Page 1

c m y

NOVISAD*

SUBOTA2.JUN2012.GODINE

GODINALXX BROJ23453 CENA35DINARA * 0,50 EUR

Internet: www.dnevnik.rs * e-po{ta: redakcija@dnevnik.rs

„ D N E V N I K S A Z N A J E ” : VLADAUSVOJILANOVEUREDBEZAPODSTICAJEUSTO^ARSTVU

Dr`avadaje500 dinarapotovqeniku str. 6

MIROSLAVUVESKOVI]UIDRUGIMANDAT REKTORAUNIVERZITETAUNOVOMSADU

Univerzitet pomeri prostora ivremena

JU^ERA[WI DAN PRIPADAO MATURANTIMA

Vrem  e ves  el  ih ras  tan  ak a st r. 7 i 12

str. 13 U@URBANIDOGOVORILIDERADS IKOALICIJEOKOSPS

Tadi}evkabinet sa17do19 ministara

Foto: M. Miqenovi}

str. 3

STRANKEDOBILENOVACZAKAMPAWUUVOJVODINI

„PASUQIJADA” UTEMERINUJU^EPO^ELA

Gostimadanas 4.000besplatnih porcija

Zaposlanike54,2 milionadinara

str. 3

NASLOVI

Politika 2 Na Kosovu povre|eni troje Srba i dva vojnika KFOR-a

str. 7

Malo sve`ije SPORT

Najvi{a temperatura 24°S

Ekonomija 5 [vercovano gorivo plovi Drinom i Dunavom

str. 16 – 20

Poqoprivreda 6 Izvoz srpskog krompira u kesicama ~ipsa

NoviSad 9 „Neobus” bi pod okriqe GSP-a

Vojvodina 11 Naruybine otvaraju nova radna mesta

Crna n ODBOJKA[ISJAJNO STARTOVALIUJAPANU

n RUKOMETNEREPREZENTATIVKE n IPOREDDVAPORAZA PRVIPUTUNOVOMSADU MIHAJLOVI]ZADOVOQAN

15 Dve godine zatvora za zlostavqawe maloletnice na Andrevqu


2

POLiTikA

subota2.jun2012.

PREDSEDAVAJU]ISKUP[TINOMSRBIJE ZAHARIJETRNAV^EVI]

ZASEDAOSAVETZANACIONALNUBEZBEDNOST

Ugro`enabezbednost naKosovuiMetohiji Savetzanacionalnubezbednost konstatovao je na ju~era{woj sednici da je ozbiqno ugro`ena bezbednost gra|ana

Kosova i Metohije. Savet je pozvao Unmik, Kfor i Euleks dauokvirusvogmandataspre~e sve poku{aje privremenih

vlasti u Pri{tini usmerene ka izazivawu nestabilnosti i gra|anedasesuzdr`eodsukoba sa pripadnicima me|unarodnihmisija. „Savet za nacionalnu bezbednostpozvaojeme|unarodne misije Unmik, Kfor i Euelks dauokvirusvogmandataspre~e sve poku{aje privremenih vlasti u Pri{tini usmerene ka izazivawu nestabilnosti i strahame|usrpskimstanovni{tvomiuzdr`eseodprimene sile prema neza{ti}enim gra|anima pokrajine”, pi{e u saop{tewu izdatom nakon vanredne sednice tog saveta odr`ane povodom jutro{wih incidenatanaseveruKosova. Savetzanacionalnubezbednostapelovaojenagra|aneda

seuzdr`eodsukobasapripadnicimame|unarodnihmisijai time doprinesu smirivawu situacije. NaKosovuiMetohiji,kako sedodajeusaop{tewu,sviproblemi moraju biti re{avani dijalogom, bez nasiqa i to je jedini put ka stabilnosti ~itavogregiona. Sednici Saveta za nacio- nalnu bezbednost predsedavao jepredsednikSrbijeTomislav Nikoli}, a prisustvovali su premijer Mirko Cvetkovi}, ministri odbrane, unutra{wih poslova, pravde, na~elnik General{taba Vojske Srbije,direktorBezbednosnoinformativne agencije i {efovi Vojno-bezbednosne agencije iVojneobave{tajneagencije.

INCIDENTINASEVERUKOSOVA

Povre|enitrojeSrba idvavojnikaKfora Troje Srba i dvojica pripadnikaKforapovre|enisuuju~era{woj akciji uklawawa barikadakodmestaRudarenaseveru KosovaiMetohije.Te`epovre|ena osoba zadobila je prostrelnuranuupredelunatkolenice. Kforjesaop{tiodasudvojicavojnikarawenahicimaizvatrenognaoru`awa,jerje„nasilna masa napala pripadnike Kfora”. TokomsukobakodRudara~ula se rafalna paqba, kori{}eni sugumenimeciibojevamunicija, a Kfor je bacao i suzavac. Ekipehitnepomo}isuzbogupotrebe suzavca me{tanima pru`alepomo}nalicumesta. Situacija kod Rudara se popodne smirila, ali napetost je ostala. Me|unarodni vojnici i daqenedozvoqavajubilokakvo kretawe gra|anima, a ~itavo podru~je nadle}u helikopteri Kfora. Kforjeuju~era{wojakciji ukloniosvebarikadeuop{tini Zve~an,ukqu~uju}iionubetonskukodmestaDudinKr{. Srbisunapravilinovubarikadu od {qunka ispred vojnika

Kfora u Rudaru, ali su pripadnici Kfora i wu uklonili.Na barikadi se nalazilo nekoliko desetina Srba, ali oni nisu

pru`aliotpor.Kforjepriveo nekolikoSrbatokomuklawawa barikada u op{tini Zve~an. Potpukovnik Kfora, ameri~ki oficirXozefLin~, rekaojeju~eprepodneda}evojnicipucatiuokupqeneSrbeukolikooni kamewem ga|aju pripadnike Kforailiakougledajuvatreno

oru`jeumasi,reklisupredsednici op{tina Zve~an i Zubin Potok gra|anima kod barikade uRudaru.

Pripadnici Kfora razgovaralisusaokupqenimSrbimao uklawawu barikade i neometanom prolasku do punkta u Jariwu. Sa predstavnicima Kfora razgovarali su i predstavnici Srba.Predsednikop{tineZve~anDragi{aMilovi} preneoje pripadnicima Kfora da je pro-

blemtrebalodabudere{enrazgovorima. „Spremni smo na nove razgovore.Rekaosamimdajebiloboqedasmorazgovaraliidanima nego {to su akcijom uru{ili te{ko ste~eno poverewe”, rekao je Milovi} i dodao da je predstavnicimaKforarekaoda nijednabarikadanijevrednagubitkabilokog`ivota,kaoida akcije koje sprovode vojnici te misijeuru{avajupoverewegra|anapremamisiji. Dragi{a Milovi} je pozvao na smirivawe tenzija na severu KosovaioceniodabibilodobrodapredstavniciSrbarazgovoraju sa predsednikom Srbije Tomislavom Nikoli}em. Predsednik op{tine Kosovska Mitrovica Krstimir Panti} rekao je da su vojnici Kfora su bez ikakvog upozorewa i bez ikakvograzlogapo~elidapucajunanarod.MinistarzaKosovo i Metohiju Goran Bogdanovi} pozvaojeKfordaseuzdr`iod primene sile i da se striktno pridr`ava i kre}e u okvirima svog mandata, a Srbe da ostanu mirniidanenasedajunaprovokacije.

REAGOVAWA

EUzabrinuta Evropskaunijaje„jakozabrinuta”zbogteku}esituacijenaseveruKosovagdejedo{lodonasiqaipozivasvestranenauzdr`anost isaradwusame|unarodnimorganizacijama,izjavilajedanasuBriseluportparolkauEvropskojkomisijiMajaKocijan~i~. Dodaju}idajere~ooperacijikojuvodiKfor,Kocijan~i~jenaglasiladajezaEU„slobodakretawajednoodtemeqnihna~ela{to jebioipredmetdijalogaBeograd-Pri{tina”. MajaKocijan~i~jenaveladaBriselpratirazvojsituacijeida jeuvezispartnerimauNATOkaouvekutakvimprilikama.„Mi pozivamosvedaseuzdr`eidasara|ujusme|unarodnimorganizacijamanaKosovu”,dodalaje.

Srbiho}ekodpredsednika Predsednikop{tineZve~anDragi{aMilovi}ka`edanakonincidenata,predstavniciSrbasaseveraKIMho}edarazgovorajus predsednikomTomislavomNikoli}em.Milovi},kojijeuZve~anu na blokiranom mostu ka selu Rudare, gde je bila barikada koju je Kfor jutros uklonio, rekao je agenciji Beta da su qudi ogor~eni akcijomKforaiupotrebomsileutojakciji. „Vremejedasenaroduka`eistina,danasprimipredsednikSrbijeTomislavNikoli}idasenaroduka`eistina,{tajepregovaranouBriselu,dasenarodnedr`iugetu,`ici,izolaciji„, rekao jeMilovi}.”Nemo`emosvedaihdr`imopodkontrolom.Uvekimatepojedincekojinemogusvetodaizdr`e,pasepla{imodanedo|edonovihincidenata„, kazaojeon.

Jovanovi}:Neophodannovi konceptpolitike PredsednikLiberalnodemokratskepartije^edomirJovanovi} izjavio je ju~e da je situacija na severu Kosova krajwe ozbiqna i ukazaodajeneophodannovikonceptpolitikeprematojpokrajini, koji}ebitiracionalnijiiokrenutijikonkretnim`ivotnimproblemima.”Onmo`edabudenapravqenimismospremnidaowemu javnorazgovaramo,bezkalkulisawaivrlootvoreno,izme|uostalogiuprocesuformirawanovevlade,nezavisnoodtogako}ebi-

dnevnik

tivlast,akoopozicija.Tojeodgovornostnaspoliti~arauSrbiji,zato{tocenuna{ihodnosailizabludanemoguvi{edapla}ajuqudikojinaKosovu`ive”,istakaojeJovanovi}uizjavidostavqenojTanjugu.

DS:Apelzamir Demokratskastrankaizrazilajezabrinutostzbogincidenatana Kosovu i Metohiji i apelovala na sve strane na hitno smirivawe situacije.„Izuzetnojeva`nodasenasiqeisukobi{topreprekinu, da se situacija normalizuje i uspostavi mir, kako bi se kroz dijalogre{iliproblemi”,ka`eseusaop{tewu.Nagla{avaseda seprobleminaKosovuiMetohijinesmejure{avatisukobima,ve} iskqu~ivo dijalogom, a za to je neophodna stabilnost i jedinstvo kako bi se za{titili svi gra|ani Srbije na Kosovu i Metohiji i o~uvalilegitimniinteresiSrbije.

DSS:Tra`itisednicuSB Beograd na akciju Kfora na severu Kosova, u kojoj je tokom uklawawa barikada bilo povre|enih, ne sme reagovati samo saop{tewem ve} mora zatra`iti sednicu Saveta bezbednosti UN, ocewenojeju~euDemokratskojstranciSrbije. „Krajwe je vreme da vlasti Srbije reaguju na pravi na~in. Nije dovoqno saop{tewe da se optu`i akcija Kfora ve} se mora upotrebitija~e,presvegadiplomatskosredstvoitra`itisednicu Saveta bezbednosti sa ~iwenicama i utvr|ivawem pravog stawa stvari kada je odnos Kfora prema srpskom narodu u pitawu”, izjaviojefunkcionerD[SlobodanSamarxi}.

SRS:Poslativojsku naKosovo Srpska radikalna stranka pozvala je ju~e predsednika Srbije TomislavaNikoli}a da,uskladusasvojimustavnimovla{}ewima vrhovnog komandanta oru`anih snaga, izda nare|ewe vojsci da za{titi Srbe na Kosovu od napada NATO i EU. „U suprotnom, Nikoli}}ebitisau~esnikunasiqunadSrbimanaKosovu”,ocenilajeusaop{tewuSRS.

Nastavak konstitutivne sednice11.juna Predsedavaju}i Skup{tinom Srbije do izbora novog predsednika Zaharije Trnav~evi} najavio je ju~e da }e konstitutivna sednica parlamenta verovatno bitinastavqenauponedeqak,11. junakadabitrebalodabuduizabraniipredsednikipotpredsednicinajvi{egzakonodavnogtela.

Srbijepodnosinajmawe30narodnih poslanika predsedavaju}em u pisanom obliku. Predsedavaju}i potom dostavqa poslanicima sve primqene predloge kandidata za predsednika Narodne skup{tine, o predlozima se otvara pretres, nakon ~ega predsedavaju}i utvr|uje listu kandidata za predsed-

Trnav~evi}jeTanjugurekaoda }etadaverovatnobitiizabrani generalnisekretariobrazovani skup{tinskiodbori.„Tojeverovatan termin i tom prilikom }e biti izabran predsednik, potpredsedniciisekretar”,rekaoje Trnav~evi}. Napitawedalitozna~idaje dogovoroparlamentarnojve}ini navidiku,Trnav~evi}jerekaoda otomenemainformacije,alida je to dinamika za koju o~ekuje da }ebitipo{tovana. Konstitutivna sednica parlamenta po~ela je ju~e potvr|ivawem mandata narodnim poslanicimanakon~egajeprekinuta.Trnav~evi}(„Preokret”)kaonajstarijiposlanikpredsedavatomsednicom. Doskora{wa predsednica parlamentaSlavica\uki}Dejanovi} ju~e je rekla da o~ekuje da }eparlamentarnave}inabitipoznata po~etkom juna, a da }e se o kandidatima za predsednika Skup{tine Srbije razgovarati slede}esedmice. PremaPoslovnikuoradurepubli~kogparlamenta,predlogkandidatazapredsednikaSkup{tine

nikaparlamentapoazbu~nomreduprezimena.Prepristupawaizboru predsednika skup{tina odlu~uje da li }e se glasati tajno ili javno, a ukoliko parlament odlu~idaseglasajavno,glasase prozivkom. Ukoliko do|e do tajnogglasawawimerukovodipredsedavaju}i na sednici Narodne skup{tine,akandidatzapredsednikaskup{tinenemo`edarukovodi,nitidapoma`eurukovo|ewu glasawem.Poslanik mo`e da glasasamozajednogkandidataza predsednika,aizabranjeonajkojidobijeglasoveve}inaodukupnogbrojaposlanika. Akosupredlo`enadvakandidata, a nijedan nije dobio potrebnu ve}inu, postupak izbora seponavqa.Ukolikojepakpredlo`eno vi{e kandidata, a nijedan nije dobio potrebnu ve}inu, ponovi}eseglasaweodvakandidata koji su dobili najve}i broj glasova, odnosno izme|u vi{e kandidatakojisudobilinajve}i jednaki broj glasova, a ako ni u drugom krugu predsednik skup{tinenijeizabran,postupakizboraseponavqa.

TVIT CRTICA Kojezamenio „Pravdu“

„Par”Tadi}– Nikoli}

Nakon{tojesaop{tenoda vi{e ne izlazi dnevni list „Pravda“ socijalista Boris Mili}evi} naveo je svoje vi|ewecelesituacije. - Napredwaci ugasili „Pravdu” sad kad su dobili RTS-konstatovao je Mili}evi}nalajni.

Analiti~ar, saradnik NSPMNikolaTanasi} podvla~i:ParTadi}–Nikoli} je oli~ewe }orsokaka u kome se nalazi srpska politika. Milsim da je prirodno da zato podele i politi~ku odgovornost,smatraTanasi}. AliderPSSBogoqubKari} poru~uje:„Sramotajene ustati kada se rukuje{ sa Predsednikom,~akiakogane ceni{ kao ~oveka mora{ da ceni{ funkciju da ceni{ Ustavisvojuzemqu“.

Zaharijei LujDavi~o FunkcionerURSSimoVukovi} imao je „poruku“ za p r e d s e d a v a j u } e g , najstarijeg poslanika Zaharija Trvanv~evi}a. - Vi|ena tri poslanika koja nisu pevala „Bo`e pravde”. Zaharije, odma to da najuri{-  „savetuje“Vukovi}. A direktor Beogradske filharmonije Ivan Tasovac zakqu~uj: Sve }e biti boqe kadaposlanicinau~edapevajuhimnu,aFSSpotpi{eugovor o poslovno-tehni~koj saradwi sa baletskom {kolom „LujoDavi~o”. - Po va`e}em poslovniku, poslanicikojidanasnisupevali himnu, ne}e mo}i da podignudnevnicezaGu~uali}e dobitikompletkaratazaEgzit-na{alioseTasovac.

Lisicaikoko{ LDP-ovac Drago Kova~evi} smatra da se „SPS mora politi~ki skloniti bar iz dvesfere“. -OkoKosovaiokokorupcije.Lisicanemo`e~uvatikoko{i-upozoravaKova~evi}.

Mnogobrojni  Kari}i koji su aktivni na lajni, bili su ponosni{tosudva~lanawihoveporodicepostaliposlanici i oka~ili su sliku Milanke iDragomiraKari}a ispred zdawa Doma Narodne skup{tine.

Zvi`daweSNS Nasuprot zadovoqstvu Kari}a,imaionihkojejedruga~ija slika sa~ekala kada su napu{taliparlament. Funkcioner SVM Balint Pastor jeobavestiosvojefanove: „Kada sam izlazio iz skup{tine oko 1.000 napredwaka mi je zvi`dalo i skandiralo: uaaaa,Pastore!“ S.St.


c m y

politika

dnevnik

Egere{i: Dogovor posle progla{ewa rezultata pokrajinskih izbora Predsednik Skup{tine Vojvodine [andor Egere{i odredi}e datum odr`avawa prve sednice novog saziva pokrajinskog parlamenta ~im budu progla{eni kona~ni izborni rezultati {to bi moglo da se dogodi krajem slede}e sedmice, re~eno je ju~e Tanjugu wegovom kabinetu. Kada u ~etiri izborne jedinice u pokrajini sutra bude odr`ano ponovqeno glasawe za izbor poslanika po ve}inskom sistemu Pokrajinska izborna komisija }e, posle isteka roka za prigovore, proglasiti kona~ne rezultate izbora za Skup{tinu Vojvodine. „Po{to od PIK-a dobi-

je kona~ne i zvani~ne izborne rezultate Egere{i }e, u skladu sa odgovaraju}im propisima, u roku od tri dana, zakazati datum odr`avawa konstitutivne sednice”, rekla je {ef wegovog kabineta ^ilaKantor. Ona je podsetila da prva sednica novog skup{tinskog saziva mora da bude odr`ana najkasnije 30 dana od dana progla{ewa kona~nih rezultata pokrajinskih izbora. Na prvoj sednici pokrajinske skup{tine bi}e potvr|eni poslani~ki mandati i izabrani predsednik, potpredsednici i sekretar Skup{tine Vojvodine.

U@URBANIDOGOVORILIDERADSIKOALICIJEOKOSPS

Tadi}ev kabinet sa 17 do 19 ministara U toku su intenzivne konsultacije DS i koalicije SPSPUPS-JS oko stvarawa vladaju}e ve}ine, s kojom bi BorisTadi} kao kandidat demokrata za mandatara za sastav nove Vlade, u ponedeqak iza{ao pred predsednika Srbije Tomislava Nikoli}a. Konsultacije vode ~elnici stranaka Boris Tadi}, Ivica Da~i}, Jovan Krkobabi} i Dragan Markovi} Palma. Kako je “Dnevniku” predo~eno u vrhu vladaju}e koalicije, ako svi dogovori i sa “tre}im partnerom” budu usper{no zavr{eni i formirana ve}ina u Skup{tini Srbije, nova Vlada, s Tadi}em kao premijerom, imala bi 17 do 19 ministarstava. - To su okvirni dogovori. Tek kada bude bio izvestan tre}i partner u vlasti zna}e se sve.Tada }e se pristupiti i podeli funkcija, a tu mislim i na mesto predsednika Skup{tine Srbije. Socijalisti su prethodno izrazili `equ da zadr`e ovu dr`avnu funkciju za sebe, a pomiwana su dva potpredsednika SPS, predsednica parlamenta u prethodnom sazivu Slavica\u-

ki}-Dejanovi}i aktuelni ministar obrazovawa @arko Obradovi}-obja{wava na{ izvor. Kako saznajemo razgovori oko raspodela funkcija prolongirani su i zbog tre}eg partnera, jer “i on treba ne{to da dobije”, a demokrate su se odlu~ile da to

Bajatovi} o~ekuje vi{e mesta u vladi Potpredsednik Socijalisti~ke partije Srbije Du{anBajatovi} izjavio je da vlada treba da bude formirana {to pre i da o~ekuje pove}ano u~e{}e kadrova te stranke i ve}i broj ministarstava, shodno rezultatu koji je SPS postigla na izborima. Bajatovi} smatra da budu}a vlada mo`e biti ne{to ve}a ili mawa, ali da mora biti stabilna da bi mogla da odgovori na otvorena socijalna, ekonomska i nacionalna pitawa. „I gra|ani i stru~na javnost zahtevaju da se vlada formira {to pre. I ja je i{~ekujem. Nije to samo zbog naglog skoka evra u posledwe vreme ve} zato {to nam privreda ve} {est meseci stoji, a socijalni zahtevi rastu”, kazao je Bajatovi} u intervjuu „Blicu”. Na pitawe ko je bli`i vladi - LDP ili URS, on je kazao da „to treba da bude tim koji mo`e unutar sebe da funkcioni{e sa {to mawe unutra{weg ucewivawa”.

bude LDP, odnosno koalicija “Preokret” koju predvodi ova stranka. “Mini koalicija”, po tvrdwi na{eg izvora iz vrha vlasti, imala je zamerke na politiku i stavove stranke ^edomira Jovanovi}a vezano za Kosovo i Metohiju i Republiku Srpsku.

- Zbog toga razgovor s Jovanovi}em treba da obavi Tadi}, da bi se na{ao na~in za promenu tih stavova, mogu}nost usagla{avawa, i onda donela kona~na odluka. ^im je Jovanovi} spreman da u|e u vlast, spreman je onda i na poteze koji tra`i ulazak u wu- obja{wava na{ izvor, uz opasku da je i lider LDP shvatio da spoqne poslove ne mo`e dobiti kao resor koji je planirao, te je stoga iza{ao sa stavom o potrebi da ih obavqa profesionalac za tu oblast. Da li }e u kombinatorikama, koje su u toku, LDP dobiti resor evropskih integracija ostaje da se vidi. Po na{im saznawima lider LDP je ostao pri stavu u razgovorima da potpredsedni~ko mesto bude vezano za evropske integracije. Nezvani~no saznajemo da je ju~e u Beogradu bio i predsednik RS MiloradDodik, a kako je “Dnevnik” raznije pisao i wegov stav, kao i SPC, }e done kle “obo ji ti” for mi ra we vladaju}e ve}ine, dakle i bude}e vlasti. D.Milivojevi}

Kora}: Sve zavisi od SPS-a Poslanik u Skup{tini Srbije i predsednik Socijaldemokratske unije @arkoKora}izjavio je ju~e da je trenutno glavni problem u formirawu vlade Srbije unutar koalicije izme|u SPS, PUPS i JS, jer }e budu}a vlada morati da donese nepopularne mere i da razmi{qa o zamrzavawu penzija i plata. Kora} je, gostuju}i na TV Pink, rekao da to ko~i formirawe vlade, dok je, sa druge strane, zemqa u lo{oj ekonomskoj situaciji zbog ~ega }e vlada morati da ima sveobuhvatni program ekonomskih reformi. Prema wegovim re~ima, mora}e da se postigne najpre dogovor u koaliciji izme|u SPS, PUPS i JS, dok u

SPS traje i rasprava o tome ko }e od socijalista biti novi predsednik Skup{tine Srbije. „Tako imamo dva problema koji }e oni re{iti i to ko~i u stvari formirawe vlade, jer ona treba da se formira ve} do ponedeqka, utorka”, rekao je Kora}.On je rekao da pretpostavqa da }e u vladi biti koalicija u kojoj }e pored DS i SPS, biti i LDP, odnosno „Preokret”. „Mogu}e je da bude i vlada ~etiri stranke, ali kako se meni ~ini trenutno bi}e vlada tri stranke”, rekao je Kora} i dodao da je ekonomska situacija u zemqi te{ka zbog buxetskog deficita, stagnacije ekonomske proizvodwe i nedostatka investicija.

REKLI SU Jerkov: Strana~ki jezik

Omerovi}: Ko je Zahariju pisao govor

^otri}: Otkriti nalogodavce nasiqa

Poslanica Llige socijaldemokrata Vojvodine AleksandaraJerkov izjavila su da je govor predednika Srbije TomislavaNikoli}a u parlamentu bio strana~ki. Ona je za RTS, objasnila da poslanici LSV nisu prisustvovali sednici na kojoj je Nikoli} polo`io zakletvu jer ta stranka smatra da on prvo pred gra|anima mora da se ogradi od ranije politike, odrekne „titule ~etni~kog vojvode” i pru`i odgovore o izbornoj kra|i i o svom obrazovawu.”Sara|iva}emo sa wim kao poslanici sa predsednikom i nismo perkr{ili nijedan zakon ili pravilo time {to nismo do{li. Zaista ne smatramo da je svetli trenutak u kome Nikoli} postaje predsednik i to smo na ovaj na~in pokazali”, navela je ona. Aleksandra Jerkov je ocenila da se Nikoli} pona{ao kao neko ko dr`i strana~ki govor.

Funkcioner Socijaldemokratske partije Srbije Meho Omerovi} kritikovao je predsedavaju}eg Skup{tine Srbije Zaharija Trnav~evi}a zbog toga {to je na sve~anoj sednici polagawa zakletve Predsednika Republike, pre niza visokih funkcionera, pozdravio wegovo kraqevsko viso~anstvo prestolonaslednika AleksandraKara|or|evi}a. „Taj koji mu je pisao govor ili ne zna Ustav po kojem je Srbija Republika ili je to namerno ura|eno”, naveo je Omerovi} u pisanoj izjavi dostavqenoj Tanjugu.U oba slu~aja, smatra Omerovi}, predsedavaju}i mora snostiti odgovornost, jer li~ni odnos i po{tovawe prema potomku nekada{we monarhije ne sme biti deo zvani~nog protokola najvi{eg organa vlasti u Republici Srbiji. Trnav~evi} predsedava Skup{tinom Srbije kao najstariji poslanik.

Potpredsednik SPO Aleksandar ^otri} podsetio je ju~e da je ova stranka pre 19. godina organizovala u Beogradu mirne demonstracije, zbog grubog fizi~kog napada poslanika vladaju}e ve}ine na opozicionog poslanika SPO. „Re`im Slobodana Milo{evi}a uhapsio je 1. juna 1993. godine predsednika SPO VukaDra{kovi}a, wegovu suprugu Danicui vi{e desetina funkcionera i ~lanova stranke. Pripadnici specijalnih jedinica policije brutalno su ih tukli i naneli su im te{ke telesne povrede opasne po `ivot”, podsetio je ^otri}. Tokom demonstracija ispred zgrade parlamenta poginuo je policajac Milorad Nikoli}.Zahtevamo, kao i svih proteklih godina, od policije i tu`ila{tva da otkriju ubice Nikoli}a, nalogodavce i izvr{ioce nasiqa na Vukom i Danicom Dra{kovi}, kao i drugim ~lanovima SPO, rekao je ^otri}.

subota2.jun2012.

3

STRANKEDOBILENOVACZAKAMPAWUUVOJVODINI

Za poslanike 54,2 miliona dinara Strankama je za finansirawe kampawe za pokrajinske izbore ispla}en novac koji im pripada po Zakonu o finansirawu politi~kih aktivnosti i Pravilniku o kori{}ewu i rasporedu tih sredstava koji je ranije usvojila Pokrajinska izborna komisija, re~eno je „Dnevniku” u PIK-u. Pomenutim zakonom predvi|eno je da se za strana~ke tro{kove izborne kampawe izdvoji 0,1 odsto buxetskih rashoda, {to je u slu~aju izbora poslanika Skup{tine Vojvodine 54,2 miliona dinara. Polovina te sume, kako je to propisano Pravilnikom PIK-a, namewena je za pokri}e tro{kova na pokrajinskim izborima po proporcionalnom sistemu, a druga polovina za izbore po ve}inskom modelu. Naime, izborni sistem u Vojvodini je kombinovan, tako da u pokrajinsku skup{tinu s 120 mesta ulazi polovina poslanika izabranih po proporcionalnom sistemu, a polovina po ve}inskom. Po podacima PIK-a, za tro{kove kampawe na izborima po proporcionalnom sistemu, na kojima je u Vojvodini u~estvovalo 14

ukupno oko 4,65 miliona dinara. Ostatak sume ili ukupno 22,45 miliona dinara dobilo je sedam lista koje su osvojile mandate u Skup{tini Vojvodine, srazmerno broju tih mandata. Ovaj deo novca namewen je u~esnicima izbora bez obzira na to da li su polo`ili jemstvo.

Najvi{e novca za tro{kove kampawe dobila je lista „Izbor za boqu Vojvodinu” koju predvodi DS, a kojoj je za 16 osvojenih mandata pripalo skoro {est miliona dinara. Lista oko SNS-a „Pokrenimo Vojvodinu” je za 14 mandata dobila oko 5,2 miliona, a koalicija SPS-PUPS-JS-SDP Srbije za devet mandata - oko 3,37 miliona dinara. Slede LSV s osam mandata i 2,99 miliona, te SRS s pet mandata i 1,87 miliona dinara. Po

Novaczave}ince Na pokrajinskim izborima po ve}inskom modelu, predlaga~i su za prvi krug izbora dobili 33.703 dinara po kandidatu, kojih je bilo ukupno 518 {irom Vojvodine. U drugom krugu sledovalo je 134.250,62 dinara po kandidatu. Najvi{e kandidata imao je savez koji okupqa DS (50) koji je na taj na~in dobio jo{ oko 6,7 miliona dinara. Tako|e, koaliciji oko SNS-a (31 kandidat) ispla}eno je oko 4,2 miliona, savezu SPS-PUPS-JS-SDP Srbije (16 kandidata) oko 2,1 milion, SVM-u (10 kandidata) 1,3 miliona, dok je LSV (osam kandidata) dobio oko 1,1 milion dinara. URSu je na ime dva kandidata pripalo 268,5 hiqada dinara, dok su DSVM, LDP i DSS dobili po 134,2 hiqade dinara, jer su u drugom krugu pokrajinskih izbora po ve}inskom modelu imali po jednog kandidata. izbornih lista, potro{eno je 27,1 milion dinara. Sem dve izborne liste, svi u~esnici najpre su dobili po 387.104 dinara, {to je ukupno 20 odsto zakonske sume koja se u jednakim iznosima izdvaja pre izbora, tj. kada lista bude progla{ena. Liste DSS-a i koalicije mawinskih stranaka „Sve zajedno” nisu polo`ile izborno jemstvo, tako da im taj deo novca nije bio dostupan. Za preostalih 12 lista ispla}eno je

~etiri mandata osvojili su DSS i SVM, kojima je pripalo po skoro 1,5 miliona dinara. Novac }e u buxet morati da vrati Srpska demokratska stranka ~ija lista je osvojila oko 0,6 odsto glasova. Po Zakonu, da bi joj izborno jemstvo bilo vra}eno stranka mora da osvoji najmawe procenat va`e}ih glasova, dok je za stranke mawina propisan prag jemstva od minimum 0,2 odsto. S.Kova~evi}

Smiqani}: Ako mora, ne}u biti poslanik Predsednik op{tine Apatin i funkcioner SPS-a @ivorad Smiqani} izjavio je za Radioteleviziju Vojvodine da }e se, ukolikoAgencija za borbu protiv korupcije zatra`i da zbog kr{ewa odredbi Zakona o sukobu interesa izabere jednu od dve funkcije, odre}i funkcije pokrajinskog poslanika, gde je pobedio u drugom krugu izbora po ve}inskom sistemu. Zbog zakona o sukobu interesa i tuma~ewa Ustavnog suda o nespojivosti javnih funkcija Smiqani} je izrazio spremnost da se opredeli za mesto predsednika op{tine. „Ja ostajem predsednik op{tine jer moram da zavr{im luku koju sam zapo~eo, moram velnes centar i jo{ mnogo toga da uradim za Apatin. A ako ne mo`e, ne}u zadr`ati poslani~ki mandat”, izjavio je Smiqani}. On je istakao da je, kandiduju}i se za poslanika u

Skup{tini Vojvodine po ve}inskom sistemu, samo `eleo da proveri kakav je wegov autoritet kod gra|ana i da je za to dobio potvrdu, pobediv{i u 27 od 29 izbornih jedinica. „Ja se nisam prepucavao sa Agencijom za borbu protiv korupcije oko funkcija, nego nisam mogao da shvatim kakvu to zakonodavnu vlast ima Skup{tina Vojvodine, ako su po Ustavu Srbije nespojive zakonodavna, izvr{na i sudska vlast”, rekao je on. Socijalisti su u Apatinu, ~iju je listu predvodio Smiqani}, na izborima 6. maja osvojili 13 od 29 odborni~kih mandata. Ina~e, Smiqani} je, po Registru funkcionera, i ~lan Upravnog odbora Klini~kog centra Srbije i ~lan Programskog saveta Radio-televizije Vojvodine.

^upi}: Mora ^lan odbora Agencije za borbu protiv korupcije ^edomir^upi} izjavio je da Skup{tina Vojvodine nema punu zakonodavnu vlast, ali da, samim tim {to je predstavni~ki organ, ona ima svoju funkciju i donosi odre|ene odluke, koje proizilaze iz zakona i ustava. ^upi} je naveo i da }e od nove Skup{tine Srbije tra`iti izmenu zakona o Agenciji, kako bi ona, pored nadzorne, kontrolne i preventivne funkcije, dobila i istra`nu funkciju, naspram koje niko ne bi imao imunitet, kako bi ova mogla uspe{no da se bori protiv korupcije, koja je postala veliko zlo u Srbiji, koje sve zaustavqa. „Ja sam za to da sankcije za odbijawe da se opredeli za jednu od funkcija budu mnogo o{trije, od pet do sedam godina zatvora”, rekao je ^upi}.


4

ekonomija

subota2.jun2012.

dnevnik

O[TARPADDOMA]EVAlUTEUPRKOSINTERVENCIJAMANBS

Dinaruozbiqnoj agoniji Dinar je ju~e pretrpeo o{tar pad od 0,6 odsto te }e zvani~ni sredwikurstokomvikendabiti 117,2740 dinara za evro, uprkos tome{tojeNarodnabankaSrbije (NBS)  prodala 60 miliona evra. Centralna banka je od po~etkagodinename|ubankarskom deviznom tr`i{tu prodala milijardu i 181,2 milion evra,ra~unaju}iinbajnovijuintervenciju,kako bi ubla`ila prekomernudnevnuoscilacijukursa.Doma}avaluta jeovegodinebilanajja~a11.januara,kadajejedan evro vredeo 103,6922dinara,aodpo~etka godine dinar je premaevruoslabio10,8 odsto. Dinar u odnosu na evro slabiji 4,6 odsto nego pre mesec dana, a 17,5 odsto nego pre godinudana.Indikativni kursdinarapremadolaru u ~etvrtak je bio 94,6827 i za 0,6 odsto je slabiji u odnosu na prethodnu vrednost. Srpska valuta je prema ameri~koj slabija 10,8 odsto na mese~nom nivou, a 29,2 odsto na godi{wem.  Od po~etka ove godine dinar je prema dolaru oslabio 14,6 odsto, navedenojenasajtuNBS. -Glavnirazlogzaneprekidno slabqewe dinara prema evru su neodr`ivejavnefinansijeSrbije-izjaviojepredsednikFiskalnogsavetaPavlePetrovi}.

Kurs je samo visoka temperatura, iza koje stoje neodr`ive javne finansije, kao „zapaqewe”, objasnio je Petrovi} na konferencijizanovinare.Prema wegovim re~ima, Narodna banka Srbije u takvoj situaciji nemo`esu{tinskipunodau~ini, osim onoga {to i sada radi,

odnosno da interveni{e na deviznom tr`i{tu i vr{i pritisak na {to br`u fiskalnu konsolidaciju Trenutnipritiscinaslabqewe dinara prema evru pokaza}e se privremenim ukoliko nova vladabrzobudeprimenilavaqanemerefiskalnekonsolidacije, izjavio je ju~e viceguverner Narodne banke Srbije Bojan Markovi}. Ako mere fiskalne konsolidacije ne budu brzo sprovedene,

NBS}e,zbogo~uvawacenovnei finansijske stabilnosti, biti prinu|enadareagujeznatnimpove}awem referentne kamatne stope i stope obaveznh rezervi, {to }e pogoditi srpsku privredu,istakaojeMarkovi}. „Takav na~in o~uvawa stabilnosti ima svoj tro{ak i bi}e problem za privredu“, precizirao je viceguverner.Markovi}jenapomenuodaje„centralniscenario“NBSdaje realno brzo o~ekivati dono{ewe validnog programa fiskalne konsolidacijeidausuprotnomcentralnabankanebitakointenzivnointervenisalanadeviznomtr`i{tu. Podsetiv{idasuintervencije od po~etka godinedostigleoko1,2 mijardeevra,onjeistakao da tako intenzivne intervencijeimajusmislasamoakoseo~ekujedasu{okovinakursdinaraprivremenog karaktera. Da ne o~ekujemo da su {okovi privremeni, ne bismo ovako intenzivno intervenisali ve} bismo odmah podigli referentnu kamatnu stopu, rekao je viceguverner napomiwu}i da se weno podizawenisadanemo`eiskqu~itizbogveli~ine{oka,alida }eonobitimnogomawezbogo~ekivawadaje{okprivremen. E.Dn.

Nova Agrobanka zdrava Viceguverner Narodne banke Srbije Bojan Markovi} izjavio je ju~e  da je „Nova Agrobanka“ formiranana„zdravojkapitalizaciji“idaseo~ekujeda}edobro funkcionisati, kao dobro kapitalizovanaiproduktivnabanka. „Nova Agrobanka”, ~iji je jedini vlasnik Agencija za osigurawe depozita, odnosno dr`ava, osnovana je radi prenosa svih obaveza i dela potra`ivawa „Agrobanke”natubanku,auciqu obezbe|ewa kontinuiteta u sprovo|ewu poslovnih aktivnosti„Agrobanke”iza{titeinteresa svih wenih deponenata i drugihpoverilacaupotpunosti. Na taj na~in dr`ava je, kao najve}ii pojedina~ni akcionar „Agrobanke”, obezbedila sigurnost svih depozita ukqu~uju}i ukupnu {tedwu gra|ana, kao i sredstva ostalih poverilaca u punomiznosu,{tojeodposebnog zna~aja za gra|ane i privredu, ali i za o~uvawe finansijske stabilnosti,saop{tilajeranije NBS.

RA^UNZANOVIMOSTBI]EPOZNATZADESETAKDANA

Be{kujo{razvla~e od70do100 milionaevra Zbog rekonstrukcije starog mosta preko Dunava kod Be{ke saobra}ajnaautoputuNoviSad-Beograd odvija se u  oba smera  preko novoizgra|enogmosta.Tako}ebiti svedonovembra,dokadajeplaniranodaseradovizavr{e.Rekonstrukcija starog mosta dodeqena je na tenderu austrijskoj firmi „Alpina”,  istovremeno kada i izgradwa novogmosta,a„Mostogradwa”radi kaopodizvo|a~.Premare~imaministrazainfrastrukturuMilutina Mrkowi}a, vrednost radova  je izme|u~etiriipetmilionaevra, a novac je obezbe|en iz kredita Evropskeinvesticionebanke. A koliko je ko{tala izgradwa novog mosta preko Dunava kod Be{ke, jo{ uvek se ne zna. Kako smo ju~e~uliuJP„PuteviSrbije”,cena }e biti poznata tek za desetak dana, shodno potpisanom memorandumuizme|uinvestitoraiizvo|a~aradovaumartuovegodine,kada serazgovaraloorijentacionoo65 milionaevrakaopolaznojosnoviu ra~unu. Da podsetimo, most je  zavr{en jo{ po~etkom oktobra pro{le godine,kadajeobe}anokako}esecenaizgradweobelodanitinajpredo kraja oktobra 2011, pa do kraja te

godine,zatimodmahposleNovegodine... Najpre se kalkulisalo kako „Alpina”tra`ivi{eod100milionaevra,pajespustilana90miliona, kako su JP „Putevi Srbije” spremnidaplate55miliona,zatim jeministarMrkowi}izjavioda}e

ka`u kada se u toku projektovawa radipredra~un,toleri{eseodstupawedo10odsto,anagotovprojekat prihvatqivo je odstupawe od triodstougovorenevrednosti.Naravno, to je praksa ako je projekat dobroura|en.

Posledwafaza SavetnikzamostoveuMinistarstvuzainfrastrukturuDejanKova~evi}ka`edajerekonstrukcijastarogmostazapo~etajo{prenekolikogodina,aovojeposledwafaza.Zbogobimnihradovamostje moraodasezatvorizasaobra}aj.Rekonstrukcijaobuhvatakolovoznu traku  i izgradwu pe{a~ke staze, popravku stubova i le`i{ta iz pravcaBeograd.Dabisesaniraokolovoz,di`esekompletnakolovoznatrasa,montirajusenovepe{a~keplo~e,ogradaihidroizolacija. Dosadajemostsanirannadowemdelu,posebnonastubovima.Osim starogmostaprekoDunavauplanujeirekonstrukcijuprilaznihsaobra}ajnicaimostaprekokanalaArkawudu`iniodoko150metara. mostko{tatiizme|u70i80milionaevra,jersuradovibiliobimnijiodo~ekivawa-ugovorenacenaje iznosila33,7milionaevra.Aonda supri~eoceniutihnule. Za razliku u ceni okrivqen je takozvani„`utifidik,me|unarodnistandardkojipredvi|adaseizvo|a~upoveriposaonaosnovuidejnog projekta i da on posle izradi glavniprojekatimost.Stru~waci

Neophodnojedasere{iipitawekrivice{tojeodugovarawaizgradwemostadowegovogzavr{etka pro{lo ~ak pet godina i  da li su rokoviopravdanoprekora~eni.Kako se na tenderu u paketu dodelio posaoizaizgradwunovogirekonstrukcijupostoje}egmosta,tozna~i da su i pre po~etka ove rekonstrukcijeprobijenirokoviizasanacijustareBe{ke. R.Dautovi}

ISTRA@IVAWEAGENCIJEZAPRIVREDNEREGISTRE

Javnapreduze}asposobna davra}ajudugove Skoro dve tre}ine javnih preduze}auSrbijijesposobnodablagovremenoizmirujesvojefinansijske obaveze,pokazalajeanalizaobonitetnojsposobnostiprivrednihdru{tavauSrbijikojujeuradilaAgencija za privredne registre (APR). Zarazlikuodjavnihpreduze}a,samo 36 odsto akcionarskih dru{tava je sposobnodanavremeizmirujesvoje finansijskeobaveze,izjavilajeju~e registrator za finansijske izve{tajeibonitetRu`icaStamenkovi} nakonferencijizanovinare. Prema wenim re~ima najboqu bonitetnost ostvarila su sredwa preduze}a,jerje71odstoovihdru{tavasposobnodaizmirujefinansijskeobaveze.

Nova ocena bonitetne sposobnosti privrednog dru{tva (skoring)ura|enajenaosnovupodataka iz finansijskih izve{taja za periodod2007.do2011.godineito

za 91.748 prrivrednih dru{tava, istaklajeStamenkovi}. USrbijiposluje793preduze}a kojasudobilaocenuA{topredstavqa najvi{u ocenu bonitetne

sposobnosti,istaklajeStamenkovi} i navela da me|u ovim privrednim dru{tvima 278 posluje u oblasti trgovine, 239 u oblasti prera|iva~keindustrije,58ugra|evini,47uoblastiinformisawa ikomunikacija,a27uoblastisao- bra}aja. Odli~an i veoma dobar bonitetni rejting A i B ima 20 odsto preduze}a,odnosno18.035privrednih dru{tava, i to su vrlo uspe{na preduze}a, koja su sigurna za poslovne partnere, koja posluju uglavnom sa sopstvenim kapitalomaiukolikopozjamqujukapital koriste ga na najefikasniji na~iniizwegaobezbe|ujusrpski razvoj,navelajeona.

DNEVNIIZVE[TAJBEOGRADSKEBERZE Pet akcija s najve}im rastom

KURSNA LISTA NARODNE BANKE SRBIJE Sredwi Prodajni Kupovni Kupovni za Va`iza za za zadevize devize efektivu efektivu

Zemqa

Valuta

EMU

evro

1

114,9285

117,2740

119,9713

114,5767

Australija

dolar

1

90,1118

91,9508

94,0657

89,8359

Kanada

dolar

1

89,8090

91,6418

93,7496

89,5340

Danska

kruna

1

15,4599

15,7754

16,1382

15,4126

Norve{ka

kruna

1

15,1843

15,4942

15,8506

15,1378

[vedska

kruna

1

12,7737

13,0344

13,3342

12,7346

[vajcarska

franak

1

95,6383

97,5901

99,8347

95,3455

V.Britanija

funta

1

142,9637

145,8813

149,2366

142,5260

SAD

dolar

1

92,9692

94,8665

97,0484

92,6846

Kurseviizovelisteprimewujuseod1.6.2012.godine

Promena %

Cena

BELEX 15 (441,87 -1,41)

Promet

Zdravqe, Leskovac

11,67

3.350

117.250

Filip Moris, Ni{

2,27

900

144.000

NIS, Novi Sad

-0,17

587

13.486.650

/

/

/

/

AIK banka, Ni{

-1,43

1.382

1.743.565

/

/

/

/

Komercijalna banka, Beograd

-3,85

1.548

157.883

/ Promena %

/ Cena

/ Promet

Imlek, Beograd

0,00

2.400

0,00

Energoprojekt holding, Beograd

Progres, Beograd

-20,00

40

4.000

-0,71

419

140.720

Soja protein, Be~ej

Dunav osigurawe, Beograd

-16,92

825

22.275

-0,61

490

730.100

Aerodrom Nikola Tesla, Beograd

Globos osigurawe, Beograd

-12,24

215

430

-2,58

415

456.880

Jubmes banka, Beograd

-0,17

11.175

223.500

Galenika Fitofarmacija, Zemun

-9,40

2.129

95.800

Metalac, Gorwi Milanovac

0,00

1.551

38.785

Jedinstvo Sevojno, Sevojno

0,00

4.394

0,00

Alfa plam, Vrawe

-0,13

6.840

68.400

730.100

Tigar, Pirot

0,00

493

0,00

Veterinarski zavod, Subotica

0,00

321

0,00

/ Pet akcija s najve}im padom

Komercijalna banka, Beograd Privredna banka, Beograd Vojvo|anskih top-pet akcija

-10,78

803

1.041.325

-10,59 Promena %

152 Cena

24.976 Promet

NIS, Novi Sad

-0,17

587

13.486.650

Danubius, Novi Sad

0,00

7.800

1.170.000

Soja protein, Be~ej

-0,61

490

Ogrev, Zrewanin

0,00

121

259.666

Kolut, Kolut

0,00

250

189.500

Naziv kompanije

Promena %

Cena

Promet

Sviiznosisudatiudinarima


BIZNISMLADIH SRBIJE

Praksaput doradnog mesta U okviru programa „Biznis mladihSrbije”ju~ejeraspisan javnipozivzaprijemmladihna radnupraksuuprivatnimpreduze}ima {irom Srbije, koji je otvorendo20.juna,saop{tioje organizator. Programradnihpraksinamewenjenezaposlenimosobamado 30godina,sasredwimilivisokimstepenomstru~nespreme.

Ciqtogprogramajedasemladimaomogu}isticaweradnogiskustva, koje je jedan od kqu~nih uslovazazapo{qavawenasavremenomtr`i{turada. Javni poziv je upu}en preduze}imaizNovogSada,Temerina, Beo~ina, Sremskih Karlovaca, Subotice, Sombora, Kawi`e, Kraqeva, ^a~ka, Gorweg Milanovca, Ra{ke i Vrwa~ke Bawe , Ni{a...  Svaki poslodavac koji u|e u program donosi odluku o praktikantu koga }e anga`ovati posle obavqenih intervjua. „Biznis mladih Srbije” }e mladima na praksi obezbediti dvomese~nu nov~anu nadoknadu, a poslodavci }e im dodeliti mentora koji }e pratiti wihov rad i razvoj i pomagati im da {toboqeodgovorenaposlovne zadatke i izazove, isti~e se u saop{tewu.

c m y

ekOnOMiJA

dnevnik

subota2.jun2012.

5

KRIJUM^AREWEIDAQEDONOSIMNOGIMADOBRUZARADU

[vercovanogorivoplovi DrinomiDunavom Iako smo poznati kao narod kojislabopamti,te{kodaseiz memorijemoguizbrisatidevedesetegodinepro{logvekakadse gorivoumestonapumpama-kupovalo na ulicama. Sre}om, toga ve} vi{e od decenije nema, ali po svemu sude}i, {verc gorivom i daqe je posao kojim se mnogi bave i koji obezbe|uje dobru zaradu. Kanali {vercerskog ulaskagoriva,nakojene}ebitiura~unatoobaveznodavawedr`avicarina, akciza i porezi, su raznovrsni,auglavnomjeputderivataprekorekekojesu,uejdnoi granica na{e dr`ave sa susedima - Dunav i Drina. Tako|e, uz potpunoilegalan,iliboqere}i krijum~arski na~in ulaska goriva , postoji i poluilegalni - kada se gorivo u Srbiju uvozi redovnim putem, ali tako da se gorivoneprijavqujekaogorivo negosirovinazaproizvdowunekihdrugihproizvoda.Iumestou fabri~kepogoneodlazenapumpe.Pojedine.Itakoseomogu}ava da neko dobro zara|uje, a uz pojedinace koji dobijaju, daleko jevi{eonihkojigube-presvega dr`avnibuxet. Te{ko je re}i koje se gorivo uvozi na nelegalan na~in, ili se nelegalnodopremauSrbiju,aliu vreme kada se, zbog visokih cena gorivaisvemaweplate`nemo}i gra|ana,nanaftnomtr`i{tubele`i pad prometa, pro{logodi{wiogormanrastuvozalo`uqa nedvosmislenajepotvrdadasene{tode{ava.Naime,pro{legodine je u Srbiju uvezeno za 130.000 tonaovoggorivavi{enegouobi~ajeno,odnosno{tosudugogodina bile standarne koli~ine koje sekre}uoko60.000tona.Nijete{kopreptotavitidasvetekoli~inenisuzavr{ileunaftarica-

Bezakcizezagrejawe Ina~e, lo`uqejenaftniderivat,kojispadautakozvanagasna uqa,iprakti~nojeistikaoidizelgorivo ibilojeoslobo|eno akcize samo ako se koristi za grejawe. Ipak, omogu}eno je da gra|aniiprivreda,za~ijuupotrebujeinamewenolo`uqe,imaju pravodaostvarepovra}ajpoosnovuakcizenatuvrstuderivata. Pore~imaMiliceBisi},obra~unavaweakcizenalo`uqeza grejawe,uobi~ajenojeususednimzemaqamapaseakcizekre}uod 25,56evrana1.000litarauBugarskojdo382,45evrana1.000litarauMa|arskoj.UMa|arskojjeakcizazalo`uqekojesekoristi kaoenergentzagrejaweistajekaozaimotornogorivo,odnosno akcizaseneumawujezaupotrebuovoggorivapotomosnovu. maipostrojewimazagrejawe,ve} na pumpama i u rezervoarima automobila. Trebare}idasenaovajna~in mogloveomadobrozaraditijerse naovuvrstuenergenta,kojisekoriste za grejawe, a ne kao pogonsko gorivo do sada nije pla}ala akciza, te je litar lo` uqa bio znatnojeftinijiodistoggorivaevrodizela, koji se koristi kao pogonskogorivo.Tako|e,lo`uqe senapumpiinesmesipatiurezervar automobila, ali kada korisnik, recimo, kupi velike ko-

li~ine, te{ko je u}i u trag kako seonotro{i. Crveno svetlo izgleda da se upalilo,makarisazaka{wewem, jersuuvedeneakcizeinaovuvrstu goriva i time spre~eno daqe potkradawe dr`ave. Naime, Vlada Srbije je pro{le nedeqe uvela akcizu na lo` uqe evropskog kvaliteta u visini od 57 dinara po kilogramu, kako bi spre~ilazloupotrebutogderivataionemogu}ilaprodajulo`uqa umesto evrodizela. Ipak, omogu}enojedagra|aniiprivre-

da,za~ijuupotrebujeinameweno lo` uqe, imaju pravo da ostvare povra}aj po osnovu akcize na tu vrstuderivata. Stru~wakzaporeskuiakciznu politiku Milica Bisi} o~ekuje da}euvo|eweakcizenalo`uqe spre~iti nelegalnu upotrebu tog derivata kao motornog goriva. Onajeistakladaseprocewujese da su prihodi buxeta u Srbiji, samo tokom pet meseci pro{le godine, zbog nelegalne upotrebe lo` uqa kao motornog goriva, umaweni za oko sedam milijardi dinara,. Po wenim re~ima, razlika u ceni izme|u lo` uqe i dizel goriva,kojajenastalazbograzlike u oporezivawu, stvarala je veliki podsticaj za nelegalnu upotrebu lo` uqa kao motornog goriva, te da se ukidawem tog oslobo|ewa, zna~ajno smawuje ta mogu}nost i, istovremeno, mo`e o~ekivati prestanak kori{}ewa lo`uqakaomotornoggoriva. Dakle, nadle`ni su odlu~ili dastanunaputnanelegalnuupotrebulo`uqa,atobi,bezsumwe trebalo da dovede i do uspostavqawa relanog stawa na naftnom tr`i{ta. Naime, nelegalni uvoz goriva,kaoidrugividovi{verca derivatima, osim {to uskra}uju sredstva koja po svakom litru kapaju u dr`avni buxet dovelo i do pada poslovawa  pumpama koje posluju legalno. Naime, podatak da je pro{le godnie, kada je ukupan pad prometa na benzinskim pumpama bio oko {est dosto, pove}an uvoz lo` uqa za vi{e negodvaputa,samposebigovori. I ina~e promet na pumpama opada, pa je tako sada smawen za oko pet do 15 odsto u odnosu na istiperiodlani. D.Mla|enovi}

SPOQNOTRGOVINSKA RAZMENASVEMAWA

Boqe trgujemo uevrima

Ukupn a spoqnotrg ovins ka robna razmena Srbije sa svetomodjanuaradoaprilasmawena je za 4,4 odsto, izra`eno u dolarima, dok je u evrimabilaza0,9odstove}auodnosu na isti period pro{le godine, saop{tio je ju~e Republi~ki zavod za statistiku. Razmena je u prva ~etiri meseca ove godine iznosila ne{to vi{e od 9,5 milijardi dolara, ili gotovo 7,3 milijarde evra. Deficit je iznosio 2,781 milijarde dolara, {to je pove}awe od 7,8 odsto uodnosunaistiperiodprethodn e god in e. Izr a` en u evrima, trgovinski mawak je bio 2,118 milijarde, {to je 13,9 ods to vi{ e neg o 2011. Izvezenojerobeuvrednosti od 3,4 milijarde dolara, {to ~ini smawewe od 8,6 odsto u odnosu na isti period prethodn e god in e, a uvez en o za 6,183 milijarde dolara, {to je mawe za 1,9 odsto. Izvoz robe, izra`en u evrima, vredeo je 2,589 milijarde {to je mawe3,5odsto,auvoz4,7milijardiiliza3,6odstovi{e neg o od jan ua r a do april a 2011. Pokrivenost uvoza izvozomiznosi55odstoimawaje od pokrivenosti u istom perio d u preth odn e god in e od 59,1odsto,navedenojeusaop{tewu.


6

POQOPRivRedA

subota2.jun2012.

dnevnik

„ D N E V N I K S A Z N A J E ” VLADA USVOJILA NOVE UREDBE ZA PODSTICAJE U STO^ARSTVU

Dr`ava daje 500 dinara po tovqeniku Vlada Republike Srbije je na predlog Ministarstva poqoprivrede, trgovine, {umarstva i vodoprivrede usvojila Uredbe o uslovima i na~inu kori{}ewa podsticajnih sredstava za podr{ku nabavke osnovnog stada u sviwarstvu, ov~arstvu i kozarstvu kao i Uredbu o kori{}ewu podsticajnih sredstava za tov sviwa u 2012. godini. Pravo na podsticajna sredstva ima registrovano poqoprivredno gazdinstvo, preduzetnik i pravno lice. Registrovani poqoprivredni proizvo|a~i podsticaje mogu da

koriste za nabavku nazimica i nerastova starosti od pet do osam meseci. Bespovratna sredstva iznose 10.000 dinara po kvalitetnom priplodnom grlu ukoliko je grlo kupqeno nakon stupawa na snagu ove uredbe i ako poqoprivrednik to grlo koristi za daqu reprodukciju na sopstvenom gazdinstvu u naredne tri godine. Bespovratna podsticajna sredstava za nabavku osnovnog stada u ov~arstvu i kozarstvu koriste se za {iqe`ice, {iqe`ane, dviske i dvizice starosti od {est do 18 meseci i iznose 5.000 dinara po

NA BERZI NAJTRA@ENIJA I[LA P[ENICA

Hlebno `ito na zeleno 18,7 dinara Kako se bli`i `etva, silosi se pripremaju za prijem novog zrna, a interes za trgovawem p{enicom je sve ve}i. Po obimu trgovawa ova `itarica je protekle nedeqe bila najzastupqenija roba na Produktnoj berzi u Novom Sadu. Hlebno `ito se prodavalo po prose~noj ceni od 24,59 dinara kilogram ( 22,77 bez PDV), {to je rast u odnosu na prethod-

nu nedequ od 1,18 odsto. Procene da bi slede}a ekonomska godina mogla da bude neizvesna sa aspekta bilansnih zatvarawa p{enice, sve ~e{}e motivi{u kupce da na terminskom tr`i{tu kupe p{enicu novog roda. Kupovina 1.500 tona novog roda realizovana je po ceni od 18,77 dinara kiloram (17,38 bez PDV). Na osnovu ovih podataka, procene oko toga sa kojom cenom }e p{enica na „spot” tr`i{tu startovati u `etvi sada su mnogo izvesnije, ocewuje Produktna berza. Tr`i{te kukurza bukvalno stoji. Prose~na cena u nedeqi

za nama je iznosila 21,92 din/kg ( 20,30 bez PDV). Izvoznici strpqivo ~ekaju jo{ povoqniji razvoj situacije nego {to je sada, pa da agresivnije nastupe na tr`i{tu. S obzirom {ta se de{ava na deviznom tr`i{tu oni }e vrlo brzo otvoriti svoju ponudu. Soja dosledno svim prethodnim nedeqama ima najve}i rast cene. Prose~na cena trgovawa iznosila je 57,48 din/kg (53,22 bez PDV). Rast cene iznosi 2,51 odsto, ali istini za voqu, realno u dolarskoj vrednosti to je prakti~no identni~na cena kao u prethodnoj nedeqi. Sojom novog roda se trgovalo „ na zeleno„ i to po ceni od 40,11 din/kg (37,14 bez PDV). Trgovalo se jo{ i sojinom sa~mom sa 44 odsto proteina po ceni od 57,23 din/kg (48,50 bez PDV). Produktna berza ukazuje na ~iwenicu da je razaraju}e dejstvo pada vrednosti doma}e valute o~igledno. Promet od ukupno 2.750 tona robe je za 119,13 odsto ve}i nego prethodne nedeqe, dok je finansijska vrednost prometa od 65,7 miliona dinara u odnosu na prethodnu nedequ u porastu za 62,41 odsto. Sti~e se utisak da nestabilnost kursa u velikoj meri spre~ava tr`i{ne u~esnike da odlu~nije iza|u na tr`i{te, ka`u na berzi.

SVE SMO BOQI NA SVETSKOJ PIJACI

Za ~etiri meseca 400 miliona suficita Srbija je za prva ~etiri meseca 2012. godine ostvarila suficit od 399,9 miliona dolara u spoqnotrgovinskoj razmeni poqoprivredno prehrambenih proizvoda, {to je rast od 9,8 odsto u odnosu na isti period lane, izjavio je savetnik predsednika Privredne komore Srbije (PKS) za poqoprivredu VojislavStankovi}. Od po~etka januara do kraja aprila izvezeno je poqoprivredno prehrambenih proizvoda za 841,6 miliona dolara, a uvezeno za 441,7 miliona dolara. Pokrivenost uvoza izvozom je 190,5 odsto, rekao je on za Tanjug. Izvoz je porastao za 4,3 odsto u odnosu na rezultate iz vremena januar-april 2011. godine, sa ukupnim u~e{}em u ukupnom robnom izvozu od 24,7 odsto dok je vrednost uvoza za 0,2 odsto mawa sa ukupnim u~e{}em u uvozu od 7,1 odsto. Najva`niji izvozni proizvodi u agraru bili su `uti kukuruz ~iji je izvoz dostigao vrednost od 219,9 miliona dolara, zatim rafinirani {e}er od {e}erne repe, zamrznuta malina roland, jestivo uqe od suncokreta, jabuke sve`e, sojino sirovo uqe, gazirana bezalkoholna pi}a, pivo. Posmatrano po odsecima u izvozu dominiraju `ita i proizvodi na bazi `ita, u vrednosti od 294,8 miliona dolara, sa uce{}em od 6,8 odsto u ukupnom robnom izvozu kako i vo}e i povr}e, sa vredno{}u izvoza od 144,3 miliona dolara i u~e{}em od 4,2 odsto, rekao je Stankovi}. „Na uvoznoj strani, me|u agrarnim proizvodima dominira tradicionalno grupa ’nekonkurentnih’ proizvoda - sirova kafa, banane, pomoranxe, ~aj, kakao, za~ini” naveo je on.

kvalitetnom priplodnom grlu. Poqoprivredni proizvo|a~ ostvaruje podsticaje ukoliko je grlo kupio nakon stupawa na snagu ove uredbe i ako to grlo koristi za daqu reprodukciju na sopstvenom gazdinstvu u naredne ~etiri godine. Zahtevi za podsticajna sredstva podnose se Upravi za agrarna pla}awa u [apcu do 31. oktobra 2012. godine. Uredbom o kori{}ewu podsticaja za tov sviwa podsti~e se sto~arstvo i pove}ava obim proizvodwe mesa i mesnih prera|evina {to }e se tako|e pozitivno odraziti na razvoj biqne proiz-

vodwe i proizvodwe sto~ne hrane. Pravo na podsticaje za tovne sviwe poqoprivrednik ostvaruje jednom za period trajawa tova i to nakon zavr{etka tova, u iznosu od 500 dinara po grlu, za najmawe 10 grla u tovu ~ija je prose~na telesna masa iznad 90 kilograma. Podsticajna sredstva ostvaruju se ako je tovno grlo nameweno za proizvodwu mesa predato klanici nakon stupawa na snagu ove uredbe. Zahtevi za podsticajna sredstava podnose se Upravi za agrarna pla}awa u [apcu do 31. decembra 2012. godine. S. G.

„MARBO PRODUKT„ OTKUPIO 50.000 TONA KRTOLASTOG POVR]A

Izvoz srpskog krompira u kesicama ~ipsa „Marbo Produkt„ iz Ba~kog Magli}a, na{ vode}i proizvo|a~ ~ipsa i grickalica, koji posluje u okviru PepsiCo-a, pro{le godine je otkupio blizu 50.000 tona industrijskog krompira u Srbiji i BiH, {to je ujedno gotovo i kompletna proizvodwa na ovim prostorima. „PepsiCo”, ina~e, ima vrlo jasne standarde poslovawa i praksu koju primewuje u vi{e od 200 zemaqa sveta gde posluje. Najboqu globalnu praksu, uz potrebne lokalne modifikacije, primewuje i na tr`i{tu zapadnog Balkana. U kompaniji isti~u da, govore}i iz iskustva u poslovawu u Srbiji, ovaj ambijent nije zna~ajno nepovoqniji. U „Pepsiju”ovo tr`i{te smatraju veoma perspektivnim, ali ukazuju i na prakti~ne, „papirolo{ke” probleme koji se javaju u trgovini u regionu, {to se svakako odra`ava na dobit kompanija ali i privreda tih zemaqa. - Od kako je „PepsiCo„2008. godine u{ao na ovo tr`i{te zna~ajno je investirao, kako u proizvodne kapacitete, dakle one materijalne, tako i u „knowhow„ i kvalitetnu praksu koju donosi. Kao lideri u oblasti slanog programa hrane, uveli smo brojne novine na srpskom tr`i{tu, koje do na{eg dolaska nisu bile praktikovane. Recimo, da koristimo najkvalitetnije sirovine i dobavqamo ih iz bilo kog dela sveta u okviru na{e mre`e – bilo da je u pitawu argentinski kikiriki ili ne{to drugo ka`e za „Dnevnik” direktor korporativnih poslova i komunikacija za zapadni Balkan „PepsiCo-a„

DaniloDrobwak. - Kompanija je u dosada{wem poslovawu nailazila na razumevawe i saradwu, a katkad je i ukazivala na potrebu uskla|ivawa odre|enih procedura u skladu sa praksom koju imamo na tr`i-

Duple procedure usporavaju poslovawe, i samim tim ne doprinose privredama koje trpe zbog toga, ukazuje na{ sagovornik uz ocenu da je smawivawe necarniskih i administrativno-birokratskih proce-

Smawivawenecarnskihiadministrativno-birokratskih proceduraujednojedobar pripremnitestzabudu}e~lanstvouEU {tima EU, a koja uzimamo kao referentna za region zapadog Balkana. Wome se niko do sada nije bavio jer, prosto, nije postojao neko sa tako bogatim iskustvom u ovom segemntu prehrambene industrije kao {to je „PepsiCo„. Konkretno, sa na{eg aspekta, za trgovinu izme|u zemaqa, necarinske barijere, odnosno duple procedure su najve}a prepreka do sada i nadamo se i o~ekujemo da }e sporazumima one biti otklowene u intersu privreda u regionu.

dura, ujedno i dobar pripremni test za budu}e EU ~lanstvo koje je strate{ki ciq zemqama zapadnog Balkana sem Slovenije, jer je ona ve} ~lanica, ali tako|e spada u oblast koju „PepsiCo„ u ovom delu Balkana pokriva. - Ne raspola`emo ta~nom kvanitifakcijom tro{kova, ali ipak vrlo jasno mo`emo imati sliku gubitaka koji se javqaju zbog duplih procedura: recimo, isporuka krompira iz Srbije za na{ pogon u Lakta{ima od tri {lepera je osam da-

na nefunkcionalna usled analiza koje se moraju obaviti u BiH (tu su, pride, i neradni i prazni~ni dani), a koje su ve} ura|ene u Srbiji pri izvoznoj proceduri. Ukoliko je prodaja u zemqama u koje izvozimo regularna ili iznad plana, logi~no je da u takvoj situaciji i kompanije koje posluju i privrede zemaqa, na kraju, imaju propu{tene dobiti - ka`e Drobwak. CEFTA sporazum je tako|e jedan od testova za EU ~lanstvo, ukazuje on. - Svakako da je wegova puna primena, {to podrazumeva, izme|u ostalog, uklawawe necarinskih barijera, koje su za nas uglavnom usporavale razmenu, vi{e nego neophodna. Ali, za to je potrebna saglasnost svih zemaqa koje ~ine CEFTA regiju, a one su, ipak, zemqe sa razli~itim politi~ko-ekonomskim prioritetima. Kao i sve regionalne integracije, i CEFTA je prirodan proces koji do svoje pune primene prolazi kroz razli~ite faze - napomiwe na{ sagovornik. Pomenimo, Ministarstvo poqoprivrede je u proteklom periodu potpisalo niz bilateralnih sporazuma sa kom{ijskim zemqama, ba{ zbog toga da bi se olak{ala trgovina u regionu. Ukoliko sporazumi doprinesu i omogu}e skra}ewe birokratskih procedura i implementaciju predvi|ene prakse i na terenu, efekti }e biti zna~ajni, ocewuje Danilo Drobwak ocewuju}i da }e to }e direktno doprineti dugoro~no ve}oj uposlenosti kapaciteta i ve}im prihodima. S. Glu{~evi}

PROTEST ZADRUGARA IZ RATKOVA, BA^KOG BRESTOVCA I SRPSKOG MILETI]A

Zadru`na imovina od nemila do nedraga Privatizacijom dru{tvenih poqoprivrednih preduze}a, a nekada{wih zemqoradni~kih zadruga iz Ratkova, Ba~kog Brestovca i Srpskog Mileti}a, u~iwena je blago re~eno, nepravda zaposlenim radnicima, odnosno, malim akcionarima. Pre svega ostali su bez posla, prakti~no na ulici, bez osnovnih prihoda za `ivot, ali ostali su i bez poqoprivrednog zemqi{ta koje su godinama obra|ivali, a koje su jo{ davne 1953. godine wihovi predhodnici, ali i preci, uneli u zadru`nu imovinu pomenutih zadruga. Pripremom dokumentacije po zahtevu Agencije za privatizaciju, za privatizaciju ovih poqoprivred-

nih preduze}a, upisana je samo dru{tvena i dr`avna imovina, a namerno ili slu~ajno, zadru`na imovina - nije. Pregledom raznih dokumenata iz vremena raspada nekada{weg PPK ,,Oxaci“, uo~eno je da tu ba{ nema nejasno}a. Neke od tada{wih zemqoradni~kih zadruga su promenile status i postale preduze}a u dru{tvenoj svojini (PDS), me|u kojima su i pomenute tri zadruge, a neke su ostale sa statusom zemqoradni~ke zadruge i one su zadr`ale zadru`nu imovinu. PDS Ratkovo, PDS ,,Vojvodina“ iz Ba~kog Brestovca i PDS ,,Srpski Mileti}“, su prodate firmi „Alfa promet” iz Oxaka, a pla}ena su visokim dugovima i kamatnim stopa-

Meqali se vlasnici - Bez vaqane dokumentacije, mi u katastru nepokretnosti ne mo`emo ukwi`iti ogromnu povr{inu zemqi{ta u bilo ~ije vlasni{tvo i u tom delu zakon je veoma jasan. [ta se doga|alo u ranijem periodu kada je pripremana dokumentacija za privatizaciju mi ne mo`emo znati. Poznato je samo da je tada dostavqena kompletna dokumentacija nakon privatizacije, po va`e}em zakonu, na osnovu koje smo mogli obaviti ukwi`bu. U ovom konkretnom slu~aju, bez sudske odluke kome se dosu|uje sada sporna imovina, odnosno Ministarstva poqoprivrede sa vaqanim tuma~ewem i Republi~kog geodetskog zavoda, u oxa~kom odelewu

katastra nepokretnosti jednostavno ne mo`emo ukwi`iti imovinu po dokumentaciji koju smo dobili od nezadovoqnih i o{te}enih zadrugara iz Ratkova, Ba~kog Brestovca i Srpskog Mileti}a. Dokumentacija iz 1953. godine, koju smo primili od predstavnika zadrugara, je na{a dokumentacija, ali je u me|uvremenu od dvadesetak godina, sporna imovina, dokumentaciono nekoliko puta mewala vlasnike po tada va`e}em zakonu. Tako i sada o~ekujemo dokumentaciju koju zahteva va`e}i zakon, da bi mogli ispuniti zahtev zadrugara re~i su Neboj{eIli}a, rukovodioca slu`be katastra nepokretnosti iz Oxaka.

ma na osnovu pre|a{wih kredita koje su uzimali od ove firme, naravno najve}im delom, a ostatak je ispla}en virmanski. Nakon nekoliko godina, „Alfa promet” je prodala svoj udeo u ove tri zadruge, Ratkovo firmi iz Osijeka, a Srpski Mileti} i Ba~ki Brestovac, navodno firmi iz Irske. Novi vlasnici, strani dr`avqani, su postali vlasnici poqoprivrednog zemqi{ta u Srbiji. Nezadovoqstvo ili boqe re~eno o~aj zbog ugro`ene egzistencije, traje ve} godinama, a pre nekoliko meseci je i kulminiralo. Svakodnevna okupqawa, u i ispred zgrade op{tinske uprave, su kako ka`u zadrugari, jedini na~in da vrate svoju imovinu. - Re~eno nam je pre par nedeqa da su na{i zahtevi usvojeni i da }e se veoma brzo sve razre{iti. Me|utim, sada se ni{ta ne doga|a. Podneli smo danas krivi~nu prijavu protiv odgovornih u katastru, jer jednostavno odbijaju ukwi`bu na{e imovine kao zadru`ne, a smatramo da su to du`ni da u~ine na osnovu podnete dokumentacije. Podneli smo jo{ nekoliko krivi~nih prijava protiv lica za koje smatramo da su tako|e odgovorne za ovakvu situaciju, a to }emo i zvani~no objaviti. Nastavi}emo okupqawa mawih ili ve}ih razmera, sve dok se na{ zahtev ne ispuni rekao nam je NenadIli}, u ime okupqenih zadrugara iz Ratkova, Ba~kog Brestovca i Srpskog Mileti}a. S. Miler


„LISJE”SPREMNOZAZADU[NICE

Pe{a~eweod SremskihKarlovaca Planinarsko-smu~arsko dru{tvo „@elezni~ar„ organizuje u nedequ pe{a~ewe od Sremskih Karlovaca, preko Dobrilovca, Velikih vrhova, Stra`ilova, te opet do Sremskih Karlovaca. Polazak je u 7.55 sati sa Me|umesne autobuske stanice autobusom sa linije broj 61 za Sremske Karlovce. Vodi~ }e biti IvanBogi~evi}, a broj telefona na koji se mo`e dobiti vi{e informacija je 021/881-671. A.L.

Prevozvozi}emnaGradskomgrobqu Danas su letwe ili duhovske zadu{nice za pravoslavne vernike. Kako je obi~aj da se na taj dan pose}uju grobovi „Lisje” }e organizovati prevoz kombijem u krugu Gradskog grobqa za stara i invalidna lica. Vozi} }e, tako|e, biti na raspolagawu posetiocima, od sedam sati ujutro pa sve dok poseta traje. Raspored polazaka vozi}a bi}e istaknut na ulazu u Gradsko grobqe.

Iz pogrebnog preuze}a ju~e su saop{tili da je na Gradskom grobqu zavr{en drugi krug ko{ewa trave na neodr`avanim grobnim mestima, dok se velike parkovske povr{ine kose ~etvrti put. Na ovom grobqu je u toku okopavawe povr{ina pod ukrasnim {ibqem. I na starim grobqima u gradu, kao i na grobqima u Petrovaradinu, Srem-

Novosadska subota2.jun2012.

Vi{eautobusa Gradsko saobra}ajno preduze}e „Novi Sad” poja~a}e prevoz do Gradskog grobqa. Na liniji 14 Centar - Sajlovo bi}e uvedeni dodatni polasci autobusa u slu~aju gu`ve.

skoj Kamenici, Veteriku i Futogu zavr{eno je ko{ewe trave, po drugi put ove sezone, kao i okopavawe povr{ina pod zelenilom. Pogrebnici su uredili i za{ti}ena grobna mesta na Gradskom grobqu i na Uspenskom grobqu, kao i grobna mesta koja „Lisje” ure|uju u dogovoru sa srodnicima pokojnika. Na svim grobqima odneto je sme}e i trava. Z.D.

hronika

Telefoni:0214806-833,4806-834,421-674,528-765,faks:6621-831e-mail: nshronika@dnevnik.rs

DOBRO JUTRO, NOVI SADE

Jo{ malo pa nestalo

K

oliko bi qudi danas vratilo na|enu torbu punu deviza?  O postocimasemo`eraspravqati.A koliko wih ne bi uop{te ni prebojalo pare iz nov~anika, bardasaberesvojemogu}nostiinatrensezamisli? Kapitalizamina{azemqa zasadanisuna{lipravuhemiju,teseovdenovcite{ko zara|uju,painalaze,pogotovonagrobqu.Anaba{ovom mestu jedan na{ sugra|anin na{ao je nov~anik krcat evrimaibezrazmi{qanapotra`iowegovogvlasnika.

Izvesnojedave}godinama `iv im o uz uzr e~ ic u “uzmi novce i be`i”, a raspraveodru{tvenim,moralnimibilokojimogdovornostima izostaju. Pored toga, edukacijasesvelanateoriju “{to vi{e zna{ ima}e{ vi{e para”, a kako }ete posle s wima, ili jo{ boqe, {ta}etebezwihtonikone ka`e. Izvesno je da }e ovakvi postupci -normalni i po{teni-kakovremeodmi~e, za}i u sferu ~iste slu~ajnosti. A. Latas

V remeploV

„PASUQIJADA” UTEMERINUJU^EPO^ELA

Gostimadanas 4.000besplatnihporcija Osmi „Bin festival”, tradicionalna “Temerinska pasuqijada”, po~ela je ju~e na popularnom Va{ari{tu. Dok su majstori ro{tiqa pripremali }umur za mrsnu vatru, manifestacija je zvani~no po~ela otvarawem „Etno sokaka” i „Slatke ulice”. Ponuda na tezgama se {arenila od kreto{a i drugih de~jih |akonija, pa

do suvenira, cve}a, suhomesnatih delikatesa i, naravno, vina i rakija. Kako se bli`io zalazak sunca, tako su na binu izlazili razni bendovi. Muzi~ki vrhunac je bio tokom no}i, kada je zasvirala „Ju grupa”, a nije mawkalo ni tambura{kih lokalnih bandi pod {atrama. Me|unarodno takmi~ewe u kuva-

wu pasuqa po~iwe danas u 11 sati. Predvi|ena je i humanitarna akcija „Najve}i ru~ak na Balkanu”, u okviru koga }e biti podeqeno 4.000 besplatnih porcija pasuqa. Progla{ewe pobednika zakazano je u 19 sati, a zavr{etak fe{te je u 22 ~asa, uz veliki vatromet. D.Ig. Foto:S.[u{wevi}

CENTARPRIPADAMATURANTIMA

RadivojMa{anin, nau~nikiratniheroj U Belom manastiru 2.juna1892. ro|en je dr Radivoj Ma{anin, jedan od najuglednijih srpskih nau~nika. Maturirao je u novosadskoj Srpskoj pravoslavnoj gimnaziji, a matematiku i astronomiju studirao u Be~u, Zagrebu, Budimpe{ti i Parizu. U Prvom svetskom ratu bio je srpski dobrovoqac, borac na Solunskom frontu, odlikovan srpskim, ruskim i engleskim odlikovawima, dok je na Beogradskom univerzitetu odbranio doktorsku disertaciju. Objavio je u odgovaraju}im me|unarodnim nau~nim krugovima vi{e cewenih studija i univerzitetskih uxbenika. N.C.

Vremeveselih rastanaka Novosadski maturanti proteklih nekoliko nedeqa nisu zauzeti samo pripremama za fakultete i vi{e {kole, ve} na|u vremena da se zabave i proslave kraj jednog perioda {kolovawa. Pre nekoliko dana kolektivno su plesali kadril na Trgu slobode zajedno sa vr{wacima iz evropskih gradova, a nakon toga su pojedina~no slavili sa vr{wacima iz svojih {kola. Tako su se i maturanti Sredwe ekonomske {kole „Svetozar Mileti}” ju~e, uz smeh i igru, na Trgu mladenaca, gde su provodili odmore, oprostili od {kolskih klupa i pokazali da ne mora svaki rastanak da bude tu`an. J.Z. Foto:R.Hayi} UPRIGRADSKIMNASEQIMA

Uutorakradovizavr}ugas Isporuka prirodnog gasa bi}e obustavqena u utorak, 5. juna, od 7 do 20 ~asova u Sremskim Karlovcima, Petrovaradinu, Bukovcu, Ledincima, Rakovcu, Sremskoj Kamenici, u svim naseqima op{tine Beo~in, Ne{tinu i Vizi}u. Basa ne}e biti zbog izvo|ewa radova na gasovodnom sistemu. A.Va.

JU^EUCRKVIIMENAMARIJINA

Promovisaninovi vinskivitezovi Crkva Imena Marijina u centru Novog Sada bila je ju~e mesto gde su kandidati za prijem u red vinskih vitezova iz celog sveta postali ~lanovi tih vite{kih asocijacija. Sve~ana ceremonija vite{kog uzdizawa obavqena je ju~e u okviru 47. Svetskog kongresa vinskih vitezova, koji se odr`ava u Srbiji do 6. juna i okupqa vi{e od 120 u~esnika sa svih kontinenata. Pre sve~anog ~ina u crkvi, u~esnici kongresa su bili u Sremskim Karlovcima, gde su obi{li Karlova~ku gimnaziju, Kapelu mira, tri crkve. U popodnevnim satima degustirali su

vina doma}ina, ali i ona koja su doneli iz zemaqa iz kojih dolaze. Nakon toga progla{eni su i pobednici Turnira u rozeu, koji je prire|en specijalno povodom ovog kongresa. Pobednik tog nadmetawa je Vinarija „Axi}„ iz Temerina. Drugo mesto pripalo je Vinariji „Veritas„ iz Sremskih Karlovaca, tre}e Vinariji GavreBoti}a iz ^uruga, a ~etvrto Vinariji „Krgovi}„ iz Podgorice. Organizator ovog svetskog skupa vinskih vitezova je Udru`ewe Evropski vinski vitezovi Sveti Georgije iz Novog Sada. Z.Ml. Foto:R.Hayi}

c m y


8

nOvOSAdSkA HROnikA

subota2. jun2012.

NA TVR\AVI TOKOM VIKENDA

„Ritualfest” zaqubiteqe `urkiisvirki OvogvikendauBorisovomateqeunaPetrovaradinskojtvr|aviodr`avase„Ritualfest”,koji}eokupitibrojneumetnike,bendoveidi-xejeve.Posetioci}eimatiprilikudasaznaju kakosepravisaundsistem,modifikujuneupotrebqivipredmeti,filcavuna,napravi{ablon,`ongliraidrugo.Bi}epredstavqeneizlo`bedoma}ihbrendovaode}einakita,odr`a}ese koncertiidi-xejnastupi. Ve~eras }e biti predstavqen Bejslajn projekat i „bek tu bek”,sesija,gde}enastupitidvanaestdi-xejeva.Gostisuhrvatskezvezdedramenbejsaidabstepa:FilipMotovunski,Meniga iemsi^aka,teRahmaniiNecone izBeograda.Sutraseodr`avajukoncertigrupe„Bicikl„izBeograda,„RabLKali„,„MokarLebac„iJKMAMKMizNovogSadaidi-xejnastupiproducentakoji~ine„AnarhIndirektTransmi{n”:IgorStangliski,Slox,DanielAleksandar idrugi.Ulaznadnevneprograme jeslobodan,dokjecenajednodnevneulaznicezano}neprograme 300dinaradopono}i,a400dinaranakonpono}i. Ulazniceseprodajuod21~asnaulazuBorisovogateqea.Detaqnije informacije mogu se na}i na sajtu www.ritualfest.com. Organizatori su kolektivi „Bejslajn”, „Audio Kolors„ i „Anarh”. A. J.

BI]E @ESTOKO NA FESTIVALU EGZIT

Ruskiandergraund naSubastejyu Suba stejx Egzit fetivala ove godine ugosti}e „Boemklatschrecords”,koji}eseupetak 13.julapredstavitisvojvizuelni {uo sa ukupno {esnaest tri metra visokih projekcionih stubovanakoje}eseprikazivativideora|enposebnozaekipu koja}enastupititove~e-„Bart B More”, „Mike Mago”, „NAT 89”, „TWR72”, „Rip Tide”, „Pretty Young Trouble”, „Boemklatsch” i „Baskerville”. Programnaovojbini12.jula otvori}e ma|arski bend „Volkova Sisters”. Isto ve~e nastupa i najvrelija{panskaelektronska atrakcija„TheZombieKids”.Poredwih,gostova}eigrupamladih„BandaPanda„.

Subota je rezervisana za ruskiandergraund,prvinastupaju indibend„Trud”,poslewihsviraja gara`na atrakcija „Elektra Monsterz”, „Stoned Boys, zatim mlada producentkiwa i dixej „Ishome”,asvezavr{avajudixejevi Mark Schedrin i Leonid Lipelis. Na ovoj najmla|oj Egzitovoj bini predstvi}e se i neke od najzaniqivijih ve~eri beogradskogKulturnogcentraGrad,pa }eseupetakodr`ati„It’sADubstep Thing”, ve~e posve}eno dapsterzvuku. Nastupi}e i bliskoisto~na atrakcija „The Middle Beast„, a binu}eovegodinedazatvaraju „PlaygroundSyndicate„. A. L.

POLOVINOM JUNA UNI[TAVAWE AMBROZIJE

Korovsekosi na800hektara Polovinom ovog meseca JKP “Gradskozelenilo”kre}esako{ewemambrozijeugraduiprigradskim mestima. Korovska

biqkauni{tava}esena800hektara povr{ine, a u ve}ini slu~ajeva,mora}edasekosidvaputa do kraja akcije, odnosno do oktobra,ka`uu“Zelenilu”. Odlukuotomekoje}elokacije imati prioritet donose

stru~waci sa Prirodno - matemati~kog fakulteta i Poqoprivrednogfakulteta,kojimaje kaoilanepoverenposaomonitoringa.Stru~wacisova dva fakulteta izdava}e naloge,odnosnoraspored „Zelenilu” gde se nalazi ambrozija koju treba kositi. Ovegodineizgradskog buxeta za uni{tavawe ove korovske biqke izdvojenoje30milionadinara, koliko je „Zelenilu” za isti posao dato I pro{legodine,podse}aju usaop{tewu. Od 30 miliona dinara, 29,4 miliona bi}e utro{ena za ma{insko ko{ewe ambrozije, a 600.000 dinara za hemijsko uni{tavawe biqke. Hemijskimputemkorov}eseuni{tavati na lokicijama gde se ne ugro`ava qudsko zdravqe, u blizini deponija, oko potoka u prigradskim mestima i delovima gde ima veliki broj divqih deponija. Z. D.

dnevnik

U AMBULANTI U FUTOGU ZAVR[NI RADOVI

Pacijentimajulotvaravrata NovaambulantauFutogu,~ijajeizgradwa po~ela u decembru pro{le godine, trebalobidabudezavr{enadokrajaovogmeseca.Sru{enjestariobjekat,kojijebioneu-

Foto:R.Hayi}

slovan i nedovoqnog kapacitetazale~ewestanovnikaFutogainawegovommestugradisenoviDomzdravqa2,5putave}i. Utokusuzavr{nizanatski radovi, postavqawe zidne i podne keramike, gletovawe, kre~ewe i montirawesanitarija,apotom slediopremaweordinacija i prikqu~ewe na gradsku vodovodnu i kanalizacionu mre`u, te }e Dom zdravqa mo}i da po~ne s radom. U novom objektu povr{ine 1.200kvadratnihmetararadi}e{estlekara op{teprakse,~etiripedijatra,tristomatologa i ginekolog. Slu`be laboratorije, patrona`eiku}nogle~ewaima}esvojeprostorije.Uskladusnormativima,planirase

i internisti~ka ordinacija nekoliko dana unedeqi. InvesticijauFutoguko{taoko80milionadinaraiovojenajve}epro{logodi{we ulagaweGradauDomzdravqa. I. D.

NEOPHODNO, A NA DUGOM [TAPU

Gradskebolnicenema, gu`veprevelike Iakoseuposledwih15godina pri~a o potrebi izgradwe gradske bolnice, za razliku od Subotice,Zrewanina,Kikinde i Sremske Mitrovice, ovakva ustanova jo{ uvek ne postoji u glavnom gradu Pokrajine Vojvodine.NoviSadimaprimarnu zdravstvenuustanovuDomzdravqa, gde se obavqaju i specijalisti~ki pregledi, kao i tercijalnu zdravstvenu ustanovu Klin i~k i centar Vojvodin e, kojijerezervisanzate`ebolesnikeislo`enijeanalizeizahvate pacijenata iz cele Pokrajine. Zbog nedostatka gradske bolnice, ove dve ustanove su preoptere}ene, {to dovodi do zna~ajnog odlagawa le~ewa pacijenataiupisivawau~uvenulistu~ekawa. UnovosadskomDomuzdravqa dnevnosepregledaoko8.000pa-

- Osnivawem gradske bolnice cijenata,atozna~idagodi{we budeokotrimilionaposetale- uglavnomgraduPokrajineznatkarima. Zbog ogromnih gu`vi no bi se rasteretio i smawio na specijalisti~ki pregled se broj pacijenata koji dolaze u ~ekadu`eodzakonskipropisa- Klini~ki centar Vojvodine, u kojem se u ovanih mes ec dana, kvimuslovimaranaro~ito za of^lan Grad skog ve }a talmolo{ko, inde intervencije za zdravstvo ternis ti~ko i iz domena tercin e u r o p s i h i j a - prof. dr Aleksandar jalne i sekundartrijsko odeqewe. Kiraq smatra da }e nezdravstvenezaAzaodre|enein{tite – ka`e Kiizgradwa gradske tervencije u raqdodaju}idase bol ni ce po ~e ti tek za Klini~kom cende{ava da paci~etiri-pet godina tru ~eka se i po jenti le`e na ingodinu,dvedana. ternojklinici40 Zna~aj gradske bolnice bio dana~ekaju}inaintervencijuiz bi vi{estruk, smatra ~lan domenavaskularnehirurgije,koGradskog ve}a za zdravstvo ja pripada sekundarnom nivou prof. dr Aleksandar Kiraq, zdravstveneza{tite. ali smatra da nije realno o~eSvi su svesni da je gradska kivati da izgradwa po~ne usko- bolnica neophodna gradu, sa sve ro,anajverovatnijetekza~eti- ve}imbrojemstanovnika,alida ridopetgodina. biseovakavprojekatrealizovao

Promocijapadobranstva na[trandu Promocija padobranstva i novosadskog„Aerokluba”,au okviru projekta „Po`uri polako”, odr`a}e se sutra od 18 do22~asanacentralnomplatou[tranda.

U okviru promocije, gra|anima }e na video bimu biti prikazani takozvani tandem skokovi, o ~emu }e govoriti tandem instruktor Sava Suvajxi}. G. ^.

U DVE OSNOVNE [KOLE

Prvopismou~iteqici Akcija„Prvopismou~iteqici”,kojajenamewenau~enicima ~etvrtih razreda, sa ciqem da senalepna~inoprosteodu~iteqice,ovegodineodr`a}esei udvenovosadskeosnovne{kole -„IvanGunduli}”i„JovanJovanovi}Zmaj”.OrganizatorjePo{taSrbije,anakrajuakcije14.

junabi}eorganizovanaizlo`ba nagra|enihradova,kaoidodela nagradazanajlep{apismausedi{tu Radne jedinice po{tanskog saobra}aja „Novi Sad”, UlicaNarodnijheroja2.Nakon toga,nagra|eniradovibi}eizlo`eni u {alter sali Glavne po{te. G. ^.

^ITAOCI PI[U SMS

postoji niz prepreka. Pored ogromnih nov~anih sredstava, koje je te{ko opredeliti u ovakvojekonomskojsituaciji,neophodnojeobezbeditiilokacijui zemqi{te,obja{wavaKiraq. - Pored toga, prvo mora da se zavr{i Klini~ki centar Vojvodine,ostalesulamelaBiC,koje su ve} trebale da budu gotove pregodinu-dvedana,aistimbi se jedan deo Klini~kog centra rasteretio–isti~esagovornik. U Vojnomedicinskom centru u Petrovaradinupostojekapacitetiizacivilneosiguranike,koji uzuputsvogizabranoglekaramogudaobaveraznespecijalisti~ke preglede, dijagnostiku, kao i da do|u na red za hirur{ku intervenciju za najvi{e mesec dana. Ipak,tonijedovoqnodasepremosti nedostatak gradske bolniceuNovomSadu. I. Dragi}

OTVOREN KONKURS ZA KREATIVCE

Birase „najzelenija”pesma Pokret gorana Novog Sada i Gradska biblioteka raspisuju konkursza„najzeleniju”pesmuGrada.Kreativnostsemoraizrazitinatemu „@ivotnasredinairecikla`a”,au~esnicimogubitibendovi~iji~lanoviimajuod15do30godina.Konkurs,kojiserealizujeseusklopuprojekta“Budidrug,okrenisakwigomjedan krug”,otvorenjedo1.jula,abi}eodabranopetnajboqihnumerapoocenistru~nog`irija. Svibendovi~ijepesmebuduodabrane}eu~estvovatinakoncertu„zelenih”bendovakoji}eseodr`atiuna[tranduudrugojpolovinijula,abi}enagra|eniisnimawempesama,koje}e iza}inazajedni~komCD-u. Tekst pesme potrebno je poslati u elektronskoj ili {tampanoj formi, kao i audio snimak, na adresu Pokreta gorana,Pozori{nitrgbroj2ilinamejladresuoffice@pokretgorana.org.rs. A. L.

065/47-66-452

Mukezbogtopole Po{tovani, u ime stanara iz Bra}e Ribnikara, obra}alismoseJKP“Gradskom Zelenilu”, ali na`alost na{zahtevnijenai{aonaodobrewe.Naime,drvotopolekojesenalazi u Ulici bra}e Ribnikar na zelenoj povr{ini,poredputa,jesadaucvatuicvetkoji leti pravi problem stanarima okolnih zgrada.Zahtevalismodajeuklone,alismo dobiliobja{wewedatonijewihovanadle`nost.MolimoVasdanasuputitenaustanovu koja mo`e da nam pomogne u ovom slu~aju.Unapredzahvalni! 063/8587... *** Molim da ne {tampate  pod brojem 065/550338,tojeuzettu|ibroj 065/5503... *** Ameri~ki sportisti sa ponosom pevaju svoju himnu bilo da su poreklom Porikanci,Francuzi…,jersuameri~kidr`avqani itojenajnormalnije.Nijemijasnoza{to tonebibilonormalnoikodnasu Srbiji. Qaji} ka`e da sebenebicenioakobi zapevaosrpskuhimnu,a

~ijubionhimnudapevaakojedr`avqanin i reprezentativac zemqe Srbije. Ne mo`e dapo{tujesebeakobipevaosrpskuhimnu,a mo`esebedapo{tujeidabudeponosankadaigraidajegolovezatuistuzemquSrbiju.Etotiga~udanevi|enog. 063/5047.. *** Znate kako se pravi baza za recikla`u? Veoma jednostavno u prodavnici. Naime, uvedetedeponapetambala`u(limenke,staklo itd) ko donese dobije na kasi 5 dinara ili10,20itd.Dokneproradisistemistandard,ovobibilosamonu`noprelaznozlo. Ali kao i uvek svako zlo bude nekom dobro! 065/9137... *** Kakav motiv ima igra~ kada igra za reprezentaciju,kadnepo{tujedr`avuza kojunastupa?Nikakav.ZatonamQaji}i sli~ni nisu ni potrebni u srpskoj reprezentaciji. 065/8337... *** Nekafiskalnisavetprvoizdejstvujesmaweweplatasvihonih kojisunadr`avnomhlebu,neka i oni osete kako je `iveti sa 25.000dinara 062/9656...


nOvOSAdSkA HROnikA

dnevnik

subota2.jun2012.

9 Foto:R.Hayi}

INFORMATIKA ]E ANGA@OVATI PROFESIONALNE SUDSKE IZVR[ITEQE

Bi}enaplatedugova bezpardona Nakon{tosupolo`ilizakletvuuMinistarstvupravde,uNovom Sadu ubudu}e }e raditi 12 profesionalnihsudskihizvr{iteqa, a za po~etak, od ju~e radi wihsedmoro.Jednaodnadle`nosti sudskih izvr{iteqa su i komunalna dugovawa, a upravo od

prinudnenaplatestrahujeveliki brojsugra|ana.IzJKP„Informatika” ka`u da }e anga`ovati privatnesudskeizvr{iteqe. -Jo{uvekseneznakada}ese todesiti,anamajeuinteresuda bude{tobr`e.Kakojeovonovina,jo{uvekneznamonakojina-

~in}emosara|ivati,aliizvesno je da ho}emo - ka`e portparolka „Informatike”, Gordana Gale{ev. ^inisedajeovasituacijazateklanovosadskakomunalnapreduze}apo{toju~enisuimaliodgovornapitawedali}einako-

ji na~in koristiti usluge sudskih izvr{iteqa. Me|utim, pretpostavke su da }e pravnici imatipunerukeposla,jersepred sudom nalazi preko 90 hiqada predmetakojiseodnosenanepla}enekomunalnera~une. J. Z.

ZBOG DUGOVA „^ISTO]I”

Sme}esegomilau12preduze}a Pre dva dana JKP „^isto}a“ uputila je upozorewa na adrese dvadeset najve}ih du`nika u kojimasenavodida}e,ukolikosvojadospeladugovawaneizmireu roku od 48 sati, biti uskra}eni zausluguodno{ewasme}a.Samo 8 preduze}a uplatilo je deo potra`ivawa i zapo~elo pregovo-

re o otplati dugovawa, ka`u u „^isto}i“. Ovimfirmasma}ebitinastavqenoredovnoodno{ewesme}a, stim{tosuuobavezidatokom narednenedeqeizmirekompletnadugovawaizavr{epregovore o na~inu re{avawa dugova. Oni daqenavodedajeodno{ewesme-

}a obustavqeno u preostalih 12 preduze}a i to “Gradskom zelenilu”,“Neobusu”,“@eleznicama Srbije”,“[iponsu”,„Agrovojvodina komercservisu”, „Interservisu”, „Tu{u”, „Sajmu”, „Autovojvodini”, „Albusu”, Vobihausu”i„Interprogresin`iweringu”.Tako|e,izovogpredu-

ze}aka`udapreduze}akojaduguju koriste kontejnere, koji se uglavnomnalazeuwihovimdvori{tima,tedanagomilanosme}ene}eugro`avatigra|ane. U„^isto}i“ka`uda}euponedeqak slede}ih dvadeset du`nika dobiti upozorewa i rok zaizmirewedugovawa. Q. Na.

„VODOVOD” SE BORI S DU@NICIMA

@eleznicadobilavodu @elezniceSrbijeplatilesu danasdeodugaiobavezaleseda }e u ponedeqak wihova ovla{}enalicapotpisatiSporazum oreprogamuduga,takodajeprivremenoponovopu{tenavodaza Staruran`irnustanicuistambene objekte koji se nalaze na

istom vodu, stoji u saop{tewu „Vodovodaikanalizacije”. Tako|e,danassuposlateopomene pred iskqu~ewe Sportskomcentru„VujadinBo{kov”i „ZGOP”-u@eleznicaSrbijeu Industrijskoj ulici, a ukoliko ovipotro{a~ineuplatedeodu-

DANAS U KARLOVCIMA

Kwigaovinogradarstvu predpublikom Promocija26.kwige-zbornika „Vinogradarstvo i vinarstvo u Vojvodini” bi}e odr`anadanasu10satiusve~anojsali Karl ova~k e gimn az ij e. U programu u~estvuju vi{i kustos Muzeja grada Novog Sada Du{ank a Mark ovi}, novin ar Quba Vukmanovi}, istori~ar Jo`ef Sabo, publicista BogdanTaneIbrajter,gajda{Maksim Mudrini}. U toku promocij e bi} e uru~ en a priz naw a “Zlatno gu{~je pero”  autorima najvrednijih radova u ovoj kwiziDu{ankiMarkovi},Qubi Vukmanovi}u i Jo`efu Sabou.

Nakon promocije u 12 sati u~es nic i }e obi} i izl o` bu „Vinogradarstvo i vinarstvo Fru{ke gor e” u pal ati „Ilion”, u Ulici patrijarha Raja~i}a 16, gde }e ih poozdraviti direktorka muzeja grada NovogSadaVesnaNedeqkovi}Angelovski.Unastavku}ebiti emitovanidokumentarnifilm o ~uvenoj novosadskoj vinogradarskojporodiciAdamovi},te prire|ena degustacija vina uz komentare glavnog i odgovorenog urednika ~asopisa „Svet pi}a” Petra Samarxije. Organizator je Kulturno-istorijskodru{tvo„P~esa” .Z. Ml.

U CK13

Konkurszaletwi program Zainteresovanikoji`eledapostanudeoletwegprogramauOmladinskomcentruCK13,UlicaVojvodeBojovi}a13,trebadapo{aqu svoje predloge programa, akcija ili aktivnosti na mejl office@ck13.org. Prilikom pisawa predloga potrebno je odgovoriti napitawako,{ta,gde,kad,kakoi

za{toidatikratakopissadr`aja. Tim CK13 }e nakon ~itawa svih predloga pozvati zainteresovane ~ijesuidejeuskladusatehni~kim i drugim resursima i kapacitetima,kakobiseonedaqerazra|ivale i realizovale. Rok za slawe predlogajesreda,20.jun. A. Va.

ga i ne postignu sporazum o reprogramubi}eiskqu~eniuutorak. Usaop{tewusedaqeka`eda su svi ostali du`nici, osim „Neimara”, platili deo dugovawaizaostatakpolo`ilimenice, pa je tako u protekloj nede-

qiprihodovanooko30miliona direktnih uplata i oko 100 miliona dinara u menicama. Slede}enedeqenastavi}eseiskqu~ivawe poslovnih potro{a~a, ~ijijedugod500hiqadadomiliondinara. G. ^.

Predstavnicizaposlenihiz“Neobusa”iGradski odbor sindikata metalaca Novog Sada predlo`i}e u utorak na sastanku s predstavnicima pokrajinske administracije i iz Razvojne banke Vojvodine da se Fabrika autobus a “Neobus” pripojiGradskomsaobra}ajnom predu z e} u „Nov i Sad”(GSP) izj av io je preds edn ik sind ik at a metalskih radnika u NovomSaduNovakVasi}. - Bankarima i pokrajinskoj vlasti predlo`i}emo da “Neobus” bude u sklopu Gradskog saobra}ajnog preduze}a i da za gradskogprevoznikapravi autobuse. Takav primerve}postojiuBeogradu,gde tamo{we preduze}e “Ikarbus” radi za  beogradskog gradskog prevoznika. Isti primer je i u Ni{ugdefirma“NiBus”radi autobuse za tamo{weg ni{kog prevoznika - objasnio je Vasi}. Dodao je, da }e taj predlog od utorka proslediti i Gradu Novom Sadu  na razmatrawe. U Gradskom saobra}ajnom predu-

zna~idaradilegalno,alimnogojeonihkojiradeusivojzoni, pa ne podle`u nikakvim kaznama, jer potro{a~ nema dokaz ka`e predsednik ovog Ugru`ewaGoranPapovi}.

Ve}ina onih koji se `ale nemaju ra~un, pa Udru`ewe za za{titu potro{a~a ne mo`e da im pomogne, te neprijatnost ostaje kao nauk za{titupotro{a~aupozoravaju sugra|anedasedobroinformi{u pre nego {to anga`uju majstora. -Potro{a~imorajudobroproveritikomepoveravajuure|aje na popravku. Ukoliko majstorimaregistrovanufirmuu Agencijizaprivredneregistre

Na kvalifikacionom turniru Red Bull King of the Rock igranomna \a~kom igrali{tu pobedio je MarkoSavi} iobezbedioplasman nafinalniturniruBeogradu.Bilo je problema sa ki{om, ali ona ipak nije uspela da  omete igra~e koji`eledabudu„kraqevistene”, a dobar basket nawu{ila je i publikakojejebilouvelikombroju. PoredSavi}a,direktanplasmanu BeogradobezbedilisuiMarkoJeremi},JovanAnti},MarkoJankovi}, Igor Todorovi}, Mihajilo Vasi},NemawaPavlovi},Nikola Samojlovi},NikolaUgrica,Aqo-

{a ]erani}, Rajko Radinovi} i Du{an Cerovi}. Takmi~ili su se basketa{iizSrbije,CrneGorei Makedonije. Pro{logodi{wi predstavnikSrbijeuAmericiDu{an Domovi} Bulut se direktno plasiraoufinale. Ostale su jo{ kvalifikacije u Beogradukoje}eseigrati6.juna,i tada }e se znati svih 19 u~esnika zavr{ne borbe. Veliko finale igrase9.juna,apobednik}eseplasiratinasvetskimegdanu~uvenom zatvoru Alkatraz u San Francisku. D. Ig.

„Neobus”bipodokriqeGSP-a busa za poznatog kupca, {tojenajve}ibrojautobusaodkadajepreduze}e 1999. godine iza{lo iz ste~aja.U fabrici je zaposleno 220 radnika, koji ve} osam mes ec i ne primajuplate. “Neob us” je priv at izov an na aukc ij i 2004. Fab rik ujekup iobiz nismen iz Sau d ijs ke Arabij eMoh amed al iMag rabi koj iseudomov in ibavihax iprev oz omiuvoznompark uimaoko2.000 autob us a. Ve} in i tih autob us a proi zv ed en a je unek ad a{wempredu z e} u “Autok ar os er ij a”, sad a “Neob us u”, {to je  sau- dijs kog biz mis men a naFotoR.Hayi} vel o da kup i nov os ads ku fab rik u autob us a. Me| ut im, on se u predu z e} u nij e poj aU Gradskom saobra}ajnom preduze}u ju~e rekli vqiv ao, pris ut an je bio predsedn ik Upravn og odb or a Zoda }e se oglasiti kada dobiju pismeni predlog ran Kij ac kao maw ins ki vlasnik.Ju~ eniKij acnij ebiou ze}uju~esureklida}eseoglaFabrika autobusa je du`na „Neob us u”. Priv at iz ac ij a stitikadaotomedobijupisme- oko4,5milionaevra,aju~era„Neob us a” svoj ev rem en o je ni predlog.U “Neobusu” je ve} {wa blokada ra~una iznosila smat ran a jedn om od uspe{nimesecdana{trajkiposvojprije 220 miliona dinara.  „Neojih. licislediste~aj,ka`eVasi}. bus „je lane proizveo 60 autoZ. Deli}

Rizi~nimajstori izsivezone no, nisam dobio. Kada sam opet ukqu~ioma{inu,bilajeupribli`no istom stawu kao i pre popravke-ka`eBranislav. Ovakvesituacijesedde{avaju,izNacionalnogudru`ewaza

PobednikNovosa|anin MarkoSavi}

POSLE MESEC DANA [TRAJKA I PRETWE STE^AJEM

KAD POPRAVQENI KU]NI APARAT STANE

Kvarnama{inizave{,elektri~nom {poretu, fri`ideru ili zamrziva~u… to s vremena na vreme sna|e svako doma}instvo.Ukolikonemajusvogstalnog ku}nog majstora, zavrzlama s popravkom po~iwe, jer je ponuda elektri~ara {arolika, a iztogdijapazonatrebaizabrati ve{tog i jeftinog majstora. De{ava se i da se sugra|ani opeku, pa umesto vi~nog  anga`uju majstora dobrog jedino u napla}ivawu usluga. Ovo je zadesiloisugra|aninaBranislavaK,kojijezbogpokvarenema{inezave{moraodaanga`uje majstora. -Ma{inanijehteladapovu~e pra{ak.Majstorjene{to~eprkaopolasata,zameniojedandeo ikaopopravio,auslugunaplatio 2.000 dinara. Ra~un, narav-

NA \A^KOM IGRALI[TU BE[E ODLI^AN BASKET „JEDAN NA JEDAN”

Prema wegovim re~ima majstorikojineizdajura~unerade nacrnoitakvimradomo{te}ujupotro{a~a,aliidr`avu,jer nepla}ajuPDV. Iz Nacionalnog udru`ewa za za{titu potro{a~a ka`u da jemnogosugra|ana,kojise`alenaovakveprobleme,alika-

ko ve} in a wih nem a ra~ un, Udru`ewe ne mo`e da im pomogne, pa im ovakve situacije ostaju kao nauk za neki budu}i period. -Potro{a~imorajubitisvesnidaimamajstora,kojineznajusvojposao.Kadaanga`ujunekog za ku}ne popravke, majstor imnakonpopravkemoraizdati ra~un i uz wega prilo`iti papir na kojem }e biti napisano {ta je sve uradio da bi popravio ure|aj. Samo u ovakvim situacijamapotro{a~mo`ebiti za{ti}en-obja{wavaPapovi}. Papovi} tako|e nagla{ava, daseovakvimproblemimabave jed in o udru` ew a za za{ tit u pot ro{ a~ a i da bi dr` avn i organi trebalo vi{e da se anga`ujunaovompoqu. N. Radman


NOVOSADSKA HRONIKA

subota2.jun2012.

DANAS U GRADU BIOSKOPI Arena: „Ma~ak u ~izmama” (14.30, 16.15), „Kung fu panda 2” (13.15), „Hepi fit 2” (13.10), „[e{ir profesora Koste Vuji}a” (15), „Loraks” (13.30, 15.20), „Ogledalce, ogledalce” (13.05), „Ameri~ka pita: Ponovo na okupu” (21.45), „Legenda o kung fu zeki” (13), „Osvetnici” (14.45, 17.15), „Mra~ne senke” (18, 20.20, 22.40), „Pupijeva potraga” (11.15), „Diktator” (15, 16.45, 18.30, 20.15, 22), „Qudi u crnom 3” (15, 17.15, 19.30, 17.40, 20, 22.20), „Nedodirqivi” (20.10, 22.25), „Sne`ana i lovac” (17.20, 19.45, 22.15)

POZORI[TA Srpskonarodnopozori{te:57. Sterijino pozorje, scena „Jovan \or|evi}” balet „Mileva Ajn{tajn” (20)

MUZEJI Muzejgrada, Tvr|ava 4, 6433–145 i 6433–613 (9–17): stalna postavka „Petrovaradinska tvr|ava u pro{losti”; postavka Odeqewa za kulturnu istoriju MuzejVojvodine, Dunavska 35–37 (utorak - petak Ad 9 do 19 sati, subota nedeqa od 10 do 18 ~asova): stalna postavka „Sa~uvani tragovi materijalne i duhovne kulture Vojvodine od paleolita do sredine 20. veka”, „Vojvodina izme|u dva svetska rata - antifa{isti~ka borba u Vojvodini 1941 1945” MuzejskiprostorPokrajinskogzavodazaza{tituprirode, Radni~ka 20a, 4896–302 i 4896-345 (8–16): stalna postavka „Vi{e od pola veka za{tite prirode u Vojvodini” Petrovaradinskatvr|ava, 6433–145 (9–17): podzemne vojne galerije Spomen-zbirka„JovanJovanovi}Zmaj”, Sremska Kamenica, Trg J. J. Zmaja 1, 462–810: stalna postavka Zavi~ajnazbirkaSremskiKarlovci, Sremski Karlovci, Patrijarha Raja~i}a 16, 881-637:postavka „Vinogradarstvo i vinarstvo Fru{ke gore” Zbirkastraneumetnosti, Dunavska 29, 451–239 (9–17): stalna postavka „Legat doktora Branka Ili}a” Muzejp~elarstvaporodice@ivanovi}, Sremski Karlovci, Mitropolita Stratimirovi}a 86, 881–071 (10–18)

RO\ENI U novosadskom porodili{tu od prekju~e u 7 ~asova do ju~e u isto vreme rodile su: BLIZANCE: Sowa Radeti} (dva de~aka) i Jelena Karanovi} (dva de~aka) iz Novog Sada i BiqanaBoro{ (de~aka i devoj~icu) iz Zrewanina, DEVOJ^ICE: ZoricaLatifovi}, Bojana\uki} i JelenaKajari iz Novog Sada, Kristina\uki} iz Tovari{eva, SvetlanaStruhar iz Ba~a i MelitaDeli} iz Be~eja, DE^AKE: Tamara Malenkovi} i Jelena Vra~ari~i} iz Novog Sada i MilkaMarjanovi} iz Petrovaradina.

SAHRANE Na Gradskom grobqu u Novom Sadu danas }e biti sahraweni: Slobodan Todora Miloji} (1941) u 12.45 sati, Dragan Jovana Mil~i} (1949) u 13.30 i Olivera Arsenija Ga{i} (1935) u 14.15 sati. Na Alma{kom grobqu u Novom Sadu danas }e biti sahrawen Miodrag Vojina Jovanovi} (1929) urna u 11 sati.

DNEVNIK

VODI^

TElEfOnI VA@nIJIBROJEVI Policija 92 Vatrogasci 93 Hitna pomo} 94 Ta~no vreme 95 Predaja telegrama 96 [lep - slu`ba AMSJ 987 Auto-moto savez Srbije 987 Informacije 988 i 0900098210 Toplana kol centar 0800 100-021 reklamacije 24 sata 4881-104, za potro{a~e 420-853 Vodovod i kanalizacija, centrala 488-33-33 prijava kvara vodovod 0800-333-021 prijava kvara kanalizacija 442-145 ^isto}a 6333-884 “Novi Sad - gas” 6413-135 i 6413-900 JKP “Stan” 520-866 i 520-234 Kol centar preduze}a „Put” 6313-599 Kol centar „Parking servisa” 4724-140 „Gradsko zelenilo” marketing i PR 4881-633 rasadnik 403-253 “Dimni~ar”, 6622-705, 6615-834 „Elektrodistribucija” centrala 48-21-222 planirana iskqu~ewa i prijava kvara 421-066 @elezni~ka stanica 443-200 Me|umesna autobuska stanica 444-022 Prigradska autobuska stanica 527-399 Gradsko saobra}ajno 527-796 Gradsko grobqe 518-078 i 518-111 Pogrebno, JKP “Lisje” 6624-102 Pogrebna ku}a „Konkordija” 452-233 Dru{tvo krematista “Ogaw” 422-288 Ger. cent. - pomo} i nega 450-266 lok. 204, 205 Prihvatna stanica 444-936 Prihvatili{te Futog 895-760/117 Dnevni centar za stara lica 4889-512 Info centar za osobe sa invaliditetom radnim danom (od 10-15) 021/447-040 ili sms 066/447-040 Komunalna inspekcija 4872-444 (centrala), 4872-403 i 4872-404 (dispe~erski centar) SOS telefon za pu{a~e u krizi - od 7 do 10 ~asova 4790-668

APOTEKE No}no de`urstvo: “Bulevar” - Bulevar M. Pupina 7 (od 20 do 7)

c m y

10

420-374

ZDRAVSTVEnASlU@BA Dom zdravqa „Novi Sad”, kol centar 4879-000 Klini~ki centar 484-3484 No}no de`urstvo za decu u Zmaj Ogwena Vuka (subota i nedeqa) 6624-668 No}no de`urstvo za odrasle (Wego{eva 4) (subota i nedeqa i praznici) 6613-067 Vr{a~ka 28 4790-584 Klinika za ginekologiju i aku{erstvo 4899-222 De~ja bolnica 425-200 i 4880-444 Institut - Sremska Kamenica 4805-100

TAKSI Prevoz osoba ote`anog kretawa „Hendikeb” 432-005, 060/313-3103 Vojvo|ani - taksi 522-333 i 065-520-0-500 Pan-taksi 455-555 VIP - taksi 444-000, SMS 1088 Delta plus - taksi 422-244 Maksi Novosa|ani - taksi 970, 451-111 Grand - taksi 443-100 Luks 30-00-00 MB - taksi 500-222 De`urni taksi 6350-350 Halo - taksi 444-9-44, SMS 069/444-444-9

POLIKLINIKA „PEKI]” Gr~ko{kolska 3, tel: 426-555, 525-261, radnim danom od 8 do 20, subotom od 8 do 14

„KOMPAS” TOURISM& TRAVEL, Bul. Mihajla Pupina 15, tel: 6611-299, 6612-306, mail:kompas@eunet.rs

RADIOLO[KI KABINET „DIJAGNOSTIKA CENTAR”, rendgen, ultrazvuk, mamografija, [afarikova 13, tel: 572-646, 571-322

O^NI CENTAR „YINI]”, Vr{a~ka 34, tel: 639-5825, 520-961 GINEKOLO[KOAKU[ERSKA ORDINACIJA „TODOROVI]”, Bulevar oslobo|ewa 48/I Tel: 442-645, 677-91-20

AUTO-SERVIS „ZORAN”, automehani~ar - autoelektri~ar, tehni~ki pregled, Reqkovi}eva 57, Petrovaradin, tel: 6433-748 PREVOD DOO, Novi Sad, Resavska 3, sve vrste prevo|ewa, inostrane penzije, tel: 6350-664, 6350-740


vojvodina

dnevnik ОДРЖАНА КОНСТИТУТИВНА СЕДНИЦА СКУПШТИНЕ ОПШТИНЕ ШИД

Председник општине Наташа Цвијетковић ШИД: Јуче је одржана конститутивна седница СО Шид. Од 39 одборника седници је присуствовало 38, док је Никола Васић био одсутан. И тако ће бити све док се, по налогу Управног суда из Београда, не понове избори у Моровићу. Демократска странка у општини Шид формирала је на основу 4.600 гласова и 12 одборника у СО Шид добијених на Ђурђевданским изборима сад своју коалицију у коју су ушли, ДСС са седам одборничких места, СПС-Пупс-ЈС са шест одборника и ЛСВ са три одборника. Поменута коалиција је за председника СО Шид изабрала Жељка Брестовачког, а за његовог заменика др Бранислава Мауковића. Председница општине Шид Наташа Цвијетковић поново је именована на ту функцију, као и њен заменик Срђан Малешевић. За секретара СО Шид изабрана је Љубица Тодоровић-Славнић. У општинско Веће, поред председнице

Наташе Цвијетковић која руководи Већем и њеног заменика Срђана Малешевића, изабрани су: Слободан Боројевић, др Нађа Гнип, Драган Гутић, Живан Илић, Биљана Крч, Дејан Логарушић, Мирослав Смиљанић и Предраг Сремчић. Опозицију општине Шид представља СНС која је имала 3.179 гласова или осам одборничких места и СРС са 1.405 гласова или три одборничка места. У коалиционе односе ушле су четири странке, које су прешле цензус и формирали укупно 28 од 39 могућих одборничких места, а то значи да опозиција има скоро дупло мањи одборника него коалиција и не може чинити никакве преокрете, нити нешто мењати. Како ће новоизабрани општински парламент радити у наредном периоду, не зависи само од њих, већ и од других чинилаца. Д. Савичин

ОБНОВЉЕНА ЗГРА ДА ХИТНЕ ПОМОЋИ

Пацијенти одпонедељка умодерномпростору

ЗРЕЊАНИН: Реновирана зграда Службе хитне помоћи у Зрењанину од понедељка ће поново примати пацијенте. У њену адаптацију уложено је 7,5 милиона динара, од чега је из буџета града издвојено 6,2 милиона, док је остатак обезбедио зрењанински Дом здравља “Др Бошко Вребалов”. Зграда је сазидана 1935. године, увек је служила у медицинске сврхе, и ово је једна од највећих адаптација од тада. - Завршавамо причу која је кренула пре четири – пет година, када смо направили план реконструкције објекта у ком је смештена Служба хитне медицинске помоћи. Дом здравља, у оквиру ког се налази и ова служба, последњих година успео је да обнови опрему, комплетан возни парк који је поприлично велик и скуп, нарочито за Хитну помоћ, да развијемо информациони систем, а добили смо и акредитацију. Сада је преостало да адаптирамо зграду старе Специјалистичке поликлинике, у коју ћемо, у будућем периоду, моћи да уложимо наша средства - најавио је јуче директор Дома здравља “Др Бошко Вребалов” БориславЂорђевић.

Главни техничар Хитне помоћи МирославКопривица казао је да су после четврт века, колико је запослен у овој служби, грађани добили адекватан простор у коме им лекари могу пружити квалитетне здравствене услуге. - Свакодневно имамо велики број позива пацијената и веома је битно да радимо у адекватним условима. Имамо три лекарске екипе, а обављамо и санитетски транспорт свих пацијената који иду на дијализу или на контроле у Нови Сад и Београд – рекао је Копривица. Градоначелник Зрењанина Милета Михајлов, који је јуче обишао обновљени објекат Службе хитне помоћи, подсетио је да је ово само једна у низу здравствених амбуланти које је локална самоуправа обухватила својим пројектом обнове. - Очекује нас да у наредних неколико месеци завршимо и фасаду зграде, а већ сада са правом можемо рећи да смо, од 42 здравствена објекта на територији града, адаптирали њих 38 – нагласио је МиЖ. Б. хајлов.

subota2.jun2012.

НОВА СКУПШТИНСКА ВЕЋИНА У СРБОБРАНУ КРИТИКУЈЕ ВЛАСТ

Одржавањеседнице 10.јуланеприхватљиво СРБОБРАН: Представници постизборне коалиције у новом сазиву Скупштине општине Србобран коју чине Социјалистичка партија Србије – „Покрет за промене др Илија Газепов“ – Лига социјалдемократа Војводине, на конференцији за новинаре, оштро су критиковали одлуку председника Скупштине Ласла Бергела да закаже конститутивну седницу локалног парламента за 10. јул. Ова коалиција има скупштинску већину од 15 одборника од укупно 28 колико броји парламент у Србобрану. Председник ОО СПС Зоран Младеновић истакао је да су 28. маја упутила захтев председнику СО Србобран да се конститутивна седница закаже за 7. јун. - Очекивали смо да бар до 12. јуна буде заказана седница с обзиром на то да тог дана истиче четворогодишњи мандат претходног сазива. Добили смо позив за 10. јул што је два дана пре истека законског рока од 60 дана са јасним циљем да се скупштина не конституше и да идемо у правцу привремених мера, али тако нешто није могуће, јер ми имамо већину – напоменуо је Младеновић. Он је нагласио да ова коалиција такву одлуку неће прихватити, како је рекао, као готову ствар. - Упутићемо захтев ДушануМихајловићу као најстаријем одборнику у новом сазиву локалног пар-

Нова изборна коалиција

ламента, да закаже седницу за 12. јун. Ми ћемо на ту седницу доћи и с обзиром да имамо већину конститусиаћемо скупштину – казао је Младеновић. Такође, он је истакао да је рок за издавање државне земље у закуп 1. новембар, а да власт у општини Србобран, како је рекао, „наврат-нанос“ прави програм издавања пољопривреддног земљишта. - Ми смо нашим програмима предвидели да на тај начин упослимо 250 људи, а сада се жели то земљиште поделити пре нашег доласка на власт и то на дужи период. Ово што се дешава у Србобрану нема везе са ДС-ом, нема везе са СПСом, већ само са самовољом једног човека, предсденика општине Србобран Бранка Гајина – рекао је Младеновић и додао да је сарадња са Демократском странком могућа, али не и сарадња са Гајином.

Наруџбине отварају новараднаместа

СОМБОР: Коначна одлука Врховног касационог суда у Београду, којом је обустављена даља продаја имовине сомборској, још увек друштвеној, фабрици обуће “Борели”, једном од највећих произвођача и продајних ланаца обуће у Србији, дала је нови “ветар у леђа”. Наиме, како кажу у

се указати та прилика.- каже генерални директор “Борелија” Мирко Вујановић, истичући да би им у овом подухвату добро дошла званично прокламовано залагање за помоћ државе намењене проширењу производних капацитета намењених извозу. У ситуацији великог спољнотрго-

Шансазаскоро 150незапослених

ше и једни и други, директни контакт је врло битан, а своје биографије, популарни ЦВ, предало је преко 700 незапослених са евиденције Националне службе запошљавања у Старој Пазови. Јадранка Бубоња из те службе је задовољна одзивом и послодаваца и незапослних и сматра да је ово прави пут и начин, јер штеди време и послодавцима и незапосленим радницима. То су потврдиле и Радмила Вагић, чија фирма „Умпром“ Стара Пазова тражи пет радника без квалификације, за производњу пет амбалаже, као и Јелена Боћанин, „Технопласт“ Стари Бановци, који тражи три радника: конструктора алата, програмера и реглера на машинама. По оцени учесника, ово је један од највећих сјамова запошљавања које је Национална служба организовала у Старој Пазови до сада, а после увида у све пријаве, стручне службе предузећа ће одлучити ко ће добити посао. На сајму се појавило највише младих, неки траже посао и по 7-8 година у струци, радећи уз пут све што им се понуди, а за разлику од ранијих сајмова запошљавања, овога пута је мање старијих радника, иако их има, нарочито металаца и текстилаца који су остали без посла тек неколико година пре пензије. А. Мали

Предсденик ОО ЛСВ АлександарЈојкић је указао да ће општина Србобран бити последња у Србији која ће конституисати локални парламент. - То је неприхватљиво, јер се прави ружна слика да је у овој средини проблем да се формира власт што није случај, с обзиром на то да сми ми то могли да урадимо три дана после избора – рекао је Јојкић. Носилац листе „Покрет за промене“ др Илија Газепов назвао је овакав поступак, још увек актуелне владајуће већине, неразумним и неморалним. - Сваки наредни дан, можемо очекивати да ће они злоупотребљавати власт као што су то радили у протеклих осам година и да ће обављати радње које иду само на штету грађана општине Србобран – истакао је Газепов.

ВЕТАР У ЛЕЂА СОМБОРСКОЈ ФАБРИЦИ ОБУЋЕ „БОРЕЛИ”

ОДРЖАН САЈАМ ЗАПОШЉАВАЊА У СТАРОЈ ПАЗОВИ

СТАРА ПАЗОВА: Национална служба за запошљавање, филијала Сремска Митровица, организовала је у Старој Пазови, први пут ове године, сајам запошљавања. Шансу за посао дало је 23 послодавца са подручја старопазовачке општине. Тражени су радници из разних области делатности, разних струка и степена стручне среме, од неквалификоване раде снаге до инжењера, где су машински инжењери и информатичари најтраженији. Према оном што су на сајму запошљавања тражиле фирме, шансу за посао има око 150 незапослених са подручја ове сремске општине. „Мухлбауер“ и „Грунфос“, на пример, траже по 15 радника, Д.О.О. Ентер рос 16, Друштво за афирмацију инвалида „Феникс“ 11 персоналних асистената, „Младинска књига“ 10 радника, по пет радника траже „Медиус“, „Умпром“, „Инком трејдинг“, „Технопласт“, „Не стле“, „Стаменски“, а тражени су информатичари, машински инжењери, инжењери саобраћаја, техничари за компјутерско конструисање, магационери, продавци, шнајдери, тапетари, возачи, администратори, кондитори. Циљ оваквих сајмова је директно сусретање понуде и потражње, тачније незапослених и послодаваца, јер, како нам реко-

11

Погон сомборског „Борелија”

овој фабрици, повећан је обим наружби из иностранства, па постоји и потреба за пријемом нових радника. - Због повећаног обима посла морали бисмо, да поред постојећих 500 радника, запослимо још четрде сетак, али како немамо средстава да инвестирамо и у нове машине, неизвесно је када ће

Мини олимпијада ЗРЕЊАНИН: У спортскорекреативном центру “Партизан”, преко пута главне аутобуске станице у Зрењанину, данас ће од 10 до 15 часова, бити одржана пета мини-олимпијада војвођанских удружења за помоћ ментално недовољно развијеним особама, под називом “Упркос свему - дохвати живот”. На овој манифестацији ће учествовати око 200 младих из десет градова Војводине. Такмичари ће се надметати у пет дисциплина: трчање, рушење чуњева, бацање обруча, надвлачење конопа и бацање кугле са рамена. Ж. Б.

винског дефицита Србије, када динар рапидно губи своју вредност, али и у светлу чињенице да се ради о друштвеној фабрици, што по дефиницији искључује богаћење појединаца, очекивано би било да држава препозна потенцијал сомборских обућара и да помогне као што је то чинила у до сада бројним случајевима у

другим срединама, али…У “Борелију” су једва дочекали да се заустави, испоставило се противправно, “черупање” имовине њховог предузећа од стране некадашње фирме-мајке, хрватског комбината коже и обуће “Борово”, па су задовољни што им макар тај економски “Дамоклов мач” не виси над вратом. - Највећи део производње је намењен извозу у Италију и Словенију, а тренутно производимо око 1800 пари обуће дневно, тако да је очекивана производња за ову годину око 360.000 пари - каже Вујановић, према чијим је речима, због великих поружбина сомборским обућарима, поред сменског рада, свака субота радна. Мада, су, као и у целој обућарској бранши, зараде “борелијеваца” још увек далеко од статистичког српског просека, крећу се око 23.000 динара, оне представљају сламку спаса за овдашње обућаре и њихове породице у граду који бележи никада вишу стопу не запо слено сти. Наиме, према званичним подацима овдашње Регионалне привредне коморе сваки четврти Сомборац и Сомборка су незапослени, тачније, стопа незапослености је чак 24 одсто. Да ли је ово податак који ће нагнати државу да помогне сомборским обућарима да прошире капацитете и запосле нових и младих 40- так људи, остаје да се види. М. Миљеновић

Изложбапаса свихраса БЕЧЕЈ: Кинолошко друштво Бечеј угостиће данас у парку крај Ловачког дома на Националној изложби паса свих раса ЦАЦ – Бечеј 2012. бројне власнике, одгајиваче и љубитеље паса из земље и иностранства. - С обзиром на то да је могуће пријавити пса и данас до почетка манифестације, неће бити изненађење ако на овогодишњој изложби видимо и 400 паса. Ко данас буде пријавио пса платиће котизацију 1.200 дина-

ра ако је домаћи власник, а 15 евра у динарској противвредности ако је из иностранства - рекла је у име организатора Сања Момчиловић-Богнич. Организатор је већ обележио девет рингова између вишедеценијских дрва, где ће исто толико међународних судија од 10 сати почети оцењивање. Проглашење победника по расама, узрасту и избор најлепших паса изложбе предвиђени су за по подне, када ће бити уручени и В. Ј. бројни пехари.

Он се посебно осврнуо на однос власти према србобранском Дому здравља за који, како је рекао, Општина као оснивач, у протеклих неколико година, није издвојила никаква средства. - С обзиром да ова власт може да обавља само текуће послове, може се десити да амбуланта у Надаљу буде затворена по налогу инспекције, јер не постоји санитарни чвор за пацијенте – рекао је Газепов. Иначе, у образложењу председника СО Србобран Ласла Бергера, стоји да је конститутивна седница заказана 10. јула како би „сви актери будућег локалног парламента добили прилику и довољно времена за коалиционе разговоре и преговоре, али и да је ова одлука донета у интересу општине Србобран, јер би у овом року требало да се изнађе најбоље решење за локалну саМ. Кековић моуправу“.

VESTI Недостајекрв свихгрупа КИКИНДА: Одељење за трансфузиологију упутило је апел суграђанима да добровољно дају крв. Према речима начелнице Одељења трансфузиологије др СрбиславеДрндарски, недостаје крв свих крвиних група: -Тренутно имамо повећану потрошњу крви на шта не можемо да утичемо. Апелујем на добровољне даваоце и све грађане да дођу и дају крв. У овом моменту недостају нам све крвне групе и осим што је повећана потрошња, током лета уобичајен је мањи број добровољних давалаца крви. Крва се може дати сваког радА. Ђ. ног дана од 7 до 11 сати.

Сремска куленијада у Ердевику ЕРДЕВИК: Привредна комора Срема, МЗ Ердевик, Покрајински секретаријат за привреду и општина Шид заједнички организују 13. по реду Сремску куленијаду у Ердевику, која почиње данас. Манифестација промовише и негује израду најбољег свињског кулена, а сваке године овде се сјате најбољи произвођачи. У центру села поставиће се 100 штандова за рекламу и за продају кулена. Поред кулена, присутни ће моћи да дегустирају сир, вино и сремски хлеб. Након оцењивања кулена, обавиће се проглашење победника и додела диплома најбољим произвођачима. Први пут ће победнику доделити златник од пет грама, други пласирани ће добити златник од три грама, а треће пласирани златник од два грама. Током дана биће доста културних манифестација па Ердевичани се надају доброј посети, а гости ће уживати у врхунским квалитетним изК. В. ложених производа.


vojvodina

subota2.jun2012.

Изборна скупштина ДВД Житиште

АПЕЛЗАПОМОЋОПШТОЈБОЛНИЦИУКИКИНДИ

Симболични поклонинедовољни

ЖИТИШТЕ: На изборној скуп-

штини Добровољног ватрогасног друштва у Житишту изабрано је председништво, које чине: председник Ненад Давидовић, потпредседник Ђорђе Мартин, секретар Петар Станић, командир Зоран Давидовић, благајник Миленко Гужвица, те два члана Зоран Катић и Милан Еремић. У Надзорном одбору су: Милан Лацков, Горан Рељић и Чеда Гуранов. Изабрана су два и делегата Петар Станић и Бранислав Степанов. Присутно је било 40 делегата, који су једногласно изабрали ново рукоВ. Х. водство.

Упозорење пчеларима уЗрењанину ЗРЕЊАНИН: Третмани са земље против одраслих комараца на подручју општине Зрењанин биће изведени у периоду од понедељка 4. јуна, до понедељка 18. јуна, саопштила је новосадска „Циклонизација“. Како се наводи, тачно место и време третмана зависиће од резултата мониторинга и временских услова, а препарат којим ће се радити је „icon“ са активном материјом „lambda-cihalotrin“. Упозоравају се пчелари да је препарат токсичан за пчеле, те да кошнице уклоне најмање пет километара од наведеног места третирања. Дејство препарата траје три дана.

dnevnik

c m y

12

МладерумскеатлетичаркеуГрадскојкући

ПРИЈЕМЗАУЧЕНИЦЕРУМСКООСНОВНЕШКОЛЕ

Захвалницеипаре најбољима

РУМА: Јуче је у румској Градској кући одржан пријем за ученице румске Основне школе „Душан Јерковић“, које су, на недавно завршеној Школској олимпијади у Сремској Митровици, екипно освојиле бронзану медаљу у атлетици, као и за ученика Средње техничке школе „Миленко Брзак - Уча“ ПетраЂуричића, који је на истом такмичењу освојио златну медаљу у скоку у даљ. Том приликом су свима додељене завалнице и новчани износ од три хиљаде динара. - Ваш успех је постигнут захваљујући доброј организацији и вашем великом труду. Свима вама желим да наставите да се бавите спортом јер је спорт јако важан у периоду одрастања и припреме за живот. Овај ваш успех доказ је да ћете сви бити веома успешни у животу, а ми смо ту да вам у постизању успеха помогнемо – казао је председник румске општине ГоранВуковић.

Овим успехом младе Румљанке су доказале да су најбоље у овој дисциплини на територији Срема, јер су се испред њих нашле екипа из Јагодине и Новог Сада. Поред самих такмичарки, успехом је презадовољна и наставница Љиљана Орловић која је девојчице припремала за такмичење и која истиче: - Конкуренција је била веома јака. Девојчице су много радиле и ова медаља је за нас златна, јер смо доказале да смо најбоља екипа у региону. Све младе атлетичарке су биле једногласне у ставу да су успехом веома задовољне, али и да су припреме биле веома напорне. Награђене младе атлетичарке су Драгана Даниловић,СоњаБјелић,Дејана Мандић, Николина Момчиловић, Теодора Алексић, Славица Новевски, Тања Столић, Јована Павловић, Тијана Филиповић и Ј.Антић КсенијаТаневић.

Колце на ТргуСветог тројства

СОМБОР: Као и матуранти широм Србије, и њихове колеге и колегинице у Сомбору ових дана бучно, весело и распојасано прослављају крај овог дела свог школовања. Неизоставан део матурантског фолклора су и трубачи, од чијих лимених инструмената ових дана одјекују сомборске улице, а као по правилу свака од матурантских „процесија„ заврши се на главног варошком Тргу Светог тројства, на коме се тек пунолетни свршени ђаци често ухвате и у ситно колце. Сада, кад су средњошколско образовање привели крају, имају неколико дана да се веселе, а након „трежњења„ преостаје им да се подухвате спремања пријемних испита на факултетиМ. Мћ ма или тражењу посла.

КИКИНДА: Локална самоуправа наставља акцију помоћи Општој болници у Кикинди. Ситуација у здравству је алармантна и тешка, истакла је помоћница председника Општине ГорданаБулатовићи додала да, осим што недостају лекари специјалисти, проблема има и са набавком опреме и свакодневних потрепштина: - Симболичним поклонима, који су, по мени, недовољни помажемо, али апелујем и на медије и на јавност да се сви укључе и помогну да се купе креветнина, јастуци, пешкири, пижаме што је свакоме неопходно када је у ситуацији да користи услуге Болнице. Донели смо пелене и пешкире за Порођајно одељење, за шта су издвојене 44 хиљаде динара из буџета, а жеља нам је да покренемо ширу јавност да помогну кикиндској Болници. -Најкритичнији су порођајни столови. Имамо три порођајна стола и сваки је стар више од 40 година. Један нов и опремљен кошта око четири хиљаде евра, а нисмо у ситуацији да сами било шта учинимо, те бих молио грађане да нам помогну и у обнављању најнеопходније опреме. Дошли смо у ситуацију да се већ трећа генерација жена порађа на истим столовима, који су већ дали свој максимум.

Најкритичнијипорођајнистолови

Неопходно је и такозвано хладно светло, односно лампе које су фиксиране на поду, а ове које се користе, старе су 25 година. Од почетка године, до данас на Порођајном одељењу рођено је 187 беба, што је тридесетак мање него у истом периоду прошле године, која је била година са најмањим бројем порођаја - каже начелник Гинеколошког одељења др ПредрагВељковић -Велики број специјалиста, двадесетак, одлази у пензију у наредних пет година, а по нормативима које је

прописало надлежно Министарство Болници недостаје двадесетак лекара. Од Министарства смо небројено пута тражили да нам одобри пријем нових лекара, који би одлазили на специјализације. Кадровски план за прошлу годину добили смо 24. децембра 2011. године, када је година била на измаку - кеже директор Опште болнице др ДушанКоларовић На специјализацији тренутно има седам лекара и то из гинекологије, педијатрије, анестезиологије, А.Ђ. рентгенологије.

ЗАВРШЕНЕ 55.МАЈСКЕ ИГРЕ У БЕЧЕЈУ

„Златни паж” припао балеринама

Два жирија и награђени актери Мајских игара

БЕЧЕЈ: Традиционална, конзервативна и у исто време раскошна. Необично обична представа с много талентоване деце. Представа која је и лекција из историје, музике, игре... Ово је образложење Стручног жирија 55. Мајских игара у Бечеју за балетску представу „Орашар“, коју су по музици Петра Илича Чајковског извели чланови Балетског студиа Креативног училишта Дома културе у Сиску и којима је припала престижна победничка награда „Златни паж“. Кореографију победничке представе потписала је Јасминка Петек-Крпљан и припала јој је награда за сценски покрет, Александар Фрањић је освојио награду за визуелни утисак, а Данијела Гргорач-Готал за костимографију. „Сребрни паж“ је припао мјузиклу „Чудесна коцка“ Дечијег драмског студиа Градског позоришта Бечеј, коју је по тексту Павла Јанковића – Шола режирао његов син Богдан Јанковић и освојио награду за најбољу режију. Када је ова

представа у питању, лауреат је и композитор Мирољуб Аранђеловић –Расински, који је добио награду за оригиналну музику, као и пре 23 године када је са истом представом на истим Играма, наравно са другим актерима на сцени, био учесник најстаријег фестивала дечијег сценског стваралаштва у нас. „Бронзаним пажом“ награђена је представа „Др Бубо“, коју су на мађарском језику припремила деца из братских градова Бечеја и Чонграда под вођством Маргит ЋукасИмрене и Иштвана Пошта. За разлику од Стручног жирија, драматурга из Београда Александара С. Јанковића и новосадске глумце и редитеље Јудит Ференц и Игора Павловића, Дечији жири предвођен Петром Живковићем сматрао је да је најбоља представа овогодишњих Мајских игара „То је пропаст твоја“ у извођењу Драмског студиа „Арлекино“ из Брчког. Једино у чему су се оба жирија сложила је млада глумица из Бече-

ја Катарина Вишковић. Јер, Дечији жири је овој талентованој девојчици доделио награду за најбољу женску улогу, а и Стручни жири је рангирао међу три равноправне најбоље улоге фестивала, заједно с њеном колегиницом из исте представе „Чудесна коцка“ Јованом Радојчић и Мајом Милошевић из Српске Црње за улогу у представи „Чудесне авантуре Лене и Еме“. Када смо код глумачких признања, Дечији жири је награду за најбољу мушку улогу доделио Озрену Чулићу из Брчког, Стручни жири је доделио и две равноправне награде за епизодне улоге, које су припале Ведаду Подбићанину из Брчког и Браниславу Ролићу из Мркоњић Града, као и специјалну глумачку награду Асји Чандић из Брчког, која је, иако девојчица, с пуно ентузијазма одиграла улогу дечака, односно с четири и по године најмлађој и најслађој актерки на сцени овогодишњих Игара Бечејки ФиоВ.Јанков ни Ловаш.

Завршен фестивал„Колибри стар”

ТЕМЕРИН: Трећи Дечји фестивал „Колибри стар“ одржан у спортској хали у Темерину. Након више аудиција за финале се пласирало 33 певача, ученика основних школа из десетак војвођанских општина. По оцени стручног жирија у конкуренцији ученика нижих разреда победила је Милица Танасић из Бачког Јарка, испред Немање Марковића из Бачког Брега и Јелене Карановић из Темерина.

У старијој групи прво место освојила је Александра Остојић из ОШ „Петар Кочић“ из Темерина. Други је Саболч Лоц, треће место освојио је дует Силвиа и Саманта Тот, сви из ОШ „Имре Кокаи“. Награду публике освојила је Милица Тадић из Темерина. Похвале за организацију фестивала „Колибри стар“ припадају запосленима у КИЦ „Лукијан М.М. Мушицки“.


dru[tvo

dnevnik MIROSLAVUVESKOVI]UIDRUGIMANDATREKTORA UNIVERZITETAUNOVOMSADU

Univerzitet pomeriprostora ivremena Sada{wi rektor UniverzitetauNovomSaduprof.dr MiroslavVeskovi},fizi~ariredovni profesor Prirodno-matemati~kogfakulteta,~ijiprvitrogodi{wimandatnaovojfunkciji isti~e 30. septembra, ~elni ~ovek jedinog dr`avnog univerziteta u Vojvodini, bi}e i u narednom mandatu, od 1. oktobra ovegodinedo30.septembra2015. - odlu~io je ju~e Savet UNS. Rektora Veskovi}a su kao jedinog kandidata predlo`ili fakulteti,institutiistru~nave}a,predlogjeutvrdiouniverzitetski Senat, a na ju~era{woj izbornojsedniciSavetaUNS-a, tajnimglasawem,onjeiizabran. Od 29 ~lanova ovog najvi{eg univerzitetskog organa upra-

da jo{ kao kandidat za slede}i rektorski mandat) javno predstavioprogramaradauSve~anoj sali Fakulteta tehni~kih nauka.Uzopaskuda„susviovdesvesnidaistorijanepo~iweodnas, ali se s nama ni ne zavr{ava”, podsetio je na najzna~ajnije rezultate minulog dvoip  ogodi{wegradaizaistaimpresivnih rezultata u svim domenima: obrazovawu, nau~noistra`iva~komiumetni~komradu,ja~awui {irewu saradwe s privredom, stalnom ja~awu kvaliteta, razvijawumobilnostinastavnikai studenata... U tom periodu UNS jeobele`ioipolavekapostojawa,dobionajpresti`nijenagrade i nametnuo se kao lider, naravnosasvojomporodicomod14

Okapeliza`rtvepo`arau„Kontrastu” Na ju~era{woj redovnoj sednici Savet UNS-a razmatrao je informacijuoinicijativizaizgradwukapele`rtvamapo`ara u diskoteci „Kontrast”, u okviru Kampusa. Inicijatori, koje podr`avaivi{ehiqadaprikupqenihpotpisastudenataigra|anaNovogSada,zamislilisudatajobjekatbudenatravnatoj povr{iniizanoveCentralnezgradeUNS-a,blizukeja,krajDunava.Nijednogmomentanedovode}iupitawepodr{kuidejida senekimobele`jemmoraovekove~itiuspomenanatragi~noizgubqenemlade`ivote,SavetjekonstatovaodaUniverzitetnijevlasnikve}korisnikzemqi{tanakojemjeKampus,kaoida postojiGeneralniurbanisti~kiplanrazvojaKampusa.Zatoje re~eno je da o realizaciji pomenute inicijative svakako mora daseodrediGradskizavodzaurbanizam. vqawa,prisutnojebilo26ijednoglasno su ukazali poverewe MiroslavuVeskovi}udarektorsku funkciju obavqa i u narednommandatu. Glasawem za rektora ~lanovi Savetasuautomatskiizabralii trojeprorektorakojejeonpredlo`io.Zaprorektorkuzanastavu izabrana je dr Zita Bo{wak, profesorka Ekonomskog fakulteta, prorektor za finansije i organizacijujedrRadovanPejanovi}, profesor Poqoprivrednog fakulteta, dok je prorektor za nauku i me|unarodnu saradwu dr Pavle Sekeru{, profesor Filozofskogfakulteta.Pejanovi} i Sekeru{ su i u aktuelnom prorektorskomtimu,smandatom do 30. septembra, tako da i oni zapravoostajunasvojimfunkcijamaiod1.oktobraovegodinedo 30. septembra 2015. Aktuelni prorektor za nastavu dr Milan Simi}, profesor Medicinskog fakulteta, sprema se u penziju, ali }e na ovoj funkciji biti do posledwegdanaseptembra. Pre izborne, a odmah zatim i redovne sednice Saveta, odr`anihuRektoratu,Veskovi}je(ta-

fakulteta i dva razvojno-istra`iva~ka instituta, u mnogim oblastimanesamouSrbijive}i {ire... Govore}iobudu}emradu,rektorjeistakaodaje`eqadaUNS pre svega bude „univerzitet po meri prostora i vremena”, onih koji na wemu rade, istra`uju i studiraju,darazvijakreativnoi produktivnoznaweistvorinove vrednosti na razli~ite na~ine. Da poboq{ava kvalitet vaspitno-obrazovnog i nau~noistra`iva~kograda,dasepovezujesuniverzitetima sli~nim po starostiiveli~ini.UKampusuUNSazavr{avaseizgradwaCentralne zgrade Univerziteta i prvi objekat ( faza) budu}eg Nau~notehnolo{kog parka, a uskoro }e startovatigradwaglavnogNTPa,{tosu25milionaevravredne investicije,kojejeunajve}ojmeriobezbediladr`ava. - @elimo da budemo jedan od nosilaca znawa na Zapadnom Balkanu-poru~iojerektorVeskovi}, podsetiv{i da su 50.000 studenatai4.500zaposlenihsna`anpotencijal. V.^eki}

IN MEMORIAM

RadovanBigovi} (1956 – 2012)

Protojerej-stavrofor profesor Radovan Bigovi}, ro|en u Nik{i}u1956.godine,preminuojepreksino}uBeogradu.Zavr{iojePravoslavnibogoslovskifakultet,nakomejeidoktorirao,iFilozofskinagrupizafilozofiju.Udvamandataje biodekanPravoslavnobogoslovskogfakulteta.Smatrasejednimodnajve}ihteologadana{wice.Bioje~lanUdru`ewakwi`evnika Srbije i urednik filozofsko-teolo{ke biblioteke „Slu`benogglasnika”RepublikeSrbije. Porednizakwiga,objaviojeokostostudija,~lanakaiesejau raznim ~asopisima u zemqi i inostranstvu. Posebno se bavio odnosimaCrkveidru{tva.Biojevr{ilacdu`nostistare{ine manastiraSvetogArhangelaGavrilauZemunuijedanjeodosniva~a Hri{}anskog kulturnog centra i wegov vi{egodi{wi predsednik.DobitnikjeZlatnezna~keKulturno-prosvetnezajednice Srbije, Zlatnog beo~uga Kulturno-prosvetne zajednice Beogradaiplaketezaslu`noggra|aninaZemuna.

StjepanGredeq (1953 – 2012) ^lanSavetazaborbuprotivkorupcijeisaradnikInstituta zafilozofijuidru{tvenuteorijuStjepanGredequmroje30. majauBeogradu,posledu`ebolesti. Gredeqjero|en1953.uSkopqu,aosnovnu{koluigimnaziju zavr{iojeuBeogradu.DiplomiraonaFilozofskomfakultetu UniverzitetauBeogradu,1978.godine,gdejeidoktorirao1993. godine.Odd1982.biojezaposlenuInstitutuzafilozofijui dru{tvenuteoriju,~ijijedirektorbiood2003.godine.Bioje glavni i odgovorni urednik ~asopisa „Sociolo{ki pregled”, „Filozofijaidru{tvo”.Objaviojeprekopedesetnau~nihradovauzemqiiinostranstvu.

subota2.jun2012.

13

NERASPOLO@EWE,UMORIBEZVOQNOSTSIMPTOMIPROLE]NEDEPRESIJE

Stigmako~iodlazak kodlekara Napetost,bezvoqnost,malaksalostistalan umor,izbegavawedru{tva,potrebazasnom,gubitak apetita ili stalna potreba za hranom mogu biti simptomi prole}ne depresije koja mo`eozbiqnodauti~enasvakodnevneaktivnosti.Sezonskadepresijajavqasesvakesezone uistovreme,anaj~e{}ezimiiuprole}e.Od wenaj~e{}epate`eneizme|u40i50godina.

Na nedavno odr`anom kongresu Svetske psihijatrijske asocijacije u Sankt Peterburgu re~eno je da }e depresija do 2030. godine postati vode}i zdravstveni problem -Naravno,nijeusvimslu~ajevimadijagnoza depresija-ka`edrSla|anaPopovi}. -Malaksalost i umor mogu bit posledica jednoli~ne zimske ishrane i pomawkawa vitamina, a neraspolo`ewemo`ebitiizavanomawkomsun~evesvetlostiiuticajemmeteorolo{kihzbivawakojimasunaro~itpodlo`nemeteoropate.Ukolikoovakvoneraspolo`ewetrajenedeqama, savetuje se odlazak kod lekara. Na `alost,depresija,kaoiostalipsihi~kiporeme}aji,kodnassejo{uvekkriju,te{koihqudi prihvatajuipriznaju,pasamimtimretkozbog wihodlazekodlekara.Sklonijismo„samole~ewu”kojesenaj~e{}esvodinauzimawupiluSrpski manastiri i crkve u rumunskom delu Banata bi}e predstavqeni kroz izlo`bu fotografija “Svedoci trajawa” koja }e u utorak, 5. juna, u 19~asova,bitiotvorenauMalom salonu Narodnog muzeja Zrewanin.Autorizlo`bekoja }etrajatido19.junajenovinar izZrewaninaMiloradSavi}, afotografijepotpisujefotoreporterizNovogSadaDarko Dozet.Projekat“SrpskimanastiriicrkveuRumuniji”prihva}en je na konkursu Ministarstvaveraidijasporeipodr`ali su ga Pokrajinski sekretarijatzakulturuiinformisaweigradZrewanin.

lazasmirewe,{tosvakakonijeodgovaraju}a terapijazadepresiju. U~estalostdepresivnihporeme}ajajevelikaiusvetu.Procewujesedausvakomtrenutku  od dva do ~etiri odsto stanovni{tva ima nekioblikdepresije.Rezultatijednestudije pokazujudaoko50odstodepresivnihqudinikadanezatra`ipomo}.Istitolikiprocenat depresivnihkojisejavelekaruop{temedicinenebudedijagnostikovan.Odpacijenatakod kojihsepostavidijagnozadepresijesamo50odstobudele~eno,aodonihkojisele~e,samopolovinabudeadekvatnole~ena.Takootprilike svaki{esnaestidepresivni~ovekprimiadekvatnuterapiju. Istra`ivawe Instituta za javno zdravqe „Batut”pokazalojedajedepresijakod4,4odsto`enai2,4odstomu{karacakonstatovana kaooboqewe.DepresijajeuSrbijime|uvode}im poreme}ajima zdravqa - zauzima ~etvrto mesto,izaishemijskebolestisrca,cerebrovaskularnihoboqewairakaplu}a.Nanedavno odr`anom kongresu Svetske psihijatrijske asocijacijeuSanktPeterburgure~enojeda}e depresijado2030.godinepostativode}izdravstveni problem. Crne slutwe izrekla je i Svetskazdravstvenaorganizacija,prognoziraju}ida}edo2020.godinedepresijabitidruga bolest(poslesr~anihoboqewa)kojaprouzrokuje invaliditet, i problem broj jedan u „zemqamatre}egsveta”. -Oveprognozesamogovoreda}esepsihi~kimporeme}ajima,me|ukojimadepresijazau-

zimazna~ajnomesto,ubudu}emoratipoklawatidalekove}apa`wa.Lekarimaop{teprakse potrebna je dodatna edukacija kako bi bili osposobqenidalak{euo~edepresijukodsvojihpacijenata,amora}evi{edaseradiina smawenu stigme me|u gra|anima koja prati psihi~keporeme}aje-ka`edrPopovi}. J.Barbuzan

SRPSKEBOGOMOQEURUMUNSKOMDELUBANATA

Svedocitrajawa Uz dva panoa, sa uvodnim tekstom i ~etiri mape, postavka ima 43 panoa sa fotografijamasvihpetmanastira ive}egbrojacrkava,urumunskom delu Banata, gde po posledw em pop is u stan ovn i{tvaiz2011.godine,upedesetak nas eq a, `iv i ukupn o 18.500Srba. -Srpskecrkveimanstiriu rumunskom delu Banata ~ine pravoslavnu,nacionalnu,emo-

tivnuiistorijskucelinu,au projektu nazvanom “Svedoci trajawa” predstavqeni su izlo`bom fotografija, prete`nofasada,katalogomikompaktdiskom.Polaznomestoje manastir Bazja{, podignut 1225.godinenalevojobaliDunava,kaozadu`binasvetogSave i nekada{wi metoh Pe}ke patrijar{ije. Poseban zna~aj imaimanastirBezdin,ovekove~enuvremesvetearhijerij-

skeliturgije,slu`ewavladike budimskog i administratora temi{varskog Lukijana i vladike banatskog Nikanora, a u toku vra}awa ^udotvorne ikone Presvete bogordice Vin~anske-Bezdinske,28.avgusta 2011, koja je prvi put sa kalu|erima tu dospela 1740. godine, sklawaju}i se od Osmanlija–obja{wavaMiloradSavi}. Osim manastira, predstavqena je i rasko{na Saborna crkvauTemi{varu,pafasade hramovauAradu,^enejuiMalomBe~kereku,idrugiverski objekti. @.Balaban

KONFERENCIJAOOBNOVQIVIMIZVORIMAENERGIJE

Sredwo{kolcinagra|eni nakonkursuFTN-a Nagradezakonkursnatemu„Izazoviobnovqivihizvoraenergije”,kojijeorgqanizovalastudentskaorganizacija„IEEEStudent Bren~”, dodeqene su u~enicima sredwih {kola koji su se bavili temama obnovqivih izvora energije, energetske efikasnostiielektri~nihautomobila.Dodelaje organizovananaFakultetutehni~kihnauka (FTN)uokviruprvestudentskekonferencije na temu obnovqivih izvora energije i energetske efikasnosti. Prvoplasirana je bila u~enica vrba{ke gimnazije „@arko Zrewanin” Isidora Radevi}, drugi je bio DavidMirkovi} iznovosadskeelektrotehni~ke{kole„MihajloPupin”,atre}aAna Kne`evi} iz gimnazije „Isidora Sekuli}” uNovomSadu. -Temakojomsamkonkurisalanatakmi~ewebilaje„Inovacijeukori{}ewusolarne energije i energije vetra”, a motiv je bila mojazainteresovanostzaobnovqiveizvore energije-reklajeIsidoraRadevi}.-Radje upotpunostisamostalan,jersutakozahtevali u konkursu, i istra`iva~ki, {to mi nije stran pojam jer se istra`ivawima bavimve}nekovremeu„Petnici”.

Ovom prilikom potpisan je i sporazum izme|uFTN-aibelgijskekompanije„Elektravings”kojiseti~ezajedni~kihaktivno-

IsidoraRadevi}primanagradu odTihomiraSimi}a

sti u okviru obnovqivih izvora energije. Dekan FTN-a Ilija ]osi} kazao je da je u pitawuugovorodugoro~nojnau~no-tehni~kojiposlovnojsaradwi. -Radi}emonaizradiprojekataiwihovoj realizaciji i podstica}emo proizvodwu elemenatakojisekoristeuoblastizelene energije. Ovo je velika {ansa za studente koji }e imati priliku da rade praksu u „Elektravingsu” i da u~estvuju u sprovo|ewuprojekata-naveoje]osi}. Saradwa }e biti ostvarena kroz Centar zaobnovqiveizvoreikvalitetelektri~ne energijekojisebaviistr`ivawimauoblasti enrgetike, a projektovao je i izradio fotonaponsku elektranu i niz idejnih re{ewasolarnihelektranauLeskovcu,Kova~ici,Crvenki,VrawuiZaje~aru. Konferenciji su prisustvovali i zamenik pokrajinskog sekretara za obrazovawe Zoltan Jege{, direktor „Elektrovojvodine” Tihomir Simi}, rektor novosadskog Univrziteta Miroslav Veskovi}, na~elnicaGradskeupravezaza{titu`ivotnesredine Aleksandra Jovanovi} Galovi} i drugi. A.J.

VESTI Mladisuzakon Desetakpripadnikaomladinskihvolonterskih grupa iz Srbije vratilo se iz Brisela. Mladi iz Ni{a, Kragujevca, Pirota, Novog Pazara, Ba~ke Palanke, Vaqeva, Prijepoqa, Ivawice,SenteiSrpskeCrwesukaopobedniciomladinskihvolonterskihakcijaupro{lojgodiniimaliprilikudaobi|uEvropsku komisiju i Evropski parlament i upoznaju se saradomEUinstitucija. Wihjeusklopuprograma“Mladisuzakon” krajempro{legodineizabraloMinistarstvo omladine i sporta i Delegacija EU u Srbiji jer su bili prvoplasirane omladinske volontereske organizacije. Pro{le godine je bilo 153 projekta koji su izradile omladinske volonterskeorganizacije~imesepokoznakoji putpokazalodaSrbijaimakvalitetneispo-

sobnemladequdeukojevrediulagati.Ovegodineprijavilose445udru`ewamladih.Ministarstvo omladine i sporta }e i 2012. godine nastavitisarealizacijomovogprograma.Nedavno je i raspisan konkurs za finansirawe omladinskihprojekatauciqupodsticawaaktivizmaivolonterizmamladih. Q.M.

Protestzaposlenihna TV„Avala”i„Pink15” Zaposleni na TV „Avala” i „Pink 15” iz Skopqaprotestovalisuju~eispredzgradeTV PinkuBeograduzbogneispla}enihzarada.ZaposlenimanaTV„Avala”nisuispla}ene~etiri, a zaposlenima u televiziji „Pink 15” iz Skopqaosamzarada. PredstavnikzaposlenihnaTVAvalaAleksandar [ubari} rekao je da ta televizija od

pre 25 dana ponovo ne proizvodi sopstveni program,jerposlodavcinisuispuniliobe}awaoisplatizaostalihzarada,~ijimprihvatawemje1.martazavr{enprethodnidvomese~ni {trajkutojku}i: -PitamoRRAzbog~egaseidaqedozvoqava takvo emitovawe programa koji nije u skladu saelaboratomnaosnovukogajeTVAvaladobilanacionalnufrekvenciju. Predstavnici zaposlenih u televiziji „Pink15”izSkopqaka`udasudo{liuBeogradjersuuvidomudokumentacijuutvrdilida jevlasniktelevizijekompanija„Pinkinternational”. -Upravojeovomestonakomemo`emodapotra`imoodgovoreuvezisana{imzara|enim, aneispla}enimplatama-reklajepredstavnicazaposlenihnateleviziji„Pink15”Sne`anaAnti}.


dRU[TvO / CRnA HROnikA

subota2.jun2012.

NASTAVQA^PORODI^NELOZE(JO[UVEK)UPREDNOSTI

]erke vole, sinovima se ponose Dobro ~uvani recept dobijawa mu{kog deteta, koji se prenosio sa kolena na koleno, otkrio je u sudwem ~asu Bla`o Baja [u{kav~evi} iz zetskog sela Vukovci. On je odlu~io da decenijama ~uvan recept za dobijawe mu{kog potomka i produ`ewe lo`e ka`e kako ga ne bi “poneo u grob”, a time odmogao mnogim porodicama u dobijawu sinova. Poznavalac “tajne mu{kog potomka” u Crnoj Gori oduvek je bio po{tovan i tra`en, a to retko zanimawe u zemqi patrijarhata, ratnika i pu{kono{a je nosilo ogroman teret odgovornosti. No, i kod nas se }erke vole, ali bez sina se o~evi mawe ose}aju mu{karcima jer time gube status “velikih dasa”. Kako je i medicina ocenila da su o~evi ti koji odre|uju pol detetu, a ne majke koje vekovima unazad krive kad rode `ensko dete, onda je receptura za mu{ke potomke veoma zna~ajna i dan danas.

re|ewu sa drugim dr`avama, pri ~emu je najzastupqeniji oblik naklonosti prema sinovima nau{trb k}eri, ali on je mnogo mawi od ostalih ekonomski i demokratski razvijenijih dr`ava u svetu. U Srbiji nisu zabele`eni slu~ajevi abortusa koji su bili motivisani polom deteta, ali u isto vreme zabele`en je ve}i broj slu~ajeva ubistva novoro|enih devoj~ica ili neadekvatne brige o `en-

Najve}adiskriminacija`enskedece uAlbaniji Od evropskih dr`ava u ovom istra`ivawu o diskriminaciji prema `enskoj deci najboqe je plasirana Makedonija, koja je zauzela peto mesto u svetu. Od zemaqa u regionu najlo{ije je pozicirana Albanija koja, prema ovom izve{taju, ima izra`enu diskriminaciju prema `enama. Bi}e da se i mnogo razvijenijim dr`avama od na{e vi{e vodi ra~una o sinovima nego o k}erkama. Naime, prema rezultatima istra`ivawa Organizacije za ekonomsku saradwu i razvoj, u konkurenciji 86 zemaqa isto~ne Evrope, Azije, Afrike i Latinske Amerike, Srbija je zauzela visoko 11. mesto u odnosu naklonosti prema mu{kom i `enskom detetu. Jer, utvr|eno je da se u Srbiji sprovodi blaga diskriminacija `ena u po-

skim bebama. Najve}a polna diskriminacija naj~e{}e se ogleda u nasle|ivawu jer se ovde jo{ uvek veruje, suprotno Ustavu Srbije i zakonima gde su deca jednaka, da k}erke treba da se odreknu svog dela nasledstva u korist bra}e, odnosno da sve treba da pripadne wima jer onda odlaze iz roditeqske ku}e i samim tim prestaju da imaju odre|ena prava. Sociolozi tvrde da je ovde zapravo re~ o nasle|u iz pro{losti kada se prema

`enskoj deci odnosilo kudikamo nepovoqnije. Podse}aju da se odvajkada za ro|ewe sina prire|ivalo posebno slavqe pra}eno pucwavom i prangijawem jer je to bio znak da se rodio naslednik, vojnik, nastavqa~ loze i krsne slave, ali i neko ko }e voditi brigu o ostarelim i bolesnim roditeqima. S druge strane brojna istra`ivawa su takva shvatawa demantovala jer pokazuju da se danas `enska deca vi{e staraju o roditeqima, da su privr`enija i da su spremna sve da u~ine kako bi im obezbedila bezbri`nu starost. U isto vreme sve je vi{e sinova ~ije se ro|ewe danima proslavqalo, koji di`u ruke na ostarele roditeqe zbog novca i imovine. Naime, nasiqe nad starim osobama u Srbiji je u porastu a nasilnici su naj~e{}e deca i unuci, pokazalo je nedavno istra`ivawe Crvenog krsta Srbije u Novom Sadu i Ni{u. Prose~na starost `rtava nasiqa je 70 godina, a izvr{ioci su naj~e{}e deca i unuci i to u 90 odsto slu~ajeva mu{karci starosti od 35 do 45 godina, dok je najmla|i imao 26 godina. Nasiqe nad starima se naj~e{}e vr{i upotrebom fizi~ke sile, dok se oru`je re|e koristi, a 90 odsto slu~ajeva nasiqa po~iweno je u porodi~nom domu. Q.Male{evi}

PRE@IVETI GRAD

Qudski nesporazum Dobar je ovo grad, uprkos nama. Posebice vaqa izme|u gluvog doba i onog koje ~uje. U tom maju{nom vremenskom opsegu qudi su omamqeni, otupqenih ~ula, skloniji iskrenosti iz nehata. Ni dan, ni no}; jedna i jedina ugodna tranzicija. Niti ubija, niti pokondiri.

Sre}nici su u{u{kani porodicom i prijateqima i sve je ude{eno da se razgaqena ishitrenost duha ispoqi ka odabranima. Zlatni momenat dobrih mama i tata, za decu nisam siguran. Tada su i du}ani i kafane prazni, {to ~oveka natera da se prema bu|elaru i jetri, a ne samo potomcima, odnosi milosrdnije. Vreme kada sove mudrosti tegle krila, a site ma~ke ne vri{te kao bebe. Mawe sre}nima zalomi se da tra`e parking mesto, koje u zlatnoj dobi biva besplatnim. Mora na bulevaru - lew kao kwaz! U redu, ima i gorih potraga u `ivotu: za posao, partnera, bubreg, boju glasa osobe koje nema. Kad se ~ovek sabere, sva su iskawa mawe bolna od ovog ali mimo te nevidqive granica izme|u `ivog i mrtvog dela dana sebi~nome je ~esto za~epqen razum, pa umisli sva{ta. Prazno parking mesto. Smeje mi se kao jedna mala kojoj sam davno nehotice poklonio pakao: podano, spremno - visi na `i~ici

mog kaprica. Ne kwaz, no car! Mesto je imalo vi{e sre}e od cure, napadnuh ga kao `edno govedo pojilo. Taj komadi} betona nije rezervisan za moje mawe tali~ne sugra|ane. Srodstvo invaliditeta i nesre}e je u ovom slu~aju preceweno; oni su baksuzi jer su ro|eni ovde.

je u o~ima jadniji, radikali bi mi ispostavili ra~un za ma{tu. Da mi je boqi, isto bi uradio LDP. Topao, prijazan glas, kakvog ~ovek u riznici se}awa skladi{ti uz nedeqne pr`enice ili kakao pred spavawe, prostodu{no mi po`ele dobro ve~e. Primetio je da, otu|en nevericom, o~ijukam uredno postavqen znak kome pripada ovo mesto te spremno kaza: „Evo dru`e (kao ratnik ratniku, a ne ^lan ^lanu) sad }u ja da isparkiram, pa ti izvoli, stani„. Stojim, gledam gospodu u poku{aju, vi{e sam sebi ka`em da je plac rezervisan s razlogom. Ne reaguje. I daqe zra~i prijateqskom intimom usamqenih saboraca, negde u rovovima partokratske ni~ije zemqe, ponavqa mantru odlaska srda~no mi prepu{taju}i pravo pre~eg. Tre}i put - ni{ta; tojest - sva{ta! Iz o~iju mu izbi sjaj kakav samo po{teni nalaza~i izgubqenih nov-

Primetiojeda,otu|ennevericom, o~ijukamurednopostavqenznakkomepripada ovomestotespremnokaza:„Evo,dru`e, (kaoratnikratniku,ane^lan^lanu),sad}uja daisparkiram,patiizvoli,stani” Cipela za grad odalami tlo. Sasvim neprimetna, k’o {to je ona mala meni bila, dole se pru`ila `uta {partana farba. Ne, ovo nije mesto za vozila osoba sa invaliditetom, ovo je zona u kojoj kom{ija u kolicima vaqa iza}i iz kola. Opijen sva|om mraka i svetla nisam primetio ispranu boju krunisanu pra{inom. Zauzeo sam, da cepidla~im, tre}inu tog mesta, a qudi ne mogu biti tre}inu trudni. Bio bih qut, samo da nije bilo wega. Sredove~ni, urnisani vlasnik sredove~nog, urnisanog „stojadina”. Pri{ao mi je „s osmehom od ~mara do obrva„ (Bukovski, prim. aut). ^ovek, jedan od nas, savr{en primerak: da mi

~anika imaju. Divan ~ovek, re~ju da ga ne pokudim, eh, da nam je vi{e ovakvih. Oklevawem sam ga zbunio. Zemqa~ke rupe u lobawi pitomo su tra`ile odgovor, promrmqah da }u ipak oti}i negde drugde. „Tjah, princip”, rekoh bogoboja`qivo, jer mi se u suprotnom Mesec smeje danima. ^uv{i to, na nepromewenom licu lagano se gasio sjaj i daqe prijateqskih badema. Dva de~ja oka, koja znaju da ga roditeqi la`u ~im ih pita ne{to sasvim blesavo i neva`no, gledala su kroz mene, parking, grad, no}. Ostadosmo dobri neznanci i ne rastasmo se kao boqi qudi. A mogli smo, be{e zlatni momenat. IgorMihaqevi}

dnevnik

c m y

14

GRUPAUHAP[ENIHRAZVIJALAPOSAONAME\UNARODNOMNIVOU

Na tekstilu zakinuli milijardu dinara poreza Sek tor po re ske po li ci je podneo je Tu`ila{tvu za organizovani kriminal u Beogradu krivi~nu prijavu protiv organizovane kriminalne grupe od 23 osobe zbog udru`ivawe radi vr{ewa krivi~nih dela, prawa novca, primawa i davawa mita, zloupotrebe slu`benog polo`aja i poreske utaje, o{tetiv{i buxet Srbije za skoro 1,2 milijarde dinara. Poreska uprava je, kako je precizirano u saop{tewu Ministarstva finansija, krivi~nu prijavu podnela u saradwi sa Slu`bom za borbu protiv organizovanog kriminala - Upravom kriminalisti~ke policije. Organizatori i ~lanovi ove organizovane kriminalne grupe su po dogovoru sa vlasnicima ve}eg broja privrednih subjekata registrovanih na teritoriji Srbije, ali i susednih zemaqa transportovali i uvozili tekstilnu robu i

ode}u na svoja privredna dru{tva i privredna dru{tva koja su pod kontrolom ~lanova organizovane kriminalne grupe. Stavqali su u promet tekstilnu robu poreklom iz azijskih i evroazijskih zemaqa, ode}u i obu}u koja je prethodno kupqena za gotov novac u Turskoj, Ma|arskoj i Italiji od ve}eg broja vlasnika, privrednih subjekata sa podru~ja Srbije, kori{}ewem poslovne dokumentacije sa neistinitim sadr`ajem, navedeno je u saop{tewu. Falsifikovanu uvoznu dokumentaciju su obezbe|ivali u nameri da se prikrije i la`no prika`e stvarna vrednost koja je vi{estruko ve}a u odnosu na vrednost robe koja je utvr|ena od strane carinskih organa i po kojoj je cariwena i to uz pomo} jednog broja radnika carine. Tako uvezenu robu prijavqeni su fakturisali na

osnovu kwigovodstvene dokumentacije u kojoj prijavqivana umawena vrednost robe i tako simulovanim pravnim poslom umawili osnovicu za obra~un PDV-a prilikom fakturisawa kupcima - saizvr{iocima pod ~ijom kontrolom su privredna dru{tva evidentirana kao kupci. Navedenu robu su u svojim kwigovodstvenim evidencijama prikazivali kao promet na malo, prodaju privrednim dru{tvima koja simuliraju poslovawe i ne pla}aju PDV ve} iskazuju zahteve za povra}aj PDV-a. Prikazivali su je, tako|e, kao prodaju privrednim dru{tvima koja prestaju sa radom i prenose osniva~ke uloge i zalihe dobara na strane dr`avqane koji su nedostupni kontroli, privrednim dru{tvima koja imaju poslovawe sa takozvanim fantomskim firmama i onim za prawe novca. E.D.

NOVIDETAQIUSUDSKOMPREPUCAVAWUAGENCIJEZABORBUPROTIV KORUPCIJEINOVOGSADA

Sud usvojio `albu Agencije Agencija za borbu protiv korupcije saop{tila je danas da je Vi{i sud u Novom Sadu usvojio wenu `albu i poni{tio re{ewe o privremenoj meri koju je tra`io gradona~elnik tog grada Igor Pavli~i}. Prema odba~enom zahtevu Pavli~i}a, Agencija bi pod pretwom nov~anog ka`wavawa, morala odmah da sa svoje internet strane ukloni tekst „Krivi~na prijava protiv gradona~elnika Novog Sada i ~lanova gradskog ve}a”. Osim privremene mere, kako se dodaje u saop{tewu, gradona~elnik Novog Sada Igor Pavli~i} i ~lanovi Gradskog ve}a tra`ili su u tu`benom zahtevu da Agencija, svakom posebno, isplati 500.000 dinara na ime nematerijalne {tete zbog povrede ~asti i ugleda, a taj postupak je jo{ u toku. Naime, Grad Novi Sad je u martu protiv Agencije za borbu protiv korupcije podneo tu`bu za nadoknadu nematerijalne {tete zbog toga {to je Agencija, kako je tada objasnio Pavli~i}, nanela {tetu gradskih vlastima kada je protiv wih podnela u me|uvremenu od-

ba~enu tu`bu u kojoj su on i ~lanovi Gradskog ve}a ozna~eni kao „organizovana kriminalna grupa”. Protiv Pavli~i}a i ~lanova Gradskog ve}a, Agencija je u januaru ove godine podnela Tu`ila{tvu za organizovani kriminal krivi~nu prijavu zbog, kako je navedeno, osnovane sumwe da su zloupotrebili polo`aj i ovla{}ewa i time naneli vi{emilionsku {tetu Novom Sadu, preduze}u ATP „Vojvodina” i Iliji Devi}u, kupcu i ve}inskom vlasniku dru{tvenog

dela tog preduze}a, kao i mawinskim akcionarima. Novi Sad je u maju 2006. godine, sklopio ugovor sa „ATP Vojvodina“ kojim se obavezao da }e za novoizgra|enu autobusku stanicu obezbediti uslove za rad u me|umesnom saobra}aju po me|unarodnim standardima, ali do toga do danas nije do{lo, zbog ~ega je Devi} podneo prijave protiv Gradske uprave sa od{tetnim zahtevom od skoro 100 miliona evra. E.D.

MASOVNAHAP[EWAZBOGFANTOMSKIHFIRMI

Utajeno 70 miliona dinara Zbog sumwe da su po~onili vi{e krivi~nih dela zloupotrebe i poreske utaje, na podru~ju Jagodine i ]uprije je uhap{eno pet lica, a krivi~nom prijavom }e biti obuhva}eno jo{ sedam osoba - saop{tio je MUP. Uhap{eni su odgovorna lica privrednog dru{tva „Armagedon eko” DOO iz Velikog Gradi{ta Dejan P. (33) i Zoran M. (39), obojica iz ]uprije, vlasnik i odgovorno lice „Sali prom” DOO iz Velikog Popovi}a, Oliver A. (39), kao i Branislav J. (58) iz i Miroslav J. (50) iz Kre`binaca u op{tini Para}in. U istoj akciji policija je podnela krivi~ne prijave protiv Sa{e O.(30) iz Kragujevca, Zvazdana R. (38) iz Beograda, Vojkana \. (42) iz Para}ina, @ivojina M. (58) iz Para}ina i

Predraga M. (38), Bobana J.(51) i Nenada M. (59) svi iz Kri`binaca. Osumwi~eni Dejan P. i Zoran M. su od po~etka 2011. do maja 2012., kao odgovorna lica preduze}a „Armagedon Eko” Veliko Gradi{te, iskoristili svoj slu`beni polo`aj i ovla{}ewa na taj na~in {to su u vi{e gradova na teritoriji Srbije sa fizi~kim licima i vlasnicima preduze}a koji se bave prodajom otpadnih metala i sekundarnih sirovina ugovorili kupovinu robe za gotov novac u ukupnom iznosu od oko 360.000.000 dinara. Deo tog novca je ispla}en fizi~kim licima, dok je osumwi~eni Zoran M. u ciqu prikrivawa kupoprodaje robe „na crno” nabavio ulazne ra~une preko tzv. „fantomskih“ preduze}a, za koje je znao da su la`ni, jer prometa izme|u ovih preduze}a i

wihovih dobavqa~a uop{te nije bilo. Potom su organizovali prevoz otpadnih metala i sekundarnih sirovina do stvarnih kupaca koji su izvr{ili pla}awe robe preko ra~una „Armagedon eko” i na taj na~in su pribavivili protivpravnu imovinsku korist za „Armagedon eko” u iznosu od preko 70.000.000 dinara (oko 700.000 evra). To je, ina~e, ukupan zbir izbegnutog poreza na dohodak gra|ana koji bi se morao platiti prilikom otkupa sekundarnih sirovina od fizi~kih lica i iznosa prethodnog PDV-a kao odbitnog poreza, a na {tetu buxeta Republike Srbije. Pripadnici MUP-a Srbije nastavqaju rad na rasvetqavawu svih nezakonitosti u poslovawu navedenih privrednih subjekata i lica. E.D.


crna hronika

dnevnik NASTAVQASEISTRAGAOISKUSNOJ RAZBOJNI^KOJGRUPI

Krugosumwi~enih nijekona~an Tu`ila{tvo za organizovani kriminal danas }e saslu{ati sedmoricu pripadnika kriminalne grupe uhap{enih zbog sumwedasuizvr{ilivi{eubistava, razbojni{tava i iznuda me|ukojimajeipoku{ajotmice dva kamiona koja su prevozila robuizvaqaonicebakraSevojnozaUkrajinu. Tu`ilac za organizovani kriminalMiqkoRadisavqevi} rekaojeTanjuguda}eposlesaslu{awabitiodlu~enoowihovom daqem procesuirawu, naglasiv{i da krug osumwi~enih jo{ nije kona~an i da se nastavqaakcijaidentifikacijedrugihpripadnikategrupe. Uhap{eni su Rajko P. (1955) i Pero \. (1967) iz Subotice, @ivojinT.(1956) izNovogSada,RadovanG. (1953)izSombora,Ra{koM. (1966)izTopolei Beogra|ani Jovica R. (1955) i Du{anO.(1952). Oni se sumwi~e za krivi~na dela ubistva, razbojni{tvo, iznude,neovla{}enodr`aweino{ewevatrenogoru`jaieksplozivnih naprava i udru`ivawe radiizvr{ewakrivi~nihdela, razbojni{tva. Osumwi~enisuuhap{enipre dvadanakadasupoku{alidaotmudvakamionavaqaonice„Sevojno” sa robom upu}enom za Ukrajinu radi prodaje ukrajinskomkupcu.

Oni su posledwih nekoliko sedmica prikupqali podatke o transporturobe,aondajejedan odpripadnikagrupepoku{aoda stupi u kontakt s voza~ima kamiona,aliutomenijeuspeo. Onihjezatopratioiokretawukamionaobave{tavaodruge pripadnike grupe koji su ih ~ekali u Vr{cu s namerom da kadkamioniiza|uizSrbijeizvr{eotmicikamionaizaplene robu namewenu ukrajinskom kupcu,rekaojeRadisavqevi}. Tu`ilac je napomenuo da je prilikom pretresa osumwi~enih prona|eno vatreno oru`ja, municija, materija za koju se sumwadajeotrovidrugestvari namewene izvr{ewu krivi~nih dela. Prema re~ima Radisavqevi}a,Tu`ila{tvosara|ujesanadleznimorganimaKipraradirasvetqavawa jednog krivi~nog delazakojesesumwadasupripadniciovegrupeizvr{ili30. maja 2011. godine na teriotirji tedr`ave. Policija je ju~e saop{tila da je ta kriminalna grupa 30. majapro{legodinenaKipruu oblasti Pila, u Larnaki poku{ala ubistvo jednog ruskog dr`avqanina,tako{tojedaqinskim putem aktivirala prethodno postavqenu eksplozivnu napravu. (Tanjug)

OTKRIVENAJO[JEDNAMRE@AFINANSIJSKIH MALVERZACIJA

Privo|ewazbogutaje Novosadska kriminalisti~ka policija odredila je zadr`avawe Rajku\. (1968)iDraganuD. (1964), iz Veternika, zbog osnovane sumwedasuizvr{ilikrivi~nodelo zloupotreba slu`benog polo`aja, dokje,zbogsumwedasuizvr{ili istokrivi~nodelo,podnetakrivi~naprijava,uredovnompostupku,protivjo{10osoba,odkojihje pet iz Novog Sada: Borislav J. (1977), Pera L. (1968), Sa{a V. (1966),TomislavM. (1974)iNada D. (1968),zatimdveizVeternika: Sini{a Q. (1979) i Dragan P. (1961), kao i Petar A. (1980), iz Futoga,MilenkoS. (1967),izBa~kogJarkaiRadowaJ. (1956),izLeskovca. Onisu,odfebruara2007.donovembra2008.godine,nateku}era~unesvojihfirmi,zanepostoje}e

isporukedobaraiusluga,primili novac od strane 109 drugih privrednihdru{tavaitajnovac,uiznosuodpreko257milionadinara, podizaliugotovini,aodtesume sujedandeozadr`avalizasebe,u zavisnostiodprocentaprovizije, dok su ostatak vra}ali vlasnicima tih preduze}a. Sve ove radwe osumwi~enisupokrivalila`nom dokumentacijom,naosnovukojesu utajiliporezitimeo{tetilibuxet Republike Srbije za oko 12,5 milionadinara. Naovajna~inosumwi~enisuza sebe i svoja privredna dru{tva pribavili imovinsku korist od blizu270milionadinara,apolicija nastavqa rad na utvr|ivawu odgovornostivlasnikapomenutih 109preduze}a. N.P.

PRIVATNATU@BAPROTIVZEMUNACA ZBOGUBISTVA

Porodica[quki} tra`iod{tetu 10milionadinara Porodica ubijenih Sredoja i Zorana [quki}a tu`ila je Vi{emsuduuBeograduosampripadnika „zemunskog klana”, koji su pravosna`no osu|eni na visoke kaznezatvorazaubistvowihovih srodnika. [quki}i privatnom tu`bom tra`e od{tetu od 10,4 miliona dinara, na ime naknade {tete zbog ubistva Sredoja i Zorana, koje su pripadnici „zemunskog klana” ubili kod Sava centra u sa~eku{i 27. septembra 2002. godine. Tu`bajepodnetaprotivsvedokasaradnikaDejanaMilenkovi}aBagzija iMiladinaSuvajxi}a zvanog\uraMutavi kojisuizbeglika`wavawe,zatimbra}eMi-

lo{a i Aleksandra Simovi}a, Sretka Kalini}a, Vladimira Milisavqeiv}a zvanogVladaBudala,MilanaJuri{i}a iDu{ana Krsmanovi}a. Pripremno ro~i{te u tom predmetu odr`ano je 30. maja, a po~etak su|ewa je zakazan za 28. novembar,objavqenojenaPortalusudovaSrbije. Sredoje Squki} koji je va`io za vo|u „zvezdarske grupe” i wegovbratZoranubijenisu27.septembra2002.uBulevaruArsenija ^arnojevi}a. Onisubiliuautomobilukada im je s leve strane pri{ao sivi „audi”,a„zemunci”suupokretuu wih ispalili 50 metaka iz dve automatskepu{ke. (Tanjug)

„Vukaomejekolimadok mikanapnijepaosruku” PavleB. (27)izBeo~ina,kojiseteretizanano{ewetelesnih povreda  i zlostavqawe i mu~ewe nad sredwo{kolkom J. K. (17)izRume,osu|enjeju~eu novosadskom Osnovnom sudu na jedinstvenukaznuoddvegodine zatvora pred ve}em koj im je presedavao sudija Stevan Pavlov. Onjetako|eodlukomsudapu{tenizpritvoraukojemsenalazi od momenta predaje policijipredvaipomeseca. Prema navodima optu`nice, okrivqeni je 19 . marta je od 7.30satido13.30~asovavre|ao, maltretirao, udarao, tukao po glavi i telu, pquvao i pretio svojojdevojciJ.K,auzsvetovezaojezasvojautomobilivukao poputu. Devojka je vidno uznemirena ispri~ala {ta joj se dogodilo tog dana, rekav{i da je pavle po~eodajeudara~imsuseliu kola. -Udaraomije{amaredokje vozio, govorio mi ru`ne re~i

i vre|ao mi moje najbli`e. Govorioje,voze}imetogdana,da }e me skinuti golu i obesiti. Znaojekolikogodinaimam.Za 17. ro|enadn mi je poklonio 17 ru`a,~akjemomtati,kojigaje primiokaosina,rekaoda`eli da me `eni kad postanem punoletna-kazalajeJ.K. -Kadameudarao,povremeno sam gubila svest, mislila sam da umirem, izgubila sam ose}aj za vreme i prostor. Plakala sam.Vukaomejekolimadokmi sekanapnijeskinuosruku-kazalajeo{te}enadevojka. Optu`eni je ju~e izjavio da ostaje pri iskazu datim pred istra`anim sudijom, a ovog puta i dodao da smatra da nisu ta~ninavodiizoptu`nice. -Iakosamka`avanzbogdroge, sada nemam veze s narkoticimaialkoholom.Sumwaosam da me vara, a kad sam toga dana videoporukenawenomtelefonu, moje sumwe su potvr|ene. Togdana,selismoprepodneu ba{tihotelanaAndrevqu,ona

je oti{ala do toaleta, a ostao jojjemobilnitelefonnastolu ivideosamporukunadru{tvenoj mere`i „Fejsbuk”. Ubrzo posleodlaskaizhotelaparkiraosamautomobilporedputau delu gde nema ku}a i pitao je {tasvetotrebadazna~i.Ona jetvrdiladanijetoonapisala nego wena  drugarica. Bilo mi jekrivo{tomiJelenanegovoriistinu,damenijelagalane bi se to desilo. U besu sam joj udario {amar, ona mi je odmah uzvratila iza{la je iz kola i potra~ala, a nekoliko metara daqesaplelaipalanakamenispri~ao je svoju verziju optu`eni. Prema wegovim re~ima, devojci je krenula krv iz nosa zbog~egajepredlo`iodajeodvezekodlekara. -Onajeinsistiraladajeodbacim kod drugarice u Rumi {tosamiu~inio.Celuprijavu je iskontruisao wen otac koji je protiv na{e veze  i nije mi jasno za{to mene tereti i ovo

POLICIJAPRIVELARADNIKAOBEZBE\EWA

Opqa~kaotrezor duplimkqu~evima Policijski slu`benici Policijske uprave u [apcu su u ~etvrtak dana uhapsili Dragana I. (1972) iz Bogati}a, zbog sumwe da je izvr{iokrivi~nodelo te{ke kra|e na {tetu Ministarstva finansijaUpravezatrezor. Osumwi~eni Dragan I. je bio zaposlen kao radnik obezbe|ewa u ekspozituri Uprave za trezor, gde je vi{e nedeqa osmatrao gde zaposleni ostavqajukqu~eveodtrezora,apotomjeiskoristiowihovunepa`wu,izneooriginalnekqu~eve

odulaznihvratainapraviokopije. Osumwi~eni je 25. maja u kasnimve~erwimsatima,nakonzavr{enog radnog vremena, sa is-

kopiranim kqu~evima otvorio ulaznu metalnu re{etku i dvoje staklenihulaznihvrata,odgovaraju}om {ifrom iskqu~io alarmiu{aouprostorijeUpravezatrezor.Izradnihstolova zaposlenih slu`benica  uzeo je dva kqu~a za otvarawe trezora, otkqu~aogaiuzeonovacuiznosuod 9.699.600 dinara. Prilikom pretresastanaidrugihprostorija policijski slu`benici su prona{li celokupan iznos novcaodnetiztrezorakojijebio zakopanubliziniwegoveku}e. Osumwi~eni Dragan I. }e uz krivi~nuprijavu,bitipriveden istra`nom sudiji Osnovnog  sudau[apcu. N.P.

re{ava na sudu. Nisam znao da je Jelena maloletna, govorila mijedaje1991.godi{teidaje dva puta pon avaq al a razr ed. Kajemsezbogovoga{tosedesilo,alijawunisamzlostavqao itukao,dajereklaistinujaje nebihudario.Tako|e,nisamje vezao za automobil, to je kompletnala`-rekaojePavleB. Prilikomsuo~ewaokrivqeni Pavle B.  gledaju}u i u o~i devojkupitaojeza{to`elida muupropasti`ivot,aonamuje odgovorila da je on wen ve} upropastio. Na odlukuSuda zna~ajno je uticao nalaz ve{taka specijalistesudskemedicine,kojijeu obrazlo`ewusvognalazanaveo da se radi o vi{estrukim povredama, prelomu nosne kosti, kaoidaujeumedicinskojdokumentaciji bolnice u Sremskoj Mitrovici kontatovan i potresmozga,adanekepovrdeodgovarajuklizawutelapo~vstoj podlozi. M.Vuja~i} CRVEN^ANIUHAP[ENIU BA^KOMPETROVCU

Privedeni zbog razbojni{tva

Policija je u Ba~kom Petrovcu u slu`benim prostorijama zadr`alaMar~elaV. (1979),DragoslavaB. (1990)obojicuizCrvenkeiVladimiraS. (1979)izBa~kogPetrovcazbogsumwedasuizvr{ilidvadelarazbojni{tva. Mar~eloiDragoslavteretese dasu,umartu,uzpretwupi{toqemizjednemewa~niceuBa~kom Petrovcu,dokojeihjeVladimir dovezao, ukrali ve}u sumu novca. OsimtogaCrven~anisesumwi~e dasu,uzpretwupi{toqem,umaju,ukralinovacicigaretesajednebenzinskepumpe. Osumwi~eni }e u zakonskom roku biti izvedeni pred istra`nog sudiju Vi{eg suda u Novom Sadu. N.P.

NAKONSVA\EUFIRMINAPADAOSUGRA\ANE

Makazamapretio ucentruProkupqa

Policijajeju~epopodneposle intezivne potrage, prona{la Du{anaS. (29)izProkupqa,radnikaJKP„Tr`nica”kojijenavi{e mestaugradubezikakvograzloga velikim makazama napadao gra|ane,reklajeTamaraKoci},portaprolPolicijskeupraveuProkupqu. -Napada~ je pod dejstvom alkohola,uzpolicijskupratwu,preve`en na odeqewe psihijatrije u Op{toj bolnici „Dr Aleksa Savi}”uProkupqugdejezadr`anna daqem le~ewu - saop{tila je u

portparolka Op{te bolnice JelenaPantovi}. UJKP„Tr`nica”supotvrdili da se Du{an S. pre napada na sugra|ane, posva|ao sa kolegama na poslu,jernijehteoda~istipikavce, nakon ~ega je napustio svoje radnomesto. Ukratkomperiodu,du{anjesa makazamapretionekoliciniosoba,ajedanodwihjepotrdiodaga jemladi}bezpovodanapaonaulici i prete}i ogromnim makazama tra`ionovac. (Tanjug)

UA\ANSKOM„PRECIZNOMLIVU”

Havarija bezpovre|enih

Kragujev~anin uhap{enuBaru

pretwu pi{toqem, oteo vi{e vrednihstvari. Policija je, uz krivi~nu prijavu, predala D. M. osnovnom dr`avnom tu`ila{tvu u Baru, na daqunadle`nost,navodiseusaop{tewu Uprave policije Crne Gore. (Tanjug)

15

DVEGODINEZATVORAZAZLOSTAVQAWEMALOLETNICENAANDREVQU

RAZBOJNI[TVONADRUSKOMDR@AVQANKOM

Dr`avqaninSrbijeD.M. (31) izKragujevcauhap{enjeuBaru, zbograzbojni{tvaikra|e,saop{tilajecrnogorskapolicija. D.M.je,kakosesumwa,zajedno sajo{jednim,zasadanepoznatim licem, upao u ku}u ruske dr`avqankeG.G.,kojasenalaziunasequ [u{aw u Baru, i od we, uz

subota2.jun2012.

Ulaz u preduze}e „Precizni liv” u Adi

U a|anskom preduze}u „Precizni liv” a.d. do{lo je do havarije na indukcionoj pe}i i istic aw a liven og gvo` |a, usled ~ega su o{te}ene elektri~ne i hidrauli~ne instalacije.Prilikomhavarijekojase

dogodila prekju~e ujutro oko tri sata ujutru, nije bilo povre|enihlica.IzPUKikinda saop{teno je da je pri~iwena mater ij aln a {teta od oko 500.000dinara. Tekst i foto: M.Mr.

POTVR\ENAPRVOSTEPENAPRESUDA

Fensipqa~ka{u osamgodina Beogra|anin Andrija J. (29) koji je zbog vi{e pqa~ki uhap{en  pro{log leta u Beogradu, pravosna`no je osu|en na osam godina zatvora i oduzimawe „plena”odoko40.000evra. Apelacioni sud u Beogradu potvrdio je prvostepenu presudukojomjeVi{isuduBeogradu 19. januara ove godine zbog pqa~ki{estbanakaJovanovi}a osudio na osam godina, a wegovogpomaga~aujednomrazbojni{tvu Aleksandra C. na godinu dana zatvora, objavqeno je na sajtusuda. Od Jovanovi}a i Cani}a solidarno se oduzima imovinska koristuiznosuod838.600dinara, a od Jovanovi}a jo{ oko 4,2 milionadinara. Jovanovi} je osu|en zbog pqa~ki {est ekspozitura banaka od juna 2010. do maja pro{le

godine,ukojejeupadaoiprete}i radnicima pi{toqem terao ihdamuuplasti~nekesestave novac,apotomseudaqavao. Takojeukupnouzeooko40.000 evra.Novacjemahomtro{iona firmiranugarderobu,ukojojje i vr{io razbojni{tva, pa je zbog takvog pona{awa i policijska akcija hap{ewa nazvana „fensi”. Kakojeranijesaop{tilapolicija,biojemodernoobu~enu modele „zara”, „dizel” farmerkeipatike„lakost”,storbom „|or|o armani” u rukama, lice jekrioiza„gu~i”nao~ara. Biojeiliurednoobrijanili sasre|enombradicom,naglavi je imao neki od firmiranih ka~keta, i tako doteran ulazio jeubankeili~akstajaouredu kaomu{terija. (Tanjug)


SPORT

subota2.jun2012.

OTVORENOPRVENSTVOFRANCUSKE–ROLANGAROS

dnevnik

c m y

16

MAJSTORICAPOLUFINALAPLEJ-OFA

Zvezdimajstoricai finale Radni~ki-CrvenazvezdaDiva71:76(17:15,20:14,15:27,19:20)

Zavr{ila nastup u Parizu: Ana Ivanovi}

Anaizgubila

AnaIvanovi}pora`ena je u tre}em kolu Rolan Garosa od ItalijankeSareEranisa 1:6, 7:5, 6:3. Drugi set je Erani dobilaposleskorosatvremena igre kada je napravila kqu~ni brejku12.gemu.Utre}emsetuje uslediosli~anscenario,Erani jenapravilabrejkza3:1,Anaje odgovorila u narednom gemu, alijeItalijankanapravilanovibrejkza4:2idokrajasa~uvalaprednost. Ivanovi}eva se u dosada{wemtokukarijeredvaputasastajala sa Italijankom i u oba navratajeslavila.Obame~aodigranasu2009.godine,aprviod ta dva duela igran je upravo na Rolan Garosu kada je Ivanovi}eva pobedila sa 7:6, 6:3. Sara Erani je ove sezone u sjajnoj formi,akolikodobroigrado-

Posle~etirigemaukojimasu Ivanovi}eva i Erani pravile brejkove,usledilasu~etirigemabezbrejkova-6:5.Anajeu12. gemu drugi put servirala za ostanakusetu,alijeEraniuspeladaiskoristislabijiserivissrpsketeniserkeijednuduplu servis gre{ku i posle 58 minuta osvoji drugi set sa 7:5. Ivanovi}eva je i u drugom setu igrala dobro, napravila vi{e vinera od protivnice (16:11), ali i vi{e neiznu|enih gre{aka(16:10). Po~etaktre}egsetapodsetio je na drugi jer u prva tri gema nije bilo brejkova, pa je Erani povelasa2:1inapravilabrejku ~etvrtom gemu, uglavnom zahvaquju}iAninimgre{kama.Usledio je jedan od najdu`ih gemova na me~u koji je Ana uspela da osvoji po{to je iskoristila

Kuzwecovapo~istila Radvawsku Ruska teniserka Svetlana Kuzwecova je sa 6:1, 6:2 pobedila PoqakiwuAgwe{kuRadvawskuutre}emkoluRolanGarosa.Poqakiwa,kojajepostavqenazatre}egnosiocanaturniru,jepora`enaposlesamo72minutaigre,aliporazRadvawskenepredstavqa veliko iznena|ewe jer u prethodnih 12 me~eva izme|u ovedveteniserkeKuzwecovajezabele`iladevetpobeda. Radvawska je u prvom setu osvojila samo devet poena na svoj servis,sedamnaprviidvanadrugiservis.Poqakiwajeimala samo{estvinerai7neiznu|enihgre{aka.Kuzwecovajeosvojila ~etiri gema na servis protivnice, dok je Radvawska jedini gemuprvomsetuosvojilakadajeserviralaKuznecova.Poqakiwajeispustilaipetbrejkprilika.IudrugomsetujeKuzwecovadominirala.Ipakpresudilajeo~ajnaigraRadvawskenadrugomservisuiKuzwecovajeimalaosamvineravi{e-14:6. U~etvrtomkolu}eKuzwecovaigratisaSaromErani. bropokazujei~iwenicadajeod pet titula u karijeri ~ak tri osvojilau2012.godini. FurioznojeAnaodigralaprviset,kojitrajaosvega24minuta,idobilagasa6:1inapravila samo tri neiznu|ene gre{ke i~ak16vinera.Napo~etkudrugogsetabiloje3:1.Srpskateniserkajesmawilana3:2.

K R A G U J E V A C : Hala ”Jezero”, gledalaca: 4000, sudije: Belo{evi} (Beograd), Stefanovi} (Kraqevo), J. Juras(Beograd). RADNI^KI: Pavkovi} 9, Sinovec, Simon 4, Markovi} 13,Bir~evi}10,Ne{ovi},Brati} 2, Vuksanovi} 5, Marjanovi}3,Skot7,Mijatovi}3,Baki}15. CRVENA ZVEZDA DIVA: ^ovi},Ili}4,Lazi}14,Nedovi},Le{i}6,Suboti}3,Radivojevi} 3, Nikoli}, Tomas 19, Milutinovi} 5, B. Popovi} 4, P.Popovi}14. Ko{arka{i Crvene zvezde igra}e u finalu Agro`iv Superlige protiv Partizana po{to su dobili majstoricu u Kragujevcu protiv Radni~kog.Ekipa Svetislava Pe{i}a je u veoma nervoznoj i neizvesnoj utakmici savladala tim MiroslavaNikoli}asa76:71. Crveno-belisuodigralislabo prvo poluvreme u napadu, alisukqu~nurazlikunapravili po~etkom nastavka kada su serijom 16-0 od minus osam do{lidoplusosam.Radni~kijeu posledwoj deonici pretio, ali Zvezda je na kraju uz puno potro{ene energije zaslu`eno trijumfovala. Prema o~ekivawima, obe ekipe duel su otvorile veoma nervozno,sapunogre{aka.Zvezda je na startu zaustavila najja~e oru`je Kragujev~ana pik igru,alijeimaladostalo{ih re{ewaunapadu.Uprvihdeset minuta najve}e vo|stvo imala jeZvezdaitonasamompo~etku kadajevodilasa5:2.Unastavku je Pavkovi} uspeo da prona|e putdoZvezdinogko{aipodeli nekoliko asistencija, pa su Kragujev~ani vodili posle prvedeonice(17:15). Usli~nomritmupo~elajei drugadeonica,aprvuozbiqnijuprednostnapraviojeRadni~ki.Pavkovi}iMarkovi}pogodili su trojke i Kragujev~ani suserijom9-0steklisedampoenavi{kau17.minutu(29:22).

Zvezdajeuzvratilasapetvezanihpoena,alicrveno-belinisumoglidapogodeni{tasadistance. Uz to Radni~ki je pokupio nekoliko ofanzivnih skokova in a poluvremenu je imao nejve}ihplusosam–37:29. Crveno - beli su drugo poluvremepo~elifurioznoizapet i po minuta nastavka pokazali vi{e nego u celom prvom poluvremenu.KrenulesuitrojkeBeogra|ana,aodbranajefunkcionisalasavr{enoiRadni~kipet i po minuta nije postigao ko{. ZatovremeZvezdajenapravila seriju 16-0 i od minus osam do{lajedoplusosam–45:37.Me|utim, Sava Le{i} je napravio

veliku gre{ku po{to je imao kontritrinajedaniodtogtrenutka doma}in je po~eo da se vra}a.RazigraoseBorisBaki} kojijeubaciodvetrojkeiKragujev~ani su u 29. minutu nakon wegove trojke pri{li na samo minus jedan – 50:49. Ipak odgovoriojeveomaraspolo`eniLazi} i Zvezda je vodila sa 56:52 pred odlu~uju}ih deset minuta. Po~etak posledwe ~etvrtine pripao je Stivenu Markovi}u kojijesadvetrojkevratiosvoj tim u potpunosti u me~ (60:60). Kragujev~ani su tokom cele posledwe deonice disali za vratom rivalu iz Beograda ali nikako nisu mogli do vo|stva. S

druge strane, Zvezda je neke nedostatke u napadu ispravqala skokom u napadu, a na kraju su upravo dve uhva}ene lopte pod ko{em Radni~kog i odlu~ile pobednika. Kragujev~ani su u posledwem minutu nakon poena uzfaulPavkovi}aimaliminus jedan–70:69,alicrveno-belisu jednostavno igrali sa vi{e energije,vi{esu`elelipobedu i na kraju su sasvim zaslu`eno doweido{li. Finale plej-ofa Partizan MTS-Crvenazvezdapo~iweuu utorak5.juna,aekipakojaprva stignedotripobedeposta}eprvak Srbije. Termini finala su 5,8,12,15.ieventualno18.jun.

KIK-BOKSERKAALEKSANDRAKRSTI]PRVAKIWASVETSKOGKUPA

Odrekreativke doreprezentativke

drugubrejkloptuitakosevratiume~-3:2.Me|utim,naredni gem Ivanovi}eva je odigrala o~ajanoiEranijebezizgubqenogpoenaosvojilajo{jedangem naAninservis.Ivanovi}evaje utimtrenucimaizgubilasamopouzdawe i Italijanka je lako privalme~krajuidobilatre}i setsa6:3.

Federersemu~io ipro{aodaqe [vajcaracRoxerFedereriutre}emkolujeizgubioset,alije uspeodaseplasirauosminufinalaRolanGarosa.Federerjeuborbizaplasmanme|u16najboqihnadrugomGrenslemusezonepobediodoma}egteniseraNikoluMauasa6:3,4:6,6:2,7:5.Trenutnotre}ireketsvetajeiudrugomkoluizgubiojedanset,odRumunaAdrijanaUngura,azafinale}eseboritisaBelgijancemDavidomGofan,kojijepobedioLuka{aKubotaizPoqske. Poslebezproblemaosvojenogprvogseta,Federerjenai{aona velikeproblemudrugom,po{tojeMauno{enpodr{kompublike uspeodaizjedna~i.Ipak,odtadaje[vajcaracponovozaigraoagresivno,osvojiv{idvabrejkautre}emsetu,apotomuspeodanadmudridoma}egteniserau~etvrtom,ujednoodlu~uju}em.

Skot gubi duel s Popovi}em i Tomasom

Dragan Krsmani} i Sa{ka Krsti}

Aleksandra-Sa{ka Krsti} na Svetskom kupu u Ma|arskoj osvojila je zlatnu medaquukikboksu,unajte`ojdiscipliniK-1(kategorijado70 kilograma). ^lanica je KBK Pagonis tima, a ina~e studira na Fakultetu sporta i fizi~kog vaspitawa u Novom Sadu. Predwomjezaistalepabudu}nost, pored trijumfa na Svetskomkupuosvajalajezlatnemedaqe na otvorenim prvenstvimaSrbijeiVojvodine,advaputabilajeprogla{enazanajboqu takmi~arku na me|unarodnoj reviji - Borbom protiv nasiqa. Pre nepune tri godine kro~ila je u salu za treninge, a ovoj ve{tini u~e je treneri DraganKrsmani}iMilo{Milutinov.Smatradasujojspecijalkesving,aperkatikik. -SbratomDavoromu{lasam u salu da bih se rekreirala. Imalasamtada95kilogramai `elela sam da smr{am. Sada imam 67 kilograma. U takmi~arsku ekipu pozvao me je Milutinov i tako je po~elo. Dugo nisam imala protivnicu zbog te`ine,asadajesvedruga~ijezadovoqnajeSa{ka. Sparinguje s mu{karcima u klubu i ka`e da svake nedeqe zaradibarpojednumodricu,jer onine`alewu,kaonionawih.

- Sparingovawe s mu{karcimamiitekakodobrodo|e,jer danijetakoverovatnodanebih bilauspe{na.UMa|arskojsam savladalaodli~nuruskureprezentativku Galinu Dijanom. Pozivuna{unajboquselekcijumnogomizna~iiuverenasam da}ujo{vi{enapredovati,jer ovaj sport volim i takmi~i}u sedoklegodbudemmogla.Sponzor puta na Svetski kup bio je IvanJovovi},verujemda}ebiti jo{ qudi koji }e nam pomo}i. Ina~e,drugarice su mi velika podr{ka i idu na svako mojetakmi~ewe. Uzor joj je amerikanka Xina Karano,kojaseboriuMMA. - Dok sam bila mala umala sam da se potu~em s de~acima. [titilasambratainisamdozvoqavaladaganekomaltretira.Sadaminapametnepadada upotrebimsvojeznawekikboksa,jersvanegativnaenergijaiz meneiza|enatreninzima. K-1 je najte`a disciplina u kik-boksu, a Aleksandra ka`e dajeba{zbogtogaivoli. -Razlog{toba{`elimdase borim u K-1 je i taj {to je moj brat dobar s Nenadom Pagonisom, koji je neprikosnoven borac u ovoj disciplina. Mojoj majcinijelakodagledakadse borim,paponekadiiza|eizsale-reklajeKrsti}eva. M.Pavlovi}


ZLATOMIRZAGOR^I], NOVI-STARI[EFSTRUKEUFKVOJVODINA

Spremanza sveizazove Upravni odbor FK Vojvodina imenovao je {efa stru~nog {taba. Iako su se u medijima pojavqivale razne “proverene” informacije tokom proteklih dana, poverewe je ukazano Zlatomiru Zagor~i}u (41), mladom stru~waku koji je crveno-bele vodio i u fini{u sezone i doveo ih do tre}eg mesta na tabeli, a time i kvalifikacija za Ligu Evrope. Senzacije nije bilo, rezultati su na najboqi na~in preporu~ili biv{eg igra~a svih ekipa u mla|im kategorijama Vo{e i reprezentativca Bugarske, odnosno in-

ZlatomirZagor~i}

ternacionalca u [vajcarskoj i pred wim je te`ak posao, koji je ujedno i veliki izazov. - Uvek je najlep{e kada se dobije poverewe u svojoj ku}i. Potajno sam se nadao ovakvoj odluci Upravnog odbora i sada, kada je ona usledila, izuzetno sam sre}an i drago mi je {to sam imenovan za {efa stru~nog {taba. Rekao sam to nekoliko puta, ponovi}u i sada- spreman sam da se nosim s izazovima koje }e mi nova funkcija doneti i predstoje mi razgovori s klup-

SPORT

c m y

dnevnik

skim ~elnicima o ciqevima u narednoj sezoni, igra~kom kadru, ko ostaje, a ko }e oti}i - ka`e Zagor~i}. Orijentacija Vojvodine u narednoj sezoni bi}e da se {to je mogu}e vi{e osloni na mlade fudbalere iz svog kadra, a vi veoma dobro poznajete situaciju kada su mla|e kategorije kluba u pitawu? - Ponovi}u i to da s ukqu~ewem mladih igra~a u seniorski tim treba biti veoma oprezan i da ~lanovi stru~nog {taba i ja moramo dobro da procenimo trenutak kada }emo to u~initi. Istina je da sam radio s mla|im kategorijama i da dobro poznajem potencijal i kvalitet mladi}a o kojima je re~, tako da }e mi to biti olak{avaju}a okolnost i ne}emo gubiti vreme na upoznavawe i procewivawe igra~a. Zanimqivo je i to da su svi ~lanovi novog stru~nog {taba ranije igrali u Vojvodini. Pored vas, da ponovimo, u wemu se nalaze pomo}nici Zoltan Sabo i Spasoje Jela~i}, kao i trener golmana Sa{a Todi}. - Ta ~iwenica je sigurno plus za klub. Verujem da }emo zajedni~kim radom i naporom doprineti da Vojvodina u budu}em periodu igra na prpoznatqiv na~in i da }e ta igra pleniti i doprineti tome da publika u velikom broju prati utakmice na na{em stadionu. Da li sve ostaje po planu {to se po~etka priprema za novu sezonu ti~e? - Za sada je tako, pa je prvo okupqawe igra~a, a time i po~etak rada zakazan za 18. jun – saop{tio je novi (stari) {ef struke FK Vojvodina Zlatomir Zagor~i}. A.Predojevi}

subota2.jun2012.

SELEKTORMIHAJLOVI]NEBRINEPREVI[EZBOGVEZANIHPORAZA

Slikasvejasnija Dva poraza orlova, istovetnim rezultatom 0:2, protiv [panije i Francuske,nisu previ{e bolna. Jednostavno, nacionalni tim Srbije sa novim selektorom Sini{om Mihajlovi}em krenuo je trnovitim putem smene generacija. Neki novi klinci dobijaju {ansu, i to protiv evropskih velesila, koje su u punom treningu jer privode kraju pripreme za EP. Evidentno je da su u reprezentaciji zavladali profesionalni odnosi, koje je nametnuo popularni Miha, i da se momcima ne mo`e ni{ta zameriti na anga`amnu i to posle napornih sezona koje su imali. - Zadovoqan sam sa obe utakmice, bez obzira na rezultate. Od prvog dana govorim da taj deo sada nije najva`niji. Mnogo mi je bitnije {to mogu na delu da vidim sve igra~e koji su krenuli na put i to {to imam vi{e informacija o wima. Slika mi je sve jasnija – ocenio je selektor. Protiv [panaca koban je bio kraj prvog, protiv Francuza start prvog poluvremena. - Kod primqenih golova uvek neko napravi gre{ku. Bez toga bi rezultat bio 0:0. Za mene su i te negativne stvari za sada pozitivne, da mogu sve da ih sagledam. Z Francuze promenili smo 10 igra~a od 11 u odnosu na tim koji je igrao protiv [panije, igrali smo protiv daleko spremnije ekipe, koja }e nastupiti na EP. Osnovna stvar je slab i neprecizan prvi pas, kada

DetaqizsusretaFrancuska–SrbijauRemsu

izlazimo iz presinga, tako stvaramo rivalu prostor da nam opasno zapreti, a mi u ofanzivi ostanemo nedore~eni - objasnio je Mihajlovi}. Ne}e selektor o u~inku pojedinaca, ali Du{an Tadi} je ostavio ba{ dobar utisak, bio je jedini na{ igra~ opasan po gol Francuza. - Fizi~ki sam pao u fini{u utakmice, zato nije bilo dobre

zavr{nice u dva navrata kada sam mogao da savldam Lorisa. Igrali smo protiv veoma jake ekipe, koja je pokazala svetsku klasu. U drugom poluvremenu smo parirali mnogo boqe, mada je bilo sve ukupno gledano i nekih negativnih stvari. Ali, ovo je jo{ uigravawe, sve nam je novo, potrebno nam je vremena da sve to do|e na svoje mesto- poru~io je Tadi}.

Sledi me~, 5. juna u Stokholmu, sa [vedskom. - Treba da izvu~emo pouke iz ovih poraza i da izborimo barem jedan povoqan rezultata. To bi nam puno zna~ilo za daqi rad. Ima}emo jo{ jednu proveru u avgustu i verujem spremni sa~ekati kvalifikacije za SP konstatovao je zamenik kapitena Aleksandar Kolarov. Z.Rangelov

Banejedini50puta udresuSrbije

BranislavIvanovi}

Novi kapiten „orlova” Branislav Ivanovi} prvi je fudbaler koji je stigao do 50 me~eva u dresu samostalne Srbije! Banetu je nastup protiv Francuza (0:2) u ~etvrtak uve~e bio 51. u nacionalnom timu, ali je sjajni defanzivac debitovao 8. juna 2005. godine za reprezentaciju Srbije i Crne Gore, u Toronto, u prijateqskom me~u sa Italijom (1:1). Posle toga, usledio je raspad dr`avne zajednice, a Ivanovi} je nastavio da igra za svoju Srbiju, za koju je nepunih {est godina igrao ~ak 50 puta. Ivanovi} je bio starter u istorijskoj, prvoj utakmici samostalne Srbije protiv ^e{ke, koju je na{a reprezentacija 16. av-

DANASNAFUDBALSKIMTERENIMA

STEVAN LUKOVI] POTPISAO ZA CRVENU ZVEZDU: PrelaznirokzaCrvenuzvezdujepo~eoonakokakosezimuszavr{io,anga`ovawemmladihidaraovitihigra~asaovihprostora. Najpre je sklopqen ugovor sa levim bekom Qubom Nenadi}em iz Kragujevca,a~etvorogodi{wiugovorpotpisaojeiStevanLukovi}(19),koji}epoja~atikonkurencijunapozicijidesnogspoqneg. Nazvani~nompredstavqawuLukovi}jezadu`iodressabrojem 34,anijeuspeodasakrijetremuiuzbu|ewezbogostvarewade~a~kogsna. -Presre}ansamzbogukazane{anse.Mogudaka`emda}udati sveodsebedasenametnemujakojkonkurencijinasvojojpoziciji. Ve{ovi}iStojkovi}suodli~niigra~i,aliverujemusvojesposobnosti,iradsatreneromkakavjeRobertProsine~ki,pasenadamda}uiskoristitiukazanu{ansu-istakaojemomakkojijekarijeruzapo~eouTopli~aninuizProkupqa,dabipotompre{aou mla|e selekcije Crvene zvezde, a u prethodne tri godine bio je ~lanSopota.Tako|e,Lukovi}jepro{aokrozsvemla|eselekcije reprezentacijeSrbije. Z.R.

17

Prva liga Srbija - NOVI SAD: Novi Sad Kolubara, PE]INCI: Dowi Srem - Sin|eli}, ZREWANIN: Banat - ^ukari~ki, PO@AREVAC: Mladi radnik - Srem, NI[: Radni~ki In|ija, MLADENOVAC: Mladenovac - Radni~ki (S), KRAQEVO: Sloga - Be`anija, LU^ANI: Mladost - Teleoptik. Utakmice po~iwu u 17 ~asova. SrpskaligaVojvodina- SENTA: Senta - Tekstilac, KIKINDA: Kikinda - Cement, LAZARE VO: Za dru gar Sloga (T), BA^KI JA RAK: Mla dost Radni~ki (NP), ^ELAREVO: ^SK Pivara - Dunav, PADINA: Dolina - Pali}, VR [AC: Vr {ac Radni~ki ([). Utakmice po~iwu u 17 ~asova. Vojv o| ans ka lig a Istok- NOVO MILO[EVO: Vojvodina - Jedinstvo (BK), KOVIN: Kolonija - Ba~ka 1901, NOVI KOZARCI: Sloboda - Borac (S), NOVI BE^EJ: Jedinstvo - Dinamo (P), BANATSKI KARLOVAC: Proleter - Kozara, BAJMOK: Radni~ki - Obili}, SRPSKA CRWA: Budu}nost - AFK, ZREWANIN: Radni~ki - Ba~ka (P). Utakmice po~iwu u 17 ~asova. Vojvo|anskaligaZapad- NOVI SAD: Borac Budu}nost (M), NOVI SAD: Crvena zvezda Ba~ka (BP), KA]: Jugovi} - Prvi maj, BA^KI PETROVAC: Mladost - Radni~ki (SM), ERDEVIK: Sloga - Mladost (T), STARA PAZOVA: Jedinstvo - Obili}, NOVI SAD: Indeks - Omladinac, SIVAC: Polet - Stani{i}. Utakmice po~iwu u 17 ~asova. Bara` za popunu Podru~ne lige Novi Sad TEMERIN: Vojvodina (Ba~ko Gradi{te) - @SK (@abaq). Igrali{te TSK -a. me~ po~iwe u 17 sati.

gusta 2006. godine dobila rezultatom 3:1. Nastupom protiv „trikolora”, defanzivac ^elsija zaslu`io je „zlatnu kopa~ku” Fudbalskog saveza Srbije, a za „dijamantsku” bi}e mu neophodno da sakupi 75 me~eva.To naravno ne}e biti nikakav problem za ovog fudbalera, koji je ro|en 22. februara 1984. godine u Sremskoj Mitrovici. Iza Ivanovi}a, po broju nastupa za Srbiju, pore|ali su se Milo{ Krasi} (46), Zdravko Kuzmanovi} (45), Milan Jovanovi} (44), Nikola @igi} (44), Dejan Stankovi} (41), Zoran To{i} (41), Marko Panteli} (40), Vladimir Stojkovi} (39), Danko Lazovi} (39)...

KANARINCIDO^EKUJUKOLUBARU

Pobedazanavija~e Fudbaleri Novog Sada igraju posledwu ovosezonsku utakmicu pred svojim pristalicama, a gost im je Kolubara. Izabranicima trenera Josifa Ili}a potreban je barem bod da bi mirno sa~ekali posldwu utakmicu, s tim {to se Kolubara bori za opstanak. Lazarev~ani su jesenas na svom terenu izgubili od Novog Sada s 2:1, a na ~etiri prethodne utakmice nisu pobedili i do{li su u situaciju da im je utakmica na Detelinari biti ili ne biti. Samo pobeda ostavqa Kolubaru u trci za opstanak sa somborskim Radni~ki i ^ukari~kim. Doma}a ekipa ima problema sa {trajkom 13 fudbalera, kao i povredama Avakumovi}a, Vu~kovi}a i Tufegxi}a, s tim {to se vra}aju Miji}, Balabanovi} i Vukasovi}. Kanarinci nisu pora`eni na Detelinari u posledwih {est utakmica i svakakoda }e u duelu sa Kolubarom pru`iti maksimum kako bi se pobedom oprostili od navija~a i rastere}eno u posledwem kolu gostovali ni{kom Sin|eli}u. - Imamo dosta kadrovskih problema. To se pre svega odnosi na mla|e igra~e koji su u fini{u prvenstva dobili {ansu i platili ceh jakom ritmu treninga i utakmica. U goste nam dolazi

ekipa Kolubare koja je u nezadivnoj situaciji i samo je pobeda vodi ka opstanku. Mi `elimo da u kvalitetnoj i borbenoj utakmici do|emo do pozitivnog

Povratakkapitena: MiloradBalabanovi}

rezultata, da se pobedom oprostimo od navija~a. Ovaj mladi tim, koji je sticajem okolnosti dobio priliku da poka`e koliko mo`e u zavr{nici prvenstva, mo`da nije sto odsto spreman da odgovori zahtevima prvoliga{kog takmi~ewa, ali borbenost i zalagawe su za svaku pohvalu - ka`e trener Josif Ili}. Utakmica na Detelinari po~iwe u 17 ~asova. I.Grubor

PRVALIGASRBIJA

PetardapodBagdalom U premijerom susretu pretposledweg 33.kola Prve lige Srbije, u Kru{evcu doma}in Napredak, ubedqivo je slavio protiv novosadskog Proletera 5:1. U prvom poluvremenu vi|ena su ~etiri pogotka. Za ~arapane koji su nakon prvih 45 minuta stekli prednost 3:1, strelci su bili Mirosavqevi} (dva) i Mati}. Jedini pogodak za Slanobarce delo je Obradovi}a. U nastavku su Kru{evqani sa dva gola Gavri}a zape~atili sudbinu Novosa|ana za kona~nih 5:1, upisav{i tako 13 prvenstvenu pobedu ~ime su izbili na tre}e mesto na tabeli.


18

SPORT

subota2.jun2012.

dnevnik

]EZAREPRANDELI,SELEKTORITALIJE

Akotreba, neidemonaEP Selektor italijanske reprezentacije pomalo nervozno govorio o aktuelnom trenutku fudbala „na ~izmi� u svetlu sumw i o name{tawu rezultata. Ako je u interesu fudbala i na{e dr`ave, ne moramo ni da igramo na EP.

- Da li su dve ili tri nedeqe dovoqne da se re{i ovaj problem? Ja mislim da ne. Treba ukinuti fudbal u Italiji na neko vreme.Domeniko Kri{ito ve} je platio ceh. On ne}e biti deo tima na EP, a policija je ispitivala i golmana \anlui|ija Bufona. Osumwi~en je i Leonar-

]ezare Prandeli

Nove afere potresaju italijanski fudbal, pri~e o name{tawima su sve utemeqenije, a istrage nisu po{te|eni ni reprezentativci koji se pripremaju za Evropsko prvenstvo u Poqskoj i Ukrajini.Italijanski premijer Mario Monti pre nekoliko dana ~ak se javno zapitao:

do Bonu}i. Svi ti oblaci nadvili su se nad selekcijom koja uvek va`i za jednog od favorita za najvi{e mesto na turniru. Reaguju}i na izjavu premijera Italije, selektor ]ezare Prandeli rekao je da ne bi imao problem sa odlukom vlasti da zarad dobrobiti fudbala italijanska reprezentacija ne ode na EP.

- Ako nam bude re~eno da ne treba da u~estvujemo na Evropskom {ampionatu, jer bi to bilo dobro za fudbal i za na{u dr`avu, ne bismo imali problem sa tim. Ima mnogo va`nijih stvari u `ivotu od fudbala pomalo qutito je rekao Prandeli za RAI Sport. ^ak 22 kluba i 61 osoba su pod istragom italijanske policije i tu`ila{tva u novom talasu optu`bi i sumwi o name{tawu utakmica. - Sramota me je da pri~am o 40 ili 50 pokvarenih pojedinaca. Ne volim ni krsta{ke pohode. Radije bih da pri~am samo o fudbalu, ali doga|aji ne idu u prilog tome - dodao je Prandeli. Advokat \anlui|ija Bufona je negirao da je wegov klijent ume{an u neka nedozvoqena kla|ewa, a italijanske novinare je zanimalo u kakvom je psihi~kom stawu jedan od najboqih golmana na svetu. - Kako se ose}a Bufon? Najboqe je da wega pitate. On je jaka osoba, ~vrstog karaktera. Nau~io je ve} da se nosi sa sli~nim neprijatnim trenucima u svom `ivotu. Uprkos tome, jasno je da svaku osobu mora da okrznu ovakve situacije - rekao je selekor. Italija je u Grupi C sa Hrvatskom, [panijom i Republikom Irskom. Prvi me~ igraju protiv [panijom 10. juna.

DOMENIKOKRI[ITONEPUTUJENAEVROPSKOPRVENSTVO

Ne}udabudem`rtvenojagwe Domeniko Kri{ito smatra da nije u redu {to je skinut sa spiska putnika za Evropsko prvenstvo. Levi bek Zenita tvrdi da nikada nije u~estvovao u name{tawu utakmica. - U `ivotu nikada nisam uradio ni{to ilegalno. Ne}u da budem `rtveno jagwe u situaciji sa kojom nemam veze. Mo`da je Italijanski savez mogao da reaguje druga~ije i potvrdi da nisam deo te pri~e. [okirao sam se zbog onog {to se desilo, a bio sam spreman za Euro - rekao je Kri{ito italijanskim medijima. Policija je pre nekoliko dana posetila kamp italijanske reprezentacije blizu Firence i Kri{itu saop{tila da se nalazi pod istragom zbog sumwe da je u~estvovao u name{tawu utakmica. - Tu`ilac je rekao mojim advokatima da u bli`oj budu}nosti ne}u morati na ispitivawe. Re~eno mi je da ne postoji nikakav problem da odem na {ampionat. Posle dolaska policije i pretresa wegove sobe, Italijanski savez i selektor ]ezare Prandeli odlu~ili su da ne uvrste Kri{ita na kona~an spisak od 23 igra~a za EP. Italijanski mediji nedavno su objavili fotografiju na kojoj se vidi Kri{ito u razgovoru sa

Duel beograski vukova i novosadskih Vojvoda

SUPERLIGASRBIJEUAMERI^KOMFUDBALU

VukoviiVojvode delemegdan Uzbudqivo }e biti ovog vikenda na terenima ameri~kog fudbala u Srbiji na superliga{kim i na prvoliga{kim te re ni ma. U okvi ru elitnog ranga odlo`en je me~ izme|u Kraqevskih kruna i Vitezova iz Kleka. Put u plej- of poku{a}e da u ovom kolu prokr~e novosadske Vojvode i beogradski Plavi zmajevi na te{kim gostovawima.Na terenu sa ve{ta~kom travom na Adi Ciganliji (15 ~asova) iza}i }e Vojvode na megdan aktuelnim {ampionima, SBB Vukovima, koji su ove godine neprikosnoveni. Mo-

raju Vojvode da se nadaju ~udu u ovom me~u ili povoqnim rezultatima u ostalim duelima, kako bi kolo pre kraja sa~uvali ~etvrtu poziciju koja ih vodi u plej -of.Naime, oni }e posle duela na Adi u posledwem kolu do~ekati vice{ampione kragujeva~ke Divqe veprove, koji u ovom kolu mogu da im od ra de ve li ki po sao eventualnom pobedom na pomo}nom terenu stadiona ^ika Da~a u Kragujevcu (16 ~asova) protiv Plavih zmajeva. Ni Zmajevi nisu bez {anse, mada su im potrebne dve pobede do kraja {ampionata da bi se nadali plej-ofu. Do sada

odi gra ni me |u sob ni me ~e vi im ne igu u prilog, po{to nikada nisu pobedili Veprove. Plej-ofa se sva ka ko ni su odrekli ni Panteri iz Pan~eva, koji su zbog odustajawa Vitezova iz Kleka u pro{lom kolu imali bezmalo mesec dana da se oporave od visokog poraza u Kragujevcu. Pan~evci }e u ovom kolu ugostiti gotovo otpisane An|eoske ratnike iz ^a~ka (nedeqa 16 ~asova, stadion SC Mladost), dok bi povoqan razvoj doga|aja u posledwem kolu mogao da im donese i razigravawe eventualnom pobedom nad Plavim zmajevima u Beogradu.

PRVALIGASRBIJE

Favoritinaisku{ewima Domeniko Kri{ito

ostalim osobama osumwi~enim za name{tawe me~eva. - Ta fotografija je od pre godinu dana, mogli su mnogo ranije da me pitaju za wu. Slika je napravqena posle gradskog derbija \enove i Sampdorije, kada mi je re~eno da su navija~i `eleli da pri~aju sa nama o igri koju smo tada pru`ili - nastavio je nekada{wi igra~ \enove, a sada ~lan ruskog Zenita. On je istakao da fotografija nije dokaz da je uradio ne{to lo{e.

- Sreo sam saigra~a \uzepe Skulija i jednog ~oveka koji mi je bio nepoznat. Obe}ao sam navija~ima da }emo igrati boqe i oti{ao ku}i. Za razliku od wega, Leo nardo Bonu}i iz Juventusa, koji je tako|e pod istragom za name{tawe me~eva, putova}e na EP. - Bilo bi u redu da smo obojica putnici za Poqsku i Ukrajinu. To {to su me zvani~no obavestili da sam pod istragom, ne zna~i i da sam kriv - zakqu~io je Kri{ito.

Tri kola preostala su do kraja Prve lige Srbije, u obe divizije postaje sve zamr{enije posle pro{lonedeqne pobede vrba{kih Lovaca nad somborskim Celtisima. Iako na prvi pogled na tabelu, mo`e da se u~ini da u ovom kolu favoriti igraju protiv autsajdera, to svakako ne}e biti tako. Danas }e najpre Legionari iz Sremske Mitrovice, na svom stadionu 25. maj, od 16 ~asova do~ekati Grofove iz Novog Kne`evca i na tom susretu poku{ati da odr`e prednost koju imaju u odnosu na svoja dva konkurenta, Lovce iz Vrbasa i Sombor Celtise. Najstariji klub u Srbiji je u velikoj seriji, obzirom da je posle po~etnog poraza u Vrbasu nepora`en u pet narednih duela, ali sva ka ko }e i ovaj me~ mo ra ti da shva te

ozbiqno ako ne `ele da izgube te{kom mukom do sada ste~eno. Rehabilitaciju posle te{kog poraza od Lovaca u pro{lom kolu tra`i}e i Sombor Celtisi, ali im zadatak ne}e biti nimalo lak, obzirom da im na noge dolaze Mamuti iz Kikinde, koji su u pro{lom kolu namu~ili upravo Legionare. Me~ se igra na stadionu PIK - a sutra u 15 ~asova. Vrba{ani su slobodni u ovom kolu. U diviziji Jug odavno su se ve} izdvojili Ni{ Imperatori i Indijansi iz In|ije, koji vode mrtvu trku za plasman u elitu. Ni{lije imaju prednost zbog me|usobnog trijumfa nad Indijansima u prvom delu prvenstva, pa je ve} sada jasno da }e upravo revan{ odlu~iti o tome koja }e se ekipa obresti u Superligi.

BREND ANROY ERS,NOV ITREN ERLIV ERP UL A

Ula`em`ivotzauspeh Brendan Roxers ne obe}ava odmah titulu navija~ima Liverpula, ali obe}ava krv, znoj i suze od starta i po~etak procesa vra}awa trofeja na Enfild roud. Brendan Roxers je tek 18. osoba koja je dobila priliku da vodi jedan od najpopularnijih timova na svetu - Liveprul. Mladi trener, koji ima 39 godina, promovisan je u trenera Liverpula, na sle div {i ta ko iko nu klu ba Kenija Dalgli{a, posle sezone koja se ne bi mogla nazvati uspe{nom, uprkos osvajawu trofeja u Karling kupu. - Pro{lo je 20 godina otkako je Liverpul osvojio posledwu titulu prvaka Engleske. Mo`da ne}emo biti spremni da ve} u narednoj sezoni

prekinemo tu crnu seriju, ali proces da se to dogodi u skorijoj budu}nosti po~iwe odmah - rekao je novi trener Liverpula, istakav{i da }e za taj ciq ulo`iti svoj `ivot! Kada je dobio ponudu Liverpula, dosada{wi trener Svonsija se nije dvoumio ni sekunde. - Iako sam mlad trener, imam 20godi{we iskustvo u fudbalu. Obe}avam da }u se boriti celim svojim bi}em za klub i qude koji ga vole rekao je Roxers, koji poti~e iz Severne Irske. Liverpul ima 18 titula prvaka Engleske, ali je posledwu osvojio u sezoni 1989/90.Roxers, nekada{wi trener Votforda i Redinga, obe}ao je da }e na Enfild vratiti napada~ki fudbal.

- Istorija kluba, ali i dugogodi{wa frustracija u nedostatku titule prvaka Engleske bili su dodatni izazov za mene da prihvatim ovaj posao. Ovo je klub u kojem, ako ima{ uspeha, ostaje{ godinama rekao je Roxers. On je odbio da komentari{e tvrdwe da se prihvatawem posla u Liverpulu obavezao da ne dovodi igra~e iz Svonsija u narednih 12 meseci. Ono {to je rekao jeste da mu je potreban odli~an tim i da }e uskoro sesti sa ~elnicima kluba i sa wima odlu~iti {ta }e raditi na tom planu. Na vi ja ~i Li ver pu la ni su ba{ blagonakloni prema odluci uprave kluba da ga postavi za trenera, ali je Roxers uveren da }e vremenom dobiti podr{ku publike.

Brendan Royers }e naredne sezone voditi slavni Liverpul


c m y

dnevnik

SPORT

subota2.jun2012.

19

INTERKONTINENTALNEKVALIFIKACIJEZAOLIMPIJSKEIGRE

Sjajanstartorlova Japan–Srbija0:3(19:25,23:25,16:25) TOK IO: Ha la Me tro po li ten, gle da la ca: 4.000, su di je: Gon za les (Mek si ko)i Du dek (Poq ska). JAP AN: Na ga no (l), Kon doh, Usa mi, Ja ma mo to 11, To mi ma cu 3, Ma cu mo to 3, Ja ma mu ra 1, [i mi cu, Fu ku za va 12, I{i ja ma 3, Jo ne ja ma 7, Ko {i ja. SRB IJ A: N. Ko va ~e vi} 10, U. Ko va ~e vi}, Ja ni}, Pet ko -

Rezultati (1.kolo) Australija–Venecuela Portoriko–Kina Iran–Koreja Japan–Srbija

pi la Sr bi ja na 14:10. Re a li zo va li su na {i mom ci sva ku kon tru i odr `a va li pred nost bez pr o ble ma. Ser vis im je

je blok Pod ra {~a ni na bio pre lom ni po tez se ta (do neo iz jed na ~e we (18:18), a kon trom Sta ro vi }a Sr bi ja je po ve la 19:18. Jo{ jed nom je xo ker iz ru ka va na {eg se lek to ra Ko la ko vi }a bio Mi haj lo Mi ti}, ko ji je do brim ser vi som do neo set lop tu na {oj se lek ci ji (24:22) i po sle to ga dvo se tov no vo| stvo. Na sta vi la je na {a rpre zen ta ci ja s do brom igrom i u tre -

bio ja ko oru` je, a ak ti vi rao se i blok i orlo vi su si gur no je zdi li ka vo| stvu. Ja pan je gre {io iz ser vi sa, a na{ blok je u ne ko li ko na vra ta bio ne mi lo sr dan za ube dqi vih 25:19. Stao je ser vis Sr bi je u na stav ku me ~a, a ka da su orlo vi po ~e li da gre {e i iz na pa da, Ja pan je pre u zeo kon tro lu dru gog pe ri o da su sre ta. Po ve li su Ja pan ci 11:9 i dr `a li dva po e na vi {ka do dru gog teh ni ~a kog tajm-auta. Po no vo

}em se tu. Ak tiv ni blok obez be dio je mno go broj ne kon tre, a kraj wi na pa da ~i bi li su ve o ma ras po lo `e ni. Ni ki} i Ko va ~e vi} su pr o la zi li, a Sta ro vi }a je za me nio Ata na si je vi} i pred nost Sr bi je ra sla je iz mi nu ta u mi nut. Od 16:11, na {i mom ci su ne za dr `i vo ju ri li ka mak si mal noj po be di, a Ja pan ci su po ku {a va li sve ne bi li se vra ti li u igru, ali su te ren na pu sti li po gnu tih gla va. M.R.

Dana{wi program 3:0 0:3 3:0 0:3

mak si mal no ozbiq no i an ga `o va no. Ve o ma je bit na ova po be da na {ih od boj ka {a jer su sa vla da li jed nu od azij skih

Australija–Portoriko(4) Kina–Iran(6.30) Koreja–Srbija(9) Japan–Venecuela(12.05)

Luka^ubrilo

IZOKVOJVODINANSSEME

Luka^ubrilo uNema~koj Tehni~ar OK Vojvodina NS seme Luka ^ubrilo slede}u sezonu igra}e u nema~kom Bulu, s kojim je potpisao saradwu na dve godine. Dete novosadskih crveno-belih je na po~etku pro{le sezone potpisao ugovor s mati~nim klubom na 1+1 sezonu i iskoristio klauzulu da ode u inostranstvo na isteku prve sezone.

U Vojvodini je pro{ao sve selekcije i u svakoj osvajao trofeje, a sada }e zapo~eti inostranu karijeru u jednoj od najja~ih evropskih liga. - Luka je dete Vojvodine, pomogli smo mu koliko smo mogli i `elimo mu puno sre}e i uspeha u daqoj karijeri - rekao je generalni direktor Vojvodine NS seme Vasa Miji}. M.R.

Iri~anini KlisurauFinskoj Prima~ servisa Nevena Iri~anin i korektor Sowa Klisura odbojka{ku karijeru nastavi}e u Finskoj. Pro{le sezone je Iri~anin igrala za Varadin, a Klusira za Vojvodinu, a nova destinacija im je

- Zadovoqne smo, veoma lepo su nas primili, kako devojke tako i treneri i qudi iz kluba. Dobro smo se pokazale, klub je organizovan i ima visoke ambicije za slede}u sezonu i drago nam je {to karijeru na-

NikolaKova~evi}unapadunajapanskiblok

NevenaIri~anin

klub HPK Naiset iz finskog grada Hamenlina, finalistu ovosezonskog plej-ofa.Posle pet dana provedenih na severu Starog kontinenta, Iri~anin i Klisura su veoma zadovoqne i pune utisaka.

SowaKlisura

stavqamo u inostranstvu. Hamelina je mali grad, ali veoma lep, samo }emo morati da se naviknemo na hladno}u - na{alila se Nevena Iri~anin. M.R.

vi} 2, Stan ko vi} 6, Ni ki} 13, Mi ti}, Ra {i}, Ata na si je vi} 3, Sta ro vi} 7, Pod ra {~a nin 10, Ro si} (l). Od boj ka {i Sr bi je tri jum fal no su po ~e li In ter kon ti nen tal ne kva li fi ka ci ja za do la zak na Olim pij ske, mak si mal nim re zul ta tom sa vla da li su Ja pan. Za raz li ku od su sre ta ovih re pre zen ta ci ja pre de se tak da na u Svet skoj li gi (bi lo 3:2 za Sr bi ju), ovo ga pu ta orlo vi ni su do zvo li li ne iz ve snost i od i gra li su

re pre zen ta ci ja, tra di ci o nal no ne u god ne svim se lek ci ja ma. Tri bo da su do bar pred znak za na sta vak kva li fi ka ci ja s ko jih u Lon don ide po bed nik tur ni ra i naj bo qa azij ska se lek ci ja. Obe re pre zent ci je su kon cen tri sa no po ~e le utak mi cu. Pri je mi ser vi sa su do bro funk ci o ni sa li i igra lo se poen za poen. Tek blo kom Pod ra {~a ni na i po sle do bre se ri je ser vi sa Ni ko le Ko va ~e vi }a re zul tat ski se od le -

ZREWANINCIPONOSNINASVOJEKUGLA[E

Blistajuiunacionalnimselekcijama Srpski kugla{i u konkurencijama pionira, kadeta i juniora ostvarili su sjajne rezultate na Svetskom prvenstvu u Nema~koj. Ovo je i svojevrsni uspeh najve}eg banatskog grada, jer su okosnicu nacionalnog tima ~inili takmi~ari i treneri zrewaninskih kugla{kih klubova Banat i Kristal. Ju ni or ska re pre zen ta ci ja osvojila je zlatnu medaqu i time odbranila titulu ekipnog prvaka sveta. Na{u reprezentaciju su, pored ostalih, ~inila i trojica ~lanova zrewaninskog Banat – Radovan Vlajkov, Slo bo dan Si mo no vi} i Dalibor Popov. Jo{ tri zlatna odli~ja osvojio je Robert Erwe{i, Novobe~ejac u dresu Segedina. Na pionirskom i kadetskom pojedina~nom Svetskom kupu ekipu je predvodio trener zrewaninskog Kristala Dragan Fatovi}. U konkurenciji pionira, ~lan Kristala Bo`idar Juri{i} izborio je bronzanu medaqu, dok je kadetsko zlato odbra-

nio Robert Erwe{i. @enska omladinska ekipa zauzela je osmo mesto, a ~lanica ovog tima bila je i Jelena Popov, takmi~arka Banata.

- Najte`e u sportu je odbraniti prethodno osvojeno, a to je juniorskoj kugla{koj reprezentaciji po{lo za rukom, pa je ostala u svetskom vrhu – ocenio je

~lan Gradskog ve}a zadu`en za sport Vojislav Mati} koji je, zajedno sa generalnim sekretarom Sportskog saveza Sr|anom Bogaro{kim i predsednikom Skup-

{tine grada Zrewanina Aleksandrom Martonom, priredio prijem za zrewaninske kugla{e. Trener Kristala i pionirske i kadetske reprezentacije Dra-

gan Fatovi} je kazao da ovaj uspeh ne mo`e biti slu~ajnost i da }e na nekom slede}em takmi~ewu ovda{wi kugla{i posti}i, ako ne iste, onda bar sli~ne rezultate. - Kuglawe u Srbiji svakako ima budu}nost i siguran sam da }e na{a zemqa ostati u samom vrhu kada je ovaj sport u pitawu, me|u ~etiri dr`ave koje se uvek bore za medaqe. Dosada{wim rezul tati ma po kazali smo da smo dominantni u mu{koj konkurenciji – naglasio je Fatovi}. Sekretar KK Banat Du{an Popadi} istakao je da takmi~arski uspesi motivi{u sve u ovom klubu da nastave sa razvojem {kole kuglawa i da svu pa`wa usmere ka mladima. ^la no vi ju ni or ske re pre zentacije su kratko prokomentarisali da je konkurencija u Nema~koj bila jaka i da su morali da ulo`e dosta truda da bi stigli do uspeha. Sve ostalo su ve} kazali na kugla{koj stazi.


20

sport

subota2.jun2012.

dnevnik

KVALIFIKACIJEZAEP:NANOVOSADSKOJSLANOJBARIIGRAJUSRBIJAIPORTUGALIJA

Zapubliku,bodoveiutisak Prviput`enskarukometna reprezentacija Srbije igra}e utakmicu u Novom Sadu.Rivalna{imdevojkamauposledwem,{estomkolukvalifikacija za Evropsko prvenstvo u Holandiji bi}e najboqa selekcija Portugalije. Utakmica se igrau18~asovauSCSlanabara,aulazjeslobodan. Timpovodomsedmojsilisuse obratili direktor reprezentacijeMilanStankovi},selektor Sa{aBo{kovi},igra~iceKatarinaLi{~evi},KatarinaToma{evi}iBiqanaFilipovi}.

grali smo uspe{no i ~ekamo `reb(6.jun)kada}emosaznati imena rivale na EP. Ve~era{wi me~ s Portugalijom ne}e ni{ta promeniti, ali }emo se maksimalnopotruditidagaodigramo vaqano i da se pobedom oprostimoodovefazetakmi~ewa.Sviovime~evi,iakonemaju rezultatskizna~aj,zanassubitnijersutoujednopripremenajprezaEP,kaoizaSvetskoprvenstv u Srbiji slede}e godine, gdenamjeciqdaosvojimomedaqu-rekaojeBo{kovi},uzkonstatacijuda`enskareprezentacija Srbije prvu put igra u No-

Vukovi}uzdame Uposeti`enskojreprezentacijibilisupredsednikRSSVelimirMarjanovi}ikompletanstru~ni{tabmu{kerukometne reprezentacije:selektorVeselinVukovi},prvisaradnikVladanJordovi}ikondicionitrenerNenadWaradi.Bo{kovi}se zahvalio Vukovi}u i wegovim saradnicima na poseti, kao i predsednikuMarjanovi}u. Vukovi}isaradnicisuposetuiskoristilidanapraveplani programtestirawaipripremazaOlimpijskeigre,gde}eSrbijirivalibitiHrvati,[panci,Danci,Ma|ariiKoreanci. - Najpre bih `eleo da zahvalim Rukometnom savezu Srbije, koji nas maksimalno podr`ava tokom ovih kvalifikacija, kao i na{im doma}inima, osobqu hotela Park i dvorane na Slanojbari,gdenammaksimalnoizlazeususret.Zahvaliobihsei qudima iz Vrwa~ke Bawe, koji su omogu}ili ekipi da imamo odli~ne uslove pred me~ s Gr~kom-rekaojeStankovi}. SelektorBo{kovi}jeistakao da bi voleo da na{a reprezentacija zavr{i kvalifikacije za Evropskoprvenstvopobedom. -UkvalifikacijamasmozauzelidrugomestougrupiizaRumunije, ~ime smo ve} ranije obezbediliu~e{}enaEPuHolandiji.Ovekvalifikacijeodi-

vom Sadu i da se nada da }e publika podr`ati devojke i u`ivatiuutakmicisPortugalijom. Bek nacionalnog tima Biqana Filipovi}, iako ima 16-godi{wu karijeru, prvi put }e igratiuNovomSadu. - Radujem se {to }u igrati prednovosadskompublikom.Do sada je reprezentacija uvek igralauZaje~aruiNi{u,asada }emoimatinovuobavezudapridobijemopublikuiuovomdelu Srbije. Prvi duel sa Portugalijomsampropustila,ali}uve~eras dati sve od sebe da ove kvalifikacije zavr{imo pobedom-reklajeFilipovi}eva. GolmanKatarinaToma{evi} reklajedajojje`ao{toekipa nijepobedilaRumuniju,padasa

DetaqizsusretaSrbija–Gr~kauZaje~aru

maksimalnim u~inkom ide na {ampionatStarogkontinenta. - Pozivam publiku da ispuni halunaSlanojbariiobe}avam

dobrurukometnupredstavu-naglasilajeToma{evi}eva. Reprezentativku Kristinu Li{~evi} prvi put u istoriji

Revija Novi Sad }e danas biti u znaku `enskog rukometa.Program po~iweupodne.NaterendvoranenaSlanojbariistr~a}epionirke(ro|ene1998/99)izsedamregionaSrbije,koje}eod12do 16~asovademonstriratisvojpotencijal.Potom}esedevoj~ice preseliti na tribine i bodriti seniorsku reprezentaciju, a pridru`i}eimsei`enskajuniorskareprezentacija.

`enskeLige{ampionajedanod glavnih sponzora takmi~ewa proglasiojujezanajboqumladu igra~icu elitnog klupskog takmi~ewa. - Ponosna sam na dobijeno priznawe. U konkurenciji je bilo mnogo dobrih rukometa{ica poput Aniko Kova~i~ i Amande Kurtovi},zahvaqujem seonimakojisuglasalizamene.Tomemotivi{edanapredujem-reklajero|enaSomborka, koja}ejo{godinudanabranitibojefrancuskogMeca,apo-

tom se osvrnula na ve~era{wu utakmicu:-Bezobzira{tosmo sekvalifikovali,ovuutakmicumoramomaksimalnodaodradimo,{tonebitrebalodabude problem s obzirom da ne}emo igrati pod imerativom pobede. Parvi je potez to {to je odlu~enodareprezentacijado|eiuovajdeoSrbije,jerVojvo|ani vole rukomet. Meni je posebnodrago{to}uigratiu Novom Sadu, a dolazak su najaviliimojiSomborci. J.Gali}

POSLEDWEPRVENSTVENOKOLOMU[KESUPERLIGE

Ko}euni`irang Najboqi mu{ki rukometni klubovi danas zavr{avaju nadmetaweuSuperligi.Triutakmice (Radni~ki - Crvenka Jafa, PKB - Po`arevac, Napredak - Smederevo) bi}e u `i`i rukometne javnosti prvenstvenozbogtoga{toseradioeki-

venkauKragujevcu.Akopobede iPKBiSmederevoiCrvenka, onda}esespasitiklubiznajsla|egselapo{tojenajboqiu me|usobnimokr{ajima. Zna~i, Crvenka pobedom u Kragujevcu zadr`ava elitni status, ali i ako odigra miro-

nalnomlokalnomderbijuukojem~estonikvalitetekipe,ni polo`aj na tabeli ne odlu~uje ishod.Rukometnimzaqubqenicimauovedvesredineteutakmice tradicionalno su me|u najdra`im,zbogtradicije,presti`a,uzbu|ewaineizostavne

ju}iuvidudakrajwiishodsusreta ne}e ni{ta promeniti natabeli.Tradicionalnirivalitet garantuje da svi oni kojivolerukometimajurazloga da subotwe ve~e provedu u dvorani Hram - rekao je u~iteqKa}anaVladanJordovi}. J.Gali}

DANASNA SPORTSKIMTERENIMA

Rukomet

Rukometa{iJugovi}aiVojvodinetradicionalnoigrajukvalitetneiuzbudqiveutakmice

pamakojeseborezaopstanaku elitnom dru{tvu. Mnogo je kombinacija oko nepoznanice ko}eostatiakonapustitiligu,aminudimonekeodmogu}nosti. UtakmicaPKB-Po`arevac je jedna od kqu~nih jer mlekaxijeprakti~nodr`esudbinuu svojimrukama.Beogra|anisuu najboqojsituaciji,pobedombi do{lido25bodovaiobezbedili opstanak u Superligi. Naravno,poduslovomdaSmederevonepobediuKru{evcuiCr-

qubivo,apritomdaPKBpobedi,aSmederevoizgubi.Tadabi senapraviokrugodtriekipe, gde su Crven~ani ponovo u prednosti. Postoje jo{ brojne kombinacije, gde je utakmica u Kragujevcu jedna od najzna~ajnijih imaju}i u vidu da su [umadinciposleubedqivogporaza od Smedereva promenili treneraLakovi}a. [toseostalihme~evati~e, duel ka}kog Jugovi}a i novosadske Vojvodine bi}e susret zapresti`.Radiseotradicio-

velikesportskeborbe,kojani ovogaputanebitrebalodaizostane. Ovo je prava prilika da igra~i poka`u svoje ume}e, da Vojvodina opravda epitet vice{ampiona dr`ave, a da neko od mladih igra~a Jugovi}a poka`e vanserijski talenat, kao {tojetobivaloikrozistorijususretadvakom{ijskakluba. -Verujemda}eutakmicabiti neizvesna i lepa za gledawe, prevashodno {to obe ekipe ulaze bez optere}ewa, ima-

Superliga (m) - KA]: Jugovi} Unimet - Vojvodina (19), BEOGRAD: Obili} @elezni~ar1949(19),PKBPo`arevac (19), KRAGUJEVAC:Radni~ki-CrvenkaJafa (19), KRU[EVAC: Napredak-Smederevo(19). Prva liga (m) - RA[KA: Bane - @elezni~ar (19), VRBAS: Vrbas Karneks - Jagodina (19), ZREWANIN: Proleter Agro`iv - Mokra Gora (18), NOVI PAZAR: Novi Pazar - Nova Pazova (18). Prva vojvo|anska liga (m) - BEZDAN: Grafi~ar - Vladimirovac(18). Prvavojvo|anskaliga(`) - NOVIKNE@EVAC:Obili}-Mileti}(18),UZDIN: Unirea-Dolovo(18). Drugavojvo|anskaliga(m) - JABUKA: Jabuka - Jedinstvo (20), ^ESTEREG: Napredak-@SK(20). Druga vojvo|anska liga (`) - ZREWANIN: Lehel Spartak(S)(15.30),KOVIN: Radni~ki (K) - Radni~ki (B) (17), APATIN: Apatin Pan~evo(14).

Malifudbal Futsalkup„Tvr|ava2012� - NOVI SAD: utakmice u grupama(od15do21,Spens)

DuelDankanaiPerkinsa

Oklahomadobila SanAntonio Neverovatnom igrom OklahomaSitisvelaje SanAntonionanajgore izdaweovesezoneismawilana1:2ufinaluZapada-102:82.Uvelikom stilu Sparsi su prekinuliserijuod20pobeda,zapo~etu 11.aprila.KojenaZapadumogao daprekineserijuod20uzastopnih pobedamo}nogiiskusnogSanAntonija?Samo tim koji u plej-ofu ne gubi kod ku}e.Oklahoma Siti Tanderzabele`ilajeidesetuuzastopnu pobedu u svojoj dvorani u postsezoniitakosmawilana1:2u finalu Zapadne konferencije NBAlige.Grmqavinajebilaubedqiva protiv tima koji do prethodne no}i, nije izgubio od 11. aprila.Tander-Spars102:82! Ovo presli{avawe veterana GregaPopovi~anijebilomogu}e samodobromigromtandemaKevin Durent/Rasel Vestrbuk i podr{kom Xejmsa Hardena. Bila je neophodnatimskaigra:Durent22 poena, 6 skokova, 5 asistencija, TaboSefolo{a19poena,6skokova, 6 ukradenih lopti, Harden 15 poena, 4 skoka, tri asistencije, Ser` Ibaka 14 poena, 3 blokade, Vestbruk 10 poena, 7 skokova, 9 asistencija,4ukradenelopte,dve blokade.S druge strane, Sparsi,

koji su bele`ili prose~no 109,4 poena tokom prethodnih mesec i podanaru{ewasvegapredsobom, zadr`ani su na svega 82 poena i ovo bi zaista mogao da bude tek po~etak duge i neizvesne serije. Jednojejasno-~i{}ewane}ebiti,anijebilonirealnodasedogodi. Toni Parker ubacio je 16 poena,uzpetizgubqenihloptii~etiri asistencije, Stiven Xekson tako|ejeimao16poena,TimDankansakupioje11,DexuanBlerdeset,uz{estkokova,aManu\inobilisvegaosam.Tojebilopremalo ~ak i za dostojan otpor, pa su najve}e zvezde San Antonija presedelekrajme~anaklupi,razmi{qaju}io~etvrtojutakmiciunedequ. -Ovosmomi.Ovakopobe|ujemo - rekao je trener Tandera Skot Bruks. Ipak,lakomislenobibilopomislitida}eiu~etvrtojutakmiciPopovi~evtimovakoizgledati.Nijenemogu}enidajeiskusni trener pustio niz vodu tre}u utakmicu, kako bi u ~etvrtoj uzvratiosvomsnagom. -Igralisusmnogovi{e`eqe, samnogovi{eenergijeodnasve~eras. Mora}emo da uzvratimo rekaojeParker.


c m y

kultura

dnevnik

subota2.jun2012.

21

ПРЕДСТАВА„МАРА/САД”НОВОСАДСКОГПОЗОРИШТАИЗВЕДЕНАКАОПОСЛЕДЊАУ ПРОГРАМУ 57.СТЕРИЈИНОГПОЗОРЈА

Фуриознопротутњалареволуција Као последња од седам представа у селекцији националне драме и позоришта, на 57. Стеријином позорју је изведена представа„Мара/Сад“ (Maratthe Sade)ПетераВајса,урежијиАндрашаУрбана,Ујвидекисинхаз/ Новосадскопозориште.КаконаводиселекторкаКсенијаРадуловићовоје„сценскиразигранаи маштовита поставка класичног текста, у којој симболи револуцијепостепенопочињудасеот-

кривајуикаоинструментаријум некогеротскогшопа:наравнода није реч о пукој ласцивности, већ о огољеној, до бруталности доведенојслициреалностиукојој као да се за превласт и моћ боре, благо речено, једни фалуси против других. У жустром темпу и уз брзе промене сценскихслика,фуриознотутњиреволуција са свим својим нусефектима, пренагљеностима, бизарностима... а упечатљива му-

ДАНАССЕЗАВРШАВА57.СТЕРИЈИНОПОЗОРЈЕ

Балет„Милева” участнаграђених Уручењемнаградаглумцима,редитељима,сценографима,костимографимаидругимпозоришнимделатницима,вечерасћеу Српскомнародномпозориштубитизатворено57.Стеријинопозорје.НаконпроглашењапобедникаучастнаграђенихнаовогодишњемПозорјубићеизведенбалетСНП-а„Милева“,намузикуМарјанаНећака,укореографијиирежијиСташеЗуровца. Токомпротеклихдеветдана,публикајеодгледаласедампредставауселекцијинационалнедрамеипозоришта,итриумеђународномпрограму„Кругови“.Жири,начелусаглумцемБраниславомЛечићем,одлучиваојеотрадиционалнимСтеријиним наградама,којећесевечераснаћиурукамадобитника.

зика и сложна, надахнута игра глумачког ансамбла уоквирују редитељскузамисао“. - „Мара д Сад“ је представа којуневредипретераноописивати,несамозатоштојесложена и стилски разноврсна и живописна,савеликимансамблом који зрачи извођачком енергијом и убедљивошћу, него зато штосетаквоштаморавидети! Није за оне са слабијим стомаком, иако се редитељ својски трудиодавеомаживибудусви забавни потенцијали откаченог Вајсовог текста, текста који је био претеча не само Милерове „Хам летмаш ин е“, него свег а оногаштоседанасназивапостдрамским, окружењу у којем Урбанпливакаошарануводи, да искористимо један од његових заштитних знакова, овде изо стао,башкаоимногедруге преп оз нат љиве „ситн иц е“ из његових режија, чинећи представуУјвидекисинхаздефинитивно посебном у узбудљивом опусуузбудљивогредитељакакавјеУрбан–напомињеусвом тексту, поводом премијере, позоришникритичарнашеглиста ИгорБурић.

ДОКУМЕНТАРИСТИЧКИТЕАТ  АР ОБЕЛЕЖИО57.СТЕРИЈИНОПОЗОРЈЕ

Светлостнакрајутунела Да је докум ент арн ис тичко позориште потпуни тренд, модерни сензибилитет, да је теа- тарместонакојемсеодговорно мора проговорити о горућим или тињајућим темама, потврдила је и претпоследња представа 57. Стеријиног позорја,

стуа л из ац иј у овак вог нач ин а представљања, аутори су били довољноуверљивинаплануреализације потребе за терапеутскимпомирењемсапрошлошћу и признавањем универзалних људских вредности као што су дом, породица, друг или момак

„Хипермнезија“ Селме Спахић (Битеф теат ар/ Фонд „Хартефакт“). Хип ермн ез иј а је пој ач ан а способностпамћењаодређених догађаја, најчешће повезана са афективно обојеним стањима дефиницијајекоја,акојојјеверовати, одређује сценски текст представе.Његаизводеоникоји су га креирали – Ермин Браво, Јелена Ћурувија Ђурица, Маја Изетбеговић, Тамара Крцуновић,ДамирКустура,СанинМилав ић, Мил иц а Стеф ан ов ић, АлбанУкај. Не улазећи претерано у проблематизацијуили,чак,контек-

Албанац, што нас све „бивше“ овдепосебнодира. Није све у дирљивости, али много тога у представи Селме Спахић заснива се на емоционалномусловавању,штојеблажитерминзапатетику(наовом Позорјупоновобисемоглоговорити о траумама из детињства, психол ош ком прис туп у ауторапозоришнојграђи).Азаправо, цела представа се концептуа лн о и извођ ачк и бор и против претераног уплива емоција. Покушава да нас сабере свенаједноместо,наместоизгубљене сигурности – детињства.

И даље, најлепше моменте „Хипермнезија“ постиже управокадглумциговореоњима.О опкољеномСарајевуисветумимо тенкова, о гранатама и срамоти деце због псовки родитеља,огладикојасенедаисказати речима (сценски покрет Далија Аћин), о почетку НАТО бомбард овањ а пар алелно из две визуре – Бео г рад а и Приштине... Тако је то било, некако. Мали јунаци великих прича истор иј е пос тај у велики страдалницималихпричапојединца, изгубљеног само зато што је, за разлику од осталедеце,живео сатетком.Затошто је имао благословенапетит. Поучна, отворенапозоришнаприча која захтева да Фото:Б.Лучић се и друштво, политика, отворе према дејству човека, идеа лн о зам иш љен ог човечанства у којем се нико не свађа, не супротставља, не манипулише истином другог. На својукорист. Сада је евидентно да се овогодишња селекција концентрисалаокопитањанаслеђа,онога што се може унапредити само упорним критичким испитивањем.Тоштосумногепредставе наликнатренд,устварисусамо почетак једне нове револуције, која ће сигурно да поједе својудецу. Дајнамцвећа,дајнамсветлости! Игор Бурић

ЧЕТИРИДРАМЕЕДВАРДАБОНДАУИЗДАЊУ„АРХИПЕЛАГА“

Злочини21.века Док издавачи углавном избегавајудаштампајудрамскетекстове, „Архипелаг„сеосмелиодапокренеедицију„Премијере„,укојојје као други наслов објавио драме британскогкласика20.векаЕдвардаБонда„Злочини21.века„. ГлавниуредникГојкоБожовићјерекао дајеБондједанодкључнихдрамскихписацанашегвремена,адаје у овој књизи светска премијера његове драме „Мелодија„. Избор је направила Наташа Миловић, а драме су, поред ње, превели Јадранка Гојковић, Ђорђе КривокапићиМаријаСтајић. Божовић сматра да је то занимљиво штиво, јер је Бонд истин-

скимајсторзадрамскитекстзанимљив различитим генерацијама и људима са различитим животним искуствима. Подсетившидајеуовоједицији, као први наслов, објавио последње драме Харолда Пинтера, Божовићјенагласиодасутокњиге пример модерне драматургије „зачитање„којесунаишленадобар пријем код читалаца. Према његовимречима,начињенјетакав тематскиизбордасестекнеувиду друштвенетемекојимасеБондбави,јеронверуједапозориштеморадаимаауторитетидапоставља питањаипозивапубликудасесуоче са њима и траже одговоре. За

Бондасу,какојерекаоБожовић,у центруинтересовањанасиљеимеханизми моћи, однос одраслих премадеци,суочавањесаизазовимабудућности... Бонд(78)јеизузетнозначајани каоредитељ,песник,есејиста,тео- ретичардрамеипозоришта,писац филмских сценарија, а написао је 50драмазапозориште,радиоителевизију. Његовдругикомад„Спасени„ (игран и код нас) био је забрањен због сцене у којој се беба каменуједосмрти.Овазабранасе сматра кључним догађајем који је довеодоукидањапозоришнецензуреуВеликојБританији. (Танјуг)

Брзимизменамасирових,бруталистичкихсцена,непосредних као и текст, Бурић наводи да је „њиховимпреплитањемиразвијањем различитих нивоа приче (публика-управа-лудаци-Мара/ Сад),Урбанпрактичноостварио

оргазмичност видео монт аже, филма и телевизије, али не оне коју гледамо ван, него оне унутар наших глава, кад је реч о природи друштва и појединца, њиховим сличностима и разликама. Сјајна музичка матрица

Силарда Мезеија, која подстиче фелинијевску фолклорност ликова и џезерски креативан неред,помишљењуБурића,заправојеосновналинијаритмарадње. Н. П-ј.

INTERVJU СЕЛМАСПАХИЋ,РЕДИТЕЉКАПРЕДСТАВЕ„ХИПЕРМНЕЗИЈА”

Документарноима нотупролазности Представу„Хипермнезија“,засновану на документарној грађи, односно личним исповестима глумаца, режирала је млада Селма Спахић, а настала је у копродукцији Битеф театра и независнерегионалнефондацијеХартефакт фонда,почијојидејијеирађена. Наиме, како Селма Спахић објашњава, ова представа је требало да на одређен начинизражавакредоХартефакт фондације, како политички, тако и уметнички.То је била њихова прва продукција, и хтели су, поњенимречима,да онабудена трагу нечега што они иначе раде, а то је помирење, проговарање и разбијање зидова ћутања на овим просторима. Али,исамајежелела да ради ову представу, одабрала документарни театар, као форму која би, чинило јој се, најбоље то показала. Признаје дајеимала велику срећу с поделом коју је пажљиво одабрала,а глумци су знали na чему ће се радити. Није било једноставно,напомињеСелма Спахић,али од прве пробе су кренули свида говоре потпуно отворено о свом животу, тако да јој се чини да није било

их изнесемо. Ако идемо већ да правимо такву представу, онда ћемо је правити до краја. l Да ли је онда теже концентрисати се на оно што је редитељски, занатски део? -Некако се занемарује а опет је јако битан, и на крају ће се ипак вратити на њега. Мени је подједнако било битно и једно и друго. Знала сам да желим да то буде позоришно уоквирено, да су изграђени редитељски знакови и да има своју поетику, и негдје сам се тиме заиста бавила подједнако као с овим другим. Јер, у једном тренутку смо, и то је заиста најтеже за актере и актерице, да кажу: добро, од сада ово постаје позоришна представа, материјал с којим ми можемо да радимо шта год желимо, да га сецирамо. Чак смо у једном тренутку расписивали сцене по мотивима њихових сцена. Онда смо од тога одустали и радили смо тачно онако како су они испричали. Да, тај умјетнички дио због тога је,мислим, позориште. Чини ми се да није тај естетски критеријум задовољен, онда дефинитивно не бих била задовољна представом. представе Фото:Б.Лучић l Какве сте досад радили? - Радиласам седам, осам представа, базираних искључиво на Задовољитипрофесионалне драмском тексту и заиста нисам интерполирала никакве елементе критеријуме документарног, осим евентуално l Све што је речено у представи је истина. Редитељ, у нешто фактографских, што ми је таквој ситуацији, има посебну одговорност, док покушатребало. Било ми је занимљиво, ва да ту истину склопи у неку уметничку целину? тачно ми је дошла фаза у којој ми - Имате посебну одговорност према људима који су толикотога се чинило да могу то да радим, подијелили са вама. Мени је било важно да представа функционинаравно, повлачећи искуство оноше, како негдје на том документарном нивоу, тако и на естетском, га што знам до тада, а то је режида задовољава своје професионалне критеријуме, и да они, као ја по драмском тексту, тако да ми глумци и глумице, стану потпуно иза ње и да се осјећају добро док се чини да је представа управо је раде, зато што је то заиста танак лед и клизав терен, и зато што комбинација те двије стране. l Шта ће бити убудуће? је то ваша интима коју не можете да оставите са стране када уђе- Е, то не знам, после сам радите. Једноставно је немогуће, зато што имате садашњи однос са рола поново драмски текст, тако да дитељима који се развија. је занимљивост тог документарног театра у томе што истовремепрепрека у њиховом отварању, врло спремно ушли у тај процес. но не постоји ништа живље на али је било компликовано. Ми- Но, било је комплицираних, за- сцени, а с друге стране је кратког слили су на друге људе које по- хтјевних проба, тешких у емотив- вијека, зато што нужно има неку мињуупредстави,наводиона,и ном смислу, зато што имате етич- ноту пролазности, дневно полизаиста је било осетљиво, с пуно ке дилеме, да ли износити ту вр- тичког, тако да има свој плус и сту интиме, али смо, заправо, и то минус. трудада нико не буде повређен. Н. Пејчић СелмаСпахић(1986)дипломи- ми је драго, увијек одлучивали да рала је режију на Академији сценскихумјетностиуСарајеву. l Рекли сте да су материјал за ову представу заправо људи. Па онда, да ли редитељ треба да буде мало и психолог? - Нужно, ја се надам да сам негдје била и то у одређеном смислу, мада, заиста, њихсу осморо


22

svet

subota2.jun2012.

BELGIJA

SIRIJA

Produbiti partnerstvoEU iRusije BRISEL: Samit EU i Rusije, 3. i 4. juna, bi}e zna~ajna prilika da se razmotre mogu}nosti za produbqivawe strate{kog partnerstva u svim oblastima, kao i na~ini rea{avawa ekonomske i finansijske krize i goru}ih me|unarodnih pitawa, izjavio je predsednik Evropskog saveta Herman van Rompej. - To }e biti zna~ajna prilika da razmotrimo duga~ak niz pitawa koja su danas aktuelna u odnosima EU i Rusije, kao {to su modernizacija, vizni re`im, trgovina - ocenio je Rompej. On je dodao da }e glavni ciq evropskoruskog samita, koji }e se odr`ati 3. i 4. juna, biti potvrda rezultata postignutih tokom proteklih godina u razvoju partnerstva EU i Rusije, kao i odre|ivawe kursa za naredne godine. Predsednik Evropske komisije @oze Manuel Barozo poru-

~io je da Rusija nije samo najve}i sused EU, ve} i wen strate{ki partner, sa kojim Unija gradi ~vrste i uzajamno korisne odnose. Samitu u Sankt-Petersburgu prisustvova}e predsednici Evropskog saveta i Evropske komisije, kao i visoka predstavnica EU za spoqnu i bezbednosnu politiku Ketrin E{ton i komesar za energetiku Ginter Etinger. Rusiju }e predstavqati predsednik Vladimir Putin, ministar spoqnih poslova Sergej Lavrov i nekoliko drugih ministara. Kako se o~ekuje, lideri }e tom prilikom razmeniti stavove o globalnoj ekonomskoj situaciji i stawu u evrozoni, kao i o regionalnim i me|unarodnim pitawima, ukqu~uju}i situaciju u Siriji, Iranu i na Bliskom istoku.

KANADA

Potragazakasapinom porno-glumcem OTAVA: Kanadski porno-glumac, osumwi~en da je raskomadao svog poznanika, objavio je video snimak tog ubistva, a delove tela poslao po{tom na vi{e lokacija u Otavi. Pisma su poslata i na adrese nekoliko politi~kih partija. Zvani~nica montrealske policije, koja je zbog daqe istrage `elela da ostane anonimna, rekla je agenciji Aso{ijejted pres da je osumwi~eni za monstruozno ubistvo, Luka Roko Mawota (29), najverovatnije pobegao u Francusku, ali da nema podatak o ta~noj lokaciji. Portparol montrealske policije Jan Lafrenijer izjavio je ranije da, na osnovu informacija koje su prona|ene u stanu Mawota i internet bloga na kojem je opisao kako planira da nestane, veruje da se on nalazi u SAD. Lafrenijer je dodao da je policija do{la do uznemiruju}eg video snimka na kojem je, kako se

pretpostavqa, prikazano kako Mawota ubija mu{karca sa kojim je bio u vezi. Na video snimku je prikazan mu{karac kako ubada {iqkom za led drugog mu{karca, koji je nag i vezan za krevet. Ubica potom na snimku obelodawuje da je `rtvi presekao grkqan, a zatim joj odseca udove i s wom izvodi seksualni ~in. Policijski portparol je dodao da je `rtva mu{karac belac, ~ija porodica ne `ivi na Ameri~kom kontinentu, pa policija ima dodatne pote{ko}e da do|e do wegove porodice. Mawota, koji je jo{ poznat kao Erik Klinton Wumen i Vladimir Romanov, stanovnik je Montreala i nema policijski dosije, a informacije o wemu prona|ene su na internet sajtu za odrasle. Za osumwi~enim je raspisana Interpolova poternica.

dnevnik

Vulkanombesa protivre`ima

DAMASK: U Siriji sukobi ne prestaju, iako je ultimatum koji su pobuwenici postavili predsedniku Asadu da obustavi nasiqe, kako se ne bi suo~io sa posledicama, istekao ju~e ta~no u podne po lokalnom vremenu. ^lanice EU tra`ile su da Agencija UN za qudska prava predlo`i pokretawe istrage o ubistvu vi{e od 100 osoba pro{le nedeqe u Huli. Sirijska opozicija navela je da re`imske snage i daqe napadaju grad Hulu, popri{te masakra tokom vikenda, kada je ubijeno vi{e od 100 osoba. Snage sirijskih vlasti ubile su 13 civila koji su se vra}ali ku}i s posla u fabrici |ubriva u Kusairu, u centralnoj Sriiji, tvrde aktivisti. Pobuwenici su naveli da }e, ako se zahtev ne ispo{tuje, prestati sve wihove obaveze i „brani}e i {tititi civile, wihova

sela i gradove”, a ponovo su zapretili „vulkanom besa”. Aktivisti su sino} na internetu objavili dva video-snimka na kojima se vide tela 13 ubijenih mu{karaca. Na jednom snimku se vide tela na zemqi sa prostrelnim povredama glave ili stomaka,

IRSKA

Irsko„da”pru`ilo malipredahevrozoni DABLIN: Nezvani~ni podaci koji govore da su Irci na referendumu glasali za ratifikovawe fiskalnog sporazuma Evropske unije o poo{travawu buxetske discipline, nisu doneli ve}i predah evrozoni, zabrinutoj za budu}nost Gr~ke u tom monetarnom bloku i za poquqane {panske banke. Irska ministarka za evropske poslove Lusinda Krajton je izjavila da je „veoma, veoma uverena” da je, na osnovu nepotpunih podataka, fiskalni pakt EU odo-

bren na jedinom plebiscitu o tom sporazumu u 17-~lanoj zoni evra, odr`anom u ~etvrtak. Finansijska tr`i{ta su danas zanemarila taj referendum i daleko su vi{e zabrinuta za druge op{te izbore u Gr~koj, zakazane za 17. jun i ubrzawe odliva kapitala iz [panije koja se odupire pritisku da zatra`i me|unarodnu pomo} za spasavawe svojih banaka. Svetske akcije i evro su potonuli, po{to su u maju pretrpeli najve-

AUSTRIJA

Krizauvladi BE^:U austrijskoj vladaju}oj koaliciji, koju ~ine Socijaldemokratska partija (SPO) i Narodna stranka (OVP), izbila je velika sva|a, koja ko~i rad vlade. Povod za zahla|ewe odnosa izme|u koalicionih partnera je postavqawe na rukovode}a mesta. Radi se o planiranom smawewu generalnog saveta Nacio-

a na drugom tela pore|ana na podu jedne zgrade oko kojih se nalazi rodbina koja oplakuje `rtve. Nema~ki ministar spoqnih poslova Gvido Vestervele pozvao je Moskvu da odustane od podr{ke Siriji, uo~i dolaska ruskog predsednika Vladimira Putina u Ber-

lin. U me|uvremenu, ameri~ki sekretar odbrane Leon Paneta rekao je da su Sjediwene Dr`ave spremne na svaki vid akcije protiv Sirije, ukoliko to bude neophodno, ali da su weni zvani~nici i daqe opredeqeni za pritisak me|unarodne zajednice na Asada da ode sa vlasti. Paneta je rekao da je wegova najve}a odgovornost da se pobrine da SAD dobiju svu potrebnu podr{ku me|unarodne zajednice, ako ameri~ki vojnici budu u~estvovali u bilo kojoj vojnoj operaciji. - Ne, ne mogu to da zamislim kazao je Paneta odgovaraju}i na pitawe novinara da li je mogu}a vojna intervencija bez podr{ke UN. Oglasio se i nekada{wi ameri~ki predsednik Bil Klinton, koji je rekao da ga pogor{avawe situacije u Siriji podse}a na Bosnu 1993. i 1994. godine.

nalne banke, kao i jednom polo`aju u Ustavnom sudu. Ministarka finansija Marija Fekter odlu~ila je da smawi broj ~lanova Generalnog saveta Nacionalne banke Austrije, usled ~ega bi „ispao” savetnik austrijskog kancelara i direktor Radni~ke komore Verner Mun, {to je naqutilo SPO.

}i mese~ni pad za osam meseci, prenela je agencija Rojters. [panija je saop{tila da su investitori povukli iz zemqe rekordih 66,4 milijarde evra (82 milijarde dolara) samo u martu, pre iznenadne nacionalizacije posrnule banke „Bankija”, ~etvrte po veli~ini u [paniji. Vlada [panije saop{tila je da je odlo`ila na najmawe nedequ dana usvajawe novog mehanizma za finansirawe {panskih autonomnih regiona, ~iji preterani buxetski izdaci u velikoj meri doprinose fiskalnim problemima zemqe, zajedno sa rastu}im dugom koji {panske {tedionice ne mogu da naplate posle kolapsa {panskog tr`i{ta nekretnina. Ta strahovawa su pomogla da prinos na sigurne nema~ke obveznice danas sklizne na rekordne minimume, dok istovremeno kamatne stope na {panski i italijanski dug postaju neodr`ive. Komesar EU za ekonomska i monetarna pitawa Oli Ren je u govoru u Helsinkiju izjavio da se evrozona suo~ava s izborom izme|u propasti ili ja~awa, {to poja~ava pritisak na lidere tog regiona da preduzmu radikalnije mere radi savladavawa krize. Evropska komisija, Evropska centralna banka i Me|unarodni monetarni fond su poja~ali pritisak na lidere evrozone da preduzmu odlu~ne mere, kao {to su formirawe bankarske unije i jedne zajedni~ke institucije za garantovawe banarskih depozita, kako bi se osigurao opstanak evrozone. Takvim merama se, me|utim, protivi Nema~ka, glavni finansijer EU, jer bi to pove}alo optere}enost wenih poreskih obveznika.

PETA STRANA SVETA

LI^NOSTI FRANSOAOLAND Predsednik Francuske Fransoa Oland na ~elo bezbednosnog tima postavio je `enu ~ime je na~iwen presedan. Oland je imenovao Sofi At, kao prvu `enu kojoj je dodeqena ta du`nost. Polovinu Olandovog kabineta ~ine `ene, kao {to je novoprogla{eni {ef francuske dr`ave i obe}ao tokom predizborne kampawe.

ALEKSISCIPRAS Lider Gr~ke levi~arske koalicija Siriza Aleksis Cipras, koja ima velike {anse da pobedi na izborima 17. juna, tra`i od bira~a mandat da poku{a da poni{ti dogovoreni paket pomo}i sa EU i MMF. - Sporazum }e biti ili ispo{tovan ili poni{ten. Mi tra`imo od gr~kih gra|ana da glasaju za nas da bismo ga poni{tili - rekao je on. Cipras (37) je uporedio kreditni sporazum sa „smrtonosnim lekom”.

MARIJANKOTLEBA Najpoznatiji slova~ki neonacista Marijan Kotleba kupio je plac usred jednog ilegalno uspostavqenog romskog nasiqa i sada `eli da protera wegove stanovnike. On je njavio da }e poru{iti naseqe u kome `ivi vi{e stotina Roma, prenosi APA. Prema zakonu, kako tvrdi Kotleba preko svog sajta, kao vlasnik on ima pravo da kad god za`eli „ukloni sme}e sa svog poseda”.

PENTAGONOV„PLANIKS”:OSVAJAWESAJBERKOSMOSA

Amerikasespremazaratra~unarima Pentagon odvaja milijarde dolara da poboq{a svoju spremnost za sajber ratovawe, a novu generaciju „vojnika” za taj rat tra`i na univerzitetima, ali i me|u zalu|enicima za video igrice, pi{e „Va{ington post”. Taj ameri~ki projekat zove se „Plan iks„ i, po pisawu va{ingtonskog dnevnika, bazira se na stvarawu mo}ne odbrane sopstvenih kompjuterskih sistema - vi{e nego na ometawu ili uni{tavawu neprijateqskih. - Ako projekat uspe, to je velika stvar: to bi zna~ilo da bi SAD bile u mogu}nosti da dominiraju digitalnim bojnim poqem - kao {to dominiraju tradicionalnim ka`e stru~wak iz Istra`iva~kog instituta Nacionalne akademije za nauku Herbert Lin. Kad ka`ete „sajber rat”, pomislite na filmske slike uni{tenih servera iz kojih kuqa dim, oborene elektro sisteme, ali u

Pentagonu ka`u da `ele da koriste to nekonvencionalno ratovawe najvi{e kao podr{ku konvencionalnim napadima - na primer, „zaslepquju}i” neprijateqske sisteme tokom bitke. Istra`iva~ki program kojim bi Va{ington trebalo da se osna`i na digitalnom bojnom poqu traja}e pet godina, vredan je 110 miliona dolara, a tokom leta bi}e otvoren za predaju novih projekata.

Jedan od ciqeva je i stvarawe detaqne mape globalnog sajber prostora, u kojem su desetine milijardi kompjutera i drugih ma{ina, koji bi se sam apdejtovao iz minuta u minut. Majkl Hajden, biv{i direktor CIA, ka`e da zami{qa „mapu na kojoj crvene ta~ke ozna~avaju neprijateqske kompjutere, a plave ameri~ke”: „Kad neprijateq unapredi svoj operativni sistem, cr-

vene ta~ke bi se pretvorile u `ute, dok sajber operateri ne razotkriju novi sistem.” Tako|e, u okviru „Plana IKS„ predvi|eno je kreirawe novog, mo}nog operativnog sistema koji je sposoban i da izvodi napade, ali i da pre`ivi kontranapade. To bi, ka`u zvani~nici, bio ekvivalent tenku samo u digitalnom prostoru, dok je sada{wi sistem kao vozilo koje divno „le`i” na autoputu, ali je suvi{e osetqivo za bojno poqe. Kreatori „Plana X” tako|e se nadaju da }e razviti sistem koji }e komandi dati mogu}nost da izvede napade i kontranapade „brzinom svetlosti”, koriste}i unapred planirani scenario, a da u celu pri~u ~ak ni ne ukqu~uju qude koji bi ru~no ukucavali kodove, po{to je taj proces prespor. To je, kako ka`u, kao kad autopilot leti po unapred odre|enoj ruti, navodi „Va{ington post”.


NAPOMOLUPOLITI^KAKRIZAUBOSNIIHERCEGOVINI

SmeweniministriizSDA SARAJEVO: SDP Zlatka Lagumxije raskinula je koaliciju sa SDA Sulejmana Tihi}a na svim nivoima zbog buxeta BiH, izjavio je potpredsednik SDP-a Damir Haxi}. Haxi} je najavio da }e SDP pokrenuti smenu ministara iz SDA gde god to mo`e, te da }e, verovatno, i SDA poku{ati isto sa SDP-ovim ministrima. - Nakon {to je [emsudin Mehmedovi} najavio da i oni mogu nas izbaciti, o~ekujem da SDA to uradi, a {to se SDP-a ti~e, boqe je da ovo uradimo odmah, pre nego {to bude kasno - rekao je Haxi} za federalne medije. Do o~ekivanog raskida koalicije do{lo je nakon {to su predstavnici SDA u Domu naroda Parlamentarne skup{tine BiH glasali protiv usvajawa buxeta BiH za ovu godinu. Nakon {to je Socijaldemokratska partija (SDP) BiH raskinula koaliciju na svim nivoima sa Strankom demokratske akcije (SDA) Sulejmana Tihi}a, ju~e su otpo~eli razgovori o novim koalicijama u Federaciji BiH. Lider SDP-a Zlatko Lagumxija sastao se sa delegacijom Saveza za boqu budu}nost BiH (SBB)

Fahrudina Radon~i}a, koji je uo~i po~etka razgovora novinarima rekao da o~ekuje pozitivan rezultat. Lider HDZ-a BiH Dragan ^ovi} veruje u dogovor Lagumxije i Radow~i}a.

~etka velike politi~ke krize u BiH. Predsednik SNSD-a Milorad Dodik je ranije podsetio da je na posledwem sastanku „{estorke” u Sarajevu re~eno da oni koji budu glasali pro-

ZlatkoLagumyija

Raskidu koalicije SDP i SDA protivi se jedino potpredsednik Srpske demokratske stranke (SDS) Oliver Tadi}. Tadi}, koji je i delegat te stran ke u Par la men tar noj skup{tini BiH Ogwen Tadi} izjavio je da je raskid koalicije SDA i SDP doveo do po-

tiv buxeta BiH „sami sebe iskqu~uju iz vlasti”, {to su, dodao je, ju~e u~inili predstavnici SDA u Domu naroda Parlamentarne skup{tine BiH. - Mi }emo podr`ati predlog koji }e SDP dostaviti u Parlamentarnu skup{tinu i bez oklevawa }emo glasati za te

predloge, a sve u skladu s politikama koje smo ranije najavqivali - kazao je Dodik uveren da SDA ne mo`e ni{ta da blokira u Domu naroda jer taj institut nije nadle`an za Savet ministara. Dodik je naglasio da se pojavila relevantna ve}ina Bo{waka za promene u sastavu Saveta ministara i to u pogledu sastava unutar bo{wa~kog naroda, dodaju}i da to iz Republike Srpske mo`e da se podr`i, preneli su bawalu~ki mediji. Prema wegovim re~ima, treba uva`iti ~iwenicu da je SDP na{ao novu ve}inu kod Bo{waka i da predla`e rekonstrukciju te vrste. Za Dodika su to, kako je rekao, normalne aktivnosti i tu nema nikakvih „politi~kih dilova”. Dom naroda Parlamentarne skup{tine BiH usvojio je buxet BiH za 2012. godinu, a poslanici iz SDA glasali su protiv, zbog ~ega je predsednik SDP-a BiH Zlatko Lagumxija zatra`io od predsedavaju}eg Saveta ministara BiH Vjekoslava Bevande da smeni dvojicu ministara i zamenika ministra iz redova SDA u Savetu ministara BiH.

ANTIVLADINIPROTESTIUPODGORICI

Vladadapodneseostavku PODG OR IC A: U~e sni ci {estog po redu antivladinog protesta u Podgorici ponovo su zatra`ili od Vlade Crne Gore da podnese ostavku. Demonstranti tra`e da premijer Igor Luk{i} podnese ostavku po{to, kako tvrde, Vlada Crne Gore ne radi svoj posao u javnom interesu, a on ne}e da

se bori protiv korupcije i organizovanog kriminala. Na zavr{nom skupu, koji su organizovali Unija slobodnih sindikata, Mre`a za afirmaciju nevladinog sektora i Student ska uni ja, pred zgra dom Vlade zakazan je novi protest, i to za 7. jun. Janko Vu~ini}, predstavnik Unije slobodnih

sindikata - jednog od organizatora protesta, rekao je da je Vlada „kukavica” jer „ne sme da uzima od tajkuna, nego od gra|ana”. On je kazao da je ciq protesta „kona~na pobeda i nova, slobodna, Crna Gora”. Sli~ne poruke sa zavr{nog skupa uputili su i predstavnik Studentske unije Ogwen

Jovovi} i izvr{ni direktor nevladine organizacije Mre`a za afirmaciju nevladinog sektora (MANS) Vawa ]alovi}. Ona je rekla da je „ne}e slomiti” i da }e nastaviti da se bori za „slobodnu Crnu Goru, dok je `iva”. Prema wenim re~ima, crnogorsku vlast ne ru{e protesti

gra|ana, nego „wihova nedela”, a pomenula je privatizaciju Kombinata aluminijuma u Podgorici, @elezare u Nik{i}u i drugih fabrika. Demonstracije u ~etvrtak, kao i predhodnih pet, po~ele su okupqawem ispred zgrade Univerziteta Crne Gore, i povorkom pored „stubova sistema” -

zagrada dr`avnih institucija ispred kojih su izvikivali parole. Prolaze}i pored RTV CG, demonstranti su uzvikivali „La`u od na{ih para!”, a za „Pobjedu” su kazali da je „poraz crnogorskog novinarstva”. Kraj zgra de ANB, de mon stranti su uzvikivali „Bando {pijunska!”, a kada su prola-

CrnaGoraotvara ambasaduuPri{tini PODGORICA: [ef crnogorske diplomatije Milan Ro}en nije precizirao kada }e biti otvorena ambasada Crne Gore u Pri{tini, ali je rekao da se nada da }e to biti {to pre. Ro}en je novinarima u Podgorici kazao da bi u Srbiji uvek bilo primedaba vezano za ovaj potez Podgorice, kad god bi se to desilo. On je ocenio da je Crna Gora vodila ra~una o tome da se zavr{e izbori u Srbiji kako „niko ne bi mogao da ka`e da se takva odluka donosi usred izborne kampawe”.

Crna Gora je, kako je kazao, odlu~ila da otvori ambasadu u jedinoj zemqi u susedstvu u kojoj nema svoje diplomatsko predstavni{tvo i „to nije nikakva novost”. - Kakve veze Srbija i bilo ko u Srbiji ima sa odlukom Crne Gore gde }e i kada }e otvoriti ambasadu? - rekao je Ro}en. U skladu sa diplomatskom praksom, Ro}en nije `eleo da saop{ti ime kandidata za crnogorskog ambasadora u Pri{tini, dok su mediji ranije spekulisali da

bi to mogao da bude biv{i direktor Radio-televizije Crne Gore i dugogodi{wi novinar Radovan Miqani}. Crnogorska vlada odlu~ila je da otvori ambasadu na Kosovu {to }e, kako je saop{teno nakon sednice, omogu}iti „daqe unapre|ewe saradwe na svim poqima”. Crna Gora je u oktobru 2008. godine priznala nezavisnost Kosova, a diplomatski odnosi sa Pri{tinom uspostavqeni su 15. januara 2010. godine.

zili kraj restorana za visoku kli jen te lu „Ma {a” ~u lo se „Mi lo vi (\u ka no vi}) pa co vi”. Demonstranti su nosili transparent „Milo, jel’ ti dosta bilo?”, a bilo je i povika: „Milo lopove, sve si prodao, plati}e{ za zlo~ine!”. U[, MANS i SU organizovali su od po~etka 2012. godine pet velikih socijalnih protesta u Podgorici, na kojima se okupilo vi{e hiqada gra|ana, nezadovoqnih te{kim socio-ekonomskim stawem u Crnoj Gori. Luk {i} je od ba cio zah tev or ga ni za to ra protesta u Podgorici da podnese ostavku, poru~uju}i im da je wegova vlada u potpunosti po sve }e na na stav ku evrop skih in te gra ci ja i ekonomskom oporavku. Premijer je kazao da oni koji tra`e wegovu ostavku ne nude jasnu alternativu {ta posle toga. Luk{i} je poru~io da }e gra|ani Crne Gore na narednim parlamentarnim izborima imati priliku da ocene rad ak tu el ne iz vr {ne vlasti. U Crnoj Gori je od po~etka godine poskupela struja i akcizna roba, dok se benzin prodaje po rekordnim cenama, {to predstavqa novi udar na standard gra|ana. Crnogorski gra|ani strahuju da, nakon poskupqewa goriva i struje, postoji opasnost od pove}awa cena ostalih proizvoda i usluga, kao {to se to ve} desilo sa akciznom robom.

Podr{ka SlovenijezaNATO PODGORICA:Crna Gora i daqe mo`e da ra~una na punu podr{ku Slovenije u procesu evropskih i evro-atlantskih integracija, saop{teno je u Podgorici nakon razgovora crnogorskih zvani~nika sa {efom slovena~ke diplomatije Karlom Erjavecom. Erjavec je itakao da je Crna Gora uspe{na u svojim evropskim i evro-atlanskim integracionim procesima, te da je dobar primer u regionu i zna~ajan faktor wegove stabilnosti. Crnogorski premijer i {ef diplomatije Slovenije ocenili su da izuzetne politi~ke odnose prati i dobra saradwa u ekonomiji.

subota2.jun2012.

c m y

balkan

dnevnik

23

BAKIRIZETBEGOVI]:

BiHsenikada ne}eraspasti SARAJEVO: Predsedavaju}i Predsedni{tva BiH Bakir Izetbegovi} izjavio da se ta dr`ava nikada i ni na koji na~in ne}e raspasti jer }e je „patrioti braniti na svaki na~in”. On je odbacio mi{qewe predsednika Republike Srpske Milorada Dodika koji ka`e da je raspad BiH samo pitawe vremena, oceniv{i da je re~ o „praznim porukama”. Izetbegovi} je izrazio nadu da }e se Bo{waci, Srbi i Hrvati ujediniti u delovawu ka pomirewu i razvoju zemqe, oceniv{i da Dodik govori o podeli Bosne da bi odvukao pa`wu sa sve lo{ijeg ekonomskog stawa u entitetu u kojem je on predsednik. - Mislim da ni on ne veruje u tu pri~u. Bosna je `ivela hiqa-

du godina, nastavi}e bar jo{ toliko - naveo je Izetbegovi} u intervjuu agenciji Anadolija. Predsedavaju}i kolektivnog {efa dr`ave upozorio je da bi, ako Dodik pokrene akcije na progla{ewu nezavisnosti RS, prve morale da reaguju velike sile kao garanti suvereniteta BiH i Dejtonskog sporazuma. Izetbegovi}, me|utim, priznaje da dana{wa BiH nije onakva za kakvu se borio wegov otac, ratni predsednik BiH Alija Izetbegovi}, ali dodaje da misli da on, ipak, ne bi bio nezadovoqan postignutim. Podsetio je na rezultate anketa prema kojima 90 odsto gra|ani `eli boqi `ivot, evropske integracije, vi{e investicija, kao i boqe odnose sa Beogradom i Zagrebom.

Josipovi}verovatno nedolazi ZAGREB: Hrvatski predsednik Ivo Josipovi} verovatno ne}e i}i na inauguraciju Tomislava Nikoli}a izjavila je hrvatska ministarka spoqnih i evropskih poslova Vesna Pusi}, dodaju}i da smatra da se „Josipovi} dobro postavio prema novom srpskom predsedniku”.

- U ovom momentu nema nikakve sumwe da Hrvatska i Srbija zbog regiona moraju sara|ivati - rekla je ona i dodala da se Tomislav Nikoli} na{ao u, za wega potpuno novoj situaciji, s „polit~kim prtqagom” koji mu ote`ava posao na koji je do{ao.

Te{korawen sve{tenik

DOBOJ: Te{ko rawen pravoslavni sve{tenik Sava u Kalenderovcima kod Dervente, kada su mu dvojica maskiranih napada~a pucala u glavu. Kako se navodi iz dobojske policije, maskirani napada~i su u no}i izme|u ~etvrtk i petka oko 22.30 sati upali u ku}u popa Save, vezali wega i wegovu suprugu i maltretirali ih, nameravaju}i da ih opqa~kaju. Napada~i su sve{teniku pucali u glavu i on je sa te{kim povredama preba~en u bawalu~ki Univerzitetsko-klini~ki centar gde mu se lekari bore za `ivot. Sve{tenikova supruga tako|e je povre|ena i ona je preba~ena u dobojsku bolnicu Sveti Apostol Luka. Napada~i su pobegli iz sve{tenikove ku}e nakon {to su kom{ije ~ule buku i krenule da vide {ta se de{ava.

Oskrnaviospomenik VUK OV AR: Dovr{ena je kriminalisti~ka obrada nad 20-godi{wim mladi}em hrvatske nacionalnosti iz Borova koji je oskrnavio spomenik „12 poginulih redarstvenika” u Borovu Selu u no}i sa 6. na 7. marta ove godine, izvestila je PU vukovarsko-srijemska. Mladi} je po spomen obele`ju „12 poginulih redarstvenika” sprejem ispisao ~etiri slova „S„ te re~ „Srbija”, a potom je razbacao vence i lampione u podno`ju spo-

menika. Tako|e, u neposrednoj blizini spomenika, po staklu izloga prodavnice me{ovite robe, istim je sprejem ispisao ~etiri slova „S. Protiv wega je ve} ranije dostavqena kaznena prijava Op{tskom dr`avnom pravobranila{tvu u Vukovaru radi po~iwenog kaznenog dela rasne i druge diskriminacije, a sad je podnesen i poseban izve{taj Op{tinskom dr`avnom pravobranila{tvu za omladinu u Vukovaru.

Yomi}dobiospor spolicijom PODGORICA: Upravni sud Crne Gore poni{tio je re{ewe Ministarstva unutra{wih poslova kojim je parohu podgori~ kom Srp ske pra vo slav ne crkve Veliboru Xomi}u odbijen zahtev za privremeni boravak u Crnoj Gori. Xomi} je rekao da presuda Upravnog suda vra}a veru u pravnu dr`avu i dokazuje da Mitropolija crnogorsko-primorska i sve{tenstvo ne kr{e zakone. Evident-

no je da ih kr{e oni koji bi trebalo da ih primewuju, naveo je Xomi}. Velibor Xomi} je dodao da ne}e da likuje nakon presude Upravnog suda u wegovu korist. - Ne smatram da sam pobedio u borbi sa dr`avom, jer se ni ranije, a ni u ovom postupku, nisam borio protiv Crne Gore u kojoj imam puno kumova i prijateqa i u kojoj `ivim sa svojom porodicom - istakao je Xomi}.


24

LekAR

subota2.jun2012.

dnevnik

STI@ULIKOMARCIUBICE

Desantpapada~a naqude apisi u medijima o komarcima ubicama koji prenose opasnu bolest lajhmaniozu i o tome kako su doline Dunava, Save i Velike Morave najrizi~niji lokaliteti u na{oj zemqi, prema re~ima stru~waka, preuveli~avaju ~iwenice, ali skre}u pa`wu na problem da su se posledwih godina u izmewenim klimatskim uslovima na{im prostorima ozbiqno pribli`ile bolesti

N

koje su bile karakteristi~ne za tropske i suptropske predele. - Bolest lajhmaniozu ne prenose komarci, ve} vrsta izuzetno sitne mu{ice ~iji je latinski naziv Phlebotomus papatasi, a narodski „papada~i” ili pe{~ane muve obja{wava dr Bosiqka Krtini} iz novosadske „Ciklonizacije”. - Izaziva~ bolesti je parazit ~iji rezervoar su glodari i neke druge `ivotiwe, a mu{ica ga prenosi tako {to nakon uboda zara`ene `ivotiwe ubode ~oveka. U na{oj zemqi, koliko mi je poznato, ovakvi slu~ajevi nisu zabele`eni, a posledwih godina mawi broj zara`enih je zabele`en prvenstveno u Dalmaciji u Hrvatskoj, kao i u Crnoj Gori i Albaniji. Te mu{ice ujedaju uglavnom u sumrak i no}u, ubod je bolan i izaziva rane na ko`i.

Bolest ima dva oblika – ko`ni i manifestni, koji je opasniji i mo`e zavr{iti smr}u ako se inficiraju jetra i slezina i ukoliko se ne le~i. Godi{we od te`eg oblika lajhmanioze oboli dva miliona qudi, a umre 60.000. Posledwih godina stru~waci upozoravaju i na mogu}nost pojave groznice Zapadnog Nila, jo{ jedne od bolesti koju sa `ivotiwa na qude prenose komar-

ci. Re~ je o flavi virusu ~iji rezervoar su ptice. - Jedan od osnovnih prenosioca te bolesti je na{ ku}ni komarac. Postoje dve ekotipske forme ovih komaraca koje i mi ovde imamo. Prvi koje zovemo urbani, a drugi su takozvani ruralni, ali ih ne treba me{ati sa re~nim komarcima. Uglavnom se ruralni hrane na pticama, a ku}ni - urbani na qudima. Do preno{ewa virusa Zapadnog Nila mo`e da do|e samo ako oni koji se ina~e hrane na pticama uzmu krvni obrok i sa ~oveka, obja{wava dr Krtini}. Prema wenim re~ima to se de{ava retko. Me|utim, ako je godina pogodna za komarce i ako postoji izuzetno velika brojnost komaraca, pove}ava se mogu}nost pojave epidemije kao {to je bio slu~aj u severnoj

Gr~koj 2010. godine. U Novom Sadu do sada nije zabele`eno prisustvo ovog virusa. Ipak, ~iwenica je da je slu~ajeva Zapadnog Nila bilo u okolnim zemqama i ne mo`e se tvrditi da ne}e biti kod nas. I Ministarstvo za{tite `ivotne sredine je jo{ 2010. godine predstavilo Nacrt prve nacionalne komunikacije, strate{ki dukument koji upozorava da „iskustva na regionalnom i me|unarodnom nivou i postoje}e informacije ukazuju na mogu}nost {irewa vektora (npr. komaraca) i egzoti~nih transmisivnih bolesti iz tropskih krajeva u zemqu”. Kako bi se spre~ilo {irewe ovih bolesti kod nas, kqu~ne su preventivne i sistematske akcije na suzbijawu komaraca. - Zahvaquju}i razumevawu pre svega gradske uprave u Novom Sadu, ali i op{tinskih uprava u Vojvodini, „Ciklonizacija” je, uzimaju}i u obzir sve pretwe po zdravqe gra|ana u ovim promewenim klimatskim okolnostima, razvila i u upotrebu uvela najmodernije sistema za{tite zdravqa gra|ana od komaraca- obja{wava dr Krtini}. -Uvo|ewem savremenog Geografskog informacionog sistema i sofisticirane opreme za helikoptere, kao i bespilotne letelice, otvorena je mogu}nost da se mapiraju sva potencijalna izvori{ta komaraca bilo da je re~ o kanalima, izlivima reka, barama ili drugim ve}im ili mawim vodenim povr{inama. Sve ovo omogu}ilo nam je da zdravqe gra|ana {titi preventivno larvicidnim tretmanima i sistematskim akcijama i da tako brojnost komaraca dr`i pod kontrolom, a mogu}nost preno{ewa zaraza svede na najmawu mogu}u meru. Q.Nato{evi}

Jogurtkaoafrodizijak? rupa nau~nika iz Tehnolo{kog instituta u Masa~usetsu do{la je slu~ajno do otkri}a da jogurt mo`e da deluje kao afrodizijak. Istra`iva~i su u po~etku ispitivali uticaj jogurta s ukusom vanile na organizme (mi{eve) stavqene u potpuno nepravilan (nezdrav) na~in ishrane - burgeri, ~ipsevi, gazirana pi}a, ali su tokom ispitivawa utvrdili da jogurt ima jako afrodizijsko dejstvo. Radi se o tome da su testisi mi{eva konzumenata jogurta bili za oko pet odsto te`i nego kod onih hrawenih na klasi~an na~in, a za 15 odsto ve}i nego kod hrawenih nezdravom hranom. Ta transformisana morfologija je bila pra}ena i sjajnijom dlakom i 10 puta gu{}om. Mi{evi pod „jogurt” re`imom ishrane su i boqe stvarali potomstvo.Pretpostavqa se da je to rezultat probioti~kih bakterija u jogurtu koje su poboq{ale zdravqe mi{eva, pa samim tim i wihov libido. (Tanjug)

G

Umornisteodalergije? Srbiji alergije poga|aju 30 odsto stanovni{tva a od tog broja polovina su deca. Alergijski rhinitis nastaje kao posledi ca aler gi je na od re |e ne

U

svetlost i tama kako bi se obezbedilo optimalno vreme za spavawe i budno stawe. Renebergov tim formira bazu podataka o pona{awu qudi pri spavawu i budnom stawu i planira da je upotrebi za pravqewe svetske mape spavawa.Oni su posle 10 godina rada, prikupili brojne informacije, ukqu~uju}i visinu, te`inu i obrasce spavawa u~esnika. Wihova analiza pokazuje da su qudi sa ve}im dru{tvenim umorom tako|e skloniji da imaju prekomernu telesnu te`inu, a otkri}a bi trebalo da se uzmu u obzir pri dono{ewu odluka o u{tedi vremena tokom dana, kao i vremenu posve}enom

radu i {koli, ka`u istra`iva~i.Tako|e bi pomoglo ako bi qudi po~eli da provode vi{e vremena napoqu tokom dana ili barem sedeli pored prozora, dodaju istra`iva~i.Po{to qudi to ne rade, wihov unutra{wi sat se pomera na sve kasnije vreme, usled ~ega ostaju budni no}u i budu umorni pre-

ga ni zma tj. do pre te ra nog imu no lo {kog od go vo ra i osloba|anja medijatora zapaqewa(histamin)koji uzrokuju pojavu simptoma: zapu{enos, curewe, svrab nosa, kijaw , suzewe, svrab o~iju. Leka ima. Nasaleze nazalni sprej je klini~ki dokazana, brza i efiksna za{tita od alergije. On sadr`i prirodnu inertnu pra{kastu celulozu . Aplikovana celuloza u obliku finog praha dolazi u kontakt sa sluzoko`om nosa i `drela, obla`e nazalne puteve formiraju}i providni za{titni sloj, film – nepropusnu barijeru za alergene. Na taj na~in spre~ava se nastanak alergijske reakcije. U koliko su simptomi ve} prisutni NASALEZE Allergy brzo i efikasno smawuje intezitet kijawa, zapu{enost, curewe i svrab nosa, suzewe o~iju...Nasaleze allergy je bezbedan za upotrebu kod dece uzrasta od 18 meseci, trudnica, dojiqa, sportista i odraslih osoba.

Podlogazagajewe mati~nih}elija im nau~nika sa Fakulteta in`ewerskih nauka u Kragujevcu razvio je specifi~nu podlogu za gajewe mati~nih }elija {to mo`e imati veliki zna~aj za medicinu i razvoj bioin`eweringa. -Trenutno radimo na projektu izrade trodimenzionalne podloge gde bi mogle da se zaseju mati~ne }elije, koje bi potom porasle u prirodno tkivo- izjavio je prof. NenadGrujovi}. Znawe i stru~nost profesora Fakulteta in`ewerskih nauka svakako }e koristiti budu}em Centru za mati~ne }elije koji bi u Kragujevcu trebalo da bude izgra|en do idu}e godine.Za izgradwu tog Centra, kao i Banke za mati~ne }elije, koju }e voditi poznati geneti~ar i profesor Medicinskog fakulteta u Kragujevcu MiodragStojkovi}, gradska uprava odredila je lokaciju na potezu izme|u Rektorata i Klini~kog centra. Prvi centar za mati~ne }elije na Balkanu, sastoja}e se od dela za

T

Dru{tveniumorizazivagojaznost D

ru{tveni umor - sindrom koji se vezuje za nesklad izme|u unutra{weg sata organizma i realnosti svakodnevnog `ivota predstavqa faktor koji doprinosi {irewu epidemije gojaznosti, zakqu~ak je jedne od novih studija. -Identifikovali smo jedan sindrom modernog dru{tva koji ranije nije bio prime}enizjavio je Til Reneberg sa Minhenskog univerziteta. -On se odnosi na sve ve}u neravnote`u izme|u dnevnog fiziolo{kog sata i dru{tvenog rasporeda. Prema Renebergovim re~ima, kao rezultat dru{tvenog umora qudi su hroni~no neispavani, a tako|e su skloni gojaznosti, pu{ewu i konzumirajwu vi{e alkohola i kofeina.Svako od nas ima svoj biolo{ki sat, ka`e Reneberg i dodaje da taj sat reguli{u dnevna

supstance-alergene iz vazduha.Tom prilikom se stvaraju specifi~na antitela u organizmu.Tokom ponovnog kontakta antitela sa alergenom dolazi do burne reakcije or-

ko dana. To zna~i da nismo spavali dovoqno i to je razlog za{to smo hroni~no umorni. Stru~waci upozoravaju da dobar san i dovoqno sna nisu gubqewe vremena, ve} garancija boqeg radnog u~inka i vi{e zabave sa prijateqima i porodicom u slobodno vreme. (Tanjug)

nau~no istra`ivawe od 10.250 kvadrata i dela od 7.250 kvadratnih metara koji je namewen za nastavu i administraciju. Objekat treba da bude zavr{en do kraja 2013. godine.

VESTI Prepovezivawem neravado funkcijeruku

Laganom rekreacijomprotiv hipertenzije

Grupa ameri~kih lekara je prvi put omogu}ila da mu{karac paralizovan nakon povrede ki~me ponovo koristi ruke, zahvaquju}i tehnici prepovezivawa nerava. Taj 71-godi{wi mu{karac paralizovan je u saobra}ajnoj nesre}i. Povreda se nalazila na najni`em vratnom pr{qenu. Hirurzi sa medicinskog faktulteta ameri~kog univerziteta „Sent-Luis” uspeli su da spoje nerv koji ina~e kontroli{e odre|ene pokrete ka`iprstom i palcem (nefunkcionalan kod le~enog pacijenta) sa drugim jo{ aktivnim nervom u podlaktici. Taj nerv omogu}ava pokret ramenom. Nakon osam meseci rehabilitacije, pacijent mo`e sam da se hrani i ~ak pi{e uz malu pomo}, objavili su lekari. (Tanjug)

Opasnost od hipertenzije (povi{enog krvnog pritiska) mogu}e je smawiti nekom od laganijih i redovnih sportskih aktivnosti, pokazali su rezultati ameri~kog istra`ivawa objavqenog u ~asopisu „Hipertenzija”. Nau~nici su do{li do tih rezultata obaviv{i istra`ivawe na oko 6.000 zdravih odraslih osoba, me|u kojima je tre}ina imala nekog u familiji obolelog od hipertenzije. Istra`ivawe je pokazalo da je opasnost od nastanka hipertenzije kod wih bila mawa za 34 odsto kada su se redovno bavili nekom od fizi~kih aktivnosti, tipa fitnes ve`bi. Nau~nici su, osim toga, zakqu~ili da nije neophodno baviti se intenzivno gimnastikom. Oni smatraju da je dovoqno 70 minuta brzog hoda dnevno da bi se dobili zadovoqavaju}i rezultati.


dnevnik

OGLASi l ^iTUQe

subota2.jun2012.

POVOQNO izdajem apartmane u Bolu na Bra~u, apartmani sa klimom, kuhiwom i terasom, pla`a, „Zlatni Rat� - Telefoni: 00385-21635960, 063/8910068. 53953 IZDAJEM sobe i apartmane u ^awu. Telefoni: 018/213-708, 064/849-61-09, +382/67-859-097, 00382/67859-097, www.danojlovicapartmani.piczo.com

FUTOG, centar, Fru{kogorska 69, jednospratna ku}a, 200m2, pogodna za dve porodice, ba{ta 500m2, hitno, 60.000e. Telefon 021/6313987. 54087 PRODAJEM novu mawu ku}u, komplet zavr{enu, name{tenu, niko nije stanovao, Novi Sad, Ul. S. Pa{}ana br. 2. Mogu}a zamena. Telefoni: 063/386-136, 064/2510-929. 53887

54125 LOKAL 43 m2 ful opremqen. Bul. Kraqa Petra 2. Telefon 065/55-106-55. 54053

IZDAJEM lepo nema{ten dvosoban stan u ulici Novosadskog Sajma 9. telefon 060/0442-711. 54045 IZDAJEM novu, name{tenu garsoweru, 28m2 u Temerinskoj ulici, 135 evra. Telefon 063/8318-299. 53458 IZDAJEM jednoiposoban i dvosoban name{ten stan u Novom Sadu. Telefon 069/25960-31. 53975 IZDAJEM nov name{ten jednoiposoban stan od 39m2 kod Socijalnog na tre}em spratu u zgradi sa liftom. Telefon 065/8333963. 54042 IZDAJEM dvosoban, potpuno opremqen, komforan stan, klima, telefon, internet, kablovska, zatvoren parking, Nova Detelinara. Telefoni: 063/559-580, 063/500-467. 54092 IZDAJE se name{ten stan na Novom Nasequ. Telefoni: 021/6215156, 063/1945588. 54096

GOLF 1.4, 96 god KW 44, zapremine 1390 BMB, 3 vrata, cena 2.200e. Telefon 459-137. 54159

VODOINSTALATER pru`a sve usluge u delatnosti: odgu{ewa odmah, vr{imo emajlirawe kada, lajsne oko kade. I van grada. Telefoni: 063/7509499, 065/5610864, 021/6394167. 54156 IZRADA roletni, venecijanera, harmonika vrata, fiksnih i rolo komarnika. Telefoni: 065/581-6333, 6434199. 54190

KUPUJEM zlatnike, dukate, napoleone, lomqeno zlato, stari srebrni i zlatni novac, medaqe, ordene, sabqe, bode`e, satove, srebrninu. Telefoni: 063/8-318-180, 021/451-409. 44679

PRODAJEM koke nosiqe stare 10 meseci, te{ke do 2kg. Komad 150 dinara. Ve}e koli~ine dostavqamo. Telefoni: 063/511932, 021/848-188. 54005

POTREBNA `ena za ispomo} staroj osobi, tri sata dnevno, u Novom Sadu, ulica A. [anti}a. Telefon 064/211-410-5. 53921

VI[E JUTARA - hektara, vo}wake, vikendice, placeve, ku}e, stanove, lokaciju za zgradu, stan za 20.000e gotovinom kupujemo. Telefoni: 063/598-463, 6618-184, 6215-260. 53971 ^ISTIM podrume, odnosim {ut, staro gvo`|e, ve{ ma{ine, {porete, automobile stare za otpad. Telefoni: 064/953-3943, 021/6618-846, 063/84-85-495. 53736

3 Obave{tavamo rodbinu i prijateqe da je 31. maja preminuo na{ najdra`i suprug, otac i deka

Slobodan Mijoli} 1941 - 2012. Sahrana je danas, 2. 6. 2012. godine u 12.45 ~asova, na Gradskom grobqu, u Novom Sadu. O`alo{}eni: supruga Milanka, deca Sa{a i Sawa, unuci Danijel, Boris, Dule i unuka Kristina.

KUPUJEM dvoiposoban stan od 60 do 65m2, bez posrednika na Limanu. Telefoni: 064/2354583, 064/382-9649. 54205

Neizmerno smo zahvalni za svu tvoju qubav i dobrotu, a tvoj vedri duh ve~no }e `iveti u na{im srcima.

CENTAR Novog Sada, ukwi`en jednosoban, prvi sprat, useqiv, svugde prirodna ventilacija, 41m2, 37.500e gotovinom. Kredite ne!! Telefoni: 061/6019393, 021/6621-797, 021/6215260. 53973

PRODAJEM dvosoban stan, Grbavica, 53m2, prvi sprat, ukwi`en ul. Qermontova 8. cena 42.000e. Telefoni: 063/1214493, 021/453968, 0039452820015. aleksandar.ludajic&gmail.com 53968 PRODAJEM bez posrednika ukwi`en dvosoban stan 60m2 na Limanu IV, mogu}nost zamene za mawi i drugih kombinacija uz dogovor. Telefon: 021/421-407 i 064/277-4931. 54230

25

54308

Miodrag Kapamaxin Kapa Od ekipe sa fudbala. Mela, Zena, Darko, Prika, Zoraja, Bojan, Vu~ko, Vule, Prale, Dragan, Milan~e, Pera, Si}a, Steva, Domagoj, Vlada, Robert, Herman i ostali. 54314

PRODAJEM troiposoban stan na Limanu IV, dobra lokacija. Telefon 021/6369-008. 54126

PRODAJEM placeve u Starim Ledincima, ukwi`ene, dozvoqena gradwa, centar, struja, voda, telefon, gas, kablovska, asfaltni put, autobus. Telefoni: 063/507-097, 021/2977565. 54031 PARAGOVO, plac 2.000m2 na glavnom putu. 1m2 / 40e. Telefon 063/86-26-504. 54200 PRODAJEM 27 ari gra|evinskog placa na Tranxamentu, Novi Sad. Mogu}nost delimi~ne kompenzacije. Telefon 064/22-87-731. 53920

Omiqenom {kolskom drugu.

Miodrag Kapamaxin Kapa Odeqewe IV3 Svetine gimnazije i razredni stare{ina Miladin Mi{~evi}, Generacija 1976. 54315


26

^iTUQe l POMeni

subota2.jun2012.

3 Tu`nim srcem javqamo da je u 79. godini preminuo na{ dragi suprug, otac i deda

dnevnik

Obave{tavamo rodbinu i prijateqe da je 31. 5. 2012. godine, preminuo u 72. godini na{ dragi suprug, otac i deda

Radoslav Vujkov

@ivko Ostoji}

3 Pro{le su tri tu`ne godine od kako nije sa nama na{a draga mama, ta{ta, svekrva i baba

Katica Grli} ro|. Bani} iz Koviqa

Sahrana je danas, 2. 6. 2012. godine, u 13 ~asova, na Dowem grobqu, u Sremskim Karlovcima. O`alo{}eni: supruga Bo`ana, sin Sa{a i k}erka Biqana sa porodicama.

Sahrana }e se odr`ati na grobqu u ^urugu, iz kapele, danas, 2. 6. 2012. godine, u 14 ~asova. Milorad Vujkov.

Dok `ivimo, `ive}e{ ve~no u srcima tvoje dece: Dane, \or|a i Stevice sa porodicama.

54310

54284

54283

Danas, 2. juna navr{ava se 5 godina od kako nije sa nama na{ dragi

Posledwi pozdrav dragom

Godina pro{la, a uspomene i daqe u nama.

@ivku Ostoji}u

Mile ]ulum Postoji ne{to {to ne umire, to su uspomene i se}awa na tebe. Jako nam nedostaje{, svakog dana sve vi{e.

od: porodica Paulin i Risti}.

Covje, Zeka, Milo{, Ciner, @ika, Boka, Igor, [one, Koka, Kiza, ^oma, Lacika, Gr~a i Mirko. 54291

54312

[ESTOMESE^NI POMEN

SE]AWE Malo je prijateqa koje trebamo svi, a jo{ mawe prijateqa kao {to si ti bio.

1957 - 2012.

Vera Petrovi} Sahrana je u ponedeqak, 4. 6. 2012. godine, u 11.15 ~asova, na Gradskom grobqu u Novom Sadu.

Ve~no }e{ biti u srcima tvoji najmilijih: supruge Branke i dece Tamare i Pe|e.

Veliov Miroslav Ne postoje re~i koje mogu opisati koliko nam nedostaje{. Sa ponosom te pomiwemo i ~uvamo se}awe na tvoj vedri duh i veliko srce za sve koje si voleo. Tvoji: otac Jovan, majka Ana, brat Goran, supruga Zlata i }erke Jovana i Milica.

54281

ro|. \or|evi} 1954 - 2002.

Sava \or|evi}

54256

Kom{ije Boki i Spasa sa decom.

Danas, 2. 6. 2012. godine, u 10 ~asova, na Gradskom grobqu u Novom Sadu odr`a}emo pomen na{im dragim.

Miodrag Kapamaxin

54316

Mi}i

POMEN

Novica Pejovi}

Tvoji supruga i deca.

Posledwi pozdrav

Dragi na{ Mi}o, oti{ao si nam prerano, ne ostvariv{i sve svoje snove, ali mi smo tu da to u~inimo za tebe.

SE]AWE

Novica Pejovi}

1926 - 2003.

Pro{lo je deset godina od kada ste nas zauvek napustili. Mnogo nam nedostajete ali mi sa ponosom i tugom u srcu ~uvamo uspomenu na vas.

O`alo{}eni: majka i supruga Katica i sestra i }erka Mirjana Ki}anovi} sa porodicom.

Aleksandra, Zdravko, Mom~ilo i Ondrej. 54292

54286

54290

Posledwi pozdrav na{em

Sa bolom i tugom obave{tavamo rodbinu, prijateqe i kom{ije da je preminuo na{ dragi

Miodrag Kapamaxin Posledwi pozdrav dragom te~i i zetu Mi}i od: dejke Milo{a, Milice, Marije, Milene i Svaje.

Obave{tavamo rodbinu i prijateqe da je posle duge i te{ke bolesti preminula na{a mama, baka i prabaka

54259

Radoslav Vujkov

Radoslavu - Radi Vujkovu

[ESTOMESE^NI POMEN

Nikola Para|ina 1931 - 2012.

1939 - 2012.

Sahrana je danas, 2. juna 2012. godine, u 13 ~asova, na Starogradskom grobqu, u Rumi.

Posledwi pozdrav Radi od: Mime, Ratka, Tawe i Kate.

od Vuke i Bate Nonin.

54295

54305

Sahrana je 2. 6. 2012. godine, u Beo~in Selu, u 15 ~asova. O`alo{}eni: sin Braca, k}i Vesna, unuci Robert i Igor, snaje i praunuci.

O`alo{}eni: sin Petar i k}erka Gordana sa porodicama. 54288

Posledwi pozdrav na{em te~i

Posledwi pozdrav dragom zetu

Bojka Ko~i{ - Tubi}

54299

SE]AWE

Marijana Dubravac

Posledwi pozdrav dragom prijatequ

na{em

ro|. Nikoli}

Radoslavu - Radi Vujkovu od: Vawe, Jelene i Vite.

54304

Radoslavu - Radi Vujkovu

od tetke Miladinke Vorgi}.

Draga na{a Makice, ve~no }e{ `iveti u na{im srcima i mislima.

Jelena @ivan Stra`me{terov 1924 - 1999.

Mi}i

1921 - 2000.

Mi znamo koliko ste nas voleli, ali Vi ne znate koliko nam nedostajete i koliko Vas volimo.

Tata Du{an i Cuka.

od porodica: Pirner i Despotov.

]erka Zorica Vasi} sa porodicom i Ba}a. 54303

54289

54282

54302


^iTUQe l POMeni

dnevnik

GODI[WI POMEN Obave{tavamo rodbinu i prijateqe da }emo danas, 2. 6. 2012. godine, u 9.30 ~asova, odr`ati godi{wi pomen na grobqu u Stepanovi}evu.

DVOGODI[WI POMEN

Gojko Kolarov

Zdravko Oborina

iz Futoga Uvek }e{ biti u na{im srcima, voqen i nezaboravqen. Tvoja Stojanka sa }erkama. 54257

Posledwi bratu.

pozdrav

dragom

Iskreno sau~e{}e od kuma Jovice ]ur~i}a sa porodicom.

54276

54233

Uvek }emo te se se}ati. Tvoji: snaja Milka, sinovac Vjekoslav i sinovica Vesna sa porodicama. 54252

3 JEDNOGODI[WI POMEN

Du{anu T. \ur|evi}u 1. 7. 1935 - 28. 6. 2011.

Radmanovi} @ivana, razrednog stare{ine Wihov IV/ 6 razred, generacije 1961/ 62. Gimnazije „Jovan Jovanovi} Zmaj”.

obele`avamo danas, 2. 6. 2012. godine, u 11 ~asova, na grobqu u Mo{orinu. Ne meri se tuga suzama, ni vremenom koje prolazi, ve} prazninom koja ostaje iznenadnim odlaskom. Zauvek u se}awu: supruge @ivke i porodica \ur|evi} i Nikoli}.

54274

JEDNOGODI[WI POMEN

Posledwi pozdrav dragoj i po{tovanoj kom{inici

Novica Pejovi} 8. 6. 2011 - 8. 6. 2012.

Hvala ti Draga, za dugogodi{we dru`ewe. Po~ivaj u miru, zaslu`ila si.

Sretko Stankovi}

54239

54306

54287

1931 - 2012.

Jovanka Jovanovi} Vreme prolazi, ali ti zauvek ostaje{ u srcima onih koji te vole. Tvoja k}erka Mira, zet Mi{ko i unuk Stefan.

i

Sestra Milica, zet Zoran, sestri}i Aleksandar i Vladimir [katari}.

Dragiwi - Dragi Stojanovi}

POMEN Pro{lo je 6 meseci od kada nije sa nama na{ ~i~a i dever

Vreme prolazi, a bol i tuga ostaju. Po~ivaj u miru. Hvala za sve {to si ~inio za nas. Tvoji najmiliji, koji te nikad ne}e zaboraviti: supruga Olga, sin Neboj{a, }erke Svetlana i Milana sa porodicama.

Piri \ure Vu~eti} Gordane Nikolajevi} udate Risti} Tatjane Popovi} Arkadija Peri} udate Zveki} Gordane Roslavqev Aleksandra Ma{i} udate Kelemen \ur|ice

Rada Vujkov

Nose te u srcu i ~uvaju od zaborava Tvoji „Grobari” iz „Ta{te”: Moma, Mile, Darko, Mirko, Lacika, Ra{o, Milo{, Mili, Ba{kalo, Ke{eq, \uro, Milovac, Paki, Ranxa, Slavko Vu~enovi} i Slavko Dejanovi}.

SE]AWE Mi `ivi maturanti III/A odeqewa Sredwe medicinske {kole - odseka medicinskih laboranata i sanitarnih tehni~ara u Novom Sadu, posle 54 godine sa du`nim pijetetom se}amo se na{ih dragih maturanata i profesora, koji vi{e nisu `ivi i to:

Viktora Tome, Slavoquba Kne`evi}a, Vujadina @ivaqevi}a, Radojka Komatine, \or|a Krsti}a, Danice Luki}, Vere Tucakov, Radivoja Simi}a,

[ESTOMESE^NI POMEN Danas, 2. 6. 2012. godine odr`a}e se parastos u Mo{orinu, na{em dragom i nikad pre`aqenom

POMEN Danas, 2. juna, u 10.30 sati, na Veterni~kom grobqu dajemo 40 dana na{em

Petru Spasojevi}u 1936 - 2012. Oti{ao si iz na{ih `ivota, ali }e{ u na{im srcima i mislima `iveti ve~no sa po{tovawem i qubavqu. Po~ivaj u miru i spokoju.

Milanu Vrani}u

Tvoji: supruga An|elija, sin Goran i }erka Slavica sa porodicama.

protojereju 1960 - 2011.

54245

kao i razrednih stare{ina

Stanislave Preradovi} i Branke Stani}.

27

Navr{ava se {est meseci od kako nije sa nama na{a majka, ta{ta i baka

Povodom 50 godina od mature sa qubavqu i setom se}amo se dragih drugarica i drugara

Radoslav Vujkov Vuca

Voqeni brate, sa tugom u srcu opra{tamo se od tebe. Neka tvoja plemenita du{a po~iva u miru. Osta}e{ u na{im srcima ve~no voqen i nikad zaboravqen.

subota2.jun2012.

Nikada te ne}e zaboraviti tvoji: mama Mara, supruga Ankica, sestra Sofija i brat Vesa sa porodicama.

PETOGODI[WI POMEN na{em dragom

Generacija {kolske 1957/58. g.

Kom{inica Kosa. 54241

54240

Dana, 1. juna 2012. godine navr{ila se godina od smrti mog supruga

54249

54234

Povodom ~etrdeset pet godina mature sa po{tovawem se se}amo preminulih drugova:

Stevanu Jelovcu Uvek te se rado se}amo.

Du{ana Bani}a @arka Pani}a Agneze Herbai Milana Hrgi}a Nikole Dimi}a Reqe Dimitrijevi}a Jelice Pavlovi}

Milana Keki}a 1932 - 2011.

O`alo{}ena porodica Jelovac. 54258

Vreme prolazi, ali u du{i i srcu ostaje duboka tuga i `alost bez tebe.

Supruga Jelena.

54246

JEDNOGODI[WI POMEN

POMEN

Maturanti IVb i IVc razreda Gimnazije „Mo{a Pijade” Generacija 1966/ 67. sa razrednim stare{inama.

54237

Jovanu Smijuqu Xinu

Jovan Smijuq Godina pro|e, ali bratska qubav nikad ne}e pro}i.

S bolom i tugom u srcu nosimo trajnu uspomenu na tebe.

Tvoj brat Svetozar - Zore sa porodicom.

Danas, 2. 6. 2012. godine, dava}emo pomen na Veterni~kom grobqu, u 10 ~asova. Tvoji: supruga Milena, sinovi Nikola i Zoran.

54250

54251


28

^iTUQe l POMeni

subota2.jun2012.

POMEN Navr{ava se godinu dana od smrti na{e mile

[ESTOMESE^NI POMEN dragoj sestri, {ogorici, tetki i baki

Mili moj

dnevnik

[ESTOMESE^NI POMEN

POMEN

Na sastanku, povodom 50 godina od mature u Sredwoj ekonomskoj {koli u Novom Sadu, sa tugom smo se setili svojih preminulih drugova i drugarica.

Jano{ Rau{ Anice @e`eq

Dejane

Marijana Dubravac

Voqena sestro, dani prolaze, ali ni jedan bez misli i se}awa na tebe, bola u srcu i neizmerne tuge u du{i za tobom. Po~ivaj u miru i raju gde plemeniti u`ivaju. Tvoja sestra Bojana sa porodicom.

Svako ve~e molim se za tebe. Svako jutro budim se za tebe. Svaki moj san si ti, nedostaje{ nam.

Igwat - Giga @ivanov

Uvek }e{ biti u na{im srcima.

4. 6. 2003 - 4. 6. 2012.

Slobodan Nakarada

Uspomene i se}awe na tebe ~uvamo u svojim srcima.

Hana i Zoja.

Tvoji najmiliji: suprug Dejan, sin Du{an, }erka Teodora, baba Nena i deda Du{an.

Olgica Pani} - Vujovi}

54254

54261

54255

54212

ro|. Ogwenovi}

ro|. Nebrigi} Ve~no u na{im srcima. ]erke Olgica i Mirjana, zetovi Sa{a i Dragan, unuci Dejan i Sowa, praunuci Aleksandar i Awa.

Mirjana Prugi} - Brzak

Jovanki Jovanovi}

54277

Tvoja porodica.

Stanica Baucal

TU@NO SE]AWE

POMEN Pro{la je godina dana, a Tebe nema. Bio si dobar ~ovek, suprug, otac i deda.

Tu`na srca obave{tavamo rodbinu i prijateqe da je na{a voqena sestra, tetka i baka

1. 6. 1995 - 1. 6. 2012. Odeqewe IV/4, Generacija 1958/1962.

54184

SE]AWE

Milan Ivani}

Milorad Jevremovi}

3. jun 2011 - 3. jun 2012. Pomen }e se odr`ati 2. juna 2012. godine, u 10.30 ~asova, na Gradskom grobqu - Kolumbarijum. Ve~no }e{ `iveti sa nama. Supruga Edita, }erka Sa{a, unuka Vawa i zetovi Miroslav i Uro{. 54280

JEDNOGODI[WI POMEN

Na{oj dragoj

na{em dragom

Olivera Ga{i}

2007 - 2012.

Vreme prolazi, ali ostaje qubav kojom su bili ispuweni dani na{e porodi~ne sre}e!

dipl. ekonomista u penziji iznenada ispustila svoju plemenitu du{u i ostavila nas u bolu i tuzi da ve~no `alimo za wom. Ispra}aj pokojnice je na Gradskom grobqu, u Novom Sadu, danas, 2. 6. 2012. godine, u 14.15 ~asova.

Vole te tvoji: Milosava, Dragan, Marina i Gordana. 54211

Pro{la je godina od kako nema na{eg brata

Weni: brat Todor, bratanice: Dragana, Marijana i Mirjana, zetovi i unuci.

Miroslav Jankovi} Mikica

Ku}a `alosti Novi Sad, Bulevar oslobo|ewa 98. Prohujalo je pet godina bez tebe. Tugujemo i ~uvamo uspomenu.

54278

Posledwi prijatequ.

Sofiji

pozdrav

dragom

JEDNOGODI[WI POMEN

Du{ka

Zoranu Miqanovi}u O`alo{}ene porodice: Miqanovi} i Kalajxi}.

posledwi pozdrav od prijateqica: Verice, Nade i Vukice.

Ve~no tu`ni: brat Nikola, sestre Sofija, Dara, Bosa, Rada i Jovanka.

54260

54269

54185

Posledwi pozdrav bratu i ujaku.

dragom

Posledwi prijatequ.

pozdrav

dragom

GODI[WI POMEN

Dragan Mil~i}

Dr @ivan Krnajac 5. 6. 2011 - 5. 6. 2012.

Tata Jova - Jovica i sestra Olgica sa porodicom.

54209

POMEN Danas, 2. 6. 2012. godine, u 9.30 ~asova, na ^enejskom grobqu, dava}emo {estonedeqni pomen supruzi

Porodica Anti}.

54273

ro|. 21. 10. 1949.

ro|. 21. 10. 1949. Sestra Desa Milovanovi} sa porodicom.

1977 - 2011. Supruga Nada i k}i Zlatica sa porodicom.

Porodica Vu~kovi} iz Leskovca.

54272

Svetlana Zori}

Obave{tavamo rodbinu i prijateqe da je 31. 5. 2012. godine preminuo na{ dragi suprug, otac, deda i pradeda

Dragan Mil~i}

Dragan Mil~i}

U mislima i se}awima ~uvamo te od zaborava.

Draga moja Ceco, po~ivaj u miru i spokoju, u zagrqaju an|ela. O`alo{}ena koleginica Nada sa porodicom iz pekare.

54275

S tugom obave{tavamo, rodbinu, prijateqe i poznanike da je preminuo na{ dragi otac, deda i svekar

Mirko Paji}

Radojki [etka ro|. Lepir Tvoj vedar lik i veseo osmeh zauvek }e ostati u se}awu. Suprug Tomislav [etka.

54063

54158

Danas, 2. juna 2012. godine odr`a}emo godi{wi pomen na Gradskom grobqu majci, baki i svekrvi

^ETRDESETODNEVNI POMEN

POMEN

Miodrag - Dragan V. Jovanovi}

Radojka [etka

54207

1927 - 2012.

Sahrana }e se obaviti u ponedeqak, 4. juna 2012. godine, u 14.15 sati, na Gradskom grobqu u Novom Sadu.

Dragan Mil~i}

Zagorki Krsti}

21. 10. 1949 - 31. 5. 2012. Sahrana je danas, 2. 6. 2012. godine, u 13.30 ~asova, na Gradskom grobqu, u Novom Sadu. O`alo{}eni: sin Zvezdan, snaja Lidija i unuci Gordan i Zvezdana. 54270

O`alo{}eni: supruga Zorka, k}erke Mirjana i Lepa, unuci Rajka i Nik{a sa porodicama i unuk Zoran.

54279

Bri`nu majku i baku nikada ne}emo zaboraviti.

ro|. Lepir

1929 - 2012. Polagawe urne i ~etrdesetodnevni pomen odr`a}e se 2. 6. 2012. godine, u 11 ~asova, na Alma{kom grobqu.

Porodica Krsti}.

O`alo{}eni: }erka Tijana sa najbli`ima.

54213

54189

Za nas }e{ uvek biti tu, jer tvoja qubav i dobrota se ne zaboravqaju. Tvoja sestri~ina Stajka sa decom. 54208


^iTUQe l POMeni

dnevnik

POMEN

GODI[WI POMEN

2. 6. 2007 - 2. 6. 2012.

Svetlana Zori} 1977 - 2011.

Stevan Plav{i}

u subotu, 2. 6. 2012. godine, u 10 ~asova, na Gradskom grobqu. Utehe nema, zaborav ne postoji. Supruga Verica, }erke Sne`ana i Du{ica sa porodicama.

54086

Joka Stupar

Ber~eg Terezija - Reska

[est meseci tuge i bola je pro{lo od kad nije sa nama. Pozivamo rodbinu i poznanike da 2. juna u 10 ~asova iza|emo na ^enejsko grobqe.

iz Titela Parastos }e se odr`ati u subotu, 2. 6. 2012. godine, na Titelskom grobqu. Ne postoje re~i kojima bi se opisala tuga i praznina koju si nam ostavila... Tvoji: Pera, Beba, Momir, Rada, Ana i Tina.

54004

Tvoji Bugarski: Mile, Goca, Jovana, Dada, mala Milena i baba Ceca.

Supruga Dragana, }erke Biqana i Qiqana sa porodicama.

Ve~no o`alo{}eni: supruga Ivanka, sin Zoran, }erka Ksenija, unuk Nikola, unuke Nina i Lara, snaja Jadranka i zet Vlada.

54051

54060

1938 - 2002.

Marko Jovanovi} Izra`avamo zahvalnost `iteqima Male Remete, firmi „Atos-Vinum� na ukazanoj pomo}i, rodbini, sugra|anima svih okolnih sela na ispra}aju na{eg Marka. Neute{ni: Velimir, Jovan i Milena.

53991

2. jun 2011 - 2. jun 2012. godine Za nas Ti nisi umrla. Samo si umorna zaspala u na{im srcima. Tvoji Branka i Petar. 54191

Draga majko, pomiwemo Te, volimo i ~uvamo u srcu i mislima. Se}awe na Tebe traja}e ve~no. Tvoja }erka Milica, unuka Milana i zet Brane. 54134

Zoran \ura{kovi}

Laza Georgijevi}

1942 - 2006.

Vreme prolazi, uspomena i tuga ostaju sa nama.

2003 - 2012.

Oti{li ste prerano, ostaviv{i nam veliku qubav i verovawe da ste tu negde oko nas. Sa qubavqu, }erke Qiqana i Mirjana sa porodicama.

Uspomenu na tebe u svom bolnom `ivotu ~uva}e: otac @ivojin, majka Roska, brat Goran, snaha Jelena i bratanci Vuk i Veqko.

54019

54029

SE]AWE

TROGODI[WI POMEN

na

^ETRDESETODNEVNI POMEN dragom

Vreme prolazi, ali tuga, bol i zaborav nikada.

K}i Teodora, supruga Qubica, ta{ta Angelina i tast Lale.

54109

2009 - 2012.

Miloradu - Miletu Beloci}u Pomen obele`avamo danas, 2. 6. 2012. godine, u 11 ~asova, na fabri~kom grobqu, u Beo~inu.

Milivoja Gligorina

Gordana ^akovac

3. 6. 1991 - 3. 6. 2012.

ro|. Martina{evi} i

Utehe nema, zaborav ne postoji, rana je do`ivotna. Volimo te i patimo za tobom.

Tvoja supruga Bosa.

Tvoja supruga Slavica.

Mama Katica i sestra Olivija sa decom.

54075

53857

54165

Mile, hvala ti za sve.

Navr{ava se `alosna i bolna godina dana od kako me je iznenada napustio moj voqeni i dragi sin

Mirjana Jovanovi} - Generalova

POMEN

6. 3. 1936 - 3. 6. 2000.

8. 6. 1997 - 8. 6. 2012.

dr Verica Milutinovi}

53993

SE]AWE

54091

TU@NO SE]AWE

POMEN

TU@NO SE]AWE na drage roditeqe

54061

Dana, 3. 6. 2012. godine, u 11 sati na{em ocu i suprugu dava}emo ~etrdesetodnevni pomen na grobqu Mala Remeta.

Pavla Mirkova

Neverica i tuga, to je sve {to je ostalo. U na{im `ivotima vi{e ni{ta nije isto od kada nema tebe. Mislimo na tebe, a neka te an|eli ~uvaju.

prof. dr Miroslav Milutinovi}

Vole Te Tvoji: Bojana, Jelena i Marko.

Qubinka Medakov

2. 6. 2012.

54107

^ETRDESETODNEVNI POMEN

sa setom, qubavqu i po{tovawem uvek }emo te se se}ati.

Pro{lo je osam godina bez Tvoje qubavi i podr{ke. Ponosni smo i zahvalni {to si bio i ostao deo nas.

Dana 2. 6. 2012. navr{i}e se jedanaest godina kada od smo izgubili na{eg voqenog supruga, oca i dedu

GODI[WI POMEN

Porodice Bogi} i Jerini}.

Marko Jovanovi}

iz Ka}a

54151

Du{anu Boji}u

I posle 40 dana

Radovan Sanader Lala

54119

JEDNOGODI[WI POMEN

Du{an Stupar sa familijom.

Jelena Marjanovi} Jelka

54072

54064

7. 6. 1984 - 7. 6. 2012.

2. 6. 2004 - 2. 6. 2012.

Uspomene ~uvamo sa qubavqu i po{tovawem. Sestra Nada sa porodicom.

Uvek voqen, nikad zaboravqen.

Jovan Bogi} Pufika

POMEN

1996 - 2012.

O`alo{}eni: otac Svetko majka Du{anka, sestra Jelena i brat \or|e.

Godina pro|e, a bol, tuga i praznina ostaju ve~no.

Uvek u mislima sa na{im Jocom

Jovanki Jovanovi}

29

SE]AWE

[ESTOMESE^NI POMEN

obele`i}emo 2. juna u 11 ~asova. Jovanka, najve}a moja sre}o i qubavi, oprosti {to je osmeh nestao sa mog lica. Oprosti {to su moji obrazi vla`ni i {to me samo}a bez tebe vre|a i boli. Bila si moj ponos i dika. Hvala ti za neizmernu dobrotu i qubav kojom si me obasipala. Tvoj o`alo{}en suprug Simo.

Pajica Pa{}an

Porodica.

subota2.jun2012.

^uvam se}awa, qubav na tebe.

uspomene

3 ^ETRDESETODNEVNI POMEN

ma{. in`. A~anski M. Lazar

Milan Jankovi}

9. 8. 1942 - 4. 6. 2011. god.

Vreme prolazi, tuga i bol ostaje. Tiho si `iveo, tiho i oti{ao. Neizmerno smo ti zahvalni za svu tvoju qubav i dobrotu. S tugom i po{tovawem: supruga Mileva, sin Vojislav, unuci Milan i Jelena.

Ostavio me je bez i~ije pomo}i. Dani bez Tebe su `alosni, dugi i bolni. Zauvek }u te ~uvati od zaborava. Tvoja neute{na mama Vida. 54048

54137

Dana, 2. 6. 2012. godine je pet godina od kada nije sa nama na{ voqeni sin i brat

Gojko - Goja Beri} Vreme prolazi, ali nam sve vi{e nedostaje{. S qubavqu tvoji najmiliji: majka Zagorka, bra}a Ilija, Milan, Mirko i sestra Staka sa porodicom. 54141


tv program

subota2.jun2012.

07.30 08.15 09.00 10.00 11.00 13.00 14.00 15.00 15.30 16.00 18.00 20.00 20.30 22.00 23.00 00.00

Глас Америке Приче из књижаре Буди родитељ Е-ТВ Ноге на пут Без цензуре Простор Лице с насловнице Војвођанске вести Здравље је лек Више од откоса Војвођанске вести Ћаскање Војвођанске вести Филм: Кобно поверење Глас Америке

Чаробни сањар Пилот бомбардер у Другом светском рату, бива оборен, након чега почиње да пати од амнезије. Његова жена живи у убеђењу да је мртав пет година, док га игром случаја не пронађе у једном малом месту. Улоге: Брук Ленгтон, КолинЕглсфил,ЏејмсДентон Режија: ТериФарли-Теруел (РТВ1,22.35)

15.00 15.05 16.20 16.45 17.00 17.25 17.55 19.30 20.05 21.05 22.00 22.35 00.05 00.20 01.20 02.50

06.20 09.00 10.00 11.30 12.30 12.40 13.10 14.05 14.30 15.45 16.10 16.30 17.00 17.45 18.00 18.15 18.30 18.45 19.00 19.25 19.30 20.00 21.00 21.30 22.00 22.30 00.00

Кухињица Вести Програм за децу и младе Вуков видео буквар Хајде са мном у обданиште Колико се познајемо Питам се, питам се Путеви наде Агро мозаик Вести Академац Увек медаља Без упута Медији у Србији-хроника пропадања Вести за особе са оштећеним слухом Петказање Све о животињама Потрошачки репортер ТВ Дневник Политбиро Пет дана до поноћи, филм 1. део ТВ Дневник Џонатан Крик Фаца Војвођански дневник Чаробни сањар, филм Хроника 57. Стеријиног позорја Џонатан Крик Пет дана до поноћи, филм 1. део Политбиро

ТВ баштине Кухињица – мађ. Добро вече, Војводино (слов) ТВ баштине Вести (мађ) Емисија на мађ. са титл. на српском Балкан експрес Програм за децу и младе Мјузикл за тинејџере Хајде са мном у обданиште Вуков видео буквар Питам се, питам се Треће доба ТВ Дневник (хрв) ТВ Дневник (слов) ТВ Дневник (рус) ТВ Дневник (рум) ТВ Дневник (ром) ТВ Дневник (мађ) Спортске вести (мађ) Кухињица – мађ. Добро вече, Војводино (мађ) Културни магазин на мађарском (Јелен-лет) Емисија на мађарском са титл.на српском Емисија на мађарском Музички програм ТВ Продаја

15.48 16.48 18.30 19.00

Јутарњи дневник Жикина шареница Дизни на РТС Плава птица Дневник Спорт плус Увиђај Ексклузивно Гастрономад ТВ лица... као сав нормалан свет Рањени орао Госпођица Марпл: Хотел „Бертрам„, филм Квадратура круга Слагалица

Келијева банда Аустралија, 1880-тих година. Нед Кели, као шеснаестогодишњак завршава у затвору, неправедно оптужен за крађу коња. Након изласка из затвора четири године касније, Нед је одлучан да живи поштено. Улоге: Хит Леџер, Орландо Блум, Џефри Раш, НаомиВотс Режија: Грегор Џордан (Б92,21.40)

Ексклузивно: Живот посвећен краљици

БрукЛенгтон

07.00 08.00 08.05 08.35 09.05 09.30 10.30 11.00 11.30 12.00 12.10 12.35 13.05 14.00

08.00 09.06 11.05 12.30 13.00 13.20 13.36 14.10 14.50 15.10

Хуго Викерс је човек који живот британске краљице ЕлизабетеДруге и њене породице прати до најситнијих детаља. Био је фасциниран њоме још као дете, када га је мајка повела да присуствује једној церемонији. Ауторка: Мира Адања-Полак (РТС1,14.10)

06.30 09.15 09.35 10.30 11.00 12.00 13.00 13.05 14.00 14.05 15.10 15.30 16.00 16.05 17.00 17.05 18.00 18.00 19.00 19.30 20.00 20.30 21.00 22.00 22.30 23.00

Серијски програм Време је на мојој страни Серијски програм Азбука родитељства Серијски програм Ленија Вести Ево нас код вас Вести Серијски програм Рецепти Лауре Равајоли Витраж Вести Серијски пограм Вести Серијски програм Седам НС дана Сремски Карловци, од суботе до суботе Објектив Сајам инфо Све што желим Седам НС дана Личности и догађаји Објектив Лична грешка Серијски програм

09.15 Мото ГП Каталуња - Тренинг 3 Мото 3 12.00 Преглед аргентинске лиге 13.00 Мото ГП Каталуња - Квалификације Мото 3 16.00 Фудбал пријатељска: Русија – Италија 18.15 Фудбал пријатељска: Енглеска – Белгија 20.15 Хрватска кошарка 22.30 НБА плеј оф 00.45 Фудбал пријатељска: Холандија – С. Ирска

Зрно по зрно У новом 71. издању емисије, поред редовних рубрика, можете погледати и прилог о томе како је протекао „Дан стрних жита“ који је у Римским Шанчевима организовао Институт за ратарство и повртарство из Новог Сада. (КТВ,12.00)

05.00 Филмски програм, 07.00 Уз кафу, 07.15 Под сјајем звезда, 09.00 Жива ватра, 10.00 Шоу - Парови, 12.00 Зрно по зрно, 13.30 У међувремену, 14.00 Топ 10, 15.00 Пипи шоу, 17.00 Суботом поподне, 20.00 Филмски програм, 22.00 Ретроспектива недеље, 23.00 Фешн стори, 01.00 Суботом поподне, 04.00 Освета 08.00 Дечији програм, 09.00 Играмо се, 10.00 Кућица у цвећу, 11.00 Филм, 13.00 Филм, 15.00 Филм, 16.30 Бибер, 17.00 АБС шоу, 18.00 У нашем атару, 18.30 Бибер, 19.00 Кад порастем бићу..., 20.00 Прес пресек, 21.00 Филм, 22.30 Бибер, 23.15 Филм, 00.15 Бибер, 00.30 Ноћни програм

Барби – Феритопија (Хепи,10.00)

19.30 20.05 21.05 00.15 02.04 02.44

Дневник Рањени орао Авијатичар, филм Тело као доказ, филм Ексклузивно ТВ лица... као сав нормалан свет 03.31 Квадратура круга 03.57 Моја лепа Србија

08.30 09.45 11.00 13.00 15.00

Домаћин Галилео Филм: Људи у Црном Филм: Балистик Жене

06.00 07.30 09.00 09.15 09.25 09.35 09.45 10.00

ОДБОЈКА: КВАЛИФИКАЦИЈЕ ЗА ЛОИ

Србија–Кореја (РТС2,08.55) 06.17 06.45 06.49 07.11 07.24 07.49 08.00 08.55

ХугоВикерс

dnevnik

c m y

30

10.30 11.00 11.30 12.10 12.39 12.54 13.30 14.00 14.30 14.55 16.00 17.00 17.30 17.55 19.36 20.10 21.45 22.15 22.45 23.40 00.30 01.00 02.30 04.00

Велики је свет Бернард Срећни клинци Руске бајке Зујалице Вилењаци Верски мозаик Србије Одбојка - Квалификације за ЛОИ: Србија-Кореја, пренос Клиника вет Профил и профит Књига утисака Свет здравља Време одлуке Моја лепа Србија Грађанин Лети, лети песмо моја мила Закључано Бременски музиканти, филм за децу Биографије Вреле гуме Тотал тенис Рукомет (ж) - Квалификације за ЕП: Србија-Португалија, пренос Олимпијски кругови Одбојка (ж) - Евролига: Србија-Шпанија, пренос Потрошачки саветник Свет спорта Велика тишина Александра Ковач у „Коларцу” Вреле гуме Одбојка - Квалификације за ЛОИ: Србија-Кореја (р) Рукомет (ж) - Квалификације за ЕП: Србија-Португалија (р) Одбојка (ж) - Евролига: Србија-Шпанија (р)

11.30 12.00 12.25 12.50 13.15 13.40 14.00 14.10 15.30 15.35 15.50 17.55 18.30 19.00 19.30 21.30 23.00 01.00 01.45 03.30 04.20

НаомиВотс 05.40 08.00 08.40 09.10 10.30 11.00 11.35 13.00 14.30 16.00 16.35 18.30 19.05 21.40 23.45 00.20 02.05 03.35

Заувјек сусједи Добра земља Топшоп Цртани филмови Више од живота Вести Б92 Пријатељи Џои Интернат Вести Ноћни ТВ пројекат Вести Филм: Бетмен, почетак Филм: Келијева банда Вести Б92 Филм: Недоумица Филм: Сутра је нови дан Филм: Легенда о Гусарском рту

07.00 10.00 12.00 13.00 14.00 15.30 17.30 18.00 19.30 20.00 21.00 23.30 01.15 03.15 05.15

Добро јутро Викендвизија Живот у тренду Звезде и фанови Голд музички магазин Филм: Какав деда такав унук Мала невеста Магазин ин Национални дневник Нове курсаџије Звезде гранда Филм: Иди ми, дођи ми Филм: Резервне убице Филм: Мистериозна трудноћа Филм

Јутарњи програм Знање на поклон Торк Метеор и пријатељ Мегаминималс Меда Чарли Телешоп Барби - Феритопија, анимирани филм Генератор Рекс Гормити Моји џепни љубимци Побуна диносауруса Пресовање Телешоп Вести Филм Вести Телешоп Долина вукова Телемастер Моја Србија Серија Филм Голи живот Филм Серија Филм Матрјошки Голи живот

Сурвaјвер - финале Себастијан, Милан, Влада или Никола? Само један постаће победник Сурвајвера и освојиће 50.000 евра. Шта ће рећи публика, а шта Велико веће, сазнаћемо у суботу у спектакуларној завршници. Проведите вече са храбрим Робинзонима: Андријом, Миланом, Маријаном, Антонијом и Миланом. Уживајте уз Наташу Беквалац, Северину, Тонија Цетинског и први глас Србије Давора Јовановића. (Прва,21.00) 16.00 17.00 18.00 19.00 19.15 20.00 21.00 00.00 02.00

Сулејман Величанствени Шатра Галилео Вести Аси Сулејман Величанствени Сурвајвер финале Филм: Савршена олуја РБ еко герила

06.00 06.30 08.00 08.30 10.30 11.00 13.00 13.30 14.00 14.30 15.30 16.00 18.30 19.00 19.30 19.55 20.00 21.00 23.00 01.00 03.00 04.30

ВОА Маратон Здравље и ви Филм: Амбасадор је убијен у Стокхолму Топ шоп Филм: Рани снег у Минхену Здравље и ви Сваштарица Улови трофеј Биљана за вас Слике живота Обични људи Слике живота Улови трофеј Мајсторски Двоугао Лутер Филм: Љубавник Филм: Педесет мртвих људи хода Филм: Амбасадор је убијен у Стокхолму Лутер Филм: Педесет мртвих људи хода

Radio Novi Sad PRO­GRAM­NA­SRP­SKOM­JE­ZI­KU:­ UKT­87.7,­99.3,­99.6MHz­i­SR­1269­KHz­(00,00-24,00) PRO­GRAM­NA­MA­\AR­SKOM­JE­ZI­KU:­ UKT­90.5,­92.5­i­100.3­MHz­(00,00-24,00) PRO­GRAM­NA­OSTA­LIM­JE­ZI­CI­MA­-­ SLO­VA^­KOM,­RU­MUN­SKOM,­ RU­SIN­SKOM,­ROM­SKOM,­BU­WE­VA^­KOM­I­MA­KE­DON­SKOM­JE­ZI­KU­ UKT­100­i­107,1­MHz­(00,00-24,00)

08.45 Ски Јахорина, 09.15 Кућни видео, 09.30 Фокус, 12.40 Бање Србије, 13.00 На здравље, 13.30 Кућни видео, 13.45 Топ шоп, 16.00 НС Индекс, 16.25 Фокус, 17.05 Ски Јахорина, 17.40 Инфо Пулс, 20.00 Фокус, 20.45 Инфо Пулс, 21.20 Филм, 23.00 Бање Србије, 23.30 Фокус, 00.00 Инфо Пулс, 00.30 Туристичке разгледнице, 00.40 Ауто шоп, 00.45 Фокус, 01.15 Ски Јахорина, 01.45 Музика

07.00 Библијске приче, 07.30 Прслук агеин, 09.30 Дечија серија, 10.05 Икс арт, 11.20 Удица, 12.00 Акценти, 12.30 Испод поклопца, 14.00 Акценти, 14.10 Пун гас, 15.00 Презент, 16.00 Акценти, 16.30 Откос, 18.00 Акценти, 18.15 Писмо глава, 20.00 Филм Инфо, 20.30 Везе, 21.00 Токови моћи, 21.30 Изазови истине, 22.00 Сајам Инфо нет, 22.30 Акценти дана, 23.00 Филм

12.00 Кухињица,13.00 Џубокс, 14.00 Документарни програм, 15.00 Доктор Ху, 15.45 Паор, 16.45 Филм, 18.30 Сремарт, 19.30 Цртани филм, 20.00 Доктор Ху, 21.00 Пут вина, 21.30 ЕТВ, 22.00 Филм, 00.00 Шоу програм: Парови, 00.50 Глас Америке

08.00 Храна и вино, 09.00 Господин муфљуз, 09.30 Опстанак, 10.00 Филм, 11.30 Храна и вино, 12.00 Пут вина, 13.00 Квиз, 14.30 Макс Кју , 15.00 Филм, 17.00 Агросфера, 18.00 Везе, 18.45 Ноди, 19.00 Мозаик дана, 19.30 Храна и вино, 20.00 Панорама општине Житиште, 20.30 Филм, 2. део, 22.00 Мозаик дана, 22.30 Служба 21, 23.00 Филм


dnevnik

subota2.jun2012.

IZBOR IZ SATELITSKOG PROGRAMA

FEQTON

19

31

ПРИВАТНИ ЖИВОТ СРБА НОВИЈЕГ ДОБА

Пише: др Милан Ристовић 07.40 08.35 09.00 09.55 10.50 11.45 12.40 13.35 14.30 15.25 16.20 17.15 18.10 19.05 20.00 20.55 21.50 22.45 23.40 00.40

Четири венчања -Америка Венчаница из снова Мајами инк Девојчице и дијадеме Џон,Кејт и осморо деце Најбољи амерички кувар Стручњак за торте Шта не треба обући Луда вожња Богата млада,сиромашна млада Л.А.Инк Кејт и осморо деце Најбољи амерички кувар Спасавање беба НYИнк Четири венчања -Америка Суочавање са траумом Дечко који није могао да омршави Л.А.Инк НYИнк

08.00 Скривена блага афричке, аустралијске и индијске уметности 09.00 Силверадо 10.00 Келтско наслеђе 11.00 Марк Форстер –дозвола за снимање 12.00 Милош Форман 13.00 Поздрав 14.30 Видео је убио радио 15.00 Ко си заправо ти? 16.00 Салвадор Дали:прича о два града 17.00 Краљичина сестра 19.00 Добродошли у осамдесете 22.00 Ђаво ког знамо 23.00 Ко си заправо ти? 00.00 Салвадор Дали:прича о два града 01.00 Краљичина сестра

08.00 Кинотека-циклускласичног вестерна:Металназвезда, филм 09.30 Резервисантермин 10.09 Кућниљубимци 10.44 Полориха,док.серија 11.15 Нормаланживот 12.00 Дневник 12.31 Ветеранимира 13.16 Духовниизазови 13.46 Призма 14.31 Мањинскимозаик 14.50 Екозона 15.20 Тичудеснимладунци,док. серија 16.15 Евромагазин 17.20 Репортери 18.20 Потрошачкикод 18.50 Глобалносело 19.30 Дневник 20.10 Дружбаправихџентлмена, филм 22.05 Пацифик 23.10 Дневник3 23.28 Времесутра 23.34 Вестиизкултуре 23.39 Националносаветовањео господарствуи подузетништву 02.03 Филмскимаратон: Транссибирскапругасмрти, филм

06.00 07.00 09.00 14.00 19.00 20.00 21.00 23.30 00.30 02.20 06.00 08.00 11.00 12.00 13.00 14.00 16.00 18.00 19.00 20.00 21.00 22.00 23.00 01.30

Дијагнозаубиство УбиствауМидсомеру Видовњак Монк Браћаисестре Хаваји5-0 Родитељиидеца Свепозакону Ноћдама БитказаЛосАнђелес УбиствауМидсомеру Дијагнозаубиство МистеријаХејвена Дображена Браћаисестре БитказаЛосАнђелес Савршенплан Свепозакону Ерика Скандал Браћаисестре Дображена Родитељиидеца Ерика

08.00Бен10:Ултимејтејлијен 08.25Училица 09.12Куварипо 09.15Колумбо 11.10 ПороциМајамија 13.25П.Ц.У,филм 15.00Инсајдер,филм 17.28Куварипо 17.30ПреживетидивqинуСевернаАфрика,док.серија 18.30РТЛДанас 19.10Галилео 20.00Будванапјениодмора 21.00Сурвајвер:Финале 23.30Упаклуосвете,филм 01.20Астрошоу 02.20РТЛДанас 02.55Лутријамијепроменила живот,док.серија

Упаклуосвете 08.00 Зумероваекипа 08.30 ПрвиБожићванземаљаца 09.30 ОзиБу 10.30Гангстерскаприча 12.00Триамигоса 14.00 Професионалац 16.00Влакомпремајугу 18.00Клопанаточковима 20.00Кобнаопсесија 22.00Пустош 00.00ПланетаX-2 01.00ПланетаX-3

Кобнаопсесија БенКронинимасве.Сјајне пријатеље, сјајну девојку и сигурну стипендију за колеџ. АлињеговживотсемењакадагановаученицаподименомМедисонувучеуавантурузаједнуноћ... Улоге: Џеси Бредфорд, Ерика Кристенсен, Шири Аплби Режија:ЏонПолсон (Синеманија,20.00)

ЂинаРоландс

Љубавнеигре Џоан  је млада, лепа, талентована и неспособна да задржи мушкарца до кога јој јестало.Изасебеиманизповршнихипропалихвеза.Кад упознаКенана,изненађенаје штоонодбијасвакуинтимнијувезу... Улоге:  Анђелина Џоли, Шон Конери, Ђина Роландс, Џилијан Андерсон, Мадлин Стов, Денис Квејд, РајанФилипе Режија:ВилардКерол (ХРТ2,14.20) 08.13 08.33 08.48 09.18 09.40 10.30 11.20 12.15 13.15 13.45 14.20 16.20 18.20 18.50 20.55 22.15 23.50 01.24 02.09

ЕрикаКристенсен

06.00 Легија изузетних плесача: Побуна почиње 07.25 Луди камен 09.15 Yу-Ги-Ох 10.45 Крива је мама 12.25 Потпредседница 12.55 Зелени стршљен 14.50 Тренер 16.15 Секретаријат 18.20 Џастин Бибер. Никад не реци никад 20.05 Не дозволи ми да одем 21.45 Љубав и друге дроге 23.35 Зец без ушију 2 01.35 Кликни за невиност 03.05 Рај,пакао 04.30 Цимерка

Аниманијаци Причеосликама МалаТВ Кућнисвемирци Тројанскикоњ,филмзадецу Петидан,токшоу ОдабраоЂелоХ. КСАутомагазин 4зида Ружиона Љубавнеигре,филм Фудбал(У21),квалификације заЕП:Хрватска-Швицарска, пренос Мењамсвет Осло:Пријатељска фудбалскаутакмица: Хрватска-Норвешка,пренос БелиЧуперак-пустоловине малогдабра,док.филм Јагањциилавови,филм ЈоханФолк ХрватскеутакмиценаЕПЕП2004.ХрватскаФранцуска,снимак ВладимирКрањчевић диригујеСимфонијским оркестромХРТ-а

08.30 10.00 11.30 13.00 15.00 16.30 18.00 20.00 22.00

Друмскитркачи Мртвинелажу Зојинтајниживот Еволуција Допросјачкогштапа Ненајављенигостизтаме ГенXполицајац Узбуна:Рубиконовазавера Свемирскивојници2:Херој федерације 00.00 Мекгајвер:Путдосудњег дана

08.00Пронађени рај 10.00Можда беба 12.00Ухвати Картера 14.00Сјај 16.00Само Синатра 18.00Последњи Мохиканац 20.00Остани уз мене 22.00Заклетва 00.00Еротскифилм 01.20Еротскифилм

Џуниор, син затвореник а на условној, познатог као Оу Ту, отет је пошто је крађа аутомобила пошла по злу. НаркобосМитузеојеЏуниоразатаоца,аОуТује,уколико жели да сина види живог,приморандаплатиоткупнину... Улоге: Тајрис Гибсон, МеганГуд,ЛаренсТејте,Хенру ХантерХол Режија:ВондиКертисХал (РТЛ,23.30)

Покондиренапрестоница

У

једном до бројних издања „српске кулинар- и меса из фуруна, те освежавајућа пића (боза, саске библије“, „Мог кувара„ Спасеније-Пате леп). У међуратном периоду умножавају се јефтиМарковић из 1939. по себно је истакнута не народне кујне, које су нудиле једно ставну куваестетска страна припреме, сервирање и конзуми- ну храну самцима и свету са скромним примањирања хране, али и да „нерасположење, преморе- ма и прохтевима. ност и узнемиреност утичу неповољно на варење“. „Европеизације“ је већ раније завршена у граДобро опремљена кухиња бакарним и тучаним ђанској српској кухињи у Аустроугарској (Војвопо суђем, гвозденим шпоретом, хладњаком, по се- дини, Славонији и Хрватској) прихватањем начина довање порцуланског сервиса за 12 или шест осо- приреме хране, избора јела и сервирања, базираба („карлсбадског“ или „мајсена“, најчешће), сре- ног на доминантној, немачко-мађарској кухињи, уз брног пробора за јело, чаша за различита пића и задржавање неких старих, традиционалних јела. У прилике, столњака од дамаста, били су део репре- Србију већ током 19. века, поред неких намирница зентовања до стигнутог „нивоа“ српске грађанске (меки сиреви, милерам, путер, виршле, шваргле, „класе“. Прилика да се „покаже“ било је позивање крвавице) стижу и, до тад стране, повртарске кулго стију различитим поводима. Али и најсирома- туре (кељ, келераба, спанаћ, тиквице, артичоке, цешнијима, бар једном или двапут годишње, обичај лер, карфиол, грашак, зелена салата, шаргарепа). је налагао да пуном трпезом дају доказа о поштовању светиње го стопримства. Дворски кувар кнеза Милана, Немац Михл, спремао је сваки дан 14 јела за бројне го сте и владареве пратиоце. Утицаји, пре свега средњоевропске кухиње, пристигле из суседства са Србима-пречанима или са странцима (Немцима, Мађарима, Че сима, Италијанима), до сељеним у Србију, уз такође незаобилазне рецепте преузимане из тад најцењеније европске кухиње, француске, мешали су се са локалном куварском вештином, у којој је био најснажнији балканско оријентални укус (преузет по средством турско-персијске и грчко-медитеранске кухиње). Кухиња коју ваља и гостима показати Дуго „амалгамисање“ је произвело од 19. века ку- Београђани су до 1914. често су лађом одлазили на хињу коју условно можемо назвати „српском“, јер породичне гастрономске излете у своје аустроује мало аутентично националног. Склоност жите- гарско суседство, Земун или Панчево, на гласу по ља престонице да прихватају новине и у кухињи, себно због одличних хренвиршли и пива. утицала је, по мишљењима странаца, да храна у У градовима унутрашњо сти Србије, по себно унутрашњо сти била квалитетнија и чуде се да „та- оним који су по сле 1878. ушли у њен састав (Ниш, кви патриоти, као што су Београђани, више воле Пирот, Ле сковац, Врање), доминатна је остала безвредне стране имитације него своја стварно балканско-оријентална гастрономска нота (ђувечи, укусна јела“. сарме, мусаке, пите, пилави, чорбе, баклаве, кадаАли, Аугуст Мале похвално пише о квалитету иф, ратлуци, сутлијаш, алве). Храна се спремала у јела служених на обедима његовог васпитаника, домаћинству, али су нека јела одношена у тепсијакраља Александра Обреновима, ђувечима и грнетима у пећа, па се из њиховог пописа каре на печење – по обичају, Олакоприхватање свих види да су потпуно била део какав се и данас среће у северинтернационалне кухиње. Доној Африци и Блиском истоку. европскихновотарија, лазак на двор краљице Драге, Ручало се за ниском софром паикухињских,приметили ручкови (у осам увече!) по стаодвојено мушкарци и жене, одсустранциичудили се ју важан део политичког ритурасли и деца. Велики цивилиала а на њима се инсистира на да„таквипатриоти,каошто зацијски искорак десио се кад домаћим производима, пре је Српкиња села за сто да обесуБеограђани,вишеволе свега вина и пива. Краљица дује са мужем, а није више стабезвреднестране Драга наглашава да је сама јала поред да би по служивала. ими т а ц и ј ене г осво ј а спремила по служење за Светог Хлеб, основна намирница стварноукуснајела” Николу, славу породице Обресрпског сељака и градске сироновић, као свој допринос потиње, дуго је печен у зиданим вратку традицији. Део дворске етикације је и у крушним пећима или у црепуљама, као и разна јевреме краљице Наталије имао неке домаће специ- ла од меса. Прављен је у разним варијантама: од фично сти, као што је служење го стима слатког као великих белих панонских, тешких три и више киобавезног ритуала добродошлице, обавезног у лограма, преко разних погача, ражаног хлеба, хељсвим грађанским домовима у Србији. даног, лепиња, симита, земички, кифли, лепињаДеликатесне радње на добром гласу у престони- рамазанки у муслиманским срединама или црног ци од краја 19. века поред домаћих трговаца, држа- збијеног као точак округлог хлеба динарских крали су и странци (Чеси и Немци кобасичарске рад- јева, кукурузне проје. ње, Италијани кафе-по сластичарнице), а у новим Ширење производње пива у Србији, чију су теххотелима и бољим кафанама је, поред назаобила- нологију донели странци (браћа Бајлони, породице зног роштиља, преовлађивала европска кухиња. Вајферт, Крен), утицало је, поред невоља у којима Њеном „напредовању“ допринеле су и све бројни- се нашло винарство због ширења пероно споре је куварице-пречанке, које су запошљаване у кућа- крајем 19. века, да квалитетно српско бело и црно ма имућнијих Београђана. вино (неготинско, метохијско, банатско, сремско) На београдским улицама и по варошима на раз- добије озбиљног такмаца. За жестока пића, по себмеђи два века је богата понуда „брзе хране“: улич- но ракије, био је „резервисан“ до Другог светског ни продавци нуде разна пецива, куване шкембиће рата највећи део рода воћа, по себно шљиве.

МеганГуд

Књигу„ПРИВАТНИ ЖИВОТ КОД СРБА”, која кошта 2.592динара, одиздавачкекуће„Клио„ (ГосподарЈованова44,Београд),можетенаручитипутемтелефона011/2626–858и3035–696, илии-мејла office@clio.rs 08.10 09.05 10.00 13.40 14.35 15.30 16.25 17.20 18.15 19.10 20.05 21.00 21.55 22.50 23.45 00.40

08.30 08.45 09.45 10.30 11.00 20.30 21.00 23.00 23.30 00.30 01.30

Мегаградитељи: Моћни бродови Чудовишта из реке Врхунско градитељство Грандиозни пројекти Велике селидбе Како се прави? Трговци Позадина авионских несрећа Борба са силама природе Пен и Телер –Лаж или истина Чари путовања Преживљавање Преживљавање удвоје Уништавање! Пен и Телер –Лаж или истина

Фитнес Тенис Тенис Тенис Тенис Тенис Борилачки спорт Аутомобилизам Фудбал Тенис Тенис

Prvi broj Slobodne Vojvodine" {tampan je kao organ Pokrajinskog narodnooslobodila~kog odbora za Vojvodinu " 15. novembra 1942. u ilegalnoj {tampariji u Novom Sadu. Od 1. januara 1953. Slobodna Vojvodina" izlazi pod imenom Dnevnik”. " " Prvi urednik - narodni heroj SVETOZAR MARKOVI] TOZA pogubqen od okupatora 9. februara 1943. Izdava~ „Dnevnik Vojvodina pres d.o.o.”, 21000 Novi Sad, Bulevar oslobo|ewa 81. Telefaks redakcije 021/423-761. Elektronska po{ta re­dak­ci­ja@dnev­nik.rs, Internet: www.dnevnik.rs. Glavni i odgovorni urednik Aleksandar \ivuqskij (480-6813). Generalni direktor Du{an Vlaovi} (480-6802). Ure|uje redakcijski kolegijum: Nada Vujovi} (zamenik glavnog i odgovornog urednika, unutra{wa politika 480-6858), Miroslav Staji} (pomo}nik glavnog i odgovornog urednika, nedeqni broj 480-6888), Dejan Uro{evi} (ekonomija 480-6859), Petar Tomi} (desk, no}ni urednik 480-6819), Vlada @ivkovi} (novosadska hronika, 421-674, faks 6621-831), Nina Popov-Briza (kultura 480-6881), Svetlana Markovi} (vojvo|anska hronika 480-6837), Vesna Savi} (svet 480-6885), \or|e Pisarev (dru{tvo 480-6815), Mi{ko Lazovi} (reporta`e i feqton 480-6857), Branislav Puno{evac (sport 480-6830), Jovan Radosavqevi} (Internet slu`ba 480-6883), Ivana Vujanov (revijalna izdawa 480-6822), Filip Baki} (foto 480-6884), Branko Vu~ini} (tehni~ka priprema 480-6897, 525-862), Nedeqka Klincov (tehni~ki urednici 480-6820), Zlatko Ambri{ak (Slu`ba prodaje 480-6850), Svetozar Karanovi} (Oglasni sektor 480-68-68), Filip Gligorovi} (Sektor informatike 480-6808), Mali oglasi 021/480-68-40. Besplatni mali oglasi za Oglasne novine 021/472-60-60. Rukopisi i fotografije se ne vra}aju. Cena primerka 30 dinara, subotom i nedeqom 35 dinara. Mese~na pretplata za na{u zemqu 940, za tri meseca 2.820, za {est meseci 5.640 dinara (+ptt tro{kovi). [tampa „Forum” Novi Sad @iro ra~uni: AIK banka 105-31196-46; Rajfajzen banka 265201031000329276

Dnevnik" je odlikovan Ordenom bratstva i jedinstva sa zlatnim vencem " i Ordenom rada sa zlatnim vencem


monitor

subota2.jun2012.

Horoskop OVAN 21.3-19.4.

Партнерски однос постаје актуелнији. Да ли зато што је викенд, па имате више слободног времена, или су се пробудиле неке скривене и успаване жеље? Потребан вам је одмор и романтика.

BLIZANCI 21.5- 21.6.

LAV 23.7-22.8.

DEVICA 23.8- 22.9.

2. jun 2012.

Овог викенда вам неће све коцкице бити на броју, па се немојте превише трудити да постигнете немогуће. Поготово у контактима са разноразним особама које вам не пашу у потпуности.

BIK 20.4-20.5.

RAK 22.6-22.7.

dnevnik

c m y

32

Субота је веома активан дан за вас, захтеван и занимљив. Поведите рачуна о исхрани и свом здравственом стању, ових дана. Смирите страсти, поготово у приватном бизнису. Уживајте у окружењу.

Острашћени сте и одлучни да остварите, чак наметнете све или ништа. Партнер неће бити задовољан уколико не покажете више иницијативе, добре воље и осмеха, жеље и нежности. Опуштено.

Друштвено сте ангажовани, из дана у дан. Има вас и ту и тамо, где се нешто дешава, где су пријатељи. Добро сте позиционирани у каријери, поготово у контакту са иностранством или званичним лицима.

Иако је време одмора, ипак нећете мировати, све и да желите. Обавезе вас не остављају на миру, чак ни викендом. Смањите темпо колико год можете. Бавите се неким видом спорта, шетњом.

Nena Radaшin, astrolog nena.r@eunet.rs VAGA 23.9- 23.10.

[KORPION 24.10- 23.11.

STRELAC 24.11- 21.12.

JARAC 22.12-20.1.

Кроз ваш знак је заполовио Месец, па сте емотивнији и осетљивији него обично. Окружите се породицом и децом, да би ту околност испунили и искористили на најбољи могући начин. Промењивост.

Неке околности вас могу узнемирити, без икакве потребе. Уколико се повучете у свој интимнији простор, покушајте да се опустите. Али, изазови који су испред вас, делују веома примамљиво.

Једна женска особа, пријатељи или ваше дете, заслужује пажњу овог викенда. Ведри и облачи, по својој жељи и расположењу. Ипак, остаћете доследни себи и деловати спокојно. Вредни сте.

VODOLIJA 21.1-19.2.

RIBE 20.2-20.3.

Време је да се озбиљније позабавите својим финансијама и будућим улагањима, поготово оним евентуално капиталним. Трошкарите новац ван плана и програма, поготово овог викенда. Провод је ОК.

Можете се наћи у ситуацији под менталним притиском, па је боље да прећутите и не одреагујете, него да учините труд и револт без резултата. Немојте губити време, већ се крећите у јавности. Добар и успешан викенд, за вас. Имате добре односе са иностранством. Искористите то. Можете направити живу журку у свом дому, позвати друштво и анимирати их. Ипак, немојте претеривати ни у чему.

TRI^-TRA^

Шеронима новогдечка V REMENSKA

Једн а од најс екс еп илн иј их глум иц а Хол ивуд а Шер он Стоун (54) у вез и је са 27 год ин а млађ им муш карц ем. Шер он се заб ав ља сАргент инц емМарт иномМиком,кој ијеодњеупола млађ и. Пар је нед авн о уск ликан док се заб ав љао на плаж и Вен ис у Лос Анђ ел есу. Иако је плаж а бил апун апап ар ац а,парсениј е скривао - држ ал и су се за руке, леж ал иједн опор еддругогзаг рљен ииљуб ил исе. Нов и дечко поз нат е глум иц е је ман екен, а упоз нал и су се прош логмес ец а.

PROGNOZA

VIC DANA

Мало

Vojvodina Novi Sad

22

Subotica

20

Sombor

22

Kikinda

21

Vrbas

22

B. Palanka

22

Zreњanin

22

S. Mitrovica 23 Ruma

22

Panчevo

24

Vrшac

22

Srbija Beograd

23

Kragujevac

25

K. Mitrovica 27 Niш

28

Evropa

Свежије

НОВИ САД: Мало ниже температуре уз делимично облачно време са повременом кишом, а биће и сунчаних периода. Дуваће слаб северни и североисточни ветар. Притисак изнад нормале. Температура од 15 до 22 степена. ВОЈВОДИНА: Мало ниже температуре уз делимично облачно време са повременом кишом, а биће и сунчаних периода. Дуваће слаб северни и североисточни ветар. Притисак изнад нормале. Температура од 12 до 24 степена. СРБИЈА: На северу ниже температуре, а у јужним пределима топло. Биће променљиво време уз смену сунчаних и облачних периода и краткотрајне кише и пљускова са грмљавином. Дуваће слаб северни и североисточни ветар. Притисак мало изнад нормале. Температура од 10°Ц до 29 степени на југу Србије. ПрогнозазаСрбијуунареднимданима: У недељу сунчаније и доста топлије. У понедељак такође веома топло, али увече и у ноћи ка уторку поново са пљусковима. У уторак хладније са кишом, а од среде поново сунчано.

БИОМЕТЕОРОЛОШКА ПРОГНОЗА ЗА СРБИЈУ: Очекивана временска ситуација ће условити блаже смањење тегоба хроничних болесника, а код здравих особа ће допринети побољшању расположења и радних способности.

Madrid

32

Rim

25

London

18

Cirih

26

Berlin

16

Beч

21

Varшava

14

Kijev

19

Moskva

19

Oslo

14

St. Peterburg 16 Atina

26

Pariz

25

Minhen

21

Budimpeшta

19

Stokholm

8

На 50-годишњицу брака Лала и Соса се договоре да освеже брачну монотонију изласком у град као некад. Наћи ће се у центру у осам сати. Спреми се Лала, порани 15 минута и чека. Прође сат, прођу и два, а Сосе нема. Бесан, Лала стиже кући и с врата упита: - Што не дође, луда жено? - Није ме мама пустила!

SUDOKU

Upiшite jedan broj od 1 do 9 u prazna poљa. Svaki horizontalni i vertikalni red i blok od po 9 praznih poљa (3h3) mora da sadrжi sve brojeve od 1 do 9, koji se ne smeju ponavљati.

VODOSTAњE DUNAV

TAMI[

TISA

Bezdan

191 (-20)

Slankamen

324 (-6)

Apatin

268 (-20)

Zemun

389 (-10)

Tendencija opadawa

Senta

259 (2)

Bogojevo

250 (-15)

Panчevo

396 (-8)

STARI BEGEJ

Novi Beчej

323 (0)

Tendencija opadawa

Smederevo

532 (-8)

Titel

317 (-7)

NERA

Baч. Palanka 260 (-10) Novi Sad

261 (-17)

Tendencija opadawa

Jaшa Tomiћ

Hetin

168 (-12) N. Kneжevac

SAVA

84 (4)

Tendencija stagnacije

200 (-1)

Tendencija stagnacije i opadawa

S. Mitrovica 364 (-32) Beograd

Kusiћ

339 (-10)

112 (-16)

Reшeњe iz proшlog broja

Dnevnik 2.jun 2012.  

Elektronsko izdanje novosadskog dnevnog lista "Dnevnik"

Read more
Read more
Similar to
Popular now
Just for you