Page 1

NOVISAD*

SUBOTA4.AVGUST2012.GODINE

GODINALXX BROJ23516 CENA35DINARA * 0,50 EUR

Internet: www.dnevnik.rs * e-po{ta: redakcija@dnevnik.rs

PROIZVO\A^IIPRERA\IVA^IMESANAJAVQUJUPOSKUPQEWA

Odlete but preko {eststo dinara? str. 6

POVODOMDANARE^NEFLOTILE,UNOVOMSADUORGANIZOVANAREGATA

NAPREDWACINEODUSTAJUODPREUZIMAWA NOVOGSADA,ALIPORU^UJUDAPARTNERE NE]E^EKATIUNEDOGLED

Politika 2 Vu~i} imenovan za sekretara SNB, a Rodi} za {efa BIA

Igor Mirovi}: U septembru }e se sve znati

NoviSad

str. 3

str. 6

Foto: N. Stojanovi}

GORANKNE@EVI]JU^E OTPUSTIOSAVETODAVCE

Bez posla ostalo vi{e od 1.600 agronoma

Vesla~i potvrdili tradiciju srpskih brodara

str. 7

Ratari tra`e gorivo za jesen i pare za subvencije str. 6

PROSE^NAZARADAPOSTANOVNIKUUSRBIJIJEDVA10.000DINARA

Beogra|ani i Novosa|ani zara|uju deset puta vi{e od ostatka Srbije

str. 4

n MILORAD^AVI]OSTAO BEZMEDAQE

str. 14 – 18

n fUDBALEREVO[EODU[EVIO n CRNOGORSKIVATERPOLISTA AMBIJENTNA„KARA\OR\U” GAVRILSUBOTI]IZABRAOSRBIJU

7 Dani opet postaju sve topliji i topliji, pune ruke posla za Hitnu pomo}

Vojvodina 11 Radnici „Vojvodinaputa” u Zrewaninu odustali od {trajka, dobili martovsku platu

Crna 13 U Sremskim Karlovcima poku{ali da ukradu metalni most

SPREMASEBUNTZBOGUPU]IVAWA ZAPOSLENIHNAPLA]ENIODMOR?

NAJVE]AVOJVO\ANSKAPAORSKAUDRU@EWAPISALAMINISTRU IVOJVO\ANSKOMSEKRETARUZAPOQOPRIVREDU

SPORT

NASLOVI

Radnici NIS-a prete blokadom pumpi str. 4

Sun~ano i toplo Najvi{atemperatura36°S


2

POLiTikA

subota4.avgust2012.

Vu~i}sekretar Savetazanacionalnu bezbednost Predsednik Srbije Tomislav Nikoli} imenovao je ju~e potpredsednika Vlade i ministra odbrane Aleksandra Vu~i}a za sekretaraSavetaza nacionalnu bezbednost, saop{tila je Pres-slu`ba predsednika Republike. Vu~i} je u svojstvu sekretaraSavetaza nacionalnu bezbednost u~estvovao ju~e na sednici tog tela,nakojojjerazmatranovi{eaktuelnihbezbednosnihtema,navodiseusaop{tewu.Imenovawe

Vu~i}anaovufunkcijupostalojemogu}enakonusvajawaiz-

mena Zakona o osnovama ure|ewa slu`bi bezbednosti,kojimsuserazdvojile funkcije {efa kabineta predsednika Republike i sekretara Saveta za nacio- nalnu bezbednost. Natajna~inVu~i} }e koordinisati rad bezbednosnih slu`bi. Vu~i} je ministarodbraneuVladiSrbije,akaoprvi potpredsednik Vladezadu`eniza odbranu i bezbednost i borbu protivkorupcijeikriminala.

Neboj{aRodi} novi{efBIA Neboj{a Rodi} imenovan je ju~e za novog direktora Bezbednosno-informativne agencije (BIA),potvr|enojeTanjuguuVladiSrbije. Rodi} je na tu funkciju imenovan na ju~era{wojsedniciVladeSrbije. Rodi}jeiskusanpravnik,apredolaskana~eloBIA,do31.majaobavqaojedu`nostgeneralnog sekretara predsednika Srbije Tomislava Nikoli}a. Bio je sekretar RIK-a 1997. godine, sekretar Komisije za sprovo|ewe referenduma ou~e{}ustranihpredstavnikaure{avawuproblema na Kosovu i Metohiji 1998, a nakon toga radiojeiuSekretarijatuSkup{tineSrbije,da bi zatim pre{ao u Ministarstvo spoqnih poslova,gdeje,izme|uostalog,biopomo}nikgeneralnogsekretaratada{wegSMIP-a. MedijiRodi}aopisujukao„~ovekaodpoverewa“ predsednika Nikoli}a i kao zanimqivost isti~udasuRodi}idosada{widirektorBIA Sa{a Vukadinovi} zajedno radili kao ~lanovi RIK-anaseptembarskimizborima2000.godine. –Rodi}jedr`avnipravniksveomadugimiskustvom i siguran sam u to da bi taj posao obavqaoizuzetnodobro…–rekaojeNikoli},obja{wavaju}iza{tojeba{ondobarizborza{efa Bezbednosno-informativneagencije.

Rodi} je peti direktor Bezbednosno-informativne agencije. Od osnivawa BIA, avgusta 2002.godine,nawenom~elubilisuAndrejaSavi},Mi{aMili}evi} (odjanuara2003.domarta 2004),RadeBulatovi} (dojula2008)iSa{aVukadinovi}.

Vlajko Seni}, Goran Petkovi}, Aleksandar Qubi} i Edi Majstorovi}. Peri{a Simonovi}, Simo Vukovi}iVladimir\uki} postavqeni su za dr`avne sekretareuMinistarstvuzdravqa. U Ministarstvu spoqne i unutra{wetrgovineitelekomunikacijazadr`avnogsekretara imenovana je Tatjana Mati},dokjeMiodragJoci} imenovanzadr`avnogsekretarau Ministarstvu gra|evinarstva iurbanizma.

Radivoje Mitrovi} ponovo je postavqen za dr`avnog sekretarauMinistarstvuprosvete,dok je Milana Raki} postavqena za dr`avnogsekretarauMinistarstvu prirodnih resursa, rudarstvaiprostornogplanirawa. Za sekretara Ministarstva prirodnih resursa, rudarstva i prostornog planirawa postavqenajeGordana[koro,azasekretaraMinistarstvaspoqnei unutra{we trgovine i telekomunikacija Danijela Ga~i}-Vuki}evi}.

RAZMENAPOLITI^KEARTIQERIJEIZME\UURS-aILSV-aUNOVOMSADU

Kojeko~io decentralizaciju

FunkcionerUjediwenihregiona Srbije Slobodan Mara{ ocenio je da je ostavka Nenada ^anka na funkciju predsednika Nacionalnogsavetazadecentralizaciju „prvi i jedini konkretankorakkojijena~iniozasve ovegodinepredsednikovawa„.U pisanom saop{tewu medijima Mara{, koji je ~lan Predsedni{tvaURS-a,istakaojedajezatu ostavku„bilokrajwevreme„jer, kakoka`e,liderLigesocijaldemokrata Vojvodine na planu decentralizacije nije u~inio ni{ta,tedaiaktuelnuostavkukoristiiskqu~ivoumarketin{ke svrhe.IzLigesocijaldemokrata Vojvodine uzvratili su da odgovornost za ko~ewe procesa decentralizacije snosi lider URS-aMla|anDinki}. – Nenad ^anak je 20 godina teoretisaoodecentralizaciji,

PARLAMENTDANASRAZMATRAAMANDMANENAIZMENEZAKONAONBS-u

[o{ki}evaostavka zasenilaamandmane

Skup{tina Srbije raspravqa}e danas o amandmanima na predlo`eneizmeneZakonaoNarodnoj banciSrbije,aglasaweoovomzakonuo~ekujeseve~erasiliuponedeqak,6.avgusta.PredlogizmenaidopunaZakonaoNBS-upodneloje105poslanika,auobrazlo`ewu je navedeno da se izmenama ne dira u samostalnost i nezavisnostcentralnebanketedasuone usmerenekapove}awunadzoraNarodne skup{tine nad NBS-om u skladusaustavnimodredbama. Tokom rasprave o zakonu u na~elu,stiglajeipismenaneopoziva ostvaka doskoro{weg guverneraDejana[o{ki}a,o~emujeposlanike obavestio predsednik Skup{tine Srbije Neboj{a Stefanovi}.Tojedelompreusmerilo raspravu o predlo`enim izmenamaZakonaoNBS-usglavneteme– smene guvernera, a predsednik parlamenta je nagovestio mogu}nost da se nakon [o{ki}eve ostavke, ve} u ponedeqak zaka`e sednica na kojoj }e biti izabran noviguverner.Dali}etakoibiti,zavisiodtogadali}epredlog za novog guvernera, koji treba da do|esAndri}evogvencaodpredsednika Srbije Tomislava Nikoli}a, sti}i u roku koji predvi|a Poslovnik parlamenta. On je naveoidauslovzaizborprvog~ovekaNBS-anijeusvajaweizmenaZakonaoNBS-u,sobziromnatoda je[o{ki}podneoostavku,ipodsetio na to da guvernera bira Skup{tinanapredlogpredsednikaRepublike. Skup{tinski odbor za finansije ju~e je odbacio ve}inu od ukupno 49 amandmana koliko je

podneto na ove izmene. Jedan od amandmanakojijeprihva}enpredvi|adaseguverner,viceguverner idirektorUpravezanadzorbiraju u Skup{tini Srbije. Drugi

we ~lana 18 da bi se otklonila svakamogu}nostdasedeviznerezerveNBS-atro{ezafinansirawedr`ave,lokalnihsamoupravai javnihpreduze}a.

Svipodr`aliSa{uJankovi}a Poslanici}eovusednicuokon~atiizboromSa{eJankovi}a za ombudsmana, koga su za tu funkciju predlo`ile poslani~ke grupeLDP,SPSiDS,apodr`alisugasviposlani~kiklubovi.Jankovi}u}etobitidrugimandatnafunkcijiombudsmana. amandman koji je tako|e prihva}enjeda}esamoguvernerNBS-a mo}idapotpisujere{ewaodavawuilioduzimawudozvolazarad bankama,auprvobitnimizmenama ZakonaoNBS-utakvaovla{}ewa bilasupredvi|enaizadirektora Upravezanadzor. Me|uamandmanimaokojima}e sedanasraspravqatijeionajkoji je podnela poslani~ka grupa URS-a,awimesepredla`ebrisa-

Opozicija je uputila kritike jer je u izmenama zakona videla presveganameruvlastidasesmeniguverneraDejana[o{ki}a,da segrubonaru{inezavisnostcentralnebanke,akritikesuuputili i zbog hitnosti postupka. Narodni poslanici Lige socijaldemokrataVojvodinepodnelisusedamamandmananapredlogizmena ZakonaoNarodnojbanciSrbije. S.St.

SNS:Li~ni~in

[efovikancelarija idr`avnisekretari ZadirektoraKancelarijeza KosovoiMetohijuVladajeju~e imenovala Aleksandra Vulina. Kancelariju za odr`ivi razvoj nedovoqno razvijenih podru~ja vodi}e ministar bez portfeqa Sulejman Ugqanin, navodiseusaop{tewuVlade. VladaSrbijepostavilajeju~e vi{e dr`avnih sekretara i sekretara ministarstava, saznajeTanjuguNemawinoj11.U Ministarstvufinansijaiprivrede kao dr`avni sekretari postavqeni su Ivica Koji},

dnevnik

12godinasedeouvlasti,ni{ta ne rade}i, dok je decentralizaciju, za svega nekoliko meseci, pokrenuoURS–poru~iojeSlobodanMara{. On je dodao da Nacionalni savet za decentralizaciju odr`aotekjednusednicu,17.marta 2010. godine, a da je URS je pre godinudanauspeodaspolamilionapotpisagra|ana,odkojih 140.000 iz Vojvodine, izdejstvujezakonskeizmenekojesuobezbedilefiskalnudecentralizacijuivratilelokalnimsamoupravamaiAPVojvodiniimovinu. –Dokje^anakpri~aopri~e, URS je nalazio re{ewa. Neodgovorno je i nedosledno pretitime|unarodnimfaktoromoko eventualne promene vlasti u Novom Sadu i praviti li~ni marketingokoostavkenajednu

odfunkcijakoje^anakobavqa –oceniojeMara{. LigasocijaldmeokrataVojvodineupozorilajenatodaMara{evo saop{tewe ukazuje na poku{ajobra~unasopozicijom.U saop{tewu, koje je potpisao potpredsednik novosadskog odbora LSV-a Branislav Anti}, isti~e se da je zapravo lider URS-a Mla|an Dinki} godinamabio„jedanodglavnihko~ni~ara decentralizacije uop{te, azatimiradaNacionalnogsavetazadecentralizaciju”. „Cene}iradMla|anaDinki}a i wegovih ministara, ali i novoprido{lih ~lanova poput Mara{a, gra|ani i gra|anke su odlu~ili da u Novom Sadu i u Skup{tini AP Vojvodine URS bude vanparlamentarna stranka„, navodi se u saop{tewu iz LSV-a. B.D.S.

Srpskanaprednastrankasaop{tila je ju~e da je ostavka guvernera NBS-a Dejana [o{ki}a podneta iz li~nih razloga, a ne, kako je obrazlo`eno,radiza{titenezavisnosti Narodne banke Srbije, „koja predlo`enimizmenamazakona nijeniugro`ena”.Usaop{tewu SNS navodi da NBS nije ostvario nijedan od svojih ciqevaipitaza{toguvernerra-

nije nije podneo ostavku. Stopainflacijeupro{lojgodini iznosilajesedampostoibila jeznatnoiznadciqane,azasamo nekoliko meseci do{lo je dodeprecijacijekursazavi{e od12odstoipotro{ena1,5milijarda evra deviznih rezervi naneuspe{nuodbranukursa.U periodu od godinu dana uni{tenojenekolikovelikihbanaka, poput Agrobanke, Pri-

vredne banke Beograd, Razvojne banke Vojvodine i Metals banke. „Guverner se brine da se izmenamazakonanenaru{ipovereweinvestitora,atokomwegovogmandatado{lojedodrasti~nogpadaprodajedr`avnih du`ni~kihpapirajerjeodpo~etka godine po tom osnovu ostvar en o sam o 76 mil io n a evra”,dodajeseusaop{tewu.

TVIT CRTICA PosleTita–[o{ki} Lajnujeovihdana„okupirao“guvernerNBSa,stariibudu}i.Takojeanaliti~ar,saradnik NSPM-a Nikola Tanasi} napisao: „Koliko ja pamtim, ovo je prvi put da se guverner NBS-a regrutujeotvorenoizpartijskihredova.Dosadasubarfolirali„. Napredwak Mario Maleti}, s druge strane, ka`e: „Izgleda da su licemerne suze najvi{e padale u Srbiji za [o{ki}em, posle Tita naravno„. Wegov strana~ki kolega zakqu~uje: „Nije [o{ki} podneo ostavku da ne bi ~ekao smenu, ve}jetou~iwenodabiunarednih{estmeseci primaoplatuod7.000evra!„

[todane RadikalIvanNini} poznatjenalajniposatiri~nimdosko~icama. „Mogu}idirektorRTS-a?[todane?DragoqubMilanovi}31.izlazinaslobodu„,podvla~iNini}.

[tadase(ne)radi Pojedini strana~ki aktivisti kritikuju i svoje i suparni~ke redove. Tako je ~lan DS-a VladimirPe{i} preporu~io„tvitera{ima”: „Koimavremena,nekapogledagovorZorana \in|i}ana’Jutjubu’.Sveto{tojeonpri~ao, danasustranciradekontra„. O novim dr`avnim funkcionerima bele`i: „AkobiVu~i}`eleosvakogadanadaobelodanipojednufunkcijukojujedobio,mislimdabi brojkaod365bilanedovoqna„.

Kriza,kriza, epa{taje Min is tar priv red e i fin ans ij a, lid er URS-a Mla|an Dinki} po~eo je da koristi „Tviter“lajnuzaobja{wewemerakojesedonoseuwegovomresoru. Napitawe:„Za{toseukidajufiskalnekase zanatlijama, gospon ministre?„, Dinki} odgo-

vara: „Zato{tojekriza,pau{alcisu,anemaju ihnitaksisti,niadvokati...„

Jorgobanka DirektorBeogradskefilharmonijeIvanTasovac upodobio je ime kandidatkiwe za guvernerku NBS-a s funkcijom koja je ~eka. „JorgobankaTabakovi}“,zapisaojeTasovacnalajni.

Hokus-pokus Analiti~ar Vladimir Todori} pita se na „Tviteru“: „Hokus-pokus i 500 lekova opet u apotekama...Jel’bitnokoihjezakqu~aoprethodnopaihnijebilo?„

(U){u{ka(va)we Na „Tviter“ lajni se aktivirao i nekda{wi funkcioner DS-a Zoran @ivkovi}. Na pitawe fana:„Zorane,ho}etelisekandidovatizapredsednika DS-a?„, @ivkovi} odgovara: „Naravno, akopostojeminimalniuslovizaregularneizboreiferkampawu„. Jedanod„tvitera{a„ka`e@ivkovi}u:„Mene nervirakakosi}utaosveovegodine,u{u{kanu vinogradu,ito}utite{kooprostiti,ostalosu kolateralirazo~arewa„. @ivkovi} mu odgovara: „Nisam ja }utao nijedandan,alimojuargumentovanupri~uniste~uli zabavqeni halabukom estradne politi~ke demagogije„.

Sa{a@Kihot Zaqubqeniciu„Tviter“nisuuveksigurniu todalijenekinalogpraviilila`an.Takosu biliunedoumicizanalog@Kihot_ex_of idali je iza wega stvarno biv{i i budu}i ombudsman Sa{aJankovi}. Na pitawe: „Da li je ovo zvani~an nalog?„, Jankovi} ka`e: „Ja ’tvitove’ u osnovi smatram ’porukama li~ne prirode’ i ovaj nalog je moj ’li~ni’. Postoji i zvani~ni’, sa ’zvani~nim’ stvarima„. S.St.


politika

dnevnik

NAPREDWACI NE ODUSTAJU OD PREUZIMAWA NOVOG SADA, ALI PORU^UJU DA PARTNERE NE]E ^EKATI U NEDOGLED

Mirovi}:Useptembru }esesveznati Nakon prili~no samouverenih socijalista i drugih potencijalporuka iz novosadskog odbora nihpartnerauwihovojnamerida Srpskenaprednestrankeda}eakpreuzmuvlastuNovomSadu~ekatuelna vlast u Novom Sadu biti tijo{nekolikonedeqaida}ese oborena, izgledalo je da je samo po~etkomseptembraznatidalije pitawedanakada}eugradubiti tu inicijativu mogu}e sprovesti. formirananovakoalicijakojabi Mirovi} je ju~e u izjavi na{em popoliti~komrasporedupreslilistukazaoidajepitawepromekalaonusrepubli~kognivoa.Mena gradske vlasti u Novom Sadu |utim,~inisedaSocijalisti~ka dosta slo`eno, ali da je wegova partija Srbije, koju napredwaci stranka odlu~na da to nastojawe vide kao kqu~nog realizuje i da }e igra~autompolinastavitirazgovoSNS je strpqiv, ali re s potencijalti~kom poduhvatu, i odlu~an u nameri jo{ nije prelominim koalicionim da se vlast u Novom partnerima. li da li }e se napredwacima priA na pitawe u Sadu prekomponuje klonitiiuNovom ~emujesporsaso(Igor Mirovi}) Sadu,gdeje,ina~e, cijalistima koji ve} u drugom mansuobjavilidatredatu partner u vlasti Ligi i denutnonepostojive}inazaformimokratama.Nakonprverundezvarawe nove koalicije u gradu, dok ni~nihrazgovorasnapredwacima napredwaci tvrde da imaju matesocijalisti su, naime, saop{tili mati~kura~unicukojaimtoomoda trenutno ne postoji ve}ina u gu}ava jer ra~unaju i na podr{ku gradskom parlamentu za promenu DSS-a, „Dveri„, SPO-a i Romske vlasti. demokratske stranke – odgovorio Funkcioner Srpske napredne jedasurazgovoriopromenivlastranke Igor Mirovi} poru~io sti u Novom Sadu tek u po~etnoj je,pak,da}enapredwaciodgovor fazi.Uzto,kakojenaveo,utoku

suigodi{wiodmoriimnogiodbornicinisuugradu. – Tako da u svemu ovome treba biti krajwe strpqiv. I SNS jeste strpqiv, ali i odlu~an u nameri da se vlast u Novom Sadu prekomponuje.Miimamosamo15 odbornika,inezavisisveodnas. Aukolikosesvestrankekojeste naveli,uzSPS,slo`eotome,mi }emoimative}inu.Akoseneslo`e,ondane}emo–kazaojeMirovi}.

DS: Na{i odbornici ne}e izneveriti Novi Sad Odborni~ka grupa Demokratske stranke u Skup{tiniNovogSada„IzborzaboqiNoviSad–Bojan Pajti}”demantovalajeju~espekulacijeomogu}ojdestabilizacijipostoje}eskup{tinskeve}inekojesu seujavnostipojavileuporedosnajavompromenevlastiugradu,adokojebi,navodno,moglodo}ii„kupovinom”odbornikatrenutnovladaju}ihstranaka. „@elimodaobavestimojavnostdajeodborni~ka grupa ’Izbor za boqi Novi Sad – Bojan Pajti}’ u potpunosti jedinstvena. Novosa|ani su Demokratskojstrancipoverilinajvi{emandatauSkup{tinigradainijedanodborniksna{elistene}eizneveritivoqugra|ana,nitidovestiupitaweaktuel-

nuskup{tinskuve}inu„,saop{tilajeju~etaodborni~kagrupa. U saop{tewu se dodaje i da su odbornici DS-a prekju~e odr`ali sastanak na kojem je razmatrana aktuelnadnevnopoliti~kasituacijauNovomSadui dogovoreno da }e se u narednom periodu nastaviti redovneaktivnostiipripremezanarednusednicu gradskeskup{tine. „Demokratskojstrancinaprvommestujepoboq{awekvaliteta`ivotaNovosa|ana,anednevnopoliti~kespekulacijeineprovereneinformacijekojeseneodgovornoplasirajuudelujavnosti„,zakqu~ujeseusaop{tewu.

Onjeporu~ioidase ta inicijativa ipak ne mo`e dugo odlagati te da do kraja avgusta ili po~etka septembra taj proces mora biti okon~an. –Nemo`esetoodlagatiunedogled.Mismo se u tom pogledu i pismeno obratili Socijalisti~kojpartijiSrbije.Smatramodaanaliza situacije i racionalan odgovormoradauslediu narednih nekoliko nedeqa. I tad }e se znati daliprihvatajuna{predlogili }eostatiuaktuelnojgradskojvlasti s demokratama – istakao je Mirovi},uzopaskudautimrazgovorima „nema nikakve misterije kao{totoizgledaujavnosti”. Powegovimre~ima,inicijativa za promenu vlasti postoji i u drugimop{tinama,navode}iprimer Beo~ina, gde su, kako ka`e, napredwaci,DSSiURSnapraviliizajedni~kuodborni~kugrupu, i gde tako|e ~ekaju da im se pridru`eodborniciSPS-a. Mirovi} smatra da bi eventualninegativanstavSPSnaincijativuSNS-auop{tinamaukojima, kako je naveo, „imamao ~istu situaciju”, najverovatnije bio problemati~an i za koalicioni odnosizme|utedvestranke. – U tom slu~aju svakako }e se praviti analiza na{ih generalnih odnosa, ukoliko socijalisti nebiprihvatilina{uinicijativuaupozicijisudaodlu~eotome kako}esepravitive}ina.Me|utim,sadtrebabitistrpqivivideti{ta}esede{avatiunarednimnedeqama–kazaojeMirovi}. B. D. Savi}

subota4.avgust2012.

3

REKLI SU

Dejanovi}:Bi}e uticajanalokal MinistarkazdravqaSlavica \uki}-Dejanovi} izjavilajedanovaVladadelujekaotimida}etrajati pun mandat, bez obzira na to {to je ~ine razli~ite partije. –Ovavladatrebadasara|ujesasviminstitucijamaigra|anima,nezavisnoodizbornevoqekojusuimali,itako}etrajati~etirigodine–reklajeslavica\uki}-Dejanovi}agencijiBeta,prenosiB-92. Onajenaveladajejednopartijskisistemprestaodapostojiidaodavno„brojnestranke~inevlade”,iistakladajesaradwasnapredwacima „korektna”idavladadelujekaotim. –Nemo`etetamo(nasednicamavlade)ba{osetitikojesocijalista, akonapredwak–navelajeona. Dodalajeida}ekoalicijanarepubli~komnivounegdeuticatiina formirawelokalnevlasti.Powenimre~ima,raskidawepartnerstvas DS-omrepubli~komnivoune}euticatinaevropskuperspektivuSPS-a.

Nikoli}:Nema tajneuSrbiji –NematajneuSrbiji,nititajnediplomatije,posebnonemani{tatajnouonome{togospodinVu~i} i ja radimo. Sve je pred o~ima javnosti – kazao je predsednikSrbijeTomislav Nikoli}. Onjerekaoda„slu`bene}ekontrolisatiSNSnegoSavetzanacionalnubezbednost,kojimpredsedavapredsednikRepublike. –Setitesekakojetobilodosada–dodaojeNikoli}. Powegovimre~ima,„novivetrovi”suda{efkabinetapredsednika RepublikenijesekretarSavetazanacionalnubezbednostidavi{ene vodidr`avu,negotoradipredsednik. –Jatra`imovla{}eweiodgovornost,nekrijemseniizapregovara~azaKosovonitiiza{efakabineta,kaoniizaJaneiMare,negoidem napred,kao{tosamto~iniocelog`ivota–kazaojeNikoli}.

Dragi{i}:Neure|ena dr`ava ImenovaweministraodbraneAleksandra Vu~i}a zasekretaraSavetazanacionalnubezbednost„nije nidobronilo{e”,ka`eprofesorZoran Dragi{i}. Onjedodaoda}eSrbija„idaqeostatineure|enadr`avabezjakihinsititucija”. – Srbija i daqe ostaje neure|ena dr`ava bez jakih insititucija i ostajenadagra|animada}eseVu~i},kao{tojeobe}ao,posvetitikriminaluikorupciji–kazaojeDragi{i}agencijiBeta. OnjekazaodajeZakonoure|ewuslu`bibezbednosti„protivustavan ilo{„,kaoidasadanepostojimogu}nostdasepromeniUstavSrbije, kojibitrebalodadefini{eSavetzanacionalnubezbednost. –Nekegre{keu~iweneupro{lostisadasenemoguispravitijerne postojepoliti~kiuslovidaseUstavpromeni–rekaojeDragi{i}. OnjekazaodajesadaVu~i}evaulogausistemunacionalnebezbednosti va`na, ali je bitna i uloga premijera Srbije i ministra unutra{wihposlovaIvice Da~i}a.


4

ekonomija

subota4.avgust2012.

MIROSLAVVASIN

dnevnik

PROSE^NAZARADAPOSTANOVNIKUUSRBIJIJEDVA10.000DINARA

U Vojvodini mawe qudi bez posla

Beogra|ani i Novosa|ani zara|uju deset puta vi{e od ostatka Srbije

Ukupan broj nezaposlenih u Vojvodini je zna~ajno smawen u odnosu na pro{lu i po~etak ove godine, {to pokazuje da napori koje ~ine pokrajinska administracija i Nacionalna slu`ba za zapo{qavawe (NSZ) daju rezultate, izjavio je ju~e u Novom Sadu pokrajinski funkcioner MiroslavVasin. Prema podacima NSZ, Pokrajinske slu`be za zapo{qavawe, na kraju pro{log meseca u Vojvodini je bilo 198.045 nezaposlenih, za 5.088 mawe nego u isto vreme 2011 .

Krajem januara ove godine, u Pokrajini je bilo 207.429 nezaposlenih, {to zna~i da je od po~etka godine taj broj smawen za 9.384, navedeno je na konferenciji za novinare na kojoj su predstavqeni podaci istra`ivawa u okviru “Biznis barometra” o oceni poslovawa i o~ekivawa privrednika Vojvodine.` Vasin, pokrajinski sekretar za privredu, zapo{qavawe i ravnopravnost polova je tom prilikom ocenio da su o~ekivawa privrednika o poslovnoj klimi u Vojvodini “pozitivnija nego {to se misli i predstavqa javnosti” i dodao da su ta o~ekivawa izra`ena u oblasti poslovawa sa inostranstvom. Najve}i skepticizam privrednika izra`en je u pogledu zapo{qavawa, ali i nekih okolnosti koje prate privre|ivawe, kazao je sekretar Vasin i istakao da }e biti nastavqena praksa koja }e “omogu}iti da ukupan privredni miqe bude uskla|en sa o~ekivawem samih privrednika, ~ije su ocene dragocene”.

Amerika ho}e Srbiju u STO Ambasadorka SAD Meri Vorlik i potpredsednik Vlade Rasim Qaji} slo`ili su se o neophodnosti {to skorijeg pristupawa Srbije Svetskoj trgovinskoj organizaciji. Ambasadorka Vorlik je izrazila spremnost da pomogne na{oj zemqi u otklawawu preostalih prepreka za punopravno ~lanstvo u Svetskoj trgovinskoj organizaciji. Qaji}, koji je i ministar spoqne i unutra{we trgovine i telekomunikacija, razgovarao je s ambasadorkom SAD i o unapre|ewu saradwe u oblasti telekomunikacija i oceweno je da bi dobra polazna osnova bilo potpisivawe memoranduma o razumevawu izme|u Vlade i SAD o saradwi u oblasti informaciono-komunikacionih tehnologija, ~iji tekst je usagla{en u maju ove godine.

Prose~na plata u Srbiji je 42.335 diwihove zarade jadne najboqe govori nara, bez poreza i doprinosa, ali kada se podatak da je prose~na plata po glaposmatraju zarade po glavi stanovnika, vi stanovnika u Srbiji u junu iznodobije se sasvim druga~ija, u mnogim mesila 10.285 dinara. stima mnogo tmurnija slika `ivota. U @iteqi Beogradskog regiona i proseku „po glavi” svaki gra|anin SrNovog Sada po toj ra~unici, mese~bije zaradi oko 10.000 dinara mese~no, no zara|uju deset puta vi{e od Opoali u nekim op{tinama Srbije mesec se vqana. Naime, kada se prose~ne plakrpi i s mawe od dve hiqadarke. te pomno`e brojem zaposlenih i poNajni`e plate u Srbiji imaju zapodele brojem stanovnika, dobijamo sleni u Mero{ini, koji, po posledwim prose~ne zarade po stanovniku koje statisti~kim podacima, mese~no dobijasu u Novom Sad i u Beogradu gotovo ju 22.689 dinara. Me|utim, kada se govojednake, a u ostatku Vojvodine i cenri o zaradi po stanovniku, statistika tralne Srbije upola mawe. Kada se pokazuje da u Srbiji ukupan fond zanajbednije `ive grarada u BeogradU nekim op{tinama |ani Opova, koji su u skom regionu poSrbije mesec se krpi i s junu zaradili tek po deli s brojem stanovmawe od dve hiqadarke 1.864 dinara i `iveli nika, dobije se, naime, od toga. Naime, proplata od 18.308 dinase~na plata u Opovu iznosila je 35.055 ra, a u gradu Novom Sadu po istom prindinara i bila je ja~a od one u Mero{ini. cipu, zarade „po glavi” iznose 18.595 diAli, s obzirom na to da ova banatska vanara. A da ne pomiwemo zarade na Savro{ica ima tek 557 zaposlenih, a 10.475 skom vencu, koje se vrte oko 95.000 dina`iteqa, Opovqani su, po glavi stanovra po glavi stanovnika, ili pak u opnika, zaradili najmawe u zemqi. Mereno {tini Stari grad, koje idu do 78.000 dina taj na~in, stanovnici Mero{ine u junara... nu su ku}i odneli 2.318 dinara. Kako Kada je re~ o Vojvodini, recimo i da pre`iveti mesec s bedne dve hiqadarke gra|ani Ba~a, kojih je 14.150 a zaposleno verovatno nije jasno ni samim stanovniih je 2.206, ponaosob zara|uju 4.979 dinacima Opova i Mero{ine, a koliko su ra, dok na primer u Vr{cu ku}i nose ko-

verete s 11.432 dinara mese~no. Interesantno je, recimo, da je prose~na plata u Plandi{tu od 26.190 dinara bez poreza i doprinosa, mawa od one u Opovu, ali `iteqi Plandi{ta „po glavi” imaju 5.065 dinara jer je odnos fona zarada i broja stanovnika povoqniji. Ina~e, Vojvo|ani su po ovom kriterijumu u junu imali zaradu po stanovniku 9.584 dinara. Elem, i posledwi statisti~ki snimci pokazuju da su razlike u prose~nim primawima u Srbiji sve ve}e. Odnosno, Beograd, Novi Sad i nekoliko ve}ih gradova rastu br`e, a ostatak zemqe tone. I

kada je re~ o stopi rasta, i o platama, i o u~e{}u u BDP-u zemqe... Pomenimo da su najvi{e prose~ne zarade u junu u Srbiji ispla}ene zaposlenima na Novom Beogradu – 63.047 dinara. U vrhu po visini plata u junu listom su bile beogradske op{tine, pa posle Novog Beograda, slede Lazarevac sa 62.123 dinara, zatim Sur~in – 61.026 dinara, Palilula – 60.524 i Stari grad – 58.879 dinara. Me|u op{tinama s najni`im platama su, osim Mero{ine, i Ariqe s 22.708 dinara, zatim Dimitrovgrad – 22.922 dinara, Kur{umlija – 23.825 dinara i Vrawska Bawa – 24.289 dinara. Posmatrano po delatnostima, najve}e prose~ne zarade imali su zaposleni u proizvodwi duvanskih proizvoda – 99.269 dinara, a najmawe zaposleni u kinematografskoj, televizijskoj i muzi~koj produkciji – 19.848 dinara. U vrhu po visini plate su i zaposleni u delatnosti udru`ewa – 98.619 dinara, zatim zaposleni u finansijskim uslugama, osim osigurawa i penzijskih fondova – 91.649 dinara, u upravqa~kim delatnostima i savetovawu – 84.363 dinara i u eksploataciji sirove nafte i prirodnog gasa – 84.090 dinara. S.Glu{~evi}

SPREMASEBUNTZBOGUPU]IVAWAZAPOSLENIHNAPLA]ENIODMOR?

Radnici NIS-a prete blokadom NIS-ovih pumpi Prvog dana ovog meseca na pla}eni godi{wi odmor iz Naftne industrije Srbije upu}eno je vi{e od 300 radnika. Taj korak je, po re~ima predsednika Nezavisnog sindikata „Naftagasa„ Save Blagojevi}a, izazvao veliko nezadovoqstvo radnika, i to ne samo onih koji su na prinudnom odmoru. Zbog de{avawa u NIS-u, zatra`ena je pomo} od me|unarodnih sindikalnih organizacija, obave{teni su inspekcijski organi, kao i predsednici dr`ave i Vlade. Ukoliko izostane reakacija, iz ovog sindikata najavqujuju blokadu najprometnijih benzinskih pumpi NIS-a, a istovremeno }e i gra|ani Srbije biti pozvani da u~ine isto – da bojkotuju odlazak na NIS-ove pumpe, ondosno ne kupuju gorivo na wima. U izjavi za „Dnevnik” Blagojevi} ka`e da eventualna blokada najpromentinijih benzinskih pumpi NIS-a zavisi od reakcije nadle`nih, pre svega inspekcijskih slu`bi, i nadle`nog ministarstva. – Blokada benzinskih pumpi je mogu}a i izvodqiva, a usledi}e ukoliko nadle`ni ne daju pozitivan odgovor na na{e zah-

Iz NIS-a, za sada, ne komentari{u eventualne blokade benzinskih pumpi, a potvr|uju da je od 1. avgusta na privremeno pla}eno odsustvo upu}eno oko 330 zaposlenih, da je ta odluka u skladu sa Zakonom o radu Republike Srbije i usagla{ena s predstavnicima reprezentativnih sindikata. Nakon 45 radnih dana, isti~u u NIS-u, radnici

je obim posla radnika koji obavqaju niskokvalifikovane kancelarijske poslove. Iz NIS-a ka`u i da se u skladu sa socijalnim programom i zakonima Srbije, u protekle tri godine primewuje program optimizacije broja zaposlenih. Program dobrovoqnog odlaska prati rad tranzicionih centara gde se zaposlenima pru`a mo-

Poslovaweuskladusazakonom

teve i ako radnici, a ve} ih je oko 400 na prinudnom odmoru, ne budu vra}eni na posao – rekao je Blagojevi}. Po wegovim re~ima, do sada je izdato gotovo 400 re{ewa o odlasku radnika na prinudni godi{wi odmor, {to je vi{e od polovine od ukupnog broja onih koje je poslodavac odlu~io da po{awe na takvu vrstu odmora. On ukazuje na toda se radnici NIS-a upi}uju na prinudni odmor, a istovremeno je anga`ovano vi{e od 2.000 rad-

nika preko nekih drugih, uslu`nih firmi, koji rade iste poslove kao oni koji su na prinudnom odmoru. Tako|e, Blagojevi} ka`e da su radnici koji su na prinudnom odmoru raspore|eni na radna mesta ispod wihove stru~ne spreme. Predsednik Nezavisnog sindikata smatra i da se preteruje u procenama vi{ka zaposlenih i da je sindikat odavno predlagao da se otpremnine za radnike preusmere na otvarawe novih radnih mesta.

Iz NIS-a isti~u da su prava radnika za{ti}ena jednim od najboqih kolektivnih ugovora u regionu, koji je rezultat zajedni~kog rada menexmenta i reprezentativnih sindikata. Tako|e, ukazuje se na to da NIS, kao jedan od najve}ih poslodavaca u Srbiji, posluje strogo u skladu sa zakonskim propisima i po{tuje va`e}i socijalni program, te da }e, kao kompanija spremna i otvorena za dijalog, reagovati i ispitati svaki navod o eventualnim nezakonitim radwama. }e se vratiti na posao, a tokom pla}enog odsustva prima}e nov~anu naknadu koja zna~ajno prema{uje iznos ustanovqen zakonom i koji je vi{i od prose~nog iznosa isplate te vrste na srpskom tr`i{tu. Isti~e se i da je odluka doneta zbog automatizacije proizvodnih i servisnih procesa, {to povremeno smawu-

gu}nost profesionalne orijentacije i pronalaska novog posla. Oni koji odlu~e da napuste kompaniju, odlaze uz otpremnine koje su iznad proseka u zemqi, nagla{avaju u NIS-u, a u slu~aju da zaposleni ne `eli da napusti kompaniju, nudi mu se preme{taj na druge poslove. D.Mla|enovi}

DNEVNIIZVE[TAJBEOGRADSKEBERZE Pet akcija s najve}im rastom

KURSNA LISTA NARODNE BANKE SRBIJE Zemqa

EMU

Valuta

evro

Va`iza

1

Kupovni zadevize

116,0007

Sredwi Prodajni Kupovni za za za devize efektivu efektivu 118,3681

121,0906

115,6456

Australija

dolar

1

99,7856

101,8220

104,1639

99,4801

Kanada

dolar

1

94,6327

96,5640

98,7850

94,3430

Danska

kruna

1

15,5844

15,9024

16,2682

15,5366

Norve{ka

kruna

1

15,7535

16,0750

16,4447

15,7053

[vedska

kruna

1

13,9757

14,2609

14,5889

13,9329

[vajcarska

franak

1

96,5065

98,4760

100,7409

96,2111

SAD

funta dolar

1 1

147,7717 95,2543

150,7874 97,1983

154,2555 99,4339

147,3193 94,9627

Kurseviizovelisteprimewujuseod3.8.2012.godine

Cena

BELEX 15 (436,00 0,13)

Promet

Razvojna banka Vojvodine, N. Sad

14,29

800

40.000

Filip Moris, Ni{

14,07

900

20.700

AIK banka, Ni{

1,21

1.417

381.080

Komercijalna banka, Beograd

9,40

1.280

26.870

NIS, Novi Sad

2.596.186

Energoprojekt holding, Beograd

3,49

445

62.720.560

1,42 Promena %

430 Cena

6.927.079 Promet

Globos osigurawe, Beograd

-19,03

200

2.200

Vital, Vrbas

-14,59

1.580

1.090.310

Albus, Novi Sad

-13,33

182

18.200

Aerodrom Nikola Tesla, Beograd Pet akcija s najve}im padom

Agrovr{ac, Vr{ac Go{a monta`a, Velika Plana Vojvo|anskih top-pet akcija NIS, Novi Sad

V.Britanija

Promena %

Vital, Vrbas Soja protein, Be~ej

Cena

Promet

-0,96

618

0,00

1.170

0,00

Imlek, Beograd

-0,37

2.411

867.800

Soja protein, Be~ej

0,00

500

7.500

Energoprojekt holding, Beograd

0,00

430

1.287.470

Aerodrom Nikola Tesla, Beograd

-1,17

424

706.063

Jubmes banka, Beograd

0,00

10.499

52.495

Metalac, Gorwi Milanovac

0,00

1.697

0,00

Galenika Fitofarmacija, Zemun

0,00

2.015

0,00

Jedinstvo Sevojno, Sevojno

0,00

4.001

0,00

Alfa plam, Vrawe

0,00

5.996

0,00

246.800

Tigar, Pirot

3,20

290

870

Veterinarski zavod, Subotica

0,00

337

0,00

198

164.230

-2,22 Promena %

2.200 Cena

402.600 Promet

-0,81

613

2.037.249

-14,59

1.580

1.090.310

494

Promena %

Komercijalna banka, Beograd

-8,76

-1,20

Naziv kompanije

Agrovr{ac, Vr{ac

-8,76

198

164.230

Razvojna banka Vojvodine, N. Sad

14,29

800

40.000

Sviiznosisudatiudinarima


dnevnik

subota4.avgust2012.

5


6

POQOPRivRedA

subota4.avgust2012.

GORANKNE@EVI]JU^EOTPUsTIOsAVETODAVCE

Bez posla ostalo 1.600 agronoma Agronomi savetodavaci, wih 1.659,anga`ovanihnaprojektuministarstvapoqoprivredeodju~eje bezposla. ministarstvopoqoprivredesrbije raskinulo je saradwu sa agronomima anga`ovanim u radu poqo-

privrednih stru~nih slu`bi, koje jenaodre|enovremeuposlilaprethodnaVladasrbije,augovoreoraskidusaradweju~ejepotpisaonovi ministar poqoprivrede Goran Kne`evi}. Onjeizjaviodajerazlogveliki mawakubuxetusrbije,jerdokraja godine samo za ispuwavawe osnovnihfunkcijamoradapozajmipreko dvemilijardeevra. „Zatonismoumogu}nostidafinansiramo megalomanske projekte biv{evladeibiv{egministrapoqoprivrede,nakojimasutokomposledwih godinu dana za potrebe predizborne kampawe zaposlili preko 1.600 qudi”, rekao je Kne`evi}.Dodaojedajesavetodavcimare~enoda}ebitianga`ovaninagodinu dana i da }e nakon toga dobiti stalniradniodnos,aliodtoganije biloni{ta,jersuanga`ovaninatri meseca na privremene i povremene poslovekojiseuvekmoguraskinuti.

Kukuruz pada na berzi Tr`i{tekukuruzajetrenutnonajinteresantnije,saop{tavajusProduktneberzeuNovom sadu.mnogoje,naime,u~esnika na ovom tr`i{tu, a motivi za trgovawem su im potpuno razli~iti.Nastraniponudetosu pre svega proizvo|a~i, ~iji je osnovni interes pokrivawe tro{kovaproizvodweuz{toje mogu}e ve}u zaradu, s druge strane,kaokupci,pojavqujuse tovqa~istokekojisuve}sada vrlo zabrinuti problemom zanavqawa proizvodnog ciklusa skupim kukuruzom, i kona~no, tujemo`dainajve}itr`i{ni

segmentnastranitra`we,ato su izvoznici, koji mu~e muku oko zatvarawa svojih ranije pruzetih obaveza na terminskomtr`i{tu,itopocenikojajeuglavnomvi{aodonekoje suugovorili.Cenakukuruzase u nedeqi za nama malo primirilaiiznosilaje27,24din/kg (25,22bezPDV-a),{tojepadod 2,38odstouodnosunaprose~nu cenuizprethodnenedeqe. Ovogodi{wicenovnimaksimum p{enice iz prethodne nedeqe od 26 din/kg, bez PDV-a, nije prema{en, ali je to bila prete`na cena trgovawa u nedeqizanama.Prvimesecuekonomskom`ivotup{eniceroda 2012. godine obele`io je i dobarizvozterobeodoko50.000 tona. Prose~na cena trgovawa iznosila je protekle nedeqe 28,04 din/kg (25,96 bez PDV-a), {tojerastuodnosunaprethodnu nedequ od 1,69 posto. Cena sojeposlevrtoglavogcenovnog usponaseprimirilaiiznosilaje77,76din/kg(72bezPDVa).suncokretovasa~mas33odsto proteina se prodavala po 31,86din/kg(27bezPDV-a).

„Tozna~idanijebiloistinskei iskrene`eqedaseonitrajnozaposle.Onizato~aknisuobezbedili sredstvautrezoruiostalisuimdu`ni oko 200 miliona dinara za prethodnikvartal,{topredstavqa jo{ jedan tehni~ki problem, koji

ca, niti mogu}nosti da se projekat nastavi. „Izdaci za wihove tromese~ne tro{kove ministarstvo su ko{tali oko 500 miliona dinara ili do kraja ove godine oko 800 miliona. Na{emi{qewejedajeuovomtrenutkuboqedasredstvakojasuobezbe|enazaovenameneusmerimopoqoprivrednicima da im bar malo ubla`imo{teteodsu{e”,rekaoje Kne`evi}. Prema wegovim re~ima, savetodavcinisuradililo{e,alije pitawe na koji na~in su to obavqaliidalijetoministarstvu potrebno u ovom trenutku. On je kazaodaseo~ekujeda}enajkvalitetniji od wih na}i posao u narednom periodu, posebno u firmama koje su trenutno u restruk-

Nijebilosms-a Nekiodagronomasusms porukomobave{tenidaimprestajeradni anga`aman. „Po{tovanekolege,sazaprepa{}ewemi`aqewemvasobave{tavamodajeodlukomnoveVladeprestaona{radnianga`man.Oddanasvi{enisteuobavezidasepojavqujetenaradnimzadacima.Zahvaqujemo vamnapo`rtvovanomzalagawuiuspe{noobavqeninmzadacima.@elimovamsvimali~nusre}ui{toskorijenala`ewenovogposla”,pisalojeuporucikojusupotpisalikoordinatoriprojekta. ministarjeju~etodemantovao. -Predamnomviditere{ewaonenastavkuugovorasastru~nimpoqoprivrednimslu`bamakojesuanga`ovalatequde.Wima}etobiti poslatodanas,aoni}eihpotompojedina~noobave{tavatiotome-rekaojeKne`evi}. }emomoratidare{avamo”,rekaoje Kne`evi}.ministarjedodaodajeo tome razgovarao sa ministrom finansijaMla|anomDinki}em idaje dogovoreno da u narednom periodu poku{aju da izmire sve te obaveze, alidazadaqeangazovawenemanov-

turiraju.Ugovoresasavetodavcimaje,podsetimo,potpisaobiv{i ministarDu{anPetrovi},atrebalojedava`egodinudana.Uministarstvu su tvrdili da su pare za to obezbe|ene i da ne}e biti problema. s.G.

dnevnik

PROIZVO\A^IIPRERA\IVA^ImEsANAJAVQUJUPOsKUPQEWA

Odlete but preko 600 dinara? Pove}awe cena sto~ne hrane, koje }e dodatno “podgrejati” ovogodi{wajakasu{a,neminovno}e prouzrokovatiposkupqewemesau srbiji,~ijibi“skok”mogaobiti najmawe 20 procenata, najavquju proizvo|a~iiprera|iva~i.sobzirom na sada{wu cenu sviwskog butaodoko530dinara,tobizna~iloda}e{nicla,utomslu~aju, prema{iti630dinara. Podse}aju}inatodajeuprotekladvameseca,anaro~itoujulu, cena sojine sa~me gotovo udvostru~ena, a 20 do 30 odsto su poskupelikukuruzidrugesirovine zasto~nuishranu,direktor“matijevi}agrara”ZoranMatijevi} izjaviojezaTanjugdatomoradovestidopove}awacenamesa,“samojepitawekada}eseonodogoditi”. – Za doma}u sto~arsku proizvodwunajboqebibilodaceneve} sadbudupove}anedabisezaustavila rasprodaja sviwa i goveda i sa~uvao sto~ni fond – istakao je on, ocewuju}i da bi odlagawe poskupqewa`ivemereimesazanekolikomesecibilo,ukrajwemishodu,“lo{ijiscenario”zasve. DirektorIndustrijemesa“matijevi}”,jedneodnajve}ihusrbiji,kojagodi{weusvojojklaniciu Novom sadu preradi vi{e od 250.000sviwaioko20.000bikovai gotovosedammilionapili}a,smatra da bi ova kriza u sto~arstvu mogla biti ubla`ena, a potom i prevazi|ena odre|enim kratkoro~nimidugoro~nimmerama. – Za po~etak bi dobrodo{le odre|enedr`avnesubvencijeza sto~arstvo,ukolikosezatona|e novca u agrarnom buxetu, a moglo bi se razmi{qati i o

Kadbisvakifarmerimaostokrma~a... Dr`avabikonkretnimmerama,presvegapovoqnimkreditima,trebalodapodstakneproizvodwutako{tobisto~ariulo`iliuobjekteiopremu,ukazujufarmeri. –Imamoikvalitetnefarmereikvalitetneprera|iva~emesaitajpotencijalmoramonanajboqina~indaiskoristimo– isti~eVladanBabi},idodajedabisvakiozbiqanuzgajiva~sviwa u sremu mogao imati od 50 do 100 krma~a, {to je odli~na osnovazakvalitetnuproizvodwu. ukidawuporezanadodatnuvrednostnasve`emesoimesneprera|evine,dabibioumawenefekatposkupqewa–predla`ematijevi}. Onjenaglasiodabiutojoblastitrebalodonetistrategijukoja}eomogu}itida,kadsrbijau|e uEU,na{ifarmeribuduspremni za“utakmicu”nazahtevnomevropskomtr`i{tu. –Kadoja~amobaznuratarskui sto~arsku proizvodwu, tek onda mo`emopri~ationekomagresivnom nastupu na drugim tr`i{tima–zakqu~iojematijevi}.

I predstavnik sremskog Udru`ewa proizvo|a~a sviwa “Grani~ar”uKuzminuVladanBabi} smatradabicena`ivemeretovqenikatrebalodabudepove}anasasada{wih 190 do 200 dinara na 250 dinarakilogramjerjebeztecene veoma te{ko zasnovati novu proizvodwu. On je rekao da na{a zemqaimauslovezaintenzivnusto~arsku proizvodwu, ali bi odre|enim merama trebalo podsta}i proizvo|a~e,presvegadapro{ire“zapate”kvalitetnihkrma~a,a timeipove}ajubrojtovqenikana 25ili26pojednojkrma~i.

NAJVE]AVOJVO\ANsKAPAORsKAUDRU@EWAPIsALAmINIsTRUIVOJVO\ANsKOmsEKRETARUZAPOQOPRIVREDU

Ratari tra`e gorivo za jesen i pare za subvencije Pitawejedali}esu{abiti progla{ena elementarnom nepogodomidali}ebitikakvog obe{te}ewa, ali su vojvo|anskipaorisigurniutodabito trebalou~initizaspasagrara i imaju konkretne predloge. Nemajudvojbeniokotogadapoqoprivreditrebavi{eparaiz republi~kogipokrajinskogbuxeta,apowimabizadoborobit celokupnogagraravaqaloimatiirazli~itemereagrarnepolitike,sobziromnaspecifi~nosti pojedinih poqoprivrednihpodru~ja. Najzna~ajnija paorska vojvo|anska udru`ewa, asocijacija „Vojvodina agrar„ i Klub „100P plus„, poslala su ministru poqoprivrede Goranu Kne`evi}u i pokrajinsom sekretaru Goranu Je{i}u spisak konkretnih mera za ubla`avaweposledicaodsu{eipredlog mogu}ih re{ewa pitawa vezanihzapoqoprivreduVojvodine aodnosesenazemqi{nupolitiku, politiku podr{ke i subvencija, naknade i poreze, privatizaciju... Kadajeosu{ire~,isti~uda je neophodno da op{tine, Pokrajina i Republika u odre|enoj mer i nad okn ad e gub it ak proizvo|a~ima i omogu}e im da imaj u min im um novc a da pripreme zemqi{te i zasnuju narednu proizvodwu, kao i da vratezadu`eno.Tobizna~ilo nadoknadu {tete registrovanimpoqoprivrednimproizvo|a~ima u zavisnosti od kulture, podru~ja i mogu}nosti buxeta. Podrazumevalo bi i isplatusubvencijaza2012.u{to skorijemrokuipromenuuredbi da bi se ispo{tovao dogovor poqoprivrednika s ministrom Du{anom Petrovi}em. Jer,ukolikobiostalenasnazi va`e}e uredbe o pla}awu po kilogramu,zbogsu{eiposta-

vqenog grani~nog referentnogprinosa,poqoprivrednici ne bi ni dobili subvencije za 2012. Najve}i problem je u tome {to te uredbe predvi|aju isplatu novca tek iz buxeta 2013. godine, navodi se u saop{tewu tih udru`ewa. Paori predla`u i ukidawe pla}awa naknade za navodwavawe i odvodwavawezaovuislede}ugodinu, kao i reprogramirawe pla}awa zakupa dr`avnog zemqi{tanatrigodineireprogramirawe dr`avno subvencionisanih kredita. Pod hitno bi, nagla{avaju, trebalo omogu}iti nabavku regresiranog gorivazajeseweradove,imaju}i u vidu da }e se, zbog su{e, onipo~etimnogoranije. Osvr}u}isenapolitikupodr{ke, „Vojvodina agrar„ i Klub „100P plus„ nagla{avaju da agrarni buxet srbije mora

[tetu}evagatijo{mesecdana ministarpoqoprivredesrbijeGoranKne`evi}izjaviojeju~e dajeVladasrbijedonelaodlukudaRepubli~ki{tabzavanredne situacije utvrdi {tetu koju je prouzrokovala dugotrajna su{a. Vladajenalo`iladaministarstvopoqoprivrede,posleutvr|enogstawa,predlo`iodgovaraju}emerezasaniraweposledicakojejesu{aostavilanapoqoprivrednuproizvodwuusrbiji,kazao jeon,dodaju}idabiunarednih30danaRepubli~ki{tabzavanrednesituacijenaosnovuizve{tajalokalnihsamoupravatrebaloda pripremipodatkeo{tetamanaterenu,posle~egabiministarstvoiza{losasvojimmeramakakobisetigubicisanirali. da,baremzasada,iznosinajmawepetodstoukupnog. „Pokrajina Vojvodina treba da sprovodi strategiju razvoja poqoprivrede donetu na nivou Republike srbije, ali mere agrane politike moraju da se razlikuju zbog zna~aja i specifi~nostipoqoprivrede.Naro~itojeva`nodasedecentrali-

zujumeresprovo|ewapolitike ruralnograzvojaidazatotreba formirati pokrajinski agarni buxet, koji ne}e biti mawi od ~etiri milijarde dinara godi{we za podsticaje i koji}eseprvenstvenokoristitizapospe{ivaweinvesticija uPokrajini.Verujemodatapodr{katrebadabudeprvenstve-

nousmerenakaonimakojinose poqoprivredu srbije – komercijalnim poqoprivrednim gazdinstvima, odnosno fizi~kim ipravnimlicima,izuzevvelikih pravnih lica. To ne zna~i da se ne zala`emo za to da svi kojisedanasbavepoqoprivredombudukorisnicinekeodmera podr{ke, ali smatramo da podr{ka traba da posebno targetira komercijalna od nekomercijlanih poqoprivrednih gazdinstava”, navodi se u saop{tewu, u kojem se isti~e da je podr{ka po hektaru sa svim svojim manama boqa od podr{ke po proizvodu. Prilikom subvencionisawa inputa korisnici moraju da imaju mogu}nost da slobodno odlu~uju od kojeg dobavqa~a }e nabaviti |ubrivo, gorivo..., a ne sme se praviti diskriminacija u odnosu pravna – fizi~ka lica prilikom dobijawa subvencija, nagla{avajuutimudru`ewima. Po wima, investiciona podr{kaubudu}nostitrebadabude osnovna mera jer je to najboqi na~in pove}awa konkurentnosti. Asocijacija „Vojvodina agrar”iKlub„100Pplus„ukazujuina~iwenicudaseZakon o poqoprivrednom zemqi{tu ne po{tuje u potpunosti, te da jeneophodnodonetizakonozadrugama,obavitirestituciju... Pomenimodastavovitihorganizacijaimajujo{ve}ute`inuakoseznadaasocijacijabroji26privrednihdru{tavaizemqoradni~kih zadruga, koje imaju kooperantski odnos s 25.000 registrovanih poqoprivrednih gazdinstava. „Vojvodina agrar„ organizuje proizvodwunavi{eod150.000hektarau Vojvodini, a Klub „100P plus„ jenajstarijeinajbrojnijeudru`ewe poqoprivrednika u Vojvodini. s.Glu{~evi}


Najvi{eambrozijenaNovomnasequ Najve}e povr{ine ambrozije nalazesenaNovomnasequ,gde jeovimkorovomobuhva}eno452 kvadratnametrakvadratna,dok je na Klisi pod ovom biqkom 295 kvadrata, saop{tavaju  iz Laboratorije za invazivne i alergijske biqke Prirodnomatemati~kog fakulteta. Ovog alergenaimaiudelugradaoko BulevaraEvrope,aprostorko-

jizauzimaje228metarakvadratnih.Velikideopovr{inauodre|enimdelovimagradau{aoje u program redovnog odr`avawa “Gradskogzelenila”ikosisedo pet puta godi{we. Iz Laboratorijezainvazivneialergijske biqke Prirodno- matemati~kogfakultetaka`udau~estalo uklawaweovognajve}egalergenaspre~avawegovocvetawe,au

borbi protiv ovog korova u~estvuju i gra|ani, koji redovno odr`avajusvojeposede. Ovalaboratorijaod2006.godineu~estvujeuprogramusuzbijawaambrozijeidrugihalergijskihbiqakanajavnimpovr{inama. Kontinuiranim monitoringom izdvojena su i najve}a nalazi{ta ambrozije u rubnim delovima grada, kao i mestima

Novosadska subota4.avgust2012.

Zelenipojas, alizasahrawivawe N

zvole ispre~io se objekat izgra|en u blizini devetog grobnog poqa i dok Ministarstvo gra|evine ne re{i zahtev vlasnika za ukwi`bu obejekta, „Lisje„ }e morati da ~eka. Pokojnici se sada sahrawuju na za{ti}enom zelenom pojasu. Dakle na zelenilu, koje su pogrebnici godinama negovali i u wega ulagali novac. Da su kojim slu~ajem iz Grada malo ~e{}e opomiwali Ministarsto, slu~aj bi bio re{en, kako god, na {tetu ili u korist „Lisja”. Z. Deli}

Naknadezanezaposlene Isplatanov~anenaknadenezaposlenimgra|animapo~iwedanas kakoobave{tavajuizNacionalneslu`bezazapo{qavawe.Naknade}egra|animo}ipodi}ina{alterimasvihpo{tauSrbiji.

U [OSO „MILAN PETROVI]”

Prijateqskime~ umalomfudbalu Prijateqska utakmica u malom fudbalu izme|u u~enika [OSO „Sveti Sava” iz [apca i[OSO„MilanPetrovi}”iz NovogSadaodigra}esesutraod 11 ~asova u {koli „Milan Petrovi}”, u Ulici Bate Brki}a na Novom nasequ. Pokroviteq utakmice je predsednica udru-

hronika

POVODOM PROSLAVE DANA RE^NE FLOTILE ORGANIZOVANA REGATA

Vesla~ipotvrdili tradicijusrpskihbrodara Vesla~karegataodr`anajeju~e na Dunavu u sklopu proslave DanaRe~neflotile-Danaroda re~nih jedinica Vojske Srbije, koji se obele`ava 6. avgusta. U organizaciji Re~ne flotile tako je organizovano takmi~ewe u dvekategorije,uprvojsu~etiri posade veslale u ~amcima tipa „[qupka”,audrugojpetposada je poku{alo {to pre da desantni-aluminijumski~amacdovesla dociqa.Uprvojregatipobedio je2.pontonirskibataqonizNovogSada,audrugoj1.pontonirski bataqon iz [abca. Start je bio kod crpne stanice “Vodovoda”, a ciq kod splava carine Lu~ke kapetanije. Pobednike su ~ekali pehar i diplome koje je uru~iokomadantRe~neflotile pukovnikAndrijaAndri}. -Vesla~karegatajeorganizovana u ciqu pokazivawa starih pomora~kih obi~aja, odnosno brodarstvauSrbiji.Zadovoqan sam rezultatima, pontonirci su pokazalinajboquspremnost{to

Foto:N.Stojanovi}

dokazujedare~naflotilaizvr{ava zadatke u sklopu kopnene vojske.Uskladusana{imtradicijama, pomorskim, re~nim i uop{te brodarstvom u Srbiji, ve}duginizgodinaproslavqamo

Ugasilise „Zastava”i„Branik”

Svetozar Mileti}

skunarodnuslobodoumnustranku,uPe{ti1866.Ubrzo,redakcija je preseqena u Novi Sad. Kada je u Mileti}evoj stranci, nazvanojRadikalska,do{lo do rascepa i 1885. stvorena nova Srpska narodna slobodoumna stranka, tj. Liberalna, ova je odmah pokrenula svoje glasilo „Branik”. Prirodno, dva lista su vodila me|usobno bezpo{tednu borbu, ali su na po~etku Prvog svetskogratado`iveliistu sudbinu. „Svojevoqno” suseugasile.Jer,redakcije nisu pristajale da se povinuju vlastima i pi{uprotivsrpskognarodaiSrbije.„Zastava” je prestala da izlazi 1., a „Branik” 4. avgusta 1914. N. C.

ovajdan,auprotekletrigodine organizujemo vesla~ke regate rekaojeAndri}. Ina~e,6.avgustjedatumkada je 1915. godine formirana prva nacionalnaRe~naflotilaKra-

qevine Srbije, porinu}em prvogsrpskogratnogbroda,oklopqenog ~amca „Jadar”, koji je u~etvovao u operacijama odbrane Beograda tokom Prvog svetskograta. A. L.

OBJAVQEN JAVNI POZIV

`ewa„MaliTesla”izSADVesnaCandi} uzpodr{kuUdru`ewa „Sre}a” sa predsednicom Sandrom Ivankovi}. Utakmici }e prisustvovati i dva reprezentativcaSrbijeumalomfudbaluBogdanMarojevi} i^edomirNikoli}. B. M.

Tra`esepopisiva~i poqoprivrede

V remeploV

„Zastavu”, jednu od najzna~ajnijihnovinasrpskihu19.ipo~etkom20.vekapokrenuojeSvetozarMileti}kadaisvojuSrp-

Zbogradovanavodovodnojmre`idanas od 8 do 12 ~asova bez vode }e biti UlicadrSimeMilo{evi}a, odUlice dr Ilije \uri~i}a do Bulevara cara LazaraiStudentskidom.IzJKP„Vodovod i kanalizacija” saop{tavaju, da postoji mogu}nost da blokada vodovodne mre`e bude pro{irena i na okolne ulice. A. L.

Telefoni:0214806-833,4806-834,421-674,528-765,faks:6621-831e-mail: nshronika@dnevnik.rs

DOBRO JUTRO, NOVI SADE

a osmom grobnom poqu na Gradskom grobqu nema vi{e mesta za sahrawivawe. Preduze}e „Lisje”, koje upravqa grobqima u gradu, ukazivalo je du`e vreme da se osmo grobno poqe popuwava i da treba osposobiti novu parcelu, odnosno deveto grobno poqe. Gradske slu`be nisu dovoqno ozbiqno shvatile pogrebno preduze}e i pomogle „Lisju„ da br`e do|e do gra|evinske dozvole, koja je potrebna radi otvarawe devetog grobnog poqa. Na putu do do-

koja su bila u procesu urbanisti~kogure|ewaiizgradwe,novihulica,bulevaraistambenih jedinica. Po wihovim podacima, prostor gde se sada nalazi BulevarEvropebiojejednood najve}ih `ari{ta ambrozije u blizini Detelinare. Izgradwomtogbulevaraprostorjeur|en, a koli~ina tog korova se smawila. N. R.

Studentskidom bezvode

DANI OPET POSTAJU SVE TOPLIJI I TOPLIJI

Punerukeposla zaHitnupomo}

U protekla 24 ~asa novosadskaHitnapomo}intervenisala je106puta,odtoga46intervencijajebiloutokudana,a60no}u. De`urni lekar Hitne slu`be dr Emil Krompholc ka`e daovihdanalekariHitneimajupunerukeposlaivelikibroj pozivaupomo}.Intervencijeu tokuno}isuseuglavnomodnosile na pru`awe prve pomo}i osobama u alkoholisanom stawu,kojesumoralipotomdavoze na detoksikaciju. Tako|e, u~estalo se javqaju i osobe s psihijatrijskim simptomima, ~ijesestaweusledvremenskih prilika pogor{ava, kao i kod sr~anihbolesnikaidrugihosobakojeimajugu{ewazbogkon-

stantno visokih temperatura. Kako se jo{ ve}e temerature prognozirajuunarednomperiodu dr Krompholc savetuje da je neophodno prilagoditi se vremenskimuslovimaistimuvezi najboqejeneizlazitivanku}e ukolikozatonemaprekepotrebe.Istotako,potrebnojedase redovnouzimahranabogatavo}emipovr}em,{tovi{ete~nosti i lagano odevawe. Hroni~nimbolesnicimasepreporu~ujedaredovnouzimajusvojuterapiju.Iakojeletoivru}inesu o~ekivane za ovaj godi{wi period,drKrompholctvrdidasu upitawuekstremnovisoketemperature,kojesuzaistaneugodneizazdravuosobu. I. D.

Republi~ki zavod za statistikuobjaviojejavnipozivza kand id at e za pop is iv a~ e u predstoje}empopisupoqoprivrede,agra|anisasadr`inom javnogpozivamoguseupoznati na sajtu www.stat.gov.rs ili na sajtuGradawww.novisad.rs Na sajtu Grada mogu se na}i jo{ i adrese i radno vreme punktova za prijem prijava za

popisiva~e, koji }e biti obavqenuperioduod10.do14.avgusta. Tekst javnog poziva kao i adreseiradnovremepunktova za prijavu popisiva~a tako|e suistaknutiinaoglasnimtablamauzgradiSkup{tinegrada,@arkaZrewaninabroj2iu Gradskojku}inaTrguslobode broj1. A. L.

U ^ITAONICI GRADSKE BIBLIOTEKE

Promocijakwige „Irasema” Kwig a „Iras em a” braz ilskog pisca @ozea de Alnekara, u prevodu Mladena ]iri}a,bi}epredstavqenauponedeqak,6.avgustau19~asovau ^itaonici Gradske biblioteke, Dunavska ulica 1. Promocijajedeoaktivnostikojenajavquju festival Dani brazila - novosadski samba karne-

val. Preds tav qaw e kwig e ukqu~ujeipredavaweoistorijskom kontekstu Alenkarovog Brazila, razgovor o samoj kwiziiwenomprevo|ewu. Govornici }e biti prevodilac]iri}ifilolog,profesor portugalskog Giqerme Seha. I. D.

U AMERI^KOM KUTKU

Besplatankurs kreativnogpisawa Besplatankurskreativnogpisawanamewenmladimaod15do 20godinaodr`a}eseuAmeri~komkutku20.avgusta,udvesesije-od11.30do12~asovaiod12.30do14~asova.Onikoji`ele da unaprede kreativno pisawe  ili nau~e da kreativno pi{u, koristeengleskijezik,dru`eseiupoznajunovequde,trebada seprijavenaimejlamerickikutak@nscable.net.Uprijavitrebanavestiime,prezime,godineikontakttelefon,arokzaprijavqivaweje16.avgust.Ameri~kikutaknalaziseuUliciPetra Drap{ina3. J. Z.


8

NOVOSADSKA HrONIKA

subota4.avgust2012.

StojanuKolarovu potrebnaoperacijaki~me Dvadeset~etvorogodi{wi Novosa|anin Stojan Kolarov boluje od retke bolesti mucopo-

lisaharidoze tip ~etiri, zbog koje je u invalidskim kolicima, mada se do pre nekoliko godina kretao i vozio bicikl. Zbog izu-

zetnog su`ewa ki~menog kanala u vratnom delu ki~me, neophodna mu je operacija kako bi se spre~ila daqa kompresija ki~mene mo`dine. Stojan nije u mogu}nosti da obezbedi novac za komplikovanu hirur{ku intervenciju, koju }e obaviti prof. dr Mi{el Zeraha u oktobru u Parizu, i tro{kove puta, jer `ivi sa ocem penzionerom, dok mu je majka poginula u saobra}ajnoj nesre}i. U tu svrhu otvoren je teku}i ra~un u banci “Inteza”, broj 1605500102308991-66 na ime Stojan Kolarov. Svaka vrsta nov~anog priloga mnogo }e mu zna~iti, za daqi oporavak i nastavak `ivota. Ina~e je student veb dizajna na Vi{oj strukovnoj {koli gde u septembru brani diplomski rad. A. L.

ZA PONEDEQAK „^ISTO]A” NAJAVILA

Umesto{trajka,jednosatna obustavarada [trajka~ki odbor u „^isto}i” odustao je ju~e od generalnog {trajka, koji je jo{ pre tri sedmice zakazao za ponedeqak. Umesto toga, sindikat }e u ponedeqak organizovati jednosatnu obustavu rada, od 12 do13 ~asova. Predsednik sindikata u preduze}u Mom~iloArsenijvi} kazao je, da je poslodavac ispunio dva zahteva, isplatio je zaostalu platu i po i uplatio penzijske doprinose.

BioSKoPi Arena: „Diktator” (15.20, 17), „Sne`ana i lovac” (22.25), „Prometej” (19.45), Madagaskar 3: Najtra`eniji u Evropi” (12.15, 14.15, 16.30, 18.15), „Lol” (18.30), „Imate li znawe za drugo stawe” (22), „Ledeno doba 4: Pomerawe kontinenata” (12, 12.30, 13.45, 14.30, 15.30, 16.15, 17.30, 18, 19.30, 20.05), „Nedodirqivi” (20.20), „^udesni Spajdermen” (11.30, 14, 16.30, 21.55), „Uspon mra~nog viteza” (14.20, 17.20, 19, 20.30, 21.15, 22). Kulturni centar novog Sada: „Tragovi rimske Panonije” (19)

MUZeJi Muzej grada, Tvr|ava 4, 6433–145 i 6433–613 (9–17): stalna postavka „Petrovaradinska tvr|ava u pro{losti”; postavka Odeqewa za kulturnu istoriju Muzej Vojvodine, Dunavska 35–37 (utorak - petak od 9 do 14 sati i od 18 do 22 ~asa, subota - nedeqa od 10 do 18 ~asova): stalna postavka „Sa~uvani tragovi materijalne i duhovne kulture Vojvodine od paleolita do sredine 20. veka”, „Vojvodina izme|u dva svetska rata - antifa{isti~ka borba u Vojvodini 1941 - 1945” Muzejski prostor Pokrajinskog zavoda za za{titu prirode, radni~ka 20a, 4896–302 i 4896-345 (8–16): stalna postavka „Vi{e od pola veka za{tite prirode u Vojvodini” Petrovaradinska tvr|ava, 6433–145 (9–17): podzemne vojne galerije Spomen-zbirka „Jovan Jovanovi} Zmaj”, Sremska Kamenica, Trg J. J. Zmaja 1, 462–810: stalna postavka Zavi~ajna zbirka Sremski Karlovci, Sremski Karlovci, Patrijarha raja~i}a 16, 881-637:postavka „Vinogradarstvo i vinarstvo Fru{ke gore” Zbirka strane umetnosti, Dunavska 29, 451–239 (9–17): stalna postavka „Legat doktora Branka Ili}a” Muzej p~elarstva porodice @ivanovi}, Sremski Karlovci, Mitropolita Stratimirovi}a 86, 881–071 (10–18)

RO\ENI U novosadskom porodili{tu od prekju~e u 7 sati do ju~e u isto vreme rodile su: DEVOJ^ICE: Tiana Ratkovi}, Eva Tomovi}, Dragana [krbi}, Sla|anaMedan, BojanaKozomora i SevinKr~oDra`ilovi} iz Novog Sada, JasminaLazi} iz Sremskih Karlovaca, Ru`icaNedi} iz Beo~ina, AmelaAhmetiiz Veternika, JelenaGajin iz Obrovca i TundeGajo iz Temerina, DE^AKE: Milana Vrsajkov Dimitrijevi}, Zorana Oplakan, Slobodanka Stankovi} Davidov, Tatjana Sofijani}, Jasmina Krsti}, MarijaVidanovi}Kopawa i Sne`anaPopeskoviz Novog Sada, Sne`ana Luki} iz Bukovca, Gordana Rosi} iz Stepanovi}eva, MilicaPavlovi} iz Stapara, SawaKrstono{i} iz Sivca, Milana \uki} iz Magli}a i QubicaDimi} iz ^uruga.

SAHRANE Na Gradskom grobqu u Novom Sadu danas }e biti sahraweni: Jovanka Milo{a Tucakovi} (1925) u 10.30 sati, Nikola Mileta Stevi}a (1940) u 11.15, Jovan Borislava Milosavqevi} (1940) u 12, Dragan Vojina Grbi} (1952) u 12.45, Radomir Branka Galovi} (1917) u 13.30, Mara Vojina [imi} (1923) u 14.15 i Sne`ana Desanke Su~evi} (1960) u 15.45. Na Uspenskom grobqu u Novom Sadu danas }e biti sahrawena Katarina Stevana Kova~i} (1938) u 11 sati.

Preostalo je, navodi Arsenijevi}, da poslodavac ka`e ko je odgovoran {to preduze}e ima gubitak od oko pola milijarde dinara. - Od gradskih ~elnika tra`imo i da iz delatnosti preduze}a izbri{e hvatawe pasa i ma~aka lutalica. „^isto}a„ nije osposobqena za to. U Beogradu je tamo{wa gradska vlast osnovala Slu`bu zoohigijene, pa tra`imo da po tom uzoru i novosadska vlast u~ini isto - izjavio je Arsenijevi}. Z. D.

U TURISTI^KIM AGENCIJAMA

Rasprodatigotovosvi aran`mani Iako su se sugra|ani `alili da novca za more nema, turisti~ke agencije imaju ruke posla. Svi aran`mani za letovawa u inostranstvu su rasprodati, saznajemo u turisti~kim agencijama. Po re~ima agenta turisti~e agencije “Aurora trevl” Milice Bjelivuk, za drugu polovinu avgusta ostalo je jo{ nekoliko aran`mana, koji se prodaju u „last minut„ ponudi. - „Last minut„ ponuda se koristi da bi se prodalo ono {to je ostalo, a takvih aran`mana nema mnogo. Kod svake ponude ostane mo`da dva ili tri aran`mana po destinaciji koja nisu prodata. Septembar je gotovo pun, pa se mo`e re}i da je sezona uspe{na- ka`e Bjelivuk. Vlasnica turisti~ke agencije “Navigator” Karolina Svilar ka`e da se struktura putnika potpuno promenila. Po wenim re~ima, interesovawe za letwe aran`mane je slabije u odnosu na prethodne godine, ali

DANAS U GRADU

DNEVNIK

tembar je razgrabqen ve} u prole}e, kada su se aran`mani nudili za 100 evra po osobi, pa }e za taj mesec biti mesta samo ako neko otka`e putovawe. Po wenim re~ima, kao „last minut„ ponudu imaju Pefkohori, ~ija je cena 250 evra, a ura~unat je prevoz i sme{taj.

U ZAVR[NICI LETWA [KOLA CRKVENOG POJAWA „KORNELIJU U SPOMEN”

telefoni VA@niJi BRoJeVi Policija 192 Vatrogasci 193 Hitna pomo} 194 Ta~no vreme 195 Predaja telegrama 196 [lep - slu`ba AMSJ 987 Auto-moto savez Srbije 987 Informacije 988 i 0900098210 Toplana kol centar 0800 100-021 reklamacije 24 sata 4881-104, za potro{a~e 420-853 Vodovod i kanalizacija, centrala 488-33-33 prijava kvara vodovod 0800-333-021 prijava kvara kanalizacija 442-145 ^isto}a 6333-884 “Novi Sad - gas” 6413-135 i 6413-900 JKP “Stan” 520-866 i 520-234 Kol centar preduze}a „Put” 6313-599 Kol centar „Parking servisa” 4724-140 „Gradsko zelenilo” marketing i Pr 4881-633 rasadnik 403-253 “Dimni~ar”, 6622-705, 6615-834 „Elektrodistribucija” centrala 48-21-222 planirana iskqu~ewa i prijava kvara 421-066 @elezni~ka stanica 443-200 Me|umesna autobuska stanica 444-022 Prigradska autobuska stanica 527-399 Gradsko saobra}ajno 527-796 Gradsko grobqe 518-078 i 518-111 Pogrebno, JKP “Lisje” 6624-102 Pogrebna ku}a „Konkordija” 452-233 Dru{tvo krematista “Ogaw” 422-288 Ger. cent. - pomo} i nega 450-266 lok. 204, 205 Prihvatna stanica 444-936 Prihvatili{te Futog 895-760/117 Dnevni centar za stara lica 4889-512 Info centar za osobe sa invaliditetom radnim danom (od 10-15) 021/447-040 ili sms 066/447-040 Komunalna inspekcija 4872-444 (centrala), 4872-403 i 4872-404 (dispe~erski centar) SOS telefon za pu{a~e u krizi - od 7 do 10 ~asova 4790-668

APoteKe No}no de`urstvo: “Bulevar” - Bulevar M. Pupina 7 (od 20 do 7)

je i uprkos tome sve rasprodato. - Qudi, koji su pro{le godine letovali za 150 ili 170 evra, nisu se prijavqivali ove godine, dok su se malo imu}niji sugra|ani, koji putuju avionom, zadr`ali kao na{i klijenti. Svi aran`mani su raprodati i „last minut„ ponude skoro da nema. Sep-

- Na{im qudima je mnogo kada se ka`e da je aran`man za jednu osobu 250 evra. Ukoliko idu u paru, samo za put i sme{taj treba im 500 evra. Kada se tu jo{ ura~una xeparac, koji mora biti minimalno 400 do 500 evra, dobija se cifra od 1.000 evra, {to je previ{e - obja{wava Svilar. Najvi{e su se tra`ila gr~ka ostrva, Turska, Egipat i Tunis. Najjeftinija ponuda za deset dana na moru u Egiptu ili Tunisu iznosila je 400 evra, dok je Turska bila jeftinija, jer su za ovu destinaciju stalno obezbe|ivani popusti. Po re~ima Bjelivuk, Turska je bila dosta interesantna za porodi~no putovawe. - Za aran`mane u Turskoj organizovane su razne akcije, pa su deca do 12 godina pla}ala samo avionske karte - ka`e Bjelivuk. Po ve} ustaqenoj navici sugra|ani su od gr~kih ostrva najradije birali Krf, Zakintos, Rodos i Krit. N. R.

420-374

ZDRAVStVenA SlU@BA Dom zdravqa „Novi Sad”, kol centar 4879-000 Klini~ki centar 484-3484 No}no de`urstvo za decu u Zmaj Ogwena Vuka (subota i nedeqa) 6624-668 No}no de`urstvo za odrasle (Wego{eva 4) (subota i nedeqa i praznici) 6613-067 Vr{a~ka 28 4790-584 Klinika za ginekologiju i aku{erstvo 4899-222 De~ja bolnica 425-200 i 4880-444 Institut - Sremska Kamenica 4805-100

tAKSi Prevoz osoba ote`anog kretawa „Hendikeb” 432-005, 060/313-3103 Vojvo|ani - taksi 522-333 i 065-520-0-500 Pan-taksi 455-555 VIP - taksi 444-000, SMS 1088 Delta plus - taksi 422-244 Maksi Novosa|ani - taksi 970, 451-111 Grand - taksi 443-100 Luks 30-00-00 MB - taksi 500-222 De`urni taksi 6350-350 Halo - taksi 444-9-44, SMS 069/444-444-9

Horistiipojci predpublikom

Ve~ara{wim koncertom u sve~anoj sali Karlova~ke gimnazije, odnosno sutra{wom liturgijom u Sabornoj crkvi u Sremskim Karlovcima ovogodi{wa jubilarna, 20. Letwa {kola crkvenog pojwa „Korneliju u spomen” bi}e zavr{ena. Osim {to su imali svakodnevne vi{esatne probe na kojima su pripremali kompozicije za zavr{ni koncert i slu{ali zanimqiva predavawa, sada{wi polaznici su bili u prilici i da ~uju iskustva nekada{wih u~esnika i dirigenata, primedbe i sugestije za daqi rad, {to je i bila ideja organizatora Dru{tva za negovawe tradicija i razvoj Sremskih Karlovaca i Muzikolo{kog instituta SANU, prilikom osmi{qavawa programa. Na zavr{nom koncertu, koji po~iwe ve~eras u 20 sati, publika }e mo}i da ~uje nekoliko pesama iz osmoglasnika Kornelija Stankovi}a, pri~asnu pesmu ovog kompozitora, kome je {kola i posve}ena i jednu wegovu svetovnu kompoziciju. Po re~ima dirigenta, vanrednog profesora na Muzi~koj akademiji u Isto~nom Sarajevu mr RadetaRadovi}a, ove godine su u programu zastupqeni uglavnom srpski autori. Bi}e tu „Tebe pojem„ iz liturgije Vlade Milo{evi}a, „Heruvimska pesma„ Bini~kog, pet pesama iz zbirke srp-

skih narodnih pesama Marka Taj~evi}a. - Postoje razli~iti kriterijumi za izbor programa - ka`e rade Radovi} , koji pet posledwih godi-

stavio u repertoar svog hora. Trudim se da uvek bude ne~eg novog, ne{to od poznatih kompozitora {to je jako malo izvo|eno, jer uglavnom se vrti isti program po na{im ho-

na vodi horsku radionicu u ovoj {koli. - Gledam koji je profil {kole, kakvog su muzi~kog obrazovawa polaznici, zatim, kakav je ciq {kole. Mi smo svakodnevno na bogoslu`ewima, pa mora biti zastupqena i ta muzika, pre svega srpska crkvena horska muzika, kao i Kornelije Stankovi}. Volim da istra`ujem i koristim priliku to da probam i ovde. Neke sam kompozicije prvi put ovde izveo, pa onda

rovima, kao da ne poznajemo sopstvenu literaturu. Po Radovi}evom mi{qewu, ova {kola mora da bude primer horovima da pevaju i mawe izvo|ene kompozicije i to treba da bude zadatak svakog dirigenta. Osim hora, na koncertu }e nastupiti i grupa pojaca, sa kojima je program pripremao docent na Muzi~koj akademiji u Isto~nom Sarajevu Predrag\okovi}. Z. Ml.

U SREMSKIM KARLOVCIMA

Paketihranezaizbeglice Materijalno najugoro`enijim izbeglicama i interno raseqenim qudima u Sremskim Karlovcima bi}e dodeqeni paketi hrane, a da bi ostvarili pravo na taj vid humanitarne pomo}i, oni treba do 15. avgusta da podnesu zahtev povereniku za izbeglice u karlova~koj op{tini, kancelarija broj 4. Obrasce prijave kandidati mogu da preuzmu na portirnici op{tine ili kod poverenika za izbeglice.

Pravo na pomo} u hrani imaju izbeglice, odnosno oni koji su imali status izbeglice i oni koji su registrovani kao interno raseqena lica sa boravi{tem ili prebivali{tem u Karlovcima. Uslov je i da im mese~ni prihod doma}instva nije ve}i od dvostrukog iznosa nov~ane socijalne pomo}i za jun, kao i to da nisu povratnici iz migracija u tre}e zemqe. Za dodatne informacije treba pozvati broj telefona 021/685-3075. Z. Ml.


nOvOSAdSkA HROnikA

dnevnik

POVODOM GODI[WICE BITKE KOD PETROVARADINA

Portretiiplanoviu Muzejugrada Ovogodi{we obele`avawe Bitke kod Petrovaradina po~elo je ju~e u Muzeju grada na Petrovaradinskoj tvr|avi otvarawem digitalne izlo`be portreta austrijskog vojskovo|e princa Eugena Savojskog, kao i dokumenata i planova te bitke, u ko-

joj su snage odmerile turska i austrijska vojska, 5. avgusta 1716. godine. - Bitka kod Petrovaradina jedna je od najve}ih na ovim prostorima, a `eleo bih da Eugen Savojski ostane deo istorije i da vi{e ne postoji potreba ni za

Postavka u muzeju

Foto:F.Baki}

vojskovo|ama ni za ratovima, te da se time bave stru~waci i istori~ari i da mi gra|ani sve to posmatramo sa strane - rekao je potpredsednik Vlade Vojvodine i pokrajinski sekretar za kulturu i javno informisawe Slavi{aGruji}. Dodao je i da }e ova manifestacija, koja se u organizaciji Muzeja grada i Istorijskog arhiva grada odr`ava od 2006. godine, do`iveti kulminaciuju Slavi{a Gruji} 2016. godine kada se bude obele`avalo 300 godina i kwiga „Bitka kod PetrovaraBitke kod Petrovaradina, te da dina 1716 - Ratni izve{taji je ona deo projekta koji podr`a- princa Eugena Savojskog” kao i va pokrajinska Vlada. {esti broj Godi{waka IstorijU Muzeju grada mogu da se po- skog arhiva grada Novog Sada. O gledaju i fotografije Spomen publikacijama su govorili poparka Po`areva~kog mira iz mo}nik pokrajinskog sekretara 1718. godine, koji je potpisan za kulturu i javno informisawe posle pobeda austrijske vojske dr Milan Mici} i profesor nad Osmanlijama u bitkama kod Filozofskog fakulteta u NoPetrovaradina, Temi{vara i vom Sadu dr PeterRokai. Beograda. Ju~e je predstavqena J. Zdjelarevi}

SLABA GRA\EVINSKA SEZONA

Gradili{tapostala retkost Broj otvorenih gradili{ta u drugom kvartalu 2012. godine. znatno mawe odstupa od overene svake godine opada, pokazuju poda- Za {est meseci ove godine ukloprojektno - tehni~ke dokumenci gra|evinske inspekcije. U jeku weno je deset objekata, u osam tacije. Za pola godine inspekgra|evinske sezone u na{em gradu slu~aja, ka`e, to su u~inili incija je primila deset odsto maje aktivno svega 74 gradili{ta, vestitori, a dva objekta su uklowe predmeta u vezi bespravne dok je pre dve godine bilo prija- wena prinudno. gradwe, u odnosu na isti period vqeno duplo vi{e, 146. u 2011. godini. KonstaDa se sve mawe gradi gotovali smo i da se niU gradu su aktivna svega vori i podatak da se lane jedno podru~je grada ne radilo na 88 lokacija. Uz 74 gradili{ta, dok ih je pre dve godine isti~e sa posebno poveto, gra|evinska inspek}anim brojem divqe bilo prijavqeno dvostruko vi{e cija saop{tava i da se gradwe - navodi glavna prijavqeni radovi odnogra|evinska inspekse na izgradwu individualnih Nakon dono{ewa Zakona o iztorka Slavica Lazov. objekata, a da u Novom Sadu na ve- gradwi i planirawu, gra|evinOna nagla{ava da gra|evinoma malo gradili{ta ni~u stam- ski inspektor ovla{}en je da reski inspektor ne kontroli{e beno - poslovni objekati. {ewem naredi zatvarawe gradisamo tehni~ku dokumetaciju koGlavna gra|evinska inspekli{ta, ako na licu mesta utvrdi ju poseduje investitor i izvotorka Slavica Lazov ka`e da da se gra|evinski objekat gradi |a~ radova, ve} da inspektori opada i izgradwa bespravno izbez dozvole. kontroli{u i kvalitet gradwe gra|enih objekata. Ove godine je - Prilikom kontrole gradwe i licencu. zatvoreno devet gradili{ta i to inspektori su uo~ili da se Z. D.

^ITAOCI PI[U SMS

065/47-66-452

Otima~inaulicama sejustrah Mo`emo li uskoro bez straha da prolazimo ulicama Novog Sada da nam ni{ta ne otmu ili „juna~ki“ nas napadnu s le|a zamaskirani juno{i. 064/1465... *** [to su se osilila ta gradska preduze}a, samo prete {trajkom. Ako je gospoda nezadovoqna platama ili im plata kasni nekoliko dana, neka napuste i samostalno daju otkaze, pa }e biti neko radno mesto za nas nezaposlene. Probajte da odradite neki mesec kod privatnika, tamo }ete imati platu 17 hiqada dinara i maksimalno 2 dana slobodna u mesecu. Itekako su vam dobre plate koliko vas ima i koliko radite... a tek {efi}i, kojekakve poslovo|e. Sve to dovesti u red, ako naravno `elimo boqe sutra na{oj deci. 064/0272... *** Ne znam za{to se gospodin ministar

spoqnih poslova Ma|arske pla{i za prava i slobode Ma|ara u Srbiji. Ma|ari kao nacionalna mawina imaju sva prava i slobode i u ni~emu nisu zakinuti. Imaju obdani{ta, osnovne, sredwe {kole, fakultete i u svakoj dr`avnoj ustanovi mogu da se sporazumeju na svom jeziku. Ne vidim u ~emu su uskra}eni. 063/5047... *** Ko nije zadovoqan, a radi u gradskim firmama, neka podnese ostavku, ode na biro rada, za-

posli se kod privatnika. Tako bi voleli da i mi imamo sindikat da nas {titi, pa subotu i nedequ slobodnu, pa osmo~asovan radni dan, redovan godi{wi odmor, da po`elimo va{a odmarali{ta, zdravstveno osigurawe i penziono, te mnogobrojne privilegije. Na{ grad jo{ uvek ima radnih i {kolovanih qudi, nisu svi oti{li, dajte im {ansu, jer ko ne `eli da radi, ne terajte ga, ali nemojte ni da ga platite. Do kada }e gradske firme da izigravaju gigante - neka shvate da su u slu`bi grada i gra|ana. 064/1810... *** Veliko i od srca hvala ginekologu dr Qiqani Trifunovi} i wenoj sestri Biqani Risti} na qubaznosti i srda~nosti prilikom pregleda. Takva qubaznost upotpuwena iskrenim osmehom danas je vrlo vrlo retka!!! Svaka vam ~ast i samo tako napred, hvala vam puno i od srca. Maja Rosi} 062/1801...

„Biser {trandarije” U okviru “Novosadskog de~jeg leta” danas i sutra na [trandu }e biti odr`an program “Biser {trandarije”. Mali{ani }e od 17 do 20 sati na [picu u`ivati u kombinaciji kreativnih, edukativnih, rekreativnih i zabavnih aktivnosti. Broj u~esnika je neograni~en, a radionice su besplatne. N. R.

subota4.avgust2012.

9

ZA KUPQENE KARTE U AUTOBUSIMA JGSP-a NOVI SAD

Nedostajesitni{ zakusur Voza~i JGSP Novi Sad ve} izvesno vreme imaju problem sa vra}awem kusura putnicima za kupqene karte i to zbog nedostatka sitnog novca u opticaju, ka`u u ovom preduze}u. Iako su u prethodnim mesecima uspevali da obezbede dovoqne koli~ine metalnog novca, kako sugra|ani ne bi imali problem prilikom kupovine karte u vozilu, posledwih nekoliko nedeqa ovo je postalo nemogu}e. Naime, Narodna banka Srbije ne obezbe|uje bankama u Novom Sadu dovoqne koli~ine sitnog novca, zbog ~ega one nisu u mogu}nosti da snabdevaju javna komunalna preduze}a, ~ija delatnost zahteva svakodnevni rad sa kovanim novcem radi vra}awa kusura. U JGSP Novi Sad ka`u da ne znaju koliko dugo }e trajati ovaj problem, jer ni{ta zvani~no ni-

su ~uli od Narodne banke Srbije, kao ni koji je razlog zbog ~ega ne{to {to je odli~no funkcionisalo mesecima unazad, sada prerasta u problem. Putnici su nezadovoqni, a voza~i nisu u mogu}nosti da im iza|u u susret. Zbog svega navedenog JGSP apeluje na sugra|ane da pripreme sitan novac prilikom kupovine karte, kako bi se izbegle neprijatne i konfliktne situacije u autobusima. Drugo re{ewe u slu~aju da putnik nema sitan novac za kartu, a voza~ nema da mu vrati kusur, jeste da se voza~ potpi{e na kartu koju je izdao, a putnik do kraja dana treba da do|e u blagajnu prijema pazara u direkciji da preuzme svoj novac. Iz JGSP mole putnike za razumevawe i nadaju se brzom re{ewu ove situacije. B. M.

RADIONICE NA [TRANDU

Recikla`abudi kreativnost Radionica „Budi kreativan na recikla`an na~in” odr`a}e se ve~eras u 19 sati na prostoru ispred Letwe zelene biblioteke na [trandu. Ovo je prva radionica ciklusa koji }e trajati do kraja sezone biblioteke, a vodi}e je stru~ne saradnice Pokreta gorana. Mladi od 15 do 30 godina uz dru`ewe sa vr{wacima tokom radionice ima}e priliku da nau~e kako se izra|uju origami ~estitke. Razvijawe kreativnosti nastavi}e se i u narednim radionicama gde }e u~esnici imati priliku da izra|uju nakit od papira ili pet ambala`e, razne ukrasne vazne i posudice, ramove, zatim da ukra{avaju svoje sveske i olovke deku-

pa` tehnikom i mnogde druge stvari. Radionice }e se odr`avati svakog dana, kada vremenski uslovi to dozvole u 19 ~asova, a ulaznica za radionicu su dve prazne aluminijumske limenke ili pola kilograma papira za recikla`u. Svakog dana, u~esnik koji donese najvi{e otpada dobi}e besplatnu ~lanarinu za Gradsku biblioteku. Svi zainteresovani za radionice se mogu prijaviti na mejl Pokreta gorana office@pokretgorana.org.rs. Ciklus radionica „ Budi kreativan na recikla`an na~in” se odr`ava u okviru projekta „Budi drug, okreni sa kwigom jedan krug” koji realizuju Pokret gorana i Gradska bilioteka. A. L.


10

vOJvOdinA

subota4.avgust2012.

dnevnik

ДР МИЛАН МИТРИЋ КАНДИДАТ ЗА В.Д. ДИРЕКТОРА КИКИНДСКЕ БОЛНИЦЕ

Бољоморганизацијом доквалитетнијихуслуга

РАДНИЦИ „ВОЈВОДИНАПУТА” ОДУСТАЛИ ОД ШТРАЈКА

Добили мартовску плату

ЗРЕЊАНИН:Запослени у зрењанинској путарској фирми “Војводинапут”нису ступили у генерални штрајк и обуставили рад јер су им у среду исплаћени мартовска зарада и заостали путни трошкови. Они су прошле недеље одржали једночасовни штрајк упозорења, најављујући да ће радикализовати протест ако пословодство фирме не испуни њихове захтеве. Радници су тражили исплату мартовске зараде и путних трошкова за четири месеца. -Плате нам касне пуна четири месеца а за почетак смо захтевали да нам буде исплаћена једна заостала зарада – објаснио је председник Самосталног синдиката у “Војводинапуту”Милан Слијепчевић. Зрењанинску фирму која води рачуна о изградњи и одржавању банатских и осталих друмова већ дуже време потресају пословни проблеми. И лане је већина од преко 300 радника ступила у генерални штрајк а кључни разлози за овако ради-

калан бунт били су кашњење плата и неисплаћени прековремени рад. По последњим информацијама из Народне банке Србије, “Војводинапут” је у блокади “тешкој” 172,3 милиона динара.Незавидна ситуација огледа се и у томе што је у седишту фирме, у Улици Жарка Зрењанина, због неплаћених рачуна искључена електрична енергија,па се запослени служе агрегатом како би могли да користе компјутере. Нема ни плина, а искључени су и фиксни телефони.Путарима повремено недостаје и материјал за обављање послова па се плаше да ће многи,због неизвођења радова, бити послати на одмор. Менаџмент је својевремено уверавао да ситуација у овој путарској фирми није драматична и да је такво стање последица ранијих задуживања код пословних банака, али се поводом последњих догађаја није оглашавао у јавности. Ж. Б.

КИКИНДА: Кандидат за новог директора Опште болнице у Кикинди је васкуларни хирург др Милан Митрић.Формално и званично на челу ове институције је и даље др Душан Коларовић који је недавно поднео оставку на место директора, објаснио нам је једини кандидат за директора др Митрић: - Доктор Душан Коларовић је поднео оставку, али док не добије решење о разрешењу,он и даље води кикиндску болницу.Ја сам кандидат за в.д.директора,али одлука о мом иоменовању зависиће од Покрајинског секретаријата за здравство у чијој надлежности је именовање руководећег кадра у болницама у Војводини. Разрешење и ново именовање чека се због годишњих одмора,али очекује се да ће сва документа из Покрајине стићи за,најкасније,петанаестак дана. -Функционисање болнице у Кикинди ни у једном моменту није нарушено услед промене руководилаца.Постоје начелници одељења који воде своје службе, тако да нема никаквих проблема у пружању услуга пацијентима који долазе у болницу. Према речима доктора Митрића, уколико буде прихваћена његова кандидатура и буде именован за в.д. директора Опште болнице, најпре

KABINET „DIJAGNOSTIKA CENTAR”, rendgen, ultrazvuk, mamografija, [afarikova 13, tel: 572-646, 571-322 O^NI CENTAR „YINI]”,

БЕЧЕЈ: Ствараоци алтернативне музичке сцене трећи пут заредом добијају прилику да своје звуке промовишу на Адреналин фесту у Бечеју.За разлику од претходна два, која су одржана у дворишту Градског позоришта,овај трећи ће бити одржан данас у дворишту Гимназије.Свирка почиње у 15сати и трајаће до02.00 сата иза поноћи.Организатори,удружења Адреналин и Хоризонт Б,очекују велико присуство младих,али неће се изненадити ако се у маси нађу и знатно старији суграђани или гости са стране. С обзиром на то да се Адреналин фест

AUTO-SERVIS „ZORAN”, automehani~ar - autoelektri~ar, tehni~ki pregled, Reqkovi}eva 57, Petrovaradin, tel: 6433-748

Vr{a~ka 34, tel: 639-5825, 520-961 GINEKOLO[KOAKU[ERSKA ORDINACIJA „TODOROVI]”, Bulevar oslobo|ewa 48/I Tel: 442-645, 677-91-20 „KOMPAS” TOURISM&TRAVEL, Bul. Mihajla Pupina 15, tel: 6611-299, 6612-306, mail:kompas@eunet.rs

ће се решавати проблеми који директно утичу на грађане. -Одговорно тврдим да у организационом смислу у болници можемо доста тога поправити. С друге стране,што се тиче проблема чије решавање зависи од финансија,ми смо ту немоћни јер зависимо од надлежних институција. Немам увид у финанасијско стање болнице и не бих био одговоран када бих са ове позиције говорио о том делу рада. Кандидат за директора болнице једини је васкуларни хирург у окру-

гу па нас је интересовало да ли ће наставити да ради као лекар специјалиста: - Учинићу све да мој посао-васкуларна хирургија веома мало или ни мало не трпи због других ангажовања. Наш саговорниник је додао је да ће се, уколико добије прилику да води болницу,потрудити да сви начелници одељења и будући начелници сектора поделе терете одговорности и организације болнице набоље. А. Ђуран

Адреналин фест

NOVOSADSKI VODI^ POLIKLINIKA „PEKI]” Gr~ko{kolska 3, tel: 426-555, 525-261, radnim danom od 8 do 20, subotom od 8 do 14 RADIOLO[KI

Др Милан Митрић

PREVOD DOO, Novi Sad, Resavska 3, sve vrste prevo|ewa, inostrane penzije, tel: 6350-664, 6350-740

одржава у склопу Прославе општине Бечеј, имају подршку локалне самоуправе, али и Покрајинског секретаријата за омладину и спорт, као и бројних предузетника и привредних субјеката. На овогодишњем Адреналин фесту наступају бечејски састав „Bloodline“,затим један од најпознатијих метал бендова у Србији београдски „RainDelay“, њихови суграђани „Rapid Force“ и „Violent Chapter“,ветерани домаће метал сцене „AmonDin“ из Ваљева и директно с европске турнеје стиже фински мелодик треш састав „Rautakeha“. В. Ј.

ДАНАС „ШТРУДЛИЈАДА” У НОВОМ МИЛОШЕВУ

Домаћице обарају Гинисов рекорд НОВО МИЛОШЕВО: Најпознатији војвођански специјалитет -штрудла “представиће”се у свим облицима и варијантама на данашњој “Штрудлијади” у Новом Милошеву. Мајсторице у справљању ове укусне посластице уједно имају пред собом велики задатак - спремају се за “обарање” Гинисовог рекорда у највећој штрудли. Али, прво ће морати да надмаше сопствени рекорд -прошлогодишња штрудла била је дугачка чак 21,60метара.У нади да ће се новомилошевачке домаћице уписати у јединствену књигу рекорда, организатори “Штрудлијаде” најавили су најбољу манифестацију до сада. Гурмани ће моћи да задовоље своја непца и пробају најразличитије врсте штрудли, класичне са маком и сиром,али и са вишњама, јабукама, џемовима, рогачем и другим. Посетиоце и ове године очекује надметање у брзом једењу штрудле, а на програму који обилује етно мотивима наћи ће се разнолике фолклорне игре и песме Председница Месне заједнице Ново Милошево Александра Ђуричин рекла је на конференцији за новинаре да ће манифестација бити крунисана вечерњим наступом певачице Јелене Костов. - “Штрудлијада” ће традиционално бити одржана у сеоском парку и у центру Новог Милошева. Оваква врста комплексне манифестације била је крупнији залогај за нас,али смо се снашли уз

добру организацију и подршку спонзора –казала је Ђуричинова. Помћник председника општине Нови Бечеј Милован Баштованов нагласио је да је локална самоуправа максимално подржала ову манифестацију, како фи-

Стогодина струје ибиоскопа ОМОЉИЦА: У Омољици данаспочињеобележавањесто година електрификације и првогбиоскопаоткривањемдвеју плоча,којеподсећајунаове догађаје. Плоче ће, у 11 сати открити градоначелник Панчева дрСветозарГавриловић идиректорЈугословенскекинотеке РадеЗеленовић. Занимљивоје дасуОмољчанипрвиуБанату ималибиоскоп,аструјусудобили15годинапреградакоме припадајуитозаслугомМинаела Селешиа и Васе Пандурова.Селешије1911.годинепрвопоставиоагрегатвећегкапацитета у свом хотелу, а затим 1912. отворио биоскоп, док је исте године Васа Пандуров потписао уговор са локалном влашћуоуличнојрасвети. З. Дг.

Турниру фудбалуна малеголове БЕЧЕЈ: Традицонални, 6. по реду, турнир у фубалу на малеголове поимену„ЈогаБонито“или„3на3“играћесеу организацји Бечејског удружењамладих–БУМнаплатоутрга испред Градске куће. Телефони за пријаве на турнир су 063/544321 (Аца) и 063/8432134(Бојан). Кот из ац иј а за екип у кој а бројитричланаиможедаима дверезервеизноси2.000динара, а у наградни фонд иде 80 одсто од уплата. Турнир почињеууторак,7.августа,изавршавасеусуботу,11.августа,а утакмицесеиграјуувечерњим сатима. В. Ј.

Радовиу УлициСтевана Шупљикца ПАНЧ ЕВ О: За саобраћај ћеоднедеље5.августаодпет сат и ујут ру бит и зат вор ен а Улица Стевана Шупљикца у делу од Илије Гарашанина до Мил ош а Обрен ов ић а. Улиц а ће бити затворена због радова на водоводној мрежи. СаобраћајнаправцимаВршац–Београдћебитипреусмерениодвијаћесеулицама:ИлијеГарашанина, Кнез Михаила ОбреновићаиМилошаОбреновића до Баваништанског пут а. Радовићетрајатидо7.августа,а аутобусиналинијама2и3нећесаобраћатикрознас ељеТесла,него улицомБаваништанскипут. З. Дг.

Неради скенер уболници

нансијски, тако и логистички, док је чланица Организационог одбора Драга Недин напоменула да сваке године има све више и више учесника, такмичара али и посетилаца. -Ово је девета година по реду. “Штрудлијаду”је започело “Коло српских сестара”и дошли смо на идеју да уприличимо такмичење домаћица у справљању штрудли. Мислим да се у Новом Милошеву и не може замислити недеља без штрудле.Мора да буде са сиром, пре супе, и са маком и вишњама после ручка – истакла је Нединова и најавила да ће,после печења џиновске штрудле, она бити подељена посетиоцима. Ж. Б.

ПАНЧЕВО:УОпштујболнициуПанчевујошод24.јула сепоправљаскенер,апроцена је да ће коштати око милион и подинара.Докапаратнебудеу функцији пацијенти којима је потребан редован ЦТ преглед због дијагностике или лечења бићеупућиваниуКЦСрбијеу Београду са овереним упутом. Онколошкиболесницићеићиу Институт за радиологију такођеуБеограду,апрегледаћесеи у Ургентном цент ру. Лежећи пацијенти ће бити послати у клиникуСветиСава. З. Дг.


kultura

dnevnik

subota4.avgust2012.

11

ПРЕДСТАВЕСНПУСПЕШНЕИУДРУГИМДРЖАВАМА

Гостовањау њујоршкомтеатру ЛаМаМаинафестивалима Представа Српског народног позоришта „Брод за лутке“ МиленеМарковић,урежијиАнеТомовић,позванајенагостовањеу децембру у чувеном њујоршком театру ЛаМаМа. То је још једно великопризнањеовојпредстави, којаједосадвишепутагостовала и увек добијала похвале, а чак шестСтеријинихнаградајеосвојила2009.наПозорју.Упредставииграју:ЈаснаЂуричић,Драгиња Вогањац, Милица Грујичић, Радоје Чупић, Ненад Пећинар и

целе Европе. Прављена је шира, паужаселекција,даби накрају, акомогутако дакажем,победницибилиСрпсконароднопозориште иЗагребачкоказалиштемладих,чијепредставесу позванена гостовањеуњујоршкитеатарЛаМама – објашњава за наш лист управник Српског народног позоришта Александар Милосављевић. То подразумева, како додаје он, и радионице у које ће бити укључениглумци,имладиреди-

Опера„Милева”нафестивалууСегедину - Наша представа „Милева“ Александре Вребалов у режији ОзренаПрохића,позванајеназаистапрестижниОперскифестивалуСегедину.Тојеозбиљанпројекаткојиподразумеванесамо гостовањенашепредставе,већиразменуоперскихпевача,такода ћеунашојпоставцинаступитиоперскисолистииздругихоперскихкућа-кажеМилосављевић. ОзначајутогфестивалаговоричињеницадаћеондогодинебитипресељенуАвињон,адаћепобедничкапредставасовогодишњегфестивалабитипозванапоаутоматизмууАвињон,наводи Милосављевић, тако да је изазов прилично велики. Комплетна средства за реализацију тог гостовања у Сегедину су добили од ВладеАПВојводине,начемујеСНП,поречимаМилосављевића, изузетнозахвалан,јербезтепомоћинебимоглидагареализују. Радован Вујовић. Композитор је Дарко Рундек, сценограф Љерка Хрибар, костимограф Момирка Баиловић,азасценскипокрет је задуженСашаКрга. - Ради се о конкурсу који су расписали њујоршки театар ЛаМаМаиПозоришницентарМартина Сегала, а у сарадњи са Европскомтеатарскомконвенцијом,чијисмомичлан.Конкурсје подразумеваопредставе којеимајуизразитиуметничкипечатмладих редитеља, и на њему је учествовало скоро 40 позоришта из

тељи, као и разговор о позориштимаи представама. - Треба рећи да је позориште ЛаМаМа Елен Стјуарт основала својевремено шездесетих година каоцентармултикултуралногтеатраидајењенутицајбиоогроман.Онајеучествоваланапрвим Битефима,билајеврлоангажованаокопромоцијаовогфестивала на међународном плану, и успостављала присне сарадничке односесаљудима,театарскимствараоцимасовихпростора.Угрупу тих људи, које је она звала

Изпредставе„Бродзалутке“

својом децом, јер је сама имала надимак Ла Мама, спадају СлободанкаЦацаАлексић,редитељкаизБеограда,њен супруг БранкоМилићевићКоцкица,Добрила Стојнић, драмска уметница и Ивана Вујић, редитељка. Она је простобринулаоовојсвојојдеци и када није била у непосредном контакту. Врло јој је било стало до позоришта с ових простора, посећивала је Београд и Србију. ПренеколикогодинајенаБелефу играна њена представа, била је честгостБитефа, итевезеизмеђуЛаМамеипозориштанаовим

ХОР КУД-a„СВЕТОЗАР МАРКОВИЋ”ОСВОЈИО ШПАНИЈУ

Првиукатегоријиполифоније На 58. интернационалном такмичењу „Хабанерас и полифониа„, у Торевијехи у Шпанији, хор Културно – уметничког друштва „Светозар Марковић“, под диригентским вођством Божидара Црњанског, у конкуренцији 16 одабраних хорова из 11 земаља с три континента, забележио је фантастичан успех и освојио прво место у категорији полифоније, трофеј и новчану награду у износу од 10.000евра. - Фестивал „Хабанерас и полифониа„ који се ове године одржавао од 23.до29.јула, нај-

програми су почињали у 23часа и трајали до дубоко у ноћ. -Хор КУД -а „Светозар Марковић“је певао друге вечери фестивала, и одмах након наступа уследили су одлични коментари од стране стручне јавности, као и колега диригената других хорова. Наш хор је заиста маестрално отпевао свих пет композиција: Обавезну „Saludo a Cuba“, затим хабанере „Voi en buscadelolvido“и „Atulado“,и након тога дело белгијског аутора Ролана Корyна „Death be not proud“, као и композицију „Ра-

Уручење наградедиригентуБожидаруЦрњанском

већи јеи најзначајнији у Шпанији,јер чуватрадицију певања хабанера на простору на коме је овај музички облик и настао – напомиње диригент нашег хора БожидарЦрњански. Овогодишњи фестивал јеокупио хорове из Колумбије, Шпаније, Србије, Венецуеле, Пољске, Литваније, Индонезије, Јужне Кореје, Летоније, Кине и Мађарске. Сви ансамбли су, по речима Божидара Црњанског, наступали током четири такмичарске вечери у чувеној „Арени сунца“у граду Торевијеха,на самој обали средоземног мора, а

сти, расти мој зелени боре“, нашег младог композитора Вука Милановића. Једино што нам је тада преостало,било је да сачекамо финално вече са гала концертом и проглашење најбољих које је уследило у суботу 28.јула. Очекивања су се испунила и наш хор је освојио највише признање и прву награду, иако су остали хорови својим изузетним богатством репертоара и квалитетом интерпретације били више него оштра конкуренција. У томе је радост била и већа.–истичедиригент победничког хора у овој конкуренцији.

Важно је напоменути, додаје он,да се на овомфестивалу додељују награде само најбољим хоровима,дакле само једна трећа, једна друга и једна прва награда. - О престижном квалитету овог Фестивала не говори само његова традиција од готово шест деценија, него и чињенице да због одличних услова које нуди, а то су боравак од седам дана на мору у хотелу за све његове учеснике,као и врло високе новчане награде. Све то, наравно, под условом да вас њихов уметнички савет сврста у један од врхунских ансамбала и упути вам позив за учешће.Укупно 37 младих певача, под мојим диригентским вођством, и овог пута је на изузетан начин пре зентова ла своје Друштво, Град, Покрајину и Републику Србију, као и на свим претходним такмичењима и фестивалима. За десет година активног рада, овај аматерски састав је стасао у најбољи у земљи, освојивши 25 највиших међународних награда и признања на најзначајнијим такмичењима у Европи, али и сва престижна домаћа одличја –указује БожидарЦрњански. Ово је до сада један од највећих успеха ове златне генерације младих певача који имају прилику да на најбољи могући начин обележе деценију изузетно успешног рада, каже њихов диригентинајављуједаихдо краја године очекује врло интересантан пројекат са џез оркестром РТБ, као и јубиларни годишњи концерт. Н.П-ј.

просторима су остале и после њене смрти – каже Милосављевић. Последње гостовање позориштасовихпростора,какопосећа Милосављевић,којејебилозаистарелевантно,било је почетком осамдесетих година, када је у Њујорку играно „Ослобођење Скопља“ Душана Јовановића у режији Љубише Ристића, који је тада добио награду Бродвеја. То је, по речима Милосављевића, билазаистаозбиљнаафирмација позоришта,тада јетобиоКПГТ, спросторабившеЈугославије.

- Ево сада прилике да поново последугогнизагодинанекопозориште из ове државе гостује у Њујорку. Ми имамо обезбеђена четиритерминазаиграње,имамо обезбеђен делимично смештај и помоћ при конструкцији сценографије, јер близу памети је да преносимооригиналнусценографију одавде, што би било екстремно скупо. Дакле, нису обезбеђенисвитрошкови,натомерадимоданађемо финансијскупотпорузаовогостовање.Онојебилонепланирано, нисмо моглида га ставимо у план свог буџета,

али надам се да ће овде људи схватитиколики језначајовоггостовања,недобијасе такав позив сваки дан,тако даверујемдаћемо наићи на разумевање – напомињеМилосављевић. По речима Милосављевића, концепт уметничког развоја ове кућесада севрлојасновидиион дајерезултатеинамеђународном плану. - Део тог плана и део те узлазне линије развоја репертоарске политике и уметничких домета СНП–а се види и на плану ових гостовања,докојих ће,надамсе, доћи-напомињеуправникСНП.Морам да кажем да су с изузетнимуспехомдочеканеидвепремијернекопродукцијеу којимаје партиципирало СНП: „Одисеј“ Горана Стефановског у режији Аце Поповског на Брионима, и, пре неколико дана „Слуга двају господара“ Карла Голдонија, као копродукција ГрадатеатраБудва, СНП–а и НП „Тоша Јовановић“ изЗрењанина. Ове представе позване су да учествују и следеће године на овим фестивалима на Брионима и у Будви, а њихове премијере у СНП–у ће бити 11. октобра („Слуга двају господара“) и почеткомновембра(„Одисеј“током три дана). Уз то, Милосављевић подсећаидасезапочетакдецембра припремају за „Дане СНП–а уЗагребу“,токомкојихћеиграти четири представеучетири театра уЗагребу.Докрајаовегодиненајављенесујошдведрамске премијере: „Салома“ Оскара Вајлда,урежијиПредрагаШтрпца и Чеховљев „Галеб“ у режији ТомијаЈанежича. НаташаПејчић

АНТОЛОГИЈАПРИЧАНАШИХНАЈПОЗНАТИЈИХПИСАЦАУИЗДАЊУ„ЛАГУНЕ”

БлиставиомажГрчкој Антологија прича о Грчкој из пера српских писаца „Овако је почело„у издању „Лагуне„у преводу на грчки Гаге Росић,до краја године појавиће се у грчким књижарама. Ово је за Танјуг изјавио уредник књиге Дејан Михајловић и објаснио да је књига, коју је приредила српска списатељица Љубица Арсић, била изложена овог пролећа на Сајму књига у Солуну, где је Србија била почасни гост, и привукла је пажњу домаћих издавача. Идеја да се начини оваква антологија,прва ове врсте у српској књижевности, потекла је од Арсићеве и њом је отворена, прошле године, нова „Лагунина„ едиција „Таласи„у којој је до сада штампно пет тематских антологија. У антологији су заступљени: Милован Марчетић, Владимир Пиштало, Видосав Стевановић, Светислав Басара,Вида Огњеновић, Филип Давид, Јелена Ленголд,Горан Петровић,Давид Албахари, Владимир Кецмановић,

Љиљана Шоп, Ибрахим Хаџић, Миомир Петровић, Љубица Арсић, Михајло Пантић, Игор Маројевић,Ђорђе Писарев,Мирјана Митровић,Вуле Журић ,Даница Вукићевић, Дејан Стојиљковић , Бранко Анђић, Енес Халиловић, Васа Павковић , Александар Илић ,Милица Мићић Димовска и Миодраг Раичевић. Како је написала Арсићева „ Неманасветучовекакојибарједном није пожелео да отпутује у Грчку. Уписана у све бедекере, конзервирана у књигама уметностинанашимполицама,онануди дугоиживотнопутовањедопрапостојбинеевропскемислипокојој смо васпитани и у којој деламо.Свакогкосесамоједномокупаоуњеномморуобузелојесвојеврсно осећање да је загазио у водупостањаиприспеонаважно местосакојегсеизмагмеихаоса појавилајасноуобличенамисаоо лепотиимудрости. Инспирисани колевком цивилизације која нам јету,надохватруке,најзначајнији савремени српски приповедачи

прерушениутуристе,оперскепеваче, заводнике, митотворце и Византинцеисписујунадахнутеи сижејно разноврсне приче. ЊиховблиставиомажГрчкојсамоје мали део онога што јој заправо свимидугујемо.

ИЗЛОЖБАУБИБЛИОТЕЦИМАТИЦЕСРПСКЕ

Векипоодпрвогброја„Јавора” Библиотека Матице српске је наосновуграђеизсвојихзбирки и РОМС-а приредила електронскуизложбуповодом150година од првог броја «Јавора», једног од, по речима Јована Скерлића, „најглавнијихкњижевнихлистовасрпских”.Ауторкаизложбеје СилвијаЧамбер,ауредникМиро Вуксановић. Изложба се може погледати у јавном каталогу Библиотеке до 27. августа, а електронски каталог изложбе трајно се чува и доступан је на CD-у у Библиотеци, као и на сајту www.bms.rs. Као лист за забаву и науку «Јавор» је излазио је у Новом Саду1862/63,ауређиваогајеи издавао његов покретач Јован Јовановић (Змај). Излазећи упоредо са «Даницом», од које се није пуно разликовао, уступио јојјеместодаби,након11годи-

на, 1874, као лист за забаву, поукуикњижевностбиопоново покренут.До1892.уређиваогаје дрИлијаОгњановић(1889.идо 13. маја 1890. са Јованом Грчићем, уредником тада привремено „угашеног” «Стражилова»), а 1893. Данило А. Живаљевић. «Јавор» је свих година излажења штампан у Новом Саду, а само последње године,1893,уЗемуну. Издавачи «Јавора» били су: Змај, Лука Јоцић, Арса Пајевић и Јован Карамата. Насвојимстранама«Јавор»је унајвећојмеридоносиопрозне, поетске и драмске књижевне текстове, оригиналне и преведене, затим популарно-научне чланке из астрономије, географије, електронике, историје, етнографије, педагогије, хемије, физике, дијететике, анатомије,

медицине и других наука и дисциплина. Посебан део «Јавора» чинила је тематски разноврсна рубрика названа најпре „Листићи”, потом „Листак”, где су објављивани извештаји из културног живота, привреде, заната,саобраћаја,разнихдруштава, некролошки чланци, библиографске вести, загонетке, одговори на питања читалаца и сл. «Јавор» је имао велики број сарадника, по речима Илије Огњановића, „многу и многу стару опробану снагу”, „многог почетника–полетарца” и„много женско име, као доказ да и Српкиња уме мислити и осећати”. Матица српска објавила је у два тома садржај «Јавора», по ауторима(1987)ипопредметима (1989), дело Иванке Веселинов којајенаписалаипредговор.


12

dRU[TvO

subota4.avgust2012.

LISTE ^EKAWA U ZDRAVSTVU NEREALNE, VODE SE PRO FORME

Novipravilnik na~ekawu DirektorRepubli~kogfondaza zdravstveno osigurawe Aleksandar Vukasnovi} smatradasuliste ~ekawanerealne,nerazumneidase vi{e vode „pro forme” nego {to susu{tinskiprecizneita~ne–od brojapacijenatadodatumao~ekivanogprijema.Vuksanovi}jezaTanjugrekaodabiproblemeupogleduvo|ewa,organizacijeia`urnostilista~ekawatrebalouzna~ajnomsegmentudare{inovipravilnik,kojijepripremilastrukazajedno s predstavnicima RFZO-a, Instituta „Batut” i Ministarstvazdravqa. – Predlog pravilnika je u Ministarstvuzdravqa,gdesamdobio uveravawa i nai{ao na razumevawe ministarke koja podr`ava dono{ewetakvogakta–naveojedirektorRFZO-a. Po wegovim re~ima, novi pravilnik propisuje ta~ne indikacije,kojejeizradilastruka,odnosno klini~ke kriterijume za koronarografiju, pejsmejkere, ugradwu valvule,bajpas,operacijekatarakte,kukovaikolena…isveostale zdravstvene usluge za koje se vode liste~ekawa. Onjeistakaoda}esetimeizbe}istavqawepacijenatanalistuu razli~itim bolnicama po razli~itimkriterijumima,„zlunetrebalo,akoimnekadzatrebaoperacija da zauzmu red”, kao i „nedo-

voqno obra|enih pacijenta” – prakti~no, ideja je da se ujedna~e klini~ki kriterijumi u svim zdravstvenimustanovama. – Iz razgovora s radiolozima koji rade na magnetnoj rezonanci dobiosaminformacijudaje50odstonalazanegativno,{tojepodatakjedinstvenusvetu,adasegotovo90odstodijagnozapostavqenih magnetom moglo indikovati drugimdijagnosti~kimmetodama–naveojeVuksanovi}. Kakojerekao,novimpravilnikomje,osimta~nihindikacija,definisan i stepen hitnosti, kao i prethodna dijagnostika koju pacijent treba da obavi da bi uop{te bioupu}ennamagnetnurezonancu iliskener.Onjenaglasiodanovi pravilnik precizno defini{e i hitna stawa koja ne}e ~ekati na listi, kao i da pacijenti ne mogu tek tako otkazivati i pomerati operacijeiznemedicinskihrazloga – odmora, privatnih poslova, slavqenaslave… Tako|e,propisanojedanemogu daseupisujunavi{elista–prilikom stavqawa na listu ~ekawa popuwava}e izjavu u kojoj, pod materijalnom i krivi~nom odgovorno{}u,potvr|ujudanisuninajednoj drugoj listi ~ekawa. Vuksanovi}jedodaodajeplaniranoimese~no ukr{tawe lista iz svih zdravstvenihustanova.

NOVINAR LASLO [A[ KONA^NO NA SLOBODI

„Ose}amsekao ponovoro|en” Novinar Laslo [a{ (69) pu{tenjeju~eoko14~asovanasloboduizOkru`nogzatvorauSubotici. IzKabinetapredsednika Srbije Tomislava Nikoli}a pomilovaweza [a{aposlatoje direktno u Okru`ni zatvor u Subotici.[a{jeizdr`avaokaznuod150danajerjeuvrediovo|udesni~arskogpokreta„64`upanije” Lasla Torackaija. Kada je otvorio vrata zatvora, Laslo [a{ je ugledao mnoge novinarskeekipekojesusvojimkamerama i fotoaparatima `eleli da zabele`eizlazakkolege. –Ose}amkaodasamseponovo rodio–rekaoje[a{poizlasku izzatvora.–Zadovoqansam.Da nijebiloLasla Juhasa,kojije20. julazabele`iomojodlazakuzatvor,nebido{lodosvegaovoga.

etikeidrugihtema,akorisnicima jeomogu}enpristupVirtuelnojbiblioteci Srbije i bibliotekarskimresursima{iromsveta.Osim renovirawa biblioteke, projekat jeobezbedioopremuzaJedinicuza razvojnastavnogplanaiprograma. –Tiresursi}edoprinetiobuci policijeuSrbijiiomogu}i}epovezivaweCentrazaosnovnupoli-

Zahvaqujem se svim kolegama i novinarskim udru`ewima {to sumepodr`ali.Znamdasusaku-

Nikoli}: Neprimerena kazna „Po{tuju}ipravnuproceduru,predsednikSrbijejepredlogo pomilovawu[a{apotpisaouuverewudajepravonaslobodumi{qewajednoodosnovnihcivilizacijskihtekovina”,navodiseu saop{tewuizNikoli}evogkabineta.Kakosedodaje,„neprimerenojedanovinarLaslo[a{slu`ikaznuzatvoraod150dana samozato{tojeizneosvojemi{qewe,{toje,tako|e,protivno svimevropskimstandardimaime|unarodnimkonvencijama”.

Renoviranabibliotekau Centruzaosnovnupolicijskuobuku UCentruzaosnovnupolicijsku obukuuSremskojKameniciju~esu otvoreni interaktivni informacionicentaribiblioteka,kojisu uspostavqeni uz podr{ku Misije OEBS-auSrbiji.Usaop{tewute misije navedeno je da bibiloteka sadr`inekolikostotinakwigaiz oblastiprimenezakona,krivi~nog prava, forenzike, qudskih prava,

dnevnik

cijsku obuku s ostalim stru~nim bibliotekama – izjavila je vr{ilacdu`nosti{efaMisijeOEBSa u Srbiji Pola Tidi. – Nova interaktivna biblioteka }e pomo}i policijiSrbijeudaqemrazvojui unapre|ewu sopstvenih ve{tina tako {to }e omogu}iti brz i lak pristupizvorimastru~nihinformacija.

pqalinovac,alidra`emijeto {tomejepredsednikSrbijepomilovao. Onka`edamujeuzatvorubilote{ko,alidaseprivikao. – Da nisam imao podr{ku novinara i mnogih udru`ewa, iza{aobihtekudecembru.Janisam mogao da platim kaznu jer imam honorarna primawa. Pitao sam Torockaija za{to me tu`i ba{ zatajtekst,aonjerekaodamo`e datu`ikogaho}e–pri~a[a{. Laslo [a{, koji je radio kao honorarnisaradnik„Hetnapa„i

pojedinih medija u Ma|arskoj, 20.jula je oti{ao u Okru`ni zatvornaizdr`avawekazneod150 danajernijeimaodaplatikaznu od 150.000 dinara. Pre nedequ dana, kada je pokrajinski sekretar za informisawe Slavi{a Gruji} posetio novinarovu suprugu,rekaojeda[a{trebada iza|ekaoslobodan~ovek. –Zadovoqansamodlukomopomilovawu Lasla [a{a, penzionisanog novinara iz Subotice, kojijebiouzatvoruzbogpovrede ~asti vo|e ma|arskog ekstremisti~kog pokreta „64 `upanije”–rekaojepotpredsednikVlade Vojvodine i pokrajinski sekretarzakulturuijavnoinformisaweSlavi{aGruji}.–Pomilovaweje jedinimogu}izavr{etaktognemilogdoga|aja, irealnojebiloo~ekivatida[a{budeoslobo|enjernijesmeonida budeosu|en,akamolizatvoren. Gruji}jeizraziozadovoqstvo itime{tosuuaktivnostimana pomilovawuiosloba|awuLasla [a{a zajedni~ki u~estvovale strukovne i druge organizacije, ukqu~uju}i i Pokrajinski sekretarijatzakulturuijavnoinformisawe. S. Ir{evi}

UPRAVA BOLNICE U ZREWANINU DEMANTUJE TVRDWE JEDNOG RADNIKA

Nijebilopartijskog zapo{qavawa JedanodradnikaOp{tebolnice “Dr \or|e Joanovi}” u ZrewaninuDragan [a{i} optu`iojena konferenciji za novinare rukovodstvotezdravstveneustanoveda jeodgovornozanaru{eneme|uqudske odnose zbog zapo{qavawa po partijskom kqu~u. Navode}i da je Bolnicabastionsiroma{tva,[a{i}je,tako|e,prozvaomenaxment datakozvanimnezdravstvenimradnicima ispla}uje samo 70 odsto plate, kao i da ne upla}uje putne tro{kove onima koji iz okolnih sela dolaze u Zrewanin na posao. [a{i} je pozvao rukovodstvo na po{tovawezakonitostiire{avawe pitawa dugovawa nemedicinskomosobqu. Direktorka zrewaninske BolniceGordana Kozlova~ki odmahje reagovalanateoptu`beisazvala pres-konferenciju da bi demantovala[a{i}evetvrdwe.Onajeodbacilasvewegovenavodeinaglasila da, i pored te{ke ekonomske situacije, ustanova koja brine o zdravqume{tanasvihpetop{ti-

nasredwegBanata,dobrofunkcioni{e. Kako je istakla, zarade za prethodnimesecispla}ujuseod12. do18.umesecu,a16.julaispla}en jestopostotniiznoszaprethodni meseczasveradnike. – Svi radnici na{e bolnice, i zdravstveni i nezdravstveni, odvajkada dobijaju platu istog dana. U svakom prethodnom mesecu ove godine,aliiranijihgodina,zaradesuupotpunostiispla}ivanenajkasnijedo20.umesecuzaprethodnimesec,aliidvetre}ineakontacijezaaktuelnimesec–objasnila jeGordanaKozlova~ki. Reaguju}i na kazivawa da se zaposlenimakoji`iveuokolnimselimaneispla}ujuputnitro{kovi, direktorkaBolnicejerekladase odmaja2009.godineoniispla}ujuu dinaridanekasnenijedanmesec. –Jedinizastojuisplatiputnih tro{kovapostojaojeod28.majado 16.juna,kadajeBolnicaposlovala u izuzetno te{kim finansijskim okolnostima,{tona{ipacijenti nisumoglidaosetejersetonipo

~emunijeodrazilonakvalitetna{eg rada. Ali, akrobacijskom ve{tinommenaxmentauspelismoda prevazi|emotajproblem–navela jeona. GordanaKozlova~kijenegirala ioptu`bedasuuposledwevreme radnici zapo{qavani po partijskomprincipuidajetodovelodo naru{enih me|uqudskih odnosa. Powenimre~ima,odjuna2011.do jula ove godine u Bolnicu je primqeno 176 novih radnika, od toga 95 u stalni radni odnos, a ostali naodre|enovreme.Me|unovozaposlenimajei19doktora. –Sviprijemisprovedenisuputemkonkursa.Raspisanojeukupno 36konkursa,sutvr|enimkriterijuma,isvipostupcibilisutransparentni. Ni na jedan prijem nismo imali ni prigovor, a kamoli `albu – kazala je Gordana Kozlova~ki,idodaladasuu2010.i2011. godinizaposleni,uanketamakoje su sprovedene, me|uqudske odnose ocenilivrlovisokimocenama. @. Balaban

BE^EJCI OBELE@ILI DAN RAVNOPRAVNOSTI

Uru~enePrvoavgustovske nagrade Recitovawem pesme Stevana Rai~kovi}a „Tisa“ na srpskom i pesme[andoraRemiweka„Zastava“ na ma|arskom jeziku, podizawem zastave op{tine Be~ej na jarbolu ispred Gradske ku}e, te sve~anom sednicom Skup{tine op{tine Be~ej, ju~e je obele`en Dan ravnopravnosti najve}e potiske op{tine. Time se podsetilo na 1. avgust 1774. godine, kada su ukazom carice A u s t r o - U g a r s k e Marije Terezije potvr|ene privilegijesrpskomstanovni{tvu i pro- {irene na nesrpsko stanovni{tvo u Potiskom di{triktu sa sedi{temuBe~eju. Potomjenovoimenovanipredsednik op{tine Be~ej Vuk Radojevi} podsetio na specifi~nost obele`avawa pomenutog praznika, po{to je op{tinska ve}ina

tekkonstituisanai,izme|uostalog,dodao: – O~ekujem da svi zaboravimo odre|enepoliti~keanimozitete idasedr`imozajedni~kihkop~i

koje nas spajaju da bismo teku}u 2012.godinupretvoriliuradnui razvojnusvedokvrednostizakojese,zapravo,svizajednoborimo nebuduop{teprihva}eneoddru{tva u kojem `ivimo – apostrofiraojemrVukRadojevi}.

Predsednik Skup{tine op{tine Be~ej Peter Knezi je, na ma|arskom i srpskom jeziku, naglasio vrednost be~ejske regije da vekovima `ivi u duhu ravnopravnosti i tol er anc ij e. Prvoavgustovskenagradeop{tine Be~ej dobili su i s t o r i ~ a r k a K o l u m b i j a univerzitetau Wujorku dr Ana Anti}, p r e d s e d n i c a Prek r{ ajn og suda u Be~eju Sne`ana Ba{i}, Igor Bra}, direktorkaNarodne b i b l i o t e k e Be~ej Er`ebet Kinka, nastavnik muzi~ke kulture, instruktor i koreograf ma|arskog narodnog plesa Ana Ki{imre-Serda, te Dru{tvozaborbuprotiv{e}ernebolestiop{tineBe~ej. V. Jankov


crna hronika

dnevnik

Poginuona{upi skog Vi{eg suda Tatjana \ura{kovi},nakondojaveodoga|aju,naredilajeobdukcijunaInstitutuzasudskumedicinudabi seutvrdiouzroksmrti,saznajemonezvani~no. M.V.

VANDALIZAMUCENTRUADE

Ciglomnaprozore crkveihotela Pol ic ijs ki slu` ben ic i u Adipodnelisukrivi~nuprijavu protiv me{tanina DanijelaP. (1992)zbogosnovasumwedajepo~iniokrivi~nodelouni{teweio{te}ewetu|e

saznali, osumwi~eni je prozor uspeo da razbije tek iz drugog poku{aja izbliza, po{to mu to nije po{lo za rukombacawemciglesve}eudaqenosti.

Hotel„Park”uAdi

stvari. On se tereti da je u cent ru Ade cig lom razb io proz or e na rim ok at ol i~k oj crkviihotelu„Park”. Uno}iizme|uutorkaisredepolupanjeprozornarimokatoli~kojcrkvi.Vandalizam je prijavio sve{tenik, koji je zatekaorazbijenostaklokada jedo{aonaslu`bu,akakosmo

Prozor na „Biznis klubu” na zdawu hotela „Park” obesni mladi} ciglom je, kako se sumwa, razbio u ~etvrtak u 2.20 sata. Otkriven je zahvaquju}i snimku sigurnosne kamere, koja je instalisana na glavnoj raskrsnici u centru Ade. M.Mr.

UI\O[U,KODKIKINDE

Kra|aslavina Kikindska policija najavila je podno{ewe krivi~ne prijave protivdvojiceme{tanaI|o{a, Nikole P. (1993), zbog osnova sumwe da je po~inio krivi~no delo te{ke kra|e, i Zorana \. (1967), zbog osnova sumwe da je po~iniokrivi~nodeloprikrivawana{tetuRukometnogkluba„Partizan”,Fudbalskogkluba „Borac” i Dobrovoqnog vatrogasnog dru{tva iz I|o{a, op{tineKikinda.

Osumwi~eniNikolaP.seteretidajetokomjulaovegodine provalio u prostorije o{te}enihklubovaiDVDI|o{,izkojihjedemontiraoiodneodvadesetakbaterijaza~esmeikuhiwski pribor, pri~iniv{i im na tajna~inmaterijalnu{tetuod oko 50.000 dinara. Drugoprijavqeni Zoran \. se tereti da je od Nikole P. kupio ukradene slavine. M.Mr.

LISICELEKARUINSTITUTAZA ORTOPEDSKO-HIRUR[KEBOLESTI„BAWICA”

Ortopeduhap{en zbogmita

Policijskislu`beniciUprave kriminalisti~ke policije i Policijske uprave za Beograd li{ili su slobode primarijusadrZoranaG. (62), hirurga za ortopedsku hirurgijuitraumatologiju,zbogpostojawaosnovasumwedajeizvr{io krivi~no delo primawemita,saop{tiojeMUP. ZoranG.,kojijeisavetnik zamedicinskapitawaInstituta za ortopedsko-hirur{ke bolesti „Bawica”, li{en je slobode u nastavku akcije suzbijawa korupcije i u saradwi s Vi{im javnim tu`ila-

{tvom u Beogradu. Osumwi~enije,dodajese,31.julaove godine, od roditeqa pacijenta H. K. zahtevao novac, u iznosu od 500 evra, da bi mu, preko reda i bez ~ekawa na lis tu zak az an ih oper ac ij a, operisao meniskus kolena, „a danas,nakonizvr{eneoperacijeiprimionovacunavedenomiznosu”. Osumwi~eni }e uz krivi~nu prijavu biti priveden istra`nom sudiji Vi{eg suda u Beogradu, napomiwe se u saop{tewu. (Tanjug)

13

RASVETQENEKRA\EUKARLOVCIMA

JU^EUTOVARI[EVU

ZoranV.(1977)izTovari{eva,kodBa~kePalanke,poginuo je ju~e  ujutro, verovatno usled strujnog udara,  dok je obavqao radovebu{ilicomna{upi.De`urniistra`nisudijanovosad-

subota4.avgust2012.

Ise~endeostarogmetalnogmosta Policija je podnela krivi~ne prijave protivBeogra|anaZvezdanaM. (1981),JovanaR. (1987),RadojaI. (1949)iSlobodana@. (1976)izObrenovcazbogsumwedasu22.julapo~inilikra|uuSremskimKarlovcima. Oniseteretedasubreneromseklidvemetalnekonstrukcijestarog`elezni~kogmostauvlasni{tvuJP„@elezniceSrbije”i po~elidaihutovarajuukamionkojimsudo-

{li, ali policija ih je primetila i odmah posletogauhvatila. Tako|e, dodaje se u ju~era{wem saop{tew u nov os ads ke Pol ic ijs ke uprav e, krivi~ne prijave podnete su i protiv Karlov~ana Stevana M. (1989) i Slavoquba R. (1991), kojima se pripisuje da su po~inili krivi~no delo neovla{}enog kori{}ewa tu|eg vozila. Oni se terete

da su pro{le sedmice u Sremskim Karlovcimaukrali„reno„kojijebiootkqu~an,alisuihpolicajciuhvatiliipotom vratilivozilovlasniku. Wihdvojicaosumwi~enasuizakra|uradijatora iz Doma zdravqa u istom mestu u aprilu,kojusu,kakosepretpostavqa,po~inilisjo{jednimmaloletnikom. M.V.

ISTRA@NISUDIJAUZREWANINUJU^ESASLU[AOOSUMWI^ENEUAFERI„JUGOREMEDIJA”

ZdravkuDeuri}u pritvordomesecdana Istra`nisudijaVi{egsudau Zrewaninu Goran Zec doneo je ju~e re{ewe o odre|ivawu pritvorado30danadirektoruzrewaninske Fabrike lekova “Jugoremedija” Zdravku Deuri}u (49) i v. d. direktora preduze}a “Penfarm”i“Luksolfarmacija”MilaniZ. (28). Ostalo dvoje, osumwi~eni da supo~inilikrivi~nodelozloupotrebeslu`benogpolo`ajai o{tetili“Jugoremediju”zaoko 600.000 evra – finansijska direktorkatefarmaceutskeku}e AnkicaM. (48)isudskive{tak gra|evinske struke Stevan G. (47), pu{teni su da se brane sa slobode. Istra`ni sudija je ujedno doneo re{ewe o otvarawu istrage protiv sve ~etvoro osumwi~enih.Deuri},MilanaZ.iAnkica M. se terete da su, u sau~esni{tvusaStevanomG.,tokom2011. godine, prilikom osnivawa “Penfarma”od“Jugoremedije”i “Luksol farmacije”, procenom vrednosti zemqi{ta i akcija “Jugoremedije”kojajebilavi{a odtr`i{ne,aliifalsifikovawem izve{taja o vrednosti licence lekova koji su ustupqeni “Penfarmu”, o{tetili zrewaninsku farmaceutsku kompaniju zaoko600.000evra. Kaoiprilikomizno{ewaodbrane u prostorijama Policijske uprave u Zrewaninu, osumwi~eni su i tokom saslu{awa predistra`nimsudijomodbacilisvenavodeizkrivi~neprijave.“Dnevnik”nezvani~nosazna-

je da je Deuri} negirao da je sa saradnicima o{tetio “Jugoremediju” i da je imovinu prebaciou“Penfarmu”,tvrde}idaje proces protiv wega politi~ki motivisanoddonedavnovladaju}egre`imadabiseskrenulapa`wa s nezakonito sprovedene

ZdravkoDeuri}

privatizacije “Jugoremedije” 2002.godine. Direktortefabrikejekazao da najvi{i organi Evropske unijezahtevajuodVladeSrbije preispitivawe sumwivih privatizacija,me|ukojimajei“Jugoremedija”. –Krajemavgustatrebalobio toj temi u fabrici da razgovaram s izvestiocem Evropskog parlamenta za Srbiju Jelkom

Kacinom. Sada ne znam kako }u ga do~ekati – rekao je, kako „Dnevnik” saznaje, Deuri} pred istra`nimsudijom. Saop{tewem za javnost ju~e se oglasio i Odbor direktora “Jugoremedije”kojijenajo{trijeosudio,kakojenaveo,“nezako-

Zrewaninu, u saradwi s Vi{im javnimtu`ila{tvom,ju~eiprekju~e izrazilo je i pedesetak radnikaiakcionara“Jugoremedije”, “Penafrme” i “Luksol farmacije”.Nakonprotestaispred zgrade Policijske uprave, onisuseokupiliipredvrati-

PalatapravdeuZrewaninu

nito privo|ewe generalnog direktoraZdravkaDeuri}aifinansijske direktorke Ankice M.”Odbordirektorajezatr`io daselicakojasuupritvoruodmahpustenasloboduidapostupak pokrenut protiv wih bude obustavqen. Svoje nezadovoqstvo zbog akcije koju su sproveli MUP Srbije, Uprava kriminalisti~ke policijeiPolicijskaupravau

maPalatepravde.Nastavilisu ju~e protest u Gradskoj ku}i, zahtevaju}i da se Deuri} i MilanaZ.pusteizpritvora. –Ovojemontiranprocesprotiv na{eg direktora. Ulo`ili smo dosta novca i truda da bismoostaviline{tona{ojdeci, ine}emoodustatiodborbe–poru~ilajevlasnicaakcija“Panfarma”VeraZlokas. @.Balaban

BIV[IPREDSEDNIKREPUBLIKESRPSKE16.OKTOBRA PO^IWEODBRANUPREDHA[KIMSUDOM

Karayi}dostavio listusvedoka

Biv{ipredsednikRepublike Srpske Radovan Karaxi}, optu`en za ratne zlo~ine nad nesrbimauBosniiHercegovini,dostavio je sudskom ve}u Ha{kog tribunala spisak svedoka koje nameravadapozovetokomdokaznog postupka odbrane koji po~iweuoktobru. „Lista svedoka je za sada poverqiva,uslu~ajudabinekood wih kasnije mogao zatra`iti mere za{tite. Imena }e biti objavqena mesec dana uo~i wihovog saslu{awa„,navodise u Karaxi}evom podnesku,uzkojijeprosledio i listu svedoka. Tu`ila{tvo je 4. majazavr{iloizno{ewedokaza,aza16. oktobar je najavqeno saslu{awe prvih svedokaodbrane. Tribunaljeujunu oslobodio Karaxi}a po jednoj od dve ta~keoptu`nicekoje biv{eg predsednika RS terete za genocid. Sudije su navele da tu`ioci nisu izneli dovoqno dokaza da bi podr`alita~kuoptu`nicekojaga je teretila za masovna ubistva, proterivawe i progon muslimanskog i hrvatskog stanovni{tva iz bosanskih gradova od martadodecembra1992.godine, nasamompo~etkuratauBosni. Tribunal, me|utim, nije odba-

ciopreostalihdesetta~akaoptu`nice,odkojihsejednaodnosi na genocid i tereti Karaxi}a za u~e{}e u masovnom ubistvu muslimana u Srebrenici 1995.godine. Optu`nica, osim toga, Karaxi}a tereti za zlo~ine protiv ~ove~nosti i kr{ewe zakona i obi~ajaratovawa. Karaxi}jeujunuzatra`ioda budeoslobo|enposvimta~kama optu`nice, tvrde}i da Tu`ila-

{tvo nije iznelo nijedan dokaz kojim bi potkrepilo navode o wegovoj odgovornosti za zlo~ine. Pravila suda u Hagu omogu}avaju optu`enima da zatra`e osloba|awe po okon~awu dokaznogpostupkaTu`ila{tva. (Tanjug)

JU^EUNI[UIPROKUPQU

Sahrawenipodoficiri VojskeSrbije Uz vojne po~asti, ju~e su sahrawenipodoficiriVojskeSrbije stariji vodnik prve klase Neboj{aMili}(37)iz98.vazduhoplovnebrigadeistarijivodnik Slavi{a Markovi} (36) iz 204.vazduhoplovnebrigade,koji sustradali1.avgustaunesre}i prilikom ra{~i{}avawa terenaodminsko-eksplozivnihsredstavanaKopaoniku. NaNovomgrobquuNi{u,pored rodbine, mnogobrojnih prijateqaikolegastarijegvodnika prve klase Mili}a su na ve~ni po~inak ispratili i izaslanik predsednika Republike Milorad Simi}, izaslanik ministra odbrane, pomo}nik ministra za bud`et i finansije Srbislav Cveji}, zamenik na~elnika General{tabaVojskeSrbijegeneral-major Milan Bjelica, komandant ViPVO general-major Ranko @ivak i komandant 250. raketne brigade PVD brigadni generalDu{ko@arkovi}. NagrobquuGorwimKordincimakodProkupqasahrawenje starijivodnikSlavi{aMarko-

vi}.OdstarijegvodnikaMarkovi}aposledwiputoprostilisu se porodica, rodbina i mnogobrojni prijateqi i kolege. Sahrani su prisustovali izaslanikpredsednikaRepublikeMiloradSimi},na~elnikGeneral{taba Vojske Srbije generalpotpukovnik Qubi{a Dikovi}, izaslanik ministra odbrane general-majorSla|an\or|evi} i komandant 204. vazduhoplovne brigade brigadni general PredragBandi}. Ministar odbrane Aleksandar Vu~i} naredio je, nakon nesre}e,hitnuistraguradirasvetqavawa svih detaqa i utvr|ivawaodgovornosti. DvojicapoginulihpodoficirabilisupripadniciVazduhoplovstvaiprotivvazduhoplovne odbrane Vojske Srbije. Oni su bili anga`ovani na ra{~i{}avawu terena od minsko-eksplozivnih sredstava na osnovu ugovoraKomandeViPVOskontrolomletewaSCG(SMATSA)radi izgradwe za{titne ograde okoobjektanaKopaoniku.


14

subota4.avgust2012.

sport

dnevnik

30.LETWЕ OLIMPIJSKЕ IGRЕ ULONDONU(27.JUL–12.AVGUST) NA[IRUKOMETA[IDANASIGRAJUSJU@NOMKOREJOM

Potro{eni svikrediti

Srps ki ruk om et ativ Danske da mo`emo da se velikogkontaktasaqudimau {i zab el e` il i su nosimo sa najja~ima. Karte su Srbiji. Nije nam lako, ali tre}iporazzaredom. otvorene, ako pro|emo daqe, ~ekamo ove dve utakmice da Imaju}i u vidu rivauradilismone{to.Akoizgu- nam otvore vrata ~etvrtfile ([panija, Hrvatska i Danbimo, to je lo{ rezultat. nala–rekaojeStani}. Selektor Vukovi} i daqe ska) mo` da je bil o rea ln o Imali smo nesre}u da se o~ekivati da izabranici Vena|emo u ovako te{koj grupi, stoji na stanovi{tu da je selina Vukovi}a izgube prve jedino{tonisamzadovoqanje wegovom timu najve}i probtri utakmice i to ne treba na~in na koji smo izgubili lem na takmi~ewu to {to su shvat it i trag i~no.Reprezentacija Srbijejeuposledwem susretu izgubila od evropskog {ampiona Danske (26:25),alijeudobrom delu utakmice, pogotovo u prvih 15 minuta, pokazala da ima adute za ~etvrtfinale. Da su orlovi u dos ad a{ wem del u takmi~ewa igrali kao u prvom delu duela sa Dancima, ili u fini{u me~a,poredskorana{eselekcijenebi stajala bolna nula. Olimp ijs ki turnir prakti~no teksadapo~iweza na{e orlove, koji uposledwadvakola B grupe nemaju pravo na gre{ku. Popravnog ispita vi{e nema, rukometa{iSrbijemora}e da savladaju Ju`nuKoreju(danas MomirRni}iDalibor^uturauduelusDancima u 12.15) i Ma|arsku (ponedeprve dve utakmice, pa ni pro- im to prve Olimpijske igre, qaku10.30)dabiseplasirali tiv Danske nismo verovali u kao i da se to vidi po napretkuuigri. u nok au t faz u. Izab ran ic i pobedu – rekao je golman - Sada nam sledi Koreja za VeselinaVukovi}asigurnosu DarkoStani}. ohrabrenipredme~eveodluke JunaknedavnogEPuSrbiji podizawe samopouzdawa i posle vrlo dobre partije u tvrdidajeatmosferauekipi onda borba za ~etvrtfinale s Ma|arima. Verujem da }e utakm ic i sa evropskim dobraiporedlo{egu~inka. {ampionomDanskom. - Trudimo se da ostanemo momci ve} danas pokazati - Malo nam je poquqano koliko - toliko koncen- pravo lice i da }e uspeti da samopouzdawe posle ovih trisani.Ne~itamo{tapi{u prika`u igru uz visoku konporaza,alismopokazalipro- na{i mediji, niti imamo centraciju-rekaojeVukovi}.

VATERPOLISTISRBIJEDANASIGRAJUSAAMERIKANCIMA(20.40)

Delfiniciqajuprvo mestougrupi

Vat erp ol o rep rezent ac ij a Srb ij e ostala je nepora`ena pos le tri odi g ran a kolauLondonu.Uprvadvakola izabranici Dejana Udovi~i}a zabele`ili su dve lake pobede protiv Ma|arske i Velike Britanije, a u tre}em su remizirali sa Crnom Gorom i jo{ uvek su u igri za prvo mestougrupi.Danas}eodmeriti snage s provoplasiranim timom u B grupi, reprezentacijomSADod20.40~asovapona{emvremenu. Selektor Udovi~i} o~ekuje te`akme~. -Bi}etote{kautakmica,kao {tojebilaionasaCrnogorcima.Amerikancimajegeneracija naizlasku,takodaimjeovoposledwi voz. Ulo`i}e sve da nas pobede.Oniigrajudruga~ijenego Crna Gora - rekao je Udovi~i}. @ivkoGoci}jenaveodao~ekuje pobedu nad SAD, ukoliko Srbijaponoviigruizprverunde. -Nebih`eleoniukompogledu da ih potcenim. Amerikanci igraju fantasti~no na turniru, pogotovo u odbrani. Moramo da se potrudimo da ispravimo sve {tomo`emoido|emodopobede kakobiu~etvrtfinaleu{lisa prvepozicijeugrupi-rekaoje Goci}. Milan Aleksi} je konstatovao: - Pobede u narednim susretimasaSADiRumunijomvodenas doprvogmestaugrupi. SlobodanNiki}igrausjajnoj formi.

CrnogoracAleksandarRadovi}iSrbinDu{koPjetlovi}vodili `estokeduele

-Ostajunamjo{dvasusretasa dvanimalolakarivala,Amerikancima i Rumunima. Ali, ono pravo nas o~ekuje od ~etvrtfinala. Du{koPijetlovi}jedodao: -Imastvariuigrikojemoramodapopravimo.Nadamseda}emoutomedauspemoida}emoka-

kosuturnirbudeodvijaoigrati sveboqeiboqe. Andrija Prlainovi} je sa 15 golovana{najefikasnijiigra~. - Golovi nisu bitni. Sada je najva`nijedajesveuna{imrukama.Mo`emodabudemoprvinatabeliida}emosveodsebedatako bude-rekaojePrlainovi}.


SPORT

dnevnik

subota4.avgust2012.

15

30.LETWEOLIMPIJSKEIGREULONDONU(27.JUL-12.AVGUST)

^avi}u ~etvrto mesto, Felpsovo 17. zlato Miloradu ^avi}u malo je nedostajalo da sesamedaqomoprosti od profesionalnog plivawa. Nije uspeo! Najboqi srpski pliva~ na ciq finalne trke u disciplini 100 delfin na Olimpijskim igrama u Londonustigaojekao~etvrtiuvremenu od 51 sekunde i 81 stotinke, 15 stotinki sporije nego u polufinalu.Titulu,17.zlatoi 21olimpijskumedaquosvojioje najuspe{niji olimpijac u istorijiMajklFelps(51.21),asrebrosupodelili^adLeKlosiz Ju`ne Afrike i Rus Jevgenij Koroti{kin, koji su stazu pre{li za po 51 sekundu i 44 stotinke.Posleslabijegstartanegoupolufinalu,^avi}jeuspeo da preuzme vode}u poziciju i okrene prvi, iza wega je bio [tefen Dibler iz Nema~ke. Wih su u drugoj polovini prestigliosvaja~imedaqa,aSrbin i Nemac podelili su poziciju ~etiri.Zastotinkusporijibio jeJuriVerlindenizHolandije, Amerikanac Tajler MekGil je podbacio sedmim mesto m (51.88),aPoqakKonrad^erni-

jaknijeuspeodaplivaispod52 sekunde (52.05). Finalna trka bilajeprili~nospora,odosam takmi~ara samo Koroti{kin je plivaobr`enegoupolufinalu. Na50slobodnozlatojeosvojio Francuz Floran Manadu sa 21,34 ispred Amerikanca KulenaXonsasa21,54iBrazilcaSezaraSjelasa21,59. Pretposledweg dana pliva~kih nadmetawa nastupila je i MiroslavaNajdanovskiudisciplini 50 slobodno. Ona je isplivala dosta slabiju trku i s vremenom od 26,46 {to je bilo dovoqno tek za 42. mesto od 73 pliva~ice. Amerikanka Misi Frenklin osvojila je zlatnu olimpijsku medaqu i postavila novi svetskirekordna200le|nouvremenuod2:04,06.Srebrojepripalo Ruskiwi Anastasiji @ujevoj sa 2:05,92,abronzajo{jednojAmerikanki Elizabet Bizel sa 2:06,55.Ina800slobodnozlato jeoti{louSD.SlavilajeKeti Ladeckisa8:14,63ispred[pankiwe Mireje Garsije Belmonte sa 8:18,76 i Britanke rebeke Adlingtonsa8:20,32.

Streqa{tvo 14.45 - MK pu{ka trostav 3h20 (`) finale (Maksimovi}, Arsovi})

Atletika

17.00 - 20 km hodawe (m) (Predrag Filipovi}) 19.50 - Disk (Dragana Toma{evi})

Vaterpolo 20.40 - Srbija - SAD

Odbojka 23 - Srbija - Brazil

MALOKALIBARSKAPU[KA60LE@E]I

Mirosavqev nije imao sre}e Milorad ^avi}

Srpskiatleti~arEmirBekri}plasiraoseupolufinalena400mprepone, po{to je u kvalifikacijama osvojio drugo mesto u grupi sa novim dr`avnim rekordom - 49,21 sekunde. On je sjajno startovao, malo je posustao u posledwih 70 metara,alijesa~uvaodrugomesto.Bekri}jeukvalifikacijama ostvario ukupno deseto vreme. Najboqi u toj kvalifikacionoj grupi bio je svetskirekorderDejvidGrinkojije400mpreponeistr~aoza48,98sekundi. - Kada je krenula trka imao sam ose}aj kao da samjedinojenastadionu.Bukvalnosamsebedoveo utufazu.Psihi~kisammnogoradionasebiikadajekrenulatrkanisamni{taregistrovao-kazaojeBekri}. Ondaverujedaupolufinalumo`edazabele`i jo{boqirezultat.

Biqana Topi} bez finala

EmirBekri}

- Mnogo zna~i posledwih 100 metara trke, jer smosvitu.Utojdeonicisedobijatrka.Sadajesve ispalo dobro - rekao je Bekri} i dodao da sada `elidobrodaseodmorizapolufinale. Polufinalejedanasu20.00pona{emvremenu.

ZBOGPOVREDE NIKOLESTOJI]A

Dvojac odustao Srpskidvojacbez kormilara Nikola Stoji}, Nenad Be|ikbiojeprinu|en daodustaneodBfinala.Dva satapredpo~etakokr{ajaza plasman od sedmog do 12. mestazvani~nidoktorSvetske vesla~ke federacije (FISA) pregledao je Nikolu Stoji}a nakon ~ega nije `eleodamudazelenosvetloza u~e{}e u trci pa je na{ ~amac, uprkos velikoj `eqi, moraodaodustane. Nikola Stoji} se povredio u polufinalu kada mu je stradao jedan od le|nih mi{i}a. Dan pauze je iskori{}en da se Stoji} osposobi zaBfinale.Me|utim,nakon pregledadoktorFISAjedoneo definitivnu odluku da muzabraninastup. Danasnastazuizlazi~etverac bez kormilara (Milo{ Vasi}, Radoje \eri}, Miqan Vukovi},GoranJagar),kojiod 11.30 ~asova vesla u B finale ove discipline. Na{ te{ki ~etverac }e veslati u {estoj stazi,azaplasmaodsedmogdo 12.mestabori}esesaposadama Rumunije, Kanade, Novog Zelanda,ItalijeiBelorusije.

OTI[LAJO[JEDNAGRUPANA[IHOLIMPIJACA

Duda{ optimista

Korejcu zlato Streli~ar Ju`ne Koreje Jin Hiek Oh pobedio je u finaluTakaharuFurukavu (Jap an) sa 7:1 i osvoj io zlatnu olimpijsku medaqu. On ima ve}ekipnoolimpijskozlato. Bronzu je osvojio Kinez Siao Siang Dai savladava{i sa 6:5 Holan|aninaRikaVanderVena.

Veslawe 10.30 - ^etveras bez kormilara finale

Rukomet

Bekri} u polufinalu uz rekord

Na{iolimpijcinabeogradskomaerodromu

Danas

12.15 - J. Koreja - Srbija

ATLETSKATAKMI^EWA

BiqanaTopi}nijeuspeladaseplasirau finale takmi~ewa u troskoku po{to je u kvalifikacijamazauzela25.mestoukonkurenciji35takmi~arki. Topi} je u prva dva poku{aja na~inila prestup,autre}emjedosko~ilana13,66metara.Normazaulazakufinalebilaje14,40 m. Najboqi rezultat u kvalifikacijama ostvarilajeKazahstankaOlgaRipakovasa 14,79 metara. Topi}eva je ove sezone najvi{e sko~ila 13.85m, a li~ni rekord joj je 14.56metara.

PROGRAM

Najboqisrpskikajaka{iiatleti~ariTatjanaJela~aiMihailoDuda{otputovalisuuLondoniistaklidajeovoprilikada poka`ekolikosunapredovaliuproteklihnekolikogodina.Kapitenkajaka{kereprezentacijeErvinHolpertrekaojedakajaka{kitimnikadnijebiobrojniji,12takmi~ara,ida}esepotruditidadonesunajboqerezultate. -Devojkesure{ileproblemkojesuimaleisvijedva~ekamo dapo~nutakmi~ewa-rekaojeHolpert. Kajaka{ica Nikolina Moldovan rekla je da su re{ile sve problemesapovredamakojesupostojaleidaimajuvelikao~ekivawaodigara. Atleti~arMihailDuda{po`eleojesvimannogosre}eiizneoo~ekivaweda}e,udesetoboju,ostvaritimnogoboqirezultatnegonaEvropskomprvenstvukadajebio~etvrti.Duda{je rekaodasusviatleti~ariovegodineostvarilidobrerezultateidasuspremnizaIgreuLondonu.TatjanaJela~areklajeda }edatisveodsebeida}epoku{atidau|eufinaleOlimpijskihigara.

Dong Dong najboqi na trambulini Kineski gimnasti~ar Dong Dong osvojio je zlatnu medaqu na trambulini na Olimpijskim igrama u Londonusa62,99poena.DmitriU{akov (Rursija)sa61,769poenazauzeojedrugomesto. ^unLongLuizKinesa61,319poenajeosvojio bronzu.

Dve medaqe Kini Kina je na Olimpijskim igrama u Londonuosvojilazlatnuisrebrnumedaquume{ovitomdubluubadmintonu. SlaviojemiksNanXang–JunLeiXao pobediv{i^enSuiJinMasa21:11,21:17. BronzanommedaqomokitiosedublizDanske Joakim Fi{er i Kristina Pedersen, savladav{iTontoviAhmadaiLilijanuNatsirizIndonezije.

Nem aw a Mir os avqev nije uspeo da se plasira u finale ga|aw a mal ok al ib arskom pu{kom 60 le`e}i. Sa jo{ osmoricom takmi~ara Mirosavqevjeukvalifikacijama pogodio 595 (po serijama 100, 99, 100, 97, 99, 100) krugova posle ~ega je morao u raspucava-

NemawaMirosavqev

we za pet mesta u finalu. U rasp uc av aw u je pog od io 51 krug,{tomujenakrajudonelo 10. mesto u ukupnom plasmanu od 50 takmi~ara, a sa 51,6 kao osmi u finale u{ao je Hrvat Bojan\urkovi}. - Razo~aran sam, me~ sam po jakom vetru dobro ga|ao osim one~etvrteserijegdesamimao tridevetke,odtogajednuelektronski mereno 9,9. Da je bila centarbiobihsigurnoufinalu.Uraspucavawusamseponovoboriosadesnimvetrom,posledwihitacsamimao9,8asa 10,4 i boqe bio bih u finalu.

Odli~nosamseose}ao,uprobi mijesvei{lokakotrebaidobro sam krenuo osnovni deo, alijenedostajaloimalosre}e -rekaojeMirosavqev. V.d.selektoraGoranMaksimovi}nemo`edapre`alizbog prop u{ ten e pril ik e za jo{ jedno finale, koje bi bilo ~etvrtonaovimIgrama. - Nije bilo visokih rezultata osim Martin ova, koj i je obor io dva svets ka rekordaiBelgjanca Koksa koji je isko~io kao pajac iz kutije i najve}e je iznen a| ew e do sada. Jeftino finale od 595 krugova je malo ko o~ekivao. Mirosavqevu svaka ~ast, zaistaseborioidva lo{a trenutka su ga udaqila od finala gdemuje,objektivno, bilomesto-rekaoje Maksimovi}. Zlat o je osvoj io odl i~n i Bel or us Sergej Martinov sa sa dva svets ka i olimpijska rekorda: sa fin al om 705, 5 (star i  704,8) i u osnovnomdelusaapsolutnih 600 krugova. Srebro jepripaloBelgijancuLionelu Koksu sa 701,2 (599), a bronza Slovenscu Rajmondu Debevecu sa701,0(596)krugova. UdrugomfinaluMKpi{toqem brza paqba Kubanac Luis Pupojesa34poenaosvojiozlatoiizjedna~iosvetskirekord finala.SrebrojepripaloVixaiKumaru(Indija)sa30,dok je bronzu osvojio Kinez Feng Ding sa 27 poena. Danas na vatrenu liniju izlaze srpske reprezentativke MK pu{kom 3 puta 20 metaka Ivana Maksimovi}iAndreaArsovi}.

ZBOGALKOHOLA

Ka`wen vesla~ sa 1.400 funti Pijani australijski vesla~ Xo{ But mora}e da plati 1.400 funtizbog{tetekojujenapravio kada je u no}i izme|u srede i ~etvrtka razbio dva izloga u Londonu. But je nakon nastupa u finalu, gde je wegov osmerac zau- zeo {esto mesto, iza{ao u grad na pi}e i tom prilikom o{tetio prodavnice. On je te no}i pretrpeo lak{e povrede glave, jer jeprilikomzadr`avawaupolicijskojstanicipaounesvest. -Ovojebilaneprijatnasituacijazasvenas.O~ekujemove}e

standarde pona{awa na{ih sportistaipodseti}emomenaxmentdaboqeobaratipa`wuna

to-rekaojezamenik{efaaustralijskogtimaKrisFidleri dodaoda}eButmoratidaseizvinivlasinicimaprodavnica.


16

sport

subota4.avgust2012.

dnevnik

30.LETWEOLIMPIJSKEIGREULONDONU(27.JUL–12.AVGUST) TURNIRKO[ARKA[A

Amerikancirekordno Selektor ko{arka{ke reprezentacije SADMajkK`i`evski uvrediosezbogpitawa upu}enognakonferencijizanovinare, da li je wegova ekipa u tre}emkoluolimpijskogturni-

ra `elela da ponizi Nigerijce poslepobedeod156:73.Utakmicajezavr{enasa83poenarazlikeukoristNBAzvezda,kojisu sa 156 postignutih poena postavili novi rekord OI. K`i`evski je odgovorio da su wegovi

MajkK`i`evskisasvojimizabranicima

PRVASAUDIJKANAOLIMPIJADI

Debitrajao 82sekunde Xudistkiwa Voxdan [aherkani postala je prva saudijska sportistkiwakojasetakmi~ilanaOI,alijewenistorijski debitrajaosvega82sekunde.Wuje nervoznuisakapomnaglavi,koja jepodse}alanapliva~ku,porazilaMelisaMojicaizPortorikau prvoj rudni takmi~ewa za `ene ispod78kilograma.

igra~i jednostavno poga|ali {uteveunormalnomritmuigre. -Vre|ameipomisaodajekao ciq na{eg ko{arka{kog programapostavqenobilo~ijeponi`avawe - odgovorio je selektor SAD i trofejni strateg univerziteta \uk. - Lebron i Kobi su celo drugo poluvreme sedelinaklupi,ondasampovukao i Karmela (dao 37 poena za 14 minuta). U posledwoj ~etvrtini nismo istr~ali nijedan kontranapad, a branili smo se zonom. On je dodao da bi selektor Nigerije mogao da se oseti poni`enimsamouslu~ajudaAmerikancinisuigralipunomsnagom. -Uko{arcimoradaseuputi {ut u roku od 24 sekunde. Na ovojutakmicisuna{eloptesamopoga|aleciq.

Nigerijajeprimila49poena ve} u prvoj ~etvrtini, na poluvremenu78iondajo{tolikou drugih20minuta. -Stra{nojebitiispra{enna takavna~in,alijesadrugestra-

neimpresivnobitiu~esnikili svedokjedneistorijskeutakmice -izjaviojeigra~afri~keselekcijeKokoAr~ibong. Nadahnuta partija Amerikanaca i mu~ewe [panije u duelu

TAKMI^EWEDVOJACABEZKORMILARA

Novozelan|anidominirali

kobkojijeizbiokadasuSaudijci zapretili da }e povu}i ovu 18-godi{wakiwu sa Igara ukolikobudemoraladaseboriotkriveneglave.Kompromisjepostignut i ona se pojavila na struwa~isauskomcrnomkapom naglavi. [aherkani je jedna od dve sportiskiwekojejeovokonzervativno kraqevstvo prvi put

Vesla~kidvojacbezkormilarasaNovogZelanda osvojiojezlatnumedaqu,po{tojetrkuna2.000metarazavr{ioza{estminuta,16sekundii65stotinki. Hejmi{BondiErikMariostavilisusvekonku-

rentezapetsekundi.Srebrnamedaqapripalaje Francuzima,abronzanaBritancima.^etvrtomestouAfinaluzauzelajeposadaItalije,petisu biliAustralijanci,a{estiKana|ani.

REZULTATI–PETIDAN

Vaterpolo(m)

Odbojka(m)

Tre}ekolo:[panija-Australija13:9,Kazahstan-Gr~ka4:11, Italija-Hrvatska6:11.

Tre}e kolo: Francuska - Tunis 25:19, Velika Britanija Argentina 21:32, [vedska Islandsino}.

Tre}ekolo:Australija-Bugarska 0:3, Poqska - Argentina 3:0, VelikaBritanija-Italijasino}.

-Dragomijei~astmije{to sam u~estvovala na Olimpijskim igrama i nastavi}u da se bavim ovim sportom - rekla je onaAFP-u. [aherkanijedozvoqenodase borinaOIsanekomvrstommaramezaglavu,~imejere{ensu-

poslalo na Olimpijadu, ali uz uslovdamorajudapo{tujustrogapravilaobla~ewa.Drugatakmi~arka je trka~ica na 800 metaraSaraAtar,kojajeodrasla u Kaliforniji. Atar se na zvani~noj fotografiji za OI u Londonuslikalabezhixaba.

1.Hrvatska 2.[panija 3.Gr~ka 4.Italija 5.Australija 6.Kazahstan

1.Francuska 2.[vedska 3.Island 4.Argentina 5.Tunis 6.V.Britanija

1.Bugarska 2.Poqska 3.Italija 4.Argentina 5.Australija 6.V.Britanija

3 3 3 3 3 3

3 2 1 1 1 0

0 0 1 1 0 0

0 1 1 1 2 3

27:19 34:23 24:19 21:23 21:25 14:32

6 4 3 3 2 0

GrupaA

3 2 2 3 3 3

3 2 2 1 0 0

0 0 0 0 0 0

0 101:54 6 0 69:40 4 0 63:47 4 2 77:84 2 3 62:85 0 3 55:117 0

GrupaA

3 3 2 3 3 2

3 2 1 1 1 0

0 1 1 2 2 2

9:1 7:4 4:4 4:6 3:6 0:6

9 6 3 3 3 0

Uzbekistanac miqenikpublike

[erzo|onJusupov

Uzbekistanski diza~tegovaukategoriji do 85 kilograma [erzo|on Jusupov postao je miqenik londonskepublikepo{to uo~i svakog nastupa glasno vrisne. Publika je prihvatila wegov obi~aj i bu~no ga podr`avala tokom takmi~ewa.No{endobrom atmosferom, Jusupov je podigao 195 kilograma iz trzaja, dokjeprethodnoizizba~ajadigao155.Onje posledrugogpoku{aja publici poslao poqupce, dok su mu gledaoci aplaud  irali stoje}i. -Mnogomisesvi|a atmosfera, veoma je prijateqska. Svi su vikalakadajetrebalo da nastupim - rekao je Jusupov. Uzbekistanacjezauzeo ~etvrto mesto u svojoj kvalifikacionojgrupi.

VawaUdovi~i},kapitenna{ihvaterpolista

GrupaB

GrupaB

GrupaB

Tre}ekolo:CrnaGora-Srbija11:11,Rumunija-Ma|arska 15:17, Velika Britanija - SAD 7:13.

Tre}ekolo:[panija-Koreja 33:29, Hrvatska - Ma|arska 26:19,Srbija-Danska25:26.

Tre}ekolo:Srbija-Nema~ka2:3,Rusija-Tunis3:0,Brazil-SAD1:3.

1.SAD 3 2.Srbija 3 3.CrnaGora 3 4.Rumunija 3 5.Ma|arska 3 6.V.Britanija 3

1.Hrvatska 2.Danska 3.[panija 4.Ma|arska 5.Srbija 6.Koreja

1.SAD 2.Brazil 3.Rusija 4.Srbija 5.Nema~ka 6.Tunis

3 2 1 1 1 0

0 1 1 0 0 0

0 0 1 2 2 3

31:22 46:28 29:29 36:31 37:40 18:47

6 5 3 2 2 0

3 3 3 3 3 3

3 3 2 1 0 0

0 0 0 0 0 0

0 0 1 2 3 3

88:63 77:73 82:74 66:72 69:83 69:86

6 6 4 2 0 0

3 3 3 3 3 3

3 2 2 1 1 0

0 1 1 2 2 3

9:1 7:3 6:3 5:7 3:8 1:9

Nema~ka olimpijka udata zanacistu Nema~ka sportska javnost {okirana je saznawem da je wihovavesla~icaNa|aDrigala udata za nacistu, odnosno~lanaultra-desni~arske partije NPD, o ~ijoj se zabrani u Nema~koj ve} dugo raspravqa! Drigala je u me|uvremenu napustila Olimpijske igre u Londonu, ali medijisuotkrilidaonave} dugo vremena odr`ava kontakte sa nacistima i sli~nimorganizacijama. Drigala(23)jeina~ebiv{a policajka i rekla je da po{tuje povequ OlimpijskihigaraidajezatonapustilaLondonjerne`elida bude optere}ewe za svoju ekipu. Ona je bila ~lan vesla~kogosmerca.

Riznica medaqa

Rukomet(m)

GrupaA

sa Velikom Britanijom (79:78) najavquju da }e ~ak i aktuelni prvaci Evrope te{ko mo}i da pru`edostojanotporAmerima, kao{tosugapru`ilipre~etirigodineuPekingu.

9 6 6 4 2 0

Zemqa Z S B UK Kina 18 11 5 34 SAD 18 9 10 37 J.Koreja 7 2 5 14 Francuska 6 4 6 16 V.Britanija 5 6 4 15 Nema~ka 4 8 5 17 Italija 4 5 2 11 S.Koreja 4 0 1 5 Rusija 3 6 8 17 Kazahstan 3 0 0 3 J.Afrika 3 0 0 3 Japan 2 6 11 19 Holandija 2 1 3 6 Ma|arska 2 1 2 5 Ukrajina 2 0 4 6 Australija 1 7 3 11 Rumunija 1 3 2 6 Brazil 1 1 2 4 NoviZeland 1 0 2 3 Slovenija 1 0 1 2 Gruzija 1 0 0 1 Litvanija 1 0 0 1 Venecuela 1 0 0 1 Meksiko 0 3 1 4 Kanada 0 2 5 7 Kolumbija 0 2 1 3 Kuba 0 2 1 3 [vedska 0 2 0 2 Belorusija 0 1 1 2 Danaska 0 1 1 2 [panija 0 1 1 2 Indonezija 0 1 1 2 Mongolija 0 1 1 2 Norve{ka 0 1 1 2 ^e{ka 0 1 0 1 Egipat 0 1 0 1 Poqska 0 1 0 1 Tajland 0 1 0 1 Tajpeh 0 1 0 1 Slova~ka 0 0 3 3 Srbija 0 0 1 1 Azerbejyan 0 0 1 1 Belgija 0 0 1 1 Norve{ka 0 0 1 1 Uzbekistan 0 0 1 1 Moldavija 0 0 1 1 Indija 0 0 1 1 Katar 0 0 1 1 Gr~ka 0 0 1 1 Singapur 0 0 1 1


SPORT

dnevnik

subota4.avgust2012.

17

UZ TRIJUMF VOJVODINE NAD RAPIDOM

I igra i atmosfera za hvalu Bilo je zaista lepo iskustvobitinastadionu„Kara|or|e”uNovom Sadu i prisustvovati prvojutakmici3.kolakvalifikacijazaLiguEvropeizme|uVojvodine i Rapida iz Be~a. Sjajna atmosfera,raspolo`enapublika,na pobeduorijentisaniigra~iVojvodineijakrivalizAustrijeobele`ilisuovajfudbalskiisportski praznik. Naravno, {lag na tortu

Prepuna lo`a Duel Vojvodine i Rapida privukaojevelikupa`wufudbalske javnosti, pa je lo`a na stadionu„Kara|or|e”bilaispuwena do posledweg mesta. Me|u mnogim poznatim licima,primetilismoiSavuMilo{evi}a, direktora reprezentacijeSrbije,kojijesvelikompa`wompratiotokme~a. Naravno,kakotoobi~nobiva kada su zna~ajni susreti u pitwu, u lo`i su se na{li i brojnimenaxeriiskauti,koji supratiliigrupojedinihfudbalera i revnosno bele`ili svojazapa`awa.

bila je pobeda Novosa|ana od 2:1, alijenawupalamalasenkau96. minutu,kadajezbogtrenutkanepa`we doma}ih igra~a Rapid postigaogolzavelikunadu,aonemogu}io Vojvodinu da na revan{ otputujesvelikih2:0. - Pad koncentracije u posledwim trenucima utakmice stajao nas je primqenog gola i dogodilo seto{tosedogodilo-rekaojedan posleutakmice{efstru~nog{tabanovosadskeekipeZlatomirZagor~i}.-Obezbedilismoprednost predrevan{iRapidjesadaekipa koja}emoratidavijarezultat.U Be~u}emomoratidaigramospuno vereusopstvenemogu}nosti,samo odnassamihzavisi}ekona~niishodimi}emobititimkojisepita. Rapid je u prvom poluvremenu, utisakje,biotimkojijediktirao tempo, ali je u nastavku doma}in preuzeokonceigreusvojeruke. -Realno,Rapidjeodigraomnogo vi{eovakvihutakmicaikaoposledicutogaimaojevi{esamopouzdawa-objasniojeZagor~i}.-Napoluvremenu smo rekli igra~ima da moraju da imaju mnogo vi{e vere u sebeionisutoprihvatili,pajeu nastavkuna{aigrabilavi{enego

AbubakarOumarupostigaotrigolauposledwetrievropskeutakmice

korektna. Hofman je dokazao da je veliki igra~, ali nas nije iznenadiojersmoznalidaonvodiigrurivala. Mi smo, naravno, imali na svojojstranisjajnupodr{kustri-

Supi} povre|en Ju~e su igra~i Vojvodine imali slobodan dan, a golman crveno-belih Nemawa Supi} oporavqaoseodpovredezara|ene prilikom situacije koja prethodila dosu|enom penalu zagoste. - Lopta je iz kornera i{la meniurukeitadamijesle|a nekouhvationogu-objasnioje Supi}. - U tom trenutku osetiosambolkaodamejeneko maqem udario i zaista nisam video {ta se dogodilo. Idem na terapiju, a u ponedeqak }u i}i i na magnetnu rezonancu, kako bi se utvrdio stepen te`inepovrede. binaitojeputdoostvarivawa`eqenihrezultata,uzigrunaterenu. Sigurnojeda}emourevan{u,u~etvrtak,datisveodsebeidauBe~ putujemosnameromdapro|emou4. kolo kvalifikacija za Ligu Evrope. FudbaleriVojvodineulo`ili su puno truda u ovoj utakmici i, usu|ujemo se da ka`emo, odigrali su iznad nivoa srpskog klupskog fudbala.Jedanodnajboqihpojedinacanaterenubiojestameni{toperIgor\uri},kojijezaustavio AmerikancaBojdaibiopravikomandantodbranecrveno-belih. -@elelismopobeduidowesmo na kraju i do{li - kategori~an je bio \uri}. - Vojvodina je veliki klubiuvekmoradastremikatrijumfima,madasemorapriznatida smo u prvom poluvremenu igrali malo boja`qivo. Jesmo bili upoznati s kvalitetom Rapida, ali je

RadostNovosa|anaposledrugoggola,kojijepostigaoMilanBojovi}

druga~ijekadaseswimsuo~itena terenu.Biloje{ansinaobestrane,alismomipodiglinivoigreu drugompoluvremenuistiglidovelikogvo|stvaod2:0.@aomije{to koncetraciju nismo zadr`ali do posledweg sudijskog zvi`duka i {tosmodozvoliliAustrijancima dauposledwimtrenucimame~apostignugol.Urevan{u}enamjedina misao biti da pro|emo daqe i verujemdasmozatosposobni.

Osvojojigri\uri}jedodao: -Zadovoqansampartijomkoju sam pru`io, mada uvek mo`e da se igra i boqe. Dobio sam `uti karton kada je Hofman proma{io jedanaesterac u 81. minutu jersambioube|endajeprekontakta Bojda i Joki}a bio faul nad na{im golmanom Supi}em. Kada je kapiten rivala pogodio stativu,biosamube|endanasje Bog pogledao i rekao sam to ar-

U revan{u ja~i za Trajkovi}a BranislavTrajkovi}jeizlo`ebodriosaigra~e,po{tonijeimao pravonastupasRapidomzbogdva`utakartonazara|enaurevan{u saSuduvom.Urevan{u}epouzdani{toperimatipravodaigraipoja~a}ekonkurencijuzamestouodbrambenomredu,{tosigurnomo`e daradujetreneraZagor~i}a,kaoinavija~enovosadskogtima.

ZVEZDA BEZ RECEPTA ZA KIPARSKI BEDEM

Nere{en rezultat za glavoboqu FudbaleriCrvenezvezderemiziralisuu prvoj utakmici 3. kola kvalifikacija za plasmanuLiguEvropesakiparskomOmonijom na Marakani 0:0. Rezultat koji na prvi pogledulivazebwupredrevan{uNikoziji zasedamdana.Terenskadominacijacrveno– belih, broj~ano ubedqiv posed lopte, samo nekolikoudaracapremagoluKipranaijedna u okvir gola sigurno  zadaju glavoboqu {efu stru~nog {taba Robertu Prosine~kom.Crveno–belipraznihkoferaputova}enarevan{naKipar.OsamputauistorijiCrvenazvezdaigralajenere{enonasvom terenuuprvomme~ueliminacijauEvropi, ~etiriputagubilajeurevan{ima,aistotolikoputaprolazila. BoriosekaolavFilipKasalicasvih90 minuta sa defanzivcima Omonije. Visok blokigustaformacijarivalaonemogu}ili sucentarforadavi{eiska`esvojebrzinskesposobnosti,aliiporedtogaostavioje vi{enegopozitivanutisak.RezultatsaMarakaneobemaekipamaurevan{udajepodjednake{ansezaprolazitrebao~ekivatidruga~ijuutakmicuodbeogradske. -@elelismodapopravimolo{utisakiz me~eva sa Naftanom. Smatram da smo odigralidobruutakmicuidasmosetrudilii borilikolikosmogodmogli,protivtotal-

Sr|anMijailovi}(levo)uverenda}eZvezdaeliminisatiOmoniju

no defanzivno orijentisanog protivnika. Faliojesamogoldautisakbudepotpun–kazaojeKasalicaidodao:-Imamorezultatkoji nam daje {anse za prolaz u slede}i krug kvalifikacija.JedanpostignutgoluNiko-

zijimo`edanambudedovoqanzaukupnupobedu nad Omonijom. Vide}emo i kako }e se onisna}i,siguransamda}emoratimalovi{edaseotvoreikrenuunapad,{to}enama otvoritivi{eprostora.

Kasalicujeponajvi{edefanzivagostiju iznenadilaizrazloga{touekipisaKipra imadostaPortugalaca,paiBrazilacakoji supoznatipotomeda`eledasenadigravaju. -Ba{sumeiznenadili.O~ekivaosamda buduofanzivniji.Me|utim,sadaseokre}emo revan{u. Dobio sam drugi `uti karton, aliimampravonastupanaKipru,jersepau- ziratekposletre}eopomene.Svismouvereni da mo`emo da u|emo u posledwe kolo kvalifikacija-optimistajeZvezdinnapada~kojisenakonme~apo`alionaboluvratuile|ima. Navodne pri~e i {pekulacije o tome da fudbaleriCrvenezvezdenisudovoqnofizi~kispremninanajboqina~indemantovao jeSr|anMijailovi}.Golobradimomakprolio je litre znoja i pretr~ao kilometre i kilometre. -Ose}amseodli~no.Naravnodasamseistro{io,alitokomme~anisamnijednogtrenutkaosetiodanemogu.[toseti~etr~awa, veoma sam zadovoqan. Da smo postigli gol, bilibismo,uverensam,napraguplasmanau slede}ekolo.Nemislimnidaje0:0lo{rezultat.Nismoprimiligol,tojenajbitnije, iuverensamdamo`emoiunokautrundukvalifikacijaiugrupeLigeEvrope-samouverenjeMijailovi}.

bitru, koji mi je pokazao javnu opomenu. Nam kraju, \uri} je rekao i slede}e: - Atmosfera na stadionu bila jefantasti~naisigurnojedasu rezultati i igre koje pru`amo najboqapozivnicanavija~imada uvelikombrojudolazena„Kara|or|e”. Imali smo sjajnu podr{kustribinaimislimdasmose svojom igrom i odnosom prema woj odu`ili gledaocima. Na namajedasadaodemouBe~ipoka`emokosmoi{tasmoidaobezbedimobaremjo{jedanevropski susret u Novom Sadu. Verujem da smosposobnidatou~inimo. Revan{utakmicaigraseu~etvrtak,9.avgusta. A. Predojevi} PRVE UTAKMICE 3. KOLA KVALIFIKACIJA ZA LIGU EVROPE An`i-Vitese KuPS-Bursa DilaGori-Anortozis ArsenalKijev-Mura AIK-Leh Kalmar-JangBojs Rid-Legija Tromso-Metalurg(D) BneiJehuda-PAOK Ruh-Plzen APOEL-Alesund Tvente-M.Boleslav Servet-Rozenborg Herenven-Rapid(Bu.) Steaua-Spartak(T) Horsens-Elfsborg Gomeq-Liverpul Genk-Aktobe Asteras-Maritimo Crvenazvezda-Omonija Videoton-Gent Hajduk(S)-Inter Eski{ehir-Olimpik Dandij.-Dinamo SentPatriks-Hanover Vojvodina-Rapid(B) Sarajevo-Zeta Atletik(B)-Slaven Admira-Sparta(P)

2:0 1:0 0:1 3:0 3:0 1:0 2:1 1:1 0:2 0:2 2:1 2:0 1:1 4:0 0:1 1:1 0:1 2:1 1:1 0:0 1:0 0:3 1:1 2:2 0:3 2:1 2:1 3:1 0:2

Revan{ susreti su na programu9.avgusta.


18

sPORt

subota4.avgust2012.

Krasi}u Fenerbah~eu Srpski fudbalski internacionalac Milo{ Krasi} karijeru }enastavitiuFenerbah~eu iz Istanbula. Kako se navodi na sajtu najpopularnijeg turskog kluba, doskora{wi igra~Juventusadanasbitrebalo da bude predstavqen navija~ima plavo-`utih sa kojima je dogovorio ~etvorogodi{wu saradwu. Krasi}jeuprethodnedvesezonezaJuventusodigrao50utakmicaipostigao10golova.Pro{lesezone,me|utim,nijeuspeo da se izbori za minuta`u kod trenera Antonija Kontea. Pre Juventusa, bio je ~lan moskovskogCSKAinovosadskeVojvodine.Krasi}jezareprezentacijuSrbijeodigrao46utakmicai postigaotrigola.

Ju`nobanatskelige startuju18.avgusta UprostorijamaFSPPan~eva izvu~enisuparovizanarednoprvenstvo u sve tri ju`nobanatske lige,kojepo~iwe18.avgust. –Osnovnizadatakjedautakmiceodigrajuuferikorektnojborbiidasebodoviosvajajunaterenu.Nijenimalolakoqudimakoji vodeklubove,aliverujemda}emo zajedni~kimsnagamaprevazi}ite probleme. Savez }e nastojati da fudbal u na{em regionu podigne na vi{i nivo - rekao je predsednikFSPPan~evoDejanSantra~. Prva Ju`nobanatska liga, parovi prvog kola: Polet (I)- Borac (S), Partizan (G) – Sloga (BNS),BAK–Slavija,Radni~ki (B) – Vojvodina, Sloga (P) – Vr-

{ac Junajted, Vulturul – Tempo, Mladost (O) – Budu}nost (BB), Dobrica–Jugoslavija. GrupaZapad,prvokolo:Glogow – Jedinstvo Stevi}, Proleter – Stari Tami{, Omladinac (D) – BSK,PlaviDunav–Strela,@eqezni~ar – Omladinac (O), Mladost (V) – Borac (P), Spartak – Pobeda, Pan~evo – Dolovo, Unirea–Polet(I). Grupa Istok, prvo kolo: CrvenaZvezda–Hajduk,[evac–Vitorul, Ratar – Borac (VG), Budu}nost (A) – Grani~ar, Jedinstvo – Potporaw,Dunav–Partizan(U), Kara{(K)–Vinogradar,Hajdu~ica–Borac(VS). B. St.

DANAS I SUTRA U BA^KOM GRADI[TU

Kvartetnaproveri Kada su ba~kogradi{tanski fudbalski zaqubqenici tokom leta2009.godine,uhladurestoranauSRC„\or|eTapavicaXoja“, vra}ali film unazad, prisetilisuse,izme|uostalog,kvalitetnih turnira koji su igrani {ezdesetih godina uo~i starta prvenstvene sezone. To je bila inicijalna kapisla da se, posle skoro pola veka, sve obnovi. Re~eno – u~iweno. Odlu~eno je da se,kaonekada,turnirorganizuje prvogavgustovskogvikenda,kako bi u~esnici imali priliku da provereformupredstartprvenstvenetrke. Na prvencu okupile su se, poreddoma}inaVojvodine,kom{ije @SK iz @abqa, Jedinstva iz Gospo|inaca i Hajduka iz ^uruga. Pobedni~ki pehar pripao je @abaq~anima. Slede}e godine

pobedilisuBe~ejci,alaneBa~kaiz\ur|eva. Ovegodine}egostinajstarije fudbalske Vojvodine u Pokrajini, koja idu}e godine obele`ava vekpostojawa,bitiJedinstvoiz NovogBe~ejaidveMladosti,iz Ba~kog Jarka i Turije. Danas od 17 sati igra}e Novobe~ejci i Ba~kojara~ani, a u 18,45 Ba~kogradi{tanci i Turinci. Sutra }eseu17satiigratizatre}emesto, a posle toga finalna utakmica. Vojvodinasutrauve~eorganizujezajedni~kuve~eruzasveu~esnike turnira, gde }e predsednik Branislav Tati} uru~iti pobedni~kipeharnajboqemu~esniku,abi}eprogla{eninagra|eninajboqiigra~dvodnevnog turnira. V. Jankov

SRPSKI BOKS U DUBOKOJ KRIZI

Olimpijskapobeda posle~etvrtveka Da je srpski boks u dubokoj krizi odavno je poznato qubiteqima plemenite ve{tine, pa se~akname}epitawekakojo{ uop{te i postoji na ovim prostorima.Akojeparametaruspe{nost rezultat na olimpijadama, onda se na{e pesni~ewe tu nalazi samo u t r a g o v i m a . Frap ir aj u} i podatakjedaje Srbija u prethodnih ~etvrt veka imala samo dva predstavnika na najve}oj svetskoj  smotri sporta. Pre ~etiri godine Pekingu u~estvovao je sada{wi profesionalac Geard Ajetovi}, a u Londonu boje Srbije branio je Aleksandar Drenovak.Onjeuprvojborbislavio, ali u drugoj ni{ta nije mogao Tur~inu Ademu Kali~iju. Posledwumedaqu,bronzanu,zatada{wu SFRJ osvojio je Hrvat Damir[karo1988.uSeulu.Kad je u pitawu bokser iz Srbije,

ondajerezultatjo{crwa,Kragujev~anin Mirko Puzovi} se popeo na tre}u stepenicu pobedni~kogpostoqajo{1984.godinenaIgramauLosAn|elesu, aposlewegavi{eniko! O~iglednojedaseuovom,nekada trofejnom sportu, veoma malo i slabo radi. Kad se razgovara s trenerima,sti~e se utisak da oni sve znaju i daimodlasciu inos trans tvo na kampove nisu potrebni. Sujeta je izuzetnoizra`enakodmnogih,dok su drugi pohvatali pozicije i nipokojucenune}edaihnapuste.Kunuseuboks,obe}avajuda }ebitiboqeida}eba{oniu tome uspeti, a to traje ~etvrt veka. Tadija Ka~ar jednom prilikomrekaojedajebokskodnas skoro mrtav sport. O~igledno da je vreme za promene u ovom sportu. M. Pavlovi}

dnevnik IZ VATERPOLO SAVEZA CRNE GORE

GavrilSuboti} izabraoSrbiju Jedan od najtalentovanijih crnogorskihvaterpolistaGavril Suboti}, sin legendarnog reprezentativca Jugoslavije Vasa, odlu~io je da igra zaSrbiju.Onjeigraozamla|e kategorije Crne Gore, a afirmaciju je stekao u Jadranu. Od naredne sezone igra}e za Partizan, a nakon pauze od godinudanaizaselekcijuSrbije. -Ni{tasebombasti~nonije dogodilo da bi do{lo do ovak ve odl uk e, ni{ ta nij e prel om il o. Weg ov razv ojn i putsportisteistudentabi}e mnogoboqipo{touBeogradu ima vi{e mogu}nosti - rekao jeVasoSuboti}. OvuvestzaradioJadranpotvrdio je i generalni sekretar Vat erp ol o sav ez a Crn e GoreDejanAxi}. - Imam informaciju iz porodice Suboti} da je wegov otac doneo odluku da Gavril igra za srpsku reprezentaciju. Poredsvihobe}awakojejedao svojim prijateqima, saigra~imainamauSavezu,onjepogaziore~itovi{egovoriowemu, ali ja to ne bih vi{e komentarisao-rekaojeAxi},kojijenajaviopromenuodnosasa VSSrbijezbogovesituacije.

GaverilSuboti}

-Mismopredpotpisivawem ugovora sa VS Srbije i ako se ovozaistaobistini,do}i}edo novih momenta u odnosima izme|udvasaveza-jasanjeAxi}. Gavrilov otac Vaso je rekao da odluku o karijeri wegovog sinamogudadonesusamoGavriloiiwegovaporodica,aneneki ~lan Savjeta ili bilo ko drugi.

- Nema tu nikakvih emocija, svejesamounajboqeminteresu zamojedete.Smatramdabibio previ{e rastrzan da je na dve strane, ovako cela wegova sportskaisvakadrugakarijera bi}e vezana za Partizan, Beograd i Srbiju - zakqu~io je Suboti}ipozvaoVaterpolosavez Crne Gore da bude iskreniji u svojimizjavama.

VANREDNA IZBORNA SKUP[TINA PLIVA^KOG SAVEZA SRBIJE

ZrewaninacDraganRadosav novipredsednik Vanredna izborna kodajebioprisutan51delegats skup{tina Pliva~kog pravom glasa. Izabrana je i Vesaveza Srbije (PSS) rifikacionakomisijausastavu odr`ana je u ZrewaniJasnaQiqak(predsednik),Radonu,azanovogpredsednikaizabran vanTe{i}iMirkoSr|anov. je Dragan Radosav. Dosada{wi -Po{tuju}iStatutiPoslovpredsednik Slobodan Bokani} nik ustanovili smo da samo 21 podneojeostavkupreistekaman- ~lanposedujeurednupunomo},da data. -Stupiosamnaodgovornuinimalolakufunkciju. Nema vremena za odmarawe, nego {to pre treba ozbiqnodakrenemodaradimo.Samouzposve}enost celog upravqa~kog tima mo`emo plivawe kao sport da podignemo na vi{inivo.Osnovnojedadeci omogu}imo {to boqe uslove, kako bi kvalitet mogli da preto~e u vrhunske rezultate - rekao je DraganRadosav. Skup{tina je protekla u `u~noj raspravi, uz bojkot ve}ine beogradskih klubova. Oni su tra`ili obja{wewe za{to je sve ura|enoishitreno,vanteku}esezoneikadajeve}ina~lanovaovogtelanagoNovipredsednikPSSDraganRadosav di{wimodmorima. - Predstavnici Pliva~kog sa- jejedanklubbezoverenepunomoveza Beograda nisu se pojavili u }i,jedannijeizmirioobaveze,a punomsastavu.Navodno,razlogje 14 je promenilo delegate u toku {to je biv{i predsednik u krat- godine, {to zabrawuje ~lan 32, komroku(7dana)zakazaovanred- stav6.Statutaukomeseka`eda nu Skup{tinu. Sve je, me|utim, klub mora najmawe 15 dana pre uradiopoStatutu-objasniojeRa- sednice da obavesti Skup{tinu dosav, predsednik PK Prole- o promeni delegata, a po{to je ter,izkojegsupoteklimnogipli- sednicazakazanaukratkomroku va~kiasovi. od sedam dana kancelarija PSS Dopo~etkasednicebiloje47 jebiladu`nadaobavestiklubodelegata,aondajekonstatovano vedanaSkup{tinupo{aquiste dajo{~etiriimajupunomo},ta- delegate-rekaojeMirkoSr|a-

nov, {ef stru~nog {taba u PK VojvodinaizNovogSada. Takojemogaodaglasasamo21 delegat, {to zna~i da nije bilo kvoruma na sednici u Zrewaninu. - Posledwa sednica Skup{tine odr`ana je 26. januara ove godine i svi ti delegati su morali da prisustvuju i ovoj,{tolepopi{eu~lanovima4.i52.Poslovnika. Po{tonijeusvojenzakqu~ak Verifikacione komisije, a predsednik je rekao da se zbog hitnosti posla mora raditi i mimo toga {to se kr{e Statut i Poslovnik, a potpredsednik jedodaodajedolazakdelegata iz Centralne Srbije skupidaseSkup{tinamora zbog toga odr`ati, smatrao sam svojom moralnom du`no{}udasednicunapustim-rekaojeSr|anov. Skup{tina je ipak odr`ana, izabran je i Upravni odbor koga ~ine: Dragan Radosav (predsednik) iz Zrewanina,Bane Kova~evi} (potpredsednik) iz Vaqeva, Slobodan Kesi} iz Novog Sada, Sa{a To{i} iz Leskovca, Neboj{a Grigorijev iz Beograda, Ivan \or|evi} iz Beograda,BorisDrobacizBeograda,NikolaDanevizKru{evca,dok}ePliva~kisavezVojvodine svog ~lana dati posle izborneSkup{tine.^lanoviNadzornogodborasu:Sini{aMoro{an(predsednik)izZrewanina, VladislavTodrovi}izBeograda iSlobodanSavi}izJagodine. G. Malenovi}

DANAS NA TISI KRAJ BE^EJA

Vaskrsnu}ekajaka{keregate Kajakje,nemasumwe,ovegodinedobiopotvrduvi{egodi{wegvrednogradaube~ejskomklubu.Kadgod igdegodseovihdanapovederazgovorokajaku,odmah seapostrofirau~e{}etrojicetakmi~araizBe~eja naOlimpijskimigramauLondonu,MarkaNovakovi}ausprinterskojdiscipliniK-1200,MarkaTomi}evi}audiscipliniK-1000iDejanaTerzi}akao~lana posade~etverca,aliitreneraJo`efa[otia,kojije 2000.godineuSidnejuveslaofinalnutrku~etveraca. Ali,be~ejskikajaknisusamopomenutiolimpijci,negoiarmijatakmi~ara,po~evodnajmla|ihuminikajaku,prekopionira,kadeta,juniora,senioradoveterana.Svisuonideokluba.Stru~nitreneriiizuzetno agilno rukovodstvo tako|e. Upravo zahvaquju}i klupskimrukovodiocima,posledvegodine,vaskrsla jekajaka{karegatanaTisi(TrofejBe~eja2012).

-Stiglesuprijavezaoko150u~esnikaiz11klubova,odkojihsudvaizinostranstva(Gra~ac-BiH,Segedin-Ma|arska),pajeregatapoprimilame|unarodni karakter.Ukupno}eseodr`ati36trkausvimuzrasnimkategorijama.[teta{tojeutokuOlimpijada, pane}eu~estvovatisrpskikajaka{kikrem,alitoje ve}vi{asilaiokre}emoseonimakojidolaze,kako bismoimomogu}ilioptimalneuslovezatakmi~ewei dru`ewe kraj na{eg dela Tise - rekao je predsednik KajakkanuklubaBe~ejMilivojStojkov. Nakrajuvaqare}idasusekajaka{inaovajna~in ukqu~iliuobele`avaweDanaop{tineBe~ej,tedaje startprvetrkezakazanza10satiida}etokomdana{wegdanabitipravakajaka{kaikebananaTisikraj Be~eja. V. Jankov

Suboti} je tre}i u nizu talentovanih vaterpolista koji je ro|en u Crnoj Gori, a odlu~io se da igra za Srbiju - pre wegatosuuradiliAndrijaPrlai n ovi} i nedavn o Du{an Mandi}, koji je sada u sastavu rep rez entac ij e Srb ij e na Olimpijskim igrama u Londonu,gdejedbitovaoume~usVelikomBritanijom. KAMP [OTOKAN SAVEZA SRBIJE U BUQARICAMA

Reprezentativci podiglikvalitet [otokankaratesavezSrbije i ovog leta organizovao je tradicionalni kamp u Buqaricama(Crna Gora). Pod dirigntskom palicom selektora Ace]irovi}aiwegovihsaradnikaMi}e]opi}a,Tihomirai Mi}e Makitana i Igora Miladinovi}atreniraloje120karatistaizceleSrbije. - Veoma sam zadovoqan ozbiqno{}upristupatreningu mladihkaratistakojisuizsvojih klubova doneli dobro predznawe – ka`e selektor SSKS SrbijeAco]irovio}.–Uzstotinak u~esnika, u Buqarice je pristigloi2oreprezentativaca(senioraiseniorki)kojisu imaliposebanprogramkakobi {to spremnije do~ekali predstoje}a velika takmi~ewa na me|unarodnojsceni(Prvenstvo sveta za seniore od 14. do 18. okotobrauItalijiiOtvoreno SKIFprvenstvosvetaod19.do 24.novembrauAustraliji). Usli~nomtonugovoriiprvi asistent  selektora Mi}o ]opi}. -PodolaskuuSrbiju,spisak reprezentativaca bi}e korigovan i na wemu }e ostati samo oni koji koji }e u~estovati na takmi~ewima u Italiji i Australiji. Nadam se da }e rukovodstvo reprezentacije uspetidaobezbedisredstvazaodlazak seniorske ekipe na ova dva velika takmi~ewa obzirom da smopro{legodineuMa|arskoj bili prvaci Evrope – isti~e ]opiu}ododaje:-Popovratku iz Crne Gore kre}emo sa pripremamaporegionima,u^a~ku, Subotici,naVlasinskomjezeru iBe~eju.Ina~e,kampuBuqaricamaprotekaounajboqemredu, svisusetrudilidapone{tonau~eodsvetskipriznatogstru~wakaAce]irovi}a. Reprezentativac Igor Miladinovi}jerekao: - Obe}avam da }e mo qubiteqe ovog drevnog borila~kog sporta obradovati dobrim rezultatimasapredtoje}ihvelikihtakmi~ewa. U Buqaricama su o karatistima brinuli i dr Dragan Paka{ki i fizioterapeut Sr|an Vasiqevi}. - Crnogorsko primorje je raj zatakmi~areiverujemda}emo seizMilanaiSidnejavratiti sa  nekoliko medaqa – rekao je drDraganPaka{ki,kojigotovo pet decenija brine o zdravqu karatista. M. Grbi}


SveT POZnATiH

dnevnik

subota4.avgust2012.

19

анаивановић илипорно-звезда

ја ааукци к с ј и п Олим

У

популарној америчкој емисији Џимија Кимела, публика није препознала Ану Ивановић, већ је већина помислила да се ради о некој порно-звезди. У част Олимпијских игара, популарни водитељ је направио видео-колаж са фотографијама спортиста и порно-звезда, а онда је питао публику - шта су ове особе по занимању? „Неки од ових људи су страховито лепи и згодни, хајде да видимо да ли можете да препознате ко се бави спортом, а ко филмовима за одрасле”, питао је Кимел. Гледаоцима је задатак био додатно отежан јер су и лепотице и фрајери били у купаћим костимима, или доњем вешу. Када се појавила Анина фотографија, већина је рекла да је у питању порно глумица.

Н

Балотелиимановудевојку

Навали,народе

еки волонтери који су учествовали на отварању летњих олимпијских игара у лондону,ставилисунапродајуреквизитекојесукористилитокомцеремоније. поред костима које су носили, књиге коју је читалаЏоанак.Роулинг,насајтуеБаyосванулисуифлајерисапрограмом,аиконфетеса спектакуларноготварањаОиулондону. Неки од продаваца су чак изјавили да су срећни, јер ће реквизити отићи у праве руке. међутим, неке њихове колеге не подржавају

оваквупродајуивеомасуразочаранињиховим поступком. „Речено нам је да можемо да задржимо реквизите које смо користили током церемоније,алимислимдајенепоштенодаих неко стави на продају“, рекао је један од извођача. Неки од њих који су ставили на аукцију реквизите, правдају се тиме да су само хтели да виде колику би цену постигли костими које суносилитокомшоуа.

Н

ајновија изабраница славног фудбалера Балотелија јефранцускапевачицаимоделВанеса лоренс. БалотелииВанесаупознали сусетокомњеговогборавканаибици протекленедеље. Новопечени пар је уживао у свим чарима једног од најпознатијих медитеранскихлетовалишта. прекоданасусекупали,аноћу уживали у дивљем проводу поклубовима. Да подсетимо, фудбалер манчестер ситија био је у вези с Рафаелом Фико, која тврди да носи његово дете, араскинулисујерју је Балотели преварио, неколико пута.Хоће ли веза са младом Францускињом потрајати или ће и она бити још једна Балотелијева рецка - видећемо.

Ванеса Лоренс

краљице, висте? професионални падобранац Гери конери забавио је свет током отварања Олимпијских игара у лондону, када је маскиран у британску краљицу искочио из хеликоптера. На интернету је објављена његовафоткау„фул”костиму, а британска штампа шали се да „краљица никада није изгледалабоље”.

Чашица„кампарија” ипенелопекруз

л

епа Шпањолка пенелопе круз новаједама„кампаријевог”календараза2013.годину. прва шпанска глумица у историји којаједобилаОскарапоћићестопама неких од најелегантнијих жена света,којесукрасилестраницепретходних календара „кампари”, као штосуселмаХајек,Евамендес,Џесикаалба,милајововић... пенелопе круз ће тако бити 14. светсказвездакојаћедасенађена страницама календара једног од најпопуларнијих пића на планети.

историјом. мислим да ће ‘кампари’ фанови широм света уживати у фотографијама, када буду видели календар,јерјетемајакозаноснаи шик”,изјавилајепенелопе. Фотограф кристијан Шулер каже да је фотографисање за календар невероватан и потпуно јединствен изазов. „‘кампари’ има историју стварања моћнеивизуелно-запањујућеслике, како у својим рекламним кампањама, тако и у календарима. мојанамерајебиладаовууспешну

Традиционално одевена у црвено пенелопе се нашла испред објектива цењеног фотографа кристијанаШулера. „‘кампари’ ради календар са талентованим и креативним фотографимаинатајначиннастају првокласна уметничка дела. Заиста сам уживала радећи на овом пројекту,заједаноднајпопуларнијих светскихбрендовасаневероватном

причу наставимо и померимо границедаље,штоосећамдасмои постигли. Дивно је радити са талентованим људима попут пенелопе,којајесвојимизгледоми јединственошћу,заистафантастично представилатемунајновијегиздања календара.” Фотографије ће премијерно бити прказаненајесеновегодиненагала пријемуумилану.

цеоХоливудна једнојслици п

оводомстотогрођенданастудија „парамаунт”, 116 звезда „стало”јенаједнуфотку. укупно 116 глумаца, режисера, продуцената,певачаичелникастудија стало је на фотографију поводомјубилеја„парамаунта”.Њихови филмови зарадили су 103 милијар-

де долара, а заједно имају 124 Оскара. Нема шансе да вам их све набројимо овде, али ево макар неких-леонардодикаприо,Томкруз, РичардГир,Џулијенмур, Џорџклуни,ЕндиГарсија,адамаасандлер, крис Рок, Роберт де Ниро, кирк Даглс, кејт Хадсон, Оливер стоуз,

Шарлиз Терон, Харисон Форд, стивенспилберг,ДастинХофман,Шон пен,Бредпит,камеронДијаз,Џони Ноксвил, Џон Траволта, Оливија Њутн-Џон, Дејвид линч, меган Фокс,антониоБандерас,Демимур, Роберт Дауни Џуниор и Џастин Бибер.


20

svet

subota4.avgust2012.

PREDSEDNI^KIKANDIDATIIJAVNOMWEWE

UKRATKO

ObamaispredRomnija

Vozusmrtio devetoro

LOS AN\ELES: Republikanski predsedni~ki kandidat se posle debakla na prvoj me|unarodnoj politi~koj turneji susre}e sa pora`avaju}im rezultatima istra`ivawima javnog mnewa. Anketa Pju istra`iva~kog centra pokazuje da je trenutni predsednik Amerike, demokrata Barak Obama, pove}ao vo|stvo u odnosu na Mita Romnija i da sada ima prednost od deset odsto - 51 prema 41. Kako navodi „Los An|eles Tajms” Pju obi~no daje ve}u prednost Obami u odnosu na istra`ivawa Si-Bi-Esa i „Wujork tajmsa”, ali i prema ovim istra`ivawima Obama vodi, samo sa mawom razlikom. Ono {to bi moglo da bude mnogo vi{e zabriwavaju}e za Romni-

PEKING:Devetoro qudi je poginulo, a ~etvoro je povre|eno kada ih je udario voz dok su prelazili `elezni~ki most na severu Kine, saop{tile su ju~e vlasti. Qudi su i{li `elezni~kim mostom da bi izbegli poplavqeni seoski put u severnoj provinciji [anksi. Teretni voz, koji je nailazio, nije uspeo da se zaustavi na vreme. Velike ki{e isprale su veliki broj puteva na severu Kine.

Sudaraviona ivozila BE^: Putni~ki avion „boing 767” austrijske kompanije AUA udario je na pisti be~kog aerodroma „[vehat” u vozilo aerodroma. U nesre}i nema povre|enih. Avion se u trenutku kolizije nalazio na parking poziciji, a 228 putnika i posada jo{ se nisu krcali, potvrdio je agenciji APA portparol AUA Vilhelm Baldia informaciju objavqenu na portalu „Ostrijen Vings“. „Boing 767” trebalo je ju~e da poleti za Wujork, ali su zbog sudara putnici ka toj destinaciji krenuli drugom letelicom sa vi{e~asovnim zaka{wewem. Baldia je rekao da su u sudaru o{te}ena vrata na teretnom delu aviona. Pre par dana desio se, tako|e, incident na be~kom aerodromu kada je avion tipa „boing 777”, prilikom vu~e u hangar, o{te}en na trupu. Avion je i daqe van upotrebe, po{to popravke nisu zavr{ene. Popravke su se odrazile i na regularan avionski saobra}aj na liniji Be~-Wujork, jer je AUA morala da sprovodi letove ka ovoj destinaciji avionima tipa Boing 767, od kojih je sada o{te}ena jedna letelica.

ja je podatak da ga ~ak 52 odsto bira~a vidi negativno u odnosu na samo 37 pozitivnih stavova. To je najmawi procenat pozitivnih glasova koji je neki predsedni~ki kandidat imao od 1988. godine. „Los An|els Tajms” iznosi procenu da su na to o~igledno uticale negativne reklame koje je lansirao Obamin {tab, a u kojima je Romni predstavqen kao ~ovek koji sakriva svoje poreske prijave. Kada se posmatraju takozvane „sving stejts”, wih 12, Obamina prednost je mawa, 48 prema 44 odsto, ali i tu vodi, prema ovom istra`ivawu. Jedina dobra vest za Romnija u ovom istra`ivawu je informacija da su wegovi simpatizeri vi{e ukqu~eni u kampawu od

Obaminih. Tako je 70 odsto Romnijevih pristalica reklo da „puno razmi{qa” o izborima, naspram 57 odsto Obaminih pristalica koji su dali takav odgovor. Ipak, ni Obamin rejting nije dobar, pa se tako 50 odsto ispitanika izjasnilo da ima pozitivno mi{qewe o wemu, a 45 odsto lo{e. Samo su Bob Dol na izborima 1996. i Xorx Bu{ ~etiri godine pre toga imali lo{iji rejting. „Los An|eles Tajms” konstatuje da ovako veliki broj negativnih glasova kod oba kandidata govori o velikoj polarizaciji bira~a. Me|u Romnijevim pristalicama ~ak 93 odsto vidi Obamu negativno, dok je kod Obaminih taj procenat u odnosu na Romnija 84.

dnevnik

Tajfunodneo37`ivota naFilipinima MANILA: Broj `rtava tajfuna Saola na Filipinima porastao je na 37, a strahuje se da }e broj nastradalih biti mnogo ve}i po{to obilne ki{e pogor{avaju situaciju u poplavqenim podru~jima, saop{tila je ju~e vlada u Manili. Monsunske ki{e nastavile su da padaju u severnim i centralnim delovima Filipina, gde su pojedini gradovi poplavqeni {esti dan za redom iako se tajfun znatno udaqio od arhipelaga. Filipinske vlasti su ranije saop{tile da su 23 osobe poginule u tajfunu, ali je agencija za civilnu odbranu iznela nove podatke po kojima je mnogo ve}i broj Filipinaca nastra-

POSLEOSTAVKEIZASLANIKAUNZASIRIJU

SAD:KinaiRusija krivezbogAnana VA[INGTON: SAD smatraju da su glavni krivci {to je izaslanik UN za Siriju Kofi Anan napustio tu poziciju Rusija i Kina, koje su odbijale da podr`e rezolucije o Siriji Sa druge strane, Iran je optu`io „neke zemqe koje su se umesale” za neuspeh mirovnog plana Kofija Anana. Anan je „neumorno radio u poku{aju postizawa konsenzusa u me|unarodnoj zajednici, okon~awu krvoproli}a i dolasku vlade koja bi ispunila legitimna nastojawa sirijskog naroda”, saop{tila je ameri~ka dr`avna sekretarka Hilari Klinton. „Na`alost, Savet bezbednosti je bio blokiran u pru`awu kqu~nog oru|a koje bi pomoglo napretku u wegovim naporima”, saop{tila je Klintonova i dodala da se Ananu zahvalila zbog preuzimawa „te{kog zadatka” da poku{a da obezbedi mirnu tranziciju u Siriji. Portparol Bele ku}e Xej Karni izjavio je da su veto odluke na rezolucije o Siriji „bile za `aqewe i stavile su i Rusiju i Kinu

Vukovi ~uvajuzatvor LUIZIJANA: Najve}i zatvor u SAD, Kazneno-popravni centar Luizijane, zbog mera {tedwe po~eo je da umesto qudi, kao ~uvare koristi vukove ukr{tene sa psima ^lan asocijacije kazneno-popravnih ustanova SAD D`or` Kemp rekao je ameri~kom dnevniku „Vol strit d`urnal” da je zatvor u Luizijani po svaku cenu morao da smawi tro{kove vezane za plate zaposlenih. Kako je preneo francuski dnevnik „Figaro”, u najve}em zatvoru u SAD, koji se prostire na povr{ini od 73 kvadratna kilometra, polovina od ukupno 5.000 zatvorenika su ubice, a 75 posto je osu|eno na kaznu do`ivotnog zatvora. Zbog smawewa buxeta ustanove, mawe od 20 miliona dolara za period od pet godina, direkcija zatvora bila je primorana da otpusti 105 od 1.200 ~uvara i 35 od 42 agenta za nadgledawe. Direkcija od 2011. godine koristi 80 pasa-vukova za ~uvawe zidina zatvora.

na pogre{nu stranu istorije i pogre{nu stranu sirijskog naroda”, preneo je AFP. Podsetimo, nekada{wi generalni sekretar UN odlu~io je da vi{e ne bude izaslanik UN i Arapske lige za Siriju, a kao razlog za to je naveo nedostatak podr{ke i sve ve}u eskalaciju sukoba u toj zemqi.

S druge strane, Kina koju su SAD „prozvale”, izrazila je `aqewe zbog takve Ananove odluke i saop{tila da }e nastaviti da radi na politi~kom re{ewu konflikta. Nakon {to je objavio da se povla~i s mesta specijalnog izaslanika za Siriju u „Fajnen{el tajmsu” pozvao i Rusiju i SAD da

Doputovalo40na{ihgra|ana BEOGRAD:Grupa od 40 dr`avqana Srbije i ~lanova wihovih porodica evakuisana je iz Sirije, i avionom „Jat ervejza” oni su doputovali u Beograd. Oni su stigli u Beograd uz pomo} ministarstava spoqnih i unutra{wih poslova Srbije. Srpski dr`avqani, uglavnom `ene udate za Sirijce, doputovali su na aerodrom „Nikola Tesla”, gde su im dobrodo{licu po`eleli predstavnici dva ministarstva koja su evakuaciju organizovala.U toj dr`avi, zahva}enoj gra|anskim ratoma, pre po~etka evakuacije bilo je oko 200 srpskih dr`avqana.

„Ve}ina wih se jo{ nije odlu~ila da do|e u Srbiju, budu}i da se uglavnom radi o me{ovitim brakovima. U Alepu, gde se vode borbe, i gde nije bilo bezbedno da se na{i gra|ani evakui{u, ostalo je nekoliko desetina na{ih dr`avqana sa kojima smo u kontaktu”, izjavio je novinarima Dragan Markovi} iz Ministarstva unutra{wih poslova. Prema wegovim re~ima, ako preostali dr`avqani Srbije budu `eleli da se evakui{u iz Sirije bi}e ponovo organizovan let iz Damaska. Markovi} je precizirao da su u grupi koja je ju~e doputovala u Beograd uglavnom qudi iz Damaska, ali i iz okolnih mesta, pa ~ak i iz Alepa.

pomognu u spasavawu Sirije od katastrofalnog gra|anskog rata i da pribli`e stavove po pitawu te zemqe. Anan je u tekstu u „Fajnen{el tajmsu” istakao da zapadna vojna intervencija sama po sebi ne bi urodila plodom u Siriji, a da je politi~ko re{ewe koje ne bi bilo sveobuhvatno tako|e osu|eno na neuspeh, preneo je AFP. „Sirija jo{ mo`e da bude spasena od najgore nesre}e. Za to su potrebni hrabrost i vo|stvo, pre svega od stalnih ~lanica Saveta bezbednosti, ukqu~uju}i predsednike Putina i Obamu”, napisao je odlaze}i izaslanik za Siriju. U me|uvremenu, u Siriji ne jewavaju sukobi, pa su tako helikopteri sirijske armije ubili 16 pobuwenika, iz iste familije u oblasti Haurana, strate{kog regiona koji povezuje prestonicu Damask sa Jordanom, gde su borbe intenzivirane proteklih nekoliko dana, saop{tili su danas opozicioni izvori, a preneo Rojters. Ove `rtve usledile su nakon {to su pobuwenici napali jedan kontrolni punkt sirijske vojske u blizini grada Busre el-Harira nakon ~ega su napadnuti iz vazduha, a vladine snage po~ele da granatiraju grad. Sirijska Opservatorija za qudska prava saop{tila jeju~e da je u granatirawu palestinskog izbegli~kog kampa Jarmuk u Damasku, poginulo najmawe 15 civila, od toga dvoje dece. Ova nevladina organizacija sa sedi{tem u Britaniji, saop{tila je da su granate pale na izbegli~ki kamp u ~etvrtak uve~e, u ju`nom delu prestonice.

dao, ukqu~uju}i 11 mladih koji su se udavili u ~etiri razli~ite oblasti tokom prekju~era{weg dana. Vlasti o~ekuju da }e bilans nastradalih biti i ve}i, s obzirom da je prijavqen nestanak ~etiri osobe, preneo je AFP. Iako je Saola pro{la Filipine, tajfun i daqe donosi obilne ki{e ostrvu, zbog ~ega se o~ekuje nova erozija zemqi{ta i rast nivoa vode u poplavqenim oblastima. Tajfun je doneo obilne ki{e i prestonici Manili i okolnim distriktima, koji su danima ve} poplavqeni, ali prema saop{tewu vlasti, nov talas padavina tu oblast ne}e zna~ajnije ugroziti.

TURSKA

Ubijenvojnik ANKARA: Kurdski pobuwenici ubili jednog turskog vojnika a ranili deset u napadu koji su izveli na jugoistoku zemqe, javila je turska dr`avna televizija, a preneo AP. Ta televizijska stanica je objavila da su pobuwenici napali vojni punkt u blizini grada Eruha u provinciji Sirt u ~etvrtak uve~e. Turski vojnici su anga`ovani u borbi protiv kurdskih pobuwenika koji se bore za autonomiju jugoistoka dr`ave gde su Kurdi ve}insko stanovni{tvo. Ankara strahuje da bi kurdski pobuwenici mogli da „iskoriste” gra|anski rat u susednoj Siriji i da postave baze u zemqi, navodi AP.

IRAN

Najve}a pretwa –blagirat TEHERAN: Komandant iranske elitne Revolucionarne garde ka`e da je najve}a pretwa Iranu takozvani „blagi rat” koji bi pokrenuli wegovi neprijateqi. U komentaru postavqenom na sajtu Revolucionarne garde, general Mohamed Ali Xafari nije definisao konkretnije {ta pod time podrazumeva. Termin „blagi rat”(soft war) obi~no se odnosi na mere poput ekonomskih sankcija, {pijuna`e, kompjuterskih virusa i prodaju neispravne opreme. Xafari je rekao da je Iran sada u „osetqivom i sudbonosnom periodu” i da mu je potrebna za{tita paravojnih Basij snaga. Zapad je pooo{trio sankcije prema Iranu kako bi ga prisilio da zaustavi oboga}ivawe uranijama po{to veruje da Iran gradi nuklearno oru`je. Iran insistira da razvija nuklearni program u mirnodopske svrhe.

PETASTRANASVETA

LI^NOSTI VLADIMIRPUTIN Predsednik Rusije Vladimir Putin ka`e da ~lanice grupe „Pusi Rajot” koje su u najve}oj crkvi u Moskvi otpevale pesmu protiv wegovog re`ima, ne treba da budu strogo ka`wene. „Nema ni~eg dobrog u onome {to su one uradile”, ali zbog toga ne treba da budu suvi{e strogo ka`wene. Rekao je novinarima da se nada da }e ~lanice pank-grupe „Pusi Rajot” izvu}i „same zakqu~ke i nau~iti ne{to na svojim gre{kama”.

KENETKLARK Britanski ministar pravde Kenet Klark izrazio je zabrinutost zbog novca koji je vlada potro{ila prilikom re{avawa slu~aja ubistva Aleksandra Litviwenka, ruskog obave{tajca koji je 2006. godine u Londonu otrovan radiokativnim polonijumom. Re~ je o iznosu od skoro ~etiri miliona funti. Ministar Klark je uputio pismo istra`nom sudiji [irli Redklif, i zatra`io da se uradi nova procena tro{kova.

GUKAILAI Su|ewe Gu Kailai, `eni visokog kineskog funkcionera, optu`enoj za ubistvo britanskog dr`avqanina Nila Hejvuda, po~e}e 9. avgusta, javila je ju~e agencija Rojters pozivaju}ui se na dva izvora. Wen mu` Bo Silai bio {ef partije i smewen je sa svih funkcija nakon izbijawa skandala sa wegovom `enom koji je potresao i vrh partije. Gu Kailai se tereti za ubistva s predumi{qajem.

PUT EPIDEMIJI VELIKIH RAZMERA IPAK OTVOREN

Ebola iz Ugande preti i Evropi? KAMPALA, ZAGREB: Smrtonosna ebola, koja hara Ugandom, mogla bi se pro{iriti i na Evropu, budu}i da je glavni grad Kampala povezan avionskim linijama sa evropskim metropolama. Stru~waci upozoravaju da je dovoqno da samo jedan zara`eni sedne u avion za Pariz ili Be~ i tako pro{iri zarazu, pi{e hrvatski „Ve~erwi list”. Ebola se ina~e periodi~no javqa u zaba~enim selima u Ugandi, a dobija se konzumirawem zara`enog majmunskog mesa. Do sada se zaraza nije {irila van zara`enog sela jer bi obi~no svo stanovni{tvo bilo zara`eno i umrlo, naj~e{}e ve} u prva 24 sata i pre nego {to bi se neko od wih domogao ve}eg naseqenog mesta. Me|utim, u posledwoj epidemiji koja je izbila pre desetak dana u selu Nijansviga, dvestotiwak kilometara od glavnoga grada Kampale, slu~aj je ne{to druga~iji.

Naime, jedan od zara`enih seqana uspeo je da do|e do bolnice u Kampali, gde je nedugo potom umro uz obilno krvarewe. Samo sat vremena kasnije, ~im se pro~ulo da je u bolnici preminuo pacijent oboleo od ebole, u glavnom gradu Ugande, u kojem `ivi milion i po stanovnika, nastala je panika. Oglasio se i predsednik Ugande Joveri Museveni, koji je rekao da je zemqa

u krizi. „Ebola je ponovno izbila, a jedan od bolesnika do{ao je do Kampale i zaraza preti svima. Ve} su se razboleli i lekari koji su s wim do{li u kontakt i qudi koji su spalili wegovo mrtvo telo nakon {to je preminuo”, kazao je on. Iako su zbog straha od {irewa ebole, ina~e najsmrtonosnije zaraze dana{wice, jer protiv we nema leka, zatvorene sve {kole i

javne ustanove u Kampali, put epidemiji velikih razmera ipak je otvoren. „Kampala je veliki grad, sa vazdu{nim vezama prema celom svetu. Dovoqno je da samo jedan zara`eni pacijent, koji je virus pokupio samo nekoliko sati pre, sedne u avion za Pariz ili Be~ i pro|e kroz taj aerodrom da bi se bolest nekontrolisano po~ela {iriti po celom svetu”, ka`e infektolog Xejms Bor~er. On dodaje da treba znati da se radi o vrlo zaraznoj bolesti koja se prenosi ve} i rukovawem ili slu~ajnim dodirom, a pacijenti gotovo da i nemaju {anse za pre`ivqavawe. Ujedno, bolest je brza pa qudi umiru u periodu od 24 sata od ulaska virusa u organizam. Prema wegovim rie~ima, samo je pitawe vremena kada }emo prvi slu~aj ebole zabele`iti na podru~ju Evrope ili SAD.


dnevnik

oglasi

subota4.avgust2012.

21

ENGLESKI, ~asovi za sve uzraste i nivoe, 800din, 60 min. Telefon 063/ 1176403. 57859

IZDAJEM jednoiposoban prazan stan sa kuhiwskim elementima na odli~noj lokaciji i povoqnoj kiriji. Telefon 021/ 521-256. 57840 IZDAJEM komforno name{tenu garsoweru, pogodno za studente i |ake, ul. Mileve Simi} br. 8. Tel. 064/1360012. 57860 IZDAJEM dvosoban name{ten stan 40m2 u ulici Pariske komune br.30 Novi Sad. Telefon 063/ 7120080. 57872 IZDAJEM name{ten jednoiposoban stan u Bra nimira ]osi}a 31/I, prvi sprat, svoj parking u dvori{tu. Telefon 064/3531161. Smiqka. 57902

LIMAN II, 44m2, IV sprat, odmah useqiv, cena dogovor. Telefon 063/239-411. 57272

PRODAJEM {estosoban stan, 130m2, deqiv u dve celine, 3 kupatila, centralno grejawe, odvojen kalorimetar, vodomer, 98.000E, kod GRAS-a. Telefon 064/165-8384. 57308


22

OGLASi l ^iTUQe

subota4.avgust2012.

Posledwi pozdrav dragom te~i, na{em deda Qubi.

PRODAJEM ba{tu - Bege~ka jama 20 ari, a mo`e i pola, .dozvoqena gradwa, struja, 100m od vode, brawena od vode. Telefon 898307. 57357

KUPUJEM sve vrste automobila starija i novija, mo`e i havarisana. Telefoni; 021-822-714 i 063-708-1939. 57186

dnevnik

Obave{tavamo rodbinu i prijateqe da je 2. 8. 2012. godine, u 71. godini preminula na{a draga supruga, majka i baka

Sa velikom tugom obave{tavamo rodbinu i prijateqe da je u 87. godini preminuo na{ dragi otac i deda

Qubomir Markov

Qubomir Markov

Ispra}aj je u ponedeqak, 6. 8. 2012. godine, u 10.45 ~asova, na Gradskom grobqu u Novom Sadu.

Milka Karanovi} Porodica Stojanovi}.

VODOINSTALATER pru`a sve usluge u delatnosti: odgu{ewa odmah, vr{imo emajlirawe kada, lajsne oko kade. I van grada. Telefoni: 063/7509499, 065/5610864, 021/6394167. 57664 IZOLOVAWE i presecawe vla`nih zidova ma{inskim putem, debqine do 55 cm, brzo i povoqno. Tel.: 064/1803850, 021/6390-810. 57281

O`alo{}eni: }erka Vesna i unuk Du{an. Sahrana je danas, 4. 8. 2012. godine, u 13 ~asova, na grobqu u Ba~kom Jarku.

58032

58038

Beskrajno smo tu`ni {to nas je zauvek napustila na{a voqena i po{tovana snaha

SEDMODNEVNI POMEN dragoj mami, baki i ta{ti

O`alo{}eni: suprug Sr|o, sin Vlade, }erka Marica, zet Sini{a, snajka Tamara i unuci Gojko, Vladimir, Stefan i Sergej.

58023

Posledwi pozdrav

Posledwi pozdrav tetki i baki

sestri,

Milki Ra{kovi} 1937 - 2012.

Sne`ana Su~evi} POTREBAN konobar na Splavu u Futogu. Telefon 063/509-167. 57281

KUPUJEM zlatnike, dukate, napoleone, lomqeno zlato, stari srebrni i zlatni novac, medaqe, ordene, sabqe, bode`e, satove, srebrninu. Telefoni: 063/8-318180, 021/451-409. 44683 ^ISTIM podrume, odnosim {ut, kupujem staro gvo`|e, ve{ ma{ine, {porete, automobile stare za otpad. Telefoni: 064/953-3943, 021/6618-846, 063/84-85-495. 57282 KUPUJEM stare automobile neregistrovane za otpad. Staro gvo`|e, ve{ ma{ine, {porete, odnosim {ut, ~istim podrume, tavane, povoqno. Telefon 064/95-33-943, 063/84-85-495, 021/6618-846. 57283 KUPUJEM lomqeno srebro i zlato, nakit, dukate, zubno zlato. Od vlasnika. Najboqa cena u gradu. Telefon 064/994-5002. 57719

Pro{lo je sedam najtu`nijih dana u na{em `ivotu. Dani brzo prolaze ali na{a qubav, tuga i se}awe na tebe nikada ne}e. Mnogo nam nedostaje{. Neka te an|eli ~uvaju. Tvoji najmiliji.

Po~ivaj u miru. Neka ti je laka zemqa. Porodica ]osin.

58034

58042

Posledwi pozdrav dragom

Milki Karanovi}

Milki Karanovi}

od devera Stanka Karanovi}a sa porodicom.

od porodica: Hrwak i Vuli}.

58025

Dana, 3. 8. 2012. godine zauvek nas je napustio na{ voqeni otac, tast i deda

deda Tomi

58024

3

Vera Krstono{i} ro|. Ba}anovi} 1934 - 2012

Posledwi pozdrav

Posledwi pozdrav dragoj mami od sina Du{ana.

od Bube i Borisa.

58035 58046

Uvek }emo se sa po{tovawem i qubavqu se}ati na{e drage kom{inice

Posledwi pozdrav dedi

Posledwi pozdrav voqenoj mami

Tomislav Proli}

Sne`ani Su~evi} ro|. [abanovi}

Neka te an|eli carstva nebeskog.

Tomislavu Proli}u Jelene Cice Pavi}

prate

do

Veri Krstono{i}

O`alo{}ena }erka Milka sa porodicom.

ro|. Ba}anovi} Majka Desanka, brat Zvonko sa porodicom.

Unuci Tomislav i Veqo i unuke Adrijana i Qubica.

Danica, Vera, Dragana i Dragan sa decom. OG-1

od: Jelice, Milice i Branka. Mamice moja, neka te an|eli ~uvaju.

58044

S tugom obave{tavamo rodbinu i prijateqe da je nakon kratke bolesti preminula na{a draga

Jelena Pavi}

58043

Tu`na srca obave{tavamo svu rodbinu i prijateqe da je 3. avgusta u 82. godini preminuo na{ dragi otac, deda i pradeda

Tomislav Proli}

ro|. 1934.

O`alo{}eni: sin Du{an, }erka Qubinka, zet Hideo i unuk Mikio. 58051

Kako mi samo nedostaje tvoj osmeh i pogled blag...

Sahrana je danas, 4. 8. 2012. godine, u 16 ~asova, u ^erevi}u. O`alo{}ena porodica Proli}. 58045

Posledwi pozdrav dragoj

mama Veri

@iksa

1931 - 2012.

Sahrana je danas, 4. 8. 2012. godine, u 15 ~asova, na Gradskom grobqu u Novom Sadu.

58039

58047

Tvoja An~i.

58036

od Olgice.

58037


^iTUQe l POMeni

dnevnik

POMEN Dana, 7. 8. 2012. godine navr{ava se godinu dana od kako nije sa nama

Draga na{a

subota4.avgust2012.

23

Sa tugom i bolom u srcu obave{tavamo svu rodbinu i prijateqe da je u 73-oj godini preminula na{a draga

Keka Emilija Luba{~ik ro|. Pa{}an Uspomenu na wenu nesebi~nu qubav, beskrajnu dobrotu i plemenitost ~uvamo sa qubavqu i po{tovawem.

za{to si nas tako rano napustila. Ko }e nas do~ekivati nasmejanog lica i vedrog duha na vratima ku}e.

Danica Vojnovi}

Dok smo `ivi ne}emo zaboraviti tvoju vedrinu, qubav i gostoprimqivost.

ro|. Dobanova~ki 1939 - 2012.

Tvoji kumovi Emilija i @eqko [krbi}.

Weni najmiliji.

58021

Posledwi ispra}aj na{e drage Babu{ke obavi}e se u kapeli seoskog grobqa u Gospo|incima, danas 4. 8. 2012. godine, u 12 ~asova.

58005

Posledwi bratu

pozdrav

dragom

Posledwi pozdrav

Posledwi pozdrav prijateqici

dragoj

O`alo{}eni: sin Stevan, snaja Nata{a, unuk Vladimir i unuka Marina.

57989

Radomiru Galovi}u

Sne`i

Sne`ani Su~evi}

od Ne{e i Jelene Stankovi}.

od: Dejana, Zvon~ice i Lane Risti}.

58030

58029

58028

Obave{tavamo rodbinu i prijateqe da je na{a voqena majka, baka, }erka i sestra

Duboko saose}amo u bolu porodice povodom gubitka i prerane smrti

od Ozrena Galovi}a sa porodicom.

Sa velikom tugom se opra{tam od moje dobre drugarice i na{e drage kume

Posledwi pozdrav na{oj dragoj

Posledwi pozdrav

Danici Danice Vojnovi} od sestre Milice i sestri}a Jovana Kalawa sa porodicom.

ro|. Dobanova~ki

57992

Hvala ti za sve lepe trenutke u na{em dru`ewu.

Sne`i Su~evi}

Milena Bregun

Posledwi pozdrav na{oj dragoj

Sne`ane Su~evi} preminula u 61. godini. Sahrana }e se obaviti na grobqu u \ur|evu, u subotu, 4. 8. 2012. godine, u 15 ~asova. Ve~no za tobom tuguju Tvoji najmiliji. 57995

^ETRNAEST GODINA tu`nog se}awa na dragog prijateqa

Milicin gimnazijski razred IV 6 sa razrednim stare{inom prof. Ru`icom Petrovi}.

Puno }e nam nedostajati tvoja pa`wa, dobrota i plemenitost.

Tvoja Smiqa sa sinovima.

Tvoji prijateqi Plav{i}i.

58033

58027

57991

3

Nani od porodice Na{aga}in.

Gojka \ura{evi}a 1998 - 2012.

57990

Sa tugom i bolom javqamo da je na{a voqena mama, baba, prababa, svekrva preminula u 84. godini.

Ne}e te zaboraviti drugovi iz {kole: Drago, Lazo. Rus, \urika, Rapai}, Zori}, Dabes, Kravi}, Mikica, Savi}, Bobi}, Marovi} i Raki}.

58003

Posledwi tati

pozdrav

Dacinom

Sne`ana Su~evi} Sosa

Sila|i Ana 22. 7. 1928 - 30. 7. 2012.

1960 - 2012. ... I sve je stalo i nasta ti{ina, umrla je majka, supruga, prijateq... Nikoli Stevi}u Ivana, Jordan, Miroslava, Milica, Aleksandra, Sowa i Vlada.

Sahrana }e se obaviti danas, 4. 8. 2012. godine, u 15.45 ~asova, na Gradskom grobqu. O`alo{}ena porodica: Branislav, Una i Milica. 58017

58009

Dala si nam osmeh i radost ovog sveta, sada si sve to odnela sa sobom i oti{la da ti an|eli poka`u nebeski put. Sahrana je danas, 4. 8. 2012. godine, u 13 ~asova, u Rumenki na ma|arskom grobqu. Sa ve~nom tugom u srcu: k}erka Ana, unuci Ferika i Robert sa porodicom, sin \urika, snaja Jelena, unuci Stevica i Kristina i praunuk Jovan. 58006


24

^iTUQe l POMeni

subota4.avgust2012.

Navr{ava se najtu`nijih ~etrdeset dana od rastanka sa dragim ocem, tastom i dedom.

Dragom tati, dedi i pradedi

Radomiru Galovi}u Braci posledwi pozdrav uz iskreno po{tovawe i veliko hvala za sve. Sin Branko, unuci Marko i Du{an, snaje Tawa i Marijana i praunuka Una. 57996

Navr{ava se najtu`nija godina od smrti drage mame, ta{te i bake

Bako, kada bi na{a qubav mogla da te vrati, `ivela bi ve~no. Po~ivaj u miru.

Od zaborava }e te ~uvati: }erka Ka}a, zet Milan, unuk Petar i unuka Lela.

Od zaborava }e te ~uvati: }erka Ka}a, zet Milan, unuk Petar i unuka Jelena.

58014

58015

Voislav [}epanov Bigovi}

Roksanda Anu{i}

pukovnik u penziji 1950 - 2012.

10. 8. 2011 - 10. 8. 2012.

Voki, nedostaje{ nam za bratsku qubav, podr{ku i smisao koji si davao na{im `ivotima. Ponosni smo na Tvoj lik i delo, `ive}e{ u na{im slomqenim srcima.

Prolaze dani, a svakim danom mi sve vi{e nedostaje{. Sestra Olga sa porodicom.

Dragan Grbi}

ro|. Keravica

^etrdesetodnevni parastos i osve}ewe spomenika odr`a}emo danas, 4. 8. 2012. godine, u 10 ~asova, na Gradskom grobqu. Po~ivaj u miru.

Danas, 4. avgusta 2012. godine, navr{ava se ~etrdeset dana od kako nije sa nama

Tvoji: sestra Novka, bra}a Mom~ilo i Slobodan sa porodicama.

Obave{tavamo rodbinu i prijateqe da je u ~etvrtak, 2. avgusta u 59. godini preminuo na{ suprug, otac i brat

Vidosave Zarupski

\oka Zarupski

pukovniku u penziji

dnevnik

1952 - 2012. Sahrana }e se obaviti u subotu, 4. 8. 2012. godine, u 12.45 sati, na Gradskom grobqu u Novom Sadu. O`alo{}eni: supruga Julia, sin Stevan, }erka Sawa i sestra Nada sa porodicom. 57983

Posledwi pozdrav velikom i po{tovanom prijatequ

Posledwi pozdrav dragom zetu i te~i

Radomiru Galovi}u

Draganu Grbi}u

Roksanda Anu{i} Vreme koje prolazi ne donosi zaborav. Tvoja plemenita du{a i veliko srce zaslu`uje ve~no se}awe.

od Nene i ^a|e.

od porodica: Ternovac i Lov~evi}.

58022

57982

Tvoji najmiliji.

58011 58001

58002

40 tu`nih dana od smrti na{eg dragog.

^ETRDESET DANA je od smrti najvoqenijeg taje.

Voqenom stricu

^ETRDESET DANA od smrti na{eg dragog.

3

Dragoj i plemenitoj Kumi

^ETRDESETODNEVNI POMEN dragom zetu

Radomiru - Braci Galovi}u Voislav [}epanov Bigovi} Tvojim odlaskom izmakao nam se najve}i `ivotni oslonac. Bio si na{ stub sre}e i najja~i izvor energije. Vreme koje je pro{lo i koje dolazi ne mo`e da ubla`i tugu koju ose}amo za tobom. Sve {to bi napisale bilo bi malo u odnosu na ono {to ose}amo u srcu. Borimo se da shvatimo da te vi{e nema ali ne mo`emo, zaborav ne postoji, samo suze, patwa i bol. Nastavi}e{ da `ivi{ kroz nas, na{a dela i re~i. Ponosne na tebe, obe}avamo ti da }emo prenositi tvoju dobrotu kroz vreme.

Tvoje: Qiqana, Bojana i Maja.

58013

Posledwi pozdrav {ogoru, ujaku i dedi

bratu

sa qubavqu i dubokim po{tovawem posledwe zbogom. Boda, Mirko i David. 57999

Voislav [}epanov Bigovi} 1950 - 2012. pukovnik u penziji Ako postoji uteha za mene, onda je to ponos {to sam tvoja. Znao si koliko te volim ali nikada ne}e{ saznati koliko patim za tobom. Mirno spavaj tajkane moj. Tvoja Bojana. 58016

Dragi ujo,

Radomir - Braca Galovi}

Radomir - Braca Galovi}

Voleli smo te i po{tovali. Po~ivaj u miru.

Dragi na{ uja~e, nikada te ne}emo zaboraviti.

Radmila i Gane sa decom, Ga}a{ i Toma{evi}.

Posledwi pozdrav od: Kristine, Novice i Ace.

57998

57997

Posledwi pozdrav prijatequ

Posledwi pozdrav na{em kumu

Voislav [}epanov Bigovi} 1950 - 2012.

Sne`ani Su~evi} Dragoqubu Topalovu

posledwe zbogom.

Vreme nije lek, ve} svedok tuge i bola, samo oni koji te vole znaju koliko je te{ko `iveti bez tebe. Ponosni {to smo te imali. Zahvaqujemo svima koji su nam u ovim te{kim trenucima izjavili sau~e{}e i posetili porodicu. Danas, 4. avgusta 2012. godine, na Gradskom grobqu u Novom Sadu, u 10.30 ~asova, porodica }e posetiti ve~nu ku}u na{eg Voja, okititi cve}em i zaliti suzama. O`alo{}ena porodica.

Milan, Milana i Isidora Sekuli}.

S ponosom }emo ~uvati uspomenu na tebe. Tvoja tazbina Rutovi}i.

58008

57973

3

3

Pro{lo je 40 dana, ali bol i tuga ne prolaze.

^ETRDESETODNEVNI POMEN voqenom suprugu.

58012

POMEN

Dragoqub Topalov

Stevan Be~eli} 4. 10. 1934 - 3. 8. 2011. Znao si da smo te voleli, ali nikad ne}e{ saznati koliko nam nedostaje{.

Jovanu Milosavqevi}u

Jovanu Milosavqevi}u

Draganu Grbi}u

Du{an Be~eli} 26. 2. 1956 - 13. 8. 2000.

od: sestre Milice, {ogora Pere, sestri}a Raleta sa porodicom.

od: prije Milice sa }erkama, Katicom i Mikom sa porodicama.

od porodice Cvetkovi}.

S qubavqu vas se se}aju: supruga i majka Natalija, sin i brat Slobodan.

58010

58019

57993

57979

Neute{ni: mama Nada, brat Milo{ i supruga Zora.

Dragoqub Topalov

Malo je re~i kojima bi se izrazila tvoja plemenitost, dobrota i qubav koju si imao prema svima.

Obele`i}emo parastos danas, 4. 8. 2012. godine, u 10 ~asova, u Crkvi Sveti Vra~i u Futogu a potom posetiti wegovu ve~nu ku}u na Cengtralnom grobqu u Futogu.

S tugom i po{tovawem, tvoja supruga Zora.

57972

57971


^iTUQe l POMeni

dnevnik

Posledwi pozdrav dragom bratu

na{em

Jovanu Milosavqevi}u Jovi od: brata Drage i sestre Slavice Perovanovi} sa porodicama.

[ESTOMESE^NI POMEN obele`i}emo na Gradskom grobqu 4. 8. 2012. godine, u 10 ~asova

Milunki Petrovi} Da{ki

Pro{la je godina, ali ne i tuga. Kume, nedostaje{ nam.

Postoji{ i traje{ u najlep{im uspomenama tvojih najmilijih. Porodica Petrovi}.

dragom

POMEN Dana, 8. avgusta 2012. godine navr{ava se deset godina od smrti na{eg dragog supruga, oca, dede i tasta

Miodrag - Miwa Mari}

57976

Posledwi pozdrav bratu i ujaku

POMEN

subota4.avgust2012.

Kumovi: Tijana, Goga i Brane.

57900

Posledwi pozdrav dragom kumu

Uvek si u na{im mislima i srcu. Tvoja porodica: supruga Biserka, k}erka Sowa, unuka Natalija i zet Goran.

57988

Posledwi pozdrav dragom kumu

SE]AWE

GODI[WI POMEN

Zora Asurxi}

Miodrag Mari} Miwa

4. 8. 2002 - 2012.

Tomislava Ranki}a

U ti{ini ve~nog sna neka te prati na{a qubav ja~a od zaborava.

Kad je qubav besmrtna - `ivot je ve~an. Smrt je samo horizont koji nije ni{ta osim granice na{eg pogleda.

Porodice: Asurxi}, Svir~evi} i Milovanovi}.

Volimo te, tvoji: Oki, Milan i Smiqka.

57837

57843

57789

POMEN

POMEN

25

Na{em dragom tati i suprugu

2005 - 2012.

Miloradu Doki}u

Borka Topi} 5. 8. 2011 - 5. 8. 2012.

Jovi Milosavqevi}u

Nikoli Stevi}u

od sestre Dragice sa porodicama Crni} i Jelovac.

od porodice Mara{.

57986

57985

Nikoli Stevi}u

od porodice Mili}evi}.

Wena deca, zet, snaha, unuke, unuci i praunuci.

3

IN MEMORIAM

57968

TROGODI[WI POMEN

Pro{lo je dvanaest godina i pro}i }e jo{ mnogo, ali samo mi koji te najvi{e volimo, znamo kako je te{ko `iveti bez tebe. Tvoji: sinovi Jovan i Zoran i supruga Milena.

57852

57738

SE]AWE

57861

3 JEDNOGODI[WI POMEN Mire}i se sa voqom Gospodwom i ~uvaju}i uspomenu, pro{la je godina od kada nije sa nama na{ dragi suprug, otac, deda i tast

Aleksandar Milanovi}

Nada Kolano

6. 8. 1999 - 6. 8. 2012.

Draga na{a, pro{le su tri godine od kako nisi sa nama.

1937 - 2009.

Trinaest tu`nih godina nije sa nama na{ dragi suprug i tata.

1934 - 2011.

Porodica.

Godine prolaze, tuga i bol zauvek ostaju.

JEDNOGODI[WI POMEN na{em dragom

Qubinku Mitrov~anu

Danas, 4. 8. 2012. godine, u 11 ~asova, iza}i }emo na ^enejsko grobqe da obele`imo godi{wi pomen na{e drage majke.

3. 8. 2000 - 3. 8. 2012.

Marinko Sari} Mi}a

odr`a}emo 4. 8. 2012. godine, na Gradskom grobqu u Novom Sadu.

^uvaju uspomenu wegovi: Mila i Kristijan.

Porodica Mitrov~an.

Miksat Josip 4. 8. 2007 - 4. 8. 2012.

Pomen }e se odr`ati u nedequ, u 10 ~asova, na Gradskom grobqu u Novom Sadu.

Tvoji najmiliji: supruga Marija, }erka @u`ana i unuk Neboj{a.

Suprug Drago, sinovi Zoran i Du{an sa porodicama

57949

57948

57819

57718

[ESTOMESE^NI POMEN Danas, 4. 8. 2012. godine navr{ava se {est meseci od kako nije sa nama na{ voqeni suprug, otac, deda i tast

Tu`nim srcem javqamo da je zaspala u snu ve~nim snom na{a draga i voqena

^ETRDESETODNEVNI POMEN na{em dragom ocu i suprugu

^ E TR NAE S TOG OD I[ WI POM E N

Radoslav Pavi}evi} Mi{a Supruga Vukica i k}erke Zagorka i Darinka sa porodicama. 57841

3 Dana, 8. avgusta 2012. godine navr{ava se godina dana od bolnog rastanka sa mojim voqenim i jedinim bratom

Katarina Kova~i} 1938 - 2012.

O`alo{}ena porodica.

Posle obavqene kremacije, pohrana urne }e se obaviti 4. 8. 2012. godine, u 11 ~asova, na Uspenskom grobqu. Ve~no o`alo{}eni: sin Slobodan, snaja Dana, unuke Tina i Maja, zaova Danica sa sinom Stevanom.

57919

57980

Du{an Ogrizovi} Toga dana, u 11.30 ~asova, na ^enejskom grobqu, poseti}emo wegovu ve~nu ku}u, obele`iti pomen i osve{tati spomenik.

Zdravku Miji}u Sad na{ `ivot nema ime, jer jako boli {to te nema vi{e sa nama. ]erka Marija, supruga Jasna s porodicama Miji} i Inovan.

Radomir Gavrilov iz Turije S po{tovawem i zahvalno{}u, supruga Dragica i porodica Crveni.

57639

JEDNOGODI[WI POMEN

Obave{tavamo rodbinu i prijateqe da 4. 8. 2012. godine dajemo jednogodi{wi pomen na{em dragom sinu, suprugu, ocu, bratu i dedi

Godina pro|e, a bol i tuga za na{om voqenom }erkom i sestrom ne prestaje

57932

57842

POMEN

Marica Fin~ur

O`alo{}ena porodica.

Dragi moj Mi{o, neprebolna rano i tugo moja, `ive}e{ ve~no u srcu Tvoje sestre Zage.

57716

POMEN

Milovanu Savi}u

Radoslavom Pavi}evi}em Mi{om

U nedequ, 5. 8. 2012. godine, u 10 sati, na Gradskom grobqu poseti}emo wenu ve~nu ku}u, zaliti je suzama i okititi je cve}em. Majka Darinka i brat Ivan. 57740

dragim roditeqima

Dragan Jovi~i}

Zorka Jovi~i}

1933 - 2010.

1936 - 2011.

S qubavqu i po{tovawem ~uvamo vas od zaborava. Sin Milan, snaha Vera, unuci Boris i Sr|an. 57855


26

07.00 08.00 08.05 08.20 08.45 09.10 09.30 10.00 10.35 11.00 11.30 12.00 12.10 12.35 13.00 14.00 15.00 15.05 16.20 16.45 17.00 17.25 17.55 19.10 19.30 20.05 21.00 21.30 22.00 22.40 22.55 00.20 01.10

Кухињица Вести Летозасве Новосадскодечијелето Уличаролије ФЛУОШ,луткарскепредставе задецу Лулу Хајдесамномуобданиште Питамсе, питамсе Путевинаде Агромозаик Вести Падамнапамет-фестивал науке Увекмедаља Здрављепресвега Варошарије Вестизаособесаоштећеним слухом Петказање Свеоживотињама Потрошачкирепортер ТВДневник Политбиро Садевојкомкаоти,филм 1.део Како....? ТВДневник Серијанедеље: ФранкРива: Последњиодтројице Ноћнасмена Фаца:Најбољи Војвођанскидневник Олимпијскахроника Филмскапремијера:Анђела, филм Серијанедеље: ФранкРива: Последњиодтројице Садевојкомкаоти,филм 1.део

Ри Расмусен

Анђела Улоге: Жамел Дебуз, Ри Расмусен, Жилбер Мелки, Серж Ријабукин, Мишел Шесно, Оливије Клавери, Соланж Мило Режија:Лук Бесон (РТВ 1, 22.55)

06.20 09.00 10.00 11.30 12.00 12.30 12.40 13.05 14.15 15.00 15.25 16.05 16.30 17.00 17.45 18.00 18.15 18.30 18.45 19.00 19.25 19.30 20.00 21.00 21.30 22.00 22.30 23.11 00.00

tv program

subota4.avgust2012.

ТВбаштине Кухињица–мађ Добровече, Војводино(слов) СеоскецрквеуВојводини-Банат ТВбаштине Вести(мађ) Чијијетосалаш: Бабинсалаш, емисијанамађар..сатитл.на српском Музичкипрограм Биографије Новосадскодечијелето ФЛУОШ,луткарскепредставе задецу Хајдесамномуобданиште Питамсе, питамсе Трећедоба ТВДневник(хрв) ТВДневник(слов) ТВДневник(рус) ТВДневник(рум) ТВДневник(ром) ТВДневник(мађ) Спортскевести(мађ) Кухињица–мађ. Добровече, Војводино(мађ) Културнимагазин(мађ)(Јеленлет) Светкојинестаје(мађ) Изнашеархиве(мађ) Музичкипрограм Концертсимфонијскогоркестра АкадемијеуметностиуНовом Саду ТВПродаја

07.30 08.30 09.00 09.30 11.00 13.00 14.00 15.30 16.00 17.00 17.30 18.00 20.00 20.30 22.00 22.30 23.00 00.00

ГласАмерике ЕТВ Будиродитељ Филм:КоњмалеВинки Перископ/Осаа Безцензуре ПисмаизХерцегНовог Војвођанскевести Здрављејелек Књижевнимагазин Војвођанскевести Вишеодоткоса Војвођанскевести Ћаскање Војвођанскевести Баропметар Филм:Фојловрат ГласАмерике

РУКОМЕТ:ЛОИ 2012

Кореја–Србија (РТС 1, 12.10) ВАТЕРПОЛО:ЛОИ 2012

Србија–САД (РТС 1, 20.35)

ОДБОЈКА:ЛОИ2012 (м)

Србија–Бразил (РТС 1, 22.55)

06.30Серијскипрограм 09.15Времејенамојојстрани 09.35РецептиЛауреРавајоли 10.00Аврикаодврхадодна 10.30Азбукародитељства 11.00 Серијскипрограм 12.00Ленија 13.00Вести 13.05Евонаскодвас 14.00Вести 14.05Серијскипрограм 14.30Белимантил 15.00Салетла 15.30Витраж 16.00Вести 16.05Личностиидогађаји 17.00Вести 17.05Зовеморе 18.30СремскиКарловци,одсуботе досуботе 19.00Објектив 19.30Времејенамојојстрани 20.00Свештожелим 21.00Личностиидогађаји 22.00Објектив 22.35Личнагрешка 23.00Серијскипрограм

06.05 Јутарњипрограм 08.00 Јутарњидневник 09.06 Жикинашареница 11.00 Вест Програмзависиодпреносаскупштинеипреносадогађајаса Олимпијскиигара 11.00 Вести 11.55 Гастрономад 12.10 Рукомет:ЛОИ 2012:Кореја Србија, пренос 13.45 Дневник 14.00 Спортплус 14.15 Ексклузивно:Ближеистини (МерлинМонро) 15.02 ТВ лица:СнежанаСавичић Секулић...каосавнормалан свет 15.53 Срећниљуди 16.52 ГоспођицаМарпл,филм 18.31 Квадратуракруга 19.01 Слагалица 19.30 Дневник 20.00 Шестикруг 20.35 Ватерполо:ЛОИ 2012:Србија -САД,пренос 21.40 Шестикруг 21.50 Срећниљуди 22.55 Одбојка:ЛОИ2012 (м):Србија -Бразил, пренос 00.35 ХичкокнаРТС,филм 02.30 Ексклузивно:Ближеистини (МерлинМонро)

dnevnik

06.02 Летњеолимпијскеигре2012 09.55 Врелегуме 10.00 СедницаНароднескупштине РепубликеСрбије програмзависиодпреносаскупштине 10.25 Летњеолимпијскеигре2012најавапрограма 10.30 Летњеолимпијскеигре2012, пренос 11.00 Атлетика, пренос 13.00 Тенис,синглидубл, финала, пренос 13.45 Стрељаштво, пренос 14.45 Веслање,четверацбезкормилара,снимак 15.30 Кошарка:САД-,пренос 16.45 Триатлон (ж), финале, снимак 17.00 Стрељаштво, снимак 17.30 Коњичкиспорт,скокови, снимак 18.00 Фудбал,четвртфинале, пренос 19.50 Атлетика, пренос 23.05 Пливање,финала, снимак 00.35 Ватерполо-ЛОИ2012:Србија -САД(р) 01.40 Одбојка(М)-ЛОИ2012:Србија-Бразил(р) 03.00 Летњеолимпијскеигре2012

Андреа Арсовић

ЛОИ2012:

Стрељаштво (РТС 2, 13.45)

06.30Маратон 08.00ЗдрављеиВи 08.30Филм:Идемодаље 10.30Топшоп 11.00 Филм:Пејзажиумагли 13.00ЗдрављеиВи 13.30Сваштарица 14.00Уловитрофеј 14.30Биљаназавас 15.30Сликеживота 16.00Обичниљуди 17.00Минисерија 18.30Сликеживота 19.00Уловитрофеј 19.30Мајсторски 20.00Мућкеспецијал 21.00Филм:Шампионислободе 23.00Филм:Опседнути 01.00Еротскасерија

06.00 07.30 09.00 09.15 09.45 10.00 11.15 11.30 11.55 12.20 12.45

Лесли Истербрук

Полицијска академија5 Ласардибившиполазници АкадемијепутујууМајамина посебнусвечаностнакојојће Ласард бити проглашен полицајцемгодине.Крадљивац драгуљапоименуМенипрокријумчариојеукамериукраденидијамант. Улоге:Буба Смит, Дејвид Граф, Мајкл Винслоу, Марион Ремзи, Лесли Истербрук, Џенет Џонс Режија:Алан Мајерсон (Б92, 21.55) 06.35 08.05 09.00 09.30 10.45 11.00 11.35 13.00 14.30 16.00 16.35 18.50 19.30 21.55 23.40 00.15 00.35 02.10 03.40 05.00

ИнспекторВаландер Добраземља Топшоп Цртанифилмови Шљака ВестиБ92 Пријатељи Каослучајно Интернат Вести Филм:ПовратакБетмена Вести Филм:ХариПотеризатвореникизАскабана Филм:Полицијскаакадемија 5:МисијаМајамиБич ВестиБ92 Спортскипреглед Филм:Дубина,1.део Филм:Дубина,2.део Филм:Лудизакоњима УкључењеуБ92Инфо

СЕРИЈА 09.45 КошаркаАдекокуп:Хрватска -Србија 11.30 Рускалига:ЦСКА-Зенит 13.45 Шкотскалига:Селтик-Аберден 15.45 Светфудбала 16.15 ЦХТВ:Челси–Милан 18.00 КошаркаАдекокуп:СрбијаБоснаиХерцеговина 20.00 Светфудбала 20.45 КошаркаАдекокуп:Словенија-Хрватска 22.30 Атлетика 23.00 Белгијскалига:АндерлехтБиршот 01.00 АТПВашингтон½Финале

Зрнопозрно У најновијем издању емисијесазнаћетекакојепротеклапроизводњамедаовегодине, а посетићемо и друштво пољопривредних произвођача „Царска башта“. И ове недеље добићете неопходне савете за одржавање њива из Пољопривредне стручнеслужбе. (КТВ, 12.00)

Вупи Голдберг

ДуховиМисисипија Драма заснована на истинитојпричииз1960-теприказуједогађајекојисууследили наконубистваборцазаљудскаправаМедгераЕверса. Улоге: Алек Болдвин, Вупи Голдберг, Џејмс Вудс, Вирџинија Медсен Режија:Роб Рајнер (Прва, 21.50) 05.30 06.00 07.30 09.00 12.30 15.00 16.00 18.00 19.00 19.15 20.20 21.50 00.00

Европулс Дођинавечеру Домаћин Филм:ВајатЕрп Езел Изгубљеначаст Филм:Свитилепикоњи Сами у тами Вести Изгубљеначаст Езел Филм:ДуховиМисисипија Трачара

Белоодело Војни заставник Саво ТиодоровићслужбујеуЦрнојГори где дане проводи патролирајућибицикломкрозмирну шуму у маскирној одећи. Када од брата близанца добијетелеграмдаимјемајка умрла, потресени Саво укрцава се на први воз и креће насахрану. Улоге: Лазар Ристовски, Радмила Шогољева, Драган Николић, Бата Живојиновић, Данило-Бата Стојковић, Богдан Диклић, Бојана Маљевић Режија:Лазар Ристовски (Хепи, 19.10)

Лазар Ристовски

Обични људи Урбана прича која прати животе три сестре и њихових родитеља глумаца. Улоге: Аљоша Вучковић, Лела Маргитић, Ванеса Радман, Ана Мајхенић, Хелена Минић, Тамара Гарбајс-Шинтић, Ксенија Пајић Режија: Бранко Иванда и Роман Мајетић (Авала, 16.00)

13.40 14.00 14.10 15.30 16.45 17.00 17.55 18.25 19.10 21.00 22.30 00.00 02.00 03.30 04.30

Јутарњипрограм Знањенапоклон Шаренивилењаци Залившкољки Телешоп Острводиносауруса,анимиранифилм Мојиџепниљубимци ГенераторРекс Гормити Побунадиносауруса Сироваприрода,документарнипрограм Телешоп Вести Летњиковац Вести –сечаемисије Телешоп Јелена Телемастер МојаСрбија Белоодело,филм Голиживот Детективскипар5,филм Агенција Голиживот МојаСрбија Јелена

07.00 10.00 12.00 13.00 14.00 15.30 17.00 18.00 19.30 20.00 21.00 23.00 00.00 01.45 03.30 05.00

Добројутро Викендвизија Немогућа мисија Живот у тренду Голд музички магазин Филм: Маратонцитрчепочасникруг Мала невеста Магазин ин Национални дневник Нове курсаџије Звезде гранда Академијадебелих-преглед дана Филм: Другарчине Филм: Директнаакција Филм: Бабарога Филм

Radio Novi Sad

Ксенија Пајић

05.00 Филмски програм, 07.00 Уз кафу, 07.15 Под сјајем звезда,09.00Жива ватра,10.00Шоу -Парови,12.00Зрно по зрно,13.30У међувремену,14.00Топ 10,15.00Пипи шоу,17.00Суботом поподне,20.00Филмски програм,22.00Ретроспектива недеље,23.00Фешн стори,01.00Суботом поподне,04.00Освета

08.45 Ски Јахорина, 09.15 Кућни видео, 09.30 Фокус, 12.40 Бање Србије, 13.00 На здравље, 13.30Кућни видео,13.45Топ шоп,16.00НС Индекс,16.25Фокус,17.05Ски Јахорина,17.40Инфо Пулс,20.00Фокус,20.45 Инфо Пулс,21.20Филм,23.00Бање Србије,23.30Фокус,00.00Инфо Пулс, 00.30Туристичке разгледнице,00.40Ауто шоп,00.45Фокус,01.15Ски Јахорина,01.45Музика

08.00 Дечији програм, 09.00 Играмо се, 10.00 Кућица у цвећу,11.00Филм,13.00Филм,15.00 Филм,16.30Бибер,17.00АБС шоу,18.00У нашем атару,18.30Бибер,19.00Кад порастем бићу...,20.00Прес пресек,21.00 Филм,22.30Бибер,23.15Филм,00.15Бибер,00.30Ноћни програм

12.00 Кухињица,13.00 Џубокс, 14.00 Документарни програм, 15.00 Доктор Ху, 15.45 Паор, 16.45 Филм, 18.30 Сремарт, 19.30 Цртани филм, 20.00 Доктор Ху, 21.00 Пут вина, 21.30 ЕТВ, 22.00 Филм, 00.00 Шоу програм: Парови,00.50Глас Америке

PRO­GRAM­NA­SRP­SKOM­JE­ZI­KU:­ UKT­87.7,­99.3,­99.6MHz­i­SR­1269­KHz­(00,00-24,00) PRO­GRAM­NA­MA­\AR­SKOM­JE­ZI­KU:­ UKT­90.5,­92.5­i­100.3­MHz­(00,00-24,00) PRO­GRAM­NA­OSTA­LIM­JE­ZI­CI­MA­-­ SLO­VA^­KOM,­RU­MUN­SKOM,­ RU­SIN­SKOM,­ROM­SKOM,­BU­WE­VA^­KOM­I­MA­KE­DON­SKOM­JE­ZI­KU­ UKT­100­i­107,1­MHz­(00,00-24,00) 07.00 Библијске приче, 07.30 Прслук агеин, 09.30Дечија серија,10.05Икс арт,11.20Удица, 12.00Акценти,12.30Испод поклопца,14.00Акценти,14.10Пун гас,15.00Презент,16.00Акценти,16.30Откос,18.00Акценти, 18.15 Писмо глава, 20.00 Филм Инфо, 20.30 Везе, 21.00 Токови моћи, 21.30Изазови истине,22.00Сајам Инфо нет,22.30Акценти дана,23.00Филм 08.00 Храна и вино, 09.00 Господин муфљуз, 09.30Опстанак,10.00Филм,11.30Храна и вино,12.00Пут вина,13.00Квиз,14.30Макс Кју , 15.00 Филм, 17.00 Агросфера, 18.00 Везе, 18.45 Ноди, 19.00 Мозаик дана, 19.30Храна и вино,20.00Панорама општине Житиште,20.30Филм,2.део, 22.00Мозаик дана,22.30Служба 21,23.00Филм


dnevnik

subota4.avgust2012.

IZBOR IZ SATELITSKOG PROGRAMA

FEQTON

9

27

ЈОВАНЈОЦАЛАЛОШЕВИЋ– ОДНАЦИОНАЛИСТЕДОАУТОНОМИСТЕ

Пише: др СашаМарковић 09.55 10.50 11.45 12.40 13.35 14.30 15.25 16.20 17.15 18.10 19.05 20.00 20.55 21.50 22.45 23.40 00.40 01.40

Девојчицеидијадеме ПакленаКели Обрачунпосластичара Стручњакзаторте Штанетребаобући Лудавожња Богатамлада,сиромашна млада ШминкањесаКлио Кејтиосмородеце Најбољиамеричкикувар Нованадапосластичара Соулфудпородица Краљицаслаткиша Необичансекс Животусветунаградних игара Л.А.Инк Соулфудпородица Краљицаслаткиша

08.00 Разбијачи шифара 09.00 Рим није изграђен за један дан 10.00 На трагу плавом дијаманту 11.00 Лондонска болница 13.00 Деца Стаљинграда 13.30 Историја америчких индијанаца:Пут плача 15.00 Инуитска одисеја:Освајање Новог света 16.00 Рим није изграђен за један дан 17.00 Средњи век 18.00 Проблем са Толстојем 19.30 Трамбо 21.00 Пројекат Мендела 22.00 Један дан у борби 23.00 Разбијачи шифара 00.00 Хероји,култ и кухиња 01.00 Мао –кинеска прича

08.00 09.30 10.30 12.00 14.00 16.00 18.00 20.00 22.00 00.00 01.00

Ловциназмајеве ОзиБу КапетанСтрахота Црвенапрашина Леденипотрес Тангоаргентино Наполеонија ЈединствениЛиланд Мојагодинабезсекса Еротскифилм Еротскифилм

Мојагодина безсекса Натали и Рос покушавају да остану у добростојећем предграђуМелбурнасадвоје деце: дванаестогодишњим сином и седмогодишњом ћерком. Њихови животи се драстично мењају када се једног дана Натали онесвести током рутинског медицинског прегледа: у питању је анеуризма, због које мора даиденаоперацију... Улоге:ПоршаБредли,ЏонатанСегат,СашаХорлер Режија:СараВат (Синеманија,22.00)

06.00 07.00 09.00 11.00 12.00 14.00 18.00 19.00 20.00 21.00 23.30 01.30

ЏулијаСтајлс

Плешимозаједно Сара живи с мајком. Плешебалетипредњомјепријемнииспитнанајугледнијем плесномстудијуЏулијард.На путу према тамо њена мајка погине у саобраћајној несрећи и Сарин цео живот се одједноммења.Морадасеодселикод оцаи прелазиунову школу... Улоге:ЏулијаСтајлс,Шон Патрик Томас, Кери Вашингтон Режија:ТомасКартер (ХРТ1,21.06) 08.00 Кинотека-циклускласичног вестерна.РиоКончос,филм 10.09 Кућниљубимци 10.45 Народнамедицинадок. серија 11.17 Нормаланживот 12.00 Дневник 12.28 Моћсудбине 13.11 Екумена 13.44 Призма 14.26 ВинегарХил,филм 16.04 Природнисвет,док.серија 17.06 Евромагазин 17.37 Репортери 18.26 Шлепзарасутетерете,док. филм 19.30 Дневник 20.10 Аушвиц-Нацистии„коначно решење”,док.серија 21.06 Плешимозаједно,филм 23.10 Дневник3 23.47 Дарјеелингд.о.о.,филм 01.18 Филмскимаратон:Сиви камионцрвенебоје,филм

07.00 07.43 08.13 08.43 09.00 10.20 10.40 12.15 13.30 14.25 15.00 17.05 18.50 19.10

19.55 23.00 23.30 00.18 00.51 01.56

ПоршаБредли

06.00 Малапродавницаужаса 07.35 Животкаотакав 09.30 Легендаопијанистина океану 11.35 Титеф 13.05 Ондин 14.50 Матурско 16.35 Девојканалошемгласу 18.05 Краљевговор 20.05 Водазаслонове 22.05 Експеримент 23.40 Самодругарски 01.30 Резервнииграчи 03.15 Кликнизаневиност

Моћсудбине Мајсторисвирачи МалаТВ Спортскеигремладих ОИЛондон2012.:Рукомет (Ж):Хрватска-ЦрнаГора, снимак ОИЛондон2012.:Енглески доручак,емисија ОИ:Лондон2012.:Рукомет (Ж):Данска-Норвешка, снимак ОИ:Лондон2012.:Ватерполо: Хрватска-Аустралија,пренос ОИ:Лондон2012.:Веслањефинале,снимак ОИ:Лондон2012.:Триатлон (Ж),снимак ОИ:Лондон2012.:Тенисфинале(Ж)илипарови(М), пренос ОИ:Лондон2012.:Рукомет (М):Хрватска-Данска, пренос ОИ:Лондон2012.:Времеза чај,емисија ОИ:Лондон2012.:Тенисфинале(Ж)завршетак, снимакиликошарка(М):САД -Литва,2.полувреме ОИ:Лондон2012.:Атлетикафинала,пренос ОИ:Лондон2012.:Пливањефинала,снимак Олимпијскимеридијани Битангеипринцезе БорисПапандопуло Ноћнимузичкипрограм

07.30 09.00 10.30 12.00 14.00 15.30 17.00 19.00 20.00 22.00 00.00

Окрутнажеља Шевинапесма Љубавнапесма Неколикодобрихљуди Пространојеморе Допросјачкогштапа Крсташ Биографија-РаселКроу 10000црнацапоименуЏорџ Багзи Светилиште-Премароману НореРобертс 01.30 Градбезневинихдуша

06.00 08.00 10.00 12.00 14.00 16.00 18.00 20.00 22.00 00.00

Мизери Нел Сенкеимагла Журба ЕниХол Запослениљуди Опчињенамесецом Пирана2:Мрестилиште Друмскакафана Еротскифилм

Дијагнозаубиство УбиствауМидсамеру Видовњак Дијагнозаубиство Краљевскиболесници Монк Закониред Браћаисестре Хаваји5-0 Дивљиусрцу Морељубави Трупа

07.10ПопПикси 08.30Бен10:Ултимејтеејлијен 09.10Колумбо 10.55ПороциМајамија 13.10Моли,филм 15.05 Господариратник:Друга странасвета,филм 17.30Преживетидивљину-Иза камере(2.део),док.серија 18.30РТЛДанас 19.10Галилео 20.00НемогућиДеjв,филм 21.40Плашљивидетектив,филм 23.15 Идемоузатвор 00.55Астрошоу 01.55РТЛДанас 02.30 Дискавери

НемогућиДејв СвемирскибродуликучовекаслетинаЛиберти острво у ватреног кугли. У њему се налази посада мајушних људи,којамахнитопокушавада координира са Дејвовим покретимаиговором... Улоге: ЕдиМарфи,ЕлизабетБенкс,ГабријелЈунион, СкотКан Режија: БрајанРобинс (РТЛ,20.00)

ЕлизабетБенкс

10.00 13.40 14.35 15.30 16.25 16.55 17.20 18.15 19.10 20.05 21.00 21.55 22.50 23.45 00.40 01.40

Прљави послови Врхунско градитељство Деконструкција Велике селидбе Како се прави? Како се то прави Кризне ситуације Борна кола браће Хау Како се прави? Дајнамо,чудесни мађионичар Чари путовања Преживљавање Преживљавање удвоје Тренуци ужаса Дајнамо,чудесни мађионичар Чари путовања

06.00 08.30 09.30 11.00 14.40 14.45 15.30 17.00 19.40 19.45 20.30 21.30 23.00 23.30 01.00 01.45

Олимпијске игре Атлетика Мултиспортови Атлетика Олимпијске игре Мултиспортови Скокови Бициклизам Олимпијске игре Мултиспортови Пливање Атлетика Олимпијске игре Одбојка Дизање тегова Пливање

Критикеиодбрана

И

зостала реакција српског становништва на трудиодаупрограмскомодређењуитаистадржапрограмску опредељеност странке, која је, ва прихвати своје обавезе на очувању културне безобзиранаконгломератмисли,ипакса- аутономије народности, која је подразумевала и чињена,билајепоследицане„утопизма”или„не- очување културе, обичаја и језика. Лалошевић је реалности” и социјално-класне диференцијације тврдио дајезаконскиилегислативноинструментанајбројнијегдела српскогстановиштвавећ,пона- лизованпуткојиомогућујеочување‘’народногиншеммишљењу,последицанемогућостиапсорпци- тегритета’’немађарскихнародаиамортизујеулогу је и прихват ања идеја друштвеног конфликт а уследнедовољногислабо као метода политичке организованог образовног борбе која је водила ка развоја становништва. антагонизму или подреУтолико пре је програмђености, асуштинскииде ско опредељење странке против народних интерезаочувањеобразовногсиса и у корист појединачстема на народном језику них политикантских поијачањекултурнеиобрагодности. зовне делатности била Странка је намеравала фундаменталана поставка дасвојрадусредсредина програмастранке.Отудје критику политичких пои прихватање социјалних тезаРадикалнестранкеи идејабило преекспресија да придобије српско стахуманизма, а не само соновништво за свој процијалног учења које је у грам.‘’Покретзаоснивакаснијим интерпретацијањеновеполитичкестранма било наводно засновакемеђунама,овостраним но на класној опредељеСрбима у Угарској... се ности интелектуа лаца и може сматрати и реакцињиховој социјално-екојом против скроз и скроз номској мисли. Бројни су неродољубиве и јалове интелектуалци ове демополитке данашњих српкратскеструјекојисуприских радикала... Прошло хват али идеју социјалне јевремезаваравањуизаравноправности. вођењу народном. ДемаМеђуњиманајзначајнигошкимзвучнимфразама јијебиоВасаСтајић,али Демократа и уредник „Слоге”:Васа Стајић данас се више не може њихов„социјализам”није војеватиниборити’’. био класне и револуционарне провенијенције већ Радикална странка је одговорила својим противодговор антрополошки опредељеног и просвети- критикама, називајући новоформирану странку тељски-романтичарскоодгајаногинтелектуалцана ‘’мађаронском,несрпскоминародноснимтежњама материјалносиромаштоунамеридасеонопрева- противном’’. Најжешћа критика била је усмерена зиђе.ВасаСтајић,једаноднајзначајнијихсрпских управопремаономделупрограмаСрпскедемократинтелектуалацауВојводини, уововреме,почевод скестранкекојије,најзначајнијимделом, приредио 1907. године постао је и професор у Учитељској Лалошевић,иакосууказалинатодајеионбиопрошколи у Сомбору, и укључио се активно у осми- тивначинаприпремезаорганизовањестранке. шљавањудемократскихидејасдубокимослонцем Уследио је и Лалошевићев одговор на критике. наулогуобразовања.Онјепостаоиједанодуред- ОнјесматраодајенајпрепотребнодасрпскинаникаСлоге исарађиваојеинтензивноуорганиза- родприхватиистинуистварностпотпунедоминацији часописа и писању ције мађарскогнародапучланака сведо1910.годитемдржавнихинституциНајзначајнијиудеоЛалошевићеву не. ја и законске регулативе. формулисањунацртапрограма Рад  странке, у органиТој доминацији, по Лалостранкебиојеувезиспроблемом зационом смислу, никада шевићу,билојепотребно нијезаживео,алијеидеја одупрети се не сировим мађаризацијеиприкладним оњенојпотребиопстајала ниподаштавањем и конметодомодбранеодтогпроцеса све до 1914. године, па и трапродуктивним иритикасније.Свесниорганизарањем‘’јернеосопорнаје ционихтешкоћа,покретачи страначкоггенерисања истинадајесвакојуспешнојборби,патакоистои иводећикреаторипрограмастранкесматралисуда политичкој,неизоставнопотребниуслов:непрецеје карактерстранкетребало употпунити иуподоби- нитисвојуснагуинеомаловажаватипротивникотиспрограмомирадомСрпскенароднесамостал- ву’’, већ је требало постојећу законску регулативу не странке, о чему је децидирано и писало у про- прихватити у одбрани ‘’народносног начела’’. ТуграмуСрпскедемократскестранке.‘’Српскадемо- мачење‘’народносногначела’’заЛалошевићаније кратска странка усваја општа начела автономног билоограничавајућифакторуразвојусрпскихнапрограма Српске Народне Самосталне Странке и ционалних идеја у Угарској већ афирмативни поприматајпрограмзаосновурадаусврхуконачног јам, који је у постојећем ригидном угарском закоуређења српске народне црквене аутономије’’. нодавствуотвараопутзаборбузаочувањенацио- Странка се у програмском нацрту залагала за од- налногидентитета,културе,језикаиобичаја. бранудемократскихначеласлободеговора,штамТимејеЛалошевићоправдаваотајвидметодолопе,збораиудруживања,затимзаекономскуипо- шкогприступаполитичкојборбикаојединипутделитичкуслободубезобзиранавероисповестина- мократскеиодговорнеодбранесрпстваумонархиродну припадност, а као своју ‘’најглавнију ду- ји.‘’Штосеутрећојтачципризнаје,непризнајесе жност’’ сматрала је ‘’да друштвеним путем свим изнекепретеранесимпатијеиљубавипремаМађасиламапорадинаморалном,културномипривре- рима,непризнајесезатодабисетимедодворило меномпрепорођајународа’’. иулагивалоМађарима,негосепризнајепростоиз НајзначајнијиудеоЛалошевићевуформулисању тогузрокаштојетоистина...Упрограмузатајатии нацртапрограмастранкебиојеувезиспроблемом непризнатиснагупротивничку,можебитигодисумађаризације и прикладним методом одбране од јетинародној,алијесвакакопогрешка,којазнатно тог процеса. Уважавајући државу, Лалошевић се утиченапотоњинеуспехполитичкеборбе’’.

СтудијудрСашеМарковића „ПОЛИТИЧКАБИОГРАФИЈАЈОВАНА–ЈОЦЕЛАЛОШЕВИЋА” објавиојеПедагошкифакултетуСомборуНовосадскогуниверзитeта Prvi broj Slobodne Vojvodine" {tampan je kao organ Pokrajinskog narodnooslobodila~kog odbora za Vojvodinu " 15. novembra 1942. u ilegalnoj {tampariji u Novom Sadu. Od 1. januara 1953. Slobodna Vojvodina" izlazi pod imenom Dnevnik”. " " Prvi urednik - narodni heroj SVETOZAR MARKOVI] TOZA pogubqen od okupatora 9. februara 1943. Izdava~ „Dnevnik Vojvodina pres d.o.o.”, 21000 Novi Sad, Bulevar oslobo|ewa 81. Telefaks redakcije 021/423-761. Elektronska po{ta re­dak­ci­ja@dnev­nik.rs, Internet: www.dnevnik.rs. Glavni i odgovorni urednik Aleksandar \ivuqskij (480-6813). Generalni direktor Du{an Vlaovi} (480-6802). Ure|uje redakcijski kolegijum: Nada Vujovi} (zamenik glavnog i odgovornog urednika, unutra{wa politika 480-6858), Miroslav Staji} (pomo}nik glavnog i odgovornog urednika, nedeqni broj 480-6888), Dejan Uro{evi} (ekonomija 480-6859), Petar Tomi} (desk, no}ni urednik 480-6819), Vlada @ivkovi} (novosadska hronika, 421-674, faks 6621-831), Nina Popov-Briza (kultura 480-6881), Svetlana Markovi} (vojvo|anska hronika 480-6837), Vesna Savi} (svet 480-6885), \or|e Pisarev (dru{tvo 480-6815), Mi{ko Lazovi} (reporta`e i feqton 480-6857), Branislav Puno{evac (sport 480-6830), Jovan Radosavqevi} (Internet slu`ba 480-6883), Ivana Vujanov (revijalna izdawa 480-6822), Filip Baki} (foto 480-6884), Branko Vu~ini} (tehni~ka priprema 480-6897, 525-862), Nedeqka Klincov (tehni~ki urednici 480-6820), Zlatko Ambri{ak (Slu`ba prodaje 480-6850), Svetozar Karanovi} (Oglasni sektor 480-68-68), Filip Gligorovi} (Sektor informatike 480-6808), Mali oglasi 021/480-68-40. Besplatni mali oglasi za Oglasne novine 021/472-60-60. Rukopisi i fotografije se ne vra}aju. Cena primerka 30 dinara, subotom i nedeqom 35 dinara. Mese~na pretplata za na{u zemqu 940, za tri meseca 2.820, za {est meseci 5.640 dinara (+ptt tro{kovi). [tampa „Forum” Novi Sad @iro ra~uni: AIK banka 105-31196-46; Rajfajzen banka 265201031000329276

Dnevnik" je odlikovan Ordenom bratstva i jedinstva sa zlatnim vencem " i Ordenom rada sa zlatnim vencem


28

monitor

subota4.avgust2012.

dnevnik

Horoskop OVAN 21.3-19.4.

Овог викенда се можете опустити у потпуности јер ништа паметније и ништа више нећете остварити под оваквим звазданим небом. На лич ном пла ну су вам потреб не промене.

BIK 20.4-20.5.

Имате добре односе с пријатељима па се дружите без великих очекивања. Пословна и финансијска ситуација вам отвара могућности напретка и зараде. Контакти с успешнима.

BLIZANCI 21.5- 21.6.

RAK 22.6-22.7.

LAV 23.7-22.8.

DEVICA 23.8- 22.9.

4. avgust 2012.

Умете да одушевите особе у свом окру же њу, парт не ра, дру штво, али и да уредите и дотерате, улепшавате простор у којем сте. Шопинг вам савршено прија. Провод.

Месец је у воденом знаку Риба па сте емотивни и рањиви, склони романтици и уметности, љубави с драгом особом. Цео викенд је благодет удвоје. Путовање и пливање.

Уколи ко се опусти те у свом простору, на свом имању, дворишту, негде поред реке, воде, на мору, с друштвом које вас анимира, викенд ће протећи брже него обично.

Промене у партнеровом понашању вам иду наруку јер можете наметнути своје планове и жеље за обоје. Викенд проведите на романтичан и пијатан начин, у љубави.

Nena Radaшin, astrolog nena.r@eunet.rs VAGA 23.9- 23.10.

[KORPION 24.10- 23.11.

STRELAC 24.11- 21.12.

JARAC 22.12-20.1.

Ваш Марс дубоко цени Сатурна, верујући му на дуге стазе, што у преводу значи да се и ви можете ослонити на особу од искуства и шарма. Више се одмарајте.

Упућени сте на партнера, на друге особе, и то ће тако да потраје читаве године. У тој ситуацији, важне су вам поруке које примате и такозвана упутства за употребу.

Краће путовање или одлазак на море ће вам донети све оно што очекујете, чак и више од тога. Мириси и таласи, одсјај Месеца на пу чи ни, под звезда ним небом...

VODOLIJA 21.1-19.2.

RIBE 20.2-20.3.

Лето пржи, али и ви на свој начин идете ди рект но ка ци љу, пу ни енергије. Страст и мудрост би требало да се усагласе, а реалност и машта такође. Иностранство вас призива.

Трошите новац за себе и друге, делећи симпатије и саосећања, заједничка искуства, интересовања, тако да ћете испунити своју душу. Великодушни сте и пожртвовани.

Кроз ваш знак током викенда плови Месец па сте изузетно емотивно осетљиви и пријемчиви. Дозволи те себи да иде а ли зу јете партнера и околности, али будите свесни тога.

TRI^-TRA^

Проговорили вампири V REMENSKA

PROGNOZA

Сунчано

Vojvodina Novi Sad

35

Subotica

34

Sombor

36

Kikinda

36

Vrbas

35

B. Palanka

35

Zreњanin

35

S. Mitrovica 36 Ruma

35

Panчevo

35

Vrшac

35

Srbija Beograd

36

Kragujevac

37

K. Mitrovica 34 Niш

37

Сага,невампирскавећпрељубничка, се наставља. Након што се Кристен Стјуарт јавноизвиниласвомдечкуРоберту Патинсону јергајепревариласа режисером филма „Снежана и ловац” ПитеромСандерсом,Патинсонјепрекинуосвакиконтактсањом.Онјетугу лечио на имању своје колегинице Риз Витерспун и није желео да се јавно оглашава. ЗатовремеКристенјебезуспешнопокушаваладагавидииличује,алиРобертјујеигнорисао,сведојуче. Наиме, извори блиски глумици потврдилисудајепарразговараотелефоном,„штојепрвикораккаизглађивању односа”,тврдеони. Раздор у њиховој вези потресао је и армију њихових фанова из серијала о вампирима„Правакрв”,којинемогуда разумејукакојеБеламогладапревари Едварда,анекиодњихсујако беснина глумицу.

Evropa

и тоПло

НОВИ САД: Сунчано и веома топло. Ветар слаб променљивог правца. Притисак око нормале. Минимална температура 21, а максимална 35 степени. ВОЈВОДИНА: Сунчано и још топлије. Ветар слаб променљивог правца. Притисак око нормале. Минимална температура 18, а максимална 36 степени. СРБИЈА: Сунчано и велика врућина. После подне ће на планинама на југозападу Србије доћи до развоја облака, али остаје углавном суво. Ветар слаб променљивог правца. Притисак око нормале. Температура од 14 до 37 степени. ПрогнозазаСрбијуунареднимданима: У недељу и почетком идуће седмице сунчано уз велике врућине и температуре близу 40 степени у недељу, а у понедељак и уторак преко 40. У уторак у централној и јужној Србији понегде до 44. У уторак увече на северу Србије локални пљускови и освежење, а у среду и на југу мања врућина, али температура неће бити испод 30 степени.

БИОметеОРОлОшкА пРОгНОзА зА СРБИЈу: Срчани болесници и особе са лабилним нервним системом могу осећати тегобе услед неповољне биометеоролошке ситуације. Могуће су несаница и главобоља. Опрез у саобраћају!

Madrid

35

Rim

31

London

22

Cirih

24

Berlin

27

Beч

29

Varшava

29

Kijev

33

Moskva

29

Oslo

20

St. Peterburg 24 Atina

36

Pariz

24

Minhen

25

Budimpeшta

33

Stokholm

23

VIC DANA - Чујем да си се оженио. Шта ти ради жена? - Ради као ликвидатор на личним дохоцима. - Где? - Код куће. Сваког 15. у месецу ликвидира мој лични доходак.

SUDOKU

Upiшite jedan broj od 1 do 9 u prazna poљa. Svaki horizontalni i vertikalni red i blok od po 9 praznih poљa (3h3) mora da sadrжi sve brojeve od 1 do 9, koji se ne smeju ponavљati.

VODOSTAњE DUNAV

TAMI[

Bezdan

201 (-15)

Slankamen

266 (-5)

Jaшa Tomiћ

Apatin

294 (-14)

Zemun

294 (0)

Bogojevo

288 (-10)

Panчevo

306 (0)

Smederevo

474 (0)

Baч. Palanka 288 (-10) Novi Sad

260 (-8)

Tendencija opadawa

SAVA

N. Kneжevac

194 (-1)

S. Mitrovica

39 (-15)

Tendencija stagnacije

Senta

265 (-2)

Beograd

238 (0)

STARI BEGEJ

Novi Beчej

344 (0)

Tendencija opadawa

Titel

248 (-6)

NERA

Hetin

92 (6)

TISA

-45 (7)

Tendencija stagnacije

Tendencija stagnacije i opadawa

Kusiћ

42 (-4)

Reшeњe iz proшlog broja

Dnevnik 4.avgust 2012.  

Elektronsko izdanje novosadskog dnevnog lista "Dnevnik"

Read more
Read more
Similar to
Popular now
Just for you