastindustrijskeproizvodwebitidvapo-

~u}ida}euseptembrubilansbiti pozitivan zahvaquju}i kredituodmilijardudolarazapokrivawedeficita,alidabisesituacijamoglapogor{atiakosene intenzivira priliv direktnih stranihinvesticija. Onjeukazaonatodasepriliv kapitalauSrbijugotovozaustavqa, a osnovni uzro~nik jeste krizauevropskombankarstvu. –Ukolikousledkrizestrategija smawivawa plasmana u evropskim bankama bude dominantna,Srbijamo`ebitite{ko pogo|enajerjevisokozavisnaod uvozakapitala–naglasiojeon. Po Stamenkovi}evim re~ima, o~ekivana posledica zaustavqawa priliva kapitala na kratak rok bi}e smawivawe doma}ih plasmana banaka, produbqivawe krizelikvidnostiidaqesmawivawedinamikeaktivnostiuprivrednomsektoru.Posledicatoga u monetarnom sektoru bila bi smawivawe deviznih rezervi, a takavefekatmogaobinakratak rokbitineutralizovanpovla~ewem kredita MMF-a, ali bi na sredwirokostaoaktuelan,dodao jeon. Stamenkovi}jenaveodasesada postavqa pitawe koliko }e kriza u evropskom bankarstvu i na~ini wenog prevazila`ewa usloviti da negativni kreditni saldobudeve}iodonogaskojim se ra~unalo da nije bilo drugog talasa krize, {to bi zahtevalo prilivinvesticijaintenzivniji odplaniranog. E.Dn.

Duli}:Gra|evinapredkolapsom Ministar`ivotnesredine,rudarstvaiprostornogplanirawa OliverDuli} izjaviojedajesituacijasprodajomstanovanatr`i{tuuSrbijizabriwavaju}aida}enarednihdanaiznetipremijerunekolikopredlogazare{avaweproblemautojoblasti. On je kazao da je sada{wa situacija veoma destimulativna za svebudu}einvestitoreidakaoposledicamo`enastatipadinvesticijaugra|evinskojindustrijinarednihgodina. –Postojivelikaopasnostda}egra|evinskaoperativado`ivetikolaps.Dr`avajeu~inilasve{tojemogla,pokrenulismo velike projekte i velika gradili{ta u svim gradovima Srbije, aliizostajuprivatniinvesticijeimislimdajetogasvestansvakokosetimebavi–kazaojeDuli},dodaju}idasezatakvute{ku situacijumorana}ire{ewe. sto, a rast prera|iva~ke industrijejedanprocenat. Vu~kovi}jenaveodaseo~ekuje dagodi{wirastizvozaSrbijeu 2011.budeizme|u12i13posto,a da rast uvoza bude ni`i za jedan procentnipoen,idodaodajelo-

{e {to opada uvoz sirovina jer tonajavqujeniskuprivrednuaktivnost. Saradnik MAT-a Stojan Stamenkovi} upozorio je na to da je mogu}e zao{travawe platnobilansne situacije u Srbiji, isti-

IZBORIZANAJBOQEPREDUZETNIKEIPREDUZE]A

Mali a, uspe{ni

Uobi~ajenojedasekrajemgodinebirajunajuspe{niji,apredstavnicimalogisredwegbiznisaimaju{ansudapostanuuspe{niudvekategorije.AgencijazastranaulagawaipromocijuizvozaRepublikeSrbije–SIEPAbira izvoznikagodineukategorijimalihisredwih preduze}a. Ovaj izbor podr`ava ProKredit

bankakojave}godinamauspe{nopratimalii sredwibizniskodnas.Najizvoznikau2011.~eka nagrada vredna 15.000 evra, a sastoji se od edukativnog seminara, koji }e realizovati uz pomo}renomiranihkonsultanstkihku}auJugoisto~nojEvropi,istudijskogputovawauNema~ku.

OvabankaiovegodineorganizujesvojtradicionalniizborzaProBiznislidera2011,gde }ebiratipotrinajuspe{nijaukategorijimalo,sredwepreduze}eipreduzetnik.Dodeli}e seispecijalnanagradapreduze}ukojejeostvarilo najve}i uspeh na poqu unapre|ewa energetskeefikasnostiusvomposlovawu. D.V.

DNEVNIIZVE[TAJBEOGRADSKEBERZE Pet akcija s najve}im rastom

Promena %

Cena

Morava, Po`arevac

19,74

364

1.820.000

Privredna banka, Beograd

15,38

375

187.490

Go{a monta`a, Velika Plana

11,63

2.400

24.000

Arhitektura i urbanizam, Zemun

10,00

1.100

325.600

5,88 Promena %

1.800 Cena

5.400 Promet

-5,56

170

34.000

Polet, Novi Pazar Pet akcija s najve}im padom Energoprojekt Visokogradwa, BG BIP u restrukturirawu, Beograd

-5,41

35

1.050

Karneks, Vrbas

-5,35

1.750

17.500

Mlekara, Subotica Voda Vrwci, Vrwa~ka Bawa Vojvo|anskih top-pet akcija Soja protein, Be~ej

BELEX 15 (539,54

Promet

Naziv kompanije

0,59)

Promena %

Cena

Promet

AIK banka, Ni{

0,77

1.837

3.164.781

NIS, Novi Sad

0,00

633

5.853.716

Komercijalna banka, Beograd

0,00

1.890

94.500

Imlek, Beograd

4,57

2.311

1.800.045

Soja protein, Be~ej

-0,35

565

7.135.830

Energoprojekt holding, Beograd

-0,23

426

289.008

Agrobanka, Beograd

0,76

4.097

2.052.744

Aerodrom Nikola Tesla, Beograd

1,18

516

3.056.225

Jubmes banka, Beograd

-4,17

1.150

1.150.000

-0,70

14.399

143.990

-2,39 Promena %

4.490 Cena

68.450 Promet

Univerzal banka, Beograd

0,00

2.815

0,00

Metalac, Gorwi Milanovac

0,29

1.710

324.900

-0,35

565

7.135.830

Jedinstvo Sevojno, Sevojno

0,00

5.200

119.600

NIS, Novi Sad

0,00

633

5.853.716

Alfa plam, Vrawe

0,00

7.500

0,00

Mlekara, Subotica

-4,17

1.150

1.150.000

Tigar, Pirot

0,58

524

1.124.083

^oka duvanska industrija, ^oka

0,00

1.800

324.000

Veterinarski zavod, Subotica

0,00

361

0,00

Fabrika {e}era, Crvenka

-0,51

3.900

136.500

Sviiznosisudatiudinarima


„FIJAT”OPREMAFABRIKU UKRAGUJEVCU

Stigla oprema izJapana

Fabrika„Fijatautomobili Srbija„saop{tilajeju~edaje u Kragujevac stigla prva od dvelinijezapogonPreseraj,u koji }e biti ulo`eno oko 100 milionaevra.Kakosenavodi u saop{tewu, iz japanske fabrike„Komacu„isporu~enaje linijaodpetautomatizovanih pres a najn ov ij e tehn ol og ij e koja se primewuje u „Fijat grupaciji„.

Oprema, te{ka blizu 3.000 tona, stigla je iz Japana brodom u 587 sanduka koji su zau- zimali6.500kvadratnihmetara. Brod je iz Japana krenuo predvamesecaiploviopreko Sueca sve do Konstance u Rumuniji,odaklesupresedopremqene u kragujeva~ku fabriku. Po~etkom slede}e godine sti}i}eidruga„Komacu„linija presa koja }e u okviru grupacijeprviputbitiinstaliranau„Fijatovoj„fabrici uKragujevcu. Usaop{tewusenavodiida su u „Fijatovoj„ fabrici u Krag uj evc u kraj em okt ob ra proizvedene prve {koqke novog modela automobila „l-zero”. Proj ek at se odv ij a prem a utvr|enom planu, {to podrazumeva i proizvodwu probne serije novog modela do kraja 2011. godine, najavili su iz „Fijata„.

sreda9.novembar2011.

5

JAVNIDUGPRE[AOGRANICUNAKON[TOJEKURSEVRAPREMA[IO102,2DINARA

Vladaprekr{ila zakon,aSrbija prezadu`ena Javni dug Srbije prema{io je granicu od 45 procenata u~e{}a u bruto doma}em proizvodu. Time je prekr{enZakonobuxetskomsistemu koji je gorwu granicu dozvoqenog javnog duga Srbije postavio upravo na 45 odsto BDP-a, a zemqa je u{la u zonu visoke zadu`enosti. Tobaremproisti~eizra~uniceekonomistedrMiroslava Zdravkovi}a, nedavno objavqene na sajtu makroekonomija.org,~ijijeovajstru~wak urednik. Naime, Fiskalnisavet,telooddr`ave zadu`eno da prati koliko odgovornu buxetsku politikuvodiVlada,nedavnojeobjaviodajeudeojavnogdugau BDP-u s posledwim zadu`ivawem dostigao 44,4 procenta. Zdravkovi} je, pak, upozorionatodasetajpokazateqzasniva na pretpostavci da }e BDP u ovoj godini iznositi 3.359milijardidinara,uzkurs od101,2dinarapokojemjeevro obra~unat. Pri kursu evra od 102,2dinaraprobijasegranica zacrtana fiskalnim pravilima. „Rast kursa evra na vrednostodvi{eod102dinarazna~idajefiskalnopraviloprekr{eno”,naveojeZdravkovi}u svojojanalizi. Upravosetodogodiloodpo~etkanedeqe:jedanevrojeuponedeqakpozvani~nomsredwem kursu Narodne banke Srbije vredeo 102,3 dinar, dok je ju~e doma}a valuta blago oja~ala i

Situacijabilaneuporedivoboqaprepo~etka globalneekonomskekrize:2008,kadajedr`avno zadu`eweSrbijebilo8,7milijardievra iugodi{wemBDP-uu~estvovalo stek26procenata zaustavila se ta~no na navedenojgraniciod102,2dinara.Odnosno, da budemo precizniji, zvani~no je ju~e evro vredeo 102,1965dinara. Tako je Srbija samo godinu dana od uvo|ewa pravila o fiskalnoj odgovornosti i postavqawa granice o zadu`enosti neve}ojod45odstoBDP-a,uspela ta pravila da prekr{i.

MRE@AZARESTITUCIJUZAHTEVAPROMENUPROPISA

Zaotetotreba novizakon

Mre`a za restituciju uputilajeju~eVladiSrbijeinicijativu da se po hitnom postupku promeneZakonovra}awuoduzete imovine i obe{te}ewu, Za-

{taju Evropske komisije navodi da „transparentna i nediskriminatorska primena Zakona o javnoj svojini i Zakona o restituciji mora biti obezbe-

kon o javnoj svojini i Zakon o planirawuiizgradwi. U saop{tewu, Mre`a navodi dajeudopisuupu}enompremijerupodsetilanatodaseuizve-

|ena”idamorajubitipreuzete dodatnemeredabibilaobezbe|ena primena nediskriminatorskog i transparentnog vra}awaimovinegra|animaipre-

nosa dr`avne svojine na druge korisnike. Mre`anavodiidajepretri danaistekaorokukojemje„Ministarstvo finansija bilo du`nodapropi{eobrazaczahteva zarestituciju,na~inipostupak prijema i obrade zahteva, kao i oblikisadr`inuizvodaizevidencije”. U saop{tewu je re~eno i da pojedineslu`bezakatastarnepokretnosti i daqe potra`iocimaoduzeteimovinenapla}uju tro{koveizradedokumentacije bezobziranato{topoZakonu vi{enemajupravonato. Usaop{tewusedodajeidaje to samo deo „ozbiqnih identifikovanihproblema”kojinisu uskladusobe}awimada}eVlada biti posve}ena efikasnoj primeni usvojenih zakona, {to ne}e biti mogu}e bez promena tih zakona i me|usobnog uskla|ivawa.

SUTRA„SJAJ”NANOVOSADSKOMSAJMU

Satovi„parishilton” uNovomSadu Na Novosadskom sajmu sutra se otvara Me|unarodna izlo`ba zlatarstva i ~asovni~arstva„Sjaj“,nakojoj}esepredstavitioko40izlaga~aizSrbije,Hrvatske,BosneiHercegovine, Makedonije, Turske i Italije, re~eno je na ju~era{wojkonferencijizanovinarenaNovosadskomsajmu.Bi}e izlo`ennakitodzlata,srebra i drugih plemenitih metala, dijamanata, brilijanata, bisera,sinteti~kogkamewazazlatarstvo, ma{inski bru{enih

c m y

ekOnOMiJA

dnevnik

cirkona, kao i oprema i alat za izradu zlatnog nakita. Svoj radpredstavi}e~lanoviUdru`ewa zlatara „Novi Sad“, a svojeznaweprikaza}eiu~enici zlatarskog smera Sredwe ma{inske {kole iz Novog Sada.Izlaga~iizoblasti~asovni~arstvaizlo`i}ekolekcije sat ov a „prins es“, „fejm“, „kraun“,„holivud“,apremijerno}ebitipredstavqenii~asovnicispotpisomsvetskipoznatemanekenkeiglumiceParis Hilton.

Izlo`ba„Sjaj„odr`avaseu hali„Master“,auKongresnom centruNovosadskogsajmabi}e odr`anonekolikoposlovnihi stru~nih skupova i predavawa i uru~ene nagrade za kvalitet idizajnproizvoda. Izlo`ba „Sjaj” traje do 13. novembra,aulazje,zbogbezednosnih mera,  iskqu~ivo iz aule Novosadskog sajma. Kapije Novosadskog sajma otvorene suod10do19~asova,aulaznicako{ta250dinara. D.Ml.

Usvajawetihpravila–donetih na osnovu iskustava mnogih evropskihzemaqakojesunataj na~inzakonskiograni~ilepotencijalno zadu`ivawe svojih vlada,krajempro{legodineje izazvaloretkonepodeqenupodr{ku svih ekonomista. Ipak, ispostavilo se da je ova vlada prekr{ila zakon koji je sama predlo`ilainijeuspeladase

tih pravila dr`i ni ~itavu godinu. Da je Srbija probila granicu javnog duga od 45 odsto BDP-a tvrdi i saradnik Ekonomskog instituta Ivan Nikoli}, koji je ovih dana izjavio da se to desilo jo{ krajemseptembraidadr`avno zadu`ewe sada u BDP-u iznosi47odsto.Nikoli}ka`e da se ~ini i da bi tu ~iwenicu mogla potvrditi i misija Me|unarodnog monetarnog fonda, koja trenutno boraviuSrbiji. Jo{ pro{le godine u~e{}ejavnogdugauBDP-uSrbije iznosilo je 41,5 odsto. Situacijajebilaneuporedivoboqaprepo~etakglobalneekonomskekrize:2008.godine dr`avno zadu`ewe Srbije bilo je 8,7 milijardi evra i u godi{wem BDP-u je u~estvovalostek26procenata. Ipak,dr`avajetada,dabiuspeladabezve}ihpotresaispuwavaobavezepremabuxetskimkorisnicima,po~eladasezadu`ujeubrzanimtempomiodtadaje dug porastao ~itavih {est milijardi evra. Ipak, treba re}i dajeovajnivozadu`enostiSrbije i daqe veoma daleko od onogkojegimajupojedineevropske zemqe koje su u{le u krizu javnogduga,poputGr~keiItalije, ~ije dr`avno zadu`ewe prema{uje100postoBDP-a,ali jeijasansignal{tanaso~ekujeakosene{toozbiqnonepromeniuna~inunakojisetro{i buxetskinovac. V.^vorkov

DANASPO^IWURAZGOVORI SMMF-om

Kontrolori vireubuyet

Zvani~nirazgovoripredstavnika Srbije i misije Me|unarodnog monetarnog fonda, povodom prve revizijearan`mana„izpredostro`nosti„,po~e}edanasodr`avawem plenarnog sastanka u Narodnoj banciSrbije. Razgovori srpskih vlasti i misije MMF-a u okviru prvog kvartalnog razmatrawa rezultata u sprovo|ewu aktuelnog stend-baj aran`manapo~elisu3.novembrau Beograduitraja}edo15.novembra, najavilajecentralnabanka. Tokom posete misije, koju ovom prilikom predvodi regionalni predstavnikMMF-azaCentralnu iIsto~nuEvropuMark Alen,bi}e razmatrana teku}a makroekonomskakretawauzemqiiizgledi zaprivrednirastoveinarednegodine,kaoisprovo|ewemonetarne politike, primena dogovorenih merafiskalnepolitikeukontekstuja~awafiskalneodgovornosti istrukturnemere.Posebnapa`wa bi}e usmerena na formulisawe okvirabuxetaza2012,usagla{enog s fiskalnim pravilima, kao i na mere ekonomske politike radi ubla`avawa spoqnih rizika i eventualnog preno{ewa efekata svetskekrizenaSrbiju. Aran`man koji je Srbiji odobren29.septembrauiznosuod935,4 milionaspecijalnihpravavu~ewa (oko 1,1 milijarde evra) zakqu~en jeizpredostro`nosti,odnosnobez nameredasesredstvakoriste,osim u slu~aju platno-bilansnih potrebazemqe.Uskladusazakqu~enim aran`manom, rezultati dogovorenog ekonomskog programa prati}e sekvartalnouokviru{estrazmatrawa,kojaimajuzaciqocenunapretka ostvarenog u sprovo|ewu aran`mana.


6

POQOPRivRedA

sreda9.novembar2011.

dnevnik

JESEWIIZLOVRIBENANAJVE]EMSLATKOVODNOMRIBWAKU

Barnam{araninefale

Wivulak{e zapaliti negozaorati Nevladina organizacija „Zelena patrola„ saop{tila je da zemqoradnici{iromVojvodinepaqewemostatkaletinenawivama izazivajupo`are,zaga|uju`ivotnusredinu,ugro`avajusaobra}aji uni{tavajuplodnostzemqi{ta. „Zelenapatrola„ jemedijima dostavilaivideo-zapisenakojimasevidikakogoremnogewive{iromVojvodine. Jed an od zem qor adn ik a na snimk u ka` e da je sves tan тогаdajepaq ew estrw ik e,sla-

me i kuk ur oz ov in e zak on om zab raw en o.Onjenav eoidaje sves tan тога da „nij e norm alno”dasewiv apal i,alijedodaoda„nem adrug ogre{ ew a„. – [ta da radimo kad wiva ne mo`edasezaore? Zardanasvakihdesetmetarastaje{iodgu{uje{ plug? Ovako je lak{e – rekaojetajzamqoradnik. „Zelena patrola„ je od nadle`nihzatra`iladakona~noprimenezakonidapo~nudaka`wavajunesavesnezemqoradnike.

SOMBORSKIKOMBINATRE[AVAPROBLEM VI[KAZAPOSLENIH

Otpremninau „Panonki”90evra Somborskivaro{kiSocijalno-ekonomski savet se nedavno zvani~no oglasio povodom stawa u pro{le godine privatizovanoj Prehrambenoj industriji „Panonka“ikonstatovaodaje,i poredte{kesituacijeukojojje ova firma, postignut dogovor sindikataiposlodavcaoisplati otpremnina onim radnicima koji ne `ele vi{e da rade u ovom preduze}u. Kako su ~lanove SES-a obavestili poslodavac,odnosnovlasnikigeneralnidirektor„Panonke“Predrag Lu~i} i Samostalni sindikat, postignut je wihov me|usobni dogovordaradnicikojiseopredelezaotpremninemogudao~ekuju dinarsku protivvrednost od90evrapogodiniradnogsta`a,kaoiispla}eneostaleprinadle`nosti i obaveze iz segmenta socijalnog programa, dodu{euz„ogradu“da}esvebiti ispla}eno na na~in i po dinamici koja ne}e „dovoditi u pitawestabilnostiprofitabilnost“ovogpreduze}a,{tagodto upraksizna~ilo. „Panonku“ je svojevremeno, ta~nije u julu pro{le godine, privatizovao „Kin|a agrar“ a na osnovu ugovora s Republi~-

komagencijomzaprivatizaciju, pokojemjeza70odstokapitala trebalodabudepla}eno200.000 evra uz do sada neuobi~ajeno osloba|awenovogvlasnikaobaveze da nastavi osnovnu delatnost,uovomslu~ajupreradumesa. U trenutku preuzimawa od „Kin|a agrara“, ina~e }erkefirme„Lu~i}grupe“,kompanije registrovane u Novom Sadu, „Panonka“jeimala103zaposlena radnika, od kojih je ogromna ve}ina, upravo u organizaciji Samostalnog sindikata, zimus protestovalaprotivnovogvlasnika zbog, kako su tada tvrdili, hroni~nog neispla}ivawa zarada, doprinosa, putnih tro{kova, nepostojawa sistematizacijeradnihmesta,alii{ikanirawa i pretwi sindikalnim aktivistima.O~iglednojedaje Samostalni sindikat postigao harmoniju u odnosima s novim vlasnikom,~emumo`eposlu`itiinezvani~nipodatakdasena ovakavodlazakiz„Panonke“odlu~ilovi{eod90radnikakoji suseve}prijavilinaevidenciju Nacionalne slu`be za zapo{qavawe,ra~unaju}inaoveotpremnine. M.Miqenovi}

URibarskomgazdinstvu“E~ka” u Lukinom Selu, nadomak Zrewanina, na na{em najve}em slatkovodnomribwaku,upunomjekujejesewiizlov,ilikakoalasivoleda ka`u “`etva” {arana. “E~ka” organizuje proizvodwu na tridesetak jezera koja se trenutno prostirunaoko1.700hektara–odLukinog Sela, preko ^ente, do Melenaca i Srpskog Itebeja. Oko 200alasatrenutnoizlovqavanajudaqenija jezera. [arani se dopremaju do centralnog pogona u LukinomSelu,gdesevr{iklasifikacija,aprimercikoji}ezavr{itiuprodajisme{tajuseutakozvanezimovnike. – U stvari, sve je podre|eno “udarnom” mesecu decembru i

naproizvodwe,alokalnazajednica mo`e o~ekivati otvarawe novihradnihmesta. „Karneks“}eimatiprilikuda, prvi put posle nekoliko godina, prodajesvojusto~nuhranudrugim proizvo|a~ima,kaoidaotkupqujetovqenikepounapreddogovorenojceni. Generalni direktor te kompanije Hju Mekrejnolds je naglasio dase„Karneks“iUdru`eweproizvo|a~asviwamoguponositipostignutim sporazumom jer }e wime biti zaustavqeno smawewe sviwskogfondauSrbiji,kojijeu posledwe ~etiri godine gotovo prepolovqen.Onjenapomenuoda

–Poslemalekrize, o~ekujemo dobru poslovnu godinu. Optimizam zasnivamo na ugovorenim poslovima za 2011, ali i povoqnom kalendaru posnih crkvenih praznika u narednojgodini–isti~e Radulovi}, a alasisuzadovoqnii cenom, koja sada iznosi 300 dinara za kilogram{arana. Na RG “E~ka” uspe{no sprovode i obimne investicioneradove.Utokujerekonstrukcijazimovnikaijezera u^enti,tepro{irewetrijeze-

ra u Mu`qi, gde }e se u proizvodwu uskoro staviti novih 70 hektara. @.B.

AGRARNAGODINAZASEQAKE–OSREDWA

Paori~uvajupoqoprivredu, apolitikajekvari Ministar poqoprivrede i trgovineDu{anPetrovi} ocenioje da je ova poqoprivredna godina biladobrajersuostvarenizadovoqavaju}irezultatiuproizvodwi `itarica, rekordni u izvozu, doma}e tr`i{te je stabilizovano, nema opasnosti od nesta{ica hrane...Paorideletajutisak,ali zaslugenepripisujuniministru, nidr`avi,niwenimagranimmerama. –Nijezatozaslu`naovavlada ve} poqoprivrednici sami. Ni{ta od ove dr`ave nismo dobli osim30odstood14.000dinarapo hektaru jer, ispla}ene su subvencijeonimakojinemajuvi{eod30 hektara.Izostalasubespovratna sredstvazainvesticije,atojenajva`nije; nije bilo ni regresa za |ubrivo...Za{tosenepohvaletimekolikojep{enicedosadzasejano? Rezultati setve su katastrofalni,aneposejanewivesuogledaloagrarnihmerakojejeovavladadonela–ka`eza„Dnevnik”poqoprivrednik iz Ka}a, prvi ~ovekKluba100PplusVojislavMale{ev. Powegovimre~ima,kreditina kojimasezasnivaceopaketagrarnih mera zapravo su slaba podr{kapoqoprivrednicimajersene mo`euozbiqnijeinvesticijeu}i s 50.000 evra. Toliko, dodaje, ko{taslabijitraktor,apritomsu zajmovi s kamatom od osam posto nepovoqniji nego prethodnih godina.Adrugihmerainijebilo. Uzprelazneocenezaproizvodwuiizvoz`itaricaresorniministar ocewuje i da je tr`i{te mleka,zarazlikuodprethodnegodine, stabilno i da nema opasnostiodnesta{ice,teda}eutoku

Sviwarstvoimavajde od„Karneksa” Industrija mesa „Karneks“ i Udru`ewe proizvo|a~a sviwa SUS u Vrbasu potpisalisuugovoroostvarivawu programa organizovane proizvodwe, kojim }e biti omogu}eno o~uvawe i razvoj doma}eg sviwarstva u narednim godinama, saop{tilajetakompanija. „Karneks“ }e lokalnim farmerimaobezbeditisto~nuhranukojaseproizvodiu wegovoj Fabrici sto~ne hrane „Vitamiks“ i garantovati otkup tovqenika po unapred dogovorenoj ceni, dok su nabavka prasadi, veterinarski i ostali poslovi obavezaproizvo|a~a. Od tog programa, koji }e biti finansirankreditimaposlovnih banaka,svezainteresovanestrane ima}ekoristi,auprvomredupoqoprivrednicijerdobijajusigurnost u proizvodwi, odnosno mogu}nostplanirawaprihodairashoda,kaoiostvarivawaprofita. Time se podsti~e pozitivna selekcijaproizvo|a~a,motivi{use za stalno obrazovawe i usavr{avaweuprimenisavremenogna~i-

obele`avawuSvetogNikole– kadajenajve}apotra`waribe uSrbiji.Zanas,me|utim,nema odmora do tada jer moramo biti spremni za sve naruxbine – ka`e direktor ribwaka u Lukinom Selu, koji uspe{no posluje u okviru kompanije “Mirotin” iz Vrbasa, Nenad Radulovi}. Prirast ~uvenog e~anskog {aranaovejeseniuplaniranim je okvirima, kao i kvalitet. “@etva” bi trebalo da bude dobra, a o~ekuje se ukupna proizvodwa od preko 3.500 tona. S plasmanomne}ebitiproblema, aizvesnekoli~inezavr{i}ena trpezama kupaca iz Evropske unije.

je takva saradwa uobi~ajena uAmerici,Kanadi,Australiji i EU, i naglasio da }e odweimatikoristinesamo poqoprivrednici, „Karneks“ i lokalna zajednica negoisrpskaindustrijamesa. Nateritorijivrbaskeop{tine nekada je bila veoma razvijena proizvodwa sviwa, koju je organizovao „Karneks“ posredstvom zemqoradni~kihzadruga.Individualniproizvo|a~iproizvodilisu vi{e od 80.000 tovqenika godi{we,alijeposledwihgodinapo~eloga{eweuslu`nogtovaiprestanak saradwe „Karneksa“ i lokalnihsto~ara. Udru`ewe proizvo|a~a sviwa osnovano je pro{le godine, a wegovih oko 50 ~lanova ima}e sad mogu}nostdauzgajaoko20.000tovqenikagodi{we.Aneksimaugovora, koje }e proizvo|a~i potpisati s „Karneksom“ na period od ~etirimeseca,kolikotrajetovni ciklus, bi}e definisane cene sto~nehraneitovqenika,navedenojeusaop{tewu.

Ciq–sto~arstvo Du{anPetrovi}izjaviojeju~edajeciqrazvojapoqoprivrededupliraweu~e{}asto~arstvaupoqoprivrednojbrutoproizvodwi. „Miimamovelikeizvoznepotencijaleijakojeva`noiciq namjedaseuSrbijiu~e{}esto~arstvaupoqoprivrednombrutoproizvodupove}asa30na60procenata,nesmawuju}ipritom ratarsku proizvodwu”, kazao je Petrovi} u [aba~koj mlekari kojajedeokoncerna„FarmakomMB”. MinistarjerekaodajeiSvetskabankaprepoznalapotencijaletogkoncernaidajeodobrilakreditod120milionaevra. „Tojeznakidasume|unarodneinstitucijezakqu~iledakoncern‘FarmakomMB’imaodli~neizvoznepotencijale”,kazao jePetrovi}inaveoda[aba~kamlakaraizvoziuRusiju,{toje signalidrugimmlekaramada}esvojeproizvodeprodatiuinostranstvu. 2012. godine proizvodwa sirovog mlekapotpunozadovoqitipotrebedoma}emlekarskeindustrije. – Po informacijama kojima raspola`e Ministarstvo poqoprivredeitrgovine,utokujeuvoz nekolikohiqadagrlasteonihjunicauSrbiju–ka`eon,idodaje da se deficit sirovog mleka na

na{em tr`i{tu nadokna|uje uvozom, te da su zbog po~etka izvoza mle~nihproizvodauEU,Rusijui Ukrajinu,na{epotrebejo{ve}e. Proizvo|a~imleka,pak,nemisledajesituacijauwihovomsektoruzadovoqavaju}a. –Svepozitivnemerekojeseodnose na sto~arstvo izdejstvovali

smo ranije, novo ministarstvo je zateklo to stawe. A sada mleko uvozimo,apritomseuvoznicidovijajudaganaraznena~ine,tojest uraznimoblicima,prevezupreko granice da bi umawili carinske tro{kove. Jeste, uvozimo steone junice.Alipitamse{tasede{avasna{im,za{tona{ekoqemoa uvozimotu|eigdesunestalekraveizSrbije?–ka`eza„Dnevnik” SawaBugarskiiz Centralneasocijacijeproizvo|a~amleka. Onanapomiwedaproizvo|a~ima mleka nije ispla}en regres od 25.000 dinara po grlu. Uredbom je, naime,definisanodasetaisplata obaviudvadela,ali,kakoka`ena{a sagovornica, vi{e od 70 odsto vojvo|anskih proizvo|a~a nije dobiloniprvideokojijetrebaloda „legne” do kraja juna. Ostatak je trebalodabudeispla}enkadapro|u inspekcijske kontrole, ali oni jo{nisunibilinaterenu,veliSawaBugarski,dodaju}idajetajiznos bioukalkulisanuskromniagrarni buxet. Na{a sagovornica ocewuje daseproblemiusto~arstvunere{avajuve}seubla`avaagonija. –Ovojeosredwapoqoprivredna godina. Dali smo sve od sebe, alijepomo}dr`aveizostala.Cenena{ihproizvodasuniskeuodnosunarepromaterijalkojije30 posto skupqi nego lane, tako da paori ne mogu da budu zadovoqni kao ministar – ka`e za na{ list poqoprivrednik sa severa Ba~ke AndrijaIvankovi}. Onocewujedaje,recimo,zapo{qavawe mladih agronoma dobra ideja, me|utim, ne sprovodi se na dobarna~inpa}ekrajwirezultat bitizanemarqiv. S.Glu{~evi}

KONSOLIDACIJABE^EJSKOGKOMBINATAIDEPOPLANU

Re{ewezaPIKjo{daleko – S novom privatizacijom PIK-a „Be~ej„ ne}e se `uriti – kazao je pokrajinski sekreta za radizapo{qavaweMiroslavVasin na konferenciji za novinare organizovanojdabisevidelodoklesestiglouprocesustabilizacije giganta u radnom ste~aju. – Rejtingkompanijejevra}en,interesovawedoma}ihistranihpartnerajeprisutno,alisvedoksene budeiskristalisalatrenutnaposlovna situacija firme nije vremedadaserazmi{qaonovojprivatizaciji. U svakom slu~aju, to ne}ebitiunarednih{estmeseci, averovatnoidu`e. –Svojevremenosmo,zbogslo`enostiposla,tra`ilipomeraweroka predaje predloga plana reorganizacijeioporavkaPIK-a„Be~ej„ te}etajdokument,uokvirukojeg}e bitiipredlogza~lanoveUpravnog odboraukojem}esena}ipredstavnicidr`avnihinstitucijaivelikihpoverilaca,bitipredat9.novembra–bilojeprvo{tojeistakaoVasin. Onjepodsetionabrojnespecifi~nosti radnog ste~aja PIK-a „Be~ej„,kakav,imaju}iuviduobim problema s kakvim se susretalo, jo{nijevi|enuSrbiji.

– Poku{ali smo s vlasnikom PIK-a„Be~ej„danapravimozajedni~ki program oporavka, ali to nije dalo odgovaraju}e rezultate. Situacija na terenu je postajala jo{ te`a i onda smo oslu~ili da krenemo robustno, uvo|ewem ste-

situaciju. Za nas je najva`niji to {tozaposleninisuoti{linaevidenciju Nacionalne slu`be za zapo{qavawe ve} su nastavili proizvodwuiredovnoprimajuzarade. Re~ju, qudi i s wima odr`avawe proizvodwe bili su nam osnovni

Nemavajdeod`urbe ^itavprocesstabilizacijePIK-a„Be~ej„krenuojeposlevapajasindikalaca,kojisadaodajuzahvalnostsvimrelevantnim~iniocima,odlokalnesamouprave,prekopokrajinskihirepubli~kihinstitucija,dozaposlenihuPIK-u„Be~ej„. –O~ekujemdakrozteku}isocijalnidijalogprvoobezbedimoopstanakproizvodwe,aondarazgovaramoioboqitkuPIK-a„Be~ej„ –rekaonamjepredsedniksamostalnogsindikataBranislav[ekerovi}.–Razumqivajenestrpqivostradnika,alisuisamisvesnitogadaod`urbenemakoristi. –Samokorakpokorakdonosinapredaku~itavomprocesustabilizacije.Imamoizuzetnusaradwusaste~ajnimupravnikomPavelomSeveriwijem panijebilo,kaoudrugimste~ajima,masovnogotpu{tawa radnika,{tonamjeomogu}iloodr`avaweproizvodweiisplatuzarada–dodaojepredsedniksindikata„Nezavisnost“AleksandarPe{i}. ~aja od dr`ave i organa Poreske uprave.Sadamo`emoprimetitida smouspeliuna{imnamerama,ali putdokona~nograzre{ewa`eqene situacije u PIK-u „Be~ej„ je jo{ jako daleko. Me|utim, savesnim radom uspevamo da pratimo

ciqu~itavomprocesu.Dotogane bido{lodanismouspelidaobezbedimobrojnepartnere,kojisupomogliurealizacijistabilizacije kompanije, i u me|uvremenu nije napravqennovigubitak–dodaoje MiroslavVasin. V.Jankov


„Drap{in” stoji zbog duga za struju

Upetak}e„Lisje„zavrnutislavine na svim ~esmama na novosadskimgrobqima,kaoionimauFutogu, Veterniku, Sremskoj Kamenici i u Petrovaradinu. Vode na grobqima ne}e biti zbog zimske sezone,anaprole}eslavine}eponovobitiodvrnute.Uobi~ajenoje dapogrebnicitokomzimezatvarajuslavinena~esmama. Z. D.

Poslovodstvo AD” Petar Drap{in”u restruktuirawu i Elektrovojvodina blizu su dogovora da se ukqu~i struja u fabrici po{tojeelektri~naenergijaiskqu~enapredve sedmicezbogdugaodoko14milionadinara, kazao je predstavnik dr`avnog kapitala u „Drap{inu”MiodragKoviqac.Premawegovimre~imafabrikanijepla}alara~unevi{eodgodinudana.Kolikaje{tetapri~iwena{to„Drap{in”sadaneradi,Koviqacni-

Trgovinskemisterije `ele da pro|u jeftinije, sve vi{e se okre}u kupovini na pijacama kod prodavaca koji sve to donose iz Ma|arske. Ukratko, pojedini proizvodi su,pokilogramuido200dinara jeftiniji nego u marketima,akvalitetimjeisti,ili ~ak boqi, pa je ra~unica vrlo jednostavna.Ono{tonamnije jasno ( ili u stvari jeste), je kakojemogu}edatiproizvodi imajuni`eceneodonihumarketima.DoputujuizMa|arske, pre|ukojustotinukilometara (transportko{ta)i…cenaim budeni`a.Pritomtiproizvodi ne kaskaju s kvalitetom. Misliteotome,akove}niste prokquviliu~emuje{tos. B. Markovi}

Danas otkrivawe spomenika Mihajlu Pupinu SpomenikMihajluPupinubi}eotkrivendanasupodne,asve~anosti }e prisustvovati gradona~elnik Igor Pavli~i} i predsednikSkup{tinegrada,AleksandarJovanovi}.Autorbronzanestatuena{egnau~nikajevajarSavaHalugin.Spomenikjepostavqen naugluBulevaraMihajlaPupinaiUliceModene. J. Z.

Studentski grad bez vode Zbog planiranih radova na vodovodnojmre`i,danas}eod8 do 15 ~asova bez vode biti deo Ulice Veqka Petrovi}a od Jiri~ekove do Ilije \uri~i}a, Ulica Ilije \uri~i}a, Sime

wazaovugodinuupreduze}uju~enisuhtelidaka`u.Obrazlo`ewejebiloda`ele da {to boqe (jeftinije) pro|u na javnom oglasuidazatopotencijalnimprodavcimane}edasaop{tekojusumuplanirajuda izbrojezapomenuteautobuse.Ovonijeprvanabavkabusevau2011.godini.Ugara`i preduze}ave}nekolikomesecijepetmini i{estsolobusevanagas. Z. D.

hronika

ZBOG HAVARIJE VETERNIK I FUTOG BILI BEZ VODE

Cisterne i prodavnice ugasile `e| Prilikom radova na rekonstrukciji benzinske pumpe na Futo{kom putu ju~e je do{lo dohavarijskogo{te}ewamagistralnogdovodnikapitkevode za nas eq a Vet ern ik i Fut og, usledkogasuovanaseqaostala bezvode. - Kako se havarija dogodila ranoujutru,odmahsmoposlali cisternesapija}omvodom.Jednasenalazilakodvrti}auVeterniku,adrugakodDomazdravqauFutogu-rekaojePRJKP „Vodovod i kanalizacija” DavorSantra~. Iakosuimaliobezbe|enizvorpija}evode,ve}inagra|ana

Med zasladio De~je selo ^lanovi Dru{tva p~elara „Jovan @ivanovi}” poklonili suju~e{ti}enicimaDe~jegsela

Milo{evi}a, Vladimira Peri}a Valtera i Trg Dositeja Obradovi}a. Cisterne sa pitkom vodom }e biti postavqene ispredobastudentskarestorana. G. ^.

Led potukao atar Nastupilo je te{ko vreme: ratovi, nerodica...Magistrat u Novom Sadu je samo tri godine kasnije izvestio najvi{u dr`avnuvlastdasupodzemnevode pokrile~etvrtinuatara,adasu useve,dokojihvodanijedoprla, uni{tili mi{evi i hr~kovi, kojihimakaonikadadosada. N. C.

je vodu nabavqala u prodavnicama. Dok oko cisterni nije biloqudi,marketisusvojekasepunilinara~unnesta{ice. -Na svakom ra~unu se nalazi bar po jedna fla{a mineralne vode,akoneibalonodpetlitara-reklajekasirkaujednoj radwiuVeterniku. Retki koji su koristili cisternu bili su |aci iz {kole „DesankaMaksimovi}”,kojisu sipali vodu u bure za potrebe oveustanove. Pore~imaSantra~a,havarijajesaniranaju~eoko13~asova. A. Va.

DRU[TVO P^ELARA „JOVAN @IVANOVI]” OPET DONELO POKLON U KAMENICU

V remeploV

U vreme napoleonovskih ratova Namesni~ko ve}e Ugarske je od Magistrata u Novom Sadu 9.novembra1813. zatra`iloizve{tajoletiniubranojtegodine.Izve{taj,kojijenapisaosenatorMaksimLepojevi},bioje kratak. Lad je potukao najve}i deo atara, pa je sa wiva ubrana tek tre}ina uobi~ajenog roda.

Gradskiprevoznikobjaviojetenderza kupovinu21soloautobusanagas.Novacza petautobusaobezbe|enjeizbuxetagrada, a 16 vozila kupi}e Gradsko saobra}ajno preduze}eosvomtro{ku.Otvaraweponudaza16autobusatrebadabude28.novembra,azapreostalihpetvozila5.decembra.Kolikojenovcapredvi|enozaovuinvesticijupredvi|enuProgramomposlova-

Telefoni:0214806-833,4806-834,421-674,528-765,faks:6621-831e-mail: nshronika@dnevnik.rs

DOBRO JUTRO, NOVI SADE

Svakodnevnipazarusupermarketimakupcepodu~ipanoramskom pregledu cena prehrambenih proizvoda, ali i tomedabez„crvene”nevredi ni ulaziti u prodavnicu. Naravno, pomenuta suma novca odnosi se samo za osnovni jutarwipazartipahleb,mleko, pavlaka,jogurtimalosalame. Me|utim, ukoliko po`elite da „omrsite brke” sirom, pe~enicom, ~ajnom kobasicom, ilisuvimvratomtreba}evam mnogove}ibuyet,aakoganemate mo`ete se jednostavno pravitidapomenuteproizvodenistenivideli. Aonikoji`eledanasvojoj trpezi imaju raznih delicija seckanih „nakoso” i pri tom

Kupuju 21 bus na gas

jeznaodaka`e.Naglasiojeda}enesta{ica energenta poremetiti dinamiku isplate zaradaiproizvodwe,kojajesimboli~na.„Drap{inovi „radnici primili su minimalac za avgust,  a da je bilo struje, isti~e Koviqac, biobiispla}enprvideoplatezaseptembar. Udru`ewemalihakcionarakojimapripada28odstokapitalafabrikeuputilojezahtevElektrovojodinidaseukqu~iure{avaweproblema. Z. D.

Novosadska sreda9.novembar2011.

GSP OBJAVIO TENDER

Foto:R.Hayi}

OD PETKA

Na grobqima suve slavine

VESTI Pregled liftova Godi{wi pregled liftova danas }e se raditi u Ulici Jug Bogdana 16, u Gunduli}evoj  od broja 20 do broja 24, Kisa~koj 59,naBulevaruoslobo|ewa33, 37,45,odbroja49dobroja61,66, 75 i 77. Liftove pregleda Institutzaza{titunaraduponaloguJKP„Stan”. Z. D.

Video radovi u Likovnom salonu Projekcija video radova i razgovoroMe|unarodnomvideo festivalu u Marseju „Trenuci videa” odr`a}e se ve~eras u 20 ~asova u Likovnom salonu, Katoli~kaporta5.Namanifestaciji}egovoritiAndrejTi{ma. A. Va.

Izlo`ba Radmile Lazarevi} Otvarawe izlo`be „Crte`i”, slikarke Radmile Lazarevi},odr`a}esesutrau18~asova u Galeriji Ogranka SANU, UlicaNikolePa{i}a6.Izlo`bu}eotvoritiakademskislikarprofesorZdravkoVajagi}. G. ^.

u Sremskoj Kamenici 150 kilogramameda,kojijeprikupqenu septembru na Festivalu meda.

Mladimstanovnicimaoveustanove med je, zajedno sa p~elarima uru~io i predsednik Skup{tine grada Aleksandar Jovanovi} koji je rekaodajeovajsladak poklon deci najpotrebniji. -Do{lismouDe~je selo da poklonimo med,kojijeprikupqen zajedni~kim snagama. Va`nojeto{tosuovi qudi u vreme krize i oskudice shvatili koliko je to bitno i humanodasepoka`equdskostidaseovazdrava hrana pokloni onima koji su budu}nost na{eggrada-rekaojeJovanovi}. Dru{tvo p~elara, koje pod pokroviteqFoto:S.[u{wevi} stvom Grada godinama

organizuje Festival meda, svake godine prikupi donaciju od 750 kilograma ovog p~eliweg proizvoda. Od ove koli~ine oni daruju De~ju bolnicu, Dom zaometeneurazvojuuVeterniku, PU „Radosno detiwstvo”, [OSO „Milan Petrovi}” i De~jeselo. -De~jeselojejednaodustanova kojoj doniramo med, a jedinirazlogjeto{tomislimo da je deci najpotrebnije da se zdravo hrane - rekao je predsednik Dru{tva p~elara „Jovan @iv an ov i}” \or| e Soviq. Vr{ilacdu`nostidirektora De~jeg sela Milena Vasi} Stupar istaklajedajedonacijazna~ajnazaovuustanovu,jer je med veoma bitan u za{titi od prehlada i zahvalila se na velikodu{nompoklonu. N. R.

JU^E PO^ELI RADOVI

U Petrovaradinu parku novo lice Povodom po~etka radova na rekonstrukciji Molinarijevog parka u Predradovi}evoj ulici uPetrovaradinu,ju~eje odr`ana konferencija za novinare u prostorijama Mesne zajednice. Tomprilikomjere~eno da}etimegra|aniiposetiocioveop{tinenapokon dobiti adekvatno ure|eniprostorza{etwuiodmor,ada}eradovitrajatiokomesecdana. PredsednikMesnezajednice „Petrovaradin” Miroslava Baji} rekla jedajeovajprojekatura|ennainicijativuSaveta MZ i mesnog odbora Demokratske stranke, a uzpodr{ku„Gradskogze- Ovako }e izgledati Molinarijev park lenila”,GradaNovogSadailo- daslu`istanovnicimakaookukalnog preduzetnika Cvije pqali{te i nadam se da }e poKr~mara. stati svima omiqeno mesto za - U parku }e biti izgra|en i odmor-reklaje MiroslavaBatrgkojibitrebaoubudu}nosti ji}.

Premare~imajednogodsponzora ovog projekta Cvije Kr~maramnogotogasemo`euraditikadasuqudislo`ni. G. ^.

c m y


8

nOvOSAdSkA HROnikA

sreda9.novembar2011.

dnevnik

ODNAREDNEGODINE

Foto:R.Hayi}

Ra~uniumaweni mnogo~lanimporodicama

GRADONA^ELNIKPRIMIOHANELORULAMHE IZDORTMUNDA

Po~asnagra|anka poma`edecu

Po~asna gra|anka Novog Sada Hanelora Lamhe izDortmunda,kojave}godinamapoma`eNovomSadu,ju~ejeposetilaGradskuku}u. -NajpresamfinansijskipomagalaBeogradu,pasamsezapitala za{to ne Novom Sadu, kad je on gradpobratimDortmunduvi{eod 25 godina - rekla je po~asna gra|anka. Lamhe, koja u na{ grad dolazi preko20godina,trenutno80odsto

pomo}iupu}ujeDomuuVeterniku, a 20 {koli „Milan Petrovi}„. Gradona~elnik Igor Pavli~i} istakaojedaLamhedolaziuNovi Sadsvakegodne,idajebilaodvelikepomo}iute{kimvremenima. Tokom humanitarnog rada finansijskijepomagalaiorganizovala dostavu hrane, slatki{a, lekova, medicinskihaparata,sredstavaza higijenuiode}uzadecuNovogSada. A.Va.

[TASUNAADICAMAREKLIOMBUDSMANU

Bespravnagradwa rodilasveprobleme Najve}i problem stanovnika Adicajebespravnagradwaiposledi~no nedostatak infrastrukture. Zaposleni u Kancelariji za{titnika gra|ana Novog Sada posetili su ovu mesnu zajednicu i upoznali se sa problemimakojimu~eAdi~ane.

bleme, kao i nepostojawe kanalizacione mre`e koja bi, kako ka`u u ovoj mesnoj zajednici, trebalo da bude izgra|ena slede}egodine. “Naseqe Adice karakteristi~no je po tome {to u wemu `ivivelikibrojintrenorase-

OmbudsmandanasnaSalajci Gradskiombudsman,uokviruProgramaobilaskamesnihzajednicanateritorijiGrada,danasboraviuprostorijamaMZ„Salajka„,Ulica[ajka{ka26,od10do12~asova.Uovomperiodu, stanovniciSalajkemo}i}edapodnesupritu`bu. Ve}inaobjekatanateritorijiAdicaizgra|enajebezgra|evinskih dozvola i urbanisti~kogplanirawa,{tojeuzrokovalomnogobrojneproblemepoput nedostatka infrastrukture, a potrebno je i legalizovati ove objekte, istakli su predstavniciMZ„Adice”.Neasfaltirane ulice i nedostatak vodosnabdevawa predstavqaju glavne pro-

qenih lica sa Kosova i sa prostora biv{e Jugoslavije,  koja imajuproblemesaprijavomprebivali{tanateritorijiGrada. Sa druge strane, Adice, kao multietni~ka sredina, mogu se pohvaliti visokim stepenom bezbednosti”, navodi se u izve{tajuizKancelarijeza{titnikagra|ana. J.Zdjelarevi}

„DNEVNIK”I „LAGUNA”POKLAWAJU KWIGE

„Ovakojepo~elo”

Iz¬da¬va~¬ka ku¬}a “La¬gu¬na”u sa¬rad¬wi s “Dnev¬ni¬kom”u na¬red¬nom pe¬ri¬od¬ u da¬ri¬va¬}e ~i¬ta¬oc ¬ e na¬{eg li¬sta sa po dve kwi¬ge po¬ne¬deq¬kom, sre¬dom i pet¬kom.Da¬nas }e dva ~i¬ta¬oc ¬ a,ko¬ja se prva ja¬vena na{ broj te¬le¬fo¬na 528765 od 13 do 13.05 ~a¬so¬va, a do sada nisu dobijala kwige u ovoj akciji, do¬bi¬ti po pri¬merak dela„Ovakojepo~elo” grupeautora. Dobitnici }e kwige preuzimati u kwi`ari “Laguna”,u Ulici kraqa Aleksandra 3,gde se mogu na}i i ostala izdawa ove izdava~ke ku}e. Nemanasvetu~ovekakojibarjednomnijepo`eleodaotputujeuGr~ku.Upisanausvebedekere,konzerviranaukwigamaumetnostinana{im policama,onanudidugoi`ivotnoputovawedoprapostojbineevropske misli.Inspirisanikolevkomcivilizacijekojanamjetu,nadohvatruke, najzna~ajniji savremeni srpski pripoveda~i preru{eni u turiste, operskepeva~e,zavodnike,mitotvorceiVizantinceispisujunadahnute isi`ejnoraznovrsnepri~e. N.R.

^ITAOCI PI[U SMS

Porodicesatrojeivi{edecenaredne {estoro, sedmoro ili osmoro pla}a}e 40 Gradskeku}e,apodnosiseGradskojupravi godine}eimatiumawenera~unezakomu- odsto mawe, a doma}instvima sa devetoro, zasocijalnuide~ijuza{tituputempisarnalijeod30do50odsto,naosnovuOdluke desetoroivi{edece,ra~un}ebitiprepo- nice Gradske uprave za oop{te poslove, o utvr|ivawu kriterijuma za umawewe lovqen. najkasnije do 31. decembra. Pored zahteva obaveza pla}awa komunalnih potrebnojeprilo`itifotokousluga, koja je doneta na oktopije izvoda iz mati~ne kwige ZahtevzaumawewepodnosiseGradskojupravi barskojSkup{tiniGrada,ana ro|enih za decu u porodici i zasocijalnuide~juza{titunajkasnije predloggradona~elnikaIgora li~ne karte, odnosno raseqedo31.decembra Pavli~i}a.Ovaodlukajeusvoni~ke dokumentacije za roditejenauciqupodsticawanataliqe i punoletnu decu. Tako|e, tetaugradu. Zahtevzaumaweweobavezapla}awako- potrebnajeipotvrdaoredovnom{kolovaPorodice sa troje, ~etvoro ili petoro munalnihuslugamo`esepreuzetinasajtu wuzadecuijedinstvenimese~nira~unza dece dobija}e popust od 30 odsto, one sa Grada www.novisad.rs ili na pisarnici prethodnimesec. G.^.

KAKOSEOBU]IUKRIZNOVREME

Markiranoano{eno jeftinijeodkineskog Prodavnicepolovnegarderobe, poznate kao seknd hend, nekada su pose}ivalisamosiroma{nislojevistanovni{tva,doksuihostali izbegavali u {irokom luku. Ekonomskakrizaimaleplatenavele su veliki broj sugra|ana da kupovinupreorjenti{uba{naoveprodavnice, koje su cenama uveliko „potukle“sveradweugradu.Zapo-

Prodavnicepolovne garderobecenama uvelikopotuklesve radweugradu lovinu sume, koju bi Novosa|ani potro{ilikupovinomsamojednog markiranogduksaudrugimbuticima, sada u seknd hendu mogu da se obukuodglavedopeteubrendiranugarderobu,kojaimjenekadabilavandoma{aja. Premare~imatrgovacauseknd hend radwama, u posledwe vreme popularnostimjeporasla. -Ulazequdi,raspitujuseikupuju.Imamostalnemu{terije,kojesu tu svaki dan. De{avalo se da do|u sugra|aniizamolenasdaimobjasnimokakvajetorobaupitawuiu ve}inislu~ajevaiza|usanekoliko komadaode}e.Nekoza1.000dinara kupi deset dukseva, a neko za nov markirankaputizdvojii6.000-ka`etrgovkiwaTajana Neranxi}.

Neranxi} isti~e da su Novosa|ani ranijih godina imalipredrasudeokupoviniuovimradwama,adanas setopromenilojersumale plate, a i shvatili su da je robajeftinaidostakvalitetnijaodonekojaseproizvodi u Kini ili Turskoj. Premawenimre~ima,uove radwe svra}aju i porodice sadecom,a~estoimdolaze isredwo{kolci,kojizaxeparac mogu da pazare duks ilixemper. Po{tovaoci modnih trendovaovde}ekomadepopularnih ameri~kih ili drugih dizajnera kupiti po neverovatno niskim cenama,{tonamjepotvrdilai Neranxi}. -ImalismonekolikomodelakreatroraDol~eiGabana,Armanijevusukwukoja je ko{tala 300 dinara i Loranovu ko{uqu za 700. ^esto imamo modele Done Karanimnogedrugepoznatemarke-ka`eNeranxi}. Za markirani polovan xemperkupci}euovimradwamaizdvojitiod100do1.000dinara.Cenazavisiodstepenao{te}ewa,pa}etakoioninovixemperikojisusamomalood{ivenibiti prodati za 100 dinara. U kine-

sevi i pantalone, nov~anike sugra|anastawi}ezaistuovu cifru po komadu, dok se u ostalimbuticimacenenovih modela ove ode}e kre}u od 1.000do10.000dinara.Uhladnim,zimskimdanima,najvi{e novcadajesezakupovinukaputa.Uprodavnicamapolovnih stvari ovaj neophodni komad ode}e mo`e se na}i i za 400 dinara,aceneuzavisnostiod modela idu i do 7.000 koliko ko{taju novi brendirani kaputi. Zimske sportske jakne stajuod200do4.000dinara,dokse uostalimbuticimazajakniceturske ili kineske proizvodwe mora izdvojitiod3.000do7.000dinara. N.Radman

skim i drugim buticima za jedan xemper niskog kvaliteta Novosa|ani moraju izdvojiti od 700 do 1.900 dinara, koliko ko{taju neznatnokvalitetniji.Polovniduk-

Izlo`ba tapiserija

ZBOGBROJNIHZAHTEVASUGRA\ANA

Semaforizatri crneraskrsnice Na pojedinim raskrsnicama u Novom Sadu sve su u~estalijesaobra}ajnenezgode,pajeZavodzaizgradwugradauovojgodinipredvideopostavqawesignalizacijenatrikriti~namestazakojejestiglonajvi{ezahtevasugra|ana.Takojeuplanupostavqawe semaforanaraskrsniciBulevaraoslobo|ewaiVojvo|anskeulice,aposaojavnenabavkejeprikraju. Preostale dve raskrsnice na koje }e biti postavqenisemaforinalazesenapotesuNoviSad-Futog.Signalizacija}ebitimontirananaraskrsnici NovosadskogputaiDunavskeuliceuVeterniku,aza taj posao u toku je izrada projektne dokumentacije. Semafor}ebitipostavqeninaraskrsniciulica IveLoleRibaraiNovosadskeuFutogu,azaovajpo-

saojepotpisanugovorsanajpovoqnijimizvo|a~em, firmom„Hidroprometin`ewering”izBeograda.U Zavoduzaizgradwugradaka`uda}epomenutiposlovipo~etidokrajagodine,ukolikovremetodozvoli. ZaraskrsnicuBulevaraJa{eTomi}aiUlicePariskekomunezavr{enajeizradaprojektno-tehni~kedokumentacije,alinovaczaovunamenunijepredvi|enovogodi{wimprogramom.Sobziromdajepotrebazaopremaweoverasrsnicevi{enegoopravdana,stru~neslu`beZavodasu,kakoka`u,spremneda prionunaovajposao~imseobezbedinovacugradskombuxetu.Dodajuda}eovaraskrsnicasigurnobiti deo predloga programa ure|ivawa gra|evinskog zemqi{tazanarednugodinu. B.M.

Tapiserije malog formata iz zbirkeAteqea61danas}ebitiizlo`eneugalerijiKulturno-informativnog centra „Mladost” u Futogu. Izlo`ba se otvara u 19 ~asova, a KIC „Mladost” nalazi se u Ulici caraLazara42. J.Z.

„Povratnepesme” Kwiga pesama „Povratne pesme” Si mo na Gra bov ca bi} e predstavqenave~erasu19~asova u ~itaonoci Gradske biblioteke,uDunavskoj1.Napromociji}e,poredautora,u~estvovati i Dragana Veleslijin i [amu Jano{ Vilmo{. N.D.

065/47-66-452

Petardegruvaju,anikonemari Odoktobranekolikou~enika O[„DositejObradovi}”naDetelinaribacajupetardenaodmorima i uve~e posle nastave. Gde sude`urninastavnici,{kolsko obezbe|ewe,komunalnapolicija, aroditeqi?Nemogu}edanikou {kolskoj zgradi ne ~uje, kad se ogla{avajualarminakolimaod detonacija! 064/0072... *** Ro|ensampreonogrataipre`ivehgaumestuukomeiokokoga su se vodile naj`e{}e bitke, {kolovahse17godina,pro`iveh u domovima osam godina i kao podstanar sedam godina, te na kraju odradih i onih 40 godina, alinikadnedo`ivehtakvomaltretirawe kao ovih posledwih

godinu-dveodstraneMUP-aradi dobijawanovihdokumenata(li~ne karte, paso{a, voza~ke i saobra}ajne dozvole), jer provedoh silne sate u redovima, najvi{e no}u.Jao,{tanamrade!Dokle? 061/7007... *** Ovihdanauokolinimojezgrade mewaju stubove-bandere unutarblokovskerasvete.Pomislih dajetopotrebnozbogwihovedotrajalosti, a samim tim i radi bezbednosti. Me|utim, kada sam pogledaoizva|enestuboveione ve} pripremqene za va|ewe videosamdasusvioniudostadobromstawuidamogujo{slu`iti godinama. To me ponukalo da obi|emidrugeblokovepoLima-

nu i utvrdih da je svuda stawe isto.Siguransamdajezaoveradove dat ogroman novac i da to predstavqa najobi~nije predizborno lickawe grada. Zar nije pre~eobezbeditinovaradnamesta za kojima mladi ovoga grada prostovape?Nese}amsekadaje uovomgraduotvoreniolezna~ajnijiproizvodnipogon,azatvorenoihjebezbroj. 063/5568.. *** I vi{edecenijsko drve}e u Ulici Sowe Marinkovi} ustupa mesto parking prostoru. Izvor zdravqaiukrasgradanestaje.Zar jemogu}edanepostojire{ewekoje}esa~uvatistarekro{we?Jo{ jedanprimeruni{tavawazelenog nasle|a. 063/8883...

*** Svaka~ast064/8242...Titojeste bio bravar, ali pona{ao se k’o akademik. Ovi dana{wi mu nisunidokolena! 063/5451… *** GSPilopovikojiharajupo gradskomautobususuisti,kraduijedniidrugiodnasgra|ana koji se silom-prilikom moramo voziti wihovim vozilima,jernemajukonkurenciju. 069/2823... *** Svismosiroma{ni,zato{to su i na{i „bogata{i” siroma{ni, ta~nije - bedni su, kao i wihovesluge-politi~ari.Nije za utehu, ali ovo je planetarna pojava! 064/2595...


nOvOSAdSkA HROnikA

dnevnik

GRADONA^ELNIK PAVLI^I] POSETIO BUKOVAC

Noviasfaltle`enaputeve Gradona~elnik Igor Pavli~i} posetiojeju~eBukovac,gde sesre|ujusaobra}ajnice,de~ija i sportska igrali{ta. Putevi se kompletno presvla~e asfaltom i popravqaju se tucani~ki drumovi na nekoliko mesta, a o~i{}ene su i dve velike deponije. U ovom mestu popravqaju seisportskirekvizitide~ijih igrali{tana~etirilokacije. Asfaltom su kompletno presvu~ene ulice Kraqa Petra prvog, Kara|or|eva, Vidovdanska i Partizanski put, dok su saniranioniuVezircu,Podvezircu,

Bukova~kom dolu i Bukova~kom platou. Mewaju se i popravqaju sportski rekviziti de~ijih igrali{tanastadionuipomo}nomterenu,uVidovdanskojuliciiuUliciPartizanskiput. - Kao {to smo sre|ivali delove Novog Sada, tako sre|ujemoiprigradskanaseqa,auBukovacjeulo`enodvadesetmilionadinara.Posaokojismoovde obavili je ono {to je mesna zajednica istakla kao najva`nije, aostalo}eseraditinaprole}e -istakaojePavli~i}. B. M.

NE PLA]AJU GREJAWE NEUREDNO SAMO FIRME I GRA\ANI

PartijeToplaniduguju {estmiliona Me|u du`nicima „Novosadske toplane„ nalaze se i politi~ke partije, re~eno je „Dnevniku„ u ovom preduze}u. Najvi{e za grejawe duguje Socijalisti~ka partija Srbije i to vi{e od dva miliona dinara. Na vrhu lestvice nepla}awa ra~una za tople radijatore su i Vojvo|anska partija sa 1,2 milion  adinara,G17plusjedu`anmilion, aSocijaldemokratskapartija985.000dinara. Me|u du`nicama su i Demokratska stranka Srbije (287.000 dinara), Demohri{}anska stranka (282.000), Pokret snaga Srbije (230.000), Partija ujediwenih penzioneraSrbije(212.000),MISDPReformisti(146.000),Narodnapartija(130.000)i Srpskanaprednastrankakojaduguje30.000 dinara.Ukupnogledano,politi~kestranke dugujuvi{eod{estmilionadinara. Predsednik Gradskog odbora SPS-a Sini{aSevi} izjaviojezana{listdaje

novosadskiodborprepargodinaizmirio sve dugove prema „Toplani„ i da se ovih dva miliona dinara verovatno odnosi na Pokrajinskiodborstranke.Komentarse-

SPS duguje vi{e od dva miliona dinara, Vojvo|anska partija 1,2 milion, G17 plus je du`an milion, a Socijaldemokratska partija 985.000 dinara kretaraPOSPSSlobodanaCvetkovi}a nismo uspeli da dobijemo, jer je stalno bio na sastancima. Zanimqiva komparacija je da je na ~elu „Srbijagasa„, kome

„Toplana„zaenergentduguje1,5milijardi dinara, predsednik PO SPS Du{an Bajatovi}. G17plusnebe`ioddugazagrejaweion }e biti izmiren u skorije vreme, re~eno namjeutojstranci.Preporu~ujemo„Toplani„ da iskqu~uje stranke ako wihova dugovawaote`avajuradovogpreduze}a,a ne da zavr}e grejawe ustanovama i gradskimpreduze}imapoputSpensaigra|animakojisunaiviciegzistencije,poru~ilisuizGradskogodboraG17plus. Ina~e,ukupnapotra`ivawa„Toplane„ su1,8milijardidinaraod~ega1,1milijardu duguju stambeni potro{a~i. Kad je re~ o dugovawima, pored „Srbijagasa„, „Toplana„duguje260milionadinara„PanonskimelektranamaTE-TO„i180milionadinaradrugimdobavqa~ima. D. Igwi}

Protesttaksista danas(ne)}ebiti? Sindikat gradskih taksista najaviojeprotestnuvo`wukoja trebadaseodr`idanas,ukolikogradskavlastneuva`iwihovezahtevezapromenomnajni`e ekonomskecene,kojujeGradsko ve}e utvrdilo krajem septembra,anakonprotestakojejeorganizovalo udru`ewe taksista SITANS.Ponajavamasindikalaca, ju~e je ugovoren susret sa predstavnicima lokalne samoupraveukabinetugradona~elnika, me|utim nije se znalo kada, nitisakim}etaksistirazgovarati.Sadrugestrane,danas,pre protesta, treba da se odr`i sastanak sa na~elikom Gradske upravezasaobra}ajiputeveRadivojem Pavlovim i ~lanom Gradskogve}azadu`enimzasaobra}aj Sini{om Bubwevi}em. Temerazgovorabi}ecenetaksi prevozaiporezi.Ukolikotaksisti ne budu zadovoqni ishodomovihsusreta,protestnavo`wa}epo~etiu11~asova. - Protest }e biti svakodnevni,po~evoddanas,padoispuwewa na{ih zahteva. Tra`imo da lokalnasamoupravapo{tujerepubli~ki Zakon o saobra}aju, kojinala`epropisivawenajni`eekonomskecene,atonikako ne mo`e biti ona koju je Gradsko ve}e propisalo. Tra`ili smo da nam se objasni po kojim parametrimasuizra~unalidaje ekonomska cena 40 dinara za start i isto toliko za pre|eni

Iskqu~ewa struje NoviSad:od8do13~asovaprevodnica na kanalu i crpka Sajlovo.Ka}:od7.30 do13.30~asovapovremenoupojedinimulicamanaseqa,od8.30 do13~asovadeonaseqa odOmladinskedoUliceSvetotaraMarkovi}asapripadaju}imposlovnimprostorom.Rakovac:od8. 30 do13 ~asovadeovikendnaseqa SalaksijeodTSpremaLedincima. Kisa~:od8do16~asovapovremeno upojedinimulicamanaseqa.

kilometar. Smatramo da je ova cenaprotivzakonitajeruzako-

nu stoji da je minimalna ekonomska cena zbir pojedina~nih

Foto:F.Baki}

cena, pa je i navedeno kojih sve cena - rekao je ju~e predsednik Sindikata gradskih taksista RadoslavKrsti}. Ukoliko bude protestne vo`we,taksisti}ekrenutisastajali{takod[trandaikreta}e se Fru{kogorskom ulicom, Bulevarom cara Lazara, ulicama Stra`ilovskom i @arka Zrewanina,BulevaromMihajlaPupina, ulicama Jovana \or|evi}a, Vladike Platona, @arka Zrewanina i nazad na Bulevar Mihajla Pupina. Takisti }e se uputiti prema Srpskom narodnom pozori{tu, polukru`no skrenuti nazad na Bulevar MihajlaPupina,potomkrozUlicu @arka Zrewanina kako bi se vratili na stajali{te kod [tranda. Kako ka`e sekretar ovog Sindikata Nenad Vrane{evi} taksisti}enapravitizastojkodzgradeSkup{tinegrada iIzvr{nogve}aVojvodine. ^lanovi udru`ewa taksista SITANS koji su organizovali pro{liprotestizistihrazloga koji se i daqe navode kao uzrok nezadovoqstva, ne}e se prikqu~iti protestu Sindikatagradskihtaksita.Kakoka`e predsednik ovog udru`ewa Milan Paunovi} neke stvari im u ovoj pri~i nisu jasne. Kako je dodao, iako ne}e u~estvovati u ovomprotestu,neodustajuoddaqeborbezasvojaprava. J. Zdjelarevi}

FESTIVAL TAKTONS U STUDIJU „M”

Zvukidaqeimamo} Tradicionalno me|unarodno takmi~ewe radijskih i televizijskih tonskih snimaka javnih medijskih servisa TAKTONS, u organiztaciji Radio difuzne ustanove Vojvodine, po~iwe danas i traja}edosubote,uprostorijama„StudijaM“. Na ovogodi{wem TAKTONS festivalu za nagradesetakmi~i~ak140snimakaito115ukonkureciji radijskih i 21 televizijskih snimaka. Snimcisevrednujupremaosamparametara,a~lanovi`irija}eimatistru~nuinstrukta`u.Gosti RUV RTV }e biti audio radnici i stru~waci iz Srbije,Ma|arske,Slova~ke,Rumunije,Slovenije,

Hrvatske, Bosne i Hercegovine, Republike Srpske,CrneGore,MakedonijeiAustrije. NakonferencijizamedijeArpadOsnovi}, izvr{nidirektorTAKTONS-a,istakaojedajejakakonkurencijanaovogodi{wemfestivaluznak dajezvukkaokategorijaidaqezna~ajaniva`an, iakonaizgledu21.veku„vladaju“vizuelnimediji.Potvrdajeivelikibrojprijavqenihizlaga~a, proizvo|a~a i distributera audio opreme na izlo`bikojaseusklopuTAKTONS-aorganizujeu holu„StudijaM“. V. V.

sreda9.novembar2011.

9

„NS BLOK” TRA@I DA GRAD FINANSIJSKI POMOGNE [KOLAMA

Bezobezbe|ewa bujanasiqe Udru`ewegra|ana„NSblok”apelujenainstitucijeGradadapomognunovosadskim{kolamaufinansirawufizi~kogobezbe|ewa. „NSblok”isti~ezabriwavaju}u~iwenicudajeNoviSadme|u~etirigradauSrbiji,poizjaviMinistraprosvete,ukojimajezabele`enopove}awenasiqau{kolama. Tako|e,izovogudru`ewanapomiwudasenesmejuzatvaratio~i pred~iwenicomdasuna{adeca,poredvr{wa~kognasiqa,izlo`enaidelovawuraznihkriminogenihiekstremisti~kihgrupa. A. L.

OBELE@EN DAN PROSVETNIH RADNIKA

\acibili zakatedrom Danprosvetnihradnikaobele`en je ju~e u svim, pa tako i u {koli „Jovan Popovi}”. Kao i prethodnih godina, u~enici ove {kole su dr`ali ~asove umesto svojih nastavnika. \aci sedmih razredadr`alisunastavuu~enicimatre}eg,petogisedmog,au~eniciosmograzredau~enicima~etvrtog,{estogiosmograzreda. - Na{a {kola je ve} postala prepoznatqiva po ovoj akciji, a nastoja}emoiubudu}nostidanegujemo ovu tradiciju. Deca bukvalnopreuzimajusveobaveze,od direktora {kole, do tetkica i majstora-ka`eprofesoristorije i nastavnik gra|anskog prava AleksandarM.^ipli}.

Kako ka`e, u~enici su se rado na{liuulozinastavnika,bibliotekara,direktora{koleiwegovog pomo}nika, majstora i sekretarice,a|acima-nastavnicimaje naro~ito bio zabavan veliki odmor, koji su proveli u zbornici sasvojimpravimnastavnicima. Iu{koli„KostaTrifkovi}” na isti na~in obele`ava se ovaj dan,aovdeje|a~kiparlamentizabraoko}ebitiod|akapredava~, a ko direktor ili kuvar.”Na{i nastavnicinerade,alisuprisutni u {koli. Sve obavqaju u~enici,aonajkojisepoka`enajboqim u svom zadatku, dobi}e nagradu” ka`e za na{ list direktor ove {koleMilanSpasojevi}. Q. Na

U ORGANIZACIJI ROTARI KLUBA

Prikupqajukwigezadecu RotariklubNoviSaddanasnaFakultetutehni~kihnaukaorganizujeakcijuprikupqawakwigazadecusposebnimpotrebamaizOsnovne{kole„Bratstvo”uBe~eju.Kwigesemogudonetiod11~asovado16 ~asova.[kola„Bratstvo”oskudevaskwigama,pasuizRotarikluba pozvaliNovosa|anedau~estvujuuhumanitarnojakciji. Z. D.

PRIVATNICI SRU^UJU FEKALIJE U [AHT KANALIZACIJE

Smraddavi UlicuRadeKondi}a @iteqi Futoga iz ulice Rade Kondi}uFutoguve}nekolikogodinapoku{avajudaspre~eizlivawe cisterni fekalija u wihov {aht, jer to prouzrokuje nepodno{qivsmrad,zbogkojegnemoguda otvoreniprozoreusvojimku}ama. Ne mogu, ka`u, ~ak ni da iza|u iz ku}a na ulicu, jer se zbog ovoga pla{eizaraze.Ovosuprouzrokovaliprivatnici,kojiizceloggradadolazeiubacujuba{utaj{aht savsadr`ajizsepti~kihjama. S problemom su upoznati i zaposleni u Stru~noj slu`bi Za{titnikagra|ana,kojisubilisu u MZ”Futog”. Predstavnici MZ upoznali su ih s naj~e{}im problemimaFuto`ana.Tadajere~eno

danemakanalizacionemre`eudelunaseqenogmesta,pasesepti~ke jamekoristezaodvo|ewevode.Za{titniku su rekli da ~i{}ewe septi~kih jama radi „Vodovod i kanalizacija” i da zbog mno{tva zahtevamoradu`edase~eka. Zbog toga se obi~no obra}aju privatnicimakojifekalijeispu{tajunanedozvoqenimmestima,a sadatoradena{ahtuglavnekanalizacije u Futogu. Jedan od velikih problema u Mesnoj zajednici Futog je i nemogu}nost naplate dugovawagra|anazakanalizacioneku}neprikqu~ke. Komunalnainspekcijajeina~e odmahiza{lanateren,napravila zapisnik. Q. Na.


VOJVODINA / NOVI SAD

sreda9.novembar2011.

c m y

10

DNEVNIK

ГРАДОНАЧЕЛНИКЗРЕЊАНИНАОБИШАОРАДОВЕуКЛЕКу

Градесеканализација иапотека

КЛЕК: Градоначелник Зрењанина, др Милета Михајлов, и помоћник градоначелника Зорица Денда, посетили су данас месну заједницу Клек, где су се упознали с радовима на канализационој мрежи и изградњи апотеке у овом месту. Клек је прво насељено место на територији Града Зрењанина у ком је почела изградња локалне канализационе мреже, а првим инвестиционим циклусом радова, подсећамо, пре неколико година обухваћени су још Елемир, Меленци и Ечка. Обилазећи са представницима МЗ Клек део села у којем је почело повезивање индивидуалних домаћинстава на уличну канализациону мрежу, градоначелник Зрењанина истакао је да је овим завршена прва фаза радова и створена могућност да се око 400 домаћинстава прикључи на мрежу, као и да ће радови бити настављени, уз очекивања да ће током наредне године мрежом бити покривен читав Клек. Посланик у Народној скупштини Србије, житељ Клека и један од креатора пројекта изградње канализа-

Почелоприкључивање400домаћинставанаканализационумрежу

ције др Габор Лоди рекао је да су активности започеле иницијативом Владе АП Војводине да свако насељено место у покрајини реализује неки инфраструктурни пројекат. - Граду Зрењанину је 2008. године из Фонда за капитална улагања АП Војводине припало око 350 милиона динара, намењених изградњи канализације у четири насељена места. Данас је у Клеку та канализација почела да се користи - истакао је Лоди. Приликом обиласка градилишта апотеке, градоначелник Михајлов

поновио је да је став локалне самоуправе да сва насељена места на територији Града Зрењанина морају имати апотеку и да ће то ускоро бити и реализовано. - Радови у Клеку, у зависности од временских услова, биће завршени за око 120 радних дана. Предрачунска вредност инвестиције је два милиона динара, а средства су обезбеђена из буџета Града Зрењанина - навео је др Милета Михајлов. Ж.Балабан

Пригоднипоклони заученике именторе

АПАТИН: За Дан Награду је у великој просветних радника Срсали Скупштине општибије ученицима који су не примило 48 ученика постигли најбоље резултаиз пет основних школа, те на општинским, међумузичке школе и три општинским и регионалсредње са подручја опним такмичењима и њихоштине као и 22 ментора. вим менторима, председНаграђене су и спортске ник општине Апатин др екипе школа, а највише Живорад Смиљанић их је из ОШ „Жарко Зреуручио је пригодне дарове њанин” и из ОШ „Мла- књиге. То је једанаести дост” у Пригревици, пут да се награђују учениГимназији и Средњој уручењекњигаусалиСкупштинеопштинеАпатин ци и просветни радници за техничкој школи са Допостигнуте резултате. Ученици који су постигли нај- мом ученика. У свечаности су учествовали и ученибоље резултате на републичким такмичењима на- ци Музичке школе који су извели краћи програм. грађени су још у јуну, на крају школске године. Ј.П.

DaNas U NOVOM saDU BIOSKOPI Arena: „Kung fu panda 2 3D” (13.30), „Zlatokosa i razbojnik” (14.20), „[trumpfovi” (16.45), „Pingvini moga tate” (15.45) „Automobili 2” (12.45, 13.10, 15.10), „Yoni Ingli{: ponovo ro|en” (17.45), „Budi malo ja” (20.15) „Tri musketara” (16.10, 21.10), „Paranormalna aktivnost 3” (22.20), „Vinks: ~arobna avantura” (13.05, 14.45, 15.05, 17), „Preostalo vreme” (18.10, 20.20), „Zaraza” (20.05, 22.40), „No} ajkula 3D” (23.10), „Kolumbijana” (18, 22.25), „Parada” (12.30, 15, 17.30, 20 22.30), „Avanture Tintina: tajna jednoroga” 819.19.10), „Dug” (21.30)

POZORI[TA Pozori{temladih: Velika sala „Testosteron” (20)

MUZEJI Muzej grada, Tvr|ava 4, 6433–145 i 6433–613 (9–17): stalna postavka „Petrovaradinska tvr|ava u pro{losti”; postavka Odeqewa za kulturnu istoriju MuzejVojvodine, Dunavska 35–37 (utorak - petak od 9 do 19 sati, subota - nedeqa od 10 do 18 ~asova): stalna postavka „Sa~uvani tragovi materijalne i duhovne kulture Vojvodine od paleolita do sredine 20. veka”, „Vojvodina izme|u dva svetska rata -antifa{isti~ka borba u Vojvodini 1941 - 1945” Muzejski prostor Pokrajinskog zavoda za za{titu prirode, Radni~ka 20a, 4896–302 i 4896-345 (8–16): stalna postavka „Vi{e od pola veka za{tite prirode u Vojvodini”

RO\ENI U novosadskom porodili{tu od prekju~e u 7 ~asova do ju~e u isto vreme rodile su: BLIZANCE: Marina[upeta iz Zrewanina (devoj~icu i de~aka), DEVOJ^ICE: BrankaSklener, LanaSredojevi}, Danijela]iri}, DraganaKusi}i DraganaTadi} iz Novog Sada, SvjetlanaMaksimovi} iz Gajdobre, NadaErdeqan iz Be{ke, IrenaMitrovi} iz Veternika, Milica Dragosavqevi} iz Temerina, Branka Jajin iz Ka}a, Jelena\uri} iz Magli}a, AlbanaBrahaj iz Be~eja i DubravkaNedovi} iz Rumenke, DE^AKE: Jelena Matanovi}, Andrea Anau-Fendrik, Mirjana Kuqa, MilicaVlahovi}i JelenaBla`evi} iz Novog Sada, KarolinaTarjan iz Temerina i GabrielaI{panovi}iz Titela.

saHRaNE Na Gradskom grobqu u Novom Sadu danas }e biti sahraweni Josip Stevana Gion (1933) u 9.45 ~asova - ispra}aj, Milena Novaka Beqanski (1926) u 10.30 ~asova - urna, Taseva Koleta \ur|ena (1924) u 11.15 ~asova, Persida Uro{a Gruber (1939) u 12 ~asova, Slavka \oka Mudri} (1937) u 12.45 ~asova, Eva Ma|a{a Uzelac (1950) u 13.30 ~asova, Petra Vase ^olakovi} (1936) u 14.15 ~asova, Nikola Vojislava Tovitovi} (1929) u 15 ~asova. Na Katoli~kom grobqu danas }e biti sahraweni Ana Edena Bece (1929) u 13 ~asova i Marcela Ferenca Pe{ti (1919) u 15 ~asova. Na Mesnom grobqu u Sremskoj Kamenici danas }e biti sahrawen Svetislav @arka Jovi} (1929) u 15 ~asova.

TElEfOnI

VODI^

VA@nIJIBROJEVI Policija 92 Vatrogasci 93 Hitna pomo} 94 Ta~no vreme 95 Predaja telegrama 96 [lep - slu`ba AMSJ 987 Auto-moto savez Srbije 987 Informacije 988 i 0900098210 Toplana kol centar 0800 100-021 reklamacije 24 sata 4881-104, za potro{a~e 420-853 Vodovod i kanalizacija, centrala 488-33-33 prijava kvara vodovod 0800-333-021 prijava kvara kanalizacija 442-145 ^isto}a 6333-884 “Novi Sad - gas” 6413-135 i 6413-900 JKP “Stan” 520-866 i 520-234 Kol centar preduze}a „Put” 6313-599 Kol centar „Parking servisa” 4724-140 „Gradsko zelenilo” marketing i PR 4881-633 rasadnik 403-253 “Dimni~ar”, 6622-705, 6615-834 „Elektrodistribucija” centrala 48-21-222 planirana iskqu~ewa i prijava kvara 421-066 @elezni~ka stanica 443-200 Me|umesna autobuska stanica 0901-111-021 Prigradska autobuska stanica 527-399 Gradsko saobra}ajno 527-796 Gradsko grobqe 518-078 i 518-111 Pogrebno, JKP “Lisje” 6624-102 Pogrebna ku}a „Konkordija” 452-233 Dru{tvo krematista “Ogaw” 422-288 Ger. cent. - pomo} i nega 450-266 lok. 204, 205 Prihvatna stanica 444-936 Prihvatili{te Futog 895-760/117 Dnevni centar za stara lica 4889-512 Info centar za osobe sa invaliditetom radnim danom (od 10-15) 021/447-040 ili sms 066/447-040 Komunalna inspekcija 4872-444 (centrala), 4872-403 i 4872-404 (dispe~erski centar) SOS telefon za pu{a~e u krizi - od 7 do 10 ~asova 4790-668

POLIKLINIKA „PEKI]“, Gr~ko{kolska 3, tel: 426-555, 525-261, radnim danom od 8 do 20, subotom od 8 do 14

RADIOLO[KI KABINET „DIJAGNOSTIKA CENTAR”, rendgen, ultrazvuk, mamografija, [afarikova 13, tel: 572-646, 571-322

„KOMPaS“ TOURiSM&TRaVEL, Bul. Mihajla Pupina 15, tel: 6611-299, 6612-306, mail: kompas@eunet.yu

O^NI CENTAR „YINI]“, Vr{a~ka 34, tel: 639-5825, 520-961

APOTEKE No}no de`urstvo: “Bulevar” - Bulevar M. Pupina 7 (od 20 do 7)

420-374

ZDRAVSTVEnASlU@BA Dom zdravqa „Novi Sad”, kol centar 4879-000 Klini~ki centar 484-3484 No}no de`urstvo za decu u Zmaj Ogwena Vuka (subota i nedeqa) 6624-668 No}no de`urstvo za odrasle (Wego{eva 4) (subota i nedeqa i praznici) 6613-067 Vr{a~ka 28 4790-584 Klinika za ginekologiju i aku{erstvo 4899-222 De~ja bolnica 425-200 i 4880-444 Institut - Sremska Kamenica 4805-100

TAKSI Prevoz osoba ote`anog kretawa „Hendikeb” 432-005, 060/313-3103 Vojvo|ani - taksi 522-333 i 065-520-0-500 Pan-taksi 455-555 VIP - taksi 444-000, SMS 1088 Delta plus - taksi 422-244 Maksi Novosa|ani - taksi 970, 451-111 Grand - taksi 443-100 Luks 30-00-00 MB - taksi 500-222 De`urni taksi 6350-350 Halo - taksi 444-9-44, SMS 069/444-444-9

GINEKOLO[KOAKU[ERSKA ORDINACIJA „TODOROVI]”, Bulevar oslobo|ewa 48/I. Tel: 442-645, 677-91-20 BiLJa&OLJa, AMBULANTA ZA MALE @IVOTIWE, Liman I, Drage Spasi} 2/a, Novi Sad, tel: 021/511-206, mob: 065/55 11 206, www.biljaolja.rs

AUTO-SERVIS „ZORAN“, automehani~ar - autoelektri~ar, tehni~ki pregled, Reqkovi}eva 57, Petrovaradin, tel: 6433-748

PREVOD DOO, Novi Sad, Resavska 3, sve vrste prevo|ewa, inostrane penzije, tel: 6350-664, 6350-740


vojvodina

dnevnik

sreda9.novembar2011.

11

Оформљенштаб зимскеслужбе Радниципресељени,дуговиостали КИКИНДСКА ОПШТИНА ТРАЖИ СТЕЧАЈ ЗА „РАСАДНИК”

КИКИНДА: Јуче је оформљен штаб зимске службе. Договорено је да 14. новембра буде одржана смотра опреме и возила који ће чистити саобраћајнице током зиме. - Зимска служба званично почиње да ради 15. новембра и у приправности је до 15. априла. Оформљена је и комисија за пријем опреме, а састављена је од представника локалне самоуправе, Јавног предузећа „Дирекција за изградњу града“ и Саобраћајне полиције - истакао је шеф штаба Бранислав Чолак. Новчана издвајања за рад зимске службе планирају се на бази

средстава утрошених претходне године. - Већ неколико година у буџету планирамо око 12 милиона динара, колико је предвиђено и за ову годину – каже Чолак. – Део новца смо уплатили као аванс. Од прошле године остало је 50 тона соли, а наручено је још 250 тона које ће бити у Кикинди до 15. новембра. Одржавање саобраћајница у зимским условима у кикиндској општини добила је фирма „Златна греда,“ која је једина и конкурисала. Пешачку зону, односно Градски трг, одржавају запослени у Јавном комуналном предузећу „6. октобар“ А. Ђ.

ДАН КИКИНДСКИХ ВАТРОГАСАЦА

Гасили620пожара овегодине КИКИНДА: Дан ватрогасно-спасилачких јединица обележен је у Ватрогасном дому у Кикинди. Према речима Бранислава Малетина, команданта

ском непажњом, а паљевине у атару и, поред високих казни, веома су честа појава. Од почетка године у Севернобанатском управном округу било је 620 пожара, што је више него у 2010. години. Председник Ватрогасног савеза Војводине Бранислав Чолак напоменуо је да ватрогасци увек дају свој максимум у решавању тешкоћа: - У Србији данас недостаје четири хиљаде ватрогасаца, а у кикиндској јединици неопходно је још шездесеНајмлађи поучени о опасностима од пожара так људи. Проблем је у недостатку новца за ватрогасно-спасилачког батаљо- набавку опреме и ангажовање вина, кикиндској јединици недо- ше људи. стају људи, опрема је застарела, Ватрогасце су поводом њихокао и возила стара до три деце- вог дана посетили предшколци није. . вртића „Наша радост” који су - Ипак, испунили смо све за- имали прилику да чују какве опадатке и у опасним ситуацијама сности може да изазове пожар и није било људских жртава. Нај- како га спречити. више је пожара изазваних људА.Ђ.

КИКИНДА: Општинско веће Кикинде је, на последњој седници, на предлог привременог заступника АД „Расадник” Милутина Гаврилова, поднело иницијативу за покретање стечајног поступка. Према Закону о стечају поступак о стечају може покренути дужник или поверилац, а у овом случају Општина Кикинда је поверилац на основу доспелих, а неизмирених обавеза за порезе и таксе. Рачун „Расадника” годину дана је у блокади док је већи део имовине под хипотеком. Правник у Савезу самосталних синдиката за општине Кикинда, Чока, Нова Црња и Нови Кнежевац Милован Гатарић истиче да је локална самоуправа основала ново предузеће ЈП „Градско зеленило и пијаце” у којем су запослени некадашњи радници „Расадника”. - У новој фирми ради 12 запослених, од 15 колико их је било у „Расаднику”. Једна радница је на боловању, а два су одсутна – каже Гатарић.

– Некадашњи радници „Расадника” нису више од 13 месеци добили зараду, те смо инсистирали на томе да им се исплате минималне плате.

послењу требало да потпишу 1. јануара 2012. Председница синдиката „Расадника” Живана Љубинковић додаје да су радници запослени на одређеним пословима за које их је ангажовала локална самоуправа. У Савезу самосталних синдиката кажу да ће тражити да се стечајни поступак у „Расаднику” одложи како би се имовина пописала у корист радника као извршних поверилаца. „Расадник” располаже одно сно има право на коришћење 125 хектара земљишта. Већински пакет акција ове фирме на аукцији је 2007. године купила МаријанаБурић из Београда по цени од око 12 Већи део имовине „Расадника” под хипотеком ми ли о на ди на ра. Са но вом вла сни цом У ЈП „Градско зеленило и пијаца” радници Агенција за приватизацију раскинула је кусу ангажовани по уговору о повременим и попродајни уговор јер није испуњава ла обапривременим пословима, док би уговор о за- ве зе. А. Ђуран

ПРИВРЕДНИЦИ СЕ ЖАЛЕ НА АДМИНИСТРАЦИЈУ, ГРАДОНАЧЕЛНИК УЗВРАЋА

Уз олакшице иде и друштвена одговорност

ЗРЕЊАНИН: Још увек нису укинуте све непотребне административне препреке које стоје на путу ефикаснијем предузетништву у Зрењанину, али се стање знатно побољшало након организованог наступа предузетника, оцењено је на трибини „Свеобухватна реформа прописа у Србији и Зрењанину – Шта је досад урађено и шта још треба да се уради”, која је у организацији удружења „Зрењанински пословни круг” (ЗРЕПОК) и Националне алијансе за локални економски развој (НАЛЕД) одржана у Барокној сали Градске куће. Циљ овог скупа, по казивању организатора, било је упознавање овдашњих привредника и предузетника, али и самих грађана, са током израде „Зрењанинске сиве књиге” коју ЗРЕПОК припрема по узору на НАЛЕД-ову „Сиву књигу”. Идеја овог пројекта је да се сачини документ у којем би били наведени све административне препреке

Некад би привредници могли да помогну граду

ко су оне процесуиране и какве одговоре упућују градска и државна администрација. - Предузетници се најчешће жале на катастар, царине, Агенцију за привредне регистре и државне осигуравајуће куће из области пензио-

„Зрењанинска сива књига” у децембру

Лепе жеље уз славски колач

Белоцрквани обележили градскуславу

БЕЛАЦРКВА: Сечењем славског колача и пригодним коктелом, у Белој Цркви је и ове године обележена градска слава Свети Димитрије, а прослави су присуствовали запослени у локалној управи, председник општине Жељко Црногорац и председник скупштине ШиманИровић са сарадницима, као и директори јавних предузећа и установа. Свештеник Младен Ђурић пожелео је Белоцркванима здравље и срећу, поводом њиховог празника, а председник општине Жељко

Црногорац да буде пре свега више Белоцрквана, затим да буде више инвестиција, да фабрике поново буду пуне радника, а Бела Црква поново пожељно место за живот, као што је некад била. Свети Димитрије је почео да се слави као светац заштитник града по завршетку Првог светског рата, јер је на тај дан српска војска краља Александра Ујединитеља прешла Дунав и ослободила град од Аустро-угарске монархије. М. В.

„Наде”у музеју

ЗРЕЊАНИН: У малом салону Народног музеја у Зрењанину прексиноћ је отворена изложба под називом „Наде,“ чији су аутори студенти графике мастер класе професора Зорана Тодовића на Академији уметности у Новом Саду. Изложба обухвата радове Тамаре Делић, Хелене Гажо, Александре Грбовић, Ане Коматине, Ђорђа Марковића и Јелене Толимир. Организатор поставке је Милан Граховац, кустос зрењанинског музеја, а изложба ће трајати до 17. новембра. Сви уметници су дипломирали 2010. године у класи Зорана Тодовића и тренутно су на мастер студијама код истог професора. Ж. Б.

НАЛЕД је 2008. покренуо акцију „Из лавиринта” како би се препознале административне препреке за привређивање и пословање у Србији, са истакнутим проблемима и предлозима за њихово решавање. Из ове акције изродио се СРП (Свеобухватна реформа прописа), а резултати су сабрани у „Сивој књизи,” која сваке године добија ново издање и има све већи утицај на доношење одлука Владе и Скупштине Србије. Увидевши резултате које је дала НАЛЕД-ова акција, „Зрењанински пословни круг” је одлучио да изради „Зрењанинску сиву књигу” којом ће се указати на проблеме који проистичу из прописа и одлука у надлежности локалне самоуправе. Прво издање очекује се у децембру. које се налазе у прописима и одлукама у надлежности, како локалне, тако и државне управе, а које отежавају рад привредника. Присутни на скупу овом приликом били су у могућности да се информишу о томе које примедбе су до сада предузетници доставили радној групи за израду „Зрењанинске сиве књиге”, ка-

ног, социјалног и здравственог осигурања - рекао је менаџер НАЛЕД-а Слободан Крстовић, али је, такође, похвалио Зрењанин који је добио признање као убедљиво најбоље место у Србији за ново инвестирање. Председник ЗРЕПОК-а и власник фирме „Импел” Драган Вида-

ковић казао је да се ситуација, по питању олакшица у пословању привредника, поправља од тренутка када су се они организовали и почели да преговарају са локалном самоуправом, али да и даље не могу да буду скроз задовољни. Јер, појаснио је Видаковић, предстоји још много посла на елеминисању сувишне администарције. Он је навео и низ примера, између осталог и обавезу да код сваког затварања радњи мора бити присутан и власник, а то је физички неизводљиво у случајевима када један предузетник има више пословних објеката. Градоначелник Зрењанина МилетаМихајлов је истакао да је, када је реч о условима за бизнис у граду на Бегеју, Светска банка недавно поново прогасила ову средину за најповољнији у Србији за отварање нових послова. Зато, надовезао се он, не би смело да буде много примедби на градску администрацију. Он је узвратио стрелицу привредницима окупљеним у ЗРЕПОК-у и предложио да се убудуће води и књига о друштвено одговорним фирмама, односно онима чији власници помажу средину у којој послују, а имају могућности за тако нешто. Ж. Балабан

СУСРЕТ ДОМАЋИНА ГАСТРОНОМСКИХ И ЕТНО ПРИРЕДБИ

Подршка„Рогљу” изКоцељевеи Сврљига

НОВИСАД: Поред тридесетак учесника на „Рогљу”, сусрету домаћина гастрономских и етно приредби из Војводине, свој долазак су потврдиле и две манифестације из Коцељеве и Сврљига. Тако ће посетиоци имати прилику да се упознају са садржајем „Фестивала зимнице”, који су сваке године одржава у Коцељеви и где се нуди више од 500 различитих врста припремљене зимнице, коју по старим рецептима припремају домаћице из овог краја. Коцељева је, иначе, општина са највећим воћњаком у Србији у односу на пољопривредне оранице. Они имају воћњаке на 3.600 хектара, а житарице гаје на 6.200 хектара. Како је за „Дневник” изјавио заменик председника општине у

Коцељеви МилутинЦвејић, жене које припремају зимницу без конзерванса, освојиле су награду у Хрватској и Словенији, а ускоро ће према посебном рецепту почети јединствену производњу џемова, сокова и разних комбинација воћа и меда. - У Нови Сад долазимо са шест најуспешнијих произвођача учесника наше зимнице и у понуди имамо скоро педесет различитих врста џемова и сокова – каже Цвејић. Из Сврљига ће туристичка организација општине у суботу на СПЕНС-у представити своју етно приредбу „Белмужијаду”, која обухвата и дегустацију овог истоименог јела. Како каже домаћин „Рогља” Јелена Крстић, програм ће по-

чети музичком тачком педесетак тамбураша и песмом о рогљу, некада омиљеном месту окупљања сеоског становништва. „Рогаљ” је до сада одржан два пута и омогућио је да се међу домаћинама приредби оствари сарадња, па је тако усаглашен и календар њиховог одржавања. Домаћин „Туријске кобасицијаде” Мирослав Медурић каже да је „Рогаљ” створио престиж међу организаторима и да је подигао ниво у организацији: - Порука да све веће приредбе живе током целе године, коју смо чули на „Рогљу”, је за све нас велики изазов – тврди Медурић и обећава да ће за све посетиоце бити довољно кобасица из Турије. В. Х.

„Преокрет” сепримиокод бирача БАНАТСКИ ДЕСПОТОВАЦ: На изборима за Савет месне заједнице Банатски Деспотовац, кандидати Либерално-демократске партије освојили су три мандата од укупно седам, колико се бирало, саопштила је ова странка и поручила да идеја „Преокрета”, коју ЛДП промовише, постаје препознатљива и у малим срединама као што је ово село у зрењанинској општини. „Сигурни смо да је то само почетак преокрета и пробоја наших идеја и ставова по којима смо већ препознатљиви, и да ће то у најскорије време подржати велики број наших суграђана“, наводи се у саопштењу Градског одбора ЛДП у Зрењанину и напомиње да је свој велики допринос на изборима у Банатском Деспотовацу дао кандидат Шпиро Краварушић. Ж. Б.

Добротвори за Милу БЕЧЕЈ: Иако од рођења болује од церебралне парализе, захваљујући бризи родитеља и сопственој упорности четрнаестогодишња Бечејка Милунка Мила Петровић успешни је ученик осмог разреда ОШ „Здравко Гложански“. У последњих годину дана због све лошијег здравственог стања тешко хода и све чешће изостаје с наставе. Имајући у виду да су јој родитељи незапослени и нису у могућности да јој купе преко потребна инвалидска колица, путем медија апелују на људе добре воље да им помогну. Добротвори могу уплатити прилог на динарски жиро рачун број: 355000320012919639. Прикупљена средства ће се користити за куповину инвалидских колица, лекарске прегледе и преко потребне лекове за Милу, како би као и вршњаци похађала завршни разред и у року полагала малу матуру. В. Ј.

Семинаро запошљавању младих

АПАТИН: У Апатину је одржан једнодневни семинар, под називом „Запосли се-ло и ти”. Присутни учесници, махом лица са евиденције Националне службе за запошљавање, имали су јединствену прилику да усвоје основна знања о модерном начину налажења потенцијалног посла, као и о могућностима за покретање сопственог бизниса. Сви учесници добили су сертификате о учешћу на овом семинару. Ј. П.


RePORTA@e

sreda9.novembar2011.

dnevnik

c m y

12

VOJVO\ANSKIKOM[ILUKRU^NOBRAOKUKURUZIGOSTIOSEUGORWEMBREGU,KODSENTE

Moba javna, ali recepti ostali tajna

B

erba kukuruza nekada se obavqalanamobu,pasuu Gorwem Bregu kod Sente, neguju}i stare obi~aje, u nedequ okupili etno-bera~e i kulinare na manifestaciji„Mobakukuruza”.Doksunawivibera~iuzpomo}prqkaosloba|ali`ute klipove od qu{tike, kulinari su se zdu{no dali u pripremawu jela srpske, ma|arskeivojvo|anskekuhiwe.Svisese}aju da su nekada, dok nije zavladala era bera~a i kombajna, dobre kom{ije zajedni~kinamobui{lijednikoddrugihiu berbeinaveseqa. Bera~esudoma}inido~ekalinasala{u I{tvana Terteija, u pratwi orkestra

ekipaizinostranstvajeruMa|arskojve} zaboraviliobi~ajeru~nogbrawakukuruzapo{toseberbaobavqama{inski–ka`eorganizatorImreEsSabo. Ekipebera~anisuslu~ajnopeto~lane jerupravotolikoqudioduvekjebilopotrebno anga`ovati da se rod ubere s jednogjutra.Ekipa„Josomsedok”,{tobina srpskombilo„Dobrekom{ije”,izUtrina u a|anskoj op{tini, prva je zavr{ila posao.KakoinebikadaVaridaPetra{ predvodi sastav koji formu odr`ava ~itavejeseni.Onaobja{wavadaseberbakukuruzapojutru„u|uture”ugovaraza120150evra. –Cenakojasepogodi|uturepodrazumeva da se kukuruz obere i utovari u

bunioizbogkobasicai{unke,abiloje projeibundevareporaznimreceptima. TerezaZoradizSanadanudizaaperitiv{qivovicu,odkojeuSanadunekadi bandere znaju da se nakrive. U ekipi sanadskihpenzionerajo{suwensuprugAndra{ Zorad, Marija Vi{wei, Etelka i LasloKo~i{. –[qivkaje~istakaosuza,slaninasapuwara,krompiruqusci,zasalatucrni lukinakrajukola~iodludaje.Kadasam bilamala,cenilosesvakopar~eproje,a

privrednim radovima te }e biti vi{e vremenazapredah. Sen}anskuekipu„Staripetaoidvekoke” predvodio je Ferenc Kere{i, a vrlo brzosuseuubirawu`utihklipovaise~e-

„Dobrekom{ije”najbr`i

CipovkaizfuruneMariceMe|eri

Orkestarudaraoritam~arda{a

„[arkaw}u”,{tobiuprevoduzna~ilomamuze, ali ne kaubojske nego sa ~izama ma|arskih ~iko{a. Orkestrom je rukovodio Jo`efRacSaboizSente,ame{ovitabandanaj~e{}eritmom~arda{arazgaqivala je~lanove22takmi~arskeekipeigoste. –Zadovoqnismoodzivomekipaizmnogihvojvo|anskihmesta,spremnihdanegujustarina~inru~neberbekukuruza.Po{tojeovejesenivremepogodovalozaberbu,jedvasmouspelidasa~uvamoparcelu zatakmi~ewe.Okolojesavrodve}ubran kombajnima,wiveuzoraneip{enicaposejana. Nije nam se pridru`ila nijedna

prikolicu, pose~e kukuruzovina, pove`eusnopoveislo`iukupe.Normalno je da smo najbr`i jer nam je to svakodnevni rutinski posao pa smo do{li malo da se razonodimo – veli Varida Petra{. Vetar nije ba{ bio ugodan, ali nije kvario raspolo`ewe. Trpeza servirana nawivizabera~e,odnamirnicajeizdoma}e radinosti. ^lanovi ocewiva~ke komisijeFerencEsSaboi\ulaGergeq veledajenazamislivoakonatrpezinemarakijedudareibeleslaninesapuware,kuvanihkrompiraijaja,nikosenije

bundevarismoseradovalikaoprazni~noj poslastici-ka`eTerezaZorad. Doksu[andorSila|i,MihaqFeher, Jo`ef Degi i Andra{ [omorai brali kukuruz i sekli kukuruzovinu, Marica Me|eri je predstavqala trepezu Udru`ewazanegovawetradicijaizNoveCrwe.Maricajesamazamesilatestoiispeklacipovkuufuruni,atusujo{pe~enikrompiru~ak{irama(qusci)iludaje,tako|eizfurune,pekmezod{qiva i doma}a mu~enica iz frakli}a. Pridru`ujeseSen}aninEndreJenei,poslovo|auBawi„Er`ebet”uma|arskomMorahalomu,kojuveomapohodegostiizvojvo|anskihmesta,panepropu{tapriliku da paorima preporu~i u`itke u velnes centru jer nailazi zati{je u poqo-

N

ema kafane u onoj na{ojnekada{wojJugiu kojojgostinisuu`ivali u ciganskoj muzici koju je nasvojoj,sadave}stogodi{woj violini, virtouzno izvodio najstarijiba~kiromskimuzi-

Kokinsin,~ijijeotacnajpoznatiji ba~ki kafanski tambura{, harmonika{ Marko, Adam, Picanov sin, i Jovan Tamburica – uz osmeh ka`e Balog,komejeviolinaostala jedinautehaiqubavposlene-

Svemupesmenasrcule`e

~ar Zvonko Balog (78) iz apatinskognaseqaRoma.Idanas, posle {est decenija provedenihukafanama,Zvonkoznada zabavigoste. – [ta bi’ drugo ja nego da prebirampo`icamamojeviolinekojusamdobiosdesetgodina da bi’ se s 18 otisnuo u svetkafanaimuzike,odOmi{a, Novigrada, Qubqane, Zagreba preko Beograda, sve do Skopqa, gde sam zabavqao goste – pripoveda Balog, koga pamtekafanskinostalgi~ari, kojidanaszamla|eisredove~nesvirau„Kraqevskomvrtu“ sasvojimorkestrom„Bak{i{ bend“. –Una{emorkestrusudeca mojih vr{waka, kao {to je

stanka supruge, koja, kako ka`e, nije bila qubomorna na druge `ene, ali jeste na violinu. Uz starogradske, ciganske romanseidrugepesme,znaovaj qubiteq muzike i kafane da gostimaprirediidrugaiznena|ewa. –Svepesmemeninasrcule`e. S qudima u kafani sam drug,praviloje–„{tosamvideo,nisamvideo–{tosam~uo, nisam ~uo“. A bilo je raznih isposvesti, pogotovo u ranim jutarwimsatimakada,dokpevci kukuri~u, na uvce gostima violinom tugu rasterujem, a radost potpirujem – sa zadovoqstvom prime}uje Zvonko, kojinebrojiskolikojeorke-

stara goste zabavqao da bi za hlebzaradio. Pamti ovaj bard ciganske kafanskemuzikedasumuprofesor muzike Aleksandar Kosti}Kalabaiwegovasupruga, profesorkaQiqa,najve}uradostpri~inilikadasumupoklonili kalofonijum za violinu. – Video profesor da se i ja moramvremenuprilago|avati. Rekaomi:tvojaviolinaudu{u dira, za perfekciju potreban je kalofonijum – pri~a Zvonko, ali se isto tako prise}a najnemilijeg do`ivqaja iz svogkafanskog`ivota: – Onomad, ta~no se se}am 1962.godine,na~ardikodsomborskog aerodroma, dobio sam no`urukubezikakvogpovoda. Gostpripit,tra`iodamu{ibicomzapalimcigaretu,jamu vatru pru`io, a on izvadio no`temiurukuse~ivozario. Spaslimemomcisaerodroma. Posle toga u toj ~ardi nikad vi{e nisam zasvirao – ka`e Zvonko,kojijeceo`ivotproveo u kafani, ali nikad nije pu{ioipio. Znali su gosti zvati posle pono}i ovog violinistu ku}i, da im priredi svirku u kafani. Ponekad je odlazio u cik zoreakobiosetiodasugosti ozbiqni. – Za~as se okupimo u nasequ Roma,papravacna~ardugdenas gosti ~ekaju. Nije nama te{ko svirati, a mnogima je danas za hleb potreban dinar, jer smo svi u mom „Bak{i{ bendu“ na socijalnojpomo}i–nebeztuge pri~a najstariji ba~ki kafanski violinista jer u penziju ovimuzi~arinikadaneodlaze. J.Prel~ec

danoslomilonogu,aSen}aninLajo{Pap jekupussasviwetinomkuvaozadru{tvo, alijezatakmi~eweprijaviospecijalitetesro{tiqa. Ekipu Udru`ewa „Srbska zemqa” iz Beograda predvodio je dr Nenad ^kowevi} iz Hrtkovaca, nadglegaju}i papke u saftu i svadbarski kupus, kakav se nije kr~kao na ovim prostorima. Me|u kulinarima opet se nenadma{nim potvrdio VladanSubotinizSanadazasarmuodov~etine, skuvanu u grn~arskom loncu. Subotin je meni upotpunio puwenim piletom, rolatom od sviwskog mesa za~iwen smokvama,suvim{qivamaislaninom,te rolovanim}evapomipile}omxigericom, asvesetona{loispodsa~a. Bilojeidrugihzanimacija.KrajDoma kulture prire|en je pravi disnotor. U centrupa`wesubiliAntalDan~oiJano{ Guti iz ekipe „Telek paprika” iz Martono{a.Dan~ojenedequdanaranije prvomestoosvojionakobasicijadiuma|arskomgraduBeke{~abaukonkurenciji 170takmi~arapripremaju}iro{tiqkobasicupotajnommartono{komreceptu. Tekst i foto: MiloradMitrovi}

ZAVI^AJNODRU@EWEUOBROVCUIDRUGEJESEWESLAVE

MAESTROZVONKOBALOG(78)[EZDESETGODINAUSVETU KAFANEIMUZIKE

[ta bi’ drugo nego da prebiram po `icama

wukukuruzovinekaopoja~awepridru`iliMilkaKurixa,Tomislav\urinidrugiizzrewaninskogKUD-a„VeseliBana}ani”,kojisunapovratkuizSuboticedo{li da obi|u dru{tvo u Gorwem Bregu. Sala{arska ekipa „Orompart” iz atara GorwegBreganijesedalanadma{itiniu gabaritu,kvalitetutrpezeniposlu,a~inili su je Marta Es-Sabo, Marija Boro{i-\evi,Er`ebetEs-Sabo,FerencBerewiiKaroqFarka{.Takmi~arskiduhje podgrevan zbog ukupne atmosfere, a nije bilosumweupristrasnostocewiva~ako jeboqeodradioposaojerjesvrhaovakvih okupqawadru`eweinegovaweobi~aja. Zamirisalisuspecijalitetiupedesetakbogra~a,okretalasejagwetinanara`wu,dimiloseisro{tiqa,augrn~arijiizZlakusakr~kaloselagano.Kalman Bor{o{iz^okespremaojenarodnispecijalitet „lu~ko{ kaposta”, slatki so~ni futo{ki kupus s ov~etinom, „tajanstvena varja~a” Slavoquba Novaka iz Gorweg Brega je slatki kupus za~inila sviwetinom, Goran Balog iz Sente je za promenu kuvao paprika{ od `drebe}eg mesajerje,na`alost,jedno`drebenena-

SpecijalitetuVladanaSubotinaukus dajuismokveisuve{qive

I Ba~ka i Banat imaju svoje Jawe

J

esenjeuba~kojravnicipored Dunava bila beri}etna, paorisuprikrajusradovimaupoqupasepolakohvatazalet za ku}na slavqa, ali i zavi~ajnadru`ewa.TakojeuObrovcu ~etvrto„Obrova~kojawskove~e“ okupilo oko 150 qudi iz ovog kraja koji imaju veze s okolinom op{tine[ipovouBosni,alisu na dru`ewe do{le i kom{ije i prijateqiizdrugihkrajeva. – Svojevremeno se u Obrovac doselilooko100porodica,aJawe predstavqa teritoriju op{tine [ipovo – pri~a organizator ove manifestacije, penzionisani oficirMiloradVojnovi}.–Ciq nam je da se sa~uva zavi~ajna ba{tina, a osim u Obrovcu, Jawana ima i u Banatu, odnosno Banatskom Despotovcu, ali i u Ba~koj, Ravnom Selu, Budisavi, pa i u Perlezu,Futogu... Me|ugostimasubiliiGlamo~ani,Livqani,Bugojanci...Ukqu~ilisuseime{tani,odnosnostarosedeoci Obrovca, pa se mogao ~uti{irokrepertoarpesama,od onih zavi~ajnih do tambura{a. Sve~anostje,sadave}potradiciji,po~elahimnomJawa,anapisao ju je profesor Boro Vojnovi} iz RavnogSela. IdoksuseObrov~anidru`ili ikrozpesmuse}alizavi~aja,Palan~ani su se okupili oko novog pravoslavnoghramaunasequ„Sinaj“,gdejeosve}enacrkvaPokrova Presvete Bogorodice. Drugi pravoslavni hram u Ba~koj Palancigradise,izme|uostalog,i izdvajawem vernika koji su prihvatili da svakog meseca odvoje procenat od svoje plate ili penzije–kokolikomo`e–koimavi{e,dajevi{e. @iteqiovogdelagrada,aima ihoko10.000,posebnosuponosni jer je odskoro na zvoniku tabla s imenom patrijarha Pavla. Svoje-

vremenosuovda{wigimnazijalci inicirali da jedna od ovda{wih ulicadobijenazivTrgpatrijarha Pavla, a lokalna vlast, odnosno odbornici,tuidejujeprihvatila. Jesenjeipo~etakku}nihslava, a po~elo je s 31. oktobrom, odnosnoSvetimLukom,paideMitrovdan,Aran|eo...Kakosebli`epraznicikojisenajvi{epraznuju,takoicenamesaska~epajedanaskilogram`ivevagejagawaca220dinara,aprasi}aod150do180dinara. Sve je vi{e posla i za ovda-

novapijacaunasequSinaj.Zasadajepo~eodaradizelenideopa jetakoovaprivatnatr`nicapostalakonkurencijaonojucentru gradakojudr`iovda{weop{tinsko Javno preduze}e „Komunalprojekt“. Svom lepotom ove jeseni zasijaojeijedinipravipasa`ucentru varo{i, ali to Palan~ani skoroidanevidejersuzakupqeni tradicionalnim jesewim poslovimapoputstavqawakupusau kace.Kilogramsekre}eod10do

BoroVojnovi}napisaojawanskuhimnu

{wepe~eware.Jednuodwihdr`i Obrad Ruwo, a poznat je po tome {tozape~ewekoristiiskqu~ivo }umur jer, veli, to daje najboqi {mek pe~ewu. Pripremio je dvadesetakra`weva,akadado|evreme Nikoqdana, odnosno Svetog Nikole, de{ava se da se u isto vreme vrti {est ra`weva, a drugih {est ve} je spremno za vatru. Najvi{eposlajeba{okoNikole iJovana,alitujeiNovagodina, Bo`i}, a ovde se mnogo slavi i \ur|evdan. Ove jeseni u Palanci ima i drugih novosti, a me|u wima je i

15dinara,anajstru~nijisenadajuda}euskorouwihovimdomovimazamirisatisarma,podvarak,a uz pe~ewe nema boqe salate od ribanca. Svisenadajublagojjeseniizimi, pa vi{e veruju u nebo nego u meteorologe.Oizbornimprognozamapri~asetekkadaseizburi}a odvadi dobre rakije, a skoro svi se hvale da nikada nije bila boqazbogslastivo}a.Najboqaje, veledoma}ini,onakojajepredvama,ba{kaoivinokojeuzmezepa{ezajesewesedeqkeipri~e. M.Suyum


dru[tvo

KOSUI[TARADE16.000NEVLADINIH ORGANIZACIJAUSRBIJI

Vojvodinagodi civilnomsektoru U Sr bi ji tre nut no de lu je 15.905 nevladinih organizacija raz li ~i tih pro fi la, obla sti delovawa i stepena uticaja u dru{tvu. Istra`ivawe koje je sproveo „Stratexik marketing” u organizaciji Fonda za razvoj ne pro fit nog sek to ra APV, Kan ce la ri je Vla de Re pu bli ke Srbije za saradwu s civilnim dru{tvom i Gra|anskom inicijativom, pokazalo je da ve}ina wih ra di u neo d go va ra ju }im uslovima, bez prostorija i opreme, bez pomo}i dr`ave ili s vrlo malo, ali da se situacija u posledwoj godini lagano popravqa.

Predstavqaju}i istra`ivawe ju~e u Skup{tini Vojvodine direktorka Fonda za neprofitni sektor APV AnaSegedinskirekla je da je ova institucija 2006. godine sprovela istra`ivawe o NVO-ima u Vojvodini, gde ih je

Javnostte{ko mewami{qewe Oko 60 odsto NVO-a smatra da se stav javnosti o wima nije promenio u posledwe tri godine, dok 36 odsto wih misli da se mi{qewe gra|ana promenilo naboqe. Ovom podatku ide u prilog i ~iwenica da ~ak 60 odsto organizacija nema strategiju za odnose s javno{}u, pokazalo je istra`ivawe „Stratexik marketinga„. zabele`eno oko 6.000, a ispostavilo se da tek mali broj ima uslove za rad. – Fond nije mogao da re{ava tu vrstu problema jer se bavi temat skim pro jek ti ma za ko je obezbe|uje novac. I pored toga, organizovali smo ciklus seminara na teme koje su se pokazale neophodnim, poput pisawa projekata, prikupqawa novca, upravqawa organizacijom, saradwa s medijima i druge – rekla je Ana Segedinski. Dub ravk a Vel at iz Gra |an skih inicijativa naglasila je da je u istra`ivawu kori{}en uzorak od 1.650 organizacija, {to smatra reprezentativnim. – Nismo tu uvrstili stranke, fondacije i zadu`bine, kao ni verske i sportske organizacije, jer svi oni potpadaju pod posebne zakone. Istra`ivawe je pokazalo da sam neprofitni sektor ima pogre{no mi{qewe o sebi u dru{tvu. Ispostavilo se da nevladine organizacije

iz devedesetih godina pro{log veka i kasnije ne znaju ni{ta o kolegama ~iji su NVO-i nastale pre tog perioda. Oni koji su nastajali pre tih godina sebe i ne prepoznaju kao nevladin sektor iako to jesu – objasnila je Dubravka Velat. Istra`ivawe je pokazalo da u NVO-ima u Srbiji radi 4.200 qudi, ne{to vi{e od toga je ubele`eno kao honorarci, dok volontera ima vi{e od 150.000, nakon ~ega slede stotine hiqada ~lanova. Najve}i broj nevladinih organizacija stacioniran je u Vojvodini (37 odsto), zatim u Beogra-

du (30 odsto), a ostale su ravnomerno raspore|ene u drugim delovima Srbije. Ve}ina NVO-a je u 2010. godini imala godi{we buxete oko 20.000 evra, dok je svaka deseta raspolagala s oko 100.000 evra. Zanimqiv je podatak da ~ak tre}ina nevladinih organizacija ne poseduje ra~unar, taman koliko je wih koje nemaju pristup internetu. Misiju organizacije imaju skoro svi, ali strate{ki plan delovawa istra`iva~ima je moglo da poka`e mawe od polovine. [to se oblasti delovawa ti~e, obrazovawe i akcije u lokalnoj zajednici su najzastupqeniji. Visoko se kotira i savetovawe i pru`awe profesionalnih usluga, najmawe je dru{tava koji se bave lobirawem ili pru`awem materijalne pomo}i. Izve{taj nadaqe pokazuje da je ve}ina NVO-a nezadovoqna poreskom politikom i zakonom o udru`ewima. Saradwu dr`ave s neprofitnim sektorom organizacije su ocenile prose~nom ocenom tri, {to je mali pomak u odnosu na raniji period. Vi{e od 40 odsto NVO-a ocenilo je politi~ku klimu u dr`avi kao nepogodnu za ovaj sektor, kao i da je uticaj sektora na kreirawe dr`avne politike suvi{e mali. Ni saradwa NVO-a s poslovnim sektorom nije boqa od saradwe s dr`avom. [to se odnosa s medijima ti~e, istra`ivawe je pokazalo da je tek deset odsto organizacija imalo saradwu ili kontakte s novinarima. Ve}ina wih ima delimi~no poverewe u medije, a saradwu lak{e ostvaruju s lokalnim medijima nego s onima s nacionalnom pokriveno{}u. Saradwa u samom NVO sektoru naj~e{}e se zasniva na lokalnom nivou. Ve}ina wih je zadovoqna saradwom s kolegama. P.Klai}

Filozofski fakultetmorasam dare{iproblem Ministar prosvete i nauke @arko Obradovi} izjavio je da fakulteti i univerziteti imaju obavezu da u skladu sa zakonom obezbede normalno odvijawe nastave. Komentari{u}i zahtev Saveta Filozofskog fakulteta u Beogradu, koji je posle sednice zatra`io od Ministarstva, kao osniva~a, pomo} pri re{avawu problema blokade nastave, ministar je dodao da fakultet sam mora da re{i taj problem. – Dr`ava jeste vlasnik imovine, ali wom upravqa fakultet i obaveza je pre svega fakulteta i univerziteta da u skladu sa zakonom obezbede normalno odvijawe nastave –

rekao je ministar Obradovi}. – Obaveza fakulteta je da obezbedi uslove da profesori mogu da rade i da studenti mogu da poha|aju nastavu i nije dobro da se primewuju mere da jedni studenti ne dozvoqavaju drugima da poha|aju nastavu. Ina~e, blokada Filozofskog fakulteta u Beogradu se nastavqa, a predstavnici studenstkog Plenuma za danas su najavili protest s kojeg }e ponovo zatra`iti ispuwewe zahteva za lak{i upis naredne godine studija, smawewe {kolarina i smenu rektora Univerziteta u Beogradu BrankaKova~evi}a.

sreda9.novembar2011.

13

SVEVI[EGRIPOZNIHPOAMBULANTAMATRA@ILEK

Doantibiotika samouzrecept Sa svakodnevnim pove}awem broja obolelih od respiratornih virusnih infekcija u apotekama {irom Vojvodine bele`i se pove}awe potro{we lekova kojima se ubla`avaju gripozni simptomi. Dugogodi{wa praksa gra|ana da se na najmawi znak prehlade, bola u grlu ili kijavice uzimaju atibiotici, pre ki nu ta je po o {tra va wem propisa i kontrole izdavawa lekova. Naime, ni u dr`avnim apotekama ni u onim u privatnom vlasni{tvu antibiotici se vi{e ne mogu dobiti bez recepta ili izve{taja lekara da je taj lek nophodan. Oni koji imaju overenu zdravstve nu kwi `i cu an ti bi o tik mogu dobiti uz recept, o tro{ku zdravstvenog osigurawa, a oni koji nisu zdravstveno osigurani lek mogu kupiti samo ili uz recept ili uz izve{taj izabranog lekara. Po{to se antibiotici ne mogu kupiti u slobodnoj prodaji, lekari op{te medicine u domovima zdravqa bele`e pove}an broj pacijenata koji zahtevaju da dobiju recept za taj lek.

Ova grupa lekova spada u najpopularnije medikamente, a qudi im pridaju magi~na svojstva u svim slu~ajevima kad se jave neki od zdravstvenih problema – Iako pacijentima ka`em da antibiotici ne deluje na viruse, veliki broj wih tra`i da im ga propi{em ~im osete prehladu – ka`e dr Katica Varga. – Imam pote{ko}e da im objasnim da se antibiotici ne mogu uzimati preventivno, a prili-

~an broj wih tra`i da im ispi{em recept za taj lek jer putuju pa da ga imaju pri ruci ako nazebu. Ova grupa lekova spada u najpopularnije medikamente, a qudi im pridaju magi~na svojstva u svim slu~ajevima kad se jave ne-

ki od zdravstvenih problema. Apotekari ka`u da je kupovina antibiotika na svoju ruku, dakle bez recepta, bila uobi~ajena pojava, a du`inu uzimawa leka i dozu naj~e{}e su pacijenti sami sebi odre|ivali. Srbija je me|u vode}im zemqama u Evropi po potro{wi antibiotika, pokazuju preliminarni rezultati projekta pra}ewa potro{we lekova u 35 zemaqa na{eg kontinenta. Podaci iz tridesetak na{ih mikrobiolo{kih laboratorija govore da 22 pacijenta na 1.000 stanovnika uzima terapiju antibioticima. Lekari stoga neprestano upozoravaju na to da je neophodno poraditi na podizawu svesti gra|ana o opasnostima koje mo`e doneti sve ve}a rezistentnost (otpornost) na antibiotike, kao i na razvoj rezistentnih bakterija. Neracionalna potro{wa ovih medikamenata dovodi do toga da medicina po~iwe da gubi bitku s rezistentno{}u bakterija na antibiotike, zbog ~ega oni vi{e nisu delotvorni. J.Barbuzan

RAZVIJAWEPSIHOFIZI^KIHPERFORMANSIKODDECE

Iroditeqiho}e na„Superzabavnipoligon” Nesvakida{we sportsko nadmetawe za najmla|e ~lanove Karate kluba “Zrewanin” pripremio je stru~ni tim zrewaninskih karatista. Naime, u Domu borila~kih sportova prvi put je odr`ano takmi~ewe u poligonu spretnosti pod nazivom “Superzabavni poligon”. Iako su se najmla|i karatisti i wihovi drugari premijerno susreli s ovom disciplinom, nije im zafalilo motiva, sr~anosti i pravog takmi~arskog zanosa da za {to kra}e vreme savladaju nimalo jednostavne prepreke na poligonu. – Stru~ni tim na{eg kluba na ovaj potez odlu~io se nakon konsultacija s renomiranim stru~wacima iz oblasti kineziologije. Zajedni~ki smo pripremili ~etiri nivoa slo`enosti poligona, u zavisnosti od uzrasta i pola – kids, junior, ma-

ster i master plus nivo. Kineziolo{ki gledano, putem poligona se razvijaju sve neophodne antropolo{ke sposobnosti koje su relevantne, pre svega, za normalan rast i razvoj, ali i za eventualno daqu takmi~arsku karijeru – obja{wava trener KK “Zrewanin” Simo Salapura, i precizira da zadaci, koji su logi~ki povezani u smislenu celinu, uvek sadr`e elemente za ciqno razmi{qawe (koncentraciju), za koordinaciju, senzibilizaciju pokreta, ravnote`u, odnosno za razvijawe celokupnih psihofizi~kih performansi kod u~esnika. Uz bu~no navijawe i podr{ku roditeqa i drugova, u~esnici takmi~ewa, koji nisu bili samo ~lanovi kluba ve} se u ko{tac s preprekama mogao uhvatiti bilo ko, uspe{no su savladali sve zadatke, pa`qi-

vo osmi{qene tako da ih podstaknu na to da daju maksimum i prevazi|u svoje sposobnosti. – Interesantna je bila reakcija roditeqa: zatra`ili su, a stru~ni tim je prihvatio sugestiju, da se na narednom takmi~ewu kreira poligon izazova – namewen wima – dodaje Salapura. Prva mesta na “Superzabavnom poligonu” osvojili su DuwaAn|elkovi}, Aurena Pola~ek, Nikola Vasili}, Mateja Andri}, Svasja Pola~ek i Marko Andri}, druge pozicije pripale su Branku[ov{u, Ivani [ov{, Rastku Popovi}u, Lazaru Andri}u i Jovani Oreq, a tre}e Filipu Laki}evi}u, Mateji Popovi}u, Mateji Vujinu, MiliKir}anski, DuwiSalapuri, MarkuVujinu i MiwiSekuli}. @.Balaban

(NE)TOLERANTNISREDWO[KOLCI

@enetrebadaspasavajunaciju Oko 40 odsto sredwo{kolaca u Srbiji smatra da su pripadnici LGBT-populacije bolesni, a oko 20 odsto misli da im nije mesto u wihovim {kolama i da „zaslu`uju batine”, rezultat je istra`ivawa koje je sproveo Helsin{ki odbor za qudska prava. Istra`ivawe je sprovedeno od aprila do juna ove godine, me|u 630 sredwo{kolaca u {est gradova Srbije – Beogradu, Novom Sadu, Kru{evcu, Zrewaninu, Ni{u i Novom Pazaru. Autorka istra`ivawa, sociolog Marija Radoman istakla je da istra`ivawe ukazuje na o{tre podele me|u sredwoURU^ENENAGRADE„DR \OR\E NATO[EVI]” ZA PEDAGO[KU IZUZETNOST: Profesorki biologijeuGimnaziji„IsidoraSekuli}”mrJovankiTerzi},profesorki jugoslovenske kwi`evnosti i srpskog jezika u Tehni~koj{koli„9.maj”uBa~koj Palanci” Jugoslavi Luli}ipredstavnicimaOsnovne{kole„Petefibrigada”iz Kule, Muzi~ke {kole „Petar Kran~evi}” iz Sremske Mitrovice i Sredwe tehni~ke {kole„MilevaMari}”»izTitela pokrajinski sekretar za obrazovawe, upravu i nacionalnezajednicemrAndorDeli uru~io je ju~e u Vladi Vojvodine priznawa „Dr \or|e Nato{evi}” za izuzetan do-

{kolcima, po{to ima onih ekstremno netolerantnih, ali i liberalnih. – Oko 14 odsto sredwo{kolaca smatra da istopolnim parovima treba omogu}iti usvajawe dece, a 16,5 odsto podr`ava istopolne brakove – ka`e Marija Radoman. Istra`ivawe pokazuje i da 37 odsto ispitanika ima ekstremno {ovinisti~ke i rasisti~ke stavove prema Romima, a petina ispitanih smatra da su pripadnici romske populacije „mentalno mawe sposobni da u~e”. Oko 62 odsto sredwo{kolaca bilo je svedok fizi~kog nasiqa, prinos u vaspitno-obrazovnomraduuVojvodini. -Uovimte{kimvremenima u vaspitno-obrazovnom radu jeizuzetnote{koposti}iizuzetnostitimprejena{adu`nostdajecenimoinagradimo,uznaduda}emoinatajna~in podsta}i, ne samo dobitnike nego sve prosvetne pregaoce,natodasejo{vi{ezala`u–rekaojemrAndorDeli i uru~uju}i nagrade laureatima,svimprosvetnimradnicima~estitao8.novembar,Dan prosvetnihradnika. U umetni~kom delu programa nastupili su pred{kolski hor„Vivak”iu~eniciMuzi~ke {kole „Petar Kran~evi}” iz SremskeMitrovice. D.D.

a da je `rtva nasiqa priznalo je 13 odsto ispitanika. Oko 60 odsto sredwo{kolaca smatra da u Srbiji postoji problem porodi~nog nasiqa, 61 odsto bi takvo nasiqe prijavilo. Istra`ivawe ukazuje i na tradicionolno shvatawe porodice me|u srpskim sredwo{kolcima po{to 45 odsto wih smatra da mu{karac treba da ima glavnu re~ u porodici. Oko 43 odsto sredwo{kolaca smatra da `ene u Srbiji treba vi{e da ra|aju „da bismo bili spaseni kao nacija”, a oko 30 odsto ispitanika misli da `ena mo`e biti potpuno ostvarena samo kao majka.

Predsednik Komisije za unapre|ewe bezbednosti u Beogradu Dejan Ran|i} smatra da istra`ivawe ukazuje na probleme s kojima }e se Srbija suo~avati u budu}nosti, ali i na to da dr`ava nema jasan plan i program kada je re~ o edukaciji mladih i unapre|ewu sistema vrednosti. – Re{ewe je u edukaciji i {irewu tolerancije me|u osnovcima i sredwo{kolcima – rekao je Ran|i}, i dodao da pojedini politi~ari u Srbiji svojim pona{awem doprinose {irewu neto lerantnih stavo va me|u mladima.

Foto:N.Stojanovi}

dnevnik


crna hronika

sreda9.novembar2011.

dnevnik

c m y

14

ISTRAGA O POBUNI „CRVENIH BERETKI” PRE DESET GODINA

Saslu{anMiloradBracanovi}

[UMSKI PO@AR KRAJ KU[TIQA, NEDALEKO OD VR[CA

Izgorelo25ko{nica U {umskom po`aru, koji je zahvatio Ku{tiqsku dolinu, stradalo je dosta divqa~i, izgorelo je tridesetak hektara niskog rastiwa, kao i 25 ko{nica vr{a~kog p~elara SaveA}imova. Uzrok po`ara jo{ nije utvr|en, a vatrogasci su dva dana gasili vatru koju je raspirivao orkanski vetar. Vatru je prvi opazio poqo~uvar MarjanPavlovi} i podmah pozvao vatrogasce i tako spre~io {irewe vatre. Nisko rastiwe je izgorelo, ali drve}e je u velikoj meri sa~uvano. – Oko podneva sam krenuo u obilazak atara jer se nedeqom naj~e{}e de{avaju kra|e – ka`e Pavlovi}. – Jo{ izdaleka sam primetio da se iznad kro{wi izdi`e dim pa sam brzo o tome obavestio vatrogasce. Dok sam ih ~ekao, poku{ao sam da za{titim ostale ko{nice, ve-

liki broj je ve} bio izgoreo, ali vetar je bio neumoqiv... Kada su stigli, vatrogasci su gasili vatru punih osam sati. Oko 21 sat ~inilo se da je vatra uga{ena, ali izjutra ju je vetar ponovo razbuktao pa su vatrogasci ponovo intervenisali. P~elar A}imov ka`e da ga je ovaj po`ar „ko{tao“ oko 5.000 evra. Izgleda da su po`aru kumovali ratari, koji i pored upozorewa da ne pale vatru, to ~ine, da na najlak{i na~in o~iste wive od ostataka letine. Ovom prilikom orkanska ko{ava je doprinela da se vatra otme kontroli. Pretpostavka je da se po`ar tako pro{irio, ali uvi|ajem nadle`nih organa utvrdi}e se ta~an uzrok ovog po`ara u ku{tiqskom ataru, udaqenom nekoliko kilometara od ovog sela kraj Vr{ca. R. Jovanovi}

U GRDELI^KOJ KLISURI ODUZETE NAMIRNICE S KOSOVA

Zapleweno225kila pile}ihbataka Prilikom vanredne kontrole na deonici autoputa izme|u Vrawa i Ni{a, kod mesta Xep, carinici su u ponedeqak spre~ili poku{aj krijum~arewa 225 kilograma smrznute piletine, saop{tila je ju~e Uprava carina. Pile}i bataci i karabataci ameri~kog porekla s deklaracijom Kosova u kutijama od 15 kilograma bili su sakriveni u prtqa`nom prostoru automobila vrawskih registarskih oznaka. Nekoliko kutija smrznutog mesa prona|eno je i na podu ispod nogu suvoza~a. Po{to putnici automobila nisu posedovali nikakvu propratnu dokumentaciju za meso, carinski slu`benici su ga zaplenili i predali u daqu nadle`nost Republi~-

koj veterinarskoj inspekciji, dok je protiv odgovornih lica pokrenut prekr{ajni postupak pred nadle`nim sudom. Uprava carina podse}a na to da je pre nekoliko meseci, prilikom dubinske kontrole na putu Leskovac–Ni{, u putni~kom vozilu otkrili 500 kilograma pile}ih bataka ameri~kog porekla. Ne treba podse}ati na to koliko krijum~arena hrana koja se bez nephodnih inspekcijskih kontrola na|e na tr`i{tu mo`e biti opasna po zdravqe qudi. Doslednim sprovo|ewem zakona u datim oblastima Uprava carina uspe{no {titi zdravqe gra|ana i `ivotnu sredinu od razli~itih zdravstvenih i ekolo{kih opsanosti i izazova. M. B.

U nastavku istrage protiv osam pripadnika Jedinice za specijalne operacije ju~e je u Specijalnom sudu u Beogradu saslu{an biv{i zamenik na~elnika Bezbednosnоinformativne agencije Milorad Bracanovi}. Bracanovi} je saslu{an kao svedok u istrazi koja se vodi zbog oru`ane pobune JSO-а u novembru 2001. godine, za koju se sumwa da je bila uvod u atentat na premijera Srbije Zorana \in|i}a godinu i po kasnije. Saslu{awe svedoka zakazano je do kraja sedmice. Istraga se vodi protiv osumwi~enih za organizovawe pobune – nekada{weg komandanta JSO-а MiloradaUlemekaLegije, Du{ka Mari~i}a Gumara i Zvezdana Jovanovi}a, koji slu`e vi{edecenijske kazne u zatvoru. Istragom su obuhva}ena jo{ petorica pritpadnika JSO-a – Veselin Le~i}, Mi}aPetrakovi}, DragoslavKrsmanovi}, VladimirPoti} i Dragi{aRadi} i oni su u pritvoru. Tu`ila{tvo za organizovani kriminal iniciralo je istragu zbog sumwe da su organizovali oru`anu pobunu zajedno sa sada po-

MiloradBracanovi}

kojnim vo|om „zemunskog klana” Du{anom Spasojevi}em. Tu`ila{tvo ih tereti da su u novembru 2001. organizovali pobunu jedinice, koja je otkazala poslu{nost i prekinula sve veze s komandom, blokirala bazu u Kuli, ispostavila zahteve za smenu ministra unutra{wih poslova, na~elnika Re-

sora dr`avne bezbednosti i wegovog zamenika. Potom je, uz upotrebu borbenih vozila i naoru`awa, blokirala autoput kod Vrbasa. Narednih dana je to ponovila i blokadom autoputa kroz Beograd kod Centra „Sava”, odbijaju}i istovremeno i nare|ewa da se jedinica vrati u svoju bazu u Kuli.

Uzrok pobune je, kako su tada obrazlagali komandanti jedinice, bilo nezadovoqstvo wenih pripadnika zbog hap{ewa bra}e blizanaca Nenada i Predraga Banovi}a, optu`enih u Hagu, a „beretke” su zahtevale da se hitno donese i zakon o saradwi s Tribunalom. Pobuna je trajala nedequ dana, a okon~ana je dogovorom s Vladom Srbije. Ulemek, Jovanovi} i Mari~i} u po`areva~kom zatvoru izdr`avaju vi{edecenijske kazne zatvora zvog ubistva premijera \in|i}a i drugih zlo~ina. Ulemek je bio komandant JSO-a do juna 2001, kada ga je nasledio Mari~i}. Ulemek je prvosna`no osu|en kao organizator ubistva premijera \in|i}a, a Jovanovi} kao neposredni ubica. Mari~i} je pravosna`no osu|en za ubistvo Ivana Stamboli}a i ~etvorice funkcionera SPO-a na Ibarskoj magistrali i poku{aja ubistva lidera te stranke VukaDra{kovi}a. Organizatorima oru`ane pobune preti kazna od najmawe pet do 20 godina zatvora, a u~esnicima od tri do 15 godina zatvora. (Tanjug)

ADVOKATI NEKADA[WEG NA^ELNIKA GENERAL[TABA VJ NAJAVILI @ALBU

Odbrana:Nerazumna presudaPeri{i}u Odbrana biv{eg na~elnika General{taba Vojske Jugoslavije Mom~ila Peri{i}a najavila je ju~e `albu na presudu Ha {kog tri bu na la ko jom je progla{en krivim za zlo~ine protiv ~ove~nosti i ratne zlo~ine po~iwene u Bosni i Hercegovini i Hrvatskoj i osu|en na 27 godina zatvora. Odbrana tra`i da se presuda po svim ta~kama optu`nice preina~i u „nije kriv” i da se, u skladu s tim, izmeni i smawi kazna zatvora, saop{tio je Ha{ki tribunal. „Ova `alba ima mnogo dalekose`niji zna~aj od samog ’slu~aja Peri{i}’. Presuda predstavqa nerazuman i nerealan presedan kojim se me|unarodni krivi~ni zakon {iri izvan primerenih granica”, navedeno je u obrazlo`ewu odbrane.

Mom~iloPeri{i}

Ve}ina ~lanova Pretresnog ve}a je, kako navodi odbrana, „kriminalizovala rat” koji nije zlo~in po Statutu Tribunala ili me|unarodnom pravu. „Ukoliko presuda Peri{i}u ostane va`e}a, svaki vojni komandant i nacionalni lider koji pru`i vojnu pomo} stranoj dr`avi ili tre}oj strani tokom me|unarodnog oru`anog sukoba je odgovoran za pomo} i pomagawe zlo~ina, samim tim {to je pru`io pomo} u vo|ewu rata„, navode branioci u najavi `albe. Peri{i} je 6. septembra ove godine progla{en krivim ve}inom glasova Pretresnog ve}a, uz suprotno mi{qewe sudije Molotoa, za pomagawe i podr`avawe ubistava, nehumanih dela, progona na politi~koj, rasnoj ili verskoj osnovi i napada na

civile u Sarajevu i Srebrenici. Ve}ina sudija ga je, tako|e, proglasila krivim, uz suprotno mi{qewe sudije Molota, zbog toga {to nije kaznio svoje podre|ene za krivi~na dela ubistva, napada na civile i rawavawa civila koja su po~inili tokom raketnih napada na Zagreb 2. i 3. maja 1995. godine. Peri{i} je jednoglasno oslobo|en krivice za pomagawe i podr`avawe zlo~ina protiv ~ove~nosti u Srebrenici i odgovornosti nadre|enog u vezi sa zlo~inima u Sarajevu i Srebrenici. Peri{i} se predao Ha{kom tribunalu 7. marta 2005. godine. Su|ewe je po~elo 2. oktobra 2008. godine i zavr{eno je izno{ewem zavr{nih re~i 31. marta ove godine. (Tanjug)

JO[ TRAJE ISTRAGA PROTIV BIV[EG KOMANDANTA 5. KORPUSA ARMIJE BiH

Dudakovi}–Mladi}evkapetan ~ijisuzlo~inisnimqeni Biv{i komandant Petog korpusa Armije BiH Atif Dudakovi} ve} godinama je „pod istragom” za ratne zlo~ine tokom rata u BiH, wegov slu~aj je vi{e puta bio u centru pa`we javnosti – posebno posle obelodawivawa video-snimaka na kojima nare|uje pogubqewa. Dudakovi}evo ime ju~e je ponovo „osvanulo” u javnosti po{to je stigla vest da je Agencija za istrage i za{titu BiH (SIPA) zapo~ela pretres kasarne „Orqani„ u Biha}u u sklopu istrage protiv Dudakovi}a za ratne zlo~ine nad Srbima. U toj kasarni se, zapravo, nalazi ratna arhiva Petog korpusa. Televizije u regionu proteklih godina su u dva navrata objavqivale snimke na kojim se Dudakovi} vidi kao akter i nalogodavac ratnih zlo~ina. Ipak, on je i daqe na slobodi. Dudakovi} je ro|en 2. decembra 1953. u selu Orahova, u okolini tada{we Bosanske Gradi{ke. Zavr{io je sredwu vojnu {kolu u Zadru, a 1976. Vojnu akademiju, smer artiqerija. Po~etak rata, 1991, zatekao ga je u Zadru, u Artiqerijskom {kolskom centru, posle ~ega je pre{ao u Knin. Tamo je dobio ~in kapetana i funkciju koman-

kako Dudakovi} nare|uje paqewe ku}a. Re~ je o amaterskom videosnimku nastalom u okolini Gline i Dvora na Uni, 7. i 8. avgusta 1995. godine, na kojem se pripadnici vojnih formacija „Crne mambe” iz Hrvatske i odreda „Hamze” iz BiH najsurovije obra~unavaju sa srpskim vojnicima i civilima koji tokom „Oluje” napu{taju Krajinu.

nici Petog korpusa Armije Bosne i Hercegovine, pod komandom Dudakovi}a, kako pale srpska sela u Bosanskoj krajini, u nastavku akcije „Oluja”, 16. i 17. septembra 1995. godine. Po podacima Komisije za tra`ewe nestalih u Republici Srpskoj, u toj akciji u op{tinama Petrovac, Biha}, Bosanska Krupa, Sanski

Pod za{titom Amerike? AtifDudakovi}

danta artiqerije pod komandom tada{weg kapetana prve klase RatkaMladi}a. U aprilu 1992. postao je komandant op{tinske teritorijalne odbrane Biha}a, zatim komandant Druge muslimansko-hrvatske pe{adijske brigade. U ratu u BiH je napredovao do brigadnog, a potom i divizijskog generala, a na mesto komandanta Petog korpusa Armije BiH sa sedi{tem u Biha}u postavqen je 1. novembra 1993. Jedinice pod wegovom komandom porazile su jedinice Zapadne Bosne FikretaAbdi}a. Posle rata bio je komandant zajedni~ke komande Vojske Federa-

cije BiH. BN TV emitovala je ranije video-snimke, nastale 9. jula 1994, na kojima su pripadnici Narodne odbrane Autonomne Pokrajine Zapadna Bosna, koje je zarobio Peti korpus u akciji na Iza~i}u, koju je predvodio Dudakovi}. Dudakovi}, okru`en vojnicima, pitao je tada gde su dva zarobqenika, a kad je dobio odgovor da su u kampawoli, izdao je naredbu: „Streqati na licu mesta!” Protiv Dudakovi}a su jo{ 2006. krivi~nu prijavu Tu`ila{tvu BiH podneli tada{wi predsednik i premijer RS Dragan^avi}i MiloradDodik, nakon {to su televizije u RS emitovale video-snimke

Zbog sporosti istrage o slu~aju vo|e Petog korpusa, u javnosti je vi{e puta pokretano i pitawe „ko {titi Dudakovi}a”. Beogradski advokat TomaFilaje, na primer, tvrdio (a ameri~ka ambasada momentalno demantovala) da biv{i komandant Petog korpusa Armije BiH ne}e biti optu`en za ratne zlo~ine jer to ne dozvoqavaju Amerikanci. – Dudakovi} je sara|ivao s Amerikancima. Oni su ga naoru`avali i obu~avali i on je opasan ~ovek. Ako progovori o tome da su Amerikanci donosili oru`je na tuzlanski aerodrom i ko je obu~avao muslimanske borce, onda je jasno za{to ne}e biti procesuiran – rekao je tada Fila. I Milorad Dodik je verovao da Dudakovi}a „neko {titi” i da se zato on ose}a sigurno u Biha}u i u BiH, a – kako je isticao – „svakako je trebalo ve} odavno da bude procesuiran”. Dudakovi} je ranije naveo da mu nije poznato {ta su radile wemu pot~iwene jedinice. Radio-televizija Srbije prikazala je avgusta 2006. videosnimke na kojima se vide pripad-

Most i Kqu~ ubijeno je oko 870 srpskih civila i 400 vojnika, a spaqeno vi{e od 30 sela. Predstavnik Kancelarije za tra`ewa nestalih lica Republike Srpske Milan Ivan~evi} re-

kao je da je u tim akcijama ubijeno 1.200 Srba, od ~ega 870 civila, dok se 830 osoba vodi kao nestalo. Na tom podru~ju na|ena je 21 masovna grobnica Srba, koje su ubili pripadnici Petog korpusa Armije BiH. Predsednik Komisije za istra`ivawe ratnih zlo~ina na podru~ju Biha}a i Cazina RifatDoli} tvrdio je u prole}e pro{le godine da se istraga protiv Dudakovi}a privodi kraju i da je pitawe trenutka kada }e biti obelodawena optu`nica koja generala tereti za ratne zlo~ine po~iwene na podru~ju Biha}a i Cazina tokom rata u BiH. Doli} je rekao da je Komisija, odmah po zavr{etku rata, po~ela prikupqawe materijala, ali da su zbog egzodusa brojne `rtve Petog korpusa napustile ovaj prostor. On je naglasio da je veliki broj informacija ostao u Petom korpusu, ali da su prikupili oko 200 neposrednih izjava `rtava i svedoka i veliki broj tonskih i video-zapisa. Godine 1999. Kancelariji Ha{kog tribunala u Sarajevu predat je deo te dokumentacije, ali nisu usledili nikakvi potezi Haga. (Tanjug)


crna hronika

dnevnik POSLEPRO[LOGODI[WENESRE]E,KADAJE VOZILOMNAAUTOPUTUUSMRTIOPE[AKA

Obustavqen postupakprotiv Qubi{eBuhe Prvi osnovni sud u Beogradu obustavio je krivi~ni postupak protiv Qubi{e Buhe ^umeta zbog sumwe da je pro{le godine vozilom usmrtio pe{aka, po{to je Tu`ila{tvo odustalo od krivi~nog gowewa.

alkoholisanom stawu prelazio autoput na neosvetqenom delu, u neposrednoj blizini pasarele za pe{ake. Buha je posle nesre}e odmah uhap{en, a po{to je proveo 48 sati u policijskom pritvoru,

sreda9.novembar2011.

PROFESORNEDEQKOJOVAN^EVI]OCEWUJENEPOTREBNIMUVO\EWENOVOGKRIVI^NOGDELA

Namernoizazivawe ste~ajaka`wivo iposada{wemzakonu U va`e}em Krivi~nom zakoniku Srbije (KZ), kao i u prethodnim, postoje odgovaraju}e norme za krivi~na dela ste~aja i la`nog ste~aja, kojima je za namerno izazivawe ste~aja zapre}ena kazna od {est meseci do pet godina, a za la`ni ste~aj s te{kim posledicama ~ak i od dve do deset godina zatvora. Nikava intervencija u vezi s tim delom nije potrebna – ka`e profesor krivi~nog prava dr NedeqkoJovan~evi}. Reaguju}i na medijske najave da }e Zakonom o izmenama i dopunama KZ-a, ~iji nacrt pi{e stru~na radna grupa Ministarstva pravde, biti uvedeno novo krivi~no delo – namerno izazivawe ste~aja – profesor Jovan~evi} ka`e da „takva inkriminacija ve} postoji„, te da je „iz-

izazivaju}i ste~aj, ne}e mo}i za wih biti procesuirana. Naime, sada{wa dela vi{e ne bi postojala, odnosno bila bi, kako se to u pravu ka`e, dekriminalizovana, a novo krivi~no delo se ne mo`e primewivati retroaktivno, ve} tek od onog dana kad je Zakon o izmena i dopunama KZ-a stupio na pravnu snagu pa nadaqe. Dakle, ako bi do{lo do takve izmene KZ-a, ~itava tranzicija i oni koji bi mogli do}i pod udar zbog dosada{wih slu~ajeva spornih ste~ajeva bi}e izgubqeni za procesuirawe – upozorava dr Jovan~evi}. On nagla{ava da, kad je re~ o va`e}em KZ-u, „nema problema da se procesuira namerno izazivawe ste~aja ili la`nog ste~aja, ali da se kod nas, kod kriv~nih postupaka za zloupotrebe u

nena|en plasirawem takvih pri~a u javnosti jer ne razume uop{te o ~emu se tu radi“. – To su sasvim ozbiqne stvari da se to tako javnosti servira. Upozorio bih na to da, ukoliko se uvede novo krivi~no delo umesto postoje}ih i ona budu izbrisana iz Krivi~nog zakonika, posle stupawa na snagu zakonskih izmena, lica koja su u periodu pre toga po~inila ta dela

privrednom poslovawu, uglavom ide na progon za krivi~no delo zloupotrebe slu`benog polo`aja jer je to najlak{e“. Kod nas, napomiwe Jovan~evi}, „niz decenija u krivi~nom zakodnovstvu, kad je re~ o zloupotrebama u privrednoj oblasti, postoje inkriminacije bukvalno svih spornih odnosa i problemati~nih radwi i mogu se provesti svi postupci“.

Qubi{aBuha^ume

Portparolka suda Ivana Rami}izjavila je ju~e Tanjugu da je Prvo osnovno tu`ila{tvo dopisom od 26. oktobra obavestilo sud da odustaje od krivi~nog gowewa protiv Buhe, zbog ~ega je sud obustavio krivi~ni postupak. Istraga protiv Buhe okon~ana je u junu kada je sud spise predmeta prosledio Tu`ila{tvu koje je zakqu~ilo da u Buhinom postupawu nema elemenata krivi~nog dela, odnosno krivi~ne odgovornosti. Buha, svedok-saradnik u procesu protiv „zemunskog klana”, 3. novembra pro{le godine je na autoputu Beograd–[id „audijem A-8” usmrtio pe{aka Radomira Risti}a (54) iz Bor~e, koji je u

pu{ten je da se brani sa slobode. Tokom istage, saslu{ana je i Buhina supruga Ivana, koja je bila na suvoza~kom mestu, i pripadnici wegovog policijskog obezbe|ewa, na koje ima pravo kao svedok-saradnik, koji su se kretali iza „audija”, voze}i levom trakom autoputa ka aerodromu. Utvr|eno je da Buha nije vozio pijan, niti pod dejstvom narkotika. Po Zakonu o bezbednosti saobra}aja, voza~u koji automobilom usmrti pe{aka s umi{qajem na saobra}ajnici „gde se mo`e o~ekivati nailazak pe{aka” preti kazna zatvora do 12 godina. Voza~u odgovornom za udes iz nehata predvi|ena je kazna do osam godina.

15

NedeqkoJovan~evi}

– Me|utim, aktuelna problemtika koja se de{ava u dru{tvu nije samo stvar krivi~nog prava nego i lo{ih sistemskih zakona u oblasti privrede u procesu tranzcije kao i toga {to ni ti zakoni nisu primewivani pravilno, {to je dovelo do zloupotreba u privredi i korupcije, te do poreme}enih privrednih tokova. Ono {to se javnosti plasira – da }e sada to da se re{i krivi~nim pravom, te da je problem u krivi~nom zakonodavstvu i da }e se to re{iti wegovim izmenama – najobi~nije su floskule i zablude. To treba re{avati sistemski, ozbiqnim reformskim zahvatima u oblasti privrede. Drugo, kad je re~ o ste~ajevima, za{to su dozvoli da to uzme toliko maha? Tako|e vaqa naglasiti da su krivi~ana dela u oblasti privrede veoma kompleksna zbog toga {to je Ustavom utemeqeno ekonomsko-finansijsko ure|ewe na tr`i{nim osnovama – ka`e dr Jovan~evi}.

Osim toga, on smatra da se kod nas „zakoni olako mewaju i donose, ~ak i sistemski u oblasti krivi~nog zakonodavstva, {to je veoma opasno po pravnu sigurnost gra|ana i funkcionsawe pravne dr`ave“. – U reformu krivi~nog zakonodavstva se upli}u i qudi koji tom zadatku nisu dorasli. Drugo, zakonodavna oblast je veoma suptilna i te{ka i moraju je raditi eksperti za normativnu delatnost, veliki poznavaoci instituta teoretskih shvatawa iz te oblasti i efekta prakti~nog sprovo|ewa. A ne da izmene rade prakti~ari, koji bi zbog svakog predmeta koji vide da nije zgodno re{iti da mewaju zakonske norme. Na taj na~in se naru{avaju temeqi krivi~nog zakonodavstva jer stavqaju pred javnost kao ~iwenicu da je krivi~no zakonodavstvo to koje treba da re{ava i ona pitawa za koja samo krivi~nopravna za{tita nije odgovaraju}a ve} treba da ih re{avaju drugi organi – ocewuje dr Jovan~evi}. J. Jakovqevi}

SRETENJOCI]OSVOMPRIVO\EWUOKTOBRA2007.UBEOGRADU

Hap{endanekupi „Robneku}eBeograd”?

SVEU^ESTALIJEKRA\EUSUBOTICI

Ikatedrala nametilopova U posledwe vreme sve su u~estalije kra|e u Subotici. Jedna starija Suboti~anka je divqa~ki pretu~ena i od we je oteto 2.000 evra i 100.000 dinara, a u no}i izme|u ponedeqka i utorka je provaqeno u katedralu svete Terezije Avilske. Nepoznati po~inioci su odneli novac iz kutije za prikupqawe dobrovoqnog priloga. U policijskom saop{tewu se navodi da je re~ o krivi~nom delu te{ke kra|e. GoranFa}ol {est godina radi kao zvonar u katedrali i ka`e da je ovo prvi slu~aj provale. Polomqen je prozor, a o{te}ene su ~etiri zidne i dve drvene kase za prikupqawe priloga. – ^im sam do{ao na posao, primetio sam da ne{to nije u redu. Kada sam video da je prozor razbijen, a kase obijene, izvestio sam svoje nadre|ene i

zvali smo policiju. Nisu mogli odneti mnogo novca jer smo pre devet dana ispraznili sve kase za priloge. ©[teta je velika u duhovnom smislu – rekao je Fa}ol. U suboti~koj Biskupiji obja{wavaju da su u~estale provale u crkve. Na ve}ini verskih objekata pokradeni su bakarni oluci. – Mi smo uradili sve {to smo mogli. Mo`da bi trebalo da se poja~a saradwa s lokalnom vla{}u i mo`da bi trebalo da se postavi video-nadzor – rekao je Pi-Ar suboti~ke Biskupije Mirko©Tefkovi}. Uvi|aj su izvr{ili pripadnici Policijske uprave u Subotici, u prisustvu de`urnog istra`nog sudije Osnovnog suda u Subotici. Suboti~ka policija intenzivno traga za po~iniocem ovog krivi~nog dela. S.I.

SretenJoci}, zvani JocaAmsterdam, izjavio je ju~e pred Prvim osnovnim sudom u Beogradu, gde mu se sudi zbog opirawa hap{ewu u oktobru 2007, da je tada uhap{en da bi bio spre~en da na aukciji kupi “Robne ku}e Beograd”. Iznose}i odbranu na su|ewu, koje je iz bezbednosnih razloga odr`ano u sudnici Okru`nog zatvora u Beogradu, Joci} je izneo tvrdwu da je policija to uradila u dogovoru s vlasnikom „Verano motorsa” Radomirom @ivanovi}em koji im je za tu uslugu, kako je naveo, {efu beogradske policije preko posrednika isplatio u ke{u sumu od vi{e desetina hiqada evra. Joci}u se u ovom postupku sudi za krivi~no delo spre~avawa slu`benog lica u vr{ewu du`nosti, po{to se opirao hap{ewu 26. oktobra 2007. godine u restoranu gde je slavio ro|endan s prijateqima. Patrola interventne policije navodno je do{la po prijavi, uhapsila ga, a on je sutradan ve} pu{ten iz policijskog pritvora.

SretenJoci}

U Specijalnom sudu u Beogradu Joci}u se sudi za organizovawe ubistva hrvatskog novinara Ive Pukani}a 23. oktobra 2008. u Zagrebu, dok je pravosna`no osu|en na 15 godina zatvora za vi{estruko ubistvo na Olimpu 1995.

– Nisam ometao policiju, oni su u mene uperili „heklere” i „kala{wikove”. Ja se nisam drao na policiju, ve} na goste koji su sko~ili na wih ~im su ih videli – ispri~ao je Joci}. Po wegovom mi{qewu, akcija hap{ewa je realizovana da bi on

bio u pritvoru u vreme aukcije “Robnih ku}a Beograd” i da bi „Baja Verano (Radomir @ivanovi}) mogao da ih kupi”. Me|utim, wegov prijateq, kako je rekao, oti{ao je na aukciju i nadmetao se s Bajom, dok nije dostigao cenu od 350 miliona evra. – Na kraju je Baja Verano kupio „Robne ku}e” za 365 miliona evra – napomenuo je Joci}. On je tako|e ispri~ao da je za „name{tawe” hap{ewa saznao od prijateqa iz Crne Gore, koga zove Nano, koji je posle hap{ewa sedeo u kafi}u s Bo{komRadowi}em, izvesnim Savom Kravom i na~elnikom beogradske policije Stevanom Bjeli}em. Joci} ka`e da mu je Nano ispri~ao da je Sava Krava Bjeli}u i Radowi}u dao 30.000, odnosno 20.000 evra da ih ~asti u ime Baje Verana jer su wega (Joci}a) spre~ili da kupi “Robne ku}e Beograd”. Su|ewe se nastavqa 28. februara idu}e godine, kada bi trebalo da svedo~e policajci koji su hapsili Joci}a. (Tanjug)

UZBUNAUKRAQEVU

La`nadojavaobombiubiblioteci Kraqeva~ka Narodna biblioteka „Stefan Prvoven~ani” ju~e oko podneva je evakuisana jer je policija dobila dojavu da je u ovoj ustanovi podmetnuta bomba, za koju je utvr|eno da je la`na. Pregled zgrade je trajao oko 45 minuta, posle ~ega je Narodna biblioteka ponovo otvorena za javnost. – Oko 11.50 sati de`urnoj slu`bi Policijske uprave u Kraqevu s telefonske govornice se javila anonimna osoba i rekla da je u Biblioteci podmetnuta bomba – rekla je Tanjugu portparolka PU Kri-

stina Nikoli}. – Odmah je formirana ekipa za protivdiverzioni pregled koja je posle uvi|aja utvrdila da je dojava o bombi la`na. Direktorka Narodne biblioteke DraganaTipsarevi} ka`e da su ne{to pre 12 sati kod we do{li policajci i saop{tili da biblioteka mora da bude evakuisana zbog dojave o bombi. – U biblioteci je na svim odeqewima bilo mnogo qudi. Me|utim, i ~itaoci i na{i zaposleni su mirno, bez ikakve panike, napustili zgradu – kazala je Tanjugu Dragana Tipsarevi}.


SPORT

sreda9.novembar2011.

dnevnik

c m y

16

LIGA[AMPIONA:VOJVODINADO^EKUJE[PANDAU

Uspehnijenemogu}amisija Vaterpolisti Vojvodine odigra}e ve~eras drugu utakmicu u Ligi {ampiona, ali prvu predsvojompublikomovegodine. Naime,Novosa|aniuokvirudrugog kola najelitnijeg klupskog takmi~ewa do~ekuju ekipu berlinskog [panadau 04. Vojvodina senadada}eutomme~uimatipodr{kunavija~a,kao{tojetobio slu~ajiuprethodnedvesezoneu Ligi {ampiona. U prvom me~u ovogodi{wegnadmetawauBgrupiizabraniciDejanaStanojevi}a su o~ekivano pora`eni od MladostiuZagrebu(14:9). Kada su izvu~ene grupe mnogi su smatrali da }e Novosa|ani

bar mo}i da se nadme}u sa Berlincima, ali {ampion Nema~ke jeuodli~nojformi,unacionalnom prvenstvu dominira, a i u prvomkoluLige{ampionapropisno je namu~io Dubrov~ane. Vojvodina igra s oscilacijama, ali se nada da }e ba{ duel sa [panadauom pomo}i da se vrati napravikolosek. - O~ekuje nas veoma te{ka utakmica. [pandau je odli~no fizi~ki spremqena ekipa, to je malte ne reprezentacija Nema~ke.Veomasuiskusni,anisulak rival ni na{oj reprezentaciji. No,bezobziranasve,mismove} plasmanom u Ligu {ampiona, i topotre}iputzaredom,napra-

Milo{Mili~i}senadauspehuume~usNemcima

vili veliki uspeh. Nemamo {ta da izgubimo. Nismo se sna{li u prvomkoluuZagrebuisada`elimodasedoka`emopredsvojom publikom. Svi smo spremni i `eqno o~ekujemo ovj duel. Nije nam bilo lako posle poraza od CrvenezvezdeuKupu,ali{taje tuje,tosmove}zaboraviliida-

Foto:F.Baki}

}emo sve od sebe - ka`e kapiten VojvodineVladimirCuki}. Milo{Mili~i}isti~edaje za wega i saigra~e od velikog zna~ajanastupuLigi{ampiona. -Zanasmladeigra~enastupu Ligi {ampiona je od ogromnog zna~aja, donosi nam iskustvo i prilikudaseogledamosanajbo-

qima. Mi moramo jo{ puno da u~imo i da se dokazujemo. Ne}e nam biti lako posle poraza od Zvezde, ali da}emo sve od sebe. Mo`dajeidobro{tosmoba{u ovom trenutku pretrpeli taj poraz da se trgnemo i da shvatimo da u svaki me~ moramo da u|emo maksimalnokoncentrisani.Zato

PARTIZANGOSTUJEVA[A[U

Prilikazapopravni PartizannesamodajeizgubiobodoveprotivSegeda(8:9)uprvomkoluCgrupe,ve}jeiostaobezka`wenihtreneraIgoraMilanovi}aiigra~aStefanaMitrovi}a.Ekipu}edanasuBudimpe{tiprotiv Va{a{avoditipomo}nikUro{Stevanovi}. -Ovonamjeveomava`nautakmicaitra`i}emo {ansuuBudimpe{ti.Va{a{jekompaktnaekipakojaimaizvanrednepojedince.Po{tujemoih,ali`elimopobedu.No,ne}ebitini{tagotovoiuslu~ajuporaza-rekaojeStevanovi}.

Milo{ ]uk veruje da crno-beli mogu do pobede. - Idemo u Budimpe{tu da ispravimo gre{ku izprvogkolaidaprobamodapobedimo.Dosta smoradiliposledwedvenedeqeio~ekujemna{emnogoboqeizdawePartizana.Ukolikopobedimo,ima}emolak{iputu~etvrfinalu-rekaoje]uk. Utakmica izme|u Va{a{a i Partizana igra seve~erasu20.30~asova.

Parovi A grupa: Budva - Olimpijakos(18),Vuqagmeni-Primorje(18) B grupa: Jug - Mladost (18.30),Vojvodina-[pandau 04(19) C grupa: Va{a{ - Partizan(20),Seged-Eger(18) D grupa: Marsej - Pro Reko (19.30), Spartak Volgograd-JadranHN(17) }emo[pandaudo~ekatipotpuno spremni-rekaojeMili~i}. Igra~i, treneri i uprava Vojvodine pozivaju navija~e da do|u u {to ve}em broju i podr`e klub, koji je ve} vi{e puta pokazao kako se bori i prezentuje i grad i zemqa. Utakmica izme|u Vojvodine i [panadaua 04 igra se ve~eras na bazenu Spensau19~asova. G.Malenovi}

SVETSKIKUPZAODBOJKA[ICEUJAPANU

Moglojedasezavr{iidruga~ije Srbija-Nema~ka2:3(22:25,26:24,23:25,25:23,11:15) TOJAMA: Hala,gledalaca: 1500,sudije:Dudek(Poqska)i Nastase(Rumunije). SRBIJA: Brako~evi}, @ivkovi},Krsmanovi}10,Male{evi} 10, Molnar 6, Antonijevi} 3, Vesovi} 13, Bjelica 19, Ninkovi}, Ra{i} 23, Veqkovi}1,Popovi}(l). NEMA^KA: Vajs2,^erlih(l),Grun 22, Kaufeldt, Su{ke 13, Mates, First 12,Ko`uh22,Brinker18,Tomsen,Burhardt,Apic3. UreprizifinalaEvropskogprvenstva, odbojka{ice Nema~ke savladale suSrbijuu~etvrtomkolunaSvetskom kupu u Japanu posle neizvesnih i kva-

litetnih pet setova. U potpunosti je ovajme~opravdaoulogunajzanimqivijeg u ovom krugu, a na{e devojke su, iakoveomaoslabqene,uspeledaosvojeveomava`anbod.UodnosunafinaleEPizBeograda,Srbijajebilabez Brako~evi},Malagurski,Ogwenovi}i Nikoli}, dok je Nema~ka bila kompletna,pasuutolikodvaosvojenaseta jo{vrednija. Svih pet setova vodila se velika borba,auzsamomalovi{esre}eismirenostiuzavr{nicamaSrbijejemogla dopobede.Ipak,kaoiufinaluEP,u taj-brejku je odlu~en pobednik, s tim {tosusadasre}nijebileNemice.

Sve do 21:21 u prvom setu na{e devojke su bile u igri, Nemice su tada osvojiletripoenaisetre{ileusvojukorist.na{prijemnijefunkcionisai kako vaqa, tehni~ar Antonijevi}evanijebilaba{najpreciznije,ali jezatonamre`iblistalaMilenaRa{i}. Da je kojim slu~ajem Bri`itka

Vesovi}evasuosvojilepopoeniSrbijajeizjedna~ilana1:1. Raspucane Grun i Brinker kod Nema~ke, a slab prijem na{ih devojaka i lo{e odigrana zavr{nica, u~inili su da na{a ekipa ostane u rezultatskom zaostatku.Nemicesupovele21:18,ali sena{elavicenisupredavale.Sneko-

IZJAVEPOSLEUTAKMICE

Selektorizadovoqni SelektorSrbijeZoranTerzi}zadovoqanjepartijomwegovihizabranica iosvojenimbodomprotivviceprvakaEvrope. -Odigralismojo{jedante`akme~sNema~kom.Iovajje,kaoipretodni, bio veoma kvalitetan. Zadovoqan sam rezultatom i prikazanom igrom. @ao mije{tosmoigralibez~etiristandardne~lanicepostave,jerdasuonebileovderezultatbisigurnobiodruga~iji.^estitkeNema~kojinadamseda}e na}imestome|unajboqetriekipenaSvetskomkupu-rekaojena{selektor. Kapiten Jovana Brako~evi} provela je u igri svega nekoliko sekundi jer jo{nijepotpunospremandazaigra. -Svakina{me~sNema~komjeveomate`akpo{tooneigrajunavrhunskom nivou.Nemajupadovauigriiveomasukvalitetne,pajezatodana{wibodza nasveomava`an.Odigralismosaizmewenimtimom,bezigra~aizstartnepostavesaEvropskogprvenstva,alismobileveomadobre.Poku{alismodaporemetimoodbranuprotivnicaidaodigramokoncentrisano,alijeNema~ka ovogaputabilaboqai~estitamobemaekipama-reklajeBrako~evi}eva. SelektorNemica\ovaniGvidetiimaojesamore~ihvalezautakmicu,kao izana{ureprezentaciju. -Utakimicajebilaveomakvalitetna,sveomadobrimnapadimaiveomasam zadovoqan pobedom. Srbije je ponovo bila ravnoprvan takmac iako igra bez Brako~evi},Nikoli},MalagurskiiOgwenovi},{tojesamopotvrdadaima ogromanpotencijal.Bilismozamaloboqiiuzelismodvaboda,alijeveoma lakomoglodabudedruga~ije,pasamzadovoqanpobedom-istakaojeGvideti.

REZULTATI Agrupa(Hiro{ima) Kina-DominikanskaR. Italija-Argentina Japan-Al`ir

3:1 3:0 3:0

Bgrupa(Tojama) SAD-Kenija Koreja-Brazil Srbija-Nema~ka 1.SAD 2.Italija 3.Kina 4.Nema~ka 5.Brazil 6.Japan 7.Srbija 8.Argentina 9.Dominkan.R. 10.Koreja 11.Kenija 12.Al`ir

4 4 4 4 4 4 4 4 4 4 4 4

4 4 3 3 3 2 2 2 1 0 0 0

0 0 1 1 1 2 2 2 3 4 4 4

3:0 2:3 2:3 12:1 12 12:3 11 11:6 9 10:5 8 10:6 8 9:6 7 8:7 7 6:8 6 5:9 3 2:12 1 1:12 0 1:12 0

DANA[WIPROGRAM Agrupa Argentina-Kina Al`ir-Italija DominikanskaR.-Japan

(3) (7) (10.20)

Bgrupa Kenija-Koreja Srbija-Brazil Nema~ka-SAD

(3) (7) (10.20)

AnaBjelicaodigralajo{jednudobrupartiju

Molnarbilaraspolo`enija(nijedan nijeosvojilauprvomsetu)pitaweje ko bi stekao po~etno vo|stvo. Razigrala se Molnarova u drugom setu i Srbije je do{le do velike prednosti (19:12),kojunijebezkomplikacijamaterijalizovala.SevnulajeserijaNemica od 7:0 i stiglo je izjedna~ewe. Optere}enu servisima Molnarovu je zamenila Tijana Male{evi} koja je ostalauigridokrajame~a.Bjelicai

liko dobrih poteza Bjelice Srbije je uspeladaizjedna~i(21:21,23:23),aliza vi{enijebilosnageirivalkesupovelasa2:1usetovima. Prviputsusena{edevojkeodlepile u ~etvrtom setu na 16:14, jer je na kratkoproradioblok,kojinijebiona uobi~ajenomnivou.Dobrosuservirale Terzi}eveizabranice,amaksimalnosu eksploatisale omalenu Vajs u bloku i poentiraleizkontranapadaprekowe.

Bjelica je jo{ jednom iskoristila set loptu za izjedna~ewe (dve su pre toga propu{tene). Do 5:5 je Srbija bila ravnopravna u taj-brejku,aposleprolazaidvaasaKo`uh, Nema~ka je do{la do ogromne prednosti(8:5)kojunijeispustilado krajame~a. Slede}i rival na{im devojakama je olimpijskipobednikBrazil. M.R.


SPORT

c m y

dnevnik

POSLEDVODNEVNEPAUZEVOJVODINA NASTAVILARAD

Zaletzafini{ polusezone Dva slobodna dana svojim to }emo taj me~ posebno priu~enicima dao je trener fudpremati. Bi}emo li{eni petobalera Vojvodine Dejan Vukirice reprezentativaca i va}evi}. Mini-pauza je usledila `no nam je da odr`imo visok posle nere{enog ishoda u Ivaritam i motivaciju kod igra~a. wici, u kojem Novosa|ani, prU slede}i utorak }emo odigravi put od kada je na mestu {efa ti trening susret s Be`anijom struke Vuki}evi}, nisu postii insistira}emo na visokom gli gol. Na kraju su i uz pomo} ritmu i kvalitetu treninga, sportske sre}e sa~uvali remi jer nas posle pauze o~ekuje pru duelu s Javorom (0:0). Izvevo duel sa Smederevom, a onda {ta~i s ove utakmice slo`ili i pomenuta utakmica s Javosu se u oceni da crveno-beli rom, sve u razmaku od tri dana. nisu pru`ili igru na nivou Svisudobili{ansu one koja se od wih o~ekuje, a trener je to ovako obrazloKoliko je realno da Vojvo`io: dina na kraju jesewe polusezo- Javor je ekipa koja u po- ne bude tre}a? sledwoj liniji igra s punim - Mora da bude realno. Ja sam rasporedom i brani se i sa de- ~ovek koji u `ivotu pred sebe vet igra~a, dok u napadu nema postavqa najvi{e ciqeve i ne vi{e od dvojice-trojice. Takav be`i od odgovornosti. Ne zarival zahteva maksimalnu kon- dovoqavam se prosekom u `icentraciju i oprez. Protiv ta- votu, posebno ne u fudbalu i kvih timova gotovo je nemogu- navikao sam da se borim za tro}e napraviti veliki broj pri- feje. O~igledno je da imamo lika, a mi smo imali dve preko grupu igra~a koja te{ko mo`e Abubakara, koje, na`alost, ni- da isprati taj deo, ali je sigursmo realizovali. Na kraju smo no da }emo do kraja jeseni poimali i sre}e da jedan pad u koncentraciji na{e odbrane nije rezultirao golom. Pojedini igra~i koji igraju u napadu ne pokazuju ono {to objektivno mogu, ali nisam ni siguran da bi oni koji bi umesto wih eventualno u{li doneli neki pomak. Ovo je prva utakmica na kojoj nismo dali gol od kada sam je trener i izgubili smo dva boda. Jer, da smo uspeli samo jednom da pogodimo mre`u Javora, uz ~iwenicu da nismo primili gol, bilo bi to dovoqno za ispuwewe ciqa. Javor je rival ~ija igra ne odgovara ni jednom rivalu, TrenerVojvodineDejanVuki}evi} godinama neguje taj defanzivniji stil i poku{ava ku{ati da ostvarimo maksiiz kontri da postigne gol. mum i do~epamo se tre}eg mesta. Posle toga, u pauzi, pokuNajslabijapartija {a}emo da dovedemo igra~e koU ~emu je bio problem da ni- ji }e poja~ati konkurenciju u ste pru`ili boqu partiju u ekipi i koji }e biti poja~awa Ivawici? u pravom smislu te re~i. Mi- Pre svega je to bio nedosta- slim da sam svima pru`io {antak jednog igra~a koji mo`e da su da vidimo na koga mo`emo donese prevagu – kategori~an da ra~unamo na putu ka ostvaje bio Vuki}evi}. – Govorim o rewu ambicija. Niko iz kluba fudbaleru koji mo`e da stvo- ne postavqa imperative pred ri vi{ak, da napravi proboj je- nas, ali sam ja taj koji to ~ini dan na jedan, ba{ kao {to to i siguran sam da Vojvodina, na ~ini Mereba{vili, koji zbog osnovu svega {to ima, mora bikartona nije mogao da igra u ti u vrhu srpskog fudbala. Netoj utakmici. I to je jedan od ka ta tre}a pozicija do zime razloga na{e slabije igre. bude na{ ciq, kao i polufinaDrugi faktor je rival koji le Kupa, a onda }emo videti nam nije ostavqao prostora da {ta nam vaqa daqe ~initi. se razmahnemo. Mi smo ponovo Omogu}i}emo grupi igra~a koigrali s Bojovi}em, Abubaka- ja ima priliku za to da ode u rom, Branom Ili}em, [kule- inostranstvo, nekima koji ne ti}em i Bilbijom u napadu, po- mogu da prate ambicije kluba ku{ali smo na sve na~ine da da prona|u sredine koje }e im stignemo do gola, ali, na`a- odgovarati, a svakako da nam je lost, u tome nismo imali uspe- ciq i da grupu omladinaca ha. Prvo poluvreme me~a bilo prikqu~imo prvom timu. Tu je ispod svake kritike, dok smo mislim na Melega, bra}u Koru drugom delu i mi i doma}ini di}, Kosovi}a i Nasti}a, jer imali po dve-tri {anse. Ni to je ono {to je karakterisalo teren u Ivawici, objektivno, Vojvodinu tokom godina i {to nije u najboqem stawu, ali je treba da bude wena odlika, a to ~iwenica i to da smo pru`ili je stvarawe igra~a iz sopstvenajslabiju igru od kada sam do- nog kadra. Igra~i koji dolaze {ao u Novi Sad. moraju da budu kvalitet i da Sledi dvonedeqna pauza, da publika u Novom Sadu ima {ta li je to dobro za timu koji vo- da vidi. Moj prvi ciq, ipak, jedite? sta da u preostala ~etiri kola - Nikad se ne zna, tek }emo igra~i daju maksimum i to je saznati koliko nam je odgova- ono {to je, uostalom, i moj porala pauza od 15 dana. ^eka nas sao. U Ivawici u tome nisam opet jedna veoma va`na serija uspeo, jer sam siguran da je ono utakmica, u kojoj smo dva puta {to su pru`ili u duelu s Javodoma}ini i dva puta gostujemo. rom daleko od maksimuma pojeUz to, igra}emo s Javorom ~e- dinaca. Treniramo jako dobro, trvtfinalni susret Kupa u ali je sve to bezna~ajno ako u Novom Sadu. Ta utakmica za prvenstvenim me~evima ne nas je najva`nija, jer sve drugo, pretvaramo taj rad u dobre osim na{eg prolaska u polu- igre i pobede. Ambicija igrafinale, bilo bi ravno kata- ~a mora da bude da pru`aju strofalno lo{em u~inku u po- maksimum u svakoj utakmici, lusezoni. Ne `elim ni da raz- jer kada je tako, ne}emo imati mi{qam o druga~ijem ishodu problem da se me|usobno poosim na{e pobede, u toj utak- gledamo u o~i - istakao je Vumici s timom iz Ivawice. Za- ki}evi}. A.Predojevi}

sreda9.novembar2011.

17

REPREZENTACIJADANASPUTUJEUSREDWUAMERIKU

Bolenedobronamerne kritike Na~in na koji su se reprezentativci Srbije, protiv Slovenaca u Mariboru, oprostili od mogu}nosti da preko bara`a ipak dohvate mogu}nost plasmana na EP bio je veoma bolan. Uostalom, ta rana i daqe pe~e reprezentativce, ali i naciju. - Ti{ti nas taj neuspeh. Imali smo vremena da analiziramo sebe i svoju igru. Znamo gde smo gre{ili, pa se nadam da se tako

@igi}kapiten Nakon povla~ewa iz nacionalnog tima Dejana Stankovi}a i Nemawe Vidi}a ostalo je otvoreno pitawe kapitena, barem za turneju po Centralnoj Americi. V.d. selektora Radovan ]ur~i} posegao je za logi~nim potezom, a traku je poverio Nikoli @igi}u, koji je upisao najve}i broj nastupa za reprezentaciju (55), dok je wegov zamenik Branislav Ivanovi} (45). ne{to ne}e ponoviti u slede}em kvalifikacionom ciklusu- konstatovao je standardni ~lan reprezentacije Branislav Ivanovi}. Veoma emotivan je bio, u posledwim susretima na{ najboqi igra~, levi bek zahuktaklog Man~ester sitija Aleksandar Kolarov, koji je priznao da Srbija nije zaslu`ila plasman na EP. - Nije nam bilo lako posle poraza u Mariboru. Nisam spavao tri dana. Ispalo je kao da su mnogi jedva ~ekali da se desi tako ne{to. Ipak, oti{lo se u drugu krajnost. Razumem osporavawe kvaliteta igra~a, ali ciq kritika je bio druga~iji. Nisu bile dobronamerne. Mi smo kao bra}a, ostali smo u takvim odnosima i posle neuspeha. Sa nekim igra~ima se poznajem vi{e od pet godina, ali drugima nije

PredvodiSrbijuNikola@igi}

interesantno da li sam sa Banetom poio kafu, ve} ne{to sasvim drugo. Nije nikakav problem da se pita da li se dogodilo to i to. Dakle, {to se ti~e fudbalskih stvari sve je na mestu, sla`em se sa svima, ali su mi neke druge pojave mnogo zasmetale- poru~io je Kolarov. Sledi i konkretnije poja{wewe: - Sada bih vi{e voleo da se spremam za bara` nego za prijateqske utakmice. Krivo mi je

Konfuzija Prili~na konfuzija nastala je u taboru orlova prilikom okupqawa u Staroj Pazovi u okviru mini priprema za ameri~ku turneju. Veliki broj otkaza igra~a, koji su motivisani vi{om silom, odnosno povredama rodio je sumwu u javnosti. Izvesno je da sve ozlede nisu ba{ toliko ozbiqne prirode da bi udaqile nekolicinu fudbalera, pre svega onih koji su u prethodnom periodu bili zaboravqeni od nacionalnog tima. Uostalom, ne pamti se tolika a`urnost administrativaca FSS, koji su po`urili da na zvani~ni sajt oka~e podu`a, pojedina~na obrazlo`ewa svih igra~a koji su morali da odbiju pozove. Tu su, kao nikad ranije, detaqni zdrvastveni izve{taji, uz zakqu~ak da igra~i izra`avju `aqewe {to propu{taju ovu akciju, ali su uvek na raspolagawu nacionalnom timu.

Jorga~evi} uBri`u ^uvar mre`e reprezentacije Srbije napustio je Gent i dogovorio troipogodi{wu saradwu sa ekipom Bri`a.Bojan Jorga~evi}, bez mnogo medijske pompe, prona{ao je novi anga`man. Iako je na sajtu Genta stajalo da pregovara sa jednim turskim klu-

{to se spomiwu neke pare. Kakve pare? Ne dolazimo da igramo za pare i jedna smo od reprezentacija koje ne dobijaju ni dinara. Nas nosi `eqa i ~ast. Takve stvari nemaju veze sa istinom i to me povre|uje - podvukao je Kolarov, izraziv{i nadu da }e u narednom periodu pru`ati partije koje ne}e razo~arati naciju. Turneja po Sredwoj Americi ne}e imati turisti~ki karakter, po mi{qewu fudbalera.

est do`iveo te`u povredu ligamenata kolena i predstoji mu du`a pauza. Rukovodstvo kluba je zbog toga brzo reagovalo i anga`ovalo Jorga~evi}a, koji posledwih sezona brani odli~no u belgijskoj ligi. Izvesno je da }e predstavqati zna~ajno poja~a-

Prelazni period do novih izbora, kao i privremeni stru~ni {tab navode na zakqu~ak da sportskih motiva i nema, ve} da dominiraju finansijski efekti turneje kako bi se popunila kasa FSS, koja }e zbog propu{tawa odlaska na EURO biti uskoro u minusu. - O~ekuju nas dve izuzetno te{ke utakmice sa kvalitetnim selekcijama Meksika i Hondurasa koje }e nam dati pravu sliku reprezentacije u ovom trenutku. One nam dosta zna~e, jer bi nam dobar rezultat pomogao da godinu zavr{imo, ipak, pozitivno- konstatovao je Bane Ivanovi}. Na{i reprezentativci danas u 10,15 ~asova lete za Frankfurt, a zatim nastavqaju za Meksiko siti. Utakmica sa Meksikom igra se u Keretaru 11. novembra u 20 ~asova po lokalnom vremenu, odnosno tri sata posle pono}i 12. novembra po sredwe-evropskom vremenu. Honduras do~ekuje orlove 15. novembra u dva ~asa posle pono}i. Z.Rangelov

IDEALANTIMALEKSAFERGUSONA

Vidi}upostavi Britanski Dejli mejl sastavio je idealan tim Ser Aleksa Fergusona tokom wegovih 25 godina u Man~ester junajtedu.U idealnih 11 nalazi se i sada{wi kapiten Nemawa Vidi}. Ferguson je Junajted preuzeo 1986. i za ovih 25 godina osvojio je neverovatnih 37 trofeja. Idealnih 11 Ser Aleksa Fergusona su: Peter [majhel, Geri Nevil, Patris Evra, Jap Stam, Nemawa Vidi}, Roj Kibn, Pol Skols, Kristijano Ronaldo, Rajan Gigs, Erik Kantona, Vejn Runi.

DAVORMAGO^,PRVOTIMACNOVOGSADA

Imamestaoptimizmu

BojanJorga~evi}

bom, srpski golman brzo je dogovorio saradwu sa Bri`om.Kako prenose belgijski mediji, informacija o pregovorima sa Turcima samo je bila paravan dok se Srbin nalazio na sastanku sa ~elnicima novog kluba. Iako se spekulisalo da }e preselewe iz Genta, u koji je stigao 2007. godine, uslediti u zimskom prelaznom roku, menaxer Dejan Veqkovi} potvrdio je da ugovor sa Bri`om stupa odmah na snagu: - Bojan }e se preseliti usred sezone, a takva mogu}nost se otvorila jer je golman Sven Do-

we za veliki klub - izjavio je Veqkovi}. Za prelazak Jorga~evi}a u Bri` Gent }e na ime obe{te}ewa inkasirati milion evra.Interesantno je da }e Jorga~evi}u glavni konkurent na golu Bri`a biti zemqak Vladan Kujovi}.O~ekuje se da }e ipak reprezentativni ~uvar Srbije dobiti prednost, kao i da }e talentovani doma}i golman Kolin Kozemans, koji je dobijao {ansu u posledwe vreme, morati da se preseli me|u rezerve i naoru`a se strpqewem.

Fudbaleri Novog Sada otputovali su na megdan Radni~kom sa `eqom da baci na ple}a Somborce na wihovom buwi{tu, {to nikom nije po{lo za rukom u dosada{wem toku lige. Bili su blizu ciqa , ali ih je sudija, po mi{qewu uprave kanarinaca, o{tetio. - Dve sudijske odluke uticale su na krajwi rezultat: propustio je da svira ~ist penal i poni{teni nam je regularan gol. I doma}i igra~i su priznali da bi u drugim okolnostima izgubili utakmicu. Na takmi~arskim organima je da se uvere u veredostojnot na{ih prigovora - kazao je Ranko \urovi}, generalni sekretar Novog Sada. Jedan od zapa`enijih aktera duela u Somboru me|u kanarincima bio je Davor Mago~. - Krajwi rezultat(0:0) mo`e vi{e da zadovoqi vi{e doma}ina. Prema prikazanim {ansama i de{avawima na ternu bili smo bli-

`i osvajawu celog plena.No, bitno je da nismo pora`eni i da se bodovni saldo uve}ao - rekao je Mago~. Kako se bli`i fini{ jeseweg dela prvenstva (ostala jo{ tri kola), ~ini se da ekipa igra sve boqe. - Dobrim igrama kumuje, pre svega, sjajna atmosfera me|u igra~ima i dobra komunikacija sa stru~nim {tabom. Trener Ili} ima viziju, a mi se zaista trudimo da svojim zalagawem ispo{tujemo wegove ideje. Obaveza Novog Sada je da na svakoj utakmici ide na pozitivan rezultat, pogotovo kada igramo na Detelinari, a takav je slu~aj i pred utakmicu sa Be`anijom naredne subote. Beogra|ani su veoma nezgodna ekipa, a priliku da se uverimo u to imali smo u predkolu Kupa, kada smo slavili nakon boqeg izvo|ewa penala na wihovom terenu. O~ekujem da }emo prikazati dobru igru i osvojiti ceo plen optimista je Mago~.


18

sport

sreda9.novembar2011.

OP[TINSKA LIGA IN\IJA – STARA PAZOVA

Remi vode}ih Dunav - ^SK 0:0 NOV I SLANK AM EN: Igrali{te Dunava, gledalaca 50, sudija Radoj~i} (In|ija). @uti kartoni: Vojvodi} (Dunav),Lap~i},Tica(^SK). DUNAV: Jelovac 7, Vojvodi} 7, Najdanovi} 7, Badovinac8,[kori}7,Radulovi}8, JARKOVCI: Borac-Polet 1:1, KR^EDIN: Fru{kogoracSloga (M) 4:1, NOVI SLANKAMEN: Dunav-^SK 0:0. 1.^SK 10 2. Dunav 10 3. Fru{kogorac10 4. Polet 10 5. Borac (J) 10 6. Sloga (M) 10

6 5 4 4 4 0

3 2 3 3 2 1

1 3 3 3 4 9

16:4 13:11 14:12 12:13 17:10 9:31

21 17 15 15 14 1

@e`eq7(@ivkovi}7),Vuka{in7,Tomi}7,Jakovqevi}7, Kiti}7. ^SK: Vojnovi}7,Lap~i}7, Bota7,Lipov~an7,Bakvi}6, Dragi}evi} 6, Tica 7, Marjanovi} 6, Simi} 6 (Mirkovi} 6),Joki}7,Arsi}6. Gosti su do{li da se samo brane, {to su na kraju me~a i usp el i. Dom a} in i su imal i {ansedaubedqivoslave,agostisuimalisamojednu{ansu zagol. B. Vujaklija

Fru{kogorac - Sloga (M) 4:1 (2:0) KR^EDIN: Stadion  Fru{kogorca,gledalaca50,sudija Bar i{ i} (Nov a Paz ov a). Strelci: D. Vu~i} u 12. i 85, Filipovi} u 26. (iz penala) i Pejakovi} u 62. za Fru{kogorac,Kusi}u86.minutu(izpenala) za Slogu. @uti karton: Kusi}(Sloga). FRU[ KOG OR AC: M. Vu~i} 7, Batalov 7 (Simovi}), Livaja 7, Ranitovi} 7, ^ortan 7,Filipovi}7(D.Petkovi}), S. Petkovi} 7, Obradovi} 7, Pejakovi}8,D.Vu~i}8,Lili} 7. SLOGA: Ipa~5,Milakovi} 6,Davidovi}6,Petakov6,Hajnal 6, Pavlovi} 6, Milin 6, Kusi} 7, Milo{evi} 6, [kori}6. Doma}ini broj~ano ja~i, jer sugostidoputovalisasamodeset igra~a. Mogli su doma}i slavitidvocifrenimrezultatom, da su napada~i bili malo ozbiqniji i precizniji pred golomIpa~a. S. Ranitovi}

Borac (J) - Polet 1:1 (0:1) JARK OVC I: Igral i{ te Borc a, gled al ac a 50, sud ij a Maks im ov i} (In| ija).Strelc i:Peu r a~ au50.za Bor ac, Jov i} u 17. min ut u za Pol et. @ut i kart on i: Rad ulov i}, Mand i}, D. Novk ov i} (Bor ac),Baj i}(Pol et). BOR AC: Kne` ev i} 7, M. Novk ov i}6,Mrao v i}7,Sto{i} 7 (Do{ en), Laz i} 7, Radul ov i} 7, Nar anx i} 7 (Petrov i}), Mand i} 7, Jaw an in 7,Peu r a~ a8,D.Novk ov i}8. POL ET: Pa{ i} 7, Mark ovi} 7, ]al i} 7, Baw eg lav 7, Kuk oq7,@ivk ov i}7,Pop ovi}7,Mar i}7,Tod or ov i}7, Baj i}7,Jov i}8. Ravn op ravn a igra, a kon a~an rez ult at rea l an. Prv i deo prip ao je igra~ im a Polet a,doksuunas tavk udom a}ifudb al er ibil iboq irival.

dnevnik

Fiorentinasmenila Mihajlovi}a Fiorentinajepotvrdila da }e novi {efstru~nog{taba biti Delio Rosi, biv{itrenerLacijaiPalerma,koji}ezvani~nobitipredstavqendanas. Srpskifudbalskistru~wak Sini{aMihajlovi}nijevi{e trenerFiorentine,objavioje taj italijanski prvoliga{. UpravaklubaizFirence odlu~ilajedasmeniMihajlovi}anakonprvenstvenogporazaodKjeva(1:0). Fiorentina je potvrdila da}enovi{efstru~nog{taba biti Delio Rosi, biv{i

Sini{aMihajlovi}

EKIPNO PRVENSTVO EVROPE

Ve}vi|enapri~a

trener Lacija i Palerma, koji}ezvani~nobitipredstavqenuutorak.Qubi~asti iz Firence ove sezone bele`e slabe rezultate i trenutno zauzimaju 13. mesto na tabeli Serije A sa samo tri pobede i 12 osvojenihbodova,azaostajudevetbodovazavode}imUdinezeom. Mihajlovi} je letos odbio ponudu milanskog Intera, po{to je imao velike ambicije sa Fiorentinom, sakojomjepro{lesezonezauzeodevetomestou{ampionatuItalije.

OP[TINSKA LIGA RUMA – IRIG (I RAZRED)

Raspolo`eni@arkov~ani Kraqevci - Napredak 1:5 (1:2) KRAQEVCI: Igrali{te OFK Kraqevaca, gledalaca 100, sudija Stojkovi} (Dobrinci).Strelci: Petkovi} za OFK Kraqevce, Star~evi} dva, Mario Buza{, Bo`i} i N.Miqkovi} za Napredak.@utikartoni:G.^vorkov,Gaji}(OFKKraqevci). OFK KRAQEVCI: Joki} 6, Tutu{ 6, Dragutinovi} 6, Kordolup7,Stri~evi}6(]etojevi}6), Ba{i}6(Aranicki6),Jovanovi} 6,Petkovi}7,G.^vorkov6,Gaji} 6,Rikanovi}5. NAPREDAK: Krni}8,Lazi}8 (MilanBuza{),Ili}8,G.Miqkovi}8,Stankovi}8,N.Miqkovi}8,Star~evi}9(Beukovi}),M. Devrwa 8, R. Devrwa 8 (S. Vi{wi}),Bo`i}8,MarioBuza{9. Raspolo`enigostiiz@arkovca odigrali su utakmicu bez gre{ke,auztosupetputapogodili mre`uneba{slabogJoki}a. B. Kordolup

Polet - Fru{ka gora 2:1 (2:1) NIKINCI: Igrali{te Poleta, gledalaca 100, sudija Svetlana Bili} (Ruma).Strelci: Stevanovi} u 35.i Cvijanovi} u 44.zaPolet,Bo`i}u15.minutu za Fru{ku goru. @uti kartoni: Dragi}evi}, Mileti}, Stevanovi}, Burmuxija, Jovanovi} (Polet),  Bo`i}, Grubje{i} (Fru{kagora).Crvenikarton:Cvijanovi}(Polet). POLET: M.Liki}7,Dragi}evi} 6, Jovanovi} 8, Trni} 6, B. Liki} 8, Tiringer 7, Burmuxija 7, Raki} 7, Stevanovi} 6, Cvijanovi}7,Mileti}7(Krsti}6). FRU[KAGORA: Radivojevi} 9, ]irkovi} 7, \api} 6 (Petrovi}6),Arsenovi}6,Dejanovi}7, Grubje{i} 7, Baxa 7, Novakovi} 6,Bo`i}7,Stupar7,Putica8.

Kona~no i Nikin~ani su osetili slast pobede. Doma}ini su biliborbenijiitojeodlu~ilo pobednika. Z. Kolyi}

Fru{kogorac - Kru{edol 2:1 (0:0) MALI RADINCI: Igrali{teFru{kogorca,gledalaca100, sudija Stoli} (Ruma).Strelci: Pavlovi}u69.i81.zaFru{kogorac, a Rado{evi} u 83. minutu za Kru{edol. @uti kartoni: @. Jovanovi}, Stojakovi} (Fru{kogorac). FRU[KOGORAC: M. Jovanovi}7,Miokovi}8,@.Jovanovi}8, Stojakovi} 8, Obrenovi} 8, Stojkovi} 8, Pavlovi} 9, Stepanovi} 8, Pavi} 7 (Radvaw), Vu~eti} 8, Baji}7. KRU[EDOL: Pardovicki 8, Vukojevi} 7, @ivi} 7, Radulovi} 7,Belanovi}7,Rado{evi}8,Anti}7(\oki}),Peri}7,Kosti}7 (Qepoja ), Zeki} 7 (Mitrovi}), Rajli}7. Doma}ini su bili boqi u toku celeutakmice.Stvorilisumnogo prilika,apostiglisamodvagola, {tojebilodovoqnozapobedu. R. Miokovi}

Sloga - Mladost (B) 2:2 (0:0) VOGAW: Igrali{te Sloge, gledalaca 100, sudija \oki} (Ruma). Strelci: Vuji} u 52. i Be`anovi}u58.minutuzaSlogu,aVeji}u71.iJugovi}u83.minutuza Mladost.@utikartoni:Popovi}, Baki}(Sloga),Mari},Veji},Jugovi}(Mladost). Crveni karton: S. Bo`i~kovi}(Mladost). SLOGA: Ma~ak, Mari~i}, Popovi}, Baki}, Nenadi}, Krsti}, Radivojevi}, Spasojevi}, Be`anovi}(Maleti}),Vuji},Dragi}evi}.

MALI RADINCI: Fru{kogorac-Kru{edol 2:1, NIKINCI: Polet-Fru{ka gora 2:1, KRAQEVCI: OFK KraqevciNapredak 1:5, VOGAW: SlogaMladost (B) 2:2, RUMA: Jedinstvo-Borac (K) 3:0.Slobodna je bila ekipa PSK Putinci.

1. Jedins. (R) 10 2. Napredak 10 3. Mladost (B)10 4. Fru{kog. 10 5. Borac (K) 10 6. PSK Putin. 10 7. Sloga (V) 10 8. Kru{edol 10 9. Polet 10 10. Fru{ka gora10 11. OFK Kraqev.10

8 7 6 4 4 4 3 4 1 2 1

2 2 1 3 3 2 4 0 4 0 1

0 1 3 3 3 4 3 6 5 8 8

18:5 23:6 21:12 10:8 14:16 12:10 12:11 8:9 11:25 10:22 13:29

26 23 19 15 15 14 13 12 7 6 4

MLADOST: Slep~evi}, S. Bo`i~kovi}, Krivo{i}, Ko{uti} (Aleksi}),Kukoq,Simi},Qubinkovi} (Veji}), Gligori}, Jugovi}, Mari},Stojanovi}. Ikod2:0ikod2:1doma}inisu proma{ilipodvetriprilikeda do|u do ubedqivijeg vo|stva, a zbogtihproma{ajanakrajususe boriliizabod. D. Vuji}

RUMA: Stadion Jedinstva, gledalaca 100, sudija Lazi} (Kraqevci).Strelci: Plav{i} u18,Vasiqevi}u36.iS.Sabou 73. minutu. @uti karton: @ivkovi}(Borac). JEDINSTVO: Qubinkovi}7, Opa~i}7,Cviji}7,Joki}7,Dejan Qubi{i} 7, Danijel Qubi{i}7,S.Sabo8,Plav{i}8(Grbi}7),Jovi}7(Basara7),Vasiqevi}7. BORAC: V. Mati} 6, [ok~ani}6,Ranki}6,Kula~in7,Vujaklija 6, @ivkovi} 6, Jovi} 6, R.Mati} 7, Milenkovi} 6, M.Mati} 7 (D.Samarxi} 6), Samarxi}6.

Derbigostima Metalac - Lipar 3:4 (2:3) vremena, pa je radost gostiju bilaneopisiva.

Rastina - Dinamo ( S) 2:2 (1:0) RASTINA: Igrali{te „Milana \evi}a“, gledalaca: 50, sudija: Be}anovi} (Sombor), strelci: Vuli} u37.iMamulau61.zaRastinu, aKmezi}u62.iTadijanu80.minutuzaDinamo.@utikarton:Krpjan (Dinamo). RASTINA: Star~evi}, D. Koruga (N. Koruga), Bogunovi}, Cvijeti},[uput,Elez,R.Vuli},Lali} (U. Vuli}), Vuki~evi}, Zubovi}, Mamula DINAMO: D. Durakovi}, Krstin,M.Vidakovi},Ba~i},Krpjan, [arac, A. Durakovi} (Barunov), Tadijan, Kne`evi}, Karjakov (Barunov),Brkin(K.Vidakovi}). U veoma zanimqivoj utakmici najrealnijiishodme~ajenere{en rezultat,adopobedesumogli,do}iijednaidrugaekipanakonpo nekoliko propu{tenih {ansi na obe strane. Igrom su obe ekipe dokazaledalo{plasmannatabe-

(13), 2. Rumunija 8 (13), 3-5. Azerbejxan,Francuska,Gr~ka8(12,5), 6. Jermenija 7 (13), 7-8. Nema~ka, Italija7(12),9-10.[panija,Rusija7(11,5_,itd.24.Srbija4(12,5). Sasvim suprotna pri~a od mu{ke je sa na{im damama. One su pak,nasvimtablamaimaleslabijirejtingodMa|aricapa,ipak,su uspeledaodigrajujo{jedanme~u ravnote`i sa ja~im protivnikom. Ma|arska(6)–(14)Srbija(Hoang -Bojkovi} 0:1,Madl-^oqu{kina remi,Rudolf-Drqevi} 1:0,GaraEri} remi). Rezultati 5. kola: Gruzija –Rusija 1,5:2,5,Francuska – Poqska1:3,Rumunija– Ukrajina 1:3,Slovenija– Jermenija 2:2,Ma|arska – Srbija 2:2,Nema~ka - ^e{ka 1,5:2,5, Bugarska - Gr~ka 2:2, [panija –Holandija1:3,Letonija – Izrael 1:3, Azerbejxan - Crna Gora 4:0, Turska - [vajcarska 3:1, Engleska – Hrvatska1,5:2,5,Litvanija– Italija2:2,Austrija- Norve{ka3,5:0,5. Plasman: 1. Rusija 10 (15), 2.Poqska 8 (14), 3. Ukrajina 8 (13,5)4.Gruzija 8 (12),5.^e{ka7 (11),6.Srbija6(13),7.Slovenija 6(12,5),8.Francuska6(11,5),9-11. Ma|arska, Holandija, Jermenija 6 (10),itd. B. D.

ZAPO^ET PROGRAM GS VOJVODINE U ^ETIRI GRADA

Razvojnagimnastika u{kolama Projekatrazvojnegimnastikeu Vojvodinipredstavqenjeizapo~et u sen}anskoj Osnovnoj {koli „Stevan Sremac”, koji je u RJ „TurzoLajo{„uSentipredstavilaiotvorilapredsednicaGimnasti~kog saveza Vojvodine Aniko @iro{-Jankeli}. Realizaciju programa Gimnasti~kog saveza Vojvodine je odobrilo i podr`alo Ministarstvo omladineisportaRepublikeSrbije jer se wime ostvaruju op{ti

vi|enojedaseobuhvatiokostotinudece. -Ciqeviprogramasupopularizacijasportskegimnastike,omasovqewe svih kategorija gimnasti~araigimnasti~arkiiukqu~ivawesvedecekojavolesportusvet sportske gimnastike. Sa ovim bi seunapredioirazvijaogimnasti~ki sport u Vojvodini kod mla|ih {kolskih uzrasta i gimnastika promovisalau{iremsmislu-nagla{avaAniko@iro{Jankeli}.

Jedinstvo - Borac (K) 3:0 (2:0)

SOMBORSKA ME\UOP[TINSKA LIGA

SOMB OR: Igral i{ te @AK-a, gledalaca 50, sudija: Mojsovi} (Apatin). Strelci: Vukovi} u 12. Burgi} u 30. i Stoisavqevi}u46.zaMetalac, a Kova~ u 29. 45. i 93. Romi} u 42.minutuzaLipar.@utikartoni: Vukovi} i Vukeli} (Metalac), a Romi} i Karin (Lipar). METALAC: Wegomir, Tordi (Jov an ov i}), Vuk el i}, Atli}, Mij at ov i} (Per i}), Burg i}, Kom az ec, Pa~ irs ki, Stoisavqevi},Vukovi},Nikoli}. LIPAR: Pena, @u`a, Ki{ (Rub e{ i}), Jov i~ i}, Pol i}, Vukovi}, Nestorovi}, Romi}, Kov a~, Maqk ov i} (^es ti}), Karin. Derbikolaprotekaojeuzanim qiv oj veo m a nei zv es noj utakmici sa dosta golova. Ve} po~etkom nastavka rezultat je bio 3:3, obe ekipe su do kraja susretaulagalemnogotrudaza pobedonosnipogodak.Tojepo{lo za nogom veoma spretnom golgeteru Kova~u u nadoknadi

Ekipno prvenstvo Evrope (Gr~ka) nam je samopotvdilodasunam fudbal i {ah sli~ni. Akosuprvadvaporazamu{keekipedonekleio~ekivanaovajdana{winasvra}aufudbalskupoziciju – navijamo, o~ekujemo i ni{ta.Svakina{igra~pojedina~no imaojevi{irejtingodsvogrivalaikadmive}neuspevamodaiznenadimo ja~e ekipe to su s nama uspeli Slovenci. Srbija (18) – (21) Slovenija 1,5:2,5 (Ivani{evi} -Beqavski remi,[olak-Leni} 0:1, Kova~evi} - Bori{ek remi,Perunovi} –Skoberne remi). Rezultati5.kola:Azerbejxan– Francuska 2:2, Nema~ka – Bugarska 1:3,[panija - Gr~ka1,5:2,5,Rumunija – Holandija 2,5:1,5, Rusija – Ukrajina2,5:1,5,Danska– Jermenija 0,5:3,5, Italija – Izrael 2,5:1,5,Ma|arska – Makedonija3:1, Moldavija - ^e{ka 2:2, Austrija – Poqska1:3,Gruzija – Island 3:1, Srbija – Slovenija 1,5:2,5, Engleska – Litvanija 3:1,[vedska – Hrvatska 1,5:2,5, Letonija - Norve{ka 2,5:1,5, Turska - [vajcarska 1,5:2,5, Crna Gora – Luksemburg 3,5:0,5,[kotska – Finska1:3,Vels – Kipar2:2.Plasman:1.Bugarska9

li i jednih i drugih nije realan pokazateq kvaliteta ovih ekipa, te igrom mogu biti zadovoqni i jedniidrugi.

[ikara - Oyaci 4:0 (2:0) SOMBOR: Igral{te [ikare, gledalaca 50, sudija: Jerilovi} (Apatin). Strelci: Miji} u 25. i 81.Curni}u26.iBa~i}u52.minutu.@utikartoni:Elez([ikara), a Mogu{, Drobac i \uki} (Oxaci).Crvenikarton:Trivunovi}u60.minutu([ikara). [IKARA: Cari}, Grahovac, Kesegi},Nik{i},Elez,Sekuli}, Trivunovi}, Topalov, Mili}, Curni},Ba~i}. OXACI: Oreq,Vajd,Jakovqevi},Milo{Kesi},MirkoKesi}, \uki}, Drobac, Mogu{, ]iri}, [o{ki},Jovovi}. [ikarajesalako}omsavladala goste.Nemo}gostijunajboqeilustruje podatak da Oxa~ani ni broj~anoja~ipunihpolasatanisu predstavqali ozbiqnu prepreku zadoma}ina.

Osnovciusen}anskoj{koli„TurzoLajo{”naotvarawuprojekta razvojnegimnastike

interesi u oblasti sporta, pogotovo{toseprojekat„Pilotprogramrazvojnegimnastikeuosnovnim{kolama”baziranasaradwi osnovnih {kola sa gimnasti~kim klubovima,saciqemdakrozbesplatno ve`bawe okupi {to ve}i broj dece mla|eg {kolskog uzrasta,kakobiseomogu}iopravilan rastirazvojdece. Programserealizujeod1.novembrado1.decembraovegodine u  ~etiri grada Vojvodine: Novom Sadu, Senti, Somboru i Sremskoj Mitrovici. U svakom gradu }e program obuhvatiti po jednu osnovnu {kolu. Prema sprovedenim anketama Gimnasti~kog saveza Vojvodine, pred-

Nakon zavr{etka programa o~ekuje se pove}ani broj sportistaukqu~enihutakmi~ewa{kolskog programa sa uspe{no savladanim zadatim elementima potrebnihza{kolskotakmi~ewe. ProjekatuSentirealizujutreneriGimnasti~kogkluba„Linea”KlaraBranova~ki,JelenaVrani}iMilivoje Mandi} u saradwi sa u~iteqicama{kole@u`anomPapiIrenomGemeri.PredsednicaGSVojvodinejeovomprilikomuru~ila{koli i struwa~e, koje je Pokrajinski sekretarijat za sport i omladinu APVojvodine,napreporukuGSVojvodine,poklonio{kolamagdesenegujegimnastikauVojvodini. Tekst i foto: M. Mitrovi}

MFL KIKINDA – NOVI BE^EJ

PobedaNakov~ana Polet - Delija 3:1 (2:1) NAKOVO: Stadion Poleta, gledalaca 100, sudija: @ivkovi}(Kikinda).Strelci:Cari} u20.Mitrovi}u30.iN.Zori} u54.zaPolet,aNedeqkovu23. minutu za Deliju. @uti kartoni: Angelovski (Polet), a Nedeqkov i Popov (Delija). Crveni karton: Angelovski (Polet). POL ET: Zril i}, Ang el ovski, Jawi}, Rodi}, [}epanovi},Biki},Cari},S.Zori},D. Tubin,Jeli~i}(D.Zori}),Mitrovi},N.Zori}(Ma~ki}). DELIJA: Badrqica, Te{in (B. Gol i}), Ber i} (Brat i}), Mil ad in ov, Pop ov, Srb qin, Barb at, Nedqkov, S. Gol i}, Peri{i},Ivanovi}. Nakov~ani su zaslu`eno u op{tinskom derbiju savladali mokrinskogDeliju. M. S.

Borac - @AK 4:2 (2:2) I\O[: StadionBorca,gledalaca80,sudijaPopovi}(Kikinda), strelci: Markov u 19. [ugi}u41.Spahi}u58.(izpenala) i 79. za Borac, a Ninkovi} u 5. i 18. minutu za @AK. @uti kartoni: Stepanov (Borac), Barbat, Bo{wakov, Mutavxi}(@AK).Crvenikarton: An|eli}(@AK). BORAC: Batan~ev, [ibul, Mili}ev, Stepanov, Mladenovi} (Raki}), Dragan, ^eleketi}, Spahi}, [ugi}, Markov, Be}agul(Vaskovi}). @AK: An|eli},Fu}ak,Blanu{ a, Nin ov i} (Jon i}), Bo{wakov, Adamov, Barbat, Mutavxi},Tanackov,Rankov(Draganov),Va`i}(Francuski). M. S.


SPORT

c m y

dnevnik

sreda9.novembar2011.

PRVALIGASRBIJE

KARATISTIHAJDUKAVODEUPREMIJERLIGISRBIJE

Derbi uZrewaninu

Nakorakdotitule

UsedmomkoluPrve rva~ke lige Srbije ekipa zrewaninskog Proletera u derbi susretu do~ekuje beogradski Partizan,dokSpartakputujeuBeogradname~saRadni~kim.CrvenobeliizZrewaninasuunaletu,uminulomkolupobedilisu Spartak,dokcrnobeliizHumske1`eledanastavepobedni~kinizidaostanunepora`eni. U minulom kolu Prolter je napravioiznena|eweipobedio Spartaksa5:2uSubotici,{to imjezanarednime~dalovetar ule|a.Ekipasuboti~kogSpartakanalazisenadrugojpozicijiidolazakuBeograd}ejojdonetinovebodovepo{toizduela sa Krsta{ima, barem na papiru,va`ezafavorite,ai`ele popravni posle poraza od Proltera. Radni~ki iz Kragujevca }e u SombornanogeRadni~kom,dok }eseuMladenovcusastatiekipe„QubomirIvanovi}Gexa“i Senta. J.G. DANASUNOVOMSADU

Tuma~ewe Zakona osportu Po Zakonu o sportu klubovi,saveziisportskeorganizacije obavezni su da se preregistrujudabinastavili sa svojim delatnostima.Tim povodom Sportska asocijacija Novog Sada (SANS),usaradwisaAgencijom „Sport lur”, organizuje sastanak sa predstvanicima svih zainteresovanih klubovau`eqidasepojasni Zakonosportu. Po Zakonu o sportu, svi klubovi moraju da se preregistruju, da usvoje nove statute, sa~ine registarcione prijave i prilo`e pisanu dokumentaciju do 12. aprila 2012. godine, u suprotnom prestajudapostoje. Sastanak }e se odr`ati u Amfiteatru TIMS-a (Radni~ka 30a), s po~etkom u 15 ~asova. KUPLENZADAME

Senta uSente{u Vat erp ol istk iw e Sente nastavqaju nadmetawe u LEN kupu. One su na kvalifikacionom turniru u italijanskoj Imperiji zauzele tre}e mesto. Sen}anke su savladale francuski Bordo (11:10) i Zapadni London(10:7),apora`enesuod ruskog Kanti Manasijska (6:34) idoma}eImperije(3:22). Senta}enastupatiuEgrupi, koja }e se igrati u ma|arskom gradu Sente{u, sa ruskim UralokaZlatust,gr~kimPatrasom idoma}imHungeritUNIEpserom.Turnir}eseigratiod18. do20.novembra G.M.

Nakon {to su u prvom delu sezone karatisti Hajduka iz Kule osvojilititulupobednika Kupa Srbije, klupsko rukovodstvoistru~ni{tabsukao naredni ciq zacrtali osvajawe Premijer lige Srbije. I na dobrom su putu da taj ciq bude i ostvaren.Naime,u^a~kujeodr`an prvi deo Premijer lige za seniore.EkipaHajdukajeimala trime~ainimalolakeprotivnike: uz pro{logodi{weg {ampionaStudentskigradbiojetu idoma}inBorac,kaoibeogradski Kolos. No, za Kuqane nije bilo prepreke - ostvarene su tripobede! -Uprvomkolusmosavladali ekipuKolosaizBeogradasa3:1, zatimudrugombraniocatitule Studentski grad iz Beograda sa 3:2itimeimserevan{iraliza pro{logodi{wiporaz,autre}emsmopobediliekipudoma}i Borac sa 4:0. Posle prvog dela zauzimamoprvomestonatabeli sa6bodovaipunisamopouzdawa i sa visokim ambicijama do~ekujemozavr{nideolige-vidno zadovoqan prokomentarisao je u~inak svojih izabranika {ef stru~nog {taba Hajduka Lazar Greber. Tripobedesudelokolektiva, ali je bilo pojedinaca koji su odsko~ili. - U na{oj ekipi se izdvojio Dejan Umi~evi} sa sve tri ubedqivepobede,aostalitakmi~ari su radili ujedna~eno dobro. Demonstriralismovrlokvalitetan karate i visok nivo pri-

N. Greber (trener), Ain, Umi~evi}, L. Greber ({ef stru~nog {taba), Nikola{, Savi} (trener), dole: Jerkovi}, ]uri} i Jovanov

premqenosti i pokazali smo najvi{eodsvihekipa-podvla~iGreber. Drugideo{ampionata}ebiti odr`an 10. decembra u Kuli. ^elna pozicija, doma}i teren, publika,svesutoargumentikojigovoredasuKuqaninakorak dotitula{ampiona. - U Kuli nas o~ekuje tako|e te`akzadatak,jer}emo,izme|u ostalog,imatidirektanduelsa najve}im konkurentom, ekipom

Dinama iz Pan~eva, koja zauzima trenutno drugo mesto na tabeli.Ovegodinesmove}osvojilititule naKupuVojvodinei KupuSrbijeisve}emouraditi dasedonastupauKulipripremimo maksimalno i da poku{amodaosvojimodrugiputuistoriji duplu krunu, Kup i prvenstvoSrbije-ka`eGreber. Ekipu Hajduka u prvom delu premijerliga{kog takmi~ewa su~inili:BojanNikola{(ka-

ameri~kih dolara, dok je drugoplasirani osvojio 8.000 dolara. Me|utim, pravi ciq ovog takmi~ewa je da vrati nacionalni ponos koji im je sru{en nakon {to je2004.godineuKinioborenrekordpobrujuu~esnikasa2.048boraca na trodnevnom takmi~ewu. Rva~i su podeqeni na isto~nu i zapadnustranu,aborbupo~iwusa mentorom(zasuul),ukazuju}i~ast rivalusvojimspecifi~nimgovorom,tekratkimplesomorlastavqaju}i{akenaramenamentora. Pobednicidvestranetakmi~e se u finalnoj borbi. Rva~i nose te{ke ~izme (gutal), uske ga}ice (shuudag)imali,nagrudimaotvoreni prsluk dugih rukava preko ramena (zodog). Pobednika odre|uje koliko je rundi dobio. Do ovogaturnirarekordjebio10,a

Rvawe

[tern nemo}an Ultimatumvlasnikaoro~endo ve~erasuneojekonfuzijuipaniku u redove igra~a.Predstavnici igra~asvih30NBAtimovasasta}e se u Wujorku, kako bi dan pre istekaultimatumarazmotrilidaqekorake.Sindikatigra~a,na~elu sa Derekom Fi{erom, izvr{nimdirektoromBilijemHanteromiadvokatomXefrijemKeslerom, odbio je posledwi predlog vlasnika,smatraju}iganeprihvatqivim,pa~akibezobraznim.

Morison promoter

Bo{kovi}pozvao36rukometa{ica Naspiskusenalazi36igra~ica-golmani:Jelena@ivkovi}(JPRadni~ki),Olivera To{ovi} (^a~ak), Jovana Risovi} (Maks sport), Marija ^oli} (Crvena zvezda),KristinaGeorgijev(Radni~kiLepenica) i Ana Ka~arevi} (Naisa), bekovi: Sawa Damwanovi} (Podravka, Hrvatska), Jelena Eri} (Zaje~ar), Marija Jawi} (Jagodina), Katarina Voj~i} (Trier, Nema~ka), Biqana Filipovi} (Avror, Francuska), Kristina Li{~evi} (Metalurg, Makedonija),AndreaLeki}(\er,Ma|arska), TawaVu~kovi}(Zaje~ar),DanijelaMati} (Zaje~ar), Jelena Trifunovi} (Metalurg, Makedonija),Jelena@ivkovi}(Ferencvaro{, Ma|arska), Dijana [tevin (Budu}-

Ko{arka{ Crvene zvezde prene}emladimasvojaiskustvauborbiprotiv{e}ernebolesti9.novembrauTCU{}e.Posleu~e{}a uakcijiBitkazabebeiprire|ivawaDe~ijenedeqe,ko{arka{ki klub Crvena zvezda upustila se u jo{ jedan dru{tveno anga`ovan projekat. U susret 14. novembru, svetskom danu borbe protiv dijabetesa,wennajboqistrelacAdam Morison bi}e promoter akcije Pobedi sa mnom. Morison, koji bolujeoddijabetesatip1,}eprenetimladimadeosvojihiskustava u borbi sa bole{}u. Wegov primerpokazujedadijabetesnemora da bude nepremostiva prepreka u bavqewuvrhunskimsportom.

Adam Morison

ZAAKCIJE@ENSKEREPREZENTACIJE

Selektor `enske rukometne reprezentacije Srbije Sa{a Bo{kovi} objavio je spisak igra~ica na koje ra~una za turnir TrofejKarpata,kaoizadveprijateqske utakmice s Hrvatskom. Okupqawe reprezentativki je zakazano za 14. novembar u Beogradu,nakon~egasledetrodnevnepripremeuKladovu. Od 18. do 20. novembra na{e rukometa{ice}eu~estvovatinaKupuKarpata,gde }ejo{igratidoma}inRumunija,MakedonijaiMa|arska.Popovratkuuzemqu,~etiri dana }e trenirati u Staroj Pazovi, nakon~egaslediputuPore~,gde}e26.i 27.novembraodigratidveutakmicesHrvatskom.

Me|utim, komesar NBA lige Dejvid [tern preneo je stav vlasnikadajetowihovaposledwakorektnaponudaida}eslede}abiti mnogo, mnogo nepovoqnija po igra~e.Prvareakcijaigra~abila jedasekreneusakupqaweglasova zaraspu{tawesindikataitu`bu sudu.Me|utim, ubrzo je shva}eno dabitobiodugotrajanprocessa krajwe neizvesnim epilogom.Oglasilosedostaigra~akoji apelujudaseponudavlasnikarazmotrijo{jednomidasestavina glasawe.KevinMartinizHjustonarekaojedabitrebaloprihvatitiovuponudu,akonemo`edase izdejstvujeboqa,dokjeKobiBrajant pozvao dve strane da se jo{ jednomsastanuiprobajudado|udo re{ewapreistekaultimatuma. Prema nezvani~nim informacijama koje se mogu pro~itati na sajtovima,sadajenajve}iproblem utome{tojeDejvid[ternizgubio kontrolu nad militantnom strujomvlasnika,kojinesamoda ne`elekompromis,nego~akpri`eqkujudaigra~iodbijuultimatum,kakobisezonabiladefinitivnootkazana!? Korazume,shvati}e. KAKOPOBEDITI DIJABETES

na wemu je postavqen novi sa 13 pobeda. Titula ozna~ava snagu i dodequje se tokom nacionalnog festival Naadam u julu. Postoji nekolikorazli~itihmedotaborbe, trikova, a pojedini stariji rva~kitvrdedaihimanekoliko stotina.Rvawejetradicijastara 7.000godinakodMongola.Ovegodine Mongolija obele`ava 2220. godi{wicuodosnivawasvojedr`avekojajeverovatnobilajedna od prvih u svetu. Mongolija kao savremena zemqa predstavqa samo deo istorijske domovine etni~kih Mongola, jer mnogi `ive naseveruiseverozapaduKine,te delovimaRusije.

Rukomet

Prva liga - QIG: Qig – Senta (16.30), BEOGRAD: Radni~ki – Spartak (18), SOMBOR: Radni~ki – Radni~ki (Kg) (19), TOVARI[EVO: Partizan – Potisje (19), ZREWANIN: Proleter–Partizan(20).

piten),  Dejan Umi~evi}, Mladen ]uri},  Dimitrije Jerkovi}, Rada Jovanov i  Mirko A © in.Udrugomdelutakmi~ewa u sastavu ekipe bi}e i dva od povredaoporavqenatakmi~ara Branislav Risti} i  Slobodan Tiragi}, a uz ekipu Dinama iz Pan~eva protivnici Hajduka u Kuli }e biti NIS Novi Sad (biv{i Naftagas) i Radni~ki izObrenovca. \.Bojani}

Naturniru6.002rva~a

DANA[WIPROGRAM

Drugamu{kaliga,sever NOVI SAD: Radni~ki @SK (16.30, Slana bara), ADA: Potisje Pleteks Hercegovina (19), SOMBOR: Somborelektro - Banatski Karlovac (19), Dalmatinac - Radni~ki ([) (20.45), KA^AREVO: Jedinstvo - Titel Xon Dir (19), APATIN: Apatin - Hajduk (19.30).

IZNBALIGE

Dejvid [tern

MONGOLIZAGINISOVUKWIGUREKORDA

Nedavno je u mongolskoj prestoniciUlanBatorodr`anotakmi~ewe u rvawu na kome su u~estvovala rekordna 6.002 rva~a.U~esnici su se takmi~ili devet dana, {to }e biti priznato kaoGinisovsvetskirekord.Rvawe je najva`niji sport me|u tri mongolskeglavneigre,me|ukojima su jo{ jahawe kowa i streli~arstvo.Mongolsko rvawe je veoma specifi~no. Ne postoji, kao kodostalihborila~kihsportova podelapote`inskimkategorijama,takodasunajve}irva~iuglavnom i najboqi. Rva~i uzrasta 14 do80godinasuseokupilinaCentralnomstadionu,gdejetakmi~ewe otvorio premijer Suhbatar Batbold. Pobednik ^imedregzen Sawadamba je dobio nagradu od 12.000

19

nost,CrnaGora),MarinaDmitrovi}(Jagodina),JelenaPopovi}(Avror,Francuska)iMilica^ovi}(JPRadni~ki),krila:JovanaBarto{i}(Zaje~ar),JelenaNi{avi}(Zaje~ar),IvanaPopovi}(^a~ak), SawaRadosavqevi}(Radni~kiLepenica), Svetlana Ogwenovi} (Mec, Francuska), MajaLukovi}(Crvenazvezda),@eqkaNikoli} (Budu}nost, Crna Gora), Katarina Krpe` (Metalurg, Makedonija), Ivana Milo{evi}(Jagodina)iSlavicaKoperec (Nopal), pivoti: Dragana Cviji} (Budu}nost, Crna Gora), Sla|ana Poplazi} (Zaje~ar), Sawa Rajovi} (Kwaz Milo{), Verica Nikoli} (Zaje~ar) i Jelena Bursa} (Makssport). J.G.

Iakojeoboleojo{sa14godina, pozitivnim stavom i uporno{}u uspeo je da postane jedan od najboqih igra~a univerzitetske NCAA lige, tre}i pik na NBA draftu i dvostruki osvaja~ {ampionskogprstenasaLosAn|eles Lejkersima. Akciju, ~iji je ciq pru`awe podstreka obolelima i podizawe svestikodzdravihqudiopotrebi redovne kontrole, pored ZvezdeorganizujuUdru`ewezaborbu protivdijabetesa„Plavikrug”i dnevnilistKurir. Poruka je da o dijabetesu ne trebamislitisamo14.novembra, ve}365danaugodini,jerodtebolestiuSrbijiboluje~ak630hiqadaqudi-{tojeoko10odstood ukupnogbrojastanovnika!


20

dnevnikOv [AH SRedOM

sreda9.novembar2011.

POLUFINALE PRVENSTVA NOVOG SADA

Po~etak 15.novembra [ahovski savez Novog Sada raspisao je polufinalni turnir za 81. pojedina~no prvenstvo grada. Turnir }e se igrati u prostorijama N[K-a od 15. do 29. novembra. Pravo u~e{}a imaju registrovani igra~i klubova [ahovskog saveza Novog Sada kao i igra~i koji su na neki na~in vezani za Novi Sad (stanuju, rade ili se {koluju u Novom Sadu): deset prvoplasiranih sa ~etvrtfinalnog turnira, svi igra~i sa FIDE rejtingom 2000 i vi{im. Upisnina iznosi 800 dinara (za igra~e koji su se plasirali sa ~etvrtfinala 400 dinara). Turnir }e se rejtingovati. Igra se po [vajcarskom sistemu devet kola a tempo igre je 30 poteza za 90 minuta i 30 minuta do kraja partije. Pojedina kola igraju se utorkom, sredom, petkom i subotom od 19-23. ~asa. Igra~i treba da ponesu ispravan {ahovski ~asovnik. Prijave se primaju do utorka 15. novembra u 14 ~asova, kada se lista zakqu~uje. Prijava se vr{i upisom na listi istaknutoj u N[K-u, na telefon 452-632 ili e-mail: nsk@open.telekom.rs. Otvarawe turnira obavi}e se 15. novembra u 18.45 ~asova. Pravo u~e{}a u finalu imaju ~etvorica prvoplasiranih sa 80-og prvenstva grada, raniji prvaci grada, igra~i sa najmawe titulom majstora, igra~i sa FIDE rejtingom 2250 i vi{im i deset prvoplasiranih sa polufinalnog turnira. TURNIR U ALIBUNARU

Pobednik ]irjani}

U Alibunaru je zavr{en rejting turnir koji se igrao po Bergerovom sistemu ubedqivom pobedom prvotimca kluba Velibora ]irjani}a. Mnogo vi{e se o~ekivalo od bra}e Kotrla koji su pretekli samo omladinku Mariju Stanimirovi}. Plasman: 1. Velibor ]irjani} 8, 2-3. Goran Leko, Du{an Jovanovi} 5,5, 4. Jon Ardeqan 5, 5. Nikola Marinkov 4,5, 6. Trajan Romanovi} 4, 7-8. Bo{ko Stanimirovi}, Sebastijan Kotrla 3,5, 9. Stefan Kotrla 3, 10. Marija Stanimirovi} 2,5 poena.

Novesudije Za seminar za {ahovske sudije prijavilo se 15 kandidata, me|u kojima i ~etiri dame. Ispiti su odr`ani u prostorijama [S Vojvodine. Za op{tinskog sudiju polo`ili su Rajko Popovi} i Ivan Taka~ iz Zmajeva, Stanislava Nedeqkovi}, Almir Gagi}, Tomislav Taka~ i Ivan Banovi} iz Novog Sada, Ondrej Hlpka iz Glo`ana, Stefan Kosti} iz Vr{ca, Danijela Petrovi} iz ^uruga i Svetlana Stojadinov iz Toma{evca. Ostalo je jo{ da kandidati za regionalne sudije Vladan Petrovi}, Marija Stojanovi}-Medar i Vojislav Veqkovi}, svi iz Novog Sada, obave i pismeni rad koji }e se odr`ati u ~etvrtak sa po~etkom u 11 ~asova. Seminar su vodili Milan Miladinov i Petar Mili~evi}.

PROBLEM BR. 362

Belidajemat udvapoteza MihajloStojni} “Die Schwalbe”, 2000.

Re{ewe problema br. 361 (Valentin Rudenko, „Due Mosse“, 1959.) sa pozicijom: beli – Ke8, De1, Ta5, La2, Le7, Sa4, Sb6, pe{ak c2; crni – Kd4, Tg4, Tg5, Lg1, Lh3, pe{aci: b4, g7; je 1.Ld5! Pretwa 2.Lc5 mat. Na 1...b3 sledi 2.Dc3 mat. Na 1...Ld3 sledi 2.Da1 mat. Na 1...T:d5 sledi 2.T:d5 mat. Na 1...Te4 sledi 2.D:e4 mat.

ISTINITE PRI^E IZ MODENE

ANALIZIRANE PARTIJE

Novosadski gambit “Do sredine 18. veka nije postojala {ahovska umetnost, ve} romanti~arska {ahovska umet nost. No to ni je bio principijelni pravac {ahovske misli, ve} posve stihijsko po vo |e we za vla sti tim ma{tawima. (P. Romanovski) Glavni nosioci tzv. stihijskog romantizma bili su {ahovski majstori rane talijanske {kole Polerio, Salvio i Greko. Osetiv{i dinami~na svojstva figura, oni su na {ahovskoj tabli stvarali originalne i po temama razli~ite kombinacije. Wihovi smeli takti~ki udari, ustremquju}i ka neuklowivom matnom na pa du, pred sta vqa ju neo spor no ogrom nu vred nost i jo{ su dan-danas nezaobilazni primeri za sve boqe uxbeni ke {a ha. Ta li jan ski maj stori zapo~eli su istra`ivawe mnogih otvarawa i gambitnih sistema (Kraqev gambit, Od bra na dva ska ka ~a, Italijanska partija), ali i analiti~ku delatnost u oblasti zavr{nice. No ~inilo se da je romantizmu kona~no odzvonilo stupawem na sce nu ob da re nog Francuza Filidora, koji je sre di nom 18. ve ka ob ja vio svoju teoriju o ulozi pe{aka u {ahovskoj partiji. Filidor TURNIR DECE U ZREWANINU

Start usubotu Osnovna {kola “Vuk Karaxi}” iz Zrewanina organizuje u subotu (11. novembra) otvoreni de~iji {ahovski turnir pod nazivom “[ah u {kole”. Mesto igrawa je sredwa {kola “Nikola Tesla” (preko puta Op{tine) sa po~etkom u 9.30 ~asova. Igra se u ~etiri grupe 1-4. i 5-8. razred posebno mu{karci i devoj~ice. Igra se po [vajcarskom sistemu 7 kola uz kompjutersko parovawe. Tempo igre je 15 minuta po igra~u a u~esnici su du`ni da ponesu ispravan {ahovski sat i preglednu {ahovsku garnitutu. Upisnina je 100 dinara. Prijave i informacije na telefon 060 56 70 890 (Lazar Doro{kov).

ne samo da je napisao teoriju koja je sasvim u suprotnosti s romanti~arskim idejama ve} je za tablom vi{e nego uverqivo dokazao prednost pozici o ne nad kom bi na ci o nom igrom. Romanti~ari su bili ogor~eni i razo~arani, ali ni su ni po mi {qa li da bez borbe ustupe svoje pozicije novoj {koli. Odbrane romantizma prvi su se prihvatili majstori iz Modene. Godine 1750. iza{la je kwiga pod naslovom “Iskustvo {ahovske igre anonimusa iz Modene”, a autor je bio Ekole del Rio. Po mi{qewu del Rija, ishod {ahovske partije mora se re{avati napadom na kraqa. Glavna snaga napada su figure koje deluju po otvorenim linijama. Da bi im se otvorio put, potrebno je prethodno ukloniti pe{ake koje im smetaju. Autor vi{e puta pocrtava tvrdwu da put do kona~nog ciqa partije – ma ti ra wa pro tiv ni~ kog kraqa – le`i u `rtvi. Misli del Rija karakteristi~ne su za plat for mu ta li jan skih majstora, koja se mo`e okarakterisati kao himna otvorenoj igri figura, direktnom napadu i kombinaciji. Nastavak u slede}em broju. B. Dankovi}

RobertMarku{

BALKAN GRAN PRI

Marku{ pobednik U Skopqu je nedavno zavr{en Open tur nir „Sko pje 2011“, koji se igrao u sklopu bodovawa za Balkan gran pri. Na petostrukoj deobi prvog mesta sa po 6,5 poena najuspe{niji je bio, ina~e i glavni favorit za prvo mesto, srpski {ahista, ~lan Novosadskog {ah kluba, Robert Marku{. Goran G. Todorovi} zauzeo je tre}e mesto sa istim brojem poena, dok se Danilo Milanovi} sa 6 poena plasirao na 9. mesto. U~estvovalo je 62 igra~a. Plasman: 1-5. Marku{, V. Ge or gi jev, G.M. To do ro vi}, Stanojoski, Pan~evski 6,5, 611. Mi ron, Ne dev, Pet kov, Milanovi}, Jianu, Nikolov 6 poena, itd.

Uzbudqivfini{

„DNEVNIKOVA” [KOLA [AHA (8)

Udvojenipe{aci Slabost udvojenih pe{aka pri pe{a~kom prodoru jasno je izra~ena u slede}em primeru. Pomar - A. Kuadras, Olot, 1974. Dijagram (Beli: Kd6, pe{aci: e3, f2, g2, g3; Crni: Kf6, pe{aci: e4, f5, g4, h5) Cr ni na po te zu – do bi tak: 1...f4! 2.Kd5 (Ili 2.e:f4 h4! 3.g:h4 g3! 4.f:g3 e3 sa dobitkom.) 2...h4! 3.K:e4 f3! 4.g:f3 h3i beli predaje. N. Vajn{{tajn - M. Rode, LonPajn,1977.Dijagram (Beli: Kc4, pe{aci: a4, b4, f2, g2, g3; Crni: Kd6, pe{aci: b6, e4, f5, g5, h5) Crni na potezu – dobitak: 1...f4! (U partiji je igrano 1...h4? 2.g:h4 g:h4 3.Kd4 Kc6 4.a5 b:a5 5.b:a5 Kd6 6.a6 Kc6 7.Ke5 Kb6 8.K:f5 K:a6 9.K:e4 i cr ni je pre dao.) 2.g:f4 g:f4 3.Kd4 e3! 4.f:e3 (Na 4.Kd3 sledilo bi 4...f3 5.g:f3 h4 6.Ke2 h3 7.Kf1 e2+ i crni bi dobio.) 4...f3 5.g:f3 h4 i cr ni do bi ja jer be li kraq ne mo`e da u|e u kvadrat h-pe{aka. Sopstveni pe{aci spre~avajukraqadazadr`iprotivni~kepe{ake A. Troicki, 1913. Dijagram (Beli: Kg1, pe{aci: a2, b2, c5, d5, f5; Crni: Kh4, pe{aci: b4, c7, d7, g2, g7, h7) Beli na potezu – dobitak: Ideja dobitka sastoji se u postavqawu barijere crnom kraqu na putu ka daminom krilu. 1.f6! (Lo{e

Spektakl naKorzici

REJTING TURNIR NS LIGE

U pro sto ri ja ma N[K-a ostalo je da se odigra jo{ jedno kolo rejting turnira igra~a novosadske lige. U vo|stvu se i daqe nalazi Stevan Jovi} ali u posledwem kolu igra pro tiv vi {e stru kog pr va ka Novog Sada Krasoja Notaro{a, dok u drugom derbiju igraju Sini{a Drowi} i Ramo Mujagi} koji zaostaju za Jovi}em samo pola poena. Pro{logodi{wi pobednik, Vo ji slav Veq ko vi}, star to vao je tek od 2. kola te uz poraze od Mujagi}a i Jovi}a mora}e da preda prelazni pehar novom prvaku. Pla sman po sle 8. ko la: 1. Ste van Jo vi} 6,5, 2-3. Ra mo Mu ja gi}, Si ni {a Dro wi} 6, 4. Kra so je No ta ro{ 5,5, 5-11. Vla di mir Ka wuh, Mi o drag Dra `i}, Ste van Mu {ic ki,

je 1.a4? zbog 1...b:a3 2.b:a3 Kg3! 3.a4 h5 4.a5 h4 5.a6 h3 6.a7 h2# mat, ili; 1.K:g2 Kg5 2.a4 b:a3 3.b:a3 Kf6 4.a4 Ke7 5.Kf3 Kd8 sa re mi jem.) 1...g:f6 2.K:g2 Kg4 3.a4 b:a3 4.b:a3Kf55.a4 (Pogre{no bi bilo 5.d6? c:d6 6.c6 d:c6 7.a4 Ke6 i kraq je u kvadratu belog pe{aka.) 5...Ke56.d6!c:d6 7.c6! d:c6 8.a5 Kd5 9.a6 i pe{ak se promovi{e. Panti}-S.Mirkovi},Karlovac, 1986. Dijagram (Beli: Kh5, pe{aci: f2, g2; Crni: Ka6, pe{aci: e5, f4, g4) Crni na po te zu – do bi tak: 1...g3! 2.f:g3 (Na 2.f3 sledilo bi 2...e4! 3.f:e4 f3 i crni bi dobio.) 2...e4! 3.Kg4 (Po sle 3.g:f4 e3 beli kraq nije u mogu}nosti da u|e u kvadrat epe{aka.) 3...f3! 4.g:f3 (4.Kh3 f2) 4...e3 i beli predaje zbog toga {to f-pe{ak smeta sopstvenom kraqu. V.Borisenko-K.Zvorikina,SSSR,1962.Dijagram (Beli: Kf4, pe{aci: a3, c2, d3, g4; Crni: Kg6, pe{aci: a5, b5, d4) Cr ni na po te zu – do bi tak: 1...a4! 2.Ke4 b4 3.K:d4 b:a3 4.Kc3 Kg5 i be li pre da je (4...Kg5 Na 5.d4 K:g4 i beli se nalazi u iznudici. Beli bi rado „pojeo“ sopstvenog c-pe{aka koji mu smeta da do|e kraqem na c2). Slobodan Mirkovi}: „[kola {aha”

dnevnik

Vo ji slav Veq ko vi}, Ivan Ti tov, Bo `i dar Kar li ~i}, Mi ro slav ^a bar ka pa 5, 12-19. Bo {ko Zlat ko vi}, Bo jan Lu ka ji}, Alek san dar Alek si}, No vi ca Ma ti}, Slo bo dan Ko sta di nov ski, Mi lan Po po vi}, Mi o drag Mi lo sa vac, Ivan Ba no vi} 4,5, 20-26. Zo ran Ra ti}, To mi slav Bu `an ~i}, Da vo rin Vra ne{, Vla dan Pe tro vi}, Pe tar Pje tlo vi}, @ar ko Si mo vi}, Zdrav ko Ja ko vqe vi} 4, 27-30. Mar ko Jo ci}, Ne nad \u ri}, Mi ro slav Po pr `en, Ne boj {a An to ni} 3,5, 31-32. Bra ni slav Po po vi}, Jo vo Pe to vi} 3, 33-38. Ja smi na Mi li vo je vi}, Cvet ko Vu ko vi}, Bra ni slav Do bri}, Mo mir Ilin ~i}, Bo ri vo je Ili}, Pe tar Bor ba{ 2,5, 39. Da ni lo Suk wa ja 1 poen. REJTING TURNIR U SOMBORU

VodiMiloje Staji} U Somboru se odigrana jo{ dva kola ovogodi{weg rejting turnira. Polske 6 odigranih kola u vo|stvu se nalazi mk Miloje Staji} iz Karavukova. ^etiri pratioca imaju pola poena mawe i me|u wima treba tra`iti i pobednika turnira. Glavni favorit po rejtingu Miodrag [quki} zaostaje 1,5 za Staji}em. Plasman: 1. Miloje Staji} 5, 2-5. Drago Kur~ubi}, Dragan ^i~a, Slavko Milovanovi} Simana Matkovi} 4,5, 6-7. Jurica Glamuzina, Vladimir Cvetkovi} 4, 8-13. Miodrag [quki}, Zoran Joti}, Milo{ Divni}, Jelena Milivojevi}, Zo ran Pe {i}, Slo bo dan Cvetkovi} 3,5, 14-19. Dragoqub \uri}, Janko Kne`evi}, Budimir @akula, Peter Loknar, Miroslav Lali}, Du{an Keli} 3, 20-22. Todor Stri~evi}, Si ni {a Gaj ~in, Ili ja Vlaisavqevi} 2,5, 23-27. Radovan Arsi}, Ivan Gali}, Vladimir [}eki}, Marina Gaj~in, Slobodan Bogdanovi} 2, 28. Jozo Pavi} 1,5, 29. \or|e \uro{ev 1 poen.

e–mail adresa sportske rubrike „Dnevnika” je: sport@dnevnik.rs

Na nedavno zavr{enom Kupu Korzike (Corsica Masters Knockout) igralo je 16 igra~a na ispadawe. Rivali su igrali po dve partije. U ~etvrtom kolu se desio incident kada je Iranac, velemajstor Ehsan Gaem Magami odbio da igra protiv Ehuda [a~ara iz Izraela. Odmah zatim, Magami je iskqu~en sa turnira. U polufinalu Anand je protiv Sasikirana obezbedio u~e{}e u finalu tek posle doigravawa koje je dobio sa 2:0. Istim rezultatom, ali bez doigravawa Mame|arov je pobedio ^eparinova i postao drugi finalista. Finale je pripalo svetskom prvaku. U prilogu donosimo obe partije finala.

Anand–Mame|arov 1.d4 Sf6 2.c4 g6 3.f3!? Dobar znak! Ne se}am se da je Anand ikada poku{ao s ovom retko igranom varijantom. 3...d5Kao {to se o~ekivalo, Mame|arov u~estano igra Grinfeldovu odbranu. 4.c:d5 S:d5 5.e4 Sb6 6.Sc3 Lg7 7.Le3 0–0 8.Dd2 Potez je “zakon” ovog otvarawa. 8...Sc6 8...Le6 9.d5 Lc8 10.Lh6 (Mame|arov – Eqanov, Dubai 2004 1:0) je jedan od “[akijevih” uspe{nih iskustava u ovoj varijanti; 8...e5 je glavna varijanta – ali ne danas! 9.0–0–0 Dd6 Ovo je jedna od glavnih linija otvarawa koju je teorija bogato razradila. Mnogo je partija u ovoj varijanti, ukqu~uju}i i kontraverzna mi{qewa o woj. 10.Kb1 (Napad sa 10.h4 Td8 11.Sb5 Dd7 12.h5 a6 13.Sc3 S:d4 14.h:g6 f:g6 15.g4 Dc6 vodi u “divqe” pozicije (Gri{~uk – Mame|arov, Moskva, 2010, remi. 10...Td8 11.Sb5 Dd7 12.d5 Se5?!N

Sumwiva novost! [ta je to toliko zabrinulo “[akija” „ da ga natera da odstupi od uobi~ajenog (i dobrog) nastavka (12...a6) kojeg je nedavno odigrao? 13.Dc2! Anand je spreman i odmah rewaguje. Beli dobija pe{aka a sad crni treba da dokazuje kompenzaciju za “`rtvovani” material. 13...c6 14.S:a7 A i {ta bi drugo? Uzmicawe skaka~em!!? 14...T:a715.L:b6Ta816.Se2?! Anand bira najsigurniji nastavak koji je po mom mi{qewu suvi{e optimisti~ki. Mogao je da igra mnogo agresivnije:16.f4 Sg4 17.Sf3 Te8 18.h3 Sf6 19.Se5 Dd6 20.d:c6 Db4 21.Lc4! D:b6 22.L:f7+ Kf8 23.Dc4 e6 24.c7 i beli ima dobitni{ki napad. 16...Te8 17.Sc3 Dd6 18.Le3 Ld7 19.d:c6 D:c6 20.Lb5 De6 21.L:d7S:d722.Db3D:b323.a:b3 Mada je Anandova skromna igra umawila wegovu prednost, u drugu ruku, postigao je laku zavr{nicu koju bi mogao da igra i “naslepo”. 23...Se524.Sd5Tac8Istina je da je vi{ak pe{aka belog udvojen ali, kao {to moj mentor, Najxel [ort, ima obi~aj da ka`e: - Pe{ak je pe{ak! 25.Td2 e6 26.Sb6 Tcd8 27.Thd1T:d228.T:d2f529.Sc4 f:e4?! 30.f:e4?! 30.Sd6 je mogao da zape~ati sudbinu crnom. 30...Tf8 31.h3 Tf1+ 32.Kc2 Sc6 33.Td1 Tf7 34.Td6 Te7 35.Lc5 Anand zapo~iwe dominatni plan u centru uprkos preduzimqivoj odbrani Mame|arova.

35...Tf7?! Ovo olak{ava Anandu posao. 35...Tc7 bilo je naizgled otpornije {to ~ini e6-pe{aka “otrovnim”: 36.T:e6?? Kf7 37.Td6 Lf8 i sad bi beli bio taj koji nastoji da remizira! 36.T:e6Ld4?? Velika gre{ka i sada je definitovno gotovo. 37.T:c6! Tf2+ 38.Kd3 b:c6 39.L:d4 T:g2 40.Se5 Tg3+ 41.Kc4 T:h3 42.S:c6 h5 43.b4 I pe{ak }e “snagom vlastite voqe” postati dama. 1:0

Mame|arov–Anand 1.d4 Sf6 2.c4 e6 3.Sf3 d5 4.Sc3Le7Odbijeni Damin gambit! Jedna od najsolidnijih varijanti protiv 1.d4. Pitamo se kakva }e biti [akijeva reakcija. Wemu je potrebna pobeda… 5.Lf4 0–0 6.e3 Sbd7 7.g4!?N Ovaj agresivan potez je poku{aj Mame|arova iz “arome” nekih drugih partija. Na primer, ako se ne varam, protiv Ponomarjova. Ovaj “bo~ni napad” nam je poznat zahvaquju}i super-velemajstorima i ma{inama! 7...d:c4Potez 7...c5!? bi bio u duhu poznatog principa: - odgovor na bo~ni napad treba potra`iti kontr-igrom u centru. 8.L:c4 c5 9.g5 Sh5 10.Le5 a6 Pohlepno 10...L:g5 je mogu}e ali to je test ma{ine ne i svetskog {ampiona! 11.Ld3 (11.d:c5) 11...g6 12.h4 S:e513.d:e5Beli arsenal se fokusira na crnog kraqa, me|utim, nedostatak koordinacije i dobro postavqeni skaka~ na h5 ometa napad beloga za nekoliko poteza. U me|uvremenu, belim ima jaku inicijativu zahvaquju}i strate{koj prednosti: par lovaca i boqa pe{a~ka struktura. 13...b5 14.Sh2? Mame|arov igra na pobedu bez obzira na cenu. Na wegovu nesre}u, prekoputa je bio Anand. 14...Ta7!Maestralno odigrano! Crni ula`e u svoje trupe najve{u umetni~ku vrednost. 15.De2 c4! Ovim potezom forsirano osvaja pe{aka. 16.Lc2 Da5 17.0–0 b4 18.Se4 D:e5 19.Sg4 Dc7 20.Tad1 a5?! (20...Ld7 21.Td4 Lb5 je bilo mnogo preciznije.) 21.Td4La622.Tfd1c323.Ld3 L:d324.T4:d3?!Pretpostavqam da se Mame|arov jo{ uvek nadao nekoj gre{ci Ananda, ina~e bi ovog lovca uzeo damom. 24...Dc4 25.Sef6+ L:f6 26.g:f6 Dc5? Najzad dolazi! Anand ~ini neiznu|enu gre{ku zahvaquju}i opasnoj inicijativi belog. Ne smemo da zaboravimo i da sat sve vreme kuca tika-taka… 27.b:c3 b:c3 28.Td8? Mame|arov je mogao da uzme opasnog c3pe{aka i konsoliduje poziciju zauzimawem c i d linije. 28.Tc1 Db5 29.Tc:c3 Db8 30.Dd1. 28...h6Anand reaguje obazrivo... 29.T:f8+D:f830.Dc4

30...Db4! Odjednom se tabla okrenula naopako. Vi{i ne daje vi{e {ansu [akiju za povratak u igru. 31.Dc8+ Kh7 32.f3 Db7 33.Df8? Mame|rov preti matom. 33...Ta8 34.D:h6+ Kg8 Pra{ina se slegla a c-pe{ak }e trijumfovati. 35.Se5 S:f6 (35...c2 je bilo br`e) 36.Df4 Sd5 37.Dd4 Db2 38.Sd3 De2 39.Te1 D:f3 40.h5 Spektakularna partija u kojoj smo u`ivali u wenom dramati~nom toku! 0:1 Komentar:E. Moradiabadi Pripremio:B. Dankovi}


c m y

sport

dnevnik

sreda9.novembar2011.

21

SPENSOVAFUDBALSKALIGAMALIH[AMPIONA Godi{te:2002. Prof.Bolesnikov-^emps075:0 Strelci:Nemet,Isakovski,VelkovskiiDervi{idva. Prof. Bolesnikov: Tajzan, Batos, Gruji}, Novevski, Nemet, Dervi{i, Isakovski, Vuruna, Velkovski, Stojkov. ^emps 07: Sapovalov,Papara,Muratovi}, Akin, Zeki}, Petrovi}, Pilipovi}, Popovi}, Vuleti}, Borovnica, \ur|ev.

Godi{te:2002. Junior–Fru{kogorac5:0 Strelci:[evo,Mileti},Popovi}i Vrceqdva. Junior:Batini},[evo,Vrceq,Radakovi},Mileti},Lovre,Popovi},Cvjeti~anin,Car,Kapicl,Novakovi},Kolunxi}iCeka. Fru{kogorac:Markov,Samac,Savanovi}, Gra~anin, Trnini}, Majstorovi},Sunajko,An~i},Kru{i},Aleksi}, Radusin, Milovanovi}, Cviji}, Bukvi},Peceq,Teofilovi}. Stari grad: Mila{inovi}, Kisi}, Ajder, Laki}, Stevanovi}, [trbac, Radanovi}, Popovi}, Bawac, ]orovi},Simi},Horvat. ^emps 07: Raki}, Maruna, Stevi}, Rodi}, Agi}, Sekulovi}, Xari}, Filip ov i}, Pap, Kap icl, Alimp i}, Dra`i},Nestorovi},Laki}.

Godi{te:2002. FKS.Mihajlovi}–FKPetarPua~a 3:2 Strelci:Popovi}trigola(S.Mihajlovi}),LulexijaiMati}(Petar Pua~a). FK S. Mihajlovi}: Ili}, Kolari}, Suba{i}, Rosi}, Santovac, Popovi},Vasiqevi},Domazetovi},Negovanovi}. FK Petar Pua~a: Kvo~ka, Rakovac, Lulexija, ^avi}, Trivunovi}, Gomirac,Mati},Urukalo,Rondovi}, @ivkovi}.

Vukovi},Svrkota,Nenezi},Radulovi}, Bukvi}, O.Svrkota , Subanovi}, Gre~, Radusin,Deli}.

Godi{te:2000. Bistrica05–Vojvodina0:5 Strelci: Jakovqev, Rube`i}, Jankovi}iJov{i}dvagola. Bistrica 05: Bogovac,Erdevik,Kop~anski, Masnec, Miji}, Rada{inovi}, [mawa, Ivanovi}, Vu~kovi}, Backovi},Damjanovi},Ivani},Luki},Sekuli},Jakovqevi}. Vojvodina: Vu~kovi},Cari},Jakovqevi}, ^uli}, Rube`i}, Jov{i}, Kova~evi},Pu{ki},Sredojevi},Jankovi},Vje{tica,Dimitrijevi},]oso,Maleti}.

In deks: Kop arn ic a, Dor ont i}, Varga,Pupin,Bo{kan,Lalovi},Toman ov i}, Vuk a{ in ov i}, Pav lov i}, Novakovi},Majer,Dolinaj,Nedi}. [K Sportlend :Desnica,Catovi}, Rad ojk ov i}, @ivk ov i}, Petk ov i}, ]or ov i}, [iqk ut, Mil in ov i}, Trifk an ov i}, Vuj i}, Blag oj ev i}, Stojanovi},Baj~eti},Simi},Burka, Kosti}.

Godi{te:2000. [KVojvodinaRMR–Junior3:0 Strelci:Marcili}iPoqakdva. [K Vojvodina RMR: Gavrilovi}, Pe{evi},Zeqko,Nenezi},Kolar,Milutinovi},Poqak,Savi}V,@ivkovi},

Godi{te:2000.

Godi{te:2002. Indeks–Bistrica051:2 Strelci:Vesovi}(Indeks),]ur~inMileta{ki(Bistrica05). Indeks: Pankov, Vesovi}, Savi}, Jerkovi},Ecet,Ke{eq,Jovanovi},Anki},Rati},Mikovi},Aleksi},Vidakovi},Lalovi}. Bistrica 05: @ivi}, Baji}, Zec, Smie{ko, Stankovi}, Pantovi}, ]ur~in-Mileta{ki, Milosavi}, Popovi}, Vuleti},Stan~evi},[krbi}.

[F Dejan Kurixa :[i{qagi},Grabe`, \ur|evi}, Luki}, Zamaklar, Mo}an,Nudi},Luki},Todi},Martinovi}, Vu~kovi}, Strani}, Kulpinac, Ra{i}, Dobromirov.

Godi{te:2002. Starigrad–^emps077:0 Strelci: Kisi}, Popadi}, Simi} i ]orovi}iBawacdva.

Futog–[KBrazilskislonovi6:1 Strelci: Popadi}, [evi}, Saravolac, Kr~mar, Ili} dva (Futog), Vuliz (Brazilskislonovi). Futog: Obradovi}, Rajak, Spasojevi}, Trifunovi}, Popadi}, Jeli~i}, [umar,[evi},Ili},Saravolac,U~ur, Kr~mari[piri}. [K Brazilski slonovi: Majki} M, Pavlov, Majki} S, Surutka, ]ulibrk, Popovi}, Bulatovi}, Matijevi}, Vulin, Gali}, Gojkov, Strani}, Rodi}, Markovi},Navratil.

Godi{te:2002. Futog–[KVojvodinaRMR0:3 Strelci:Buli}iRa|enovi}dva. Futog: Todori}A,Radosavi},Jazi}, Marti},Savi},Trifunovi},BencunS, Nikola{, Prtija, Bencun N, Sekuli}, Rokvi},Vuli},Todori}M,\uki},Trkuqa. [K Vojvodina RMR:Ra|enovi},Samarxija, Gavrani}, Radmilovi}, Verner, Zagre|a, Vargec, Buli}, Umi}evi}.

Godi{te:2000. FKPetarPua~a–VeternikВiskol 2:1 Strelci:Kne`evi}iTomi}(P.Pua~a),Jovanovi}(Veternik). FK Petar Pua~a: Toroman, Raki}, Lovri},Kne`evi},Tomi},Stankovi}J,Jovanovi},Stankovi}N,Ga~evi},Marjanovi}. Veternik Viskol:Jovan~evi},^ukovi},Dedi},Mati},Stanojevi},Mili}, Samarxi}, Jovanovi}, Popovi}, Suba{i}, [a{i}, Vu~kovi}, Malba{i}, [api},Radosavqevi},Joveti}.

Godi{te:2002. VeternikViskol– [FDejanKuriya1:3 Strelci: Veselinovi} (Veternik Viskol), Todi}, Strani} i Kulpinac ([FDejanKurixa) Veternik Viskol:Laki},Radakovi}, Veselinovi},Risti},Barbulovi},Nini}, Jov~i}, Ma~ki}, Zeli}, Raj~evi}, Dupor, Dudukovi}, Pekez, [api}, Popov,Popovi}.

Godi{te:2000. Indeks–[KSportlend2:5 Strelci:VargaiBo{kan(Indeks), Desnica,Vuji}iStojanovi}podvagola (SKSportlend).

Godi{te:2000. ^emps07–Petli}(Zrewanin)1:6 Strelci: Qubojevi} (^emps), Joki}, Ivanov, Ra{eti} dva gola, Bir~anin dvagola(Petli}). ^emps 07: Despotovi}, Qubojevi}, Radi},Mati},Jovi~in,Radovanov,Po~ek,Kova~evi},Svilarkovi},Jovi~i}, Golubovi},Nadla~ki,\eki}. Petli}: Joki}, Ra{eti} B, Ra{eti} S,Miqevi},Bala},Ivanov,Vlahovi}, Ergexija, Mi}ovi}, Simovi~, Bir~anin,Stojanovi},Svjetlica.

Godi{te:2000. KrilaKrajine–Fru{kogorac9:1 Strelci:  Prodanovi}, Budisavqevi}, Dragi~evi}, Karanovi}, Mari} i Gluvi} svi po dva (Krila Krajine), Gre~(Fru{kogorac). Krila Krajine:Karanovi},Dra`i}, Prodanovi}, Budisavqevi}, Obri}, Dragi~evi}, Mari}, Vejnovi}, Drobwak,Bubawa,Gluvi}. Fru{kogorac: Manojlovi}, ]osi}, Polovina, Papi}, Varga, Abazovski,

Savi} D, Babi}, Kova~, Ili}, Marcili},Koji~i}. Junior:Car,Babi},Brki},Popovi}, Reqi}, Erceg, [evo, Urbanek, Varinac,Mikuli},Grgurevi},Maksimovi}, Radakovi},Stankovi}.

Godi{te:2000. Slavija–Prof.Bolesnikov4:1 Strelci:  Murseli, Milo{evi} i Tomov dva gola (Slavija) i Talo (Prof.Bolesnikov). Slavija: Markovi}, Murseli, Milo{ev,Gvozdeni},Bobinac,Jo~i},Milo{evi}, Panti}, Kra~ak, Marho{evi}, Bla{~anin,Tomov. Prof. Bolesnikov: Laho{, Tomi}, Gal, Talo, Erakovi}, Drini}, Miqu{, Tasi}, Dardi}, Galin, Stankovi}, Ru`u~ka,Jeli~i},Isakovski.


22

kULTURA

sreda9.novembar2011.­

dnevnik

СУТРАСЕУМСУВОТВАРА40.НОВОСАДСКИ САЛОН

Јубиларнаизложба слика,филма, стрипа... Традиционална изложба Новосадског салона, коју организује Новосадски отворени универзитет,биће отворена од 10. новембра до 5. децембра у Музеју савремене уметности Војводине. На овом јубиларном 40. Новосадскомсалонубићепредстављени радови уметница и уметника реализовани у различитим медијима, међу којима су: слика, цртеж, инсталација, видео-инсталација, филм, фотографија, стрип и дигитални медији, као и друштвеноуметничке акције и пројекти уметничкихгрупаиасоцијација. На изложби 40. Новосадског салона учествују: Александар Димитријевић, Андреа Ивановић Јакшић, Бојана Кнежевић,Андреа Палашти,Зоран Тодоро-

вић,МилошВујановић,„TurboComix– Krekhaus“, „Фанзин цегер“, Игор Хофбауер иСилардАнтал.Новосадскисалонћесвечанобитиотворенсутра у19 часова у Музеју савремене уметности Војводине, и током отварања „Фанзин Цегер“и„Фијукмрежа“извешћеакцијуситоштампестрипмотиванаодевне предметегостију. Осим изложбе, предвиђено је још програманаовогодишњемСалону. Биће уприличена дечја радионица “Предграфичке и графичке технике” коју ће водити графичар Драган Јајић (14. новембра).Пројекцијафилмова јепланирана18.новембра.Тадаћебитиприказан Избор анимираних филмова, у режији Мирослава Јовића,“Аt Home”,

Разуђеникарактерсавременесцене СаветНовосадскогсалона(ИванКарлаварис,ДрагославВишекруна,Мирјана Благојев,ЛидијаСреботњакПришић,НиколаМацура,ГоранДеспотовскиипредседникСаветаДанилоВуксановић)позваојеисторичаркууметностиСањуКојић Младенов,даначиниадекватанизбор(безлокалнихсужавања)умноштвупојављивањасавременеуметничкесцене.СањаКојићМладенов,кураторка-селекторка40.Новосадскогсалона,направилајеизбор„којиодговараразуђеномкарактерусавременеуметничкесцене“.

БојанаКнежевић,Lookatyou

кратки играни филм у режији Ненада Микалачког, и“Life”,краткифилм урежији Силарда Антала. Хибрид медиа камп организује “Радионицу локативноггејминга”,коју водеИсидораТодоровић,уметница,и Лука Ранисављевић, програмер (25. но-

вембра). Промоција каталога, додела Велике награде Новосадског салона и панелдискусија “Уметничкапродукција у контексту савремене праксе” најављенајеза2.децембар. Удискусијиће учествовати Центар за графику, УА из ЗрењанинаичлановиСаветаНовосад-

скогсалона.МодераторћебитиДанило Вуксановић. Селекторка СањаКојићМладеновће одржати два стручна вођења кроз изложбу 22.и 29.новембра,када ће уприличити разговор са уметницима -учесницима. Н.Пејчић

ПРЕМИЈЕРА„DOGSANDDRUGS”УПОЗОРИШТУ„КОСТОЛАЊИДЕЖЕ”

ПОЗОРИШНЕПРЕМИЈЕРЕ

Породичнапредстава

Ах,таромантика свакодневног

У Позоришту „Костолањи Деже“ уСуботици,ипореднедавно одржаногшоукејспрограма,нова сезона практично почиње тек вечерас, у 19.30 часова, када је на репертоарупрваовогодишњапре-

нијелицемерно.Истинито,јернијелаж...Каокаментврдтеатарза старије тинејџере, за њихове родитеље,занекебудућеродитеље; или,какосекаженаједномместу упредстави:немапардона!“.

мијера, представа „Dogs and Drugs“. Режију представе потписујеАндрашУрбан,алидотогаје дошло крозсарадњусатриредитеља Јеленом Богавац, Золтаном Пушкашом, Ференцом Петером. Они су, појединачно, били задуженизатриповезане,актуелнеи контроверзне теме – дрога, насиље, сексуална дискриминација. Такозвани тизер гласи овако: „Разбити окове, разбити правила реализмаиисторицизмазараднеке нове стварности. Забавно, јер

На конференцији за новинаре одржаној у „Костолањи Деже“ поводом премијере Андраш Урбан је изјавио како најновија представаупозориштукојеводи иукојемрежиранијенаучно,социолошкопредавање,алидасвакакоскривадеодруштвенестварности, приказ света у којем живимо. Због провокативних тема изабранихдатриразличитаредтељарадесњиманаслободанначин, оријентишући се управо премадруштвенојсварности,Ур-

банјемишљењадаће„Dogsand Drugs“ бити можда и најбитнија засредњошколскиузраст. Глумац Имре-Елек Микеш откриоједаћепредпубликомбити динамична игра која прати већ познату естетику Позоришта„КостолањиДеже“,али да, истовремено, нуди нештосасвимново,упогледу фокуса. За његовог колегу, Арпада Месароша, материјалзасвакуодцелинабиоје толико густ, да се од њега комотно могла направити целапредстава,такодаите какоимаштадасевиди. - Имам велику љубав и поштовањепрематимтемамаиљудима–кажеглумица Марта Береш, за коју је токомрадабионајинтересантнији својеврстан документаризам. – У животу свако може бити или постати део приче о дрогама, насиљу, сексуалнојдискриминацији, такодајенајбољеискључити страхопоштовање, криву слику, криво огледало, како биселакшесатимсуочили. Надамоседанашапублика кућипонети осећајолакшања,да имтестваривишенећебитикаменужелуцу. Андраш Урбан потписао је и сценографију,апоредпоменутих глумаца,упредставијошиграју: Кинга Мезеи, Габор Месарош, ЗолтанПлетл. Драматургјебила КорнелијаГоли,амузикујекомпоноваоАтилаАнтал. Вечерашња премијера део је обележавања 17. рођендана Позоришта„КостолањиДеже“. И.Б.

ГОСТОВАЊЕЈОЖЕФА НАЂА С КОМАДОМ „ШО-БО-ГЕН-ЗО”

Тридесето извођење у Лајпцигу Комад „Шо-бо-ген-зо„Јожефа Нађа, који је премијерно изведен пре три године у Кањижи,тридесето извођење имаће на фестивалу „Позориште младог света„ у немачком граду Лајпцигу данас и сутра, док ће се 6.децембра наћи на сцени у француском граду Каора. Партнери Нађа у овој успешној представи су плесачица Сесил Лоаје и музичари Жоел Лендр и Акош Селевењи. После премијерне промоције књиге театролога Милана Мађарева „Театар покрета Јожефа Нађа„на овогодишњем Битефу,азатимиуНовомСаду,Регионални креативни атаље „Јожеф Нађ„у Кањижи промоцију приређује у петак, 11.новембра, у 19сати, у малој сали Дома уметности. Књигу ће представити у име издавача Позоришног музеја Војводине уредница издања Ивана Кочи, позоришни критичар Владимир Компицл, директор РКА „Јожеф Нађ„ Золтан Бичкеи, уметник Мирослав Јованчић из Суботице и аутор Мађарев. На промоцији ће бити емитовани инсерти из представа Јожефа Нађа,а у музичком делу програма наступиће музички дуо Мирослав Јованчић (виолина) и Зоран Дукић (гитара). М.Митровић

Сесил Лоаје и Јожеф Нађ у комаду „Шо-бо-ген-зо”

ТенаШтивичић,Немо’ш побећ‘однедеље,режијаСлађанаКилибарда, Народнопозориште„ТошаЈовановић“Зрењанин И кад год прође поред излога, она не може одолети да се не огледауњему.Аон,онјеправа свиња! Е, у драми Тене Штивичић тај излог и та свиња, играју улогунедеље,данакадјеБогвидеодаједобро,пасеодморио,а ТенаШтивичићуњеговомодсуству олучила да се запита над судбином оних које је створио – мушкарца и жене. Првенствено, о њиховој упућености једно на друго на прагу зрелог доба,јерне,тунетреба говорити о љубави. Љубави у свету „Не мо’ш побећ’од недеље“ нема, односноима,самоакосе успешно савладају игре безграница -имиџ,секс, пријатељи, новац, деца, и остале препреке које претходе циљу слатке брачне еутаназије. Дакле, играчи су Она и Он у формули романтичнекомедијезаоштренепроблематикомкојау стварности лако заврши у трагедији или неком отужном реализму Ње каоробота савиклерима укосиикутлачому руци,аЊега са новинама у једној и даљинскимудругојруци.Нанивоуинтроспекције луцидан, трејнспотерскитекстТенеШтивичић (видиседајеречоранимрадовима хрватске списатељице), вицкаст на нивоу стенд-апа (у драми се ликовиобраћајупублици/читаоцима, сами себи и једни другима),клишеизирансамимизбором тема и драматуршких мотива, Слађана Килибарда, која поред

режије потписује и „тотал дизајн“ (превод, адаптацију, сценографију,костимографију...)представе у зрењанинском Народном позоришту,насценигачинимаксималнодинамичним,јапијевски модерним,штододатноубрзаваи чини урнебеснијом позицију у којој ликови немају куд, не могу дасесаберу.

говогделасобе/позорнице,ачак ионекојечине„спољне“зидове, докрајаћесеподићи,ањихдвоје,башкаонапочетку,нећеиматикудједнооддругог,иодсамих себе.Времеизмеђу,уогољеноји огољавајућој поставци, млади глумцисасвимдоброиспуњавају константном акцијом и присуствомнеувекједноставнимзбог

Једну просечну жену (Она) играСањаРадишић,ањеногтако привлачног опозита, једног просечног мушкарца, је л’, тумачи ДејанКарлечик (Он).Устандардизованој подели улога између Ње и Њега, Она полако, али сигурно, постаје женка-резонерка, аОннадуванимужјак,чијаћесигурностипакишчилетипредналетом њеног, како то мушкарци најчешћевиде,безобразногшарма.РолетнекоједелеЊенодЊе-

интимизирања и дистанце које захтевају промене саме форме, ритмаизадатих радњи.Одстана, преко џогинга, кревета, улице, посла, до дискотеке и станице, њих двоје суверено владају сценамаиликовима,слакоћомизазивајући симпатије, разумевање и одобравање, чак и онда кад је садржај оно што нас буди, а не само ушушкава. Кад нам потказује и како смо, а не само какви смо. ИгорБурић

НОВАПОЗОРИШНАСЦЕНАУБЕОГРАДУ

„ПансионБекет” отвара Пароброд театар -НовакамернасценаПаробродтеатарбићеотворена у суботу 12. новембра премијерним извођењем представе„ПансионБекет”урежијиСтеванаБодроже,најавилисуорганизатори.ДиректоркаУКПароброд Милена Рајковић рекла је на конференцији за новинаре да је нова позоришна сцена са 32 места у гледалишту, специфичан простор намењен неафирмисаним уметницима и извођењу комада који нису привлачни позориштима окренутим комерцијалним садржајима.РедитељСтеванБодрожарекаоједазбог недостаткановцаукултури,управепозориштауглавномпредностдајусигурнимрепертоарскимпотезима иведримкомадима,како бипривукливишепублике ибарвратилионоштојеуложено. „Верујемдапостојипубликазадубокеикомплекснедрамскесадржајекојесамотребапонудитиуквалитетномоблику”,рекаојеБодрожаидодаодајеновисценскипросторпогоданзаизвођењекомадакоји

наилазе на подозрење у институционалним позориштима. БодрожајерекаодапредставарађенапоБекетовим драмским текстовима у фокусу има актуелне теме самоћу, отуђеност, тугу, празнину, очај, осећања која судеосвакодневице,окојимајемогућедиректноговорити,јерљудитакосхватајуданисусами.ОнјерекаодакраткеБекетоведрамедосадауглавномнису билеизвођене,осимједногодтихтекстова(Неја)којије‘80.бионасцениПозориштановеосећајностиу извођењуСоњеСавићиурежијиЕгонаСавина. Представа„ПансионБекет”састојисеоднеколико Бекетовихмонодрамскихминијатураудраматизацији Тамаре Бијелић, а улоге тумаче Вања Ејдус, Тамара Крцуновић и Милица Стефановић. Представа се састоји од Бекетових кратких драма „Дођи-пођи”, „Не ја”,„Кораци”,„Љуљашка”,каоиделовапесама„Како рећи”иНештотамо”.


kultura

c m y

dnevnik

sreda9.novembar2011.

23 Фото: Н.Стојановић

ОБЈАВЉЕНАНОВААНТОЛОГИЈАХИСПАНОАМЕРИЧКЕПРИЧЕ20.ВЕКА

Најсвеобухватнијаслика плоднекњижевности

Издавачкакућа„Танеси“изБеограда ових дана објавила је у својојбиблиотеци„Светскакњижевност“првитомновеАнтологије хиспано америчке приче 20. века снасловом„Вечитасмртод љубави јача“ (како гласи и назив приче Габријела Гарсије Маркеса),којејеодабрала иприредилаБојанаКовачевић-Петровић. У овом првом тому заступљенисуаутори:Леополдо Лугонес (Баба Јулија), Орасио Кирога (Низводу),РомулоГаљегос (Стари клавир), АлфонсоРејес(Вечера),Сесар Ваљехо (Пут око будућности), Мигел Анхел Астуријас (Гватемала), МануелРохас (Чашамлека), Хорхе Луис Борхес (Tlen, ukbar, orbis tertius), Фелисберто Ернандес (Крокодил), Силвина Окампо (Леполдинини снови),АлехоКарпентјер (Пут ка семену), Артуро УсларПјетри(Киша),Сиро Алегрија (Калисто Гармендија),ХуанКарлос Онети (Добродошао, Бобе),ХуанБош(Газде),ХосеЛесама Лима (Љубичасто двориште), Мануел Мухика Лајнес (Уметник), Марио Монтефорте Толедо (Солдатуша),ХулиоКортасар(Запис у бележници), Адолфо Бјој Касарес (Успомена на Паулину), Аугусто Роа Бастос (Приватни пријем), Хуан Рулфо (Анаклето моронес), Хуан Хосе Ареола

(Оглас), Марио Бенедети (Кућа Ириарте), и Габријел Гарсија Маркес (Вечита смрт од љубави јача). Подсећајући на досад објављене изборе латиноамеричке приповедачке књижевности, Бо-

јана Ковачевић-Петровић је у предговору напоменула да је у 20.векустваралоготовостотину писаца чије би се приче могле сматрати антологијским, те су неки,безобзиранакритеријуме, морали бити изостављени. Али, издавач „Танеси“ је одлучио да објавиовуантологијуудватома, итимечитаоцимапружи,поре-

чима Бојане Ковачевић-Петровић, најсвеобухватнију слику о плодној приповедној књижевноститогконтинента. -Шириизбор,којијеобухватао све значајне приповедаче с територије Хиспанске Америке, сведенјена50писацакојисусеквалитетом приче, значајем опуса и субјективним параметрима приређивача уклопили у концепцију Антологије.Заразликуодвећине антологијаукојимајеприбегавано територијалном груписању аутора, приређивач се овог пута одлучиозахронолошкиредослед премагодинамарођењаписаца,с идејом да први том обухвати краткепричеиприповеткебезмалоцелог20.века,докбиокосница другог, поред познатих имена хиспаноамеричке књижевности, били и нови, млађи аутори, још увек непознати нашој читалачкој публици, али већ афирмисани и награђиванинахиспанскомкњижевномтлу–напомињеупредговоруБојанаКовачевић-Петровић, додајућидајеоваантологијанамењена најширем кругу читалаца, али и хиспанистима, будући да је опремљена насловима изворника, детаљним библиографскимподацимаиизборомлитературе. Кратакпрегледиосвртнахиспаноамеричку књижевност 20. века, као и стваралаштво њених најизразитијихпредставника, Бојана Ковачевић-Петровић даје у поговоруовекњиге,укојојсуобјављене и кратке биографије писаца. Н. Пејчић

ИЗЛОЖБАРАДОВАПРОФЕСОРАИСТУДЕНАТААКАДЕМИЈЕУМЕТНОСТИ УНОВОМСАДУ

Креативни судар различитих форми Изложба радова професора и студената Академије уметности у Новом Саду,под називом “Разлике”, отворена је прексиноћ у Савременој галерији Зрењанина, и трајаће до 1. децембра. Пројекат “Разлике”настао је2005. у тежњи да окупи професоре и студенте новосадске Академије да заједно истражују области социјалне,економске, културне и политичке вредности “разлика”. Овај својеврсни уметнички пројекат, отворен је за креативни судар различитих и другачијих уметничких,друштвених,социјалних и политичких форми изражавања. - Основа се заснива на идејном концепту Микеланђела Пистолета, дефинисаног текстом “ProgettoArte”из 1994.и пројектом “Волети разлике” из 2003. године. Реализација пројекта се одвија на годишњем нивоу, активно кроз дискусије, обиласке одређених дестинација и изложбе ангажованих професора и студената. Сви учесници се могу изразити кроз излагачке и теоретске садржаје, који обухватају савремену уметничку праксу – појашњава аутор пројекта “Разлике”Горан Деспотовски. Принципи ове уметничке идеје су: направити искорак из

оквира класичних медија, занемарити круту академску поделу ликовних дисциплина и створити интердисциплинарну и експерименталну акцију код учесника. Уједно, она тежи да артикулише и подстакне очување разлика.

стварасеамбијент који кроз анализу,дијалогеи креативнесадржајеелиминише дистанце и подстиче истицање разлика –наглашава Деспотовски. Значај пројекта потврђују и институцијекојесу га подржале у претходном периоду. До сада

КЦНСИДЕУСУСРЕТНОВОСАДСКОМЏЕЗФЕСТИВАЛУ

Концерти,радионице, изложбе Концертом Лене Ковачевић и њеног бенда, синоћ је у Културном центру Новог Сада почео програм „У сусрет Новосадском џезфестивалу“којићетрајатидо 16.новембра,кадајезаказанозванично отварање популарне манифестације. Клуб „Трибина младих“ ће вечерас у 20 часова удомитииНСБигбенд,асатпреконцерта заказано је отварање изложбе„Џезплакат“студенатаВисо-

кетехничкешколеу Новом Саду. Завикендћебитигусто,јерће вечерњеконцерте,аочекујусенаступи „Сити рејн вокер“ Игора Молнара и излетнички џем сешн у „Фокстроту“, програмски да обогатирадионицаФеренциМагнусМелквартета,којаћесвојузавршнупрезентацијуиматиунедељу. Ференц и Магнус Мел квартет наступаупонедељак,аодуторка

прекоданапочињевокалнарадионицаЈеленеЈововић-Ревишин.У вечерњем термину у КЦНС концерт ће одржaти састав „Воја Би 3“. Каоликовнаувертиразаглавни деопрограмаНовосадскогџезфестивала, у Галерији „Нова“ Српскогнародногпозориштаодуторка,15.новембра,бићепостављена изложба„Паковањемузике“ЗоранаЈањетова. И. Б.

НАРЕПЕРТОАРУБИОСКОПА„АРЕНАСИНЕПЛЕКС”

Триновафилма Трифилмакојајепубликаимала у пентхаусу украо њихову пензију, приликедавидинапротеклојреви- сковаће невероватан план –отеће од ји„Синеманија“одсутрасунаре- њега оно што им и припада. Талендовномрепертоаруновосадскогби- тована екипа глумаца унапредила је оскопа„Аренасинемплекс“. сценарио с повременим импровизаРадња филма „Аноминум“којије цијама,а њихов сјајан однос ван карежирао Роланд Емерик смештена мера преточио се у исти такав и на је у политички узбуркану елизабе- филму. Поред Бен Стилера и Еди танску Енглескуи бави се питањем Марфија,уфилмуиграјујошиМекоје вековима заокупља највеће умове света. Још од Марка Твена и Чарлса Дикенса, преко Хенрија Џејмса и Сигмунда Фројда,поставља се питање ко је аутор драма које потписује Вилијем Шекспир. Стручњаци су расправљали,о томе су писане бројне књиге, а научници су посвећивали своје животе како би доказали или оспорили тезу о томе ко је највеће име енглеске књижевности.„Анонимус“ даје један од могућих одговора, фокусирајући се на време препуно политичких интрига, тајних романси на двору,племића гладних моћи,које је јавно излагано на најневероватнијем месту: лондонској по- Ванеса Редгрејв у филму „Анонимус” зорници.Улоге тумаче измеђуоста- тју Бродерик, Теа Леони, Габори лих Рис Ифанс, Ванеса Редгрејв и Сидибе,КејсиАфлек,АленАлдаи Себастијан Ерместо. многидруги. Удругомфилму “Пљачка с врха“ Одсутрајенарепертоаруинови Бен Стилер и Еди Марфи предводе филм Вудија Алена ’’Поноћ у Пасјајну глумачку екипу у комедији о ризу’’, романтична комедија о повредним и поштеним радницима родици која због посла одлази у који желе да се освете преваранту Париз и двоје младих који треба да са Вол Стрита. Када запослени у се венчају на јесен и о њиховим луксузној згради у Централ парку искуствима која ће им променити открију да је милијардер који живи животе.

Главни јунак Гил је холивудски сценариста који машта да напусти Холивуд и постане озбиљан писац. Заљубљује у Париз и жели да се пресели у њега после свадбе,али Инес, његова вереница,не дели његово мишељње.У својим ноћним лутањима романтичним улицама Гил сусреће главне актере париског златног доба

из 20-их година прошлог века.С Хемингвејем и Фицџералдом обилази култна места,а дружи се и са Пикасом,Далијем и њиховим љубавницама и музама...Гил открива право срце велеграда и непресушни извор инспирације за писање,али је све даљи од жене коју треба да ожени...У филму глуме Овен Вилсон, Рејчел МекАдамс, Маријон Котијар, Кети Бејтс,Карла Бруни и други.

ПОЗИВМУЗИЧАРИМАСЕКС-ЈУПРОСТОРА - Значај овога заснива се на својеврсном сједињавању свих уметничких области - категорија, учествовању сва три департмана Академије уметности и њиховој међусобној интеракцији.Пројекат на тај начин тежи да обухвати и допуни едукативне елементе потребне за развој стваралачке способности. Кроз период његове реализације,

је,наиме,реализован у сарадњи са Музејом савремене уметности Војводине, Српским народним позориштем,“Новкабелом”, Галеријом “Подрум”, Студентским културним центром Нови Сад,Универзитетском библиотеком “Светозар Марковић” Београд, Савременом галеријом Зрењанин и другима. Ж. Балабан

НАЈЗНАЧАЈНИЈЕПРИЗНАЊЕЗАМУЗИЧКОСТВАРАЛАШТВО

Срђану Хофману награда „Мокрањац” Композитору Срђану Хофману додељена је награда „Мокрањац„ за дело „Гледајући у Огледала Аниша Капура„,за две харфе и процесоре звука,саопштило је Удружења композитора Србије. Жири,који су чинили композитори Ивана Стефановић, Александра Вребалов, Милан Михајловић и Милош Заткалик и музиколог Соња Маринковић,једногласно је одлучио да награда припадне Хофману.

Награда „Мокрањац„је најзначајније признање за музичко стваралаштво у Србији,које се,под покровитељством Министарства културе,додељује за најбоље премијерно изведено дело српског аутора у претходној години. СрђанХофманрођенје1944.уГлини.Студијекомпозиције завршио je1968. у Београду, где је потом и магистрирао.БиоједеканФМУдо1998.Унашумузикууводиразличитепојавеевропскеавангарде.

Aудицијаза „Oркестaрбезграница” „Оркестар без граница“(NoBordersOrchestra-NBO) отворио је позив за све професионалне музичаре с ексЈу простора, да се пријаве на аудиције и учествују у стварању регионалног симфонијског оркестра који ће иматиоко65чланова. АудицијећесеудецембруовегодинеодржатиуБеограду,Љубљани,НовомСаду (3.децембра),Подгорици,Приштини,Сарајеву,СкопљуиЗагребу.Позивзаучешћенааудицијамаотворенједо15. новембра Свеинформацијеувезисапријавомдоступнесунасајтуwww.nobordersorchestra.org Како подсећају у Музичкој омладини Новог Сада, једнојодинституцијакојајепосредноукљученауовај пројекат, идеја „Оркестра без граница“ је да окупи врхунске професионалце отворене за уметничку,личну и међукултурну размену,који желе да раде заједно,и да уживају у креативним изазовима и заједничком музицирању. Оно што додатно истиче мисију овог оркестрајестеичињеницаданемастароснеграницеи да ће музичари бити бирани по својим уметничким потенцијалима. Овако формиран оркестар одржаће турнеју по главним и фестивалским градовима у региону југоисточне Европе 2012, и представљаће врхунски

регионални ансамбл који ће наредних година стајати раме уз раме са врхунским европским оркестрима.Овај оркестарима дугорочну мисију.Сваке наредне године ансамбл ће наступати с новим програмом на фестивалима у региону,као и у различитим културним центрима у престоницама западне Европе. На иницијативу уметничког директора пројекта Премила Петровића, диригента који живи у Берлину, пројекат су основале три копродуцентске куће: Удружење „Оркестар без граница“, „Југоконцерт“ установа културе специјализована за музичко-сценске пројекте,и Operadeproduction.У пројекту партнерски учествују и најзначајнији фестивали и институције са ових простора као што су „Бемус“,Фестивал Љубљана, „Сарајевска зима“, „Номус“, Музички центар Црне Горе,Хрватско друштво складатеља,„Охридско лето“, Факултет музичке уметности Скопље, КамерФест, REmusicaфестивал. Пројекат се реализује под покровитељством Европске асоцијације фестивала, а ужива подршку Европског парламента, Европске комисије, Унескоа, Jeunesses Musicales Internationales, Берлинске филхармоније,Дојчебанк... Н. П-ј.


24

svet

sreda9.novembar2011.

dnevnik

KINASEPROTIVI[IREWUNUKLEARNOGORU@JA

RUSKIGASSTIGAODOBALTIKA

Francuskaprotiv napadanaIran PARIZ, PEKING: Francuska je„veomazabrinuta”zbogpotencijalnemilitarizacijeiranskognuklearnogprograma,aliseprotivi bilo kakvom napadu na Islamsku republiku jer to mo`e da izazove nepopravqive {tete, rekao je danas ministar spoqnih poslova Alen @ipe. U isto vreme predstavnik kineskog ministarstva spoqnih poslova Hong Lei rekao

Ukoliko izve{taj IAEA, koji trebadabudeobjavqenovenedeqe, uka`edaIrangradikapaciteteza proizvodwu atomske bombe, onda }e Francuska ~vrsto podr`ati uvo|ewedodatnihsankcijaUN,rekaoje@ipe,istakav{ida}euraditisve{tomo`ekakobispre~io vojnu akciju, preneo je Rojters. Iranu su do sada zbog nuklearnog programa uvedene ~etiri runde

IranskinuklearnireaktorBu{er

je da Teheran treba da „poka`e fleksibilnostiiskrenostianga`ujeseuozbiqnojsaradwisaagencijom”,dokjeodIAEAzatra`io dabude„pravednaiobjektivna”. @ipe je izrazio zabrinutost zbog spekulacija da Izrael pripremanapadnairanskanuklearna postrojewa uo~i objavqivawa izve{taja Me|unarodne agencije za atomskuenergiju(IAEA)onuklearnimaktivnostimaTeherana.

sankcija.Me|utim,RusijaiKina, dvastalna~lanaSavetabezbednostiUN,jasnosustaviledoznawa dabinovesankcijete{kopro{le. „Mi smo veoma zabrinuti po{to je Iran pre{ao crtu. To }e ozbiqno destabilizovati region”, rekao je @ipe radiju RLT. „Francuska pozicija je ~vrsta, ukoliko treba da poja~amo sankcije, mi smo spremni”, dodao je on.Po wegovim re~ima, potrebno

SadamovWC eksponat ameri~kogmuzeja BAGDAD: Ameri~ka vojska napu{tapalatebiv{egira~kog predsednika Sadama Huseina u ratnom {tabu u Bagdadu koje }e vratitiIra~animaslede}egmeseca, me|utim Sadamov zatvorski WC odlazi sa Amerikancima.^eli~nakomodaioja~ana~eli~navrataizva|enesuiz}elijeukojojjeSadamproveoposledwedvegodine`ivotapredpogubqewe 2006. i bi}e izlo`eni u muzejuvojnepolicijeuSAD. „Nenosimoni{ta{tojepripadaloIra~anima.Nosimosamo ono{tosmomidoneli,{tosmo koristiliikadanamnijevi{e potrebno vra}amo ku}i”, ka`e potpukovnik Xeri Bruks, ameri~kivojniistori~ar. Vila u kojoj su ameri~ki vojnici izgradili maksimalno ~uvanizatvorzaSadamanalazise uokviruameri~kogkompleksau blizini bagdadskog aerodroma, poznatog kao baza „Viktori”.

Ona}ebitipredataira~kojvladi u decembru, jer se ameri~ka vojskapotpunopovla~iizIraka dokrajagodine. Okru`enazidomdugim42kilometara i bodqikavom `icom, ubazi„Viktori”,najve}ojod505 ameri~kihbazauIraku,biloje stacionirano 40.000 vojnika i 25.000 zaposlenih. Sada je tamo ostalo samo 4.000 vojnika.Od maksimalnog broja od blizu 170.000 vojnika, koliko ih je u jednom trenutku bilo u Iraku, SADihsadaima31.000u12baza. Palate u kojima se nalazila ameri~ka ratna komanda, izgra|ene po ugledu na francuski Versaj,suispra`wene,aameri~ki restorani „Burger King” i sli~ni,kojisuopslu`ivaliameri~ke vojnike, su zatvoreni. Ameri~ki zvani~nici ka`u da zasobomostavqajuubazi„Viktori”opremuuvrednostiodoko 100milionadolara. (Tanjug)

je uraditi sve kako bi se izbegla nepopravqiva {teta koju bi izazvalavojnaakcija. Iran treba da poka`e „iskrenost”i„anga`ujeseuozbiqnojsaradwi” sa Me|unarodnom agencijom za atomsku energiju (IAEA), saop{teno je ju~e u Pekingu uo~i objavqivawaizve{tajateagencije omogu}imtajnimnastojawimaTeheranadarazvijaprogramnuklearnog naoru`awa.Podaci prikupqeni od IAEA }e biti objavqeni ove nedeqe i prema izjavama diplomata odnosi}e se na nastojawe Teherana da prikupi materijal i tehnologiju za proizvodwu atomske bombe i razvoj rakete koja bi mogladajeponese. Predstavnik kineskog ministarstva spoqnih poslova Hong Lei rekao je da Teheran treba da „poka`e fleksibilnost i iskrenost i anga`uje se u ozbiqnoj saradwi sa agencijom”, dok je od IAEAzatra`iodabude„pravedna iobjektivna”. „Kinajeprotiv{irewanuklearnogoru`jaiprotivisedabilo kojazemqauregionuBliskogIstokarazvijanuklernooru`je”,rekaojeHongLeiOnjeistakaodaje „obaveznopotrebnospre~itinove potrese u pogledu bezbednosne situacije na Bliskom Istoku”, preneoAFP. Iran,komesuUjediwenenacije ~etiriputauvodilesankcijeidaqe trvdi da su wegove aktivnosti na nauklearnom planu iskqu~ivo miroqubive i odbacuje sve optu`beokoizradeatomskebombe.

Severnitok pu{tenurad LUBMIN: Severni tok, novi gasovod koji }e omogu}iti direktno dopremawe ruskog gasa kroz Balti~ko more u Evropu, pu{tenjeju~eurad,~ime jeotvorenonovopoglavqe u globalnim energetskim odnosima. Nema~ka kancelarka Angela Merkel, ruski predsednik Dmitrij Medvedev,premijeriFrancuske i Holandije Fransoa Fijon i Mark Rut, kao i evropskikomesarzaenergiju Ginter Etinger, simboli~no su otvorili ventile gasovoda dugog 1.200 kilometara,nasve~anosti u Lubminu na severoistokuNema~ke. AngelaMerkeliDmitrijMedvedev Medvedevjeoceniodaje otvorena „nova stranica u ener- nitok„dokazdana{kontinenti getskompartnerstvu”RusijeiNe- daqeznadaseokrenebudu}nosti” ma~ke.FijonjerekaodajeSever- utrenutku„kadajeumodi”nedo-

Opasnaretorika RuskiporedsednikDmitrijMedvedevoptu`iojeju~eIzrael dakoristi„opasnuretoriku”kojabimogladovestidokatastrofalnogratasIranom.”Pretwavojnimudarommo`edovestido velikograta”,upozoriojeMedvedev.Nazajedni~kojkonferenciji za novinare sa nema~kim kolegom Kristijanom Volfom, Medvedevjenaglasiodajesadava`nodasesmirisituacija„dubokoudahneiotvorerazgovori”. „Ratoborne izjave da je neka dr`ava - Izrael ili bilo koja druga,spremnadaupotrebisiluprotivIranailibilokojedrugezemqenaBliskomistoku,jevrloopasnaretorika”,zakqu~io jeMedvedev.

PREDSEDNIKPOQSKEPOZDRAVIONOVISAZIVPARLAMENTA

Dr`avapostojizboggra|ana

VAR[AVA: Predsednik PoqskeBrowislavKomorovskinapo~etku prve sednice novog saziva Sejma poqskog parlamenta po`eleojeju~eposlanicimaibudu}oj vladi hrabriju politiku koja }e obnovitiPoqacimaverudadr`avapostojizagra|ane.Komorovski jepred460poslanikadowegdoma poqskog parlamenta naglasio da suPoqacinaredovnimizborima 9.oktobraizabralikontinuitet, alidapolitikamoradabudehrabrijaunajva`nijimzadacimakoji stoje pred novom vladom i parlamentom. „Najva`nije je da se poboq{a kvalitet funkcionisawa dr`ave. Poqacio~ekujuto.Znamodajedr`avatuzagra|aneaneobrnuto”, kazao je Komorovski i upozorio poslanikesasvihstranapoliti~kogspektrada}emoratidasara|ujuunajva`nijimpitawima.Komorovskijepomenuoipotrebuja~awapravnedr`aveipravosduja, borbu s birokratijom i neophodnostvo|ewamudreitrezvenepri-

vredne politike kako bi Poqska iunarednimgodinamaizbeglarecesiju,kao{tojojjepo{lozarukomuposledwojkrizi.

DonaldTusk

Posle izbora novog rukovodstva Sejma, dosada{wi premijer Donald Tusk podneo je ostavku, a zatimje{efdr`aveTuskupoveriomandatdasastavinovuvladu. Tusk je jedini premijer kome su

Poqaci ukazali poverewe da vodizemquudvamandataiPoqsku }e tako voditi stara koalicija Tuskovih liberala i Poqske narodne stranke Tusk je najavio da }etoipakbitinovaekipapo{to bi iz starog sastava u vladi trebalo da ostanu svega petoro, {estoro ministara, me|u kojima {ef diplomatije Radoslav [ikorski i ministar finansija JacekRostovski. U novoj vladi ne}e biti nekih poznatihministarakao{tojedosada{waministarkazdravqaEva Kopa~, koja je predlo`ena u ime Gra|anske platforme za predsednikaSejma.EvaKopa~postalaje poznata u vreme epidemije novog gripa zato {to se kao jedini ministarzdravqauEvropiiodbila dakupujevakcinezatubolestdok ne budu kompletno testirane.Zahvaquju}i ~eli~noj ministarki Poqskajebilajedina~lanicaEU kojanijekupilavakcineakasnije nije morala neiskori{}ene da uni{tava.

statakpoverewaikadajeu tokuvelikadu`no~kakriza.Etinger je pozvao Gasprom da ne zapostavi kanale kroz Ukrajinu i Belorusiju, koji su i daqe neophodni. Konzorcijum Severni tokzaprojekatvredan7,4 milijardi evra predstavqa zajedni~ki poduhvat ruske dr`avne firme Gasprom,nema~kihkompanija BASF i EON, holandske kompanije Gasuin i GDF Suez iz Francuske. Kadabudeoperativankrajem 2012. godine, gasovodom}ebititransportovano55milijardikubikagasa svake godine u zemqe EUunarednihnajmawe50 godina {to }e biti dovoqno za snabdevawe oko 26 milionadomova. Rusija tim gasovodom `eli da smawi zavisnost od Ukrajine i drugihtranzitnihzemaqaukojima se pojavio problem cena prenosagasa{tojeunekimslu~ajevimadovelodopotpunogprekida isporukegasauEvropu.Poqskai zemqeBaltikavi{eputasuizrazile zabrinutost zbog projekta kojiprelaziprekowihovihteritorija,tvrde}ida}eostatisame u pregovorima sa Rusijom za vlastite isporuke gasa.[vedska je ulo`ilaprigovorpopitawuekologijezbogogromnogcevovodana dnumora,alijeGaspromtoodbacio.

SADnekriju vanzemaqce VA[INGTON: Bela ku}a nije odbacila ideju o postojawu vanzemaqacausvemiru,alijenavelada nemadokazadasuoniikadapoku{alidakontaktirajusqudima.To jenasajtuadministracijeameri~kogpredsednikaBarakaObameobjavio wegov savetnik zadu`en za svemirskupolitikuikomunikacijeFilLarson,posledvepeticije kojimaseodvlastitra`idaobjavesvasaznawaovanzemaqskimbi}ima.„Ameri~kavladanemadokaze o postojawu vanzemaqskog `ivota,nitiotomedasutakvabi}a poku{avala da stupe u kontakt s qudima.Nepostojeniinformacijekojeupu}ujunatodasenekidokazi skrivaju od javnosti”, objasniojeLarsonnainternetstrani Bele ku}e.On ipak nije odbacio ideju o postojawu vanzemaqskih bi}adodav{idaNASAistra`uje itakvemogu}nosti. Peticijeukojimasetra`idase ujavnostiznesusvasaznawaovanzemaqskom`ivotuimalesu17.000 potpisa.

PETASTRANASVETA

LI^NOSTI DANIJELORTEGA Biv{ivo|asandinisti~kogpokretauNikaragvi,DanijelOrtegapobediojenaizborimaza predsednikadr`ave,osvojiv{i63odstoglasova bira~akojisuiza{linaizbore.OgromnaprednostkojuimaOrtegaposvojprilici}eubla`iti uticaj izve{taja o neregularnostima tokom glasawa, ocewuje Aso{ijeted pres.Ortega jo{ nijezvani~noobznaniosvojupobedu.

SILVIOBERLUSKONI Italijanski premijer Silvio Berluskoni izboriojeju~eusvajawedr`avnogra~unazapro{lu godinu, zahvaquju}i opoziciji koja nije glasala, alijeizgubioapsolutnuve}inu,{tobimogloda vodi wegovoj smeni. Neposredno pred glasawe u parlamentu, Umberto Bosi, lider Lige za sever koja je koalicioni partner tra`io je od Berluskonijadapodneseostavku.

HERMANKEJN Republikanskikandidatnaslede}impredsedni~kimizborimauSADHermanKejnodbacioje ju~eoptu`be[eronBajolekzaseksualnouznemiravawe.KejnjezatelevizijuEjbi-sirekaoda nastavqakampawuzapredsedni~keizbore.[eronBajalekjeprekju~eoptu`ilaKejnazaseksualnouznemiravaweujulu1997.godine,kadaje tra`ilapomo}zaposao.

PremijerkaTajlandaotkazalaput zbogpoplava

BANGKOK, HANOJ: Tajlandska premijerka Jingluk [inavatra otkazala je planirani putnatrgovinskiforumzemaqaPacifika na Havajima zbog poplava koje vi{e od tri mesecapoga|ajustanovniketezemqe. „SadajevremedaqudiuTajlandupomognu jedni drugima, pa vas obave{tavan da ne}u i}i” na samit, poru~ila je premijerka Tajlanda. Poplave, najgore u posledwih pola veka,po~elesukrajemjulaidosadajeuwima stradalo 527 Tajlan|ana naj~e{}e zbog davqewauvodi.Poplavesupogodileiokolnezemqe.UVijetnamuvlastisusaop{tile dajeucentralnimiju`nimdelovimapoginulo88qudidokse~etvorovodekaonestali.UVijetnamupodvodomsuivelikidelovianti~koggradaHoiAn,kojijepodza{titomUNESKO-a,saop{tilisuju~elokalni zvani~nici. Prema wihovim podacima, ove poplave,nastalezbogmonsunskihki{a,spadajuunajgorekojesuzadesileVijetnamuposledwih10godina. U Tajlnadu neke provincije severno od Bangkoka su pod vodom vi{e od mesec dana.

VodajeprodrlaiuBangkok,izazivaju}inevoqezavi{eoddevetmilionastanovnika.Zbog togasusveglasnijekritikenara~unvladine neefikasnostiure{avawuproblema. SamitoekonomskojsaradwiAzijeiPacifika, kome je doma}in predsednik SAD

Barak Obama, okupi}e 21 {efa dr`ava s obe strane Pacifika, ukqu~uju}iikineskogpredsednika Hu \intaoa, prenela je agencijaAP.Jingluk,kojajena mesto premijera do{la pro{logavgusta,ve}jezbogpoplavaotkazalaputuKinupro{log meseca. MinistarenergijeTajlandaje upozorio da }e se kriza sa poplavomuBangkokuodu`itijo{ jedanmesec,doksulokalnevlasti savetovale novu evakuaciju stanovnika iz severnih delova gradakojisusadapodudaromvode koja je ranije ve} prodrla u srceprestonice.Dosadajeevakuacijanare|enau12od50distriktaBangkoka,asadajei`iteqimasevernogdistriktaKlongSamVare~enodaseevakui{u.Evakuacijakojaseodnosiinaokolnapodru~ja nijeobavezna,pamnogiqudiostajuda~uvajusvojeku}eiradweukojejeprodrlavoda.


BALkAn

dnevnik

UNHCRpozdravqa Deklaracijuoizbeglicama @ENEVA: Agencija Ujediwenih nacija za izbeglice (UNHCR) pozdravila je ju~e zajedni~ko nastojawe zemaqa regiona da se pomogne u re{avawu problema nekih od 200.000 izbeglica iz ratova na prostoru biv{e Jugoslavije, isti~u}i da }e to pomo}i nastojawima ~etiri zemqe da budu primqene u EU. Ministri inostranih poslova Srbije, Bosne i Herzegovine, Crne Gore i Hrvatske dogovorili su pre dva dana mere kako bi se re {i li naj hit ni ji problemi izbeglica i prona{ao traj ni sme {taj za oko 73.500 najrawivijih osoba, koje i da qe `i ve u ko lek tiv nim centrima. Agencija UN je poru~ila da }e, ukoliko se realizuje dogovoreni program, to predstavqati podr{ku za ulazak ~etiri zemqe u EU. „UNHCR pozdravqa

CRNA GORA

Zelenoza pregovore PODGORICA: Nema~ki parlament }e po~etkom decembra podr`ati preporuku Evropske komisije (EK) o otvarawu pregovora o ~lanstvu sa Crnom Gorom, saop{tio je danas poslanik vladaju}e nema~ke koalicije Peter Bajer. Izvestilac poslani~kog kluba vladaju}e koalicije za Crnu Goru je u razgovoru sa crnogorskim {efom diplomatije Milanom Ro}enom kazao da }e Bundestag 2. decembra dati zeleno svetlo da Podgorica dobije datum za otvarawe pristupnih pregovora sa EU, saop{teno je iz vlade. Evropska komisija je 12. oktobra preporu~ila otvarawe pristupnih pregovora sa Crnom Gorom, a kona~nu odluku trebalo bi da donese Evropski savet na decembarskom samitu. Mediji, me|utim, pozivaju}i se na „neformalni dokument” navode da su Francuska i Nema~ka protiv toga da Crna Gora na decembarskom samitu EU dobije datum pregovora, a pojedini zvani~nici navode da nije izvesno da }e politika pro{irewa biti na dnevnom redu predstoje}eg sastanka {efova dr`ava i vlada u Briselu. Delegacija Bundestaga u dvodnevnoj je poseti Crnoj Gori gde razgovara sa predstavnicima vlasti, opozicije, nevladinog sektora i medija

deklaraciju. Ona dolazi u vreme intenzivnih napora ~etiri zemqe i predstavqa ~vrstu privr`enost wihovih vlada da sara|uju na regionalnom i dr`avnom nivou u bavqewu sa dugotrajnim problemom u ovom delu

Evrope”, navodi se u saop{tewu agencije. Organizacija je saop{tila da je radni plan, koji }e biti sa~iwen kao sastavni deo programa, omogu}iti izbeglicama da ostvare sva svoja prava i nastave sa

normalnim `ivotom. U saop{tewu se tako|e se ka`e da }e UNHCR ostati „anga`ovan i sna`no privr`en u pru`awu podr{ke vladama ovih zemaqa u zatvarawu poglavqa sa raseqenim licima i izbeglicama”. Deklaraciju o okon~awu raseqavawa i obezbe|ivawu trajnih re{ewa za ugro`ene izbeglice i interno raseqena lica potpisali su u ponedeqak na konferenciji o izbeglicama ministri spoqnih poslova Srbije Vuk Jeremi}, Hrvatske Gordan Jandrokovi}, BiH Sven Alkalaj i Crne Gore Milan Ro}en. Komesar EU za pro{irewe [tefan File poru~io je da dogovor o zajedni~kom pristupu regiona u re{avawu pitawa izbeglica treba da poslu`i kao sna`no ohrabrewe zemqama ~lanicama EU da u decembru glasaju za daqe {irewe Unije. (Tanjug)

VISOKIPREDSTAVNIKUNVALENTININCKOOSITUACIJIUBiH

Lideri{estpartijakrivi zbogstagnacijeudr`avi SARAJEVO: Visoki predstavnik Valentin Incko uputio je novi izvje{taj Savetu bezbednosti Ujediwenih naroda (UN) o situaciji u BiH, u kojem optu`uje lidere {est politi~kih partija da su krivi zbog stagnacije u dr`avi i zbog neusvajawa buxeta. Incko medijima nije `elio da potvrdi sarxaj izvje{taja, a za “Dnevni avaz” je rekao da }e izvje{taj prezentovati 15. novembra UN-u, te da ga ne `eli do tada komentarisati. List navodi da je Incko u redovnom izvje{taju koji {aqe u Wu-

jork istakao da je politi~ko okru`ewe u BiH u periodu stagnacije, optu`uju}i ~elnike {est najve}ih politi~kih partija, SDP, SNSD,SDA, SDS, HDZ BiH i HDZ 1990, da ne uspijevaju formirati novi saziv Vije}a ministara BiH. Tako|e, protivqewe iz dva entiteta, naro~ito iz Republike Srpske, nastavqa spre~avati usvajawe adekvatnog dr`avnog buxeta, naveo je Incko u izvje{taju. On je naglasio da Republika Srpska nastavqa kombinovati pravne i politi~ke aktivnosti

koje dovode u pitawe dr`avne institucije, kompetencije i zakone, kao i autoritet visokog predstavnika i relevantne rezolucije Sveta bezbednosti UN-a. Iako je Narodna skup{tina RS 1. juna poni{tila odluku o raspisivawu referenduma, objavqenu 13. aprila, kontroverzni zakqu~ci ostaju problemati~ni, napisao je Incko. Tako|e je naveo i da predsjednici dve hrvatske partije- HDZ BiH i HDZ 1990 nastavqaju pritisak za osnivawe tre}eg entiteta u BiH, {to dodatno komplikuje situaciju.

File:UBosnikrajwi~as zareforme BRISEL: Evropski komesar [tefan File ocenio je ju~e u Evropskom parlamentu (EP), u Briselu, da je „kucnuo krajwi ~as za formirawe nove dr`avne vlade” u Bosni, za ustavne promene, popis stanovni{tva i reforme da bi se iza{lo iz zastoja u pribli`avawu te zemqe Evropskoj uniji. File je, u izlagawu poslanicima EP „prijateqima BiH”, i u prisustvu {efa diplomatije BiH Svena Alkalaja, naglasio da „svi moramo sna`no delati kao partneri kako

bismo zajam~ili da ta zemqa (BiH) ne}e zaostati za ostatkom regiona”. Evropski komesar za pro{irewe je ukazao na oktobarski godi{wi izve{taj o BiH u kojem se navodi da „i daqe nema otklona u politi~kom i institucionalnom zastoju” u toj zemqi. „Bosna i Hercegovina nema vladu u dr`avnoj ravni, a nema napretka u programu reformi u ciqu pribli`avawa te zemqe EU”. File je primetio da od toga zavisi ho}e li

~lanice EU u decembru odlu~iti da stave na snagu Sporazum o stabilizaciji i pridru`ivawu s BiH. Evropski komesar je podsetio da je Evropska komisija pokrenula mehanizme za to da Bosna ipak dobije sredstva od sto miliona evra iz pretpristupnog EU fonda IPA i za re{avawe ovogodi{wih problema. „Ali {tagod mi u~inili, Bosni i Hercegovini mo`emo pomo}i samo ako ona sama sebi pomogne”, napomenuo je evropski komesar za pro{irewe.

JosipBoqkovac ostajeupritvoru

Izbornakoalicija KosoroveiKeruma ZAGREB: Predsednica Hrvatske demokratske zajednice (HDZ) Jadranka Kosor i predsednik Hrvatske gra|anske stranke (HGS) Zzeqko Kerum potpisali su ju~e u Zadru sporazum o predizbornoj i postizbornoj saradwi. Te dve stranke ima}e zajedni~ke izborne liste u 9. i 10. izbornoj jedinici koje obuhvataju Splitskodalmatinsku, Dubrova~ko-neretvansku, Li~ko-sewsku, Zadarsku i [ibensko-kninsku `upaniju. „Ovu saradwu temeqimo na programima i na tragu ekonomskog osna`ivawa kao zajedni~kog ciqa, te hri{}anskim vrednostima i domoqubqu”, rekla je Jadranka Kosor, prenose lokalni mediji. Ona je dodala da `eli da okupi sve koji „misle hrvatski i za Hrvatsku” i dodala da istra`ivawa

HDZ-a pokazuju da }e ta stranka u 9. i 10. izbornoj jedinici osvojiti najvi{e glasova u odnosu na druge stranke i koalicije. Jadranka Kosor je rekla i da se vode pregovori s jo{ nekim strankama u drugim izbornim jedinicama. Prema koalicionom sporazumu HGS-u splitskog gradona~elnika @eqka Keruma pripa{}e 3. i 7. mesto na listi u 10. izbornoj jedinici, dok }e u 9. izbornoj jedinici imati 7. mesto na listi. HDZ tradicionalno najvi{e glasova osvaja u 9. izbornoj jedinici, gde je i na posledwih parlamentranim izborima 2007. osvojio deset poslani~kih mesta. Opoziciona Socijaldemokratska partija (SDP) u toj izbornoj jedinici osvojila je tada samo ~etiri mesta.

ZAGREB: Vanraspravno ve}e @upanijskog suda u Zagrebu odbilo je ju}e `albe biv{eg hr vat skog mi ni stra unu tra {wih poslova Josipa Boqkovca (90) na odluke o pokretawu istrage i odre|ivawu pritvora zbog sumwe da je naredio ubistvo civila u maju 1945. na karlova~kom podru~ju. „S obzirom na te{ke okolnosti izvr{ewa krivi~nog dela prihva}ena je argu men ta ci ja is tra `nog sudije da Boqkov cu od re di pri tvor”, navedeno je na internet stranicama su da. Po vo dom hap {ewa Boqkovca, Savez an ti fa {i sti~ kih boraca i antifa{i sta (SA BA) Hr vatske pozvao je ju~e hr vat sku i svet sku javnost da ih podr`e „u ot po ru isto rij skom re vi zi o ni zmu kojim se `ele rehabilitovati pora`ene snage u Drugom svetskom ratu, a Hrvatsku graditi na osnovama suprotnim wenom Ustavu”. U saop{tewu koje su potpisali po~asni predsednik SABA Stjepan Mesi} i predsednik Ratko Mari~i}, ocewuje se

da je hap{ewem istaknutog antifa{iste i prvog ministra policije Hrvatske „rukavica ba~ena u lice dana{woj Evropi, oslo we noj na an ti fa {i sti~ke temeqe”. Josip Boqkovac, koji je bio {ef Ozne u Karlovcu, uhap{en je 2. novembra pod sumwom da je

naredio ubistvo 21 civila u maju 1945. na karlova~kom podru~ju. Nakon saslu{awa, odre|en mu je jednomese~ni pritvor i nalazi se u zagreba~kom zatvo ru u Re me tin cu.Hap {e we prvog hrvatskog ministra unutra{wih poslova izazavalo je brojne polemike u Hrvatskoj.

sreda9.novembar2011.

25


SveT POZnATiH

sредa9.novembar2011.­

dnevnik

c m y

26

Ко повезује Роналда, Балотелија и Берлусконија Ф

удбалер Манчестер ситија Марио Балотели у вези је са старлетом Рафаелом Фико, бившом девојком Кристијана Роналда и звездом неколико Берлусконијевих чувених „бунга-бунга„ журки. Заштитно лице кампање за безбедну употребу ватромета Балотели (21) усликан је недавно са Рафаелом (23), девојком која је у Италији постала позната након учешћа у ријалитију Велики брат, а у свету након што је на интернету понудила невиност на продају. Након успеха у ријалитију и на интернету, Рафаелу је спазио Кристијано Роналдо 2009. године, а убрзо и италијански премијер, који ју је звао на чувене журке са маскама, стриптизом и еротским плесовима. Кладионица „Ладброкес” је својевремено нудила квоту на Рафаелу да је она мајка Кристијановог јуниора, а сада је допала руку младом фудбалеру који је недавно запалио своју кућу претераном употребом пиротехнике и којег су фотографи усликали како прелистава порно-часописе у радњи. Савршени једно за друго.

D

jesupomnopratiliYeksonovi obo`avaoci{iromsveta. Majer (58) je odveden ruku vezanihlisicama,po{tojeporota na sudu u Los An|elesu predvadanadonelajednoglasnuodlukuowegovojkrivici. Doktoru, kome bi mogla da budeizre~enakaznado~etiri godinezatvora,bi}eizre~ena presuda29.novembra.Ispred sudniceokupilosevi{edesetina Yeksonovih obo`avalaca,aplaudiraju}i,doksuneki briznuliupla~.

Marej je na sudu izjavio da nijekrivzaoptu`bedajepeva~u „Trilera” dao prekomernu dozu sna`nog anestetika propofola,kojiseobi~nokoristiuhirurgiji,{toje,pre-

vin, priznao je da je Yeksonu dao dozu propofola kako bi mupomogaodazaspi,awegovi advokatisutokomsu|ewareklidajepeva~samodgovoran zasvojusmrt,jerjebezznawa Marejauzeododatnudozuleka zajednosadrugimsedativima, {tojebilofatalno. Tu`iocisuokriviliMareja za nemar prilikom le~ewa Yeksona, jer je u wegovoj ku}i dr`aoopasanlek,nijepratio wegovo stawe, odlagao da pozovehitnupomo}inijerekao lekarimadajepeva~udaopropofol. Sudija je Mareju odredio pritvor do izricawa kazne29.novembra,nakon{toje dvegodineproveonaslobodi po{to je pu{ten uz kauciju, preneojeRojters. Tokom saop{tavawa odluke o krivici, Yeksonova majka KetrinisestraRebisuplaka-

Prekomernadozalekova Yeksonjepreminuo25.juna2009.godine,u50.godini, od prekomerne doze anestetika propofola, u kombinacijisadrugimsedativima,kojejeuzimaozbogproblema saspavawem.Onjeprona|enmrtavusvojojku}iuLosAn|elesu,trinedeqeprepo~etkapovratni~keserijekonceratauLondonu. maocenama,bioglavnirazlog smrtiMajklaYeksona25.juna 2009.godine.Lekar,kojijetokom su|ewa tvrdio da je ne-

le,ausudnicisubiliipolubra}aipolusestrepeva~aLa Toja, @ermen i Rendi, kao i wihovotacYo.

Џенифер Анистон

Мирка Васиљевић и Вујадин Савић добили сина

LekarMajklaYeksonakriv zaubistvoiznehata oktor Konrad Majer, li~ni lekar pokojnog pop peva~a Majkla Yeksona progla{en je, odlukom porote, krivim za ubistvo iz nehata, poslesedamnedeqasu|ewako-

PAPARACO

П

опуларна глумица и њен вереник, фудбалер Вујадин Савић су у петак увече у једној болници у Бордоу добили сина Андреја. Мама и беба се осећају добро, а деда, легендарни фудбалер Дуле Савић је радост поделио са домаћим медијима. „Добио сам унука у 20 часова и 22 минута, пресрећан сам. Зове се Андреј. Јавили су ми преко Скyпа. Сво троје су одлично.” Пар је већ извесно време у Француској заједно са баком Марином Савић, где Вујадин игра фудбал, док је деда Дуле, некадашњи главни нападач Црвене звезде, у Београду.

Д

Гоца Тржан има новог дечка?

омаћа штампа преноси да је певачица у вези са бубњарем свог пратећег бенда. Гоца Тржан (38) и Раша Новаковић (24) у вези су већ неко време, а извор близак пару тврди да често заједно проводе време у Новом Саду. Новаковић свира бубњеве у бенду који прати певачицу на наступима. Тржанова, која се недавно развела од супруга Ивана са којим има четворогодишњу ћерку Лену, није желела да за „Прес” потврди нити демантује да је у новој вези.

Кети, не гледај

С

упруг певачице Кети Пери почастио је пољупцем госпођу која му је доделила награду у Лос Анђелесу. Расел Бренд добитник је признања „Мушкарац године” организације „Пријатељска кућа”, која женама нуди рехабилитацију од дроге и алкохола.

Адел мора под нож П Бренд је својевремено био зависник од хероина, пића и секса, али тврди да је већ девет година потпуно „чист”. Награда за рад на подизању свести о трезвености толико га је одушевила, да је директорку „Пријатељске куће” Пеги Олбрехт пољубио у уста. Бренд је тој организацији понудио и аукцију за фанове, чији ће победник добити прилику да упозна британског комичара, а сав приход намењен је „Пријатељској кући”.

евачица је саопштила да отказује све концерте до краја године, јер мора на операцију. Сви концерти које је Адел заказала за 2011. су отказани до даљњег, јер су њени проблеми са гласом озбиљнији него што се мислило. Доктори су јој најпре саветовали мировање и одмор, али мораће проблем са гласним жицама да реше хируршким путем. „Срце ми је сломљено, али морам све да откажем како бих се опоравила”, кратко је саопштила Адел својим фановима. Док се певачица не опорави, подсетите се њеног невероватног гласа.

Ф

удбалери и манекенке одувек су иделан спој. Још када је у питању шпанска крв - онда сексепил пршти на све стране. Фудбалски клуб Барселона не само што има најбољег фудбалера не свету (Лионел Меси) већ и најсексепилније играче међу којима су Ђерар Пике и Виктор Валдес, али се

Го л и ш а в и В и к т о р В а л д е с и њ е го ва д р а га они на овој листи не би нашли да поред њих нису певачица Шакира, односно манекенка Јоланда Кардон. Иако је Пике смувао ватрену Колумбијку, Шпанци се држе

свог, па су у анкетама за најсексепилније парове углавном гласали за „домаћи” пар Валдес Јоланда. Да би и оправдали тај епитет њих двоје су снимили „безобразни” едиторијал.


dnevnik

OGLASi l ^iTUQe

sreda9.novembar2011.

27

Posledwi pozdrav

KUPUJEM razne sitne stvari iz doma}instva: alate, kwige, porcelan, kristal, igra~ke. Telefon: 064/99-45002. 40571 ^ISTIM podrume, tavane, odnosim {ut, kupujem staro gvo`|e, ve{ ma{ine, {porete, karoserije, automobile za otpad. Telefoni: 064/9533943, 6618-846, 063/848-5495. 40872

NikoliCrnkovi}u

od porodica Sele{i i Kraj~evi}.

41184

Posledwi pozdrav dragoj na{oj

Posledwi pozdrav sestri}u i bratu

OlgiciKalu|erski NikoliCrnkovi}u Hvala ti za svu qubav koju si nam pru`ala. Po~ivaj u miru.

Porodice: Kali},A~anski, Coki} i Toma{.

od: tetke Kate, sestre Bebe, brata Bo`e sa porodicama.

41185

41181

Tu`nim srcem obave{tavamo rodbinu i prijateqe da je preminuo

NikolaCrnkovi} 1956-2011. Sahrana je u utorak, 9. 11. 2011. godine, u 15 ~asova, na Dowem grobqu, u Sremskim Karlovcima. Tvoji Beba i Kaja. 41182

Zbogom, draga na{a drugarice

POZIVAJU se svi o~evidci saobra}ajne nezgode koja se dogodila dana, 21. 8. 2010. godine, oko 20 ~asova u Novom Sadu na raskrsnici ulica Bulevar oslobo|ewa, Novosadskog sajma i Pavla Papa da se jave Osnovnom sudu u Novom Sadu kod sudije Nade Bale{evi} na broj pedmeta P1661/11 radi svedo~ewa. 41124

IZDAJEM lepo name{ten, dvosoban stan, u Ulici novosadskog sajma 7. Telefon 063/765-3632. 41053

HIDROIZOLACIJA svih vrsta ravnih krovova, podruma, gara`a, skidawe vlage sa zidova. Mo`e i odlo`eno pla}awe. Garancija. Telefoni: 021/731-895 i 064/128-94-87. 38026 VODOINSTALATER pru`a sve usluge u delatnosti: odgu{ewa odmah, vr{imo emajlirawe kada, lajsne oko kade. I van grada. Telefoni: 063/7509499, 065/5610864, 021/6394167. 41089 KU]NI MAJSTOR - monta`e, demonta`e, name{taja, sanitarija, popravke, vrata, prozori, roletne, brave, {arke, kre~ewe, farbawe, rasveta. Telefon 065/6824-398. 41117

OlgaKalu|erski ^uva}emo uspomene na na{e dane rada i stvarawa, na ono vreme u kojem se ~asno i dostojanstveno radilo i dru`ilo. Nedostaja}e nam tvoje tiho i postojano prijateqstvo, draga Olgice. Sindikalcisedamdesetihiosamdesetih izgradaNovogSada. 41186

Posledwi pozdrav

AniPopac Neka po~iva u miru Bo`ijem.

DIHTOVAWE prozora, vrata, fleksibilnim alu lajsnama, za{titite se od hladno}e, vetra, buke i vode. Telefon 062/367-376, 064/261-3610. 41107

SADNI MATERIJAL za vi{egodi{wi rasad mente i melise. Telefon 063/1100872. 41103

O`alo{}eni: prija Mika,Miroslavai Mile@i`asa porodicom. 41180


28

^iTUQe l POMeni

sreda9.novembar2011.

Opra{tamo se sa tugom i bolom od

Posledwi pozdrav dragom dedi, stricu i deveru

Posledwi pozdrav

Posledwi bratu

Nikodiji Vojinovi} od prije Klare i prijateqa Nedeqka Miqkovi}.

dnevnik

pozdrav

dragom

Persida Gruber

Bori Bekvalcu

Jelene Ini}

Nikoli Tovitovi}u

1929 - 2011.

Posledwi pozdrav Emilovoj mami od wegovih prijateqa: porodica Mikovi}, [rek, Jovi}, Melanije i Bobe.

od wegovog brata Kozarev Nedeqka i od sestre A}imovi} Mare sa porodicama.

41175

Tu`na srca opra{tam se od jedine sestre

Posledwi pozdrav.

41167

Opra{tamo kom{inice

se

od

drage

41138

Nikola Crnkovi}

Posledwi pozdrav

Milke Janus

Zauvek tvoji: Vera, Bucke, Duki, Tea i Ria.

od: Jelene i Nata{e, Zorana, Sne`ane, Gordane, Vesne i Milice Tovitovi}.

Pamti}emo je po wenoj dobroti i iskrenom prijateqstvu.

41177

41127

41166

Posledwi pozdrav dragom

Posledwi pozdrav

Janus Milki od porodice Veliov.

od stanara Despota Stefana 6, Novi Sad.

Wene kom{ije sa 11. sprata zgrade sa Bulevara Despota Stefana broj 6.

Jovanke Mili~i}

41172

41169

Posledwi pozdrav

Sa tugom i bolom javqamo ro|acima i poznanicima da je u 82. godini preminula na{a draga i voqena

Oti{la je iznenada i bez povratka, ali }e zauvek ostati u mom srcu. O`alo{}ena sestra Anica.

41153

Nikodiji Vojinovi}

Tiho, kao {to je i `ivela preminula je u 74. godini na{a draga sestra

~ika Bati

Olgi Kalu|erski

ro|ena Bibi} od Aleksandra Mesaro{a sa porodicom.

Obave{tavamo rodbinu i prijateqe da }e se sahrana obaviti 9. 11. 2011. godine, u 15 ~asova, na Beo~inskom grobqu. od Spomenkinih drugara: Jelene, Tawe, Oqe, Natke, Pe|e, Neboj{e, Baneta i Vukana.

Sahrana mile i drage pokojnice obavi}e se 9. 11. 2011. godine, u 14 ~asova, na mesnom grobqu, u Negoslavcima. O`alo{}eni: sin Petar, }erka Vesna, snaja Milica i unuka Vesna. 41162

41164

Jovanka Mili~i} O`alo{}eni: }erka i zet sa porodicom, sin i snaja sa porodicom.

Ana Popac

Posledwi pozdrav Milanovoj mami

dugogodi{wa radnica „Nive�

Iznenada nas je napustila na{a draga prijateqica i saradnica

Sahrana je danas, 9. 11. 2011. godine, u 14 ~asova, u @abqu. O`alo{}eni: sestra Anica, brat Milan i snaja Bo`enka.

41183

41173

41152

Na{em prvom rektoru, dragom kolegi, prijatequ i velikom ~oveku

Olgi Kalu|erski

Persida Gruber od: Milene, Maje, Milana, Sare i Pe|e.

Osta}e u na{im srcima i se}awu FOREVER. Dr Marija Ratkovi} i saradnici. 41170

41179

Posledwi pozdrav majci na{eg kolege

Ani Popac

prof. dr Ogwenu Baki}u 1951 - 2011. redovnom profesoru Univerziteta EDUCONS, Sremska Kamenica

Posledwi pozdrav dragoj

Olgi Kalu|erski

Steva, Loki, Zlaja, Dana i Marijana.

Milan, Mia, Lara i Aleksandar Ba{i}.

41165

41163

POMEN

ostajemo neizmerno zahvalni za svu po`rtvovanost, izuzetni profesionalizam i vi{egodi{wu posve}enost izgradwi na{eg Univerziteta. Ispra}aj za kremaciju je u ponedeqak, 14. 11. 2011. u 12.00 ~asova na Novom grobqu u Beogradu, a komemorativni skup u petak, 25. 11. 2011. u 11.00 ~asova na Univerzitetu Educons u Sremskoj Kamenici. S tugom i po{tovawem, Kolektiv, menaxment i studenti Univerziteta EDUCONS.

Posledwi pozdrav dragom suprugu i ocu

Aleksandar Marinovi} Aca

Nikoli Tovitovi}u

9. 11. 2001 - 9. 11. 2011. Nikada te ne}emo zaboraviti. Uvek }e{ biti u na{im srcima. ]erka Jovana i tetka Nada.

56/P 41161

Sahrana je danas, 9. 11. 2011. godine, u 15 ~asova, na Gradskom grobqu, u Novom Sadu. O`alo{}eni supruga Tomanija i sin @arko Tovitovi}. 41126


^iTUQe l POMeni

dnevnik

PETOGODI[WI POMEN voqenoj sestri

Obave{tavamo rodbinu i prijateqe da je u 86. godini preminuo na{

Vreme prolazi a tuga za tobom ostaje. Nedostaje{ mi mnogo. Uvek si sa mnom u mojim mislima, ne zaboravqam te ni jednog trenutka. Mila moja sejice. Tvoja Marica.

Najdra`em te~i

Sahrana je u ~etvrtak, 10. 11. 2011. godine, u 10.30 sati, na Gradskom grobqu, u Novom Sadu. O`alo{}eni: supruga Radmila, sin @eqko, }erka Vesna, unuci Milan, Jelena, Neda i Bojana sa suprugom Mladenom.

29

SE]AWE 2009 - 2011.

Nikoli Tovitovi}u [ici

Josip Kali}

Milici Gvoji}

sreda9.novembar2011.

posledwi pozdrav od porodica ^eki} i Srdanov.

Prof. dr Du{an Ko{ar~i} Dugo nisi sa nama i daqe je beskraj bola i praznine, ali se}awa na ono dobro i plemenito u na{em `ivotu traje zauvek. S qubavqu, Tvoja porodica.

41142

41146

41136

41157

Obave{tavamo rodbinu i prijateqe preminula na{a draga supruga i mama

da

je

Dragan Krga

Obave{tavamo rodbinu prijateqe da je preminula

i

Posledwi pozdrav majci na{eg kolege.

Edita Avramovski

iz @abqa

Ana Popac

1930 - 2011. Dragane, danas je 18 godina od kako te nema, mi svaki dan pla~emo za tobom.

Sahrana }e se obaviti dana, 10. 11. 2011. godine, u 9.45 sati, na Gradskom grobqu, u Novom Sadu. O`alo{}eni: }erke Mirjana i Lidija, unuci Vladimir, Ivan i Milo{.

Tvoji: tata, mama, sestra Sofija i brat Jovica. 41052

41158

Danas, 9. 11. 2011. godine navr{avaju se 2 godine od kada nije vi{e sa nama, na{a }erka, supruga, majka i baka

Obave{tavamo rodbinu i prijateqe da je preminula na{a

Ustanova Studentski centar Novi Sad.

1532-P

Posledwi pozdrav dragom ~ika Bati.

na{em

Posledwi pozdrav dragom prijatequ

na{em

Olga Kalu|erski 1943 - 2011.

Mirosava Grbi}

Zora Burka

Sahrana je u ~etvrtak, 10. 11. 2011. godine, u 14.15 sati, na Gradskom grobqu, u Novom Sadu.

S qubavqu i po{tovawem ~uvamo uspomenu na wu. Porodica Burka i majka Spasa Pavlov.

Sahrana }e se obaviti dana, 10. 11. 2011. godine, u 11.15 sati, na Gradskom grobqu, u Novom Sadu.

Svetislav Jovi}

Svetislavu - Bati Jovi}u 1929 - 2011.

Jasmina, Zoran i Marko Rude`.

Wegovi: Dana i Zija.

O`alo{}ena porodica.

41148

Pro{lo je tu`nih godinu dana od kad nije sa nama na{a draga

1927 - 2011.

41159

Zauvek weni: suprug Boris i sin Milan.

41150

41151

Sa tugom obave{tavamo rodbinu, prijateqe i poznanike da je 8. 11. 2011. godine preminuo

41141

Mileva Vi{ekruna 1931 - 2010.

S velikom tugom obave{tavamo rodbinu i prijateqe da je preminuo na{ voqeni suprug i otac

Ve~no o`alo{}eni: }erka Branka, zet Mi{o, unuke Tatjana i Sowa i ostala rodbina. 41137

Posledwi pozdrav dragoj majci

Persidi Gruber Sahrana je danas, 9. novembra 2011. godine, u 12 ~asova, na Gradskom grobqu.

Josip Ma}e{i}

Svetislav - Bata Jovi}

1935 - 2011.

17. 4. 1929 - 8. 11. 2011.

Sahrana }e se obaviti u ~etvrtak, 10. 11. 2011. godine, u 13.30 ~asova, na Gradskom grobqu, u Novom Sadu.

Sahrana je danas, 9. 11. 2011. godine, u 15 ~asova, na grobqu, u Sremskoj Kamenici.

O`alo{}eni: supruga Sofija }erka Nada, zet Tibor i svastika Slavka.

Wegovi najmiliji: }erka Spomenka, zet Danko i unuka Iris Zagor~i}.

O`alo{}ena porodica: Emil, Eduard, Anita, Rocio i Nada. 41155

41125

41149


tv program

sreda9.novembar2011.

ВАТЕРПОЛО:ЕВРОЛИГА

Војводина –Шпандау

06.00 07.30 08.00 10.00 11.00 12.00 13.00 14.00 15.00 15.30 16.00 17.00 17.30 18.00 19.10 20.00 20.30 21.30 22.00 22.30 00.00

Музичкосвитање ГласАмерике Панонскојутро Аналија Свеоживотињама Билаједномједнанедеља Закоракиспред Белилукипапричица Врбашкахроника Војвођанскевести Уогледалу Дискавери Војвођанскевести Аналија Путоманија Војвођанскевести Теманедеље Билаједномједнанедеља Војвођанскевести Дискавери ГласАмерике

11.30 12.10 12.35 12.50 13.05 14.05 14.30 15.00 15.10 16.00 17.20 18.00 18.00 19.30 20.05 20.40 21.00 22.00 22.30 23.00

Добројутро, Војводино Једаннаједан Политбиро-страначкахроника Стањенапутевима Центарсвета Вечесазвездама:РадеМарковић Кухињица Веки позабудућност Крозбаштубанатску Светогорскизапис Љубавнициитајне Заједно Дунав,заувек Вестизаособесаоштећеним слухом Радар Вечесазвездама:СлавкоСимић Једаннаједан Разгледнице Ватерполо,Евролига: Војводина-Шпандау,пренос ТВДневник НАТОурегиону Емисијаоздрављу Изнашегсокака Војвођанскидневник Све(т)оконас Својмеђутуђима,туђмеђу својима,филм

Једаннаједан Гост емисије „Један на један” биће Расим Љајић, шеф Националног савета за сарадњусаХашкимтрибуналомиминистаррада. Ауторка и водитељка: Даница Вученић (РТВ 1, 17.20)

06.30 07.00 08.35 09.30 10.15 10.30 11.05 11.30 12.30 12.40 13.10 13.40 14.10 15.00 15.30 17.00 17.30 17.45 18.00 18.15 18.30 18.45 19.00 19.25 19.30 20.00 21.30 23.05 23.30 00.00

Кухињица–мађ. ТаблоидНС Безупута Трећедоба Хајдесамномуобданиште Питамсепитамсе Кадзазвони Музичкипрограм-етно Вести(мађ) Македонскосонце ТВБаштина: Рогови ТВБаштина: Музичкатрагања Европазапочетнике Центарсвета Добровече,Војводино(ром) Пословниуспех(мађ) Музичкипрограм–мађарска музика ТВДневник(хрв) ТВДневник(слов) ТВДневник(рус) ТВДневник(рум) ТВДневник(ром) ТВДневник(мађ) Спортскевести(мађ) Кухињица–мађ. Добровече,Војводино(рум) Потпуношворц,филм ТВБаштина:ГециниДунђерски ТВБаштина:Музичкатрагања ТВПродаја

Србија–Бразил (РТС 1, 13.23) 06.05 08.00 09.05 10.00 10.30 11.00 12.00 12.15 12.37 13.23

(РТВ 1, 18.55) 06.30 09.00 09.30 10.05 10.07 10.30

НАПОМЕНА:НаРТС2 у10.00могућјепренос СкупштинеРепубликеСрбије

ОДБОЈКА(Ж): СВЕТСКИКУП

06.30Новосадскојутро 08.30Хранаивино 09.05Интернаистрага 10.05Врелегуме 10.30Истрага 11.00 Вести 11.05 ДрМартин 12.07Годинепролазе 12.30Цртанифилм 12.40Неонсити 13.05Интернаистрага 14.00Вести 14.05Дунавскасалетла 14.30Повратакурај 15.00Вести 15.05ДрМартин 16.00Објектив(слов) 16.15Објектив(мађ) 16.30Спринт 17.00Хранаивино 17.30Новосадскопоподне 19.00Објектив 19.30Објектив(слов) 19.45Објектив(мађ) 20.00Евонаскодвас 21.00Интернаистрага 21.50Неонсити 22.00Објектив 22.30ДрМартин 23.10Неонсити 23.20Годинепролазе

14.45 15.00 16.00 17.00 17.20 17.45 18.25 19.00 19.30 20.05 21.04 22.49 23.53 00.00

06.10 06.40 07.35 08.30 09.45 11.00 12.00 13.00 13.15 13.30 14.00 14.55 15.00 16.05 17.00 18.05 18.25 19.00 19.20 20.00 21.15 22.15 00.00 00.30 00.45 01.45

Јутарњипрограм Јутарњидневник Отворена врата Траг Странац у Србији Атлассвета Дневник Спортплус Злочиначкиумови Одбојка(ж)Светскикуп,Србија-Бразил Гастрономад ОвојеСрбија Породичноблаго ДневникРТВојводина Штарадите,бре Београдскахроника Око Слагалица Дневник Породичноблаго Превозник,филм Злочиначкиумови Евронет Јединица

Експлозив Аурора Тајнастарогмоста Дођинавечеру Бандини Забрањеновоће 1001ноћ Ексклузив Вести Експлозив Трачара Срећневести Дођинавечеру Домаћине,оженисе Тајнастарогмоста Ексклузив Експлозив Вести Забрањеновоће Кадлишћепада Пакленакухиња Пирамида Експлозив Ексклузив Трачара Пакленакухиња

06.30 10.00 10.30 19.00 19.30 23.30 00.30

АТПМастерсПариз Евролига АТПМастерсПариз Тенис АТПМастерсПариз Тенис Евролига:Билбао–Фенербахче 02.15 Евролига:Канту–Олимпијакос 04.00 Прегледхоландскелиге

Љиљана Несторовић

Пипишоу

Пирамида

У овој емисији такмичиће се ОШ „Младост” из Томашевца и ОШ „Бранко Ћопић” из Лукићева.Упознаћете се са занимањем дубореза, а сви ви који волите животиње, видећете једну малу симпатичну животињу –хрчка. (КТВ, 20.00)

Овесредеучествују:Маја Гојковић, председница Народне партије, Горица Нешовић,водитељканаРТС-у и Александар Мартиновић, потпредседник Српске радикалнестранке. Водитељка: Љиљана Несторовић (Прва, 22.15)

Слагалица ДенииДеди Мунзи ДенииДеди Озибу ПчелицаМаја ДенииДеди Томасидругари Плава птица Између игре и математике Шешир без дна Арс практика Е-ТВ ТВмрежа Хит либрис Наука 2011. 18.међународна трибина композитора 12.29 Посматрачмора 13.00 Трезор 14.00 Плава птица

07.00 07.33 07.36 07.42 07.45 07.52 08.16 08.19 08.29 08.54 09.04 09.36 09.50 10.21 10.53 11.27 11.59

06.15 07.05 07.30 08.00 08.15 08.30 09.30 10.00 10.40 11.05 11.30 11.55 13.55 14.45 15.05 16.00 16.35 17.00 17.30 18.00 19.15 19.40 20.10 21.05 23.10 23.45 00.15 00.20

Долинасунца СунђерБобКоцкалоне ПингвинисМадагаскара ВестиБ92 Топшоп Долинасунца Хоћудазнам ВестиБ92 Топшоп СунђерБобКоцкалоне ПингвинисМадагаскара Филм:Заштитник ИстражитељиизМајамија Топшоп Доме,слаткидоме ВестиБ92 Спортскипреглед Измеђудвеватре Свепосписку СунђерБобКоцкалоне Пријатељи Дваипомушкарца ИстражитељиизМајамија Филм:Крвнавеза ВестиБ92 Измеђудвеватре Штадаобучем? Доушници

Крвнавеза

ВАТЕРПОЛО: ЛИГАШАМПИОНА

Вашаш–Партизан (РТС 2, 19.55) 14.36 14.39 15.06 15.20 15.48 16.35 17.02 18.02 18.36 18.39 18.45 18.48 18.53 19.17 19.55 21.00 22.01 22.30 00.09 00.11 00.35

dnevnik

c m y

30

Између игре и математике Шешир без дна Арс практика Сексперти ВииМираАдањаПолак Линк ПородицаСопрано Рок Вилиџ 2011. ДенииДеди Мунзи ДенииДеди Озибу Усвету Беокулт Ватерполо:Лига шампиона: Вашаш-Партизан,пренос ПородицаСопрано Кошарка:Партизанреалданпре Кадчовекпадне,филм 52.октобарски салон,хроника Музичкипрограм Гитар арт фестивал

06.00ВОА 06.30Чистрачун 07.00Маратон 08.05Кефалица 08.10Двоугао 08.15Изавести 08.45Милица² 09.00Коферче 09.30Отворенистудио 11.00 Топшоп 11.30 Милица² 11.45 Филм:Уцарствужена 14.00Вести 14.30Изавести 15.00ПородицаСерано 16.30Редизакон 17.30Чистрачун 18.00Вести 18.30Двоугао 18.35Коров 19.00Безтрага 20.00Изавести 20.30Милица² 20.45Филм:КопирајућиБетовена 23.00НЦИС 00.00Вести 00.15Изавести 00.45Милица² 01.00Филм:Заплет 03.00Милица² 03.30НЦИС 04.30Филм:Заплет

Пензионисани ФБИ агент Тери Мек алеб недавно је имао трансплатацију срца. Грасијела Риверс га унајмљује да истражи смрт њене сестре Глорије која је Мекалебу донирала срце. Мекалебсазнаједајеубиство,које је убица хтео да прикаже као последицу пљачке, води доФБИ-а. Улоге: Клинт Иствуд, Џеф Денијелс, Анђелика Хјустон, Дилан Волш Режија: Клинт Иствуд (Б92, 21.05)

Анђелика Хјустон

07.00 Добројутро 10.00 ПутокосветабyДулеиРадојка 10.30 ДобровечеСрбијо 11.30 Наслеђеједнедаме 12.30 Краљицајуга-последњаепизода 13.30 Сестре 14.30 Квиз,породичниобрачун 15.00 Гојковићи 15.30 Ноћујуну 16.30 Маланевеста 17.40 Националнидневник 18.00 Тајнаљубав 18.30 Наслеђеједнедаме 19.30 Националнидневник 20.00 ПутокосветабyДулеиРадојка 20.30 ТитоиДража 21.00 Брачнисудија 22.00 48сатисвадба 23.30 Црнахроника 00.00 Наслеђеједнедаме 01.00 Ноћујуну 02.00 Филм: Краљкомедије

Мина Костић

Једнажеља, једнапесма Гости водитељк е Тијане Марковић биће познате певачи народне музике: Џеј, Нада Топчагић, Мина Костић и Горан Јевтић, који ће, у новом амбијенту и уз подршкуоркестраМише Мијатовића, гледаоцима испуњаватимузичкежеље. (Хепи, 20.00) 05.30 07.55 08.00 08.10 08.35 08.50 09.00 09.15 09.25 09.40 09.55 10.00 10.25 10.45 11.10 11.35 12.00 12.10 12.20 12.30 12.40 12.50 13.20 13.40 13.55 14.00 15.00 15.40 15.55 16.00 17.55 18.25 19.00 19.55 20.00 21.55 22.00 23.00 23.55 00.00 00.55 01.50 02.30 03.15 05.15

Јутарњипрограм Вести МалимедаЧарли Повратакмалогтигра БобаиБиба БајкаоТибету Метеор имоћникамиони Анђелинабалерина Срећназвезда–Представљање Телешоп Вести Бакуган Хорсленд Сабрина Југио АвантуремалогПере Метеор имоћникамиони Ноди МалимедаЧарли Торк Срећназвезда–Представљање Квизић Пресовање Телешоп Вести ЗвезданакапијаСГ1 Црвениорао Телешоп Вести Вишеодигре,филм Телемастер Насловнастрана,квиз Црвениорао Вести Једнажеља,једнапесма Вести СузеБосфора ЗвезданакапијаСГ1 Вести Црвениорао СузеБосфора ЗвезданакапијаСГ1 7живота Једнажељаједнапесма Насловнастрана,квиз

Radio Novi Sad PRO­GRAM­NA­SRP­SKOM­JE­ZI­KU:­ UKT­87.7,­99.3,­99.6MHz­i­SR­1269­KHz­(00,00-24,00) PRO­GRAM­NA­MA­\AR­SKOM­JE­ZI­KU:­ UKT­90.5,­92.5­i­100.3­MHz­(00,00-24,00) PRO­GRAM­NA­OSTA­LIM­JE­ZI­CI­MA­-­ SLO­VA^­KOM,­RU­MUN­SKOM,­ RU­SIN­SKOM,­ROM­SKOM,­BU­WE­VA^­KOM­I­MA­KE­DON­SKOM­JE­ZI­KU­ UKT­100­i­107,1­MHz­(00,00-24,00)

07.00Уз кафу,07.30Бели лук у папричица,08.30 Цртани филм,09.00Одељење за убиства,10.00 Шоу -Парови,11.00Кућа 7жена,12.00Србија коју волим,13.00Зрно по зрно,14.00Живети свој живот,15.00Спортска галаксија,16.00Освета,18.00Одељење за убиства,19.00Објектив,20.00Пипи шоу,22.00Објектив,22.30Кућа 7жена,00.00Објектив,00.30Ток шоу

08.15 Школа, 08.45 Топ шоп, 09.00 Ауто шоп, 09.10 Туристичке, 09.25 Тандем, 09.30 Фокус, 10.00Мозаик,12.00Кухињица,12.45Туристичке, 13.05Фокус,13.45Топ шоп,14.00Мозаик,16.00Фокус,16.25Тандем,16.40Булевар, 17.30 Златибор, 18.00 Мозаик, 20.00 Фокус, 21.00 Фам, 21.25 Филм, 23.15Фокус,23.40Туристичке,00.25Ауто шоп,00.35Хај-фај,01.30Фокус

08.00 555 личности,  09.00 Преглед штампе, 09.30 Актуелно, 09.40 НС инфо, 10.15 Док. филм,11.00Пун гас,12.15Уторком у 21,13.20 ИнЏој,14.00Акценти,14.15Писмо глава,15.15Токови моћи,16.00Акценти, 16.30 Квиз, 18.00 Акценти, 18.15 Наш град, 19.00 Актуелно, 20.05 Икс арт, 21.00Екстреми,23.00Ко пре њему две,00.15Комерцијални програм

08.00 Дечији програм, 09.00 Кухињица, 10.00 Главни осумњичени,10.30Кад порастем бићу..., 11.00 Никад се не зна, 12.00 Отворени екран, 13.00Метрополе и регије света,14.00Инфо К9,15.00Контранапад,16.00Инфо К9,16.45Бибер,17.00Главни осумњичени,18.00Лек из природе,18.30Инфо К9,19.00Кухињица,19.45Бибер,20.15Травел клуб,21.15Отворени екран, 22.15Бибер,22.35Инфо К9,23.00Филм,01.00Бибер,01.30Ноћни програм

12.00Сремнадлану:Рума,13.00Џубокс,14.30 Ловциназмајеве,15.00ДокторХу,15.45Кухињица, 16.15 Очи у очи, 17.00 Новости 1, 17.15 Сремнадлану:Инђија,18.10Измеђуредова,19.00Новости 2,19.30Ловци назмајеве,20.00ДокторХу,20.45Док.програм,22.00Новости 3,22.30Шоу програм: Парови,23.30Измеђуредова,00.15Глас Америке

08.00 Банат данас, 09.00 Господин муфљуз, 09.30Опстанак,10.00Филм,12.00Катедрале, 13.00Квиз,14.30Земља наде,15.30Док.програм,16.00Пријатељи и супарници,17.00Под сунцем, 17.50 Вести за глувонеме, 18.00 Банат данас, 19.00 Мозаик дана, 19.30 Храна и вино, 20.00 Пријатељи и супарници, 21.00 Тајни знак, 22.00 Мозаик дана,22.30Макс Кју,23.15Квиз,00.15Под сунцем.


dnevnik

sreda9.novembar2011.

IZBOR IZ SATELITSKOG PROGRAMA

FEQTON

10

31

@IVOT I POSLOVI DR LAZE KOSTI]A

Пише: Милан Живановић 08.35 Све о псима, мачкама, љубимцима 09.30 Грађевинске интервенције 10.25 Четири венчања - Америка 11.20 Удварање у мраку 12.15 Л.А. Инк 13.10 Стручњак за торте 14.05 Најбољи амерички кувар 15.00 Краљ посластичара као кувар 15.25 Џон, Кејт и осморо деце 15.55 Венчаница из снова 16.20 Шта не треба обући 17.15 Све о псима, мачкама, љубимцима 18.10 Грађевинске интервенције 19.05 Мајами инк 20.00 Богата млада, сиромашна млада 20.55 Венчаница из снова 21.50 Нисам знала да сам трудна 22.45 Др Џи: Форензични патолог 23.40 Л.А. Инк 00.40 Богата млада, сиромашна млада 01.40 Венчаница из снова

07.00Добро јутро, Хрватска 09.09 Краљ винограда 10.13 Поглед у будућност, док. серија 11.10 Опра шоу 12.00 Дневник 12.34 Кад заволим, време стане 13.20 Све ће бити добро, серија 14.16 Реч и живот 14.50 Алиса, слушај своје срце 15.35 Алпе Дунав Јадран 16.05 ХАЗУ Портрети 16.25 Хрватска уживо 17.45 8. спрат, ток шоу 18.24 Од Ларк Рајса до Кендлфорда 19.30 Дневник 20.10 Стипе у гостима 20.50 Мисија 21.45 Паралеле 22.15 Отворено 23.05 Дневник 3 23.40 Други формат 00.30 Шаптач псима 01.20 Опра шоу 02.00 Жица 02.55 Прекид програма ради редовног одржавања уређаја 04.40 Краљ винограда

08.00 Мистерије историје 09.00 Рим није изграђен за један дан 10.00 Ратници 11.00 Ноћ сломљеног стакла 12.00 Атина. истина о демократији 13.00 Други светски рат у боји 14.00 Мумија која је дошла из леда 15.00 Ко си заправо ти? 16.00 Рембрантово “Оптужујем” 18.00 Свет по Ленону 19.00 Црна смрт 20.00 0,9 Ампера 21.00 Ланкастер у рату 22.00 Тајм тим година X 23.00 Ко си заправо ти? 00.00 Рембрантово “Оптужујем”

08.00 08.30 09.30 10.00 10.30 11.00 13.15 16.00 18.00 20.00 22.00 00.00

Легенда о змају Завера Розвел Легенда о змају Дигсвил Завера Рузвел Очима убице Анђео и одметник Још један дан у рају Нестанак Гарсија Лорке Бу! Земља чуда Еротски филмови

Нестанак Гарсија Лорке

Прича о новинару који покушава да истражи мистериозни нестанак чувеног песника и тада политичког агитатора који је нестао убрзо након избијања шпанског грађанског рата 30-их година. Улоге:ЕндиГарсија,Есаи Моралес,НаимТомас Режија : МаркосЗуринага (Синеманија,18.00)

ЕндиГарсија

06.00 Улични плес 3Д 07.40 Мармадјук 09.10 Роми и Мишел на годишњици матуре 10.40 Има ли тамо кога? 12.10 Чудовишта данас 13.55 Истините приче 15.25 Чувар моје сестре 17.15 Свадбена торта 18.45 Наопак дан 20.05 Паклене улице 21.50 Права крв 22.50 Џоунсови 00.25 Рок барка 02.40 Страва у Улици брестова 04.15 Живот без граница

06.20 08.20 09.20 10.20 12.20 13.20 14.20 15.20 17.20 18.20 19.20 20.20 21.20 22.20

Дијагноза: Убиство Неш Бриџис Закон и ред Дијагноза: Убиство Неш Бриџис Вокер, тексашки ренџер Закон и ред Дијагноза: Убиство Ургентни центар Вплер. телсађло ренџер Неш Бриџис Ургентни центар Плаве крви Хаваји

07.50 09.45 10.30 11.25 13.15 14.10 15.05 16.55 17.05 18.00 18.30 19.05 20.00 21.00 21.50 23.40 23.55 01.35 02.35 03.20

Кобра 11 ТВ продаја Вечера за 5 Емператриз Крв није вода Крв није вода Кобра 11 РТЛ 5 до 5 Вечера за 5 Ексклузив Таблоид РТЛ Данас Крв није вода Ружа ветрова Кости ЦСИ Њујорк РТЛ Вести Пут освете Астро шоу Кости РТЛ Данас

СЕРИЈА

ЦСИ: Њујорк

Брус Вилис

Умри мушки 2 Највећи међународни аеродром постаје арена смртоносне борбе у коју ће неочекивано бити увучен детектив Џон Меклејн. Његов је противник бивши амерички војни заповедник који предводи групу специјалаца... Улоге: Брус Вилис,Бони Беделија, Вилијам Атертон,Реџиналд Вел Џонсон, Франко Неро,Денис Франц Режија:Рени Харлин (ХРТ 2,21.00) 07.50 08.20 08.45 09.30 10.00 10.45 12.15 13.00 13.25 13.50 14.30 14.55 15.20 15.50 16.05 16.20 16.45 17.05 18.00 18.20 18.35 19.05 19.30 20.00 21.00 23.05 00.05 00.50

Мала ТВ Серија за децу Школски сат Четворо против З Алиса, слушај своје срце Теретњак за Африку, филм Краљица тестенина Потрошачки код Еко зона Бриљантин Х2О Уз мало воде! Еџмонт Школски сат Изазови Руперт Мала ТВ Цртана серија Шаптач псима Регионални дневник Жупанијска панорама 4 зида Патак Фрка Музика, музика... шансоне Гевин и Стејси(1/8) Умри мушки 2, филм Жица Закон и ред Стари момци

08.00 Жена, мајка, убица: Прича М. Хилија 10.00 Очима убице 12.00 Чланица клуба 13.45 Један неваљали момак 15.30 Три слепа миша 17.30 Опседнута 19.30 Управник затвора Ред Рок 21.30 Широка вода 23.15 Замишљени саиграч 00.00 Четврта прича 02.45 Жена, мајка, убица: Прича М. Хилија 04.45 Очима убице

08.20 Бела палата 10.00 Прва лига 2 12.00 Прва лига 3: Повратак у друголигаше 14.00 Повратак у рај 16.00 У акцији 18.00 Предлог 20.00 Милерово раскршће 22.00 Повратни удар 00.20 Врући сусрети 02.00 Прљави кодекс

У финалу шесте сезоне ЦСИ тим прати траг лукавог криминалца Шејна Кејсија и схвати да је његова следећа мета Дени. Сада Кејси прати Данија, Линдси и њихову кћерку, који се налази на одмору ван града... Улоге: Гери Синис, Скит Урлих,ЕдвардФурлонг,СараКартер,ДаницаПатрик (РТЛ,21.50)

ГериСинис

10.00 10.30 10.55 11.50 12.45 13.40 14.35 15.30 16.25 17.20 18.15 19.10 19.40 20.05 21.00 21.55 22.50 23.45 00.40 01.40

Како то раде? У делићу секунде Преживљавање Лимарска радионица/Лондон У потрази за забавом Амерички чопери Прљави послови Опасан лов Разоткривање митова Врхунско градитељство Преживљавање Како се прави? Како то раде? Врхунски војник Најбољи остају Мајстори за оружје Погранична полиција Разоткривање митова Врхунски војник Најбољи остају

08.30 08.45 09.15 12.30 13.30 16.00 17.00 19.00 21.05 21.10 22.10 22.15 22.50 23.00 23.30 00.00 00.45

Мотоспортови Аутомобилизам Фудбал Дизање тегова Фудбал Дизање тегова Фудбал Дизање тегова Сви спортови Коњички спорт Коњички спортови Голф Једрење Тенис Сви спортови Фудбал Дизање тегова

Побратими по перу

О

ономе {та је уистину претходило његовом ректне рецензије. Тако Лаза не само да је био путу у Црн у Гору, Лаз а ниј е хтео да вр{њак кња`ев него и његов „побратим по перу„ оптере}ује Мат авуљ а, буду}ег вел иког коме је овај дуго вагао улогу коју }е му дати као пријатеља. Листа Кости}евих занос а и низбрдица свом госту, али и ~иновнику. Средином јула постала је повелика, а све је и{ло дотле да 1885. Лаза је обаве{тен да је постављен за уредогор~ени Лаза јануара 1879. пи{е из Бе~а прија- ника „Глас а Црн огорц а„, звани~ног орг ан а тељу Јовану Бо{кови}у: „...ако за који дан не до- Кња`евине, с платом од 100 фјорина месе~но и с бијем друге прилике, гледа}у да се докопам додатком од обезбе|ених претплатика. ко~ија{ке слу`бе код бе~ког трамвај а, но како ни то не иде без протекције, не верујем да }е ме та бува ујести...” Млад ен Лес ковац тај ход од недрага до немила резимира овако: „Кости} је до{ао на Цетиње после низа те{ких ли~них пораза. [та је све претурио преко главе тих год ин а! некол ико Пропао је на изборима за пе{тански Парламент, план о покретањ у дневн ог лис та није се остварио, онај о кор ес под енц био ру јо{ мање, напис ао је ону бедну „Окупацију„, брзо схватио да је слаба, па о њој }утао као заливен. Основно на~ело је објављено у „Летоп ису„, али без ве}ег одјека, од катеЛоканда,Костићев дом на Цетињу дре на Великој {коли није могло бити ни{та, изјаловио се и план да О том послу, на којем }е звани~но остати све у|е у бе~ки Рајхстаг, гувернадурство у Бару до 27. април а 1891, Кости} се јавн о ниј е спре~ио је Андра{и ли~но, није оти{ао у Сара- изја{њавао, па ни сам Мат авуљ ниј е мог ао јево, ако је то уоп{те озбиљно мислио, његова закљу~ити да ли је био задовољан или није. Прву краткот рајна дипломатска каријера завр{ила се горку пилулу он је ве} попио када је по налогу и безмало скандалом, после трогоди{њег боравка о тро{ку књаза морао да напи{е приказ за његоу Београду морао се оданде склонити крију}и се ву драму „Балканска царица„ и објави га 1885, да не би допао затвора, а ту негде треба тутнути и доду{е под псеудонимом, у бе~кој „Новој слоону ту`но-коми~ну веридбу с Јул~ом. Ако је бодној {тампи„. Специјално због тог деликатног истина да се мо`е у~ити на поразима, оволико их задат ака, до којег је књазу било изузетно стало, је ипак преви{е...” Лаз а је доб ио пла}ено одсус тво, усп ут Зато је ту Цетиње, најмла|а европска престо- обављају}и неке мутне полити~ке послове о којиница, у којој се по~ела скупљати дипломатска ма су реф ер ис ал и бе~ки и српс ки `бири, елит а и градити ~увена попоказују}и тиме да Кости}у сланства. За Лазина временикада до краја нису вероваКомпромиси које је Лаза на све је то јо{ било по ли и да је био под сталном ку}ама, а дома}инстава ниправио у Црној Гори су такви пол иц ијс ком пратњ ом, на је било ви{е од 200 и стасвим нивоима. и толики да је он сам негде новника ви{е од 1.500. Но, Комп ромиси које је Лаз а записао да „сваки човек има и даље све се збива од Биправ ио у Црн ој Гори су тачасова када није он” љард е до Локанд е, новог кви и тол ики да је он сам двора књаза Николе, и Зетнегде зап ис ао да „свак и ског дома у којем су библи~овек има ~асова када није отека, музеј и позори{те. О првом периоду Лази- он„. За драмско дел о свог послодавц а није, сване аклиматизације Мат авуљ ка`е: „За ду`е вре- како, мог ао да ка`е да је ген ијалн о а да је његов мена Лаза је био приједмет оп}е па`ње. Кнез и твор ац исти так ав пис ац. А управ о се то кнегињице ~есто га позиваху; мла|и Петрови}и, о~екивало, тим пре {то су друг и то и говорил и Пиге, дипломате, сва остала интелигенција, оку- на сва уста и пис ал и где су стигли. Кости}ев пљају се око њега. Становао је и хранио се у Ло- приказ „Балканске цариц е„ имао је друга~ији канди. Лијегао је доцкан, устајао доцкан. Готово приступ и тон. Упркос похвал ама, а све преко цијело вријеме до подне пролазило му је у тоале- ле|а неду`ног Њего{а, књаз Никол а није био ти и дору~ку, послије подне у карт ању, пред ве~е задовољ ан, пос ебн о {то је у све, мора се приу вратоломији, јер његове {етње бјеху права вра- знат и врл о ве{то, Лаз а уплео поглав ље о ласкатоломија по брдима цетињским.” њу као опасности у реа лн ом оцењ ивањ у нап ис аСам књаз је био амбициозан др`авник и јо{ ног. Књаз је то одмах проз рео и Кости} је добио самоуверенији песник / драмски пис ац који не са- прв и мин ус, али и до`ивео пад на лествиц и мо да је хтео да „надњего{и Њего{а„ него и сву о~екиваних ду`ности. На стран у {то је и сам драмску класику. Његова околина, одани дворски Лаз а играо улог у војводе Лал а и у спец ијалн о слу`беници и све{теници, поптуно су га увера- {ивеној црн огорској но{њи изговарао два-три вали у ту опасну заблуду. И сам Кости} као да је стиха и до`ивљавао аплауз е на отворен ој сцен и био позван да томе да властору~не потврде ди- на Цет ињ у, али и на гостовањ има.

Књигу Милана Живановића „ЛАЗИН КРОС ЖИВОТУ УЗ НОС 1841–1910”, у издању “Прометеја” и „Тиског цвета” можете уз попуст од 20 одсто купити за 640 динара у новосадској књижари “Мост” (Змај Јовина 22, тел. 021/ 529–899). Prvi broj Slobodne Vojvodine" {tampan je kao organ Pokrajinskog narodnooslobodila~kog odbora za Vojvodinu " 15. novembra 1942. u ilegalnoj {tampariji u Novom Sadu. Od 1. januara 1953. Slobodna Vojvodina" izlazi pod imenom Dnevnik". " " Prvi urednik - narodni heroj SVETOZAR MARKOVI] TOZA pogubqen od okupatora 9. februara 1943. Izdava~ „Dnevnik Vojvodina pres d.o.o.”, 21000 Novi Sad, Bulevar oslobo|ewa 81. Telefaks redakcije 021/423-761. Elektronska po{ta re­dak­ci­ja@dnev­nik.rs, Internet: www.dnevnik.rs. Glavni i odgovorni urednik Aleksandar \ivuqskij (480-6813). Generalni direktor Du{an Vlaovi} (480-6802). Zamenik generalnog direktora Smiqa Maksimovi} (480-6816). Ure|uje redakcijski kolegijum: Nada Vujovi} (zamenik glavnog i odgovornog urednika, unutra{wa politika 480-6858), Miroslav Staji} (pomo}nik glavnog i odgovornog urednika, nedeqni broj 480-6888), Dejan Uro{evi} (ekonomija 480-6859), Petar De|anski (desk, no}ni urednik 480-6819), Vlada @ivkovi} (novosadska hronika, 421-674, faks 6621-831), Nina Popov-Briza (kultura 480-6881), Svetlana Markovi} (vojvo|anska hronika 480-6837), Petar Tomi} (svet 480-6882), \or|e Pisarev (dru{tvo 480-6815), Mi{ko Lazovi} (reporta`e i feqton 480-6857), Branislav Puno{evac (sport 480-6830), Jovan Radosavqevi} (Internet slu`ba 480-6883), Ivana Vujanov (revijalna izdawa 480-6820), Filip Baki} (foto 480-6884), Branko Vu~ini} (tehni~ka priprema 480-6897, 525-862), Nedeqka Klincov (tehni~ki urednici 480-6820), Zlatko Ambri{ak (Slu`ba prodaje 480-6850), Svetozar Karanovi} (Oglasni sektor 480-68-68), Filip Gligorovi} (Sektor informatike 480-6808), Mali oglasi 021/480-68-40. Besplatni mali oglasi za Oglasne novine 021/472-60-60. Rukopisi i fotografije se ne vra}aju. Cena primerka 30 dinara, subotom i nedeqom 35 dinara. Mese~na pretplata za na{u zemqu 940, za tri meseca 2.820, za {est meseci 5.640 dinara (+ptt tro{kovi). [tampa „Forum” Novi Sad @iro ra~uni: AIK banka 105-31196-46; Rajfajzen banka 265201031000329276

Dnevnik" je odlikovan Ordenom bratstva i jedinstva sa zlatnim vencem " i Ordenom rada sa zlatnim vencem


monitor

sreda9.novembar2011.

H or os ko p OVAN 21.3-19.4.

Месецјезапловиокрозвашзнак идонеовамемотивнеслабости,романтику и потребу за љубављу. Ипак, држитесесвојихначелаинећетепогрешити.Креативнистеине превишеефикасни.Фаталност.

BLIZANCI 21.5- 21.6.

LAV 23.7-22.8.

DEVICA 23.8- 22.9.

9. novembar 2011.

Диванданзавас! Трошитеновац на лепе ствари, шопинг, излазак, билошташтовампричињавазадовољство. Маштовити сте и романтични, истовремено. Борац у вама сенећепредати,самопредахнути.

BIK 20.4-20.5.

RAK 22.6-22.7.

dnevnik

c m y

32

СредајеМеркуровдан,вашдан, па можете бити у свом пуном елементу.Чинитештавамприја,удруштву драге особе, партнера. Ипак, могућисунеспоразуми.Укомуникацијисеприлагодите.

Могуће су честе промене плановаиусмерења.Немојтебитипопустљиви нити испуњавати туђе захтевемимосвојихпринципа.Такође, немојте се нервирати због ситница којеживотнезначе.

Помало сте већ заморени и потребан вам је одмор, промена средине и односа. У каријери и на пословном плану су извесне неизвесне околности, поготово у вези с једном женском особом.Излазак?

Удомусуприсутнипролазнипроблеми због попустљивости и недоследности.Нарадномместуседржите тесне сарадње с претпостављенима и доследно испоштујте договоре. Иностранство.

Nena Radaшin, astrolog nena.r@eunet.rs

VAGA 23.9- 23.10.

[KORPION 24.10- 23.11.

STRELAC 24.11- 21.12.

JARAC 22.12-20.1.

ВашватрениМарсполакоизлази из краљевског знака Лава па су на видикупромене.Ускороћетезбацитикрунуизасукатирукавенапосве практичанначин.Упартнерствувишеслушајте.

Решавате званичне сит уације, уколикосеприлагодитедатимстандардимаизакону.Путовањесеодлаже,аодносисиностранствомданаснисуусаглашени. Различитиинтересисенеуклапају.

У јавности се представљате у свомнајбољемсветлу.Затоизађите, појавитесеирецитеоноштотреба. Искључивистеитимеизазиватенезадовољство оних који су вам иза леђа. Стабилнистеукаријери.

VODOLIJA 21.1-19.2.

RIBE 20.2-20.3.

Иматемогућностидасарађујетес одређеним мушким ауторитетом. Зато,искориститесвојешансе,али без журбе и не на прву лопту. Има оних који се ослањају на вашу озбиљност,јачинуидоследност.

Уколико останете код куће, уживаћете данас и сутра. Љубав више нијеоноштоваспокрећевећнешто много конкретније и материјалније. Можетеуређивати својдом,куповати намештај.

Краће путовање с дозом умереног хедонизма је сасвим ОК. Ипак, вишерадостивамдоносекомуникативни односи укаријери и послови које обављате у ходу. Ситуација с родбиномнијенајидеалнија.

TRI^-TRA^

Кејтиухаљини безгрудњака V REMENSKA

PROGNOZA

Сунчано

Vojvodina Novi Sad

15

Subotica

14

Sombor

14

Kikinda

14

Vrbas

14

B. Palanka

15

Zreњanin

15

S. Mitrovica 16 Ruma

15

Panчevo

16

Vrшac

15

Srbija Beograd

16

Kragujevac

17

K. Mitrovica 17 Niш

Иако је права реткост видети је на јавним догађајима, а и кад се појави делује помало запуштено, глумица Кејти Холмс пријатно нас је изненадила својом појавом на премијери комедије „Џек и Џил” у Лос Анђелесу појавила се у маштовитој, секси креацији. На премијеру је стигла без супруга Тома, а својом лепотом је заслепила присутне. За ту свечану прилику одабрала је хаљину из сопствене модне линије „Холмс и Јанг”. Црно-љубичаста хаљина наглашавала је њену витку линију. Горњи део хаљине састављен је од трака, тако да грудњак није био потребан, док је доњи део лепршава црна плисирана сукња. Целу линију Кејти је подигла секси ципелама с изразито високом петом, док је сјајну дугу косу распустила.

18

Evropa

и тоПло

Madrid

НОВИСАД: Сунчаноирелативнотопловремезаоводобагодине. Ветар слаб северни. Притисак изнад нормале. Минимална Rim температура3,амаксималнадо15степениЦелзијуса. London ВОЈВОДИНА: Ујутру је могућа магла по Срему и на западу Cirih Бачке.Утокуданасунчаноипријатнотопловремезаоводобагодине.Ветарујутрујугоисточни,азатимслабсеверни.ПритисакизBerlin наднормале.Минималнатемпература2,амаксимална16степеBeч ни. СРБИЈА: УјутрупокотлинамазападнеијужнеСрбијемагла.У Varшava токуданасунчаноипријатнотопловремезаоводобагодине.ВеKijev тарслаб,ујутруисточниијугоисточни,атокомданасеверни.Притисакизнаднормале.Минималнатемпература0,амаксимална18 Moskva степени. Oslo Прогноза за Србију у наредним данима: У четвртак пријатно топлоипретежносунчановремеузтемпературеизнадпросеказа St. Peterburg оводобагодине.УпетакизавикендхладнијеузмаксималнетемAtina пературеисподдесетстепениијутарњемразеве. БИОМЕТЕОРОЛОШКА ПРОГНОЗА ЗА СРБИЈУ: Временске прилике ће бити релативно повољне за већину хроничнихболесника.Известанопрезсесаветујеастматичаримаисрчанимболесницима.Опрезно усаобраћају!

16 22 16 12 14 14 9

VIC DANA Долазимлађаженаубутик: -Купилабихмужуједнулепу кравату,некукојабиистакла његовеочи. Продавачица: -Свакакраваталакомушкарцу истакнеочи,самојетреба доброзатегнути.

6 2 10 5 20

Pariz

15

Minhen

12

Budimpeшta

14

Stokholm

10

SUDOKU

Upiшite jedan broj od 1 do 9 u prazna poљa. Svaki horizontalni i vertikalni red i blok od po 9 praznih poљa (3h3) mora da sadrжi sve brojeve od 1 do 9, koji se ne smeju ponavљati.

VODOSTAњE DUNAV

TAMI[

Bezdan

1 (1)

Slankamen

146 (-12)

Jaшa Tomiћ

Apatin

57 (-2)

Zemun

220 (-20)

Bogojevo

58 (-5)

Panчevo

256 (-14)

Baч. Palanka

88 (-5)

Smederevo

434 (-16)

Novi Sad

83 (-7)

Tendencija stagnacije

SAVA

N. Kneжevac

149 (-2)

S. Mitrovica

97 (-19)

Tendencija stagnacije

Senta

219 (-1)

Beograd

177 (-18)

STARI BEGEJ

Novi Beчej

296 (0)

Tendencija opadawa i stagnacije

Titel

135 (-15)

NERA

Hetin

66 (4)

TISA

22 (1)

Tendencija stagnacije

Tendencija stagnacije

Kusiћ

36 (0)

Reшeњe iz proшlog broja

Dnevnik 9.novembar 2011.  

Elektronsko izdanje novosadskog dnevnog lista "Dnevnik"

Read more
Read more
Similar to
Popular now
Just for you