Page 1


CONTABILIDAD CORPORACIÓN BACILÖ ¿QUÉ ES CONTABILIDAD? ¿QUÉ ES ESTE LIBRO? PRIMERAS PREGUNTAS CONTESTADAS PARA SITUAR A LOS LECTORES






Introducción: Que es contabilidad? Que es este libro? Para la preparación y/o edición de este libro partimos de la relación que el evento artístico bienal Manifesta 8, al amparo de la Fundación Internacional Manifesta, que se ha desarrollado en Murcia entre las fechas 9 octubre 2010- 9 enero 2011, ha tenido con la Corporación Bacilö, como una de las propuestas artísticas seleccionadas por los curators oficiales del evento. Esta relación ha pasado por momentos dulces y algo más amargos, tanto para una parte como para la otra, al final el desarrollo de las comunicaciones y negociaciones dieron lugar a una expulsión unilateral por parte de la organización de Manifesta 8 de la propuesta de la Corporación Bacilö . Con este libro la Corporación Bacilö intenta dar un poco de luz a la situación vivida por este colectivo, todos sabemos que es sólo la versión de una de las partes, y por tanto no será nunca un documento totalmente objetivo, aunque hemos intentado ser lo mas neutrales posibles, editando toda la documentación de las relaciones, comunicaciones y contratos existentes sin manipulación ninguna, como todos los lectores podrán comprobar. Aun sabiendo que es solo la versión de una de las partes, los lectores deberán saber que por parte de Manifesta 8 no se ha querido en ningún momento dar su versión de los hechos, por lo que presuponemos que estarán de acuerdo con nuestra versión o como dijese Tomas Moro, EL QUE CALLA OTORGA. Este silencio institucional que hemos denotado por parte de la organización de la bienal dice muy poco a su favor a la hora de querer llegar a un consenso de soluciones, por lo que nos hacen creer que la decisión de la expulsión de la Corporación Bacilö fue tomada sin remisión, de ahí que todos los esfuerzos de la Corporación Bacilö por buscar un poco de luz a la solución de la ruptura se han encontrado siempre con un muro de silencio y desden por parte de los organizadores. En este libro contemplamos también los hechos acaecidos durante los meses de preparación y desarrollo del PROYECTO CONTABILIDAD presentado por la corporación bacilo, y toda la documentación existente tanto del propio proyecto como de las continuas comunicaciones con los curators responsables de la bienal, por lo que el lector podrá hacerse su propia idea del porque del affaire, comprobando por si mismo si la propuesta de la Corporación Bacilö en su PROYECTO CONTABILIDAD es algo incomodo para una bienal de este estilo en el momento económico y social en que nos encontramos actualmente. El lector podrá ir desgranando la información sobre el PROYECTO CONTABILIDAD por medio de las claves que la Corporación Bacilö va dando en el desarrollo del libro, pues desde Bacilö contemplamos nuestro trabajo como un proyecto interactivo donde el protagonista primero es el espectador-imomi-lector, que deberá interpretar cual PIEDRA ROSETA de la cultura visual actual todos los documentos que le presentamos en esta edición, así que el viaje intelectual de cada uno de los lectores será un viaje personal. Aunque desde la Corporación Bacilö hemos querido dar un desarrollo semienciclopedico de la documentación, siempre existen resquicios de orden-caos que


caracteriza el trabajo de Bacilö, sobre todo debido a la cantidad ingente de documentación que nuestra Corporación mueve en cada uno de sus proyectos, por el arduo trabajo de investigación que desarrollamos en cada propuesta. Desde Bacilö contemplamos este libro como un trabajo terapéutico tras el affaire acaecido durante meses, pues consideramos que nuestro trabajo no debía quedar en la sombra, sobre todo por el esfuerzo puesto por los componentes de nuestra Corporación a la hora de desarrollar el PROYECTO CONTABILIDAD incluido en la programación de Manifesta 8 en su sección PROYECTO MOCHA comisariado por el COLECTIVO ACAF. El lector podrá así mismo vislumbrar información sobre las medidas legales que nuestra Corporación a emprendido contra Manifesta 8 como información sobre nuevas propuestas en que la Corporación Bacilö trabaja actualmente, tanto propuestas para nuevas bienales MANIFESTA como orientadas a la dinamización culturoespectacular de nuestro futuro más cercano. Para finalizar desde la Corporación Bacilö invitamos a Manifesta 8 a expresar su versión públicamente, pues estaríamos encantados de incluir su versión en este libro, convirtiéndolo así en un objeto-libro objetivo a ojos de los detractores de esta 1º versión-edición. Esperamos que disfruten con la lectura-consumo de este compendio de informacióndesinformación que la Corporación Bacilö les ofrece tan amablemente.


jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj

7LFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLF



WDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLF WDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLF WDFWLFWDFWLFWDFWLFಹ (OUHORMGDODVH³DOVLQTXHKD\DKDELGRUHVSXHVWDSRUSDUWHGH0$1,)(67$ORVPLVPRVTXH KDQFRQVHJXLGRTXH&217$%,/,'$'KD\DVLGRODDFFLµQP£VYLVWD\FRQRFLGD GHOD LQWDFKDEOHWUD\HFWRULDGHEDFLO¸ HQWDQVRORVHPDQDVYLVLWDVDQXHVWUEORJ QRV

SILENCIO

REVHTXLDQQXHYDPHQWHFRQXQP£VTXHMXJRVRDODYH]TXHLOXVWUDWLYR

INSTICIONAL….  &8ƒ/(6(/&267(727$/'(/$25*$1,=$&,•1'(81 &,&/2(;326,7,92&2020R&+$6(66,216(1(/48(3$57,&,3$1

$57,67$6&218135(6838(672'(೼325&$%(=$"&8ƒ/ (6(/35(&,248(&255(6321'($/$3$57(

%852&5ƒ7,&2$'0,1,675$7,9$'(/$0,60$&2181 (48,32'($/0(126

7‹&1,&26>(48,32&85$725,$/^

3(5621$6`68%&2&20,6$5,$^3(5621$`7(&1,&2'(0217$-( ^"01,02`<12&217$026$/2675$163257,67$60217$'25(67‹&1,&26 '(352'8&&,•1<'(0ƒ6$'<$&(17(6(181/$5*2(7&(7&(7&‹7(5$'( $&•/,7267‹&1,&2$'0,1,675$7,92648(68(/(1&21//(9$5(67(7,32'(


(9(1726@48((67ƒ175$%$-$1'2'85$17(0ƒ6'(81$“2 &2168

&255(6321',(17(68(/'2<&2175$72'(75$%$-2 (//266  &8ƒ/(6(/35(&,2'(/9,$-(</$(67$1&,$'(81$6(0$1$$ 18(9$<25.'(/$&268%&20,6$5,$3$5$6(/(&&,21$5 0$7(5,$/ಯ5(/(9$17(ರ3$5$/$(;326,&,•1"&8$/(6(/35(&,2 '(/

*$%,1(7('($548,7(&726'( %(5/148(+$(67$'275$%$-$1'27$1'8523$5$/$ ',6326,&,•1(63$&,$/'(/$5,'&8/$325&,•1'(

$5&+,92(6&$6$0(17(5(/(9$17(48( ),1$/0(17(6(+$75$'2 9(53$5$&5((5,16(57$5)272(1&8$1726(

&8ƒ/(6/$

',6321*$'((//$ 

5(/$&,•1 352325&,21$/(175( /26*$6726727$/(6 48(&21//(9$81$ (;326,&,•1</$ 3$57(48(6(/(


$6,*1$$/$8725'( /$0,60$"

 6,(648(6(/($6,*1$$/*2 ಹ

 5HDOLFHPRVXQDHVWLPDFLµQDSUR[LPDWLYD B3RQJDPRVTXHORVDVDODULDGRVVHDQPLOHXULVWDVTXHORGXGDPRVDXQTXHDOJXQRGHHOORV SUREDEOHPHQWHORVHDಹ  Ã&#x2020; W«FQLFRV [ à³¼PHQVXDOHV [PHVHV à³¼  B3RQJDPRVTXHHOYLDMHD1<IXHVH/2:&267Ã&#x2020;YLDMH LGDYXHOWD à³¼HVWDQFLD G¯DV  à³¼GLHWDV[G¯DV à³¼  >3UHFLRVGHWHPSRUDGDEDMD\SHQVLµQGH HVWUHOODVFRQVXOWDGRVHQODZHE@

 B3RQJDPRVTXHHOJDELQHWHGH%HUO¯QOOHYµDFDERVXSUR\HFWRHQWDQVRORXQPHVDOJRKDUWR LPSUREDEOHSHURHVSDUDVHJXLUWLUDQGRSRUOREDMR\TXHLQFOX¯GRHOHVWXGLR\WRGRORTXH FRQOOHYDUDIXHVHQ  Ã&#x2020;à³¼ TXHQRHVSRFRSHURGHVFRQRFHPRVVLHOORVWDPEL«QYLQLHURQGH$OHPDQLDSDUDFRQRFHUHO HVSDFLRLQVLWXRVLIXHDWUDY«VGHODUHGDXQTXHIXHVHQMµYHQHVHVWDFDQWLGDGQRHV GHVDIRUDGDSDUWLHQGRGHOKHFKRGHTXHORVHVWXGLRVGHDUTXLWHFWXUDVXHOHQFREUDUD SRUFHQWDMH   B3RQJDPRVTXHODSDUWLGDDVLJQDGDDODVHFFLµQJU£ILFD\SXEOLFLGDGHVGH  Ã&#x2020;à³¼  B1RHQWUDPRVHQRWURWLSRGHJDVWRVGHULYDGRVFRPRSHUVRQDOGHYLJLODQFLDHQFDUJRGHWH[WRV HVFULWRVSRUWHµULFRV B3RQJDPRVHQGHILQLWLYD HVXQSRQHUFRPRGLFHQHQ$QGDOXF¯D TXHHOFRVWH727$/GHOD

H[SRVLFLµQURQGDU£ORV

೼೼

GHORVFXDOHV

à³¼ VRQODSDUWLGDDVLJQDGDDORV DUWLVWDV 



HVPX\VHQFLOOR


HQWRQFHVOOHJDUDODFRQFOXVLÂľQHVWLPDWLYD>DWUDYÂŤVGHXQDVLPSOHRSHUDFLÂľQDULWPÂŤWLFD@DTXHOD UHODFLÂľQFRUUHVSRQGLHQWHHQHVWHFDVRHVGH

DDSUR[3RUFDGD

SDUWHVJDVWDGDVHQWRGRORTXHHQYXHOYHDXQDPXHVWUDHVODTXHVHDVLJQDDOWUDEDMRWRWDO KRQRUDULRV\SURGXFFL¾QLQFOXLGRV GHOFUHDGRUGHODPLVPD (VWDSURSRUFL¾QHVWLPDPRVTXHQRHVPX\GHVDFHUWDGDHVP£VLQFOXVRSUREDEOHPHQWHVH TXHGHFRUWDಚ7LFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDF

WLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDF WLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDF WLFWDFWLFWDFWLFWDFWLFWDFWLFಚVHFLHUQHQODVFRQVHFXHQFLDV

GHEDFLO¸WLFWDF7,&7$&  )HGHHUUDWDV/DDFFL¾QP£VYLVWDGH&RUSRUDFL¾QEDFLO¸IXHIHVWL0$'BPD[

>AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@ Murmuranoicas-murmuranoia â&#x20AC;&#x153;(â&#x20AC;Ś) â&#x20AC;ŚPĂ´r otra parte le indicamos a usted y a la entidad a la que representa que estamos

de

UN CLĂ SICO IMPERECEDERO//THE CLASSICenIMPERISHABLE preparando unas clausulas a incluir en el contrato basĂĄndonos el Manual

Buenas PrĂĄcticas ArtĂ­sticas.

ONE

Se las haremos llegar lo antes posible para que puedan consultarlas previamente al encuentro con nuestro enviado-representante para la firma del contrato.

Por otra parte se incluirĂĄ una baterĂ­a de propuestas y compromisos de bacilĂś. Ă&#x2030;stas podrĂĄn ser aceptadas o no, pero rogamos sean tenidas en cuenta y en todo caso que sean incluidas en el contrato como peticiones realizadas por bacilĂś y aceptadas o no por M8.

(VER compromisos y pericones de bacilĂś al final del presente documento) Atentamente Dpto. de legalidad infructuosa de la CorporaciĂłn BacilĂś.

â&#x20AC;?

From: corporaciĂłn bacilĂś <corporacionbacilo@yahoo.com.au>

0$/(7Â?1325$&Â&#x192;0$/(7Â?1325$//Â&#x192; To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; bacilĂś

<corporacionbacilo@yahoo.com.au> %5,()&$6()25+(5(%5,()&$6(7+(5( Sent: Thu, 5 August, 2010 6:29:29 PM

Subject: a cerca del contrato bacilĂś con M8RM  **********************************************************************

********************************


T E R C E S P TO

G N I T MEE

Public MeetingS_Bacanal/Homenaje


BREVE HISTORIA EPISTOLAR DE UN FRACASO INSTITUCIONAL RELACIÓN DE LAS ÚLTIMAS SOLICITUDES DE INFORMACIÓN DEMANDADAS POR EL APARATO CURATORIAL DEL PROYECTO MOCHA SESSIONS DE MANIFESTA 8 Y RESPUESTAS/DOCUMENTOS TEÓRICOS FACILITADOS POR CORPORACIÓN BACILÖ RELATIVOS A SU PROYECTO CONTABILIDAD QUE ACABAN CON LA DECISIÓN POR PARTE DEL COMISARIADO DE LA EXPULSIÓN DE CORPORACIÓN BACILÖ.


SOLICITUD DE INFORMACIÓN Nº01 ENVIADA A CORPORACIÓN BACILÖ EL 20/08/2010 proyecto ... From: Yolanda Riquelme <yolandariquelme@manifesta8.es> ... View Contact To: corporación bacilö <corporacionbacilo@yahoo.com.au> Hola, Me pongo en contacto con vosotros de nuevo con motivo de la acción que plantearéis dentro del proyecto MoCHA Sessions, desde vuestro último e-mail y la conversación que tuvimos ayer he estado planteándome todo el tiempo si realmente puedo trabajar con vosotros sin tener esta información, finalmente tengo que comunicaros que realmente me supone un problema a nivel profesional el no conocer el trabajo que desarrollaréis dentro de un proyecto que está involucrando también mi trabajo como comisaria, un trabajo que entiendo como un diálogo y una colaboración entre ambas partes. Ya le comenté a Claudio que para nada pretendo ser intervencionista con vuestro proyecto y que os respeto como artistas, es por esto por lo que me ha interesado mucho desde el principio que participarais en MoCHA Sessions, pero entiendo también que el respeto hacia mi trabajo involucra esté diálogo y transmisión de información, por otra parte necesaria para seguir adelante con las diferentes fases del proyecto. Esta es la manera en la que he trabajado siempre y la manera en que considero que se debe funcionar para tener un desarrollo profesional y serio de un trabajo. Esta tarde he tenido una reunión con Bassam el Baroni, comisario de ACAF, y Esther Regueira, coordinadora general, para revisar el proyecto del MoCHA y sinceramente me ha resultado muy poco profesional el no poder dar información acerca del trabajo de unos de los artistas que estamos invitando a participar en el marco de un proyecto que en cualquier caso estamos elaborando todos juntos. Me gustaría por tanto volver a pediros que consideréis este tema ya que creo que es importante para que todos podamos realizar nuestro trabajo lo mejor posible. Por último me gustaría volver a aclarar que en este mail no hay involucrado en absoluto ningún aspecto personal, os escribo esto precisamente porque se trata de un tema estrictamente profesional que supone un impedimento para desarrollar un buen trabajo tal como lo entiendo. Espero que podamos seguir hablando, Un saludo, Yolanda Yolanda Riquelme Asistente de comisariado Manifesta 8 Manifesta 8, la Bienal Europea de Arte Contemporáneo Región de Murcia en diálogo con el Norte de África 9 de octubre 2010 - 9 de enero 2011 http://www.manifesta8.es


RESPUESTA DE CORPORACIÓN BACILO A LA SOLICITUD Nº01 Y DOCUMENTO ADJUNTO ENVIADO EL 31/08/2010 CONTABILIDAD contexto y descripción ... From: corporación bacilö <corporacionbacilo@yahoo.com.au> [Chat now] ... View Contact To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Cc: eurrutia bear37 <pedro.eurrutia@gmail.com>; Claudio Aldaz <clau_aldaz@yahoo.com>; bacilö <corporacionbacilo@yahoo.com.au>; NEGRO guirao <pedroguirao@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>; señor restado <laracraft@hotmail.com>... more CONTABILIDAD CONTXT.pdf (44KB) Estimada Yolanda, Como le habíamos anunciado en nuestro último correo, le remitimos el documento elaborado por la Corporación Bacilö que esperamos cubra la información demandada por ustedes respecto al proyecto Contabilidad. Se trata de una breve contextualización teórica así como una esquemática descripción de la materialización práctica de la idea en la que trabajamos desde el inicio. Asi mismo le agradeceríamos que cualquier duda o aclaración respecto a este documento y cualquier otra información relativa a aspectos concernientes a nuestro trabajo, nos sea solicitada siempre via mail. Esta manera de proceder es crucial para el amplio desarrollo del proyecto CONTABILIDAD como usted podrá emtender una vez leído el documento que le adjuntamos. Esperando la continuación de este fructífero diálogo, le saluda atentamente, CORPORACIÓN BACILÖ


Contexto Teórico y breve descripción de la propuesta de Corporación Bacilö, CONTABILIDAD, dentro del proyecto MoCHA Sessions de Manifesta8. En la producción de un proyecto artístico, desde la concepción de la idea hasta la presentación ante el público, el tiempo, esfuerzo y dedicación que corresponden estrictamente al aspecto creativo suponen, como mucho, el 50% del total de tiempo, esfuerzo y dedicación empleados por el artista en dicho proyecto. El otro 50% se emplea en, llamémoslo así, los asuntos burocráticos. Contratos, facturas, correspondencia, llamadas telefónicas, elaboración de documentos, textos e imágenes requeridos a efectos comunicativos y de difusión del evento, elaboración de presupuestos y necesidades técnicas, etc. Por supuesto hablamos de artistas y colectivos artísticos que no pertenecen al mainstream o, al menos, que no cuentan con un representante externo que se ocupe de todos estos asuntos (galería, manager,…). La buena gestión de estos asuntos burocráticos es fundamental, cualquier fallo, descuido o mal paso, repercuten directamente en el desarrollo y resultado final de la parte creativa, pudiendo incluso llegar a frustrarla. Pero es sólo ese 50% correspondiente al aspecto creativo el que finalmente se muestra al público. Todos los asuntos burocráticos necesarios para conseguir la visibilidad de cualquier trabajo artístico, se mantienen, sin embargo, invisibles. Atendiendo a esta realidad y a la importancia, prácticamente pareja, que el aspecto burocrático tiene en el desarrollo y producción de un proyecto artístico, Corporación Bacilö, decide alterar el orden de los factores: los asuntos burocráticos pasan a ser objeto artístico visible y público, mientras que el trabajo artístico se convierte en documento administrativo, privado y, por lo tanto, invisible. Esta inversión permite la visibilidad de lo que normalmente permanece invisible a los ojos del público y viceversa. Aquí se encuentra el nexo que relaciona nuestra propuesta con el proyecto MoCHA, el archivo, el documento, la memoria administrativa se convierten en objeto artístico, y el trabajo artístico propiamente dicho pasa a ser un mero documento burocrático. Por lo tanto CONTABILIDAD consta de dos partes: La primera es un trabajo que recopila toda la documentación generada en ese diálogo institución / artista durante toda la fase de producción. Dicha colección de documentos será exhibida encuadernada en forma de libro sobre una mesa de oficina en el espacio expositivo, disponible para su consulta y lectura. La segunda parte consiste en una acción privada y secreta que se desarrollará en un espacio no destinado a la exhibición de objetos artísticos y que generará como producto un documento que será entregado al comisario/a del proyecto MoCHA, en sobre cerrado, por un representante de Corporación Bacilö el día previsto para la acción. Corporación Bacilö


RESPUESTA DE EL ENTE CURATORIAL A TRAVÉS DE SU PORTAVOZ/SUBCOMISARIA YOLANDA RIQUELME SOLICITANDO MÁS INFORMACIÓN MÁS DETALLADA ENVIADO A CORPORACIÓN BACILÖ EL 01/09/2010 RE: CONTABILIDAD contexto y descripción ... From: Yolanda Riquelme <yolandariquelme@manifesta8.es> ... View Contact To: corporación bacilö <corporacionbacilo@yahoo.com.au> Cc: eurrutia bear37 <pedro.eurrutia@gmail.com>; Claudio Aldaz <clau_aldaz@yahoo.com>; NEGRO guirao <pedroguirao@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>; señor restado <laracraft@hotmail.com>; COMMENT ALLEZ VOUS? <in_direct_film@hotmail.com> Hola, Aprecio el envío del texto y vuestra disposición, sin embargo el texto que me enviáis al mismo tiempo que aclara parte de vuestro proyecto, desde mi punto de vista genera muchas dudas. Partiendo de la base de que sigo sin tener información de la acción que planteáis, lo cuál me sigue generando el mismo conflicto que cuando os escribí mi último mail, no entiendo cuál va a ser la visibilidad de la acción si ésta se desarrolla en otro lugar y la acción pública se reduce a la entrega de un sobre, por otra parte el hecho de que este sobre me sea entregado me hace de alguna manera partícipe y como comprenderéis, no voy a formar parte en una acción de la que no tengo información. Considero también que debería haber sido informada previamente de que pretendéis utilizar la correspondencia por mail que hemos mantenido durante todo este tiempo, en este caso no tanto por temas de contenido del proyecto sino por una cuestión básica de respeto. Ya os comenté en mi último mail que no puedo trabajar en las condiciones opacas que de alguna manera siento que se me han ido imponiendo, creo que yo he sido clara desde un primer momento con las condiciones que se os ofrecían para participar en este proyecto y creo que no habéis expresado desde un primer momento la premisa de mantener este secreto en el trabajo que plantearéis en este marco, un detalle que sólo quedó claro el día que Claudio vino a revisar vuestro contrato. Por una parte por supuesto respeto esa postura pero me parece fundamental que informéis de antemano de vuestras condiciones para que ambas partes puedan aceptar libremente y en conocimiento de todos los detalles el colaborar juntas, por mi parte, ya os he expresado que este detalle es decisivo para mi a la hora de plantearme una colaboración con vosotros, de nuevo porque no entiendo un trabajo conjunto si no hay un diálogo y una transmisión de información fluida. Todo esto os lo he comunicado ya a través de vuestros dos interlocutores, en cualquier caso, también quería que pudierais leerlo todos vosotros. Esta mañana he hablado con Pedro Eurrutia y hemos tratado todos estos puntos, espero que podamos dar un giro a esta colaboración y poder empezar a plantear una fluidez en este diálogo, Espero que no alarguemos más este asunto ya que en esta fase del proyecto necesito mover las cosas mucho más rápido, Un saludo, Yolanda


RESPUESTA DE CORPORACIÓN BACILÖ A LA SOLICITUD DE MÁS INFORMACIÓN MÁS DETALLADA RELATIVA AL PROYECTO CONTABILIDAD ENVIADO EL 02/09/2010 Re: CONTABILIDAD contexto y descripción ... From: corporación bacilö <corporacionbacilo@yahoo.com.au> [Chat now] ... View Contact To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Cc: eurrutia bear37 <pedro.eurrutia@gmail.com>; Claudio Aldaz <clau_aldaz@yahoo.com>; NEGRO guirao <pedroguirao@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>; señor restado <laracraft@hotmail.com>; COMMENT ALLEZ VOUS? <in_direct_film@hotmail.com> Estimada Yolanda, Sentimos mucho que el último documento enviado por Corporación Bacilö con la intención de esclarecer los aspectos confusos de nuestra propuesta para el proyecto MoCHA Sessions, no haya servido para tal fin. Aunque el fracaso en Bacilö es parte inherente en nuestras acciones y productos hasta el punto de convertirse en un término bipolar que los define (éxitofracaso Bacilö), también es una postura de Bacilö, dentro de su filosofía y modo de proceder habituales, el intentar por todos los medios a su alcance simpatizar, sincronizar, no suponer ninguna amenaza y conseguir la fluidez en la comunicación como interlocutores/ mediums ( “no huyan, somos sus amigos”)* *frase utilizada ampliamente por Bacilö en todas sus intervenciones públicas, grabaciones y textos, y que forma parte del Diccionario/Vademécum/Poemario de Bacilö Quizás, para facilitar este asunto, sería de enorme utilidad que usted nos comunicara, con toda exactitud y concreción, qué información y con qué nivel de detalle tendríamos que aportar para superar este obstáculo que dificulta nuestro diálogo. Anticipándonos a las preguntas específicas que usted formule y abundando en nuestra voluntad de ofrecer una información, cada vez más amplia y profunda, tanto del concepto como de la naturaleza y forma de nuestra propuesta y acción finales, le informo que estamos preparando para su envío dos documentos que le serán adjuntados en un nuevo correo el próximo martes día 7 de septiembre.(sabemos de la urgencia para aclarar estos asuntos. Pero como usted conoc, la complejidad que supone dentro de nuestra Corporación el que las decisiones deban ser consensuadas entre todos y cada uno de sus componentes, nos insta a solicitarle la concesión de ese plazo de 4 días máximo para remitirle la información lo más detallada posible)


Dichos documentos son: Una Descripción Administrativa Bacilö, documento que detalla esquemática y gráficamente los aspectos más objetivos tanto de la acción como de la propuesta general. ·La Partitura Bacilö de la acción a desarrollar dentro del proyecto CONTABILIDAD. Las Partituras Bacilö son documentos utilizados a nivel interno en todas las acciones de la Corporación, que tienen la función de servir de guión (pasos a seguir) durante la ejecución de dicha acción. Normalmente, estas Partituras Bacilö no se hacen públicas puesto que son consideradas una herramienta. Dichas Partituras suelen terminar de elaborarse pocos días antes de la acción. Por lo tanto, la Partitura de la acción de Corporación Bacilö dentro de su proyecto CONTABILIDAD, que le remitiremos el próximo martes, no debe considerarse como un documento cerrado y definitivo. Le enviaremos la Partitura en el estado en el que actualmente se encuentra, pero este documento seguirá transformándose y ampliándose en los sucesivos meses. Si usted así lo requiriera, Corporación Bacilö podría comprometerse a remitirle, desde este momento hasta su conclusión, las distintas modificaciones que dicho documento vaya experimentando. Con la aportación de estos nuevos documentos Corporación Bacilö le está ofreciendo toda la información de la que, hasta ahora, dispone relativa a la parte preformativa del proyecto CONTABILIDAD. Aún así, atenderemos todas aquellas preguntas que sean formuladas de una manera concreta y que ayuden a la comprensión de cualquier punto que aún permanezca indefinido. En un plazo mucho más breve, es decir antes del martes 7, le reenviaremos el texto contenido en su último mail con comentarios y respuestas incorporados a sus palabras y que esperamos, una vez más, que ayuden a la comprensión definitiva de nuestra manera de trabajar en éste y otros proyectos. Atentamente y Siempre Expectante, CORPORACIÓN BACILÖ


RESPUESTA Y APORTE DE DOCUMENTACIÓN DEFINITIVA DESCRIPCIÓN DETALLADA DEL PROYECTO ENVIADO A YOLANDA RIQUELME EL 07/09/2010 NUEVO APORTE INFORMATIVO ... From: corporación bacilö <corporacionbacilo@yahoo.com.au> [Chat now] ... View Contact To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; eurrutia bear37 <pedro.eurrutia@gmail. com>; Claudio Aldaz <clau_aldaz@yahoo.com>; bacilö <corporacionbacilo@yahoo.com.au>; NEGRO guirao <pedroguirao@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>... more CONTABILIDAD descrip admn.pdf (5978KB) Estimada Yolanda, Como le fué anunciado la semana pasada, Corporación Bacilö ha recopilado, de manera excepcional, en el documento que adjuntamos a este mail, TODA LA INFORMACIÓN de la que disponemos en este momento, lo más detallada y clara posible, relativa a la acción performativa en la que estamos trabajando incluida en nuestra propuesta CONTABILIDAD. Esperamos sinceramente que este nuevo aporte satisfaga su demanda y complete el vacío comunicativo, impulsando definitivamente la continuidad de este proyecto. Como en el mismo documento está explicado, no poseemos más detalles que los que en este momento le enviamos. Nuestra propuesta, como en el resto de trabajos de Bacilö, sigue en proceso de revisión, transformación y ampliación hasta el mismo día en el que se hace efectiva, por lo que es natural que la información que ahora ofrecemos sufra sutiles cambios en los días venideros. Por esta misma lógica de continuum work in progress, y respondiendo a su comentario en el último mail recibido, “...creo que yo he sido clara desde un primer momento con las condiciones que se os ofrecían para participar en este proyecto y creo que no habéis expresado desde un primer momento la premisa de mantener este secreto en el trabajo que plantearéis en este marco, un detalle que sólo quedó claro el día que Claudio vino a revisar vuestro contrato.” es natural que la información al inicio del proyecto fuese más escueta e indefinida que ahora, como será más amplia y detallada conforme avanca el tiempo. Si Ud. así lo desea, Corporación Bacilö se compromete a enviarle en los días que siguen hasta la fecha de presentación de la propuesta CONTABILIDAD un reporte informativo (en formato similar al actual documento adjunto), cada vez que el trabajo sufra ampliaciones y modificaciones sustanciales. Para su tranquilidad, a estas alturas del proceso, las líneas más determinantes de nuestra propuesta están bastante fijadas. La natural evolución sólo producirá básicamente mayor nivel de detalle en dichas líneas y no giros drásticos. Como siempre le invitamos a que siga comunicándonos vía mail cualquier duda respecto a este trabajo de la forma más concreta posible. Corporación Bacilö responderá igualmente de la manera más concreta y detallada posible. Esperando sus opiniones, Le saluda atentamente, CORPORACIÓN BACILÖ


RESPUESTA DE YOLANDA RIQUELME AL ÚLTIMO APORTE INFORMATIVO ENVIADO POR CORPORACIÓN BACILÖ DONDE SE DECIDE EXCLUIRLOS DEL PROYECTO MOCHA SESSIONS RECIBIDO EL 09/09/2010 RE: NUEVO APORTE INFORMATIVO ... From: Yolanda Riquelme <yolandariquelme@manifesta8.es> ... View Contact To: corporación bacilö <corporacionbacilo@yahoo.com.au>; eurrutia bear37 <pedro.eurrutia@gmail. com>; Claudio Aldaz <clau_aldaz@yahoo.com>; NEGRO guirao <pedroguirao@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>; señor restado <laracraft@hotmail.com>... more Estimados Corporación Bacilö, Siguiendo vuestras indicaciones, paso a transmitiros por mail mis comentarios con respecto a la última comunicación que hemos mantenido. Para empezar me gustaría volver a aclarar que la bienal Manifesta funciona en base a un sistema de trabajo que estructura el desarrollo de los proyectos artísticos de una manera operativa, funcionamos así con todos los artistas participantes. Esta estructura de trabajo y las condiciones del mismo han sido comunicadas desde un principio muy claramente y la aceptación de esta participación por vuestra parte ha sido totalmente libre. He sido totalmente transparente desde un primer momento con este aspecto y en ningún momento pretendemos forzar a nadie a trabajar en unas condiciones económicas o de desgaste energético con las que el artista no se sienta cómodo, así que, a pesar de que la elección de participación en el proyecto se haya realizado de manera libre y consciente por vuestra parte, siento que hayáis tenido inconvenientes con el desarrollo de esta colaboración, lo cual queda reflejado en la comunicación que hemos mantenido durante este tiempo y en el proyecto que planteáis. La información que enviáis sobre vuestro trabajo llega en una fase del proyecto demasiado avanzada y, como bien apuntáis, tras largas negociaciones que han ocupado vuestro tiempo por supuesto, pero también una gran parte de mi tiempo de trabajo, un tiempo que en este momento tengo que ocupar necesariamente en resolver aspectos de cara a la inauguración y la definición total de los proyectos de los que soy responsable. Como os he dicho en otras ocasiones, respeto y valoro vuestro trabajo y considero que representáis un papel significativo dentro del tejido artístico murciano, por este motivo he tenido interés de que participarais en este proyecto y he hecho todo lo posible por conseguir una comunicación fluida con vosotros, sin embargo considero que no hemos llegado a un punto en el que haya un entendimiento y un ambiente de trabajo en el que podamos funcionar cómoda y productivamente, disculpad pero ya os he dicho, no puedo permitirme ya el seguir alargando estas comunicaciones y negociaciones por lo que me veo obligada a prescindir de vuestra participación en el proyecto. Espero que en otro momento podamos tener las condiciones que favorezcan una colaboración. Un cordial saludo, Yolanda Riquelme Asistente de comisariado Manifesta 8 Manifesta 8, la Bienal Europea de Arte Contemporáneo Región de Murcia en diálogo con el Norte de África 9 de octubre 2010 - 9 de enero 2011 http://www.manifesta8.es


RESPUESTA A LA EXPULSIÓN DE CORPORACIÓN BACILÖ DEL PROYECTO MOCHA SESSIONS ENVIADA EL 13/09/2010 Respuesta a la exclusión de Bacilö del proyecto MoCHA ... From: corporación bacilö <corporacionbacilo@yahoo.com.au> [Chat now] ... View Contact To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; bacilö <corporacionbacilo@yahoo.com.au> Cc: fernandolopez@manifesta.org; press@manifesta8.es COMUNICADO respuesta a la eliminación de Bacilö del proyecto MoCHA.pdf (26KB) Estimada Yolanda Riquelme, Le adjuntamos la carta que Corporación Bacilö ha redactado como respuesta a su reciente decisión de prescindir de nuestra participación en el proyecto MoCHA. Permítanos que dicho documento también lo remitamos a otros responsables del equipo organizador de Manifesta 8, puesto que consideramos que tanto la responsabilidad de dicha decisión como algunos de los contenidos de nuestra respuesta atañen de alguna manera a esras otras personas o departamentos, impulsados únicamente por una clara voluntad comunicativa. Reciba un cordial saludo, CORPORACIÓN BACILÖ


Murcia 12 de Septiembre de 2010 Estimada Yolanda Riquelme, Desde Corporación Bacilö no podemos ocultar la sorpresa que su última comunicación nos ha producido. También nos ha sorprendido con la celeridad en que se ha hecho efectiva su decisión de eliminarnos de la ecuación al ver que tanto el nombre de Corporación Bacilö como la información sobre nuestro proyecto para MoCHA ha desaparecido de la página web de Manifesta 8. Dado que los argumentos que siempre ha utilizado en los últimos correos que nos ha dirigido cuestionaban la profesionalidad en nuestra manera de proceder, intentaremos estructurar una crítica constructiva y detallada relativa a lo que, según nuestra modesta e independiente opinión, constituye un episodio y un ejemplo más de la dudosa profesionalidad con la que procede la Institución a la que usted representa. Empezando por el final, una decisión de tamaña magnitud, no puede ejecutarse así sin más y de una manera unilateral. Por que si esto es así, el mensaje que transmite es que cualquier expresión artística que en su proceso, en su fondo o en su forma, suponga dificultad o conflicto para la comodidad o los intereses del Aparato Organizador puede, con total impunidad, ser desprogramada en cualquier momento. Y esto no deja de ser, aunque a algunos les moleste la denominación, una censura encubierta y parapetada tras imprecisas justificaciones de desacuerdo. Ninguno de los motivos que usted presenta como detonadores de tal decisión están convenientemente documentados y explicados. Suponemos que, si usted ejerce su trabajo desde una perspectiva estrictamente profesional, podrá ilustrarnos dichos motivos debidamente con documentos y explicaciones claros y concisos. Si esto no es así se corre el riesgo de que lo interpretemos, nosotros y el ciudadano (del cual proviene en última instancia el dinero y las infraestructuras que usted maneja), como un acto de arbitrariedad que impone los intereses personales sobre los profesionales. Por nuestra parte, pese a unos inicios ambiguos y confusos en cuanto a la claridad o transparencia de nuestra propuesta, los últimos documentos que le han sido remitidos aportan toda la información que hasta el momento se nos había demandado, con niveles de detalle formal y conceptual totalmente clarificadores. Nuestra voluntad de comunicación para con usted ha sido tal que hemos accedido a desvelar el contenido de una parte que, como ya le justificamos, era fundamental mantener en secreto. Hemos pues cedido incluso en demandas que para nosotros han supuesto una pequeña traición a nuestros postulados teóricos y que por supuesto han cercenado la dimensión de los mismos. No podemos pues admitir de ninguna manera que después de todo esto se nos siga reprochando la falta de claridad acusados de poner obstáculos en la comunicación. Siguiendo ahora con cuestiones prácticas. En toda relación profesional, cuando ambas partes acuerdan una colaboración, el siguiente paso necesario para el comienzo del trabajo es la firma del contrato. Las cláusulas contenidas en dicho contrato pueden ser discutidas, modificadas o ampliadas hasta conseguir el modelo definitivo. Esta forma profesional de proceder asegura a ambas partes el cumplimiento tanto de deberes como de obligaciones, y es un documento que en caso de incumplimiento de


cualquiera de sus puntos tiene la validez legal necesaria que permite la ruptura del acuerdo. La elaboración y firma del contrato es algo que Corporación Bacilö ha exigido desde el inicio, sin embargo, aún a estas alturas, sigue sin haberse hecho efectivo. Sin este documento acordado y firmado hemos seguido trabajando durante 4 meses sin ninguna idea de las condiciones reales (sólo verbales) de esta colaboración, totalmente desprovistos de la legalidad que debe prevalecer en cualquier actividad profesional. Más grave es aún cuando la parte contratante es una Institución que maneja infraestructuras y fondos públicos. Por lo tanto cuando usted dice: “Manifesta funciona en base a un sistema de trabajo que estructura el desarrollo de los proyectos artísticos de una manera operativa…”

Entendemos que lo que usted califica como manera operativa no contempla en ningún momento la firma de un contrato o, cuando no existe ningún documento donde se hayan determinado unos plazos concretos para la definición de los proyectos, comprenderá que valoremos como contradictorias sus palabras: “La información que enviáis sobre vuestro trabajo llega en una fase del proyecto demasiado avanzada...”

Por último, sin querer ocupar más de ese preciado tiempo del que usted no dispone para este tipo de apreciaciones relativas a la profesionalidad en la práctica artística, y como un ejemplo más de las paradojas, contradicciones e incluso hipocresía a las que tristemente nos tiene acostumbrados el sistema del arte, transcribimos la información pública que ACAF, al que usted representa, asiste y depende, ha redactado describiendo la línea conceptual de su propuesta curatorial: Alexandria Contemporary Arts Forum se centra en el cultivo de una mayor concienciación del arte en relación a todos los aspectos de la vida y la cultura contemporáneas. Entre las propuestas de ACAF para Manifesta 8 se encuentra The Backbench Project. Inspirado en el Parlamento Británico, el término Backbench hace referencia a aquellos políticos que, a pesar de no estar en primera línea, también pueden aportar soluciones. Cuatro colectivos artísticos (con miembros procedentes de Egipto, India, Italia, Holanda y Estados Unidos) y dos moderadores establecerán una discusión a partir de la que intentarán plantear soluciones a diferentes problemáticas del arte actual, y en especial a las demandas para llevar a cabo una crítica de modo espectacular. Este debate, celebrado en un escenario construido para la ocasión en el Centro Párraga de Murcia, será reproducido en la antigua Oficina de Correos y Telégrafos y constituirá la base de una instalación fílmica. En otra sede, ACAF mostrará nuevos trabajos de varios artistas residentes en Murcia realizados en reacción a los documentos y ficheros importados de los archivos del Museo de Arte Hispánico Contemporáneo de Nueva York (MoCHA), que cerró en la década de los 90. Al mismo tiempo, en Cartagena, el artista egipcio Mahmoud Khaled presentará una performance en la que un actor representará el papel de un artista contemporáneo arquetípico, un profesional que vive en un mundo precario, sin hogar, aunque equipado de su ordenador portátil y su I-Phone.


Jeremy Beaudry (Alexandria Contemporary Arts Forum)Reckoning with Unknown

Knowns:a brief for Manifesta PLATFORM FOR (UN)SOLICITED RESEARCH AND ADVICE

The development of ACAF’s curatorial contribution to Manifesta 8 begins with a quest to identify the ‘unknown knowns’ of the contemporary art system. What do we believe, but don’t know we believe, about contemporary art and curating? And what about politics, human geographies or histories, and the communication of cultural difference through today’s culture infrastructure? What codification occurs along the points where the mundane details of everyday life meet with the industries of politics and culture? Art appropriated as a tool for a social and political agenda has inhibited us in locating the deep beliefs and knowledge that we are not fully aware of, but which we harbour in our collective unconscious. It is time to begin understanding this collective unconscious of art and locate what might be the actual problems at hand, or even better, what could even offer some solutions. The Theory of Applied Enigmatics is rooted in an analysis of the condition of art today, and from there looks to operate as a kind of cultural algorithm, leading us towards some resolutions for the questions above. Through its application, the theory should lead towards the emergence of a multi-layered and complex project that while remaining part of what we call the ‘art system’ makes a route to its goal without using most of the widely accepted or highly criticized paths to a ‘successful project’.

Estando irónicamente muy próximos en nuestro proyecto a la línea conceptual y a las reflexiones que propone el mismo colectivo de comisarios que nos ha rechazado, e independientemente de lo que nos depare el futuro más próximo, le informamos que Corporación Bacilö, impulsados por un personal ejercicio de ética artística y profesional, seguirá trabajando en este proyecto para revelar esos aspectos mundanos y habitualmente ocultos de lo que se da en llamar “el sistema del arte”, con la voluntad de ayudar a comprender que existe una necesidad urgente de cambio, regulación y actualización en las dinámicas de las estructuras culturales, así como por una cuestión de respeto y valoración al esfuerzo y el tiempo empleados en el desarrollo de esta idea. Para nosotros las condiciones en las que hasta ahora hemos funcionado no han variado ni económica ni estructuralmente. Sea de una manera oficial, amparado por la Institución Cultural, o extraoficial, de manera independiente, autogestionada y autofinanciada, el proyecto CONTABILIDAD sigue su curso y será presentado en las fechas previstas. Sin nada más que añadir, con esta respuesta a su último correo, damos por finalizada cualquier futura comunicación con usted, a no ser que hubiera una rectificación en su decisión. Si tal rectificación no se produjese le invitamos a que la eliminación de Corporación Bacilö y su proyecto CONTABILIDAD del proyecto MoCHA se haga pública a través de una nota informativa en la página web de Manifesta 8 y de los medios de comunicación que sí emplearon ampliamente cuando anunciaron su participación. Suponiendo su más que previsible negativa a efectuar este gesto de coherencia profesional, corresponderá entonces a Corporación Bacilö tal tarea, al mismo tiempo que el Ente Institucional Cultural demostrará una vez más que los medios de comunicación le interesan más como aparato para la Propaganda que como herramienta informativa.. Atentamente le saluda y se despide, CORPORACIÓN BACILÖ


EX-MANIFESTA EX-MOCHA SESSIONS NUEVA DIMENSIÓN TRAS LA EXPULSIÓN LAS CONSECUENCIAS DE BACILÖ ACCIONES LEGALES_EL CAMINO DEL DOLOR SILENCIO INSTITUCIONAL REPERCUSIÓN EN LOS MEDIOS PRESENTACIÓN DEL LIBRO/ARCHIVO CONTABILIDAD (VERSIÓN DEMO ABIERTA)


acción/consecuencia nº1

REPARTO DEL COMUNICADO PÚBLICO REDACTADO POR CORPORACIÓN BACILÖ QUE INFORMA SOBRE SU EXPULSIÓN DEL PROYECTO MOCHA SESSIONS. REALIZADO EN LA ENTRADA DEL ESPACIO AV DE MURCIA, SEDE DEL PROYECTO MOCHA SESSIONS EL 07/10/2010 (INAUGURACIÓN OFICIAL DE MANIFESTA 8 PARA PRENSA Y PROFESIONALES.


YOLANDA RIQUELME. CO-COMISARIA DEL PROYECTO MOCHA SESSIONS Y ASISTENTE DEL EQUIPO DE COMISARIOS ACAF

Estimada Yolanda Riquelme, Desde Corporación Bacilö no podemos ocultar la sorpresa que su última comunicación nos ha producido. También nos ha sorprendido con la celeridad en que se ha hecho efectiva su decisión de eliminarnos de la ecuación al ver que tanto el nombre de Corporación Bacilö como la información sobre nuestro proyecto para MoCHA ha desaparecido de la página web de Manifesta 8.


acción/consecuencia nº2

COMIENZAN LAS ACCIONES LEGALES CON LA INTENCIÓN DE LLEGAR A UN ENTENDIMIENTO AMISTOSO

Por fin EL BUROFAX

bacilö

ganza foñúh,o´pirt

venga

ven

Murcia, 13-10-2010 FUNDACIÓN MANIFESTA 8 Sra. Directora General Centro Párraga

C/ Elisea Oliver, s/n Murcia 30.002

N / Ref. Carp. S / Ref.: Estimados Sres.: Mi

cliente,

“Asociación

cultural

Caarl

(Corporación Bacilo)”, me ha hecho entrega de la documentación necesaria para proceder judicialmente frente a Vds., en reclamación de las cantidades que les corresponden al amparo del contrato suscrito verbalmente por ambas partes en fecha 19 de agosto de 2010 –del que existe un borrador por escrito remitido por Vds.-, y previas las negociaciones existentes desde el mes de mayo de 2010. A la cantidad pactada se le adicionará el importe de los daños y perjuicios causados, toda vez que “Asociación Caarl” ha desarrollado íntegramente el trabajo pactado, y lo ha puesto a su disposición a su entera satisfacción, conforme a las condiciones técnicas y artísticas puestas de manifiesto por las dos partes, habiendo asumido los gastos que el trabajo conlleva. El intercambio de emails acredita la existencia del vínculo contractual. En estos correos electrónicos se plasma la existencia de actos preparatorios del trabajo realizado y las matizaciones que Vds. realizaban según la evolución del proyecto. De igual modo consta por escrito su aceptación de las condiciones económicas y técnicas del trabajo


realizado. La acción cultural a desarrollar ha sido incluida en su catálogo oficial del MANFESTA 8. En todo caso se habría producido un uso manifiestamente irregular de la imagen de mis clientes susceptible de reclamación por daños y perjuicios. Y antes de dar estado judicial al asunto, y en evitación de mayores gastos y molestias, y por si existe algún error en la apreciación de los hechos, le brindo la posibilidad de solucionar amistosamente el asunto, para lo que esperamos sus noticias hasta el próximo día 25 de octubre de 2010, en el bien entendido de que transcurrida dicha fecha sin sus noticias, sin nuevos avisos, procederé conforme a las instrucciones recibidas. Sin otro particular, les saluda atentamente.

Jurista de la Corporación Bacilö

respuesta: SILENCIO INSTITUCIONAL


acción/consecuencia nº3

ENSAYOS PARA UNA CARTA AL DIRECTOR DIRIGIDA A LOS MEDIOS DE COMUNICACIÓN ESCRITA (NO ENVIADA FINALMENTE)

ensayo nº1

������������ ���� ������������������������������������������������������������������������� ���������������������������������������������� ��������������������������� ����!����������������"��������#���������������������������$���������� �������������������������������%������������������������������������� ����� ������������������������������������������������������������&���������� �������������'����������������������������������$������������������������� �(�

)��������������������������������������$������������������������������������� ���������'������������������&��*++,������������������������������������������ �������������������������������(� ���'��������&������������������������������ �����������������������������������������������������������������������-������ ��$��������������������������������$���������������.��������������� �����������������/�����(� �������������������������0����������.����������*++1� -��������'�����������'����������������������������������$�(����.�������� ���������-��������'����'���������������������������������������( �-��������������������������������'������-������������������������&��(���� '���������������������������������������������������������������������������� '�����������������������������.���������-�������������������������������������� ���������'�������.������������������ ����������������������������������������� ��������������������������������������������������������.����� ������������������.���������������������������������������$����������������� ����������������������������������������(��������������������������2'�3�$���� ���������-���������������������������������������3��������������������� ���� ��������4 5����������������������������������������������������������"�������$����������� �������������������6�-���'����������������������������������'���������� .������������$�����������������3�����������3�������'�������������������� ������������(�����������������������$��������������������������������������� ��������������������������$���������$������������� ���&���� ������������ ������������������������3���������������������$����������������������������� �����������������������������.������������������ ����������������������������� ����� ��������������������������������������������(�7������'�������������� ��������8������9���������������.������������������( :�����������������������������������3�������$�"�'����������� ������������� ����-�(� �������������������������� ���������������������������������� ���������������������������������������������������3�����.������������������ �������������(��������������������������.������������� �����������������$������� �����������������������$��%����;����������"�����������������������$�������������� ���������������������������������������������$���0�������������� ��"�������������.�������������������������������������������(�2:����������� �����$��������������������3��-�����������������4��2����'�3������������� ������.�����������$�������-��������������������������4(�<����������������'���� �����������������������������������%����;��������.��������������������0������ '����������������������������������������������������������������������0������� ���.��������������������������$�(��-����$������������������� �������������%����;(


ensayo nº2 El proyecto Contabilidad de Corporación Bacilö, es expulsado de Manifiesta 8, sin razón aparente. La organización de Manifiesta 8, la bienal europea de arte contemporáneo región de Murcia (España) en dialogo con el norte de África se ha vista en bien en expulsar y/o eliminar, a pocas fechas de la inauguración del evento, la producción de uno de los colectivos que formaban parte del proyecto MOCHA. En principio la organización del evento, por medio de su equipo curatorial, no han dado ninguna razón que justifique esta decisión, por lo que desde el colectivo expulsado vemos claros tintes de censura, siempre y cuando ello no sea desmentido, o bien justificado de una forma clara y convincente, tanto al colectivo como a la sociedad en general y a la murciana en particular por ser esta la que acoge dicho evento. En principio, el evento Manifiesta 8 se puso en contacto con la corporación bacilo para incluirlo en su programación, por el interés del equipo curatorial del proyecto MOCHA hacia el trabajo de bacilo. Se llego a un acuerdo verbal, siempre en espera de rubricar un contrato oficial que estaba en eterna preparación, mientras la burocracia continuaba su lánguida andadura, Corporación Bacilö comenzaba a trabajar en el proyecto, de todo esto se cumplen ahora 4 meses aproximadamente. 4 meses en los que el contrato no ha llegado, 4 meses en los que Manifiesta 8 no ha concretado en ningún momento datos tan importantes como la dotación económica para financiar la producción del proyecto, 4 meses de eternas reuniones y largos trámites burocráticos, 4 meses de eternas exigencias por parte de la organización del evento hacia la Corporación Bacilö y hacia el proyecto, en realidad, 4 meses de trabajo de un colectivo y de las personas que lo componen truncado sin ninguna razón aparente, no sabemos si por exigencias de fuerzas mayores, superiores al equipo curatorial o por el mero capricho de alguna persona del equipo curatorial, pero independientemente del autor de esa decisión, esta misma constituye un episodio y un ejemplo más de atropello e indefensión del artista frente a los continuos abusos de poder, la hipocresía y la volatilidad conceptual del Ente Institucional Cultural. Pensamos desde Corporación Bacilö que una decisión de tamaña magnitud, no puede ejecutarse así sin más de una manera unilateral. Porque si esto es así, el mensaje que transmite es que cualquier expresión artística que en su proceso, en su fondo o en su forma, suponga dificultad o conflicto para la comodidad o los intereses del Aparato Organizador puede, con total impunidad, ser desprogramada en cualquier momento. Y esto no deja de ser, aunque a algunos les moleste la denominación, una censura encubierta y parapetada tras justificaciones de desacuerdo. Corporación Bacilö pidió una disculpa pública tras este desagradable hecho, al igual que anunciaron públicamente la participación de corporación bacilo, utilizando su nombre y elementos plásticos de su proyecto tanto en medios de comunicación como es la web oficial del evento, esto no se ha producido, así que corporación Bacilö ha decidido mover ficha. Corporación Bacilö informa que continuará trabajando en este proyecto, puesto que para nosotros las condiciones en las que hasta ahora hemos funcionado no han variado ni económica ni estructuralmente. Sea de una manera oficial amparado por la Institución Cultural o extraoficial de manera independiente, autogestionada y autofinanciada, el proyecto CONTABILIDAD sigue su curso y será presentado en las fechas previstas. Es simplemente una cuestión de respeto y valoración al esfuerzo y el tiempo que hemos empleado en esta idea. Así mismo, informamos que en breve Corporación Bacilö tomara medidas legales contra Manifiesta 8, pues contamos con toda la documentación que corrobora esta situación ante la que nos encontramos y podemos demostrar que ha existido una relación contractual entre las dos partes. Para más información rogamos consulten blog, web, se pongan en contacto con nosotros, etc.


ensayo nº3 Manifesta 8 impone su propia reforma laboral El macroevento artístico Manifesta 8, coincidiendo con la aprobación del gobierno de su reforma laboral ha convenido llevar a efecto su propia reforma laboral, empujando a los artistas que han tomado parte en su programación a aceptar condiciones laborales que se alejan mucho de las condiciones de los trabajadores de cualquier rama profesional. Con esta carta Corporación Bacilö no pretende sino dar un poco de luz a todo lo acontecido en la relación artista-evento, no solo en nuestro caso, que consideramos de la mayor aberración posible, sino en relación a todos los artistas o colectivos que han tomado parte en esta ecuación laboral. Manifesta 8 ha empujado a los profesionales del arte a aceptar condiciones de trabajo que se asemejan más a una relación laboral punible en cualquier campo que a la relación que debe reinar en un estado de derecho como en el que nos encontramos. No con ello decimos que los artistas y/o colectivos acepten estas condiciones voluntariamente y luego se quejen por ello, sino que Manifesta 8 ha engañado reiteradamente con total impunidad a los artistas, dando largas sobre las condiciones de trabajo, posponiendo la firma de contratos, evitando en todo momento mentar el tema de asignaciones económicas de producción, etc. etc. Mientras tanto Manifesta 8 exigía a los artistas que cumpliesen los plazos de presentación de los proyectos a realizar, presentación de las necesidades técnicas de estos proyectos, que cumpliesen plazos y que materializasen los proyectos con las condiciones prometidas en primera instancia, aunque estas condiciones eran recortadas paulatinamente y las exigencias eran incrementadas de igual forma. Entre tanto, el artista seguía esperando el borrador del contrato y con ello seguía perdiendo derechos laborales, pues su trabajo, en algunos casos ya acabado, debería ser modificado en el momento en que llegasen las ultimas condiciones y/o restricciones que Manifesta 8 creía necesarias. Corporación Bacilö ha sido uno de estos colectivos artísticos de los cuales Manifesta 8 se ha reído, llegando al punto de ser excluidos de la programación de este evento tras 4 meses de trabajo, 4 meses de trabajo en los que 5 personas de este colectivo han invertido tiempo y dinero de sus propios bolsillos para llevar a cabo un proyecto y materializar parte de este, mientras, seguíamos esperando noticias de un contrato que nunca llego y Manifesta 8 seguia iba incrementando las exigencias para con el proyecto que Corporación Bacilo seguía desarrollando. Desde Corporación Bacilö creemos que esto es un abuso en toda regla, pues los artistas y/o colectivos tenemos o deberíamos tener los mismos derechos laborales que cualquier otro profesional, y más cuando estos eventos artísticos están respaldados por las administraciones públicas, que deberían guardar el mayor celo posible para que estas circunstancias de ilegalidad laboral no se puedan llevar a cabo desde sus propias instancias. Esto es solo la punta de iceberg, pues Corporación Bacilö debe seguir denunciando irregularidades ante el trato dado por Manifesta 8 para con nosotros, pues incluso tras ser excluidos de la programación del evento, Manifesta 8 ha hecho uso fraudulento, para su propio beneficio, de imágenes, logotipos, textos y demás documentación propiedad de Corporación Bacilö sin nuestro consentimiento. Esperamos con esta carta poner en conocimiento del público las condiciones laborales de total irregularidad a las que se ven avocados los artistas y/o colectivos creadores de las obras que podemos ver en cualquier evento público por la total impunidad con que cuentan sus organizadores.


acción/consecuencia nº4 DIALOGANDO CON UN GIGANTE MUDO E INVISIBLE

SE COMIENZAN A PUBLICAR DOCUMENTOS ANTERIORES Y NUEVOS ARTÍCULOS RELATIVOS AL PROYECTO CONTABILIDAD EN EL BLOG DE CORPORACIÓN BACILÖ DURANTE EL MES DE OCTUBRE LAS VISITAS AL BLOG CRECEN CORPORACIÓN BACILÖ DIFUNDE LAS NOTICIAS A TRAVÉS DE SUS AMIGOS/SIMPATIZANTES INTERNACIONALES. EL BLOG COMIENZA A RECIBIR VISITAS DESDE ESTADOS UNIDOS, ALEMANIA, RUSIA, REINO UNIDO, HOLANDA... ALGUNOS SITIOS ONLINE SE HACEN ECO DE LA NOTICIA


http://www.contraindicaciones.net/2010/10/exmanifesta8-comunicado-publico-de-corporacion-bacilo.html

http://esferapublica.org/infoesfera/?p=2388


acción/consecuencia nº5 DIALOGANDO CON UN GIGANTE MUDO E INVISIBLE 2ªPARTE

ANTE EL SILENCIO INSTITUCIONAL COMO ÚNICA REACCIÓN TANTO POR PARTE DE LA DIRECCIÓN/COORDINACIÓN DE MANIFESTA 8 COMO POR PARTE DEL EQUIPO DE COMISARIOS Y ASISTENTES DE COMISARIOS DE ACAF, RESPONSABLES DEL PROYECTO MOCHA SESSIONS, CORPORACIÓN BACILÖ DA EL SIGUIENTE PASO EN EL PROCESO DE ACCIONES LEGALES:

LA VÍA DE CONCILIACIÓN/ PASO INTERMEDIO Y PREVIO A LA DENUNCIA, DONDE SE VUELVE A INTENTAR UN ENTENDIMIENTO AMISTOSO BREVE RELACIÖN DE HECHOS

_Mediados de marzo de 2010, primeros contactos informales con la comisaria para MOCHA SESSIONS Yolanda Riquelme en la que la responsable propone a Pedro Guirao y Claudio Aldaz, socios de la asociación CAARL (en adelante Corporación Bacilö) participar en el proyecto sin poder exponer unas condiciones laborales definitivas. La oferta consiste en la participación de un colectivo con el mismo presupuesto concedido a un solo artista. Se rechazan estas condiciones y se solicita una mejora de las mismas por tratarse de un colectivo de 6 componentes. La participación de Corporación Bacilö queda supeditada a condiciones definitivas. _Inicio de abril de 2010, ante la premura por la confirmación de participación en el proyecto por parte de la comisaria, (que aún carece de una oferta definida) Corporación Bacilö emplaza a la representante de M8 a la concreción de unos mínimos económicos y a la comunicación de una fecha para la firma del contrato. A raíz de ello en reunión mantenida en fecha de 6 de abril se nos aseguran unos mínimos económicos y se nos informa de que la firma del contrato será inminente. Hasta este momento la comunicación se produce a través de reuniones y conversaciones telefónicas. A instancias de una solicitud de los miembros de Corporación Bacilö relacionada con la realización su proyecto y para dejar “constancia física” de la negociación, la comisaria se comunicará en adelante por escrito vía e-mail. El día 9 de abril tiene lugar el comienzo de la relación de correos electrónicos, la comisaria envía información relativa al proyecto dando por confirmada la participación de Corporación bacilö, hecho que no se produce hasta el día 20 de abril, fecha en que Corporación bacilö así lo expresa por correo electrónico. Siempre a la espera de las condiciones definitivas que son insistentemente solicitadas. _En correo electrónico del 30 de abril se informa por parte de la comisaria de la fecha de firma del contrato que será el 10 de mayo. Las condiciones económicas definitivas se posponen a la espera de ser aumentadas con la consecución de ayudas para el proyecto. _En mayo se nos presenta en la página web de manifesta como participantes y comienza la solicitud de material gráfico e información del colectivo por parte de Yolanda Riquelme y Manifesta 8.


Capturas tomadas de la página web de MANIFESTA8.

_De buena fe bacilö cumple con los plazos marcados por la comisaria para la entrega del material solicitado. _En el mes de julio se emite un programa del ciclo expositivo en el que se inserta la intervención de bacilö para el mes de enero. _El contrato llega finalmente en fecha 4 de agosto en el que la cantidad final es de 1.500€ (cantidad aún no definitiva). Tras varias revisiones y modificaciones basadas en el “Manual de Buenas Prácticas Artísticas”, suscitadas por diversas irregularidades que arrojaba el mismo, más la inclusión de un listado anexo de cláusulas por parte de la Corporación Bacilö, aceptables o denegables por MANIFESTA8 y expuestas en reunión con Yolanda Riquelme, comisaria, y Fernando López, director de producción, el martes 24 de agosto. Se entrega firmada copia de la supuesta versión definitiva del contrato a Yolanda Riquelme y Fernando López. En los días posteriores a esta última reunión, se nos solicita una ampliación informativa de nuestra intervención que es satisfecha en un dossier con una argumentación conceptual y expositiva del proyecto. _Tras un periodo de silencio institucional Corporación bacilö es expulsado el día 12 de septiembre, en una decisión unilateral por parte de MANIFESTA8, sin cobertura laboral alguna, sin contrato firmado, tras más de 4 meses de trabajo y viendo censurado nuestro trabajo.

RELACIÓN DE DOCUMENTOS ACREDITATIVOS

_Existe un documento firmado y sellado por M8 que consigna la recogida del material de trabajo relacionado con el proceso de trabajo. _Existe copia del contrato ofrecida por M8 que tras diversas revisiones y modificaciones más la inclusión de clausulas de la Corporación Bacilö, se entregó a MANIFESTA8. _Existe una relación de correo electrónico con la comisaria Yolanda Riquelme que acredita todos los hechos anteriormente expuestos. VÍA DE CONCILIACIÓN CORPORACIÓN BACILÖ

Dado que el aparato burocrático-legal de Asociación CAARL no se puede comparar con el de una institución como la Fundación MANIFESTA8 y FUNDACIÓN GENERAL MANIFESTA, optamos por la vía de conciliación como recurso legal para resolver el


conflicto con los responsables del proyecto MoCHA SESSIONS y FUNDACIÓN MANIFESTA, dejando patente una vez más las buenas intenciones de Corporación Bacilö por evitar mayores contratiempos en forma de proceso legal. Estimamos que se produce un abuso de poder por parte de la institución y sus mecanismos de la desesperación en el ofrecimiento de unas garantías o cobertura legal mínimas para el artista. Es por eso que demandamos justicia e instamos a MANIFESTA8 al resarcimiento y cumplimiento de los siguientes puntos: INDEMNIZACIÓN ECONÓMICA -Dado que el trabajo ha sido realizado, Asociación CAARL reclama a FUNDACIÓN MANIFESTA8 la cantidad mínima pactada en negociaciones previas verbalmente y bajo contrato Æ1500 € -BECA de manutención concedida por la O.C.A. cancelada por la expulsión del cicloÆ 1000 € -Uso inadecuado de nuestra imagen (en web hasta el 12 de septiembre, fecha de expulsión del colectivo, y catálogo) sin el correspondiente pago de derechos de propiedad intelectual (de imagen y de autor)Æ 3.000 € -Daños y perjuicios morales (abandono y rechazo de otros proyectos, precariedad laboral)Æ6.000 € Correspondientes a indemnización de cada uno de los 6 miembros de corporación bacilö participantes en esta acción. RECONOCIMIENTO / REPARACIÓN MORAL Æ Se pide a Manifesta que reconozca mediante documento firmado y sellado, y que así mismo haga público por los medios establecidos en el presente documento, los siguientes extremos que se han producido en la negociación con Corporación Bacilö para su intervención en MoCHA SESSIONS: _Reconocimiento de las irregularidades laborales en la relación mantenida con Corporación bacilö (5 meses a la espera de contrato, sin protección ni cobertura legal en la realización del trabajo que finalmente queda sin remunerar. _Reconocimiento del incumplimiento de fechas anunciadas por la organización en la firma de documentación que blindara nuestro proceso de trabajo. _Reconocimiento del incumplimiento de pacto verbal ejercido por sus representados, comisaria Yolanda Riquelme. _Reconocimiento de condiciones precarias de trabajo para este colectivo en particular. -Reconocimiento de la manera inadecuada y totalmente inaceptable de proceder y resolver la situación mediante la expulsión de Corporación Bacilö, totalmente desprotegida y a merced de la precariedad laboral ofrecida por M8. -Requerimiento de Manifestación pública de los puntos anteriores por parte de MANIFESTA 8 en los medios de comunicación, locales y nacionales, en los que M8 ha anunciado sus eventos y actividades. -Separata para el catálogo que a modo de fe de erratas informe del error de inclusión de Corporación Bacilö en dicha publicación. -Se requiere la destrucción por parte de M8 de todo el material que Corporación Bacilö haya facilitado a M8 en la presunción del buen término de esta relación laboral. -Se requiere una notificación pública de la CONTABILIDAD del proyecto MoCHA SESSIONS y de todos los gastos, directos e indirectos, que ha acarreado la exposición MoCHA SESSIONS (ya solicitadas como parte de nuestro proyecto) como gesto de transparencia.


acción/consecuencia nº6

CORPORACIÓN BACILÖ ENVÍA UNA NOTA INFORMATIVA CONVOCANDO UNA RUEDA DE PRENSA DONDE SE ANUNCIA LA PRESENTACIÓN DEL LIBRO CONTABILIDAD AL MISMO TIEMPO QUE SE INFORMA A LOS MEDIOS DE LA SITUACIÓN VIVIDA HASTA EL MOMENTO

La otra cara de MANIFESTA8: Nota de prensa por la expulsión unilateral de Corporación Bacilö ... From: corporación bacilö <corporacionbacilo@yahoo.com.au> [Chat now] ... View Contact To: info@progreso80.com; bacilö <corporacionbacilo@yahoo.com.au> Cc: aarco@laverdad.es; aparra@epi.es; artepalante@gmail.com; canal21@canal21.tv; carmencastelo@ ono.com; Cristina Carreres <ediciondigital@laopiniondemurcia.es>; cristínpisito <ccarreres@hotmail. com>; culturalaverdad <cultura@laverdad.es>; Cultural <cultural@laverdad.es>... more NOTA DE PRENSA.pdf (821KB) El jueves 16 a las 12h en sala PROGRESO 80 tendrá lugar una rueda de prensa convocada por el colectivo Corporación Bacilö en relación a su arbitraria e injustificada expulsión de la sección oficial de MANIFESTA8 en el ciclo MoCHA SESSIONS. Además se presentará el libro CONTABILIDAD (a las 12h y también a partir d las 20´30h)que este colectivo ha preparado continuando y concluyendo así el proyecto con el que fue invitado a participar por la propia organización de este MACRO-evento de coste millonario. Esta fundación internacional, además de ofrecer precariedad laboral a los artistas participantes (no así a la sección de comisarios/curators), hace oídos sordos a los intentos de entendimiento por nuestra parte, por lo que hemos optado por efectuar una demanda judicial que se presentará así mismo en la susodicha Rueda de Prensa. Nuestra intención con este llamamiento a los medios de comunicación es provocar un revuelo mediático con el que intentar llamar al orden (ante estos desmanes absolutistas y de censura) a una fundación (y una administración murciana que lo consiente) que supuestamente aboga por la independencia y autonomía del arte. Si estos hechos no resultan importantes para la sociedad, no por ello han de dejar de ser considerados como muy graves en lo referido al terreno laboral en pleno S.XXI. Instamos así mismo a MANIFESTA8 al reconocimiento de estos graves sucesos o a que al menos de su propia versión de lo acaecido en vez de ocultarse tras la máscara anónima que otorga la institucionalidad. Esperando que resulte resulte de su interés Corporación Bacilö


DOCUMENTO NOTA DE PRENSA CON DOCUMENTACIÃ&#x201C;N ANEXA ADJUNTO AL MAIL ENVIADO EL 13/12/2010

1RWDGHSUHQVDGH&RUSRUDFLµQ%DFLO¸HQUHIHUHQFLDDODH[SXOVLµQXQLODWHUDO SRUSDUWHGH0$1,)(67$GHOFLFORH[SRVLWLYR0R&+$6(66,216  /D&RUSRUDFLµQEDFLO¸TXHLQLFLDOPHQWHLEDDSDUWLFLSDUHQHOSUR\HFWR0R&+$6(66,216GH 0$1,)(67$ KD VLGR DSDUWDGD HQ XQD GHFLVLµQ XQLODWHUDO SRU SDUWH GH OD RUJDQL]DFLµQ GHO HYHQWRSRUXQFRQIOLFWRGHOTXHQRHVUHVSRQVDEOH7UDVXQDLQIUXFWXRVDQHJRFLDFLµQ TXHGXUµ P£V GH  PHVHV  HQ OD TXH VH UHLYLQGLFDEDQ XQDV PHMRUHV FRQGLFLRQHV JHQHUDOHV SDUD HO FROHFWLYR GH FUHDGRUHV TXH FRPSRQH &RUSRUDFLµQ EDFLO¸ DV¯ FRPR SDUD WRGRV ORV DUWLVWDV SDUWLFLSDQWHVHQHVWHPDFURHYHQWRFXOWXUDO  'HELGR D GLYHUVDV LUUHJXODULGDGHV  GXUDQWH HO SURFHVR GH FRQFHSFLµQ \ FRPLVDULDGR GH OD PXHVWUD &RUSRUDFLµQ EDFLO¸ GHFLGH HPSUHQGHU DFFLRQHV OHJDOHV FRQWUD 0$1,)(67$ UHFODPDQGR ORV GD³RV PRUDOHV \ SHUMXLFLRV HFRQµPLFRV SRU HO WUDEDMR UHDOL]DGR VLQ UHPXQHUDFLµQ DOJXQD GXUDQWH P£V GH  PHVHV 7DPEL«Q SRU HO XVR GH VX LPDJHQ VLQ DXWRUL]DFLµQ H[SUHVD GHO FROHFWLYR HVWDQGR LQFOXLGRV HQ VX ZHE GXUDQWH P£V GH  PHVHV \ ILQDOPHQWHWDPEL«QHQHOFDW£ORJRGHODELHQDO  (O SUR\HFWR &217$%,/,'$' LED D YHUVDU VREUH ಯOD SDUWH GH DWU£Vರ OR TXH QR VH YH GH XQD H[SRVLFLµQ QHJRFLDFLµQ GH FRQGLFLRQHV ILUPD GH FRQWUDWRV IDFLOLWDFLµQ GH PDWHULDO UHTXHULGR SDUDODUHDOL]DFLµQGHOHYHQWRಹ $KRUDGDGDVODVFLUFXQVWDQFLDVEDFLO¸GHFLGHKDEODUGHWRGR DTXHOORTXHTXHGDRFXOWRSDUDHOPHURHVSHFWDGRUHQWRGRORTXHDWD³DDHVWH0(*$HYHQWR FXOWXUDO

 LUUHJXODULGDGHVWDOHVFRPRODIDOWDGHFRQFUHFLµQGHFRQGLFLRQHVGHILQLWLYDVHFRQµPLFDV\GH WUDEDMR GHULYDFLµQ GH UHVSRQVDELOLGDGHV LQWHQWDQGR HYLWDU HO DFFHVR GLUHFWR GH &RUSRUDFLµQ EDFLO¸ FRQ OD DXWRULGDG HIHFWLYD HQ WRPD GH GHFLVLRQHV DXVHQFLD WRWDO GH SURIHVLRQDOLGDG \ UHVSHWRDOWUDEDMRUHDOL]DGRSRUHVWHFROHFWLYRGXUDQWHP£VGH PHVHVHQORVTXHQRVHKDQ FRQVHJXLGRREWHQHUXQDJDUDQW¯DHQIRUPDGHFRQWUDWRSRUSDUWHGH0\ILQDOPHQWHODWRPDGH GHFLVLµQXQLODWHUDOSRUSDUWHGHODFRFRPLVDULDGH0IDOWDQGRDORVP£VHOHPHQWDOHVSULQFLSLRV GH PRUDOLGDG \ GLJQLGDG ODERUDO DO H[SXOVDU D &RUSRUDFLµQ %DFLO¸ TXH KDE¯D VLGR DV¯ PLVPR LQYLWDGDDSDUWLFLSDUHQHVWHSUR\HFWRSRUODVXVRGLFKD&2FRPLVDULD

 


&21',&,21(6'(3$57,&,3$&,Â&#x2022;1 &RQGLFLRQHVRIUHFLGDVSRU0$1,)(67$D&RUSRUDFLµQ%DFLO¸SDUDSDUWLFLSDFLµQ HFRQµPLFDVà³¼SRUSUR\HFWR\RDUWLVWD à³¼HQFRQFHSWRGHUHPXQHUDFLµQXKRQRUDULRVà³¼HQ FRQFHSWRGHSURGXFFLµQ B2IUHFLPLHQWRGHODVPLVPDVFRQGLFLRQHVSDUDFROHFWLYR\DUWLVWDLQGLYLGXDOSDUDXQSUR\HFWRFRQXQ SURFHVRGHWUDEDMRP¯QLPRGHPHVHVGHGXUDFLµQ 

%5(9(5(/$&,Â&#x2DC;1'(+(&+26 B0HGLDGRVGHPDU]RGHSULPHURVFRQWDFWRVLQIRUPDOHVFRQODFRPLVDULDSDUD02&+$6(66,216 <RODQGD5LTXHOPHHQODTXHODUHVSRQVDEOHSURSRQHD3HGUR*XLUDR\&ODXGLR$OGD]VRFLRVGHOD DVRFLDFLµQ&$$5/ HQDGHODQWH&RUSRUDFLµQ%DFLO¸ SDUWLFLSDUHQHOSUR\HFWRVLQSRGHUH[SRQHUXQDV FRQGLFLRQHVODERUDOHVGHILQLWLYDV/DRIHUWDFRQVLVWHHQODSDUWLFLSDFLµQGHXQFROHFWLYRFRQHOPLVPR SUHVXSXHVWRFRQFHGLGRDXQVRORDUWLVWD6HUHFKD]DQHVWDVFRQGLFLRQHV\VHVROLFLWDXQDPHMRUDGHODV PLVPDVSRUWUDWDUVHGHXQFROHFWLYRGHFRPSRQHQWHV/DSDUWLFLSDFLµQGH&RUSRUDFLµQ%DFLO¸TXHGD VXSHGLWDGDDFRQGLFLRQHVGHILQLWLYDV B,QLFLRGHDEULOGHDQWHODSUHPXUDSRUODFRQILUPDFLµQGHSDUWLFLSDFLµQHQHOSUR\HFWRSRUSDUWHGHOD FRPLVDULD TXHD¼QFDUHFHGHXQDRIHUWDGHILQLGD &RUSRUDFLµQ%DFLO¸HPSOD]DDODUHSUHVHQWDQWHGH0 DODFRQFUHFLµQGHXQRVP¯QLPRVHFRQµPLFRV\DODFRPXQLFDFLµQGHXQDIHFKDSDUDODILUPDGHOFRQWUDWR $UD¯]GHHOORHQUHXQLµQPDQWHQLGDHQIHFKDGHGHDEULOVHQRVDVHJXUDQXQRVP¯QLPRVHFRQµPLFRV\ VHQRVLQIRUPDGHTXHODILUPDGHOFRQWUDWRVHU£LQPLQHQWH+DVWDHVWHPRPHQWRODFRPXQLFDFLµQVH SURGXFHDWUDY«VGHUHXQLRQHV\FRQYHUVDFLRQHVWHOHIµQLFDV$LQVWDQFLDVGHXQDVROLFLWXGGHORV PLHPEURVGH&RUSRUDFLµQ%DFLO¸UHODFLRQDGDFRQODUHDOL]DFLµQVXSUR\HFWR\SDUDGHMDUಯFRQVWDQFLD I¯VLFDರGHODQHJRFLDFLµQODFRPLVDULDVHFRPXQLFDU£HQDGHODQWHSRUHVFULWRY¯DHPDLO (OG¯DGHDEULOWLHQHOXJDUHOFRPLHQ]RGHODUHODFLµQGHFRUUHRVHOHFWUµQLFRVODFRPLVDULDHQY¯D LQIRUPDFLµQUHODWLYDDOSUR\HFWRGDQGRSRUFRQILUPDGDODSDUWLFLSDFLµQGH&RUSRUDFLµQEDFLO¸KHFKRTXH QRVHSURGXFHKDVWDHOG¯DGHDEULOIHFKDHQTXH&RUSRUDFLµQEDFLO¸DV¯ORH[SUHVDSRUFRUUHR HOHFWUµQLFR6LHPSUHDODHVSHUDGHODVFRQGLFLRQHVGHILQLWLYDVTXHVRQLQVLVWHQWHPHQWHVROLFLWDGDV B(QFRUUHRHOHFWUµQLFRGHOGHDEULOVHLQIRUPDSRUSDUWHGHODFRPLVDULDGHODIHFKDGHILUPDGHO FRQWUDWRTXHVHU£HOGHPD\R/DVFRQGLFLRQHVHFRQµPLFDVGHILQLWLYDVVHSRVSRQHQDODHVSHUDGHVHU DXPHQWDGDVFRQODFRQVHFXFLµQGHD\XGDVSDUDHOSUR\HFWR B(QPD\RVHQRVSUHVHQWDHQODS£JLQDZHEGHPDQLIHVWDFRPRSDUWLFLSDQWHV\FRPLHQ]DODVROLFLWXGGH PDWHULDOJU£ILFRHLQIRUPDFLµQGHOFROHFWLYRSRUSDUWHGH<RODQGD5LTXHOPH\0DQLIHVWD

B'HEXHQDIHEDFLO¸FXPSOHFRQORVSOD]RVPDUFDGRVSRUODFRPLVDULDSDUDODHQWUHJDGHO PDWHULDOVROLFLWDGR B(QHOPHVGHMXOLRVHHPLWHXQSURJUDPDGHOFLFORH[SRVLWLYRHQHOTXHVHLQVHUWDOD LQWHUYHQFLµQGHEDFLO¸SDUDHOPHVGHHQHUR B(OFRQWUDWROOHJDILQDOPHQWHHQIHFKDGHDJRVWRHQHOTXHODFDQWLGDGILQDOHVGH೼ FDQWLGDGD¼QQRGHILQLWLYD 7UDVYDULDVUHYLVLRQHV\PRGLILFDFLRQHVEDVDGDVHQHOಯ0DQXDOGH %XHQDV3U£FWLFDV$UW¯VWLFDVರVXVFLWDGDVSRUGLYHUVDVLUUHJXODULGDGHVTXHDUURMDEDHOPLVPR P£VODLQFOXVLµQGHXQOLVWDGRDQH[RGHFO£XVXODVSRUSDUWHGHOD&RUSRUDFLµQ%DFLO¸ DFHSWDEOHVRGHQHJDEOHVSRU0$1,)(67$\H[SXHVWDVHQUHXQLµQFRQ<RODQGD5LTXHOPH FRPLVDULD\)HUQDQGR/µSH]GLUHFWRUGHSURGXFFLµQHOPDUWHVGHDJRVWR6HHQWUHJD ILUPDGDFRSLDGHODVXSXHVWDYHUVLµQGHILQLWLYDGHOFRQWUDWRD<RODQGD5LTXHOPH\)HUQDQGR /µSH]


(QORVG¯DVSRVWHULRUHVDHVWD¼OWLPDUHXQLµQVHQRVVROLFLWDXQDDPSOLDFLµQLQIRUPDWLYDGH QXHVWUDLQWHUYHQFLµQTXHHVVDWLVIHFKDHQXQGRVVLHUFRQXQDDUJXPHQWDFLµQFRQFHSWXDO\ H[SRVLWLYDGHOSUR\HFWR B7UDVXQSHULRGRGHVLOHQFLRLQVWLWXFLRQDO&RUSRUDFLµQEDFLO¸HVH[SXOVDGRHOG¯DGH VHSWLHPEUHHQXQDGHFLVLµQXQLODWHUDOSRUSDUWHGH0$1,)(67$VLQFREHUWXUDODERUDODOJXQD VLQFRQWUDWRILUPDGRWUDVP£VGHPHVHVGHWUDEDMR\YLHQGRFHQVXUDGRQXHVWURWUDEDMR





&DSWXUDVWRPDGDVGHODS£JLQDZHEGH0$1,)(67$








'RFXPHQWDFLµQ$1(;$ B'RFXPHQWDFLµQDFUHGLWDWLYDGHSDUWLFLSDFLµQ FDSWXUDVGHODZHEGH0  B%UHYHH[SOLFDFLµQGHOSUR\HFWR B&DUWDGH%DFLO¸DODUHVSRQVDEOHGHOFRPLVDULDGRGHOFLFOR  B5(/$&,Â&#x2022;1'('2&80(1726$&5(',7$7,926 GDGDVXH[WHQVLµQVHSUHVHQWDXQDVHOHFFLµQGH ORVPLVPRV(OORWHFRPSOHWRGHLQIRUPDFLµQVHSXHGHHQYLDUHQIRUPDWRGLJLWDODDTXHOTXHORVROLFLWH  

_([LVWHXQGRFXPHQWRILUPDGR\VHOODGRSRU0TXHFRQVLJQDODUHFRJLGDGHOPDWHULDOGH WUDEDMRUHODFLRQDGRFRQHOSURFHVRGHWUDEDMR B([LVWHFRSLDGHOFRQWUDWRRIUHFLGDSRU0TXHWUDVGLYHUVDVUHYLVLRQHV\PRGLILFDFLRQHVP£VOD LQFOXVLµQGHFODXVXODVGHOD&RUSRUDFLµQ%DFLO¸VHHQWUHJµD0$1,)(67$ B([LVWHXQDUHODFLµQGHFRUUHRHOHFWUµQLFRFRQODFRPLVDULD<RODQGD5LTXHOPHTXHDFUHGLWD WRGRVORVKHFKRVDQWHULRUPHQWHH[SXHVWRV B&DW£ORJRGHODELHQDOGRQGHILQDOPHQWH\SRUHUURUVHLQFOX\HD&RUSRUDFLµQ%DFLO¸ B3URJUDPDGHO&LFORH[SRVLWLYR\RWURVGRFXPHQWRVHPLWLGRVSRUODSURSLDRUJDQL]DFLµQGH 0$1,)(67$




  




Atentamente le saluda y se despide, CORPORACIÓN BACILÖ  9$'(&21&,/,$&,•1&25325$&,•1%$&,/˜ 'DGRTXHHODSDUDWREXURFU£WLFROHJDOGH$VRFLDFLµQ&$$5/QRVHSXHGHFRPSDUDUFRQHOGH XQDLQVWLWXFLµQFRPROD)XQGDFLµQ0$1,)(67$\)81'$&,•1*(1(5$/0$1,)(67$ RSWDPRVSRUXQD'HPDQGDSRUY¯DGHFRQFLOLDFLµQFRPRUHFXUVROHJDOSDUDUHVROYHUHOFRQIOLFWR FRQORVUHVSRQVDEOHVGHOSUR\HFWR0R&+$6(66,216\)81'$&,•10$1,)(67$GHMDQGR SDWHQWHXQDYH]P£VODVEXHQDVLQWHQFLRQHVGH&RUSRUDFLµQ%DFLO¸SRUHYLWDUPD\RUHV FRQWUDWLHPSRVHQIRUPDGHSURFHVROHJDO (VWLPDPRVTXHVHSURGXFHXQDEXVRGHSRGHUSRUSDUWHGHODLQVWLWXFLµQ\VXVPHFDQLVPRVGH ODGHVHVSHUDFLµQHQHORIUHFLPLHQWRGHXQDVJDUDQW¯DVRFREHUWXUDOHJDOP¯QLPDVSDUDHODUWLVWD




EL ARCHIVADOR CAJÓN DESASTRE DE ARCHIVOS Y DOCUMENTOS OFICIALES, EXTRAOFICIALES Y ESPONTÁNEOS RELACIONADOS CON LA EXPERIENCIA CONTABLE ORDENADOS ALEATORIAMENTE


lunes 15 de noviembre de 2010

ERRORES FATALES (5525)$7$/(FKDUDEDFLO¸LPSXQHPHQWHVLQFRQVLGHUDFLµQSRUXQDP¯QLPDGLJQLGDG ODERUDO\VLQSUHYHUODVFRQVHFXHQFLDVOHJDOHVTXHHOORSXGLHUDDFDUUHDU (5525)$7$/'DUSRUKHFKRTXHODVDGYHUWHQFLDVHUDQHQEDOGH\TXHEDFLO¸QROOHJDU¯D KDVWDODVXOWLPDVFRQVHFXHQFLDV (5525)$7$/,QFOXLUD&RUSRUDFLµQ%DFLO¸HQODVHFFLµQGHELRJUDI¯DVGHSDUWLFLSDQWHVHQOD ELHQDOJUDFLDVDORFXDOWHQHPRVEDVHGHUHFODPDFLµQFRQVWDWDEOH 3RUVLDFDVR0WXYLHUD ODLQWHQFLµQGHVLPSOHPHQWHQHJDUORVPHVHVGHWUDEDMRTXHKHPRVUHDOL]DGR

SDJGHOFDW£ORJRRILFLDOGH 0$1,)(67$/DPHQWLUD\ODRVDG¯DWLHQHQVXVFRQVHFXHQFLDV

   (5525)$7$/$FXGLUDXQDFLXGDG0XUFLDSRUFDVROOHQ£QGRVHODERFD\ UHJDODQGRORVR¯GRVFRQPRQVHUJDVGHDUWHLQGHSHQGLHQWH\DXWRQRP¯DXQGLVFXUVRTXHQDGD WLHQHTXHYHUFRQODUHDOLGDGGHHVWDELHQDO\ORV0$&52HYHQWRV0,//21$5,26ILQDQFLDGRV FRQHOGLQHURS¼EOLFRTXHQRVHTXHGDHQODUHJLµQ SXHVORVDUWLVWDVDSHQDVUHFLEHQFDQWLGDGHV ಯVLPEµOLFDVರSRUQRGHFLUYHUJRQ]RVDV GHJUDGD\GHYDO¼DDORVDJHQWHVFXOWXUDOHVORFDOHVDOD YH]TXHOLTXLGDRWUDVLQLFLDWLYDVTXL]£VFRQPD\RUUHSHUFXVLµQ\WUD\HFWRULDHQHVWDFRPXQLGDG $XGLWRULRGH&HXW¯DVRFLDFLRQHVGHEDQGDVGHP¼VLFDIHVWLYDO$/7(5DUWH0XFKR0$<2 UHSUHVHQWDFLRQHVGHSHTXH³DVFRPSD³¯DVWHDWUDOHV\XQVLQILQGHHYHQWRVFXOWXUDOHVGHPHQRU SUHVXSXHVWR3(52SUREDEOHPHQWHGHPD\RUFDODGRVRFLRFXOWXUDOVHKDQTXHGDGRVLQ ILQDQFLDFLµQSDUDHOHMHUFLFLRGH0XFKDVJUDFLDV0$1,)(67$

08&+$6*5$&,$6&216(-(5$'(&8/785$

CONSULTEN LA PRENSA. 3XEOLFDGRSRU&RUSRUDFLRQEDFLO¸HQFRPHQWDULRV

(QODFHVDHVWDHQWUDGD


Archivo del blog x

Ⴍ  

o

o

o

ႭQRYLHPEUH  

ƒ

$17(3(18/7,0$7(:$51,1*)25($57+

ƒ

&2081,&$'2LQ626WHQLEOH816867$,1$%/(&20081,4

ƒ

81260,18726086,&$/(6

ƒ

$17(3(1œ/7,0$$'9(57(1&,$3$5$/$7,(55$

ƒ

(5525(6)$7$/(6

ƒ

(QOD$FDGHPLDVHFRQYLHUWHHQ

ƒ

81&/ƒ6,&2,03(5(&('(527+(&/$66,&,03(5,6+$%/(

ƒ

'•1'((67ƒ/$3$67$":+(5(v67+(&$6+"

ƒ

)(67,0$'0$;

ႫRFWXEUH  

ƒ

5(/$&,•1352325&,21$/"

ƒ

5(&(3&,”1\5(9(5%GH0

ƒ

%852)$;&217$%,/,'$'BBB/HJDO$FWLRQV

ƒ

FRQWUDWR\FODXVXODVEDFLO¸

ƒ

6(“25(6'(0$1,)(67$8132&2'(',*1,'$'/$%25$/

ƒ

5(3$572'(/&2081,&$'23œ%/,&2(;

ƒ

(;0DQLIHVWD(;0R&+$6HVVLRQV&2081,&$'23œ

ƒ

5HVSXHVWDDOD(;FOXVLµQGH&RUSRUDFLµQ%DFLO¸GHO

ƒ

&25325$&,•1%$&,/˜HV(;SXOVDGR(;FOXLGRGHOSUR

ƒ

&217$%,/,'$'GHVFULSFLµQFRQWRGROXMRGHGHWDO

ႫVHSWLHPEUH  

ƒ

'HVFULSFLµQDGPLQLVWUDWLYD&ƒ/&8/2'()/8-26'(

ƒ

&RQWH[WR7HµULFR\EUHYHGHVFULSFLµQGHODSURSXHV

o

ႫDJRVWR  

o

ႫMXQLR  

o

ႫPD\R  

o

ႫDEULO  

ƒ ƒ ƒ

&217$%,/,'$'(;+,%,&L•1+20(1$-( 0R&+$352-(&7 DQWLEDFLO¸

ƒ

2%-(7,926GHEDFLO¸

ƒ

DSXQWHVFURQROµJLFRVBORVRU¯JHQHVn79VURGDQWH

ƒ

QRPHQFODWXUD(63(&),&$B%ƒ6,&$

ƒ

4X«HVEDFLO¸

ƒ




carta a la corporación ... INDIRECTFILM PROYECT ION <in_direct_film@hotmail.com> From: ... View Contact To: carta a los bacilo.pdf (47KB) Acabo de leer los últimos 20 correos que la Corporación está llevando a cabo con M8. Y constato lo caluroso que ha sido el verano también en cuestiones burocráticas. Sin ser del todo consciente de lo sucedido hasta hoy, he estado escribiendo una carta a los operarios estos días atrás. Una carta que viene a colación de los últimos acontecimientos con Mocha, mi pensamiento como veréis anda por caminos sanadores para todos. (…) Un saludo a todos, estoy con vosotros y en abierto...

Extractos autorizados de la Carta a los Operarios de la Corporación Bacilö.¬//: Queridos Compañeros, leo en la distancia la situación con el comisariado del Proyecto Mocha/Manifesta8. (…) Me encuentro empujado a una Pequeña Reflexión Bacilö... Inicio mi reflexión por el

En una de nuestras ilustraciones de la Biblia Bacilö vemos Operarios Bacilö bajar de los comienzo:

cielos al Planeta Imomi; estos Operarios son enviados por el ILUSTRE BACILÖ (probablemente un ILustre Virus) para evangelizar y salvar a los Imomis y la sociedad que han creado.


Una sociedad y unos Imomis que el propio Ilustre Bacilö y su colega el Doctor Feüerbach supusieron, años atrás, enfermos, y, lo que es más grave, inconscientes de la gravedad de la situación creada. Aquella bajada de los cielos es llamada por los Escribanos Bacilö “YIHAD BACILÖ” (entendiendo Yihad como Esfuerzo). Un esfuerzo que los Operarios Bacilö realizan desde años atrás y en el que, al igual que monjes de otras religiones/corporaciones, ponen su ESPÍRITU y su FÉ al servicio de esta Sociedad Imomi: “BACILÖ ES UN CAMINO ESPIRITUAL Y DE SALVACIÓN” Partiendo pues de uno de nuestros primeros y más antiguos objetivos, SANARNOS de... y SANAR a la población

Imomi (Sesión ANTIEstrés/Primer Proyecto

Bacilö/San Javier), no concibo el descomunal ESFUERZO y DESGASTE que a veces nos persigue:

contra dicha Población Imomi. Si el esfuerzo es sanar al Imomi y de paso sanarnos a nosotros mismos, en algún punto de nuestra MISIÓN nos desviamos.

La lucha trae consigo violencia, un asunto del que Bacilö siempre ha huído, a pesar de que muchos Imomis lo han deseado (a veces para hacernos desaparecer). Si Bacilö en su sano ejercicio práctico parece un juego artístico payasesco e

inocuo, en Bacilö,

Sanar al Paciente coloca a sus Operarios en la cámara de operaciones del

SANADOR

El Sanador Bacilö es un sujeto actante y un jugador,

.

que obra con decisiones firmes y contrastadas las obsesiones neuropatológicas del Imomi.

Así pues, nuestro

juego esconde un universo tan serio

como la parte lúdica que expone dicho juego. Somos Nuevos Terapéutas, sin duda, con

bruta técnica nutrida de las

cloacas del submundo artístico, que no cesa, desde los bufones de la antigüedad a los hiperrománticos, a Jarry, los dadaístas, Artaud, situacionistas, neodadás, y todos los que desconocemos u olvidamos por desgracia ... cada uno de nosotros con su particular membrana y complementaria con el otro...ELEGIDOS por el ILUSTRE BACILÖ, la población Imomi apenas contiene respuestas que darnos; son nuestros pacientes!!


Me viene a la memoria nuestro Coche Salón de Té al servicio del festivalero feliz o enervado, nuestros Rituales (enormemente) transformadores, nuestra potente misa ... lúdicos proyectos para el Imomi, reales en sus consecuencias terapeúticas, redondos aunque aún intuitivos por la juventud de Nuestra Obra, trabajos que han encontrado el fervor del Imomi de manera muy directa, su aprobación y fanatismo hacia Bacilö. Hemos tenido que recorrer un camino largo y duro a través del Desierto Bacilö, sólos, dejados de la mano de Bacilö. Dejarnos llevar por la autocomplacencia y por el hastío generalizado de esta sociedad nos separa del silencioso desierto y nos devuelve al mundanal ruido. A no ser que estemos inmersos en la guerra y en la enfermedad (cosa posible muy a pesar nuestro) no entiendo nuestra falta de estrategia más allá de la lucha armada, de COMPASIÓN BACILÖ hacia las patologías del Imomi y su Maquinaria Organizativa. En la terapia (sicológica o escénica), la llamada, la petición o el acercamiento de una persona al sanador es el primer paso. No podemos actuar sin ser interpelados por una persona u organización que lo necesita. ¿Porque no somos más amigos del comisario Imomi que nos solicita? Podemos devolverle con SANACIÓN BACILÓ su invitación. Para ello nos llama, ¿no?. Me pregunto si en la confusión general del Mundo Imomi en el que nos encontramos (El Desierto Bacilö) no estamos pasando de la terapia de choque al choque sin terapia, a la lucha sindicalista, a la guerrilla sin cuartel, a la JUNGLA IMOMI. En el caso de Manifesta8, al que fuimos invitados, entendimos que entrar en el Proyecto MochA nos daría oportunidad de estar dentro de una Máquina Organizativa Imomi una vez más, y poder así actuar con Bacilö dónde nos reclama el DESTINO BACILÖ,

aunque fuera sin remuneración justa.

Con la ley del mínimo esfuerzo por delante nos propusimos entrar a actuar

(…).

En nuestra última reunión prestamos atención a la parte contratante sólo desde el

reivindicacionismo

, es decir, las injusticias y desigualdades que generan este tipo de SuperEventos en el mundo clasista Artístico. No se llegó a hablar de

nuestra Misión Terapeútica

por encima de las dificultades.

Y paradójicamente, es por esa misma Misión por la que el

Logístico Imomi siempre acude a nosotros:

Aparato


REDENCIÓN, la FLAGELACIÓN y el PERDÓN de BACILÖ.

en su fondo inconsciente busca la

Proyecto Mocha nos solicita y exige una atención; quizá tengan razón, ¿Porque no? Cuando hablamos de Mínimo Esfuerzo no estábamos hablando de no respetar las reglas del Mundo Imomi (que tanto las necesita). Al contrario, economizar esfuerzos pero manteniendo el espíritu Bacilö despierto y sus Esfuerzos en crear Eventoterapias.

bacilö ante la DMMMMXXLV Asamblea de las Naciones Hundidas explicando la necesidad de más eventoterapias por el mundo.

bacilö saluda a las masas de acólito-adeptos en su gira por Occipitópolis en el MLXIII aniversario de la Gerontocracia


 9HUVL¾Q-$5'FRU­

SEĂ&#x2018;ORES DE MANIFESTA, ÂĄÂĄ UN POCO DE DIGNIDAD LABORAL!! ÂŹ://..Aporte informativo: Relato TELEGRĂ FICO de lo acontecido hasta la fecha durante el desarrollo de CONTABILIDAD en respuesta al continuo ACOSOburocrĂĄticoINSTITUCIONAL_ytal que no ha permitido a CorporaciĂłn BacilĂś trabajar a su ritmo, hostigado continuamente por el aparato belico-funcionarialinstitucional encarnado en la figura de la SUB-CO-comisaria denominada Y1. &20,(1=$1 /$6 1(*2&,$&,21(6 &21 0< 0DQLIHVWD<RODQGD  $&/$5$1'2 < $&25'$1'2&21<'(6'((/35,0(5020(172 FDIÂŤVSUHYLRV\SULPHUDVUHXQLRQHV WUDV DFHSWDU HO SUR\HFWR  &8$/ 9$ $ 6(5 /$ 0$1(5$ '( 75$%$-$5 '( /$ &25325$&,Â&#x2022;1 $ 68*(5(1&,$ '( < 6( (67$%/(&( 48( %$&,/Â&#x2DC; 325 /$6 &21',&,21(6 (63(&Â?),&$6 '(/ 352<(&72 (67$%/(&(5Â&#x192; 81$ 18(9$ )250$ '( 352&('(5 8Q 1(: 02'(/ VSHFLILF 3$5$ /$ 2&$6,Â&#x2022;1 (1 (/ 48( 72'$ /$ &2081,&$&,Â&#x2022;1 < 5($/,=$&,Â&#x2022;1 '(/ 352<(&72 6( 5($/,=$5Â&#x192; 9Â?$ 9,578$/ $ 75$9Â&#x2039;6'(/26',9(5626&$1$/(648(1262)5(&(/$5(' '(6'( $17(6 '(/ ,1,&,2 6( ,1)250$ '( &8$/ 9$ $ 6(5 (6$ 0$1(5$ '( 352&('(5 (6 '(/ 72'2 ,1&,(572 48( 12 +$<$026 6,'2 &/$526 (1 (67( < 27526$63(&726&21/$25*$1,=$&,Â&#x2022;1'(+(&+21(:02'(/6<&21680(HVWR 7$;$7,9$0(17(/2(;321(1$/$9(=48(62/,&,7$148(126(/(6//$0(0Â&#x192;6 325 7(/Â&#x2039;)212 $//Â&#x192; 325 (/ 0(6  Â&#x2022;  '(/ $Â&#x201C;2 &255,(17( <$ $+Â?   6(/(,1)250$$<'(6'((/'Â?$48(/$5(/$&,Â&#x2022;1(175(/$&25325$&,Â&#x2022;1< 0< 6(5Â&#x192; (675,&7$0(17( 325 9Â?$ 0$,/ < 6( ,1)250$ &5,67$/,1$0(17( '( 48( (6726 '2&80(1726&$57$6 6216(5Â&#x192;1 686&(37,%/(6 ,1&/862 0Â&#x192;6 6(5Â&#x192;13$57()81'$0(17$/'(/$3,(=$<'(18(675275$%$-2 6,%,(1(6&,(57248(126(,1',&Â&#x2022;,1,&,$/0(17(32518(675$3$57(48(/$ 3,(=$&21//(9$%$81$$&&,Â&#x2022;162535(6$7$032&2181&$$17(66(126 +$%Â?$,167$'2(127526352&(62635(9,26 (1$Â&#x201C;26'((;3(5,(1&,$&202 &2/(&7,92 $7(1(548(5(9(/$5(/&217(1,'2'(18(675275$%$-2'( 0$1(5$(;+$867,9$(67((;75(02 /$1(&(6,'$'<(/'(5(&+2$ &216(59$5(/0,67(5,2&2023$57(,175Â?16(&$'(18(67526352&(626 

',026325+(&+248((5$&212&,'2325$48(//2648(126+$%Â?$1 ,19,7$'2$3$57,&,3$5 6,(1'2

352)(6,21$/(6'(/0(',2

$57Â?67,&2 <3$57,(1'2'(/$%$6('(48(

2%9,$0(17(&212&Â?$1

18(675$0$1(5$+$%,78$/'(352&('(526(+$%5Â?$1,1)250$'2 0,1,0$0(17(DOPHQRV


&202&2175$3$57,'$(11,1*œ1020(172,1,&,$/6(126,1',&•48((5$81$ &21',&,•16,1(48$121&212&(5/$727$/,'$'3250(125,=$'$'((/ &217(1,'2'(18(675$$&&,•1 ,1,&,$/0(17(126(62/,&,7$35(6838(6721, 6,1236,61,3/$1'($&78$&,•1 $/*248(6,3267(5,250(17(6(5(9(/$ &202(/48,''(/$&8(67,•1'(%(5$1'(+$%(57(1,'2(1&8(17$08&+2 $17(6<+$%(5/262/,&,7$'2&216(&8(17(0(17(>FRPRVHKL]RFRQHOUHVWRGH PDWHULDODQWHULRUPHQWHUHTXHULGR@ (QUHVXPHQSRUQXHVWUDSDUWH 6(+$35(6(17$'272'2(/0$7(5,$/48(+$6,'262/,&,7$'23253$57('( 0&855,&8/80%,2*5$)$'(/*5832,0ƒ*(1(63$5$3$1)/(726< 38%/,&$&,21(6<$5*80(17$&,•1&21&(378$/'(/352<(&7272'2(//2(1 /263/$=26&219(1,'26&21/$&2FR&20,6$5,$ 6(+$$&&(','2$(;7(1'(5/$6$&/$5$&,21(6$5((/$%25$5<5('$&7$5 72'2$48(//248(/$25*$1,=$&,•1&216,'(5•2325781262/,&,7$5$œ1 5(68/7$1'2126$72'$6/8&(6,11(&(6$5,2 (QUHVXPHQSRUSDUWHGH0 126(&2081,&$181$6&21',&,21(6'(),1,7,9$6+$67$/$)(&+$(148( %$&,/˜(6(;38/6$'2'(/352<(&720R&+$6(66,216 $60,6026('(1,(*$(/$&&(62$0$7(5,$/,17(512 '(/$25*$1,=$&,•1  48($7$“(',5(&7$0(17($(67$(;326,&,•15(48(5,'2325%$&,/˜ 0$7(5,$/48(3256838(672127(1$132548‹)$&,/,7$5126/26'$726 62/,&,7$'26(5$1(&21•0,&26$3523•6,72'(/$25*$1,=$&,•1'(/ 35(6(17((9(172 /$35,0(5$9(56,•1'(/&2175$72 6,175$'8&,5$/(63$“2/ //(*$(1 $*2672 75$6/$1(&(6$5,$1(*2&,$&,•13$5$/$,1&/86,•1'(&/$868/$6%$&,/˜< (/,0,1$&,•1'(&/$868/$6,1$3523,$'$6 32512'(&,5$%86,9$6 3253$57( '(/$25*$1,=$&,•1'(/0$&52(9(172/$9(56,•1'(),1,7,9$6(&21&5(7$ 8126'$6$17(6'(6(37,(0%5( 6(1,(*$1$),50$5(/&2175$7262/,&,7$1'218(9$6<(;7(16$6 $&/$5$&,21(6+$67$/$)(&+$(148(%$&,/˜5(68/7$(;38/6$'2'(0$1(5$ 81,/$7(5$/$,1,&,26'(6(37,(0%5(75$60ƒ6'(0(6(6'(,1)58&78262 75$%$-2'(72'26686&20321(17(66,1&2175$726,1+$%‹56(/( )$&,/,7$'281$6&21',&,21(6'(),1,7,9$6

<6,11,1*81$


&216,'(5$&,•1'(/248($()(&726

/(*$/(6(67238',(5$68321(5 6(“25(6'(0$1,)(67$cc8132&2'( ',*1,'$'/$%25$/ 6(+$7(1,'248(&217(67$5(/7(/‹)2123$5$75$7$5$6817265(/$7,926 $/352<(&72 6,148(48('(&2167$1&,$()(&7,9$'(/275$7$'2 (1 ,1180(5$%/(62&$6,21(6\3(6($62/,&,7$55(,7(5$'$0(17(/$(/,0,1$&,•1 '((67$9$'(&2081,&$&,•1 32548(5(68/7$%$)81'$0(17$//$ (;,67(1&,$'('2&80(17$&,•1325(6&5,72 

*********************************************************************

7UDVYLVLWDUODVSULQFLSDOHVVHGHV\UHFLQWRV H[SRVLWLYRVGHODELHQDO0HVWRHVORTXH QRVSUHJXQWDPRV $IWHUYLVLWLQJWKHPDLQH[KLELWLRQVSDFHVRI 0ZHZHUHZRQGHULQJ

:+(5(v67+(021(<"




A propósito de la fiesta de INAUGURACIÓN “¿Me podría decir alguien con cierta exactitud el precio de un ágape para todos esos invitados (unos 1500 profesionales acreditados según la organización, sin contar a los 500 periodistas y a los que fueran porque sí)que se fue al garete por unas lluvias anunciadas?... ¿ES QUE NADIE PODÍA HABER PREVISTO EL USO DE UNA CARPA PARA ESTA SITUACIÓN POR OTRA PARTE PREVISTA? O ES QUE COMO EN MURCIA NO LLUEVE NUNCA PODEMOS DERROCHAR EL DINERO EN FIESTAS QUE NO LLEGAN A REALIZARSE ¡¡¡¡PERO QUE SI QUE SE PAGAN!!! ¿CUANTO DEL DINERO DE LOS CONTRIBUYENTES MURCIANOS O DEL PRESUPUESTO MILLONARIO DE ESTE EVENTO SE GASTÓ EN UNA SOLA NOCHE DANDO DE COMER GRATIS A TODOS ESOS PROFESIONALES EN ESTA OSTENTOSA POLITICA DEL DERROCHE [MURCIANÍSIMA, MODERNÍSIMA Y PROVINCIANA] DEL PAN PARA HOY HAMBRE PARA MAÑANANA? Y más aún ¿de cuántas personas se compone el equipo de trabajo de MANIFESTA8 que lleva operando en Murcia desde hace más de un año cobrando su sueldo para no ser capaz de preveer una situación, insisto ANUNCIADA POR LOS METEORÓLOGOS, como la del pasado sábado?

¡¡¡¡MANIFESTA-MiERDAFESTA!!!!!” $QµQLPREORJXHURGH,QWHUQHW )XHQWHFRQWUDLQGLFDFLRQHVQHW


HQWRQFHVOOHJDUDODFRQFOXVLÂľQHVWLPDWLYD>DWUDYÂŤVGHXQDVLPSOHRSHUDFLÂľQDULWPÂŤWLFD@DTXHOD UHODFLÂľQFRUUHVSRQGLHQWHHQHVWHFDVRHVGH

DDSUR[3RUFDGD

SDUWHVJDVWDGDVHQWRGRORTXHHQYXHOYHDXQDPXHVWUDHVODTXHVHDVLJQDDOWUDEDMRWRWDO KRQRUDULRV\SURGXFFL¾QLQFOXLGRV GHOFUHDGRUGHODPLVPD (VWDSURSRUFL¾QHVWLPDPRVTXHQRHVPX\GHVDFHUWDGDHVP£VLQFOXVRSUREDEOHPHQWHVH TXHGHFRUWDಚ7LFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDF

WLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDF WLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDFWLFWDF WLFWDFWLFWDFWLFWDFWLFWDFWLFಚVHFLHUQHQODVFRQVHFXHQFLDV

GHEDFLO¸WLFWDF7,&7$&  )HGHHUUDWDV/DDFFL¾QP£VYLVWDGH&RUSRUDFL¾QEDFLO¸IXHIHVWL0$'BPD[

>AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@ Murmuranoicas-murmuranoia â&#x20AC;&#x153;(â&#x20AC;Ś) â&#x20AC;ŚPĂ´r otra parte le indicamos a usted y a la entidad a la que representa que estamos preparando unas clausulas a incluir en el contrato basĂĄndonos en el Manual

Buenas PrĂĄcticas ArtĂ­sticas.

de

Se las haremos llegar lo antes posible para que puedan consultarlas previamente al encuentro con nuestro enviado-representante para la firma del contrato.

Por otra parte se incluirĂĄ una baterĂ­a de propuestas y compromisos de bacilĂś. Ă&#x2030;stas podrĂĄn ser aceptadas o no, pero rogamos sean tenidas en cuenta y en todo caso que sean incluidas en el contrato como peticiones realizadas por bacilĂś y aceptadas o no por M8.

(VER compromisos y pericones de bacilĂś al final del presente documento) Atentamente Dpto. de legalidad infructuosa de la CorporaciĂłn BacilĂś.

â&#x20AC;?

From: corporaciĂłn bacilĂś <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; bacilĂś <corporacionbacilo@yahoo.com.au> Sent: Thu, 5 August, 2010 6:29:29 PM Subject: a cerca del contrato bacilĂś con M8RM

********************************


Corporación %DFLO¸GHVHDKDFHULQFOXLUHQHOSURSLRFRQWUDWRRGRFXPHQWRDQH[RODVVLJXLHQWHV SHWLFLRQHV\FRPSURPLVRVDILQGHTXHFRQVWHQFRPRWDOHV  B&RUSRUDFLµQ %DFLO¸ GHVHD VH³DODU D OD GLUHFFLµQ GH 0$1,)(67$ 5HJLµQ GH 0XUFLD \ D OD )XQGDFLµQ 0$1,)(67$ HQ DGHODQWH \ SRU H[WHQVLµQ 050  TXH KD UHGXFLGR VX FDFK« FRQVLGHUDEOHPHQWH SDUD OD UHDOL]DFLµQ GH OD DFFLµQ GH OD TXH HV REMHWR HO SUHVHQWH FRQWUDWR (Q FRQVHFXHQFLD VROLFLWD VHU PLHPEUR GHO HTXLSR FXUDWRULDO GH 0DQLIHVWD D³R   HQ FRQWUDSUHVWDFLµQSRUORDQWHULRUPHQWHH[SXHVWR $&(37$'2'(1(*$'2

Ɉ

Ɉ

0DUTXHFRQXQDHTXLVHQODFDVLOODORTXHSURFHGDDFHSWDFLµQRGHQHJDFLµQ   B&RUSRUDFLµQ %DFLO¸ VROLFLWD D OD RUJDQL]DFLµQ GH 050 TXH WUDVODGH VX GLVFRQIRUPLGDG D OD )XQGDFLµQ 0$1,)(67$ HQ OR UHIHULGR D ODV FRQGLFLRQHV GH FRODERUDFLµQ RIUHFLGDV D ORV DUWLVWDV FRQFUHWDPHQWH HO FDFK« SURFHGLPLHQWR \ D OD SURGXFFLµQ WDQWR OD FDQWLGDG DVLJQDGD FRPR D ODV FRQGLFLRQHV R H[LJHQFLDV SRU SDUWH GH OD HQWLGDG RUJDQL]DGRUD H[LVWH D QXHVWUR HQWHQGHU XQ VXVWDQFLDOGHVHTXLOLEULRHQWUHORVFRPSURPLVRVGHPDQGDGRVDODUWLVWD\ORVPHGLRVIDFLOLWDGRVD«VWH SDUDXQFRUUHFWRGHVDUUROORGHOSUR\HFWR HVSHUDQGRVXPHMRUD\DPSOLDFLµQSDUDSUµ[LPDVHGLFLRQHV \YHQLGHURVDUWLVWDV&RQVLGHUDPRVTXHSHVHDTXHVHDXQSDVRDGHODQWHFRQFHSWXDUORVKRQRUDULRV GHODUWLVWD SUHFHGHQWHTXH\DVHKDGDGRHQHVWDUHJLµQHQIHVWLYDOHVFRPR$/7(5$57(FRQXQDV FRQGLFLRQHV TXH GXSOLFDEDQ ODV RIUHFLGDV SRU 0$1,)(67$  HV P£V LPSRUWDQWH KDFHU PHQRV FRQ PHMRUHVFRQGLFLRQHVSDUDWRGRVTXHP£VDFDPELRGHXQVXSXHVWRODQ]DPLHQWRDOHVWUHOODWRDUW¯VWLFR TXHFRQFUHWDPHQWHDQRVRWURVQRQRVLQWHUHVDHLQFOXVRQRVDEXUUH3DUDQRVRWURVHVWDHVODWµQLFD GHORVPDFURHYHQWRVFRPRHVWDELHQDO 1R REVWDQWH EDFLO¸ KD GHFLGLGR FRODERUDU HQ SRV GH OD FRQVHFXFLµQ GH VXV ILQHV ¼OWLPRV \ GH XQD FU¯WLFDFRQVWUXFWLYDHQODVQXHYDVUHODFLRQHVYHQLGHUDVHQWUHDUWLVWDHLQVWLWXFLµQ $&(37$'2'(1(*$'2



Ɉ

Ɉ

B'DGDODQDWXUDOH]DGHOSUR\HFWR&217$%,/,'$'TXH&RUSRUDFLµQ%DFLO¸YDDGHVDUUROODUGHQWUR GHODSURSXHVWD0R&+$VHVVLRQV\GHODSURSLDQDWXUDOH]DGHODPD\RU¯DGHWUDEDMRVTXHHVWH FROHFWLYRYLHQHGHVDUUROODQGRGHVGHKDFHD³RVVROLFLWDTXHVHUHVSHWHVXGHUHFKRDODLQWULJDHO PLVWHULR\ODDPELJ¾HGDGHQORTXHVHUHILHUHDODFRQFUHFLµQGHGHWDOOHVGHVFULSWLYRVGHODDFFLµQD OOHYDUDFDER &RUSRUDFLµQ%DFLO¸DVHJXUDTXHODDFHSWDFLµQGHHVWDFO£XVXOD 12FRQVWLWX\HQLQJ¼QREVW£FXORSDUDODFRUUHFWDFRQVHFXFLµQGHOSUR\HFWR 12HQFLHUUDQLQJXQDHVWUDWDJHPDQLLPSOLFDQLQJXQDDFFLµQGHPDODIHTXHVXSRQJDXQULHVJRSDUD OD2UJDQL]DFLµQQLSDUDHOS¼EOLFR 12LQWHUILHUHHQHODSRUWHGHRWURWLSRGHLQIRUPDFLµQSUDFWLFRWHµULFDQHFHVDULDDHIHFWRV RUJDQL]DWLYRVGHFRPXQLFDFLµQRPRQWDMH


6UHSUHVHQWDXQDVSHFWRGHWHUPLQDQWHSDUDFRQVHUYDUODLQWHJULGDGFRQFHSWXDOHQODSUHVHQWDFLµQ GHOWUDEDMRILQDOL]DGR $&(37$'2'(1(*$'2

O

O

 B&RUSRUDFLµQEDFLO¸VROLFLWDD050ORVGDWRVGHFRQWDELOLGDGGHOSUHVHQWHSUR\HFWR 0R&+$VHVVLRQVSDUDFRQWUDVWDUORVHQVXSURFHVRGHLQYHVWLJDFLµQFRQHOUHVWRGHORVDUFKLYRVGHO 0R&+$UHIHULGRVDHVHDVSHFWRFRQWDELOLGDG $&(37$'2'(1(*$'2

O  &203520,626'(%$&,/˜ 

%DFLO¸UHDOL]DU£SDUD0R&+$VHVVLRQVXQDDFFLµQ¼QLFDHLUUHSHWLEOH$GHP£VDSRUWDU£ FRPR PDWHULDO DGLFLRQDO SDUD H[SRVLFLµQ GRFXPHQWRV GHULYDGRV GH OD LQYHVWLJDFLµQ HIHFWXDGD VREUH ORV DUFKLYRV GHO 0R&+$ GRFXPHQWRV IDFV¯PLOHVRULJLQDOHV \ YLGHR GRFXPHQWDO GXUDQWHHOSHULRGRGHODH[KLELFLµQ\TXHTXHGDU£QHQSRVHVLµQGHEDFLO¸ XQDYH]DFDEHODPLVPD



%DFLO¸VHFRPSURPHWHDGHVWUXLUORVDUFKLYRVIDFLOLWDGRVSRU050HQHOWUDQVFXUVRGH ODDFFLµQ



%DFLO¸VHFRPSURPHWHDIDFLOLWDUD050XQGRVVLHUFRQXQDVHOHFFLµQGHLP£JHQHV\ YLGHR GHO WUDEDMR UHDOL]DGR $V¯ PLVPR LQIRUPD GH OD HGLFLµQ SRVWHULRU GH XQ DPSOLR YLGHRGRVVLHUDGLVSRVLFLµQGHTXLHQHVW«GLVSXHVWR YDOJDODUHGXQGDQFLD DDGTXLULUOR SRU HO SUHFLR TXH PDUTXH &RUSRUDFLµQ %DFLO¸ \ UHVHUY£QGRVH WRGRV ORV GHUHFKRV GHULYDGRVGHVXDXWRU¯D



%DFLO¸ VH FRPSURPHWH D WUDEDMDU FRQ WRGRV ORV PHGLRV \ FRQRFLPLHQWRV D VX DOFDQFH SDUD OOHYDU D FDER OD DFFLµQ GH &217$%,/,'$' GH PDQHUD HILFD] \ KRQHVWD DFWLWXG TXHVLHPSUHKDFDUDFWHUL]DGRDOD&RUSRUDFLµQHQODFRQVHFXFLµQGHVXVILQHV

   )PGR)PGR &RUSRUDFLµQEDFLO¸0$1,)(67$5HJLµQGH0XUFLD

O


Descripción administrativa: CÁLCULO DE FLUJOS DE ENERGÍA INVERTIDA EN PROCESO La acción CONTABILIDAD [exhibiciónYhomenaje] que Corporación Bacilö llevará a acabo para el proyecto MoCHA SESSIONS en MANIFESTA8, consta de 2 partes bien diferenciadas: Por un lado esta la negociación administrativa de las condiciones que rodean a una exhibición (en este caso la de esta exposición en particular) y por otro el proceso de concepción conceptual del proyecto. Para la primera parte Bacilö se sumerge en las profundidades y entresijos de la maquinaria burocrático-administrativa poniéndose su máscara funcionarial para negociar unas condiciones aceptables por ambas partes para el correcto desarrollo de su trabajo. Esta sección suele necesitar una inversión de esfuerzo- tiempo-energía que según ha calculado la

MICROcorporación patrocinadora de bacilö consumeESTO suele rondar el 68,8%*, más de 2/3 del total trío “esfuerzo- tiempo-energía” invertido en el PROCESO TOTAL . Esta parte es inherente a todo proceso artístico desarrollado en colaboración con las instituciones-agentes culturales. Sólo en el caso de que se autogestione la producción y realización desaparece o se reduce a la mínima expresión este porcentaje. En este intercambio de pareceres los representantes de la corporación se ocupan de labores tan dispares como: RECEPCIÓN DE LLAMADAS, ACUDIR A REUNIONES INFORMATIVAS, CÁLCULO DE PORCENTAJES, ACUDIR REUNIONES INFRUCTUOSAS, ENVÍO DE INFORMACIÓN, IMPREVISTOS CON LA ORGANIZACIÓN, IMPREVISTOS CON LOS MIEMBROS DE LA DIRECTIVA DE LA CORPORACIÓN, TASACIÓN ENERGÉTICA Y ECONÓMICA DEL PROYECTO, RESTO DE OPERACIONES SUPERFLUAS… que tienen como objeto el buen termino de la negociación. Si tomamos como válido este porcentaje, lo que nos resta, ese 31,2% de energía es lo que nos queda para afrontar la creación y desarrollo de la pieza, esto es, la segunda y fundamental parte del proyecto. Para ello, y a la par que se producen las negociaciones, La Corporación ha decidido revisar los archivos del MoCHA en busca de datos que clarifiquen los gastos derivados de una exposición, leitmotiv¿? del actual proceso. {Los datos obtenidos a este respecto son escasamente relevantes}. Al mismo tiempo también, elabora los contenidos solicitados por la organización para cuestiones como publicaciones en general (catálogos, programas de mano, cartelería…). Este aspecto que quizás para otros suponga un esfuerzo añadido es solventado por los técnicos de La Corporación con eficacia milimétrica y no suele suponer más de un 4% [gracias a la ingente y variada cantidad de archivos y documentos (gráficos, visuales, sonoros…) generados en la andadura de Bacilö]. Si restamos este 4%, nos queda un 27,2% . Bien, a esta cifra debemos aplicar complejas fórmulas aleatorio-fractales_bacilö que permiten convertir los carbones en carbunclos y los pajares en montañas de agujas y/_o perlas, a través de las cuales se regenera de manera

fractal la energía convirtiéndose de nuevo en un 100%. Condición ideal indispensable para afrontar con solvencia cualquier empresa, empeño o aventura. Este procedimiento es muy delicado, ya que un simple 0,3% de variación en la energía invertida en la parte correspondiente a la primera parte puede suponer el fallo total de la ecuación reduciéndose entonces el flujo energético en un 10%, lo que nos llevaría al actual

2,7% del que goza el presente proceso en la actualidad.

Con sumo y titánico esfuerzo y sin remanentes de energía, toca alimentarse para poder continuar con el duro día a día. Dado que Bacilö es conocedor y consciente de todos estos y otros datos {obtenidos de la labor realizada en anteriores procesos} actúa consecuentemente CALCULANDO una acción de AUTOABASTECIMIENTO con la que conseguir finalizar el proyecto. El registro de esta acción es lo que bacilö llevará a cabo y ofrecerá en forma de archivo visual al representante elegido por M8 en un acto final sin implicación del público, SIN PÚBLICO ASISTENTE.


El objeto a presentar en su periodo correspondiente de exhibición será un libro que recopile los documentos fruto del intercambio administrativo mantenido con los representantes de MANIFESTA y M8. De esta forma bacilö mostrará al público ávido de respuestas y de conocimiento intrínseco de los mecanismos institucionales del arte la otra parte que nunca se puede apreciar de lo que conlleva una exposición. Al mismo tiempo habrá realizado la acción que le permita llegar al final del proceso para mostrar el fruto de su labor documental y de negociación extenuante en forma de documento textual recopilatorio. Sin más les saludo atentamente. Doctor Feuherbach. Informe realizado bajo los auspicios de consumeESTO Responsable de cálculos de deriva de procedimientos burocrático-inevitables artísticos

* Estos porcentajes son subjetivo-orientativos y pueden variar en cada proyecto y según la manera de proceder de

cada artista, pero en definitiva es una media geométrico-aritmética-poligonal de los procesos realizados previamente por bacilö en colaboración con la institución.


Versión del contrato corregida remitida por el departamento de deriva legal al de manipulación textual, para envío a los técnicos de M8:

Leyenda Revisiones:

Lo que está en rojo negrita bacilö son nuevas anotaciones Lo que está en azul bacilö son tus anotaciones que ya estaban Lo que está subrayado con línea es que se reafirma Lo que está así son puntos discutibles o sobre los que llamo (yo, bacilö) la atención

Y en este color son artículos extraídos de otros contratos de bacilö o de miembros de su corporación en exposiciones previas, que podrían/deberían ser incluídos…sobre todo porque hablan de compromisos por parte de la institución. Contrato de producción Manifesta 8 Nombre: Dirección: E-mail: Página web: Teléfono móvil: Por el presente contrato se confirma que Fundación Manifesta 8 Región de Murcia producirá sola o en colaboración con terceras partes - y exhibirá la obra Contabilidad como parte del programa de la Bienal Europea de Arte Contemporáneo Manifesta 8, que se celebrará del 7 de Octubre de 2010 (inauguración profesional) hasta el 9 de enero de 2011. La correspondencia y anexos generados para el desarrollo del proyecto forman parte de este acuerdo.-¿? La obra forma parte del proyecto Mocha Sessions del colectivo curatorial Alexandria Contemporary Arts Forum en el marco de Manifesta 8 Region de Murcia. La instalación estará ubicada en el Espacio AV de Murcia. Presupuesto El presupuesto total del proyecto no excederá la cantidad máxima de 1.500 Euros, e incluye los siguientes conceptos relacionados con la producción y la exhibición de la obra: - honorarios del colectivo artístico - producción de la obra, incluyendo todos los gastos del estudio del colectivo y sus colaboradores, materiales, realización de la obra, implementación arquitectónica y gastos extra de mantenimiento. - alquiler de equipos - instalación y mantenimiento (incluidos todos los gastos relacionados) en el Espacio AV. - seguro - transporte de la obra y/o materiales necesarios para el montaje de la misma hasta el Espacio AV. - Montaje y desmontaje de la instalación. La inauguración para la instalación está prevista para el día 7 de enero de 2011, teniendo el colectivo que hacerse cargo del montaje dos días previos a la misma, y del desmontaje, un día después de la clausura (10 de enero de 2010). INSTALACIÓN-PRESENTACIÓN DOCUMENTACIÓN [día 3 //ACCIÓN día 7 ]-¿? Æ confirmar El colectivo artístico recibirá 1.500 Euros (impuestos incluidos) por transferencia bancaria para cubrir los gastos de producción tras el envío de la correspondiente factura. FACTURA del TOTAL-¿? Forma de pago? Es decir, será un único ingreso del 100% del presupuesto? o se realizará en dos o más plazos?....y, faltaría algo así:

El ingreso de esta cantidad económica será realizado a la firma de este contrato y tras la presentación de la correspondiente factura. El colectivo artístico se compromete a facilitar a Fundación Manifesta 8 Región de Murcia aquella información necesaria tanto para la instalación de la obra como para su comunicación un mes antes de la fecha de inauguración de la instalación.


El colectivo artístico garantizará que el material necesario para el montaje de la obra estará preparado para el montaje con suficiente antelación. Fundación Manifesta 8 Región de Murcia no se hará cargo de aquellos gastos para los que el artista haya encontrado fuentes de financiación de forma independiente. En el caso de que Fundación Manifesta 8 Región de Murcia consiga financiación extra para el proyecto Mocha Sessions, la aportación a la producción de esta obra/instalación podrá incrementarse. El resto de servicios necesarios serán encargados y organizados por Manifesta 8 dentro de los límites del presupuesto disponible. Manifesta 8 no puede garantizar la provisión de servicios que no hayan sido solicitados con suficiente antelación.( = x días)

Manifesta 8 Región de Murcia acordará con el ARTISTA las condiciones del catálogo. Corresponde, en todo caso, a Manifesta 8 Región de Murcia, el encargo y contratación de textos, fotografías, diseño, maquetación e impresión de dicho catálogo y acordar con profesionales y empresas los términos de su participación en la elaboración del mismo

Tras la instalación En caso de que cualquiera de los organizadores de Manifesta 8 esté interesado en adquirir una obra producida por Manifesta 8, se deducirán los gastos correspondientes a los costes de producción. EntoncesÆ en cuyo caso la obra ya no será producción de M8 al haberse deducido los gatos de producción en la transacción de la venta. // en cuyo caso el apartado Obra Producida por…. de los créditos de la obra, pasará a ser: Obra Producida por Corporación Bacilö Si la obra forma parte de un eventual Programa de Coleccionistas, se firmará un contrato aparte. El equipo y material adquirido por Fundación Manifesta 8 Región de Murcia permanecerá en propiedad de la organización. La Fundación Manifesta 8 Región de Murcia podrá vender elementos y material técnicos, dado que estos elementos no se identifican como parte de la obra del artista. Incluidos los adquiridos con el dinero de la producción?? Los elementos alquilados (monitores, reproductores de DVD etc.) serán devueltos al proveedor. El resto de las partes de la obra no requeridas por el artista, serán destruidas. No está permitido el uso posterior de ninguno de los elementos?? // SE REFIERE AL ARCHIVO DE MOCHA O A NUESTRA OBRA producida partiendo de los archivos? . Seguros La obra del artista será asegurada por Fundación Manifesta 8 Región de Murcia si la cobertura de seguro es posible. La responsabilidad exigible por el daño se limita al valor de la obra o a sus costes de producción, aquel que sea más bajo (esto hay que discutirlo seriamente, se modificaría de la siguiente manera: La responsabilidad exigible por el daño se limita al valor total de obra y el valor de la misma será el indicado por el colectivo a la firma del contrato). Las obras situadas en espacios públicos no serán aseguradas. Las copias para exposición aportadas en formato digital (DVD, BlueRay) no serán aseguradas, Sobreentendemos que por espacios públicos se quiere indicar al aire libre ya que la sala AV es un espacio público.

SEGURIDAD, VIGILANCIA Y CONSERVACIÓN

Manifesta 8 Región de Murcia deberá contratar un seguro para la exposición cuya prima corresponderá al valor de las obras que en su momento indique el ARTISTA, y la cobertura deberá tener efectos desde el momento que se inicie el embalaje de las obras, hasta el momento de su re-entrega en el lugar convenido


Manifesta 8 Región de Murcia deberá proteger en todo momento las obras de la exposición de cualquier condición que pueda deteriorarlas o amenazarlas, incluidos a título ilustrativo pero no limitativo, la luz directa del sol, las precipitaciones, una luz excesiva sin protección y condiciones de temperatura y humedad extremas y fluctuantes. Fundación Manifesta 8 Región de Murcia no puede proporcionar un seguro médico a los artistas visitantes. En previsión de accidente o enfermedad durante su estancia, el/la artista deberá asegurarse de estar cubierto/a por un seguro médico. Condiciones adicionales Todas las obras producidas por Fundación Manifesta 8 Región de Murcia deberán hacer constar el crédito Manifesta 8 Región de Murcia. Documentación El/la artista recibirá: - Cinco ejemplares del catálogo y cinco ejemplares de la guía. PARA ESTA ACCIÓN SOMOS 6 - Fotografías digitales de instalación de su proyecto.(será del proyecto terminado e instalado) - En el caso que el proyecto sea de naturaleza preformativa, o contenga alguna de sus partes de dicha naturaleza, 10 minutos de video Derechos

Las obras producidas son propiedad de ARTISTA DERECHOS DE IMAGEN Y DIFUSIÓN La institución se compromete a enviar al ARTISTA una copia de la documentación donde consten los actos promocionales, comunicados de prensa, datos de asistencia y de cualquier otro material impreso referente a la exposición El Copyright de todas las obras es © Corporación Bacilö CESIÓN A TERCEROS Manifesta 8 Región de Murcia no podrá ceder ninguno de los derechos derivados del presente contrato sin informar previamente al ARTISTA y poseer la autorización del autor de las obras. Por el presente contrato, el/la artista transfiere los siguientes derechos a Manifesta 8 durante la duración de la exposición: -

Derecho de exhibición de la obra Derecho a reproducir fotografías de la obra con fines promocionales hasta el 9 de enero de 2011 Derecho a reproducir imágenes de la obra del artista en y sólo en las publicaciones de Manifesta 8 (catálogo, guía, folletos, página web, servicios de e-mailing, etc.) Derecho a transferir el material documental y los archivos del/la artista a International Foundation Manifesta de Amsterdam. Derecho a mostrar extractos de la obra de hasta tres minutos en la página web. En todas las publicaciones, las obras producidas por Fundación Manifesta 8 Región de Murcia deben indicar: Cortesía de Manifesta 8 Región de Murcia, España EN EL CASO DE QUE LA OBRA NO SEA VENDIDA DEDUCIENDOSE LA CANTIDAD DE PRODUCCIÓN Y EN CUYO CASO MANIFESTA YA NO SERÍA PRODUCTORA SI NO EL MARCO DE EXHIBICIÓN.


El/la artista garantiza: 1.- ostentar todos los derechos de propiedad intelectual y material sobre la obra y todos sus elementos; 2.- su propia autoría y la originalidad de la obra y de todos de sus elementos; 3.- que en el caso de que en la obra se contengan o utilicen elementos los derechos de propiedad intelectual sobre los cuales pertenezcan a terceros autores, artistas, productores o editores, el/la artista ha obtenido las autorizaciones necesaria para su incorporación a la obra y el uso de la misma según lo previsto en el presente contrato sin coste alguno para Fundación Manifesta 8 Región de Murcia. El/la artista garantiza que no existe ni contraerá ningún compromiso, acuerdo, opción o gravamen sobre los derechos mencionados en el párrafo anterior que pueda limitar o impedir la cesión a Fundación Manifesta 8 Región de Murcia de los mismos ni el ejercicio totalmente pacífico de los derechos por parte de ésta -y/o por parte de cualesquiera terceros designados por Fundación Manifesta 8 Región de Murcia - con el alcance descrito en el presente contrato. El/la artista se hace plenamente responsable ante Fundación Manifesta 8 Región de Murcia y ante terceros de cuantas reclamaciones puedan surgir como consecuencia del incumplimiento de las garantías por él prestadas en la presente cláusula, así como de la indemnización de cualesquiera daños y perjuicios causados, manteniendo totalmente indemne a Fundación Manifesta 8 Región de Murcia y a tales terceros.

Manifesta 8 Región de Murcia garantiza/se compromete a: (falta este punto

ejem, ejem…..)

en este apartado…

Cortesía A la finalización de Manifesta 8, toda la documentación de los proyectos financiados total o parcialmente por Manifesta 8 irán acompañados de la línea de cortesía: Manifesta 8 Región de Murcia, España. Cualquier otro uso comercial (merchandising, souvenirs, etc) será objeto de un acuerdo adicional con el artista. El artista proporcionará la información pertinente relativa a instituciones que hayan contribuido a la producción de la obra y deban ser mencionadas en todas las publicaciones y material de comunicación.

CAUSAS DE RESOLUCIÓN DEL CONTRATO Serán causas de resolución: a) El incumplimiento del objeto del contrato. b) El acuerdo mutuo de las partes. El incumplimiento de alguna de las obligaciones del presente contrato Otros acuerdos En caso de legislación contradictoria, la ley española será la única vinculante; y la corte autorizada será la de Murcia.

Fdo.

Fdo.

Hedwig Fijen Presidenta Fundación Manifesta 8 Región de Murcia Murcia, 3 de agosto de 2010.

Corporación Bacilö.


Documentación desclasificadade régimen interno://..

Estimadas MICROcorporaciones Fieles Patrocinadores de Bacilö, Como pueden Uds comprobar en los últimos mails recibidos y enviados en y desde el correo de la Corporación Bacilö, las conversaciones con el ENTE organizadorcomisario del proyecto MoCHA Sessions de Manifesta8, están en un momento de crisis éxitofracaso muy interesante puesto que está generando documentos por ambas partes de un increíble valor. Tras el envío de un texto revelador donde se abordaba el marco teórico del proyecto CONTABILIDAD, aún se le piden más detalles a la Corporación. Como respuesta, en el último mail que Bacilö ha remitido a Yolanda M8, la Corporación se ha comprometido a enviar nueva documentación el próximo martes 7 de septiembre (pueden revisar dicho mail en el correo corporativo en la carpeta SENT/ENVIADOS). Por lo tanto, estas son las instrucciones a seguir por todos los operarios para los próximos días: 1. Elaboración de lo que Bacilo ha denominado Descripción Administrativa de la acción. Cada operario deberá preparar un documento que, mediante el uso de Lenguaje Esquemático y Administrativo bacilö, acompañado de todos los recursos que cada uno estime oportunos (gráficos, esquemas, fórmulas matemáticas,….), haga una descripción lo más objetiva posible de la acción a llevar a cabo. Está de más recordarles que la elaboración de este documento así como la interpretación de lo que puede significar Descripción Administrativa debe ser siempre abordado desde una óptica Bacilö. Cada operario realizará individualmente una Descripción Administrativa. El contenido de todas las Descripciones Administrativas enviadas al correo de la Corporación serán remezcladas y fusionadas en una única Descripción Administrativa Final. 2. Tomando como base la partitura de la Misa Episcópica Bacilö, ya modificada por la MICROcorporación Husflid (documento adjunto a este mail). Revisar y añadir nuevas modificaciones que consideren oportunas. La intención es ir entramando el guión de la acción. Como se hará con el documento Descripción Administrativa Bacilö, la partitura que será enviada a Yolanda M8 fusionará todas las modificaciones y ampliaciones del texto base en un solo documento, que podríamos llamar la prePARTITURA. Calendario y plazos: Envío de los documentos desde los operarios al correo corporativo___hasta el domingo 5 de septiembre (incluido) Elaboración de los documentos finales ( Descripción Administrativa Bacilö + prePARTITURA) resultado de la remezcla y fusión de los documentos aportados por los operarios_____el lunes 6 de septiembre. Envío de los documentos finales resultantes______martes 7 de septiembre Desde la Corporación se les ruega que reflexionen y enfoquen sus energías bacilö en el punto en el que estamos para los próximos días.


Estamos en un momento muy interesante y enriquecedor de este trabajo, desde la Corporación Bacilö se les anima a que den lo mejor de su sabiduría bacilö en pos de la consecución de un buen trabajo. “No es posible hacer La Araña con un solo operario o incluso con 2. En la correcta ejecución de este ejercicio de Poder reside la fuerza de Bacilö”. REVELACIONES DE BACILÖ, cánticos para la vieja, era

Reciban un HOLA A BACILÖ AHORA! y un RA!!! Corporación Bacilö / Asuntos Internos ************************************************************************************************************

ESTIMADOS tod@s respondo brevemente a varias de las informaciones e instrucciones recientes para confirmar la aportación de los textos solicitados por parte de la Corporación y que consumeESTO presentará en las fechas indicadas.  Queridos operarios y MICROcorporaciones Bacilö, Adjunto el documento remezclado con todas las aportaciones de NO TODOS ustedes. Como podrán observar al final de dicho documento se le solicita a M8 Y1 un aplazamiento en el envío de la Partitura en aras de formalizar un documento si no más aclarador sí (y esto es asunto sólo de la Corporación) en pos de elaborar un documento realmente Bacilö, es decir, con la participación del 100% de sus componentes. Si no recibo ninguna orden de rectificación o ninguna sugerencia de cambio o corrección del documento, éste será enviado mañana a primera hora de la mañana. disfruten de sus SuperSalones NEW MODELS FOR A NEWBATTLE ********************************************************************** From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; eurrutia bear37 <pedro.eurrutia@gmail.com>; Claudio Aldaz <clau_aldaz@yahoo.com>; bacilö <corporacionbacilo@yahoo.com.au>; NEGRO guirao <pedroguirao@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>; señor restado <laracraft@hotmail.com>; COMMENT ALLEZ VOUS? <in_direct_film@hotmail.com> Sent: Tue, 7 September, 2010 11:02:05 AM Subject: NUEVO APORTE INFORMATIVO Estimada Yolanda, Como le fué anunciado la semana pasada, Corporación Bacilö ha recopilado, de manera excepcional, en el documento que adjuntamos a este mail, TODA LA INFORMACIÓN de la que disponemos en este momento, lo más detallada y clara posible, relativa a la acción performativa en la que estamos trabajando incluida en nuestra propuesta CONTABILIDAD. Esperamos sinceramente que este nuevo aporte satisfaga su demanda y complete el vacío comunicativo, impulsando definitivamente la continuidad de este proyecto. Como en el mismo documento está explicado, no poseemos más detalles que los que en este momento le enviamos. Nuestra propuesta, como en el resto de trabajos de Bacilö, sigue en proceso de revisión, transformación y ampliación hasta el mismo día en el que se hace efectiva, por lo que es natural que la información que ahora ofrecemos sufra sutiles cambios en los días venideros.


Por esta misma lógica de continuum work in progress, y respondiendo a su comentario en el último mail recibido, "...creo que yo he sido clara desde un primer momento con las condiciones que se os ofrecían para participar en este proyecto y creo que no habéis expresado desde un primer momento la premisa de mantener este secreto en el trabajo que plantearéis en este marco, un detalle que sólo quedó claro el día que Claudio vino a revisar vuestro contrato." es natural que la información al inicio del proyecto fuese más escueta e indefinida que ahora, como será más amplia y detallada conforme avanca el tiempo. Si Ud. así lo desea, Corporación Bacilö se compromete a enviarle en los días que siguen hasta la fecha de presentación de la propuesta CONTABILIDAD un reporte informativo (en formato similar al actual documento adjunto), cada vez que el trabajo sufra ampliaciones y modificaciones sustanciales. Para su tranquilidad, a estas alturas del proceso, las líneas más determinantes de nuestra propuesta están bastante fijadas. La natural evolución sólo producirá básicamente mayor nivel de detalle en dichas líneas y no giros drásticos. Como siempre le invitamos a que siga comunicándonos vía mail cualquier duda respecto a este trabajo de la forma más concreta posible. Corporación Bacilö responderá igualmente de la manera más concreta y detallada posible. Esperando sus opiniones, Le saluda atentamente, CORPORACIÓN BACILÖ

videos http://es.youtube.com/eventoterapia für kinder http://www.piczo.com/corporacionbacilo für generationBACILÖ http://www.myspace.com/corporacionbacilo

BACILö REAL http://corporacionbacilo.blogspot.com/


ANTES

BEFORE


DESPUÉS AFTER


De: Corporación Bacilö Dirigido a: Resposable/es de comisariado del proyecto MoCHA Sessions Seguimos sin entender en que sentido y a que nivel dificulta el desarrollo profesional del proyecto MoCHA, el hecho de que queramos mantener en secreto los detalles descriptivos de nuestra acción. Si atendemos al aspecto técnico, en ningún momento nos hemos negado ni nos negaremos a facilitar toda la información técnica necesaria para un correcto montaje y organización del proyecto. Por lo que entendemos que nuestra postura en ninguna manera afecta negativamente al correcto desarrollo del proyecto MoCHA en su apartado técnico. En cuanto al apartado curatorial, que es, según creemos por el último mail que se nos ha remitido, el punto conflictivo de todo este asunto, siempre hemos estado y seguimos estando completamente dispuestos a ofrecer con detalle toda la información relativa al contexto conceptual de nuestra propuesta. Por lo cual seguimos sin encontrar dónde está el motivo real que determina que nuestra postura en este proyecto NO es profesional, que constituye un problema y un obstáculo a parte de ser calificada como IRRESPETUOSA con el trabajo del comisario. Nuestra actitud siempre ha sido y será dialogante, siempre ha sido y será respetuosa con el trabajo de los demás. Desde hace 7 años, Corporación Bacilö trabaja y ha trabajado siempre con profesionalidad, incluso en momentos en que desde la parte curatorial u organizativa han faltado a este principio. Y es precisamente apelando a esa profesionalidad y a nuestro deseo de establecer un diálogo más profundo si cabe que solicitamos: - un encuentro durante la primera semana de septiembre con el/la responsable último del apartado curatorial del proyecto MoCHA en el que ambas partes podamos exponer claramente nuestras posturas y llegar a un acuerdo y entendimiento definitivos. - una explicación por escrito de los motivos que justifican la necesidad, por parte del equipo curatioral, de conocer los detalles descriptivos de la acción que Corporación Bacilö pretende realizar dentro del proyecto MoCHA. Escrito en el que se argumente el por qué la omisión de dicha información dificulta y traba el correcto desarrollo de las labores de comisariado, con el único fin de que podamos entender la necesidad de dicha demanda. Si así se requiriera, Corporación Bacilö, se compromete igualmente a elaborar un escrito donde se justifiquen los motivos por los cuales el secreto de su acción constituye un aspecto fundamental en el mantenimiento de la integridad conceptual del trabajo a desarrollar. Esperando su consideración y una pronta respuesta les saluda atentamente, Corporación Bacilö


DES-CORRESPONDENCIAS DES-correspondencias BATALLA EPISTOLAR MAILS HISTORIA EPISTOLAR EXTENDIDA DEL ÉXITO-FRACASO DE CORPORACIÓN BACILÖ EN SU RELACIÓN CON EL ENTE INSTITUCIONAL BUROCRÁTICOCULTURAL RELACIÓN DE E-MAILS


Hola chicos,

Aquí tenéis la información del archivo del MoCHA (Museum of Contemporary Hispanic Art) que tengo por ahora junto con una breve presentación del proyecto con el archivo que se va a plantear en Murcia y un primer esbozo de las ideas que basan y articulan el proyecto. Disculpad pero toda la información está en inglés, dentro de poco dispondré de más info también español. Una parte de los materiales del archivo han sido digitalizados hace poco y subidos a los archivos del Estado de Nueva York, les podéis echar un vistazo en este link http://iarchives.nysed.gov/dmsBlue/getCollectionImagesServlet?id=68646 Es la única información visual que os puedo facilitar por ahora,

En este link tenéis el artículo de una exposición que se planteó en este y otros dos museos más en 1990, “The Decade Show” http://www.nytimes.com/1990/05/25/arts/review-art-3-museums-collaborate-to-sum-up-adecade.html?pagewanted=1 Bueno, esto es lo que os mando por ahora para que os vayáis haciendo una idea, Hablamos pronto, Un saludo, Yolanda

Yolanda Riquelme Asistente de comisariado Manifesta 8 Manifesta 8, la Bienal Europea de Arte Contemporáneo Región de Murcia en diálogo con el Norte de África 2 de octubre 2010 - 9 de enero 2011 http://www.manifesta8.es ----Antiguo Cuartel de Artillería | Pabellón 5. C/ Madre Elisea Oliver Molina, s/n 30002 Murcia (Spain) yolandariquelme@manifesta8.es t. +34 868 95 06 51 m.+34 671 64 22 75


Yolanda Riquelme Curatorial Assistant Manifesta 8 Manifesta 8, the European Biennial of Contemporary Art Region of Murcia ( Spain ) in dialogue with northern Africa nd th October 2 , 2010 - January 9 , 2011

http://www.manifesta8.es ----Antiguo Cuartel de Artillería | Pabellón 5. C/ Madre Elisea Oliver Molina, s/n 30002 Murcia (Spain) yolandariquelme@manifesta8.es t. +34 868 95 06 51 m.+34 671 64 22 75

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporacionbacilo@yahoo.com.au; pedroguirao@pedroguirao.com; claudio@aldaz.es

13 April, 2010 8:05:37 PM

Sent: Tue, Subject: Proyecto archivo Hola a todos,

Espero que todo vaya bien. Estos últimos días estamos avanzando mucho en el desarrollo de la bienal y tenemos que ir aclarando ciertas etapas de los proyectos lo antes posible, por motivos de disponibilidad del archivo de Nueva York y mía propia, he tenido que adelantar a la semana que viene el visitar el archivo allí para seleccionar el material que traeremos a Murcia (que como os comenté, estará aquí desde junio), me gustaría por tanto tener previamente por parte de cada uno de los artistas participantes unas nociones de los bloques de interés con los que posteriormente pueden trabajar para desarrollar su trabajo, prefiero hacerlo de esta manera para que lo que traigamos sea realmente significativo y pueda ser integrado coherentemente en el proceso de trabajo posterior, Es por esto por lo que me gustaría saber si finalmente consideráis que podéis trabajar con esta propuesta y en el caso de que así sea, si podrías ir definiendo las áreas que os podrían interesar a lo largo de esta semana, esto me va a servir para estructurar mi primer acercamiento al material de Nueva York, a partir de ahí, me gustaría concertar algún meeting por skype esta semana que viene en el que podamos trabajar juntos para terminar de definir el material realmente interesante, Siento que todo sea algo precipitado, sin embargo los ritmos de una bienal de estas características nos obligan a definir aspectos con cierta rapidez, por ahora en cualquier caso, sólo tendría que saber con qué áreas crees que podrías trabajar, el proyecto por supuesto iría definiéndose a lo largo de los meses posteriores. Ya que el otro día hablamos muy rápido del proyecto del archivo y su justificación, me gustaría comentaros algunos detalles que creo que son importantes de mencionar, Como ya sabéis, el planteamiento inicial de la bienal Manifesta es el de establecer un diálogo con el Norte de África planteando la articulación de diferentes conexiones y discursos en torno a la relación norte-sur, esta va a ser la primera edición de la bienal en la que se gira en torno a


este eje y se mira a otro continente, ya que desde su origen Manifesta ha reflexionado en tono a las relaciones este-oeste dentro del contexto europeo. Esta ha sido la propuesta temática inicial que han recibido los colectivos de comisarios participantes en la bienal, a partir de ahí cada colectivo ha reaccionado de una manera diferente. La reacción del colectivo ACAF a esto ha sido de rechazo a asumir esta temática preestablecida para configurar su proyecto y han optado por plantear una crítica y revisión a este tipo de exposiciones temáticas que pueden ofrecer al espectador una idea ficticia de una realidad cohexionada y simplificada que en realidad no existe. Todo su proyecto por tanto se articula en torno a un análisis del sistema del arte, de la posición del artista y la de ellos mismos como comisarios en todo este entramado. Para ACAF, este tipo de narrativas curatoriales monumentales, de paso tan de “carne de bienal” (diálogo intercultural, norte-sur, este-oeste, inmigración y el recurso del agua, por poner los ejemplos específicos de esta bienal) tienen su origen en un momento determinado de la historia en el que las instituciones comienzan a pedir una justificación clara de cualquier proyecto cultural, hablamos de los 80 y del momento en el que en Inglaterra Margaret Tatcher sube al poder y en los Estados Unidos, Ronald Reagan, (esta claro que en el caso español, las circunstancias de nuestra historia determinan un desarrollo diferente de este proceso, pero creo que comenzamos a recibir poco a poco este tipo de herencias culturales desde la instauración de la democracia) El Museo de Arte Contemporáneo Hispanoamericano surgió en el año 85, un momento en el que estaban fraguando este tipo de metodologías de trabajo curatorial, en el archivo incluso está la carta de Reagan apoyando y remarcando la importancia de la creación de un museo de estas características, una institución que daba visibilidad a una serie de artistas que se movían en ámbitos alternativos, de un origen determinado – latino en este caso - y que no tenían una representación en otros museos “mainstream”, dominados por artistas que atendían al perfil de “hombre occidental blanco”, sin tener en cuenta que al mismo tiempo, de alguna manera, estos artistas quedaban así recluidos en una especie de guetto artístico Sin embargo, a pesar de los logros y estas intenciones que fundaban el origen del museo, éste acabó cerrando tan sólo 5 años más tarde, Consideramos que el origen y cierre de este museo es significativo dentro de un momento clave de la historia, el archivo se trae para reflexionar y especular en torno a su cierre y por tanto su “fallo” como museo, ¿Por qué el museo no funcionó? ¿Cómo pudo un centro artístico tan importante aparecer y desaparecer tan fácilmente? ¿Fue su programa expositivo fortuito o supuso el surgimiento de otra visión de la institución y del trabajo curatorial? Por tanto, estos discursos de crítica institucional y de revisión del sistema artístico son los que justifican el traerse el archivo de este museo muerto, el hecho de que sea de Nueva York y de arte hispanoamericano ha sido circunstancial, pero al mismo tiempo nos ha parecido muy interesante el hecho de que se trate de arte hispano que viaja a España y a partir de ahí creemos que se puede plantear otra posible línea de trabajo girando en torno a la idea de la toma de conciencia de comunidad artística por parte de unos artistas que poseen un sentido de pertenencia a dicha comunidad a través de la identificación compartida con una identidad determinada, hispana en el caso de los artistas del museo, española en el caso de los artistas que trabajaran desde Manifesta, quizás, ¿y qué similitudes / diferencias pueden haber entre estas dos identidades que comparten ciertas conexiones pero se han desarrollado en contextos tan diferentes?

Con respecto a las condiciones de participación, por ahora todo sigue tal y como os comenté, tan sólo que hasta que no reciba una respuesta de sponsorización por parte de algunas empresas con


las que hemos contactado, he decidido reducir el número de artistas participantes a 7 para tener algo más de margen (por ahora los artistas con los que he hablado son Rosell Meseguer, Ana Martínez, Jeleton, Eduardo Balanza, Irene Lucas y Cristoph Euler, Sam 3 y vosotros) En cualquier caso os escribo a continuación lo que os conté para que todo quede más claro,

En principio el dinero que dispongo para cada artista es de 1000 euros, digo en principio porque este es el presupuesto base con el que contamos desde Manifesta pero a partir de aquí estamos trabajando desde nuestros departamentos de Grants y Marketing para conseguir otro tipo de ayudas y sponsors que nos puedan permitir el ampliar este presupuesto inicial de producción así como el cubrir otros gastos adicionales como el transporte, alojamiento, etc..

El último contacto que he establecido ha sido con el Instituto Cervantes, ya que este proyecto va a involucrar a artistas españoles y se plantea el ser presentado en Nueva York a su término, creo que encaja bastante en sus esquemas y podemos tener posibilidades de conseguir alguna aportación por su parte, la semana que viene me reúno con los responsables del Instituto en Nueva York para presentarles el proyecto y pedirles una subvención.

Se realiza un contrato con el artista donde se establecen los detalles de su colaboración, el presupuesto concedido finalmente para la realización de la obra, el pago, los detalles de instalación, desinstalación y seguro de la pieza, así como los derechos de reproducción de la obra por parte de Manifesta 8 durante el periodo de exposición. Estamos trabajando con un estudio de arquitectos de Berlín, nOffice ( http://www.noffice.eu/ ) , que va a realizar el diseño expositivo de las sedes de ACAF en Manifesta (el espacio de exposiciones temporales en el Museo ARQVA de Cartagena y el antiguo Edificio Correos y Espacio AV en Murcia), para el Espacio AV se planteará un espacio donde se dispondrá el archivo, documentos seleccionados y catálogos de exposiciones del museo, a modo de espacio de consulta y trabajo, a su vez se dispondrá otro espacio donde se realizarán las


presentaciones y contará con algunos elementos móviles que permitan adaptarlo a las necesidades expositivas de cada trabajo. Paralelamente también se desarrollará un programa de performances que tendrán lugar durante la primera semana de la bienal, aunque todavía estamos definiendo y cerrando este programa. Os adjunto también en este e-mail, las únicas imágenes digitalizadas que tenemos por ahora del archivo sólo para que podáis haceros una idea, también os envío el texto de la “Teoría de la Enigmática Aplicada”, la teoría que el equipo de ACAF ha desarrollado para abordar la estructuración de su proyecto para Manifesta, creo que os puede ayudar a entender mejor todos estos planteamientos Por favor, no dudéis en hacer cualquier comentario o pregunta sobre el tema, sí que me gustaría pediros una respuesta lo antes posible para tener clara vuestra participación en el proyecto, Mañana por la tarde llamo a Claudio para seguir hablando del tema, Un saludo, Yolanda

Yolanda Riquelme Asistente de comisariado Manifesta 8 Manifesta 8, la Bienal Europea de Arte Contemporáneo Región de Murcia en diálogo con el Norte de África 2 de octubre 2010 - 9 de enero 2011 http://www.manifesta8.es ----Antiguo Cuartel de Artillería | Pabellón 5. C/ Madre Elisea Oliver Molina, s/n 30002 Murcia (Spain) yolandariquelme@manifesta8.es t. +34 868 95 06 51 m.+34 671 64 22 75

De: Claudio Aldaz [mailto:claudio@aldaz.es] Enviado el: martes, 20 de abril de 2010 23:55 Para: Yolanda Riquelme Asunto: Re: hola desde Manifesta

Hola Yolanda Hemos tenido una reunión y hemos decidido confirmarte que el proyecto nos interesa y que bacilö quiere participar

a la espera de las condiciones

definitivas. Nos vamos a plantear una forma de proceder acorde a las

condiciones de trabajo, como ya habíamos comentado previamente. En breve Corporación bacilö o una de las micro-corporaciones que lo representan se comunicará contigo

vía mail para continuar con el resto de avenencias que nos quedan.

Un cordial saludo Claudio


Hola Claudio, Me pillas justo ahora con el ordenador, estupendo! Entonces, si te parece, paso a poneros en contacto con Neli, la responsable de Grants en Manifesta, para que empiece a trabajar con vosotros para pedir subvenciones, sé que en este momento hay una convocatoria de la Comunidad de Madrid para Artes Plásticas, como uno de vosotros (no recuerdo quién) vive allí, creo que podemos pedir alguna ayuda para él, el plazo para presentarnos a esta convocatoria es el 28 de abril, por lo que no tenemos mucho tiempo, lo que necesita Neli tan sólo es el currículum, así que estaría genial que lo tuviera cuanto antes, quizás estaría bien tener el correo directo de este chico que vive allí, ¿Qué pensáis? Si confirmamos entonces vuestra participación, necesitaría también vuestra bio como colectivo para ponerla en el catálogo, os mando a continuación otro mail donde tenéis el modelo que nos ha mandado el editor para que la vayáis preparando, Os mando algunas imágenes más del archivo, son muy malas porque son fotos que he hecho yo con mi cámara corriendo, pero es sólo para que veáis algo, luego tendríamos que escanearlas en una buena resolución, Espero pues un próximo contacto bien de la corporación con mayúscula o de una de las micro para seguir con el plan MoCHA, Un saludo! Yolanda

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: pedroguirao@pedroguirao.com; Claudio Aldaz <claudio@aldaz.es>; corporacionbacilo@yahoo.com.au Sent: Wed, 21 April, 2010 12:16:51 AM Subject: componentes Por cierto, ¿me podríais mandar los nombres de todos los integrantes del colectivo? Por favor especificad cuál de vosotros vive en Madrid y cuál no es de España, nos viene muy bien saber la nacionalidad porque quizás podemos pedir alguna subvención a alguna institución de su país de origen, Gracias, Yolanda Riquelme Asistente de comisariado Manifesta 8

****************************************************************** From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Neli Kovacheva <neli.kovacheva@gmail.com> Cc: corporacionbacilo@yahoo.com.au; pedroguirao@pedroguirao.com; Claudio Aldaz <claudio@aldaz.es>

, 21 April, 2010 12:19:54 AM

Sent: Wed

Subject: Corporación Bacilö Hola Neli,


Seguimos definiendo el proyecto del archivo MoCHA y de nuevo me gustaría

“presentarte” a otro colectivo que va a participar en el proyecto, se trata de la Corporación Bacilö, formada por cinco

componentes, uno de ellos vive en Madrid, por lo que quizás en su caso podríamos optar a pedir una subvención a la Comunidad de Madrid, les he escrito para que me especifiquen de quién se trata y supongo que enseguida recibirás noticias de ellos. Señores Bacilö, os hablé ya de Neli, ella es la responsable de Grants en Manifesta 8, por lo tanto encargada de ayudarnos a buscar subvenciones y financiación extra para los diferentes proyectos que se presentarán en la bienal, es posible que os escriba si necesita información sobre vosotros para pedir algún tipo de ayuda, como vuestro currículum artístico, etc, también nos puede ayudar en el caso de que necesitéis alguna carta de invitación de Manifesta de cara a pedir vosotros otras ayudas, no dudéis en poneros en contacto con ella o conmigo para cualquier cosa que necesitéis o cualquier duda que tengáis, Gracias a todos por la colaboración, Un saludo Yolanda From: Neli Kovacheva <neli.kovacheva@gmail.com> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Cc: corporacionbacilo@yahoo.com.au; pedroguirao@pedroguirao.com; Claudio Aldaz <claudio@aldaz.es> Sent: Wed, 21 April, 2010 9:04:52 AM Subject: Re: Corporación Bacilö

Hola Yolanda, Me alegro que todo vaya bien y que se vaya ampliando el número de artistas para el proyecto MoCHA. Tan solo quería recordar que el plazo para la subvención de la Comunidad de Madrid es el 28 de abril, y por lo tanto pedir que los artistas madrileños se pongan lo antes posible en contacto conmigo para poder valorar las posibilidades y ponernos en marcha. Gracias a todos!!! Un saludo, Neli Kovacheva Coordinadora Subvenciones para Manifesta 8 ***************************************************************+** From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporacionbacilo@yahoo.com.au; pedroguirao@pedroguirao.com; Claudio Aldaz <claudio@aldaz.es> Sent: Wed, 21 April, 2010 12:22:32 AM Subject: bio Manifesta 8 Hola,


Bueno, como os comentaba, aquí tenéis el ejemplo de bio que necesito para el catálogo, tenemos que estructurar esta información de acuerdo al diseño que el editor nos ha mandado, aquí os adjunto un ejemplo para que os hagáis una idea, la parte del texto que explica vuestro trabajo tiene que tener un máximo de 130 palabras o 700 letras

Céline Condorelli 1974, Paris . Lives and works in London . Céline Condorelli works with art and architecture, combining a number of approaches from developing structures for ‘supporting’ (the work of others, forms of political imaginary, existing and fictional realities) to broader enquiries into forms of commonality and discursive sites, resulting in projects merging politics, fiction public space and whatever else feels urgent at the time. Céline Condorelli is the author/editor of 'Support Structures' on Sternberg Press (2009) and one of the founding directors of Eastside Projects, artist-run exhibition space in Birmingham , UK . Recent exhibitions include ‘Revision, part 2’ at Cell Project Space, London (2010), 'Generosity is the new political' at Wysing Arts, Cambridge , 'And the columns held us up' at Artists Space, New York City (2009). Recent projects include developing Support Structure phase 1-10, with Artist-Curator Gavin Wade, various sites (2003-2009). Así ya lo vais preparando, sólo para que lo tengáis en cuenta, necesitaría mandarlo al editor a finales de este mes, si tenéis alguna duda ya sabéis dónde encontrarme, Bienvenidos a bordo! Espero no haberos asustado con este bombardeo sistemático, Seguimos hablando pronto, Un abrazo Yolanda

********************************************************************** From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Cc: COMMENT ALLEZ VOUS? <in_direct_film@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>; señor restado <laracraft@hotmail.com>; claudio@aldaz.es; pedroguirao@pedroguirao.com Sent: Thu, 22 April, 2010 6:09:55 PM Subject: Re: hola desde BACILÖ HOLA diga HOLA a bacilö AHORA:--_HOLA ..//~·$¬¬Estimada Yolanda_//-La Corporación tiene el placer de ponerse en contacto con usted para confirmarle su presencia en EL PLAN MOCHA (siempre que se proceda de manera contemporizada, esto es, _sin prisas causas por la agonía). Bacilö ha PRE-accedido y comienza a barajar unos parámetros y contra-prestaciones en el caso de que las condiciones no sean del todo satisfactorias. Se las haremos llegar contemporizadamente. -->Para nosotros será un placer comenzar los PRE_preparativos y prepararles la información que nos solicitan. Estamos re-estructurando el equipo y la forma en la que procederemos con la comunicación de aquí en adelante. Tras la procedente deriva de responsabilidades estableceremos un mutuo acuerdo de la forma de proceder. -//Mientras tanto podemos facilitarle parte de la información que nos solicitan. bacilö se compone de 5 microcorporaciones de diversa procedencia y planteamientos


artísticos_o NO consume ESTO: Murcia, España (see logo *) NEW MODELS: Murcia, España (") SUPERARTE: Cieza, Murcia, España (") IN_direct-FILM: Paris, Francia, [ubicado en : Murcia, España] (") HUSFLID: Porsgrunn, Noruega (") [ubicado en: Madrid, España] *Se puede enviar en calidad superior. En breve le adjuntaremos el resumen de modelo)

bio solicitado_(bajo modelo_y _sin

Estamos procesando la información que nos has mandado, en cualquier caso podemos especificarle que bacilö ha señalado [dejando entrever parte del asunto sobre el que versará su propuesta-proyecto-procedimiento procesual] el concepto:

CONTABILIDAD

. Por lo cual le solicitamos toda aquella información que pueda recavar a cerca de gastos-ingresos, precios de entrada al museo, facturas de envíos y transportes, gastos totales de organización de un evento o exposición, fácturas de ágapes-inauguraciones, FACTURAS DE TODO. Atentamente Equipo de Operadores de DERIVA del departamento de PRE-comunicación. videos http://es.youtube.com/eventoterapia für kinder

http://www.piczo.com/corporacionbacilo

für generationBACILÖ

http://www.myspace.com/corporacionbacilo

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Cc: COMMENT ALLEZ VOUS? <in_direct_film@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>; señor restado <laracraft@hotmail.com>; claudio@aldaz.es; pedroguirao@pedroguirao.com Sent: Fri, 23 April, 2010 3:08:53 PM Subject: RE: hola desde BACILÖ Estimados señores,

Es también para mi un placer el contar con su presencia en el mencionado plan que nos ocupa en este momento, a partir

de aquí puedo asegurar que las prisas se minimizarán al máximo ya que el material del archivo estará a su disposición desde junio y el plan MoCHA verá la luz en octubre. Muchas gracias por toda la información acerca de su grupo y su imagen corporativa


PRE-agradezco su PRE-aceptación, y espero

con curiosidad saber los parámetros y contra-prestaciones de los que hablan, Sí que me gustaría pedirles una confirmación de participación en base a todo lo que hemos hablado, es fundamental para mí saber con seguridad qué agentes formarán parte de este proyecto,

Las condiciones de las que hablamos sólo cambiarán para incrementar su presupuesto inicial, como dije, algo que no puedo asegurar todavía, pero en lo que estamos trabajando. Con respecto a este tema, he apreciado que una de sus micro-corporaciones se encuentra ubicada en Madrid HUSFLID: Porsgrunn, Noruega (") [ubicado en: Madrid, España]

Ya que tenemos la posibilidad de solicitar una ayuda a la Comunidad de Madrid, solicitaría unos datos más detallados de esta micro-corporación específica, entiendo que esta información pueda tener un cierto grado de confidencialidad (y si ustedes lo prefieren no la incluiremos en el catálogo), pero en este caso puede ser interesante el utilizarla para conseguir una ayuda corporativa

Tomo nota de sus intereses con el material del archivo, creo que queda bastante claro por dónde van a encaminar sus pasos dentro de este plan, Recibirán noticias mías en breve, Muchas gracias por su atención, Reciban un cordial saludo, Yolanda

**********************************************************************

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Cc: COMMENT ALLEZ VOUS? <in_direct_film@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>; señor restado <laracraft@hotmail.com>; claudio@aldaz.es; pedroguirao@pedroguirao.com Sent: Tue, 27 April, 2010 10:25:19 AM Subject: hola Hola chicos, Tan solo una cosa rápida, ¿me podrías enviar por correo electrónico el CV de la Corporación por favor? Para que quede más claro el tema de la bio, os envío aquí otro ejemplo de bio de colectivo que ya he recibido para que os hagáis una idea más clara, Un saludo, Yolanda

Take to the Sea


Lina Attalah 1982, Cairo . Lives and works in Cairo . Laura Cugusi 1982, Sardinia . Lives and works between Cairo and Sardinia . Nida Ghouse 1982, Bombay . Lives and works out of Bombay . Long before it was named, Take to the Sea was conceived in an attempt for someone with the wrong passport to have the right reason to get the official letter that would then enable a visa to stay on in Cairo . More formally, as an open-ended research project on ‘irregular’ migration from Egypt to Italy via the Mediterranean Sea, it was initiated in 2008 and funded in its first phase by the Centre for Migration and Refugee Studies at the American University in Cairo. Since then, it has mutated many times, and different minds and motivations have migrated through it to produce sound, moving-image, and text-based work. In its most recent configuration, Take to the Sea turned the tide in on itself to perform how its members inhabit some of the very conditions they seek to consider.

************************************************************ From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Tue, 27 April, 2010 7:23:34 PM Subject: Re: hola

Estimada Yolanda, Mañana miercoles 28 de abril, le será enviada la información requerida a Bacilö via email, en la franja horaria comprendida entre el café de la tarde (posttelediario) y el café de la mañana del día siguiente (post-reposo nocturno). Dado que mañana miércoles por la tarde, los componentes de la Corporación se reunirán, puede usted aprovechar dicha coyuntura para solicitar alguna otra información de su interés o exponer/comunicar dudas al respecto del trabajo que Bacilö pretende desarrollar dentro del proyecto MOCHA /Manifesta 8.


via email a esta dirección

Puede hacerlo durante la mañana.

Sin otro particular reciba un amistoso cordial y analógico saludo, Corporación Bacilö

videos http://es.youtube.com/eventoterapia für kinder

http://www.piczo.com/corporacionbacilo

für generationBACILÖ

http://www.myspace.com/corporacionbacilo

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Cc: COMMENT ALLEZ VOUS? <in_direct_film@hotmail.com>; kamachooo piotro <pedcario@hotmail.com>; señor restado <laracraft@hotmail.com>; claudio@aldaz.es; pedroguirao@pedroguirao.com Sent: Tue, 27 April, 2010 10:25:19 AM Subject: hola Hola chicos, Tan solo una cosa rápida, ¿me podrías enviar por correo electrónico el CV de la Corporación por favor? Para que quede más claro el tema de la bio, os envío aquí otro ejemplo de bio de colectivo que ya he recibido para que os hagáis una idea más clara, Un saludo, Yolanda

*********************************************************************


From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Tue, 27 April, 2010 7:42:19 PM Subject: RE: hola Estimados señores, De acuerdo, por ahora lo único que necesito es tener la documentación que les solicité previamente, es decir, bio del colectivo, Sin más tan sólo esperar que sigamos en contacto y transmitirles

Un cordial saludo Atentamente, Yolanda From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Thu, 29 April, 2010 11:25:11 AM Subject: bio Corporación Bacilö

Hola Yolanda Hola M8 Hola Bacilö, Como habíamos acordado aquí le remitimos la siguiente información requerida sobre nuestra Corporación: Bio de Corporación Bacilö Esperamos que se ajuste a sus necesidades, aunque nos hemos permitido la licencia de exceder minimamente la extensión recomendada. Aprovechamos para comunicarle que hemos abierto recientemente un blog donde tendrá acceso a información más amplia y detallada sobre los métodos y credos de esta ENTEidad. Le invitamos a que lo visite con periodicidad moderada. http://corporacionbacilo.blogspot.com/ En cuanto a la otra información demandada (Currículum), antes de proceder al envío, nos gustaría saber si le sirve el modelo que Corporación Bacilö ya envió, junto con un breve dossier al equipo de Manifesta hará unos meses.

"...no hay errores,...sólo hechos..." Corporación Bacilö


********************************************************************** From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Fri, 30 April, 2010 11:08:54 AM Subject: Fw: BACILÖ CV

HOLA Yolanda // MoCHA Project...Bacilö le comunica: Adjuntamos documentación tipo CURRICULUM VITAE Nos gustaría además que nos informara sobre los siguientes asuntos a efectos de organización interna de nuestra agenda corporativa: CALENDARIO_ fechas en la que está prevista la firma del contrato _ fechas de disponibilidad del Archivo _ fechas previstas para la muestra de resultados Atentamenta Corporación Bacilö Departamento de TeleComunicación / Radioemisión / preVISIÓN ********************************************************************** From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Fri, 30 April, 2010 12:17:02 PM Subject: RE: BACILÖ CV Hola señores, Gracias por el currículum, Con respecto a vuestras preguntas: Fechas en la que está prevista la firma del contrato – en cuanto cerremos totalmente la fase de estimación de proyectos en la que nos encontramos, esto será el

10 de Mayo

, en una semana aprox, inmediatamente

empezaremos a contactar con los artistas para formalizar el contrato de participación Fechas de disponibilidad del Archivo – en este momento la gente encargada del archivo en Nueva York está comenzando con la digitalización de documentos, hemos establecido el tenerlos en Murcia a partir de junio, con una fecha límite del 15 de ese mes, en cualquier caso yo ya tengo aquí en la oficina algunos catálogos que traje conmigo y también otros archivos digitales que me grabé en varios DVD y que os

los documentos de los que dispongo por ahora no son de contabilidad, sino de flyers de actividades / exposiciones del

podría pasar en el caso de que estuvierais interesados, sin embargo

museo.


Fechas previstas para la muestra de resultados – el proyecto MoCHA se va a inaugurar con la inauguración de la bienal, es decir, a principios de octubre, a partir de ahí los proyectos artísticos se irán presentando secuencialmente durante la duración de la bienal, desde este principio de octubre hasta el 9 de enero de 2011, el ritmo de presentaciones será de una cada dos semanas, es decir, dos al mes, aún no he definido eso ya que primero quería tener claro los artistas que participaban y a partir de ahí comenzar a hablar con ellos para, según su disponibilidad, ir configurando el programa de presentaciones, por lo que vosotros mismos podéis decirme en qué momento dentro de esta franja de tiempo os podría venir mejor, me vendrá muy bien tener algunas nociones de vuestra disponibilidad para ir teniendo una idea de la organización de las presentaciones Esto último lo podemos ir viendo con más calma en base a lo que vosotros vayáis hablando y definiendo para coordinaros los 5, Una última anotación es que hay varios artistas que participan en el proyecto que no viven en Murcia y para los que sería interesante conseguir una residencia por el tiempo en el que van a estar trabajando con el archivo, en el caso de que sea necesario, les voy a escribir pronto a la gente del LAB para ver si podrían poner a nuestra disposición los pisos que tienen para residencias artísticas, como en vuestro caso uno de vuestros compañeros quizás vendría a Murcia unos días, si me decís más o menos cuándo estáis pensando, ya podría hacer una primera sugerencia de fechas en las que estamos interesados a los del LAB, Espero haber aclarado vuestras dudas, pero para cualquier otra pregunta o comentario ya sabéis dónde encontrarme, Un saludo, Yolanda

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: laracraft@hotmail.com; Neli Kovacheva <neli.kovacheva@gmail.com> Cc: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Mon, 10 May, 2010 7:05:12 PM Subject: MoCHA project Hola, Aquí adjunto la descripción del proyecto MoCHA en inglés para la inscripción del OCA, No dudéis en poneros en contacto conmigo si necesitáis algo más de mi parte, Saludos, Yolanda From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Anders Restad <laracraft@hotmail.com>; Neli Kovacheva <neli.kovacheva@gmail.com> Cc: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Mon, 10 May, 2010 7:15:30 PM Subject: RE: OCA Hola chicos, Os escribo ahora para aclarar el punto del trabajo que Corporación Bacilö va a presentar en la bienal Manifesta 8, como ya hemos comentado en alguna ocasión, todos los artistas que participan en el proyecto del archivo desarrollarán su trabajo más adelante ya que no podrán trabajar en él hasta que no tengan a su disposición el material del archivo que hemos seleccionado.


Por ahora creo que para solicitar ayudas y subvenciones podemos utilizar la descripción general del proyecto que os acabo de mandar tal y como hemos hecho en otras ocasiones,

Con respecto al budget, en principio tenemos una suma previamente establecida desde Manifesta, la idea es aumentarla a partir de subvenciones si es posible, Thomas, nuestro director técnico, ha desarrollado un presupuesto base que de nuevo no está totalmente detallado para cada uno de los artistas ya que la definición de los proyectos y sus necesidades de producción, como ya he comentado, se perfilarán más adelante, Neli, te envío lo que tenemos por ahora a continuación espero que sea lo que necesitamos para esta solicitud, Para cualquier otra cosa, ya sabéis dónde estoy, Un saludo, Yolanda De: Neli Kovacheva [mailto:neli.kovacheva@gmail.com] Enviado el: lunes, 10 de mayo de 2010 16:56 Para: Anders Restad; Yolanda Riquelme Asunto: Re: OCA

Estimado Anders, Yolanda me ha comentado que podríamos comunicarnos perfectamente en español, así que sin pensarmelo más, sigo nuestra comunicación en castellano. Me temo que no entiendo lo que pone en la web de OCA, pero aquí va la información que necesitas. - the work bacilö are contracted to do and the budget - es un tema que tendréis que aclarar entre Bacilo e Yolanda. Yolanda, a lo mejor aquí necesitaríamos la ayuda de Thomas, no? - curatorial statement - attached - project description - te adjunto descriptión de Manifesta. En breve te pasamos tb la descripción general del proyecto MoCHA. Faltaría ampliar la información ( si fuera posible) con la parte que llevaría a cabo Bacilo - carta de invitación - será enviada esta tarde No dudes en ponerte en contacto conmigo para cualquier cosa. Por favor, mantennos informados sobre el desarrollo de la solicitud. Saludos, Neli


2010/5/10 Anders Restad <laracraft@hotmail.com> Hello Neli, I have been looking at the OCA page and the http://www.stikk.no/reisestotte/soknadsskjema.php?action=2&id=10 where the application is located. First of all, I am not that familiar with Manifesta 8 or the work bacilö are contracted to do for the festival, there are so many parts of the application I have no information available. Please if you could provide the following by copy and paste: ’Project description’, ’Curatorial statement’, ’Comments on the budget’ and 'additional comments'. We also need a formal invitation from the institution and its designated curator or director. I am currently translating my CV into english. Anders Date: Mon, 10 May 2010 08:39:52 +0200 Subject: OCA From: neli.kovacheva@gmail.com To: laracraft@hotmail.com; yolandariquelme@manifesta8.es Dear Anders, My name is Neli Kovacheva. I am the Grants Coordinator for Manifesta 8. I would like to welcome you to Manifesta 8 and remind you of the possibility of a grant from the Norwegian institution OCA. The deadline is 15th May. Please, do not hesitate to contact me if you should have any doubts. Best, Neli Kovacheva Grants Coordinator for Manifesta 8 +34 608 910 315

From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; neli.kovacheva@gmail.com; bacilö <corporacionbacilo@yahoo.com.au>


Sent: Wed, 12 May, 2010 7:19:40 PM Subject: Re: OCA

estimadas Neli y Yolanda Nuestro agente-operador ubicado temporalmente en Madrid: HUSFLID, nos informa

de los

excesivos requerimientos

demandados

para el acceso a la beca que le costearía única y exclusivamente el viaje. Según su informe acarraría un desgaste energético mayor preparar toda esa información que superaría con creces el fruto obtenido de todas esas gestiones burocráticas. El volumen de material solicitado: "- the work bacilö are contracted to do and the budget - es un tema que tendréis que aclarar entre Bacilo e Yolanda. Yolanda, a lo mejor aquí necesitaríamos la ayuda de Thomas, no? - curatorial statement - attached - project description - te adjunto descriptión de Manifesta. En breve te pasamos tb la descripción general del proyecto MoCHA. Faltaría ampliar la información ( si fuera posible) con la parte que llevaría a cabo Bacilo - carta de invitación - será enviada esta tarde" los requisitos que no dependen de nosotros mismos, la imposibilidad de presentar un resumen de propuesta debido a que, como sabemos todos, no se tendrá acceso directo al archivo hasta que este se encuentre en Murcia [y no será hasta entonces cuando bacilö

definitivamente

defina

su propuesta y presente consecutivamente un proyecto final], la necesidad de establecer unas fechas de ida y vuelta del billete cuando


aún no se ha concretado la fecha de intervención... todos estos entresijos burocráticos pertinentes resultan demasiado agotadores y requisan demasiado tiempo que hemos de invertir en otros menesteres y labores para la supervivencia de la Corporación. Por todo lo cual,la Corporación bacilö asumirá los costes de traslado, manutención y alojamiento del representante que HUSFLID envíe para la intervención. Somos conscientes de que ustedes intentan mejorar nuestras condiciones de trabajo. Somos así mismo conscientes de que el sistema no les deja. Agradecemos encarecidamente su atención y sus buenas intenciones. Atentamente Corporación Bacilö From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Cc: pedroguirao@pedroguirao.com; claudio@aldaz.es Sent: Thu, 13 May, 2010 10:35:21 AM Subject: OCA Hola señores, Después de vuestro último correo, me da la sensación de que no leen los e-mails que les envíamos, a ver, esta beca cubre los viajes de alojamiento y estancia pero también gastos de producción por lo que sí que puede ser interesante el solicitarla para aumentar el presupuesto del que disponen para su proyecto y por otra parte si finalmente cubren los gastos y alojamiento de Anders por su cuenta, quizás pueden invertir este dinero de la beca a su vez en algún otro apartado de su proyecto. Les vuelvo a hacer los comentarios que tanto Neli como yo ustedes:

YA

les enviamos a todos

NO es necesario que enviéis la descripción de vuestro proyecto ahora, ya que ESTA MUY CLARO que todavía no lo podeis definir ESTO YA SE LO DIJE A NELI Y A

1. Descripción del proyecto – COMO OS YA OS DIJE

VOSOTROS y le envié el proyecto del archivo para que se utilizara en esta solicitud.

Por otra parte, nuestro director técnico YA HA PREPARADO UN PRESUPUESTO GENÉRICO que se puede utilizar para esto sin que ustedes tengan que mover UN SÓLO DEDO.

2. Fechas en las que se desarrollará – SE PUEDEN DAR UNAS FECHAS

APROXIMATIVAS que son totalmente válidas aunque luego cambien para pedir la solicitud ahora, creo que eso es bastante sencillo, si queréis sugerencias… del 1 al 15 de septiembre / 15-30 sept / 1-15 oct……


3. A continuación se pedían una serie de documentos (curatorial statement, que YA

ESTÁN PREPARADOS Y ESTÁBAN ADJUNTADOS EN OTRO MAIL Y TAMBIÉN EN ESTE , señores se trata tan solo de un reenvío que se

gestiona con un clic.

4. Carta de invitación – QUE YA SE LES HA ENVIADO y que de nuevo sólo tendrían que adjuntar con otro clic.

1

Por lo tanto y resumiendo, el único trabajo que se les estaba pidiendo es tener preparado CURRICULUM EN INGLES que tenía que ser adjuntado con la solicitud y el resto de información ya puesta a su disposición, sinceramente considero que puede ser un esfuerzo equiparable al escribir uno de estos e-mails. Supongo en cualquier caso por sus comentarios, que igualmente esta acción les seguirá pareciendo un requerimiento excesivo, pero haganme saber si cambian de opinión porque puede merecer la pena.

En cualquiera de los casos respeto su decisión ya que no pretendemos forzar a nadie a realizar tales excesivas tareas y agradezco sus agradecimientos a la vez que aprecio su apreciación, Por nuestra parte seguimos intentando mejorar las condiciones del trabajo de todos a pesar de que muchos elementos ciertamente nos lo impidan, Seguimos en contacto, en breve me volveré a poner en contacto con ustedes para concretar otros apartados de su colaboración, Un cordial saludo, Yolanda From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Fri, 14 May, 2010 5:20:40 PM Subject: RE: OCA Hola Anders & co, Me alegra mucho el recibir este mail y comprobar que podemos emplear nuestros esfuerzos y nuestro tiempo en cosas realmente productivas, entiendo entonces que lo único que te falta es el presupuesto que te adjunto en este correo. Hemos preparado un presupuesto algo más inflado ya que como bien sabéis las instituciones suelen aportar un porcentaje del mismo, esperamos con esto el poder recibir la máxima ayuda posible para vuestro proyecto, hemos anotado un viaje de producción con una estancia de 15 días y también un viaje para la presentación de 3 días, ya que vosotros desarrolláis performances, y basándonos en anteriores trabajos vuestros, hemos añadido una serie de requerimientos de equipo técnico, otra cosa que hemos añadido es la publicación de una tirada de posters, estoy añadiendo esta parte del proyecto ya que junto con Neli nos estamos moviendo para conseguir subvenciones que nos permitan publicar una serie de posters (uno por artista) que terminen configurando una especie de publicación del proyecto con todas las intervenciones con un formato tipo periódico, os iré informando sobre esto a medida que vayamos consiguiendo cosas. Si tienes alguna duda, pregunta o comentario, me puedes localizar en este mail o en el teléfono 671 64 22 75,


Esperamos que haya suerte con esta solicitud, Un saludo, Yolanda

From: Anders Restad <laracraft@hotmail.com> To: alexandra@oca.no; yolandariquelme@manifesta8.es Cc: corporacionbacilo@yahoo.com.au Sent: Wed, 26 May, 2010 1:44:36 PM Subject: RE: OCA International Support Programme - Ref N. OCA02-2010B-14136

Hi Alexandra, As requested I attach an artist portfolio we did some years ago.

Regarding the budget I can confirm that the 7.741 is in kroner, it refers to the 1000 euros that I found in the budget. I do not have any insight into this part of the project, so this mail is also sent to the responsible person at Manifesta. Anders From: alexandra@oca.no To: laracraft@hotmail.com Subject: OCA International Support Programme - Ref N. OCA02-2010B-14136 Date: Tue, 25 May 2010 16:59:11 +0200 Dear Anders Restad, OCA is currently in the process of preparing the applications in relation to the International Support Programme, deadline 15 May, for the meeting of the Jury Committee. In relation with your application Ref N. OCA02-2010B-14136 we realize that some documentation is missing, respectively: 1. No visual material or artist portfolio. â&#x20AC;&#x2122;Upload Materialâ&#x20AC;&#x2122; should consist of visual documentation on on the project and/or artist's portfolio. It should consist of one file (maximum 3 MB, as pdf, gif, png, jpg, mp3 or mp4). If necessary please combine multiple images within a single file before uploading or refer to web page links for additional documentation of the work.


2. We need further clarification concerning the submitted budget, specifically which categories is this amount meant to cover? Please refer to the categories within the application form since this is not clear within the attached budget. Also since the attached budget is in Euros please confirm if the total amount of 7.741 refers to NOK. - The detailed budget from the host institution should be uploaded as a single pdf file (maximum size 3 MB). Please notice that budged within application form should be fielded even if detailed budget is uploaded. Please send this information according to the format described within the guidelines to my e-mail no latter than Thursday 27 May, so it can be added to your application. With best Wishes, Alexandra -Alexandra Cruz Coordinator for International Relations Office for Contemporary Art Norway Nedre gate 7 0551 Oslo Norway tel. +4723233150 url. www.oca.no From: Alexandra Cruz <alexandra@oca.no> To: Anders Restad <laracraft@hotmail.com> Cc: yolandariquelme@manifesta8.es; corporacionbacilo@yahoo.com.au Sent: Thu, 3 June, 2010 2:09:31 PM Subject: Re: OCA International Support Programme - Ref N. OCA02-2010B-14136

Dear Anders, I tried to call but we do not have your phone number within the application. In any case, regarding the submitted budget and since we do not have received any additional information so far, can you just confirm to which category within the budget the 7.741 NOK correspond to? From the additional budget you have submitted I could see that the 1.000 Euro that you refer in your e-mail bellow as the correspondent amount for the 7.741 NOK is relative to artist fee. However and since this is not a category considered within the application form I want to have your confirmation if this is what this amount is meant to cover. I would appreciate your answer to this e-mail still today. Many Thanks, Alexandra


**********************************************************************

From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Anders Restad <laracraft@hotmail.com>; bacilö <corporacionbacilo@yahoo.com.au> Sent: Fri, 18 June, 2010 6:59:29 PM Subject: MoCHA-PROJECT

La próxima acción oficial que la Corporación bacilö llevará a cabo tendrá lugar en la bienal de arte contemporáneo MANIFESTA8 en el MoCHA-project (Murcia octubre de 2010-enero de 2011) y versará sobre el concepto de CONTABILIDAD en el entorno artístico. Tanto en el medio burocráticoinstitucional como en el propiamente creativo de los procesos. Bacilö se interesa por este campo tras su periplo de acciones emblemáticas* de los últimos 7 años por motivos muy concreto_específicos relacionados con la subsistencia de la corporación que alberga a sus patrocinadores: NEW MODELS FOR A NEW BATTTLE, HUSFLID, in_DIRECT_film, SUPERARTE S. A. y consume ESTO. El entorno burocrático del arte Y SU SISTEMA han despertado el interés de bacilö dada su capacidad estructuradora-desestructuradora de generación de propuestas culturales y procesos de creación. La Corporación Bacilö, brazo ejecutor de los designios de su líder y siguiendo las precisas instrucciones de éste está recopilando todo el material relacionado con la realización de este proyecto y los agentes culturales que lo proponen. Su intención, en un claro homenaje a los creadores en general, es la de dar un nuevo uso al capital recibido en concepto remunerativo. Esta acción de NUEVO USO será desvelada en una intervención en el espacioAV de Murcia con fecha aún por determinar. La documentación de la acción y los archivos recopilados serán incluidos en los fondos de archivo del extinto Museum of Contemporary Hispanic Art.

Más info en : http://www.tea-tron.com/corporacionbacilo/blog/about/ http://corporacionbacilo.blogspot.com/ * en su loco y titánico esfuerzo por subvertir el sistema de sitemas bacilö ha intervenido en espacios tales como: espacios independientes, museos, galerías de arte, centros comerciales, festivales musicales, teatros, sesiones-predicaciones en la calle e iglesias. Asi mismo ha realizado acciones//eventos como: conciertos, desconciertos, EVENTOTERAPIAS, ruedas de prensa, mítines y actos litúrgicos o misas.

From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; bacilö <corporacionbacilo@yahoo.com.au> Sent: Fri, 18 June, 2010 7:34:35 PM Subject: MoCHA PROJECT Hola YOLANDA puedes ver una breve descripción introductoria de la acción de la Corporación en: http://www.tea-tron.com/corporacionbacilo/blog/2010/06/18/mochaproject-en-manifesta8/

más info en particular y en general en: y

http://corporacionbacilo.blogspot.com/


atenteMENTE operador

RA_dar!

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Wed, 23 June, 2010 9:47:28 PM Subject: periódico MoCHA Hola, Comentaros que el formato del periódico que haremos para el proyecto del MoCHA será de 30 x 42 cm , como ya dijimos, dispondréis de una doble página ( 60 x 42 cm ) para vuestra intervención en la que podéis incluir también texto si queréis, hemos hecho una previsión de 3 páginas de texto por artista para la traducción al inglés, dentro de esta extensión entraría también vuestra bio y la explicación de vuestro proyecto. Aún no hemos definido si el periódico se imprimirá a todo color o a 2 tintas, esto dependerá de las posibilidades de financiación que encontremos, en cualquier caso os iremos informando tan pronto como vayamos avanzando con esto. La recepción de los archivos del MoCHA se ha retrasado un poco y estarán en Murcia la semana que viene, yo voy a estar fuera toda esa semana pero una compañera, Julieta, se encargará de hacer las copias de los DVD en cuanto los recibamos y se pondrá en contacto con vosotros para que paséis por la oficina a recogerlos, prepararé también el acuerdo que tenéis que firmar donde se explican las condiciones de uso del material. A los que no estéis en Murcia os lo enviaremos por correo. En nuestra oficina estarán los catálogos originales que podéis venir a consultar cuando queráis, También os informaré pronto de la definición del espacio expositivo en el Espacio AV, Para cualquier duda o comentario ya sabéis dónde encontrarme, Un saludo, Yolanda

From: Virginia <virginia@manifesta8.es> To: Virginia <virginia@manifesta8.es> Sent: Thu, 1 July, 2010 6:36:28 PM Subject: urgent request for images Dear all, I’m writing from Communication Department to ask you for some images of your artwork. We urgently need them because September magazines issues are closing next week. Sending images is the one way we can have an opportunity to be published. The images will be use for local, national and international press (specialised and not), magazines (specialised and not), Manifesta 8 website, Manifesta Biennal Facebook., etc. It’s better if the images are from the artwork you’re working for Manifesta 8. Please notice that the images you’re sending should be impressive to the media. Enclose completed credits. th Please send the images before July 5 .

Do not hesitate in contact me if you have any doubt.


Regards, Virginia Delgado Departamento Comunicación y Marketing Manifesta 8 Manifesta 8, la Bienal Europea de Arte Contemporáneo Región de Murcia en diálogo con el Norte de África 9 de octubre 2010 - 9 de enero 2011 ----Antiguo Cuartel de Artillería | Pabellón 5. C/ Madre Elisea Oliver Molina, s/n 30002-Murcia (Spain) virginia@manifesta8.es t. +34 868 95 07 50

--------

La información contenida en este mensaje y en cualquier archivo adjunto es confidencial y está dirigida únicamente al destinatario del mensaje. Si Ud. no es el destinatario correcto por favor notifíquelo al remitente y elimine inmediatamente el e-mail y los posibles archivos adjuntos de su sistema. Manifesta 8 se exime de cualquier responsabilidad respecto a la correcta transmisión electrónica de los contenidos del mensaje o al momento de su llegada. Ningún derecho podrá derivarse del contenido de este e-mail. This e-mail and any attachments are confidential and intended only for the addressee. If you are not the intended recipient, please inform the sender as soon as possible and delete this email and any attachments from your system. Manifesta 8 cannot accept any responsibility for the complete and correct electronic transmission of the contents of the e- mail or for the time of its arrival. No rights may be derived from this e-mail.

******************************************************************

From: "berta@manifesta8.es" <berta@manifesta8.es> To: yoputa.es@hotmail.com; micorasao@yahoo.es; corporacionbacilo@yahoo.com.au; goneballester@hotmail.com; ilucas@gmax.at; jeleton@jeleton.com; arte.rosellmeseguer@gmail.com Sent: Mon, 5 July, 2010 5:20:24 PM Subject: Data

Dear all My name is Berta Garrido. I`m working as an intern in Manifesta8. I Would like you to kindly send me the following data, so we can build a complete register of the artists participating in Manifesta8:

Full name and address: Telephone and e mail: Nationality: Thanks and do not hesitate to contact me should you have any doubt.

Berta.


From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Fri, 16 July, 2010 3:03:08 PM Subject: + MoCHA Hola, Espero que llevéis bien el verano, este mail tan sólo para recordar y comentar algunas cosas, como hablamos en la reunión de junio, se habían planteado unas fechas para definir los proyectos que eran: 21 de Julio – plazo para tener una definición del proyecto, cuanto más detallada mejor, a nivel de necesidades de producción y también de contenido 26 de Julio – plazo para entregar vuestra imagen / intervención en el periódico del proyecto En este momento estamos preparando la Guía de Manifesta 8 que será una publicación gratuita donde habrá información de las obras que se muestran, cada artista va a tener una página que incluye: -

Biografía – utilizaremos la misma del catálogo

Imagen – podemos utilizar la misma que se imprimirá en el periódico o si lo preferís cualquier otra imagen que tenga una relación con el proyecto que presentaréis, también puede ser de algún trabajo vuestro anterior pero que tenga esta cierta relación con vuestro trabajo en Manifesta. Pie de foto / Imagen – con la acreditación de la imagen y si es aplicable, la cortesía de la misma Texto que explica el proyecto con una extensión máxima de 300 caracteres, unas cuatro líneas, este texto también nos lo están mandando los artistas Nosotros también nos hemos puesto como plazo el 26 de julio para cerrar el tema de vuestro presupuesto y formalizar los contratos, La semana que viene estará en Murcia Bassam, el comisario del colectivo ACAF de Egipto, así que me encantaría tener una reunión con vosotros para presentároslo, os llamaré para ver quién está por aquí, Hablamos pronto, Un saludo, Yolanda

********************************************************************

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Wed, 21 July, 2010 6:26:40 PM Subject: MoCHA News 2 Hola,

Os adjunto en este e-mail el plano del Espacio AV, el lunes tengo una reunión con los arquitectos para terminar de definir dónde se ubicará el archivo dentro del espacio y espero poder mandaros más información la semana que viene. Tened también en cuenta que el departamento de educación de Manifesta va a plantear uno de sus espacios educativos en la sala pequeña de la izquierda.


Estamos traduciendo el contrato al español, ya que algunos los solicitasteis, para enviároslo a finales de esta semana y que podáis ir leyéndolo, como os comenté, queremos cerrar el lunes el tema del presupuesto del que disponéis y por lo tanto el contrato, Aún tengo que definir las fechas exactas de las presentaciones, pero por ahora está es la distribución del programa que os propongo: OCTUBRE Rosell Meseguer Alfonso Escudero NOVIEMBRE Gonzalo Ballester Jeleton DICIEMBRE Ana Martínez Irene Lucas & Christoph Euler ENER O Corporación Bacilö

Ö ö

Bueno espero vuestros comentarios al respecto, en cualquier caso me pondré en contacto con vosotros a final de esta semana para ver si podemos tener otra reunión esta vez también con Bassam, quizás de cara al lunes que viene, Hablamos pronto, Un abrazo, Yolanda

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Wed, 21 July, 2010 6:15:06 PM Subject: MoCHA news 1 Hola, Este mail para comentaros varias cosas acerca del material que estamos esperando por vuestra parte que utilizaremos para dos publicaciones diferentes:

1. MATERIAL PARA LA GUIA de la bienal: Necesitamos una breve DESCRIPCIÓN DE VUESTRO PROYECTO que no debe exceder los 300 caracteres, unas cuatro líneas, para los que aún no tengáis totalmente definido el proyecto, comentaros que esta descripción puede plantear también los intereses que os están moviendo a la hora de definir vuestra propuesta, os adjunto algunos ejemplos de otros artistas para que tengáis una referencia, por supuesto vuestro texto me lo mandáis en español NASTIO MOSQUITO Title: Frozen War Single Channel Video, 2010 Nástia will take a look at the moment we are living. cold war consequence, immigration, emigration, the end of the world in 2012, and why he would never fornicate Carla Bruni after Sarkozy. The confusion between knowledge and information, this is our War. Our Frozen War. Europe ? America ? Africa ? Asia ? Our WAR!


JEAN-MARC SUPERVILLE SOVAK Title: "It Can't Last, no Rush" Bricks, sheet metal, 2010 It has been said that under every church in Spain lies a mosque. How is the brick in a mosque different from the brick in a church, a factory or an emperor’s palace? Using clay from the region of Murcia , sun-dried bricks will be made, each stamped with the word “EMPIRE”, in order to construct a monument to impermanence. IMAGEN para la guía que ilustrará vuestra página, la guía será en blanco y negro por lo que tiene que ser una imagen en escala de grises con una resolución de 300 píxeles en formato JPG u otro compatible. Por favor añadid el copyright de la imagen así como el pie de foto que debemos incluir -

Cortesías que deberíamos incluir si es necesario

IMPORTANTE – EL PLAZO PARA LA ENTREGA DEL MATERIAL PARA LA GUÍA ES ESTE LUNES

2. MATERIAL PARA EL PERIÓDICO MoCHA – considerando que tenemos que trabajar

más los contenidos y en muchos casos hace falta más tiempo para definir el proyecto hemos decidido ATRASAR la fecha de entrega de este material, que será una imagen o la intervención que queráis plantear y que también puede incluir texto, atrasamos el plazo para entregar esta imagen / intervención al 20 de Agosto, en cualquier caso, si lo tenéis ya preparado estaremos encantados de recibirlo ya para ir adelantando trabajo

Espero que esté todo claro, escribidme si tenéis alguna duda, A continuación os mando otro correo con más detalles, disculpad por el bombardeo… Yolanda

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Mon, 26 July, 2010 11:32:43 AM Subject: MoCHA Hola, Disculpad por no haberos mandado el contrato traducido el viernes como os dije, me lo han entregado esta misma mañana, aquí lo tenéis para echarle un vistazo, os adjunto también unos planos del Espacio AV, en el primero están especificadas las medidas, en el segundo están marcados las zonas que serán utilizadas por el departamento de educación y por el archivo, la zona en blanco delimitada por la línea naranja es el espacio del que disponéis para vuestra intervención. Os envío por Yousendit algunas fotos de la sala para que tengáis una idea más clara del espacio, Hablamos pronto, Un saludo, Yolanda


From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; bacilö <corporacionbacilo@yahoo.com.au> Sent: Tue, 27 July, 2010 12:24:10 AM Subject: PROGRAMA: Corporación bacilö bacilö informa:

Corporación bacilö CONTABILIDAD, performance, 2010 Contabilidad es una propuesta que versará sobre las vertientes económicas que rodean a todo evento artístico en sus aspectos tangenciales. Bajo este enfoque bacilö recopilará información de los archivos de MOCHA y realizará una ÚNICA acción terapéutico-chamánicosimbólica para homenajear y homenajearse en nombre de los artistas que nunca han podido debidamente hacer lo propio con el fruto de su trabajo. corporativos saludos cordiales ********************************************************************** From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporacionbacilo@yahoo.com.au Sent: Wed, 28 July, 2010 12:21:26 PM Subject: concretando Hola,

Tan sólo para dejarlo por escrito algunas cosas que comentamos ayer, he

pedido al departamento de producción que emita ya vuestro contrato con el presupuesto del que disponemos en este momento y del que ya hablamos, os lo mandaremos por correo electrónico en cuanto lo tenga para que todos lo podáis leer, dar vuestro ok y pasar a firmarlo, para hacer las cosas más sencillas siempre con los colectivos artísticos hemos realizado el contrato con un portavoz del mismo, ya me diréis con quién decidís que se haga aunque entiendo que por cuestiones prácticas lo mejor es que sea Claudio.

Con respecto a las fechas de presentación, en vuestro caso hablamos de plantear vuestra intervención en enero, normalmente las presentaciones se van a

plantear los viernes, pero en vuestro caso, por temas de fechas de vacaciones y cierre de la bienal el día 9, creo que lo mejor sería plantear vuestra performance el lunes 3, por favor confirmadme la fecha para poder incluirla en la información de la guía,


Os envío también el logo del MoCHA Sessions que estamos trabajando y que determina también la distribución del material en el espacio a nivel conceptual, Hablamos, Un saludo, Yolanda From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Thu, 29 July, 2010 12:16:21 PM Subject: MoCHA Hola, Por si alguno os interesa os adjunto las medidas de las columnas en el plano del Espacio AV, también va el curatorial statement de ACAF para Manifesta 8. Un saludo, Yolanda From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Thu, 29 July, 2010 8:19:21 PM Subject: concretando Hola, Os envío el programa de las presentaciones MoCHA a lo largo de la bienal, creo que ya he hablado con todos de los detalles, pero decidme por favor si algo no queda claro, lo que os mando es por una parte un calendario de las presentaciones y otras actividades en el espacio, así como las fechas de desmontaje e instalación de cada uno de los proyectos, hemos calculado un día de desmontaje y dos de montaje, por favor comentadme si os parece razonable para vuestra instalación el tener dos días, en el caso de la artista expone primero, Rosell Meseguer, ella dispondrá de algo más de tiempo para realizar su montaje. Hemos adelantado el día de las presentaciones al jueves para contar en el desmontaje con el día del lunes en el que la sala está cerrada al público. Por otra parte también os adjunto el pequeño dossier de los proyectos que voy a mandar al Espacio AV, por ahora es la información que me habéis mandado para la guía. Un saludo, Yolanda (VER PROGRAMA) *************************************************************** From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporacionbacilo@yahoo.com.au Sent: Wed, 4 August, 2010 11:08:02 AM Subject: contrato Hola, Aquí va vuestro contrato, nos vemos la semana que viene y ya hablamos de vuestros comentarios al respecto, Un saludo, Yolanda


******************************** From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; bacilö <corporacionbacilo@yahoo.com.au> Sent: Thu, 5 August, 2010 6:29:29 PM Subject: a cerca del contrato bacilö con M8RM Estimada Yolanda Agradecidos quedamos por su atención de la biografía traducida. Pôr otra parte le indicamos a usted y a la entidad a la que representa que estamos preparando unas clausulas a incluir en el contrato basándonos en el Manual

Prácticas Artísticas.

de Buenas

Se las haremos llegar lo antes posible para que puedan consultarlas previamente al encuentro con nuestro enviado-representante para la firma del contrato.

Por otra parte se incluirá una batería de propuestas y compromisos de bacilö. Éstas podrán ser aceptadas o no, pero rogamos sean tenidas en cuenta y en todo caso que sean incluidas en el contrato como peticiones realizadas por bacilö y aceptadas o no por M8.

(VER compromisos y pericones de bacilö al final del presente documento) Atentamente Dpto. de legalidad infructuosa de la Corporación Bacilö.

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Thu, 5 August, 2010 6:33:43 PM Subject: RE: a cerca del contrato bacilö con M8RM Señores, Avisadme con tiempo para concertar la reunión con el enviado y que pueda organizar

también un encuentro con el coordinador de producción que es el responsable de los contratos Gracias,

Pese a haber concretado el encuentro el coordinador no se presentó.

****************************************************************** De: corporación bacilö [mailto:corporacionbacilo@yahoo.com.au] Enviado el: viernes, 06 de agosto de 2010 12:34 Para: Yolanda Riquelme; bacilö Asunto: REVISIÓN del contrato con M8RM_ por bacilö Estimada Yolanda NO SE ASUSTE le remitimos el contrato para que pueda ser RE-visionado por ustedes previamente a la firma del mismo.


El enviado-corredor con instrucciones de legalidad bacilö estará encantado de departir con usted y quien M8RM designe para perfilar los últimos aspectos del contrato. También acudirá con las solicitudes de bacilö a incluir en documento anexo [ACEPTADAS O NO] perfectamente redactadas y entendibles. El enviado-corredor acudirá a reunión en fecha por determinar con usted misma poniéndose en contacto por vía telefónica (mal que nos pese) el mismo lunes por la mañana para concretar el encuentro. Corporativos y legales SALUDOS cordiales.

******************************** From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Fri, 6 August, 2010 1:37:16 PM Subject: RE: REVISIÓN del contrato con M8RM_ por bacilö Hola, No hay ningún problema y no me asusto, sólo quiero asegurarme de que tratáis este tema con la persona responsable y por nuestra parte tenemos varios comentarios a vuestras aportaciones, lo hablamos el lunes y desde luego finalmente todo lo firmado debe ser aceptado por ambas partes, Un saludo, Yolanda

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Tue, 10 August, 2010 8:07:12 PM Subject: exposición en AV Hola,

Según he hablado con Claudio esta mañana, el montaje del material que la Corporación Bacilö va a instalar en el Espacio AV para su acción se realizará los días 28 y 29 de diciembre y la acción se realizará el día 7 de enero, quería preguntaros si consideráis que el público podría

visitar el Espacio AV en los días previos al 7 ya que parte de vuestro proyecto ya estará instalado,

Quiero meter en la guía las fechas de presentación de cada uno de los proyectos del MoCHA Sessions y me gustaría saber si podemos anotar que a partir del 30 se puede ver parte de vuestro proyecto y que el 7 sería la acción, personalmente me parece interesante que se pueda ir viendo parte de vuestro proyecto antes para que tenga algo más tiempo de visibilidad, por otra parte creo que puede generar más expectativas de cara a la performance del día 7. Ya me diréis,


Os mando el contrato en cuanto lo reformulemos, Un saludo, Yolanda

From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; bacilö <corporacionbacilo@yahoo.com.au> Sent: Wed, 11 August, 2010 8:20:24 PM Subject: Re: exposición en AV

hola

HOLAestimadaYOLANDA

Le remitimos los compromisos completados bajo bacilö.

QUORUM

Aceptamos la propuesta de que el trabajo pueda verse a partir de los días de montaje (27 y 28 de diciembre). En cuanto a lo referido a revelar el contenido y sentido de la acción, la Corporación se reserva _{el derecho a la intimidad de su proceso creativo} y le remite al punto 3 de sus compromisos en el documento anexo.

atentaMENTE

dpto. estival de la Corporación

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Tue, 10 August, 2010 8:07:12 PM Subject: exposición en AV Hola, Según he hablado con Claudio esta mañana, el montaje del material que la Corporación Bacilö va a instalar en el Espacio AV para su acción se realizará los días 28 y 29 de diciembre y la acción se realizará el día 7 de enero, quería preguntaros si consideráis que el público podría visitar el Espacio AV en los días previos al 7 ya que parte de vuestro proyecto ya estará instalado, Quiero meter en la guía las fechas de presentación de cada uno de los proyectos del MoCHA Sessions y me gustaría saber si podemos anotar que a partir del 30 se puede ver parte de vuestro proyecto y que el 7 sería la acción, personalmente me parece interesante que se pueda ir viendo parte de vuestro proyecto antes para que tenga algo más tiempo de visibilidad, por otra parte creo que puede generar más expectativas de cara a la performance del día 7. Ya me diréis, Os mando el contrato en cuanto lo reformulemos, Un saludo, Yolanda


From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporacionbacilo@yahoo.com.au Sent: Wed, 4 August, 2010 11:08:02 AM Subject: contrato Hola, Aquí va vuestro contrato, nos vemos la semana que viene y ya hablamos de vuestros comentarios al respecto, Un saludo, Yolanda

**********************************************************************

From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: Yolanda Riquelme <yolandariquelme@manifesta8.es> Sent: Thu, 19 August, 2010 6:04:57 PM Subject: Periódico MoCHA Hola a todos,

Recordaros que tenemos que recibir vuestra imagen y texto de vuestro proyecto para el periódico MoCHA a lo largo de esta semana y la que viene, por favor es importante disponer de este material a final de mes sin falta porque tenemos que tener lista la tirada para la inauguración, Gracias, Un abrazo, Yolanda From: corporación bacilö <corporacionbacilo@yahoo.com.au> To: Yolanda Riquelme <yolandariquelme@manifesta8.es>; bacilö <corporacionbacilo@yahoo.com.au> Sent: Fri, 20 August, 2010 2:39:37 PM Subject: Re: Periódico MoCHA

Tal y como habíamos convenido le adjuntamos el archivo para el PeriódicoMoCHA. Quedamos a la espera de la copia definitiva del contrato para su inminente firma. Por favor remitannos los datos fiscalespara la facturación. From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Fri, 20 August, 2010 4:31:40 PM Subject: RV: contrato Hola, Confirmo que he recibido correctamente la imagen para el periódico, por mi parte reenvío los detalles para la factura, Un saludo, Yolanda


From: Yolanda Riquelme <yolandariquelme@manifesta8.es> To: corporación bacilö <corporacionbacilo@yahoo.com.au> Sent: Thu, 19 August, 2010 4:54:44 PM Subject: contrato Hola, Aquí tenéis el contrato, los detalles que debéis incluir en la factura son:

Factura emitida a: MURCIA CULTURAL, S.A. Auditorio y Centro de Congresos Victor Villegas Avenida Primero de Mayo s/n 30006 – MURCIA CIF: A-30262596 Enviada a: Manifesta 8 Antiguo Cuartel de Artillería | Pabellón 5. C/ Madre Elisea Oliver Molina, s/n 30002 - MURCIA (Spain) También nos la podéis mandar por correo electrónico, Un saludo, Yolanda


EL PRIMER CONTRATO: _vayatela! Contrato de producción Manifesta 8 Nombre: Dirección: E-mail: Página web: Teléfono móvil: Por el presente contrato se confirma que Fundación Manifesta 8 Región de Murcia producirá sola o en colaboración con terceras partes - y exhibirá la obra Contabilidad como parte del programa de la Bienal Europea de Arte Contemporáneo Manifesta 8, que se celebrará del 7 de Octubre de 2010 (inauguración profesional) hasta el 9 de enero de 2011. La correspondencia y anexos generados para el desarrollo del proyecto forman parte de este acuerdo. La obra forma parte del proyecto Mocha Sessions del colectivo curatorial Alexandria Contemporary Arts Forum en el marco de Manifesta 8 Region de Murcia. La instalación estará ubicada en el Espacio AV de Murcia. Presupuesto El presupuesto total del proyecto no excederá la cantidad máxima de 1.500 Euros, e incluye los siguientes conceptos relacionados con la producción y la exhibición de la obra: - honorarios del colectivo artístico - producción de la obra, incluyendo todos los gastos del estudio del colectivo y sus colaboradores, materiales, realización de la obra, implementación arquitectónica y gastos extra de mantenimiento. - alquiler de equipos - instalación y mantenimiento (incluidos todos los gastos relacionados) en el Espacio AV. - seguro - transporte de la obra y/o materiales necesarios para el montaje de la misma hasta el Espacio AV. - Montaje y desmontaje de la instalación. La inauguración para la instalación está prevista para el día 7 de enero de 2011, teniendo el colectivo que hacerse cargo del montaje dos días previos a la misma, y del desmontaje, un día después de la clausura (10 de enero de 2010). El colectivo artístico recibirá 1.500 Euros (impuestos incluidos) por transferencia bancaria para cubrir los gastos de producción tras el envío de la correspondiente factura. El colectivo artístico se compromete a facilitar a Fundación Manifesta 8 Región de Murcia aquella información necesaria tanto para la instalación de la obra como para su comunicación un mes antes de la fecha de inauguración de la instalación. El colectivo artístico garantizará que el material necesario para el montaje de la obra estará preparado para el montaje con suficiente antelación. Fundación Manifesta 8 Región de Murcia no se hará cargo de aquellos gastos para los que el artista haya encontrado fuentes de financiación de forma independiente. En el caso de que Fundación Manifesta 8 Región de Murcia consiga financiación extra para el proyecto Mocha Sessions, la aportación a la producción de esta obra/instalación podrá incrementarse.


El resto de servicios necesarios serán encargados y organizados por Manifesta 8 dentro de los límites del presupuesto disponible. Manifesta 8 no puede garantizar la provisión de servicios que no hayan sido solicitados con suficiente antelación.

Tras la instalación En caso de que cualquiera de los organizadores de Manifesta 8 esté interesado en adquirir una obra producida por Manifesta 8, se deducirán los gastos correspondientes a los costes de producción. Si la obra forma parte de un eventual Programa de Coleccionistas, se firmará un contrato aparte. El equipo y material adquirido por Fundación Manifesta 8 Región de Murcia permanecerá en propiedad de la organización. La Fundación Manifesta 8 Región de Murcia podrá vender elementos y material técnicos, dado que estos elementos no se identifican como parte de la obra del artista. Los elementos alquilados (monitores, reproductores de DVD etc.) serán devueltos al proveedor. El resto de las partes de la obra no requeridas por el artista, serán destruidas. No está permitido el uso posterior de ninguno de los elementos. . Seguros La obra del artista será asegurada por Fundación Manifesta 8 Región de Murcia si la cobertura de seguro es posible. La responsabilidad exigible por el daño se limita al valor de la obra o a sus costes de producción, aquel que sea más bajo. Las obras situadas en espacios públicos no serán aseguradas. Las copias para exposición aportadas en formato digital (DVD, BlueRay) no serán aseguradas, Fundación Manifesta 8 Región de Murcia no puede proporcionar un seguro médico a los artistas visitantes. En previsión de accidente o enfermedad durante su estancia, el/la artista deberá asegurarse de estar cubierto/a por un seguro médico. Condiciones adicionales Todas las obras producidas por Fundación Manifesta 8 Región de Murcia deberán hacer constar el crédito Manifesta 8 Región de Murcia. Documentación El/la artista recibirá: - Cinco ejemplares del catálogo y cinco ejemplares de la guía. - Fotografías digitales de instalación de su proyecto. Derechos Por el presente contrato, el/la artista transfiere los siguientes derechos a Manifesta 8 durante la duración de la exposición: -

Derecho de exhibición de la obra Derecho a reproducir fotografías de la obra con fines promocionales hasta el 9 de enero de 2011 Derecho a reproducir imágenes de la obra del artista en las publicaciones de Manifesta 8 (catálogo, guía, folletos, página web, servicios de e-mailing, etc.)


-

Derecho a transferir el material documental y los archivos del/la artista a International Foundation Manifesta de Amsterdam. Derecho a mostrar extractos de la obra de hasta tres minutos en la página web. En todas las publicaciones, las obras producidas por Fundación Manifesta 8 Región de Murcia deben indicar: Cortesía de Manifesta 8 Región de Murcia, España

El/la artista garantiza: 1.- ostentar todos los derechos de propiedad intelectual y material sobre la obra y todos sus elementos; 2.- su propia autoría y la originalidad de la obra y de todos de sus elementos; 3.- que en el caso de que en la obra se contengan o utilicen elementos los derechos de propiedad intelectual sobre los cuales pertenezcan a terceros autores, artistas, productores o editores, el/la artista ha obtenido las autorizaciones necesaria para su incorporación a la obra y el uso de la misma según lo previsto en el presente contrato sin coste alguno para Fundación Manifesta 8 Región de Murcia. El/la artista garantiza que no existe ni contraerá ningún compromiso, acuerdo, opción o gravamen sobre los derechos mencionados en el párrafo anterior que pueda limitar o impedir la cesión a Fundación Manifesta 8 Región de Murcia de los mismos ni el ejercicio totalmente pacífico de los derechos por parte de ésta -y/o por parte de cualesquiera terceros designados por Fundación Manifesta 8 Región de Murcia - con el alcance descrito en el presente contrato. El/la artista se hace plenamente responsable ante Fundación Manifesta 8 Región de Murcia y ante terceros de cuantas reclamaciones puedan surgir como consecuencia del incumplimiento de las garantías por él prestadas en la presente cláusula, así como de la indemnización de cualesquiera daños y perjuicios causados, manteniendo totalmente indemne a Fundación Manifesta 8 Región de Murcia y a tales terceros.

Cortesía A la finalización de Manifesta 8, toda la documentación de los proyectos financiados total o parcialmente por Manifesta 8 irán acompañados de la línea de cortesía: Manifesta 8 Región de Murcia, España. Cualquier otro uso comercial (merchandising, souvenirs, etc) será objeto de un acuerdo adicional con el artista. El artista proporcionará la información pertinente relativa a instituciones que hayan contribuido a la producción de la obra y deban ser mencionadas en todas las publicaciones y material de comunicación. Otros acuerdos En caso de legislación contradictoria, la ley española será la única vinculante; y la corte autorizada será la de Murcia.

Fdo.

Fdo.

Hedwig Fijen Presidenta Fundación Manifesta 8 Región de Murcia Murcia, 3 de agosto de 2010.

.


REFLEXIONES PERPENDICULARES CONCLUSIONES OBLICUAS DOCUMENTOS Y ARCHIVOS INSPIRADOS A RAIZ DE LA EXPERIENCIA DE ÉXITOFRACASO CON EL ENTE INSTITUCIONAL BUROCRÁTICOCULTURAL


It is time to begin understanding this collective unconscious of art and locate what might be the actual problems at hand, or even better, what could even offer some solutions.


Carta de bacilo a los imomi-busteros

En estos tiempos en que políticos economistas y/o burócratas en general, se encuentran en permanente crisis existencial, pues no saben quien les clavara el puñal por la espalada, Bacilö aparece como una amenaza más a la que combatir. Bacilö representa todo lo que ellos odian y contra lo que han luchado desde el principio de los tiempos, Bacilö no es una organización secreta , masones, club winderberg, pero para ellos es lo mismo, pues Bacilö no duda en guardar algunos secretos ante las preguntas que ellos hacen para dejarte participar de su mundo, en su juego de relaciones sociales y cultura reglada que espera e impone una rectitud de pensamiento y comportamiento, sin dudas, a todo el que pretenda entrar en este simulacro de la realidad. una realidad desaparecida tras una cortina de humo que hace del imomi un ser deprimido, un ser en constante crisis existencial; debido en su mayor parte a la actitud de unos poderes fácticos que pretenden ese estado en la masa imomi para poder así controlar y dirigir a este imomi, ofreciéndole de vez en cuando una zanahoria como incentivo y obligando así al imomi a permanecer bajo el paraguas de este sistema, por el miedo a no conseguir más zanahorias si cuando se produzca el reparto esta fuera y no es consagrado con una plaza en el paraíso imomi.


funcionariosinstitucionalescuratorburocrtassilentservants.org

El imomi burócrata sólo persigue la belleza de un resultado, la seguridad que le reporta el manejo de datos, ya sean matemáticos, estadísticos o culturales, esto es lo que persigue en su gestión, pues estos datos sólo deben ser interpretados, pero no necesitan de una vigilia constante por parte de él o de su equipo, esto es lo que el proceso significa para el imomi-burócrata. Este imomi sería el responsable ante sus superiores de todo lo acontecido durante un proceso que él ha gestionado, mientras que el solo tramite de datos no le reporta responsabilidad alguna, pues todos los datos se pueden modificar al gusto del consumidor, y aunque no fuese así, todas las interpretaciones se harían a partir de unas premisas que todos los imomis ya conocen, por herencia cultural; solo por el hecho de pertenecer a ese grupo de imomis, pues todo imomi lleva años oyendo como debe interpretar cada uno de los datos que le son dados a su libre interpretación.

Su propia autocensura, que a la vez tranquiliza al imomi-súperburócrata que esta por encima de él, y este a su vez tiene otro híperburócrata por encima y etc, propicia que conforme bajas en la escala jerárquica, el celo del imomi encargado crece proporcionalmente. Nadie esta seguro en su entorno y en su puesto y debe conservar la relación amistad-odio con el imomi que esta por encima de él en la cadena, con el fin de que esta tranquila relación le reporte un futuro lleno de fortuna y seguridad.

Bacilö en sus ensayos éxito-fracaso no necesita de cómplices, pues no tiene una meta concreta, por ello son ensayos donde el resultado final éxito-fracaso no tiene más importancia que el mismo proceso. Pero este proceso no interesa al imomiburócrata, pues en este proceso pueden ocurrir o darse situaciones un tanto incomodas para el poder fáctico al que representa, esto no tiene porque darse de una forma absoluta y en todos los ensayos, pero la desconfianza y el celo de este imomi-burócrata, hará que los procesos no pasen la criba de propuestas, pues conllevan un riesgo intrínseco de fracaso, tanto del proceso como de su gestión.


ANTEPENÚLTIMA ADVERTENCIA PARA LA TIERRA BURÓCRATAS ARMADOS DE INEFICACIA, ¡¡¡ PREPARAOS !!!

“Arrepentíos TODOS pecadores burocráticoADMINISTRATIVOS vuestras vidas

tristes

, vacías y grises redecoradas y

el jugo de las ideas

SACIADAS con de creadores independientes sin protección laboral ni cobertura legal se acercan a un

FINAL_funcionarial_yTAL. NADIE SABE CóMO NI CUANDO PERO SOn MUCHOS LOS QUE SABEn POR QUÉ…”

Extractos APÓCRIFOS del GÉNESIS bacilö Publicado por Corporacion bacilö en 12:12

**********************************************************************


SISTEMA BUROCRATICO BACILÖ


CHARACTERS LA TEORÍA DEL CASTELLER INVERTIDO

ENLACES ESTRUCTURA DRAM�TICA DE RELACIO

REPRESENTACIÓN GRÁFICA DE LA MEGAESTRUCTURA ABSURDA Y PARANOICA GENERADA POR LA MÁQUINA/ENTE BUROCRÁTICOCULTURAL


ART SYSTEM

artist


mรกquinanimalburocraticoartisticum


an analysis of the condition of art today, and from there looks to operate as a kind of cultural algorithm, leading us towards some resolutions for the questions above. Through its application, the theory should lead towards the emergence of a multilayered and complex project that while remaining part of what we call the ‘art system’ makes a route to its goal without using most of the widely accepted or highly criticized paths to a ‘successful project’.


ENCUENTRA


LAS 7 DIFERENCIAS


MENTIRAS ESTADÍSTICAS REVISITADAS POR LABORATORIOS BACILÖ


PROYECTO DE COMISARIADO DE CORPORACIÓN BACILÖ PARA MANIFESTA 9 _2012 LA ACEPTACIÓN DE ESTA PROPUESTA POR PARTE DE LA FUNDACIÓN MANIFESTA CONDONARÍA LA DEUDA ECONÓMICA Y MORAL QUE DICHA INSTITUCIÓN HA ADQUIRIDO CON CORPORACIÓN BACILÖ EN LA BIENAL MANIFESTA 8


BREVE ORÍGENES HISTORIA ERAS Y PRESENTE ILUSTRADA DE DEBACILÖ BACILÖ


Corporación Laboratorios Bacilö

El colectivo base (compuesto por 5 artistas/operarios de España, Francia y Noruega) y su líder, el ficticio ilustre Bacilö, elaboran desde el año 2003 un laboratorio experimental basado en la rearticulación del mundo para el I.M.O.M.I. (Individuo Medio O Medio Individuo).

Llamamos Bacilö o Acción Bacilö a la serie de creaciones realizadas por Bacilö a través de sus operarios, individuos anónimos que en un sentido personificado de la actuación, ponen en marcha la cosmología Bacilö y sus cerebros/máquinas.

“Bacilö es para la sociedad actual un cuerpo o máquina, amorfa y crítica, en busca de individuos adeptos para una nueva interpretación del mundo”.


Bacilö recurre en más de una ocasión a sistemas de acción y captación, ya existentes en el panorama sociopolítico occidental, de tipo político, religioso, deportivo... emulándolos exageradamente hasta rozar el ridículo mas absoluto.

Desde su propia experiencia los laboratorios Bacilö intervienen con expectación y sorpresa sea en un museo, un supermercado, un paso de cebra, un escenario… Sin menospreciar el hipotético fracaso en sus acciones, bacilö crea puestas en escena totales en las que el espectador--paciente se ve envuelto en la ficción de su propia ficción.

Los métodos aplicados al IMOMI sea cual sea la acción realizable son la terapia de choque, la psicosátira, los rituales de lo deshabitual, sketches duros y/o blandos, la paranoia acústicovisual, el paracaidismo teórico, el delirio formal, la eventoterapia, la sesión antiestrés, la simulación y la sistematización de ideas o ficciones fijas y lógicas.


Las acciones Bacilö pueden ser públicas o clandestinas, programadas o clandestinas. USTED tiene el privilegio de poder ELEGIR entre las siguientes EVENTOTERAPIAS bacilö : [Acciones o Partituras fijas dentro de la Cosmología Bacilö ] -SESION ANTIESTRES BACILÖ -RITUAL DE LO INHABITUAL BACILÖ -CONFERENCIA BACILÖ -TOUR METROPOLIS BACILÖ -DISCO GALLERY -DESCONCIERTO BACILÖ -BAUTIZO BACILÖ -MISA BACILÖ -MITIN BACILÖ -RUEDA DE PRENSA BACILÖ -RADIO EMISION BACILÖ


La Corporación BACILÖ es una operación terapéutica ofensiva e inofensiva presidida por el Ilustre Bacilö y puesta en acción por los siguientes patrocinadores: NEW MODELS SUPERARTE S.A. CONSUME ESTO IN_DIRECT_FILM HUSFLID


BACILÖ TRABAJA PARA USTED DESDE LA INVESTIGACION PERFORMATIVA HASTA LA PUESTA EN MARCHA DE MECANISMOS PERVERSOS Y SIMPÁTICOS


La Corporación bacilö se dedica a la realización de acciones subversivas que abarcan un variado y nutrido abanico de posibilidades, eventos y ubicaciones donde poder intervenir. Desde festivales de nuevas tendencias (.APARTE, ESCENA CONTEMPORÁNEA) museos (MUA, Museo de la Universidad de Alicante), Salas de conciertos y fiestas (Siroco, FNAC de Plaza Norte en Madrid), espacios alternativos y hasta gimnasios, bodas, bautizos y discotecas… o el propio festiMAD. Así mismo, bacilö lleva desarrollando su proyecto de control del orbe para desencadenar el advenimiento ANTI-estrés desde agosto de 2003 [primera manifestación pública en siglos], hace ahora dos años, aunque su presencia es anterior a los albores del raciocinio. Su formato SESIÓN BACILÖ continúa siendo indescriptible. bacilö siempre trata de ofrecer en todas sus intervenciones una terapia anti-stress, un viaje a gastos pagados real o virtual que deambula por los terrenos de lo cómico, lo mediático, el discurso político, lo festivo, lo cutre, la baja y la alta tecnología, la improvisación, el travestismo, la cultura popular, la saturación y las referencias solo para iniciados. Todas estas características y unas constantes como el elemento maquina, las ambientaciones músico_sónico-visuales-ruidísticas específicas, el uniforme espacial entre mecánico y súper-héroe, el pseudo-anonimato, los medios audiovisuales ficticiamente HIPERtecnificados, una específica ambientación sónico-ruidosa y la intervención en directo, son las que determinan la acción definitiva. bacilö no pretende quedar ni bien ni mal con nadie, sino llevar a cabo las eventoterapias que se propone; el hecho de que el sus acciones sean calificadas o no de exitosas, es más un aspecto secundario que no depende de la fluidez de las mismas ni de la respuesta recibida por los asistentes/presentes. Es más bien una cuestión de norma. Por tanto lo que para otros es un fracaso, para bacilö no es más que un hecho...


1º- BACILÖ TIENE COMO GRAN OBJETIVO, COMO BIEN SABE USTED, LA CONQUISTA DEL MUNDO Y LA CONSECUENTE REMODELACION DEL SISTEMA INTERNACIONAL.. DICHOS FINES, COMO BIEN SABE USTED, NO SON FINES BÉLICOS, NI PACIFISTAS, NI POLITICOS, NI DEL DEPORTE DE COMPETICIÓN Y MENOS AUN DE LA NUEVA COCINA. LA MISION POR LA QUE BACILÖ HA VENIDO A ESTE PLANETA, COMO YA LE HE DICHO, ES UN ENIGMA QUE MUTA, ES DECIR UN IMPULSO EN DIRECTO O EN INDIRECTO POR EL CUAL TODO EL ESFUERZO SE CONCENTRA EN UN SOLO PUNTO. BIEN VALE DECIR EN ESTE CONTEXTO, QUE BACILÖ NECESITA AHORA MAS QUE NUNCA, UN FUERTE E INVENCIBLE EJERCITO DE SERES SIN VOLUNTAD CON EL QUE CREAR UNA FUERZA PATETICA Y ABSURDA EN CASO DE CUALQUIER RESPUESTA BÉLICA CONTRA BACILÖ. ESPERO HABER SIDO CLARO SOBRE ESTE PUNTO.

2º- SER UN EMPRESARIO QUE PATROCINA E INVIERTE EN LA CORPORACIÓN BACILÖ Y SUS LABORATORIOS NO HA SIDO, NI ES, UN CAMINO FACIL PARA AMBAS PARTES. IN_DIRECT_FILM, COMO BIEN SABE USTED, ES UNA DE LAS EMPRESAS MAS COMPETITIVAS DE ESTE PAIS EN EL SECTOR DE PRODUCCION AUDIOVISUAL Y DE COMUNICACIÓN DE MASAS. CON ESTO QUIERO DECIR QUE LOS PROBLEMAS DE UNA JOVEN DEMOCRACIA COMO ES LA ESPAÑOLA, SUS DISGRESIONES CULTURALES DEL TERRITORIO, SU PSEUDO-POLITICA BIPOLAR, Y EL INCANSABLE ESFUERZO DE ALINEAMIENTO CULTURAL CON EL RESTO DE PAISES POSDESARROLLADOS, SON ASUNTOS QUE HAN IMPULSADO A MIS COMPETIDORES A CREAR CIERTOS RECELOS E INCLUSO AMENAZAS CONTRA MI EMPRESA POR ESTAR APOYANDO ECONOMICAMENTE A LA CORPORACION BACILÖ, ALGO SIMILAR A LOS EMPRESARIOS VASCOS QUE CONTRIBUYEN VOLUNTARIAMENTE CON EL IMPUESTO REVOLUCIONARIO.

3º- AL PRINCIPIO DEL AÑO 2013 DE VUESTRA ERA, CUANDO SE HAYAN COMPLETADO TODOS LOS PREPARATIVOS, EL SISTEMA BACILÖ ENTERO, DEL QUE VUESTRO SOL ES LA OCTAVA ESTRELLA, SE CONVERTIRA EN UN SISTEMA DE APRENDIZAJE SUPERIOR Y EN HOGAR DE LAS METROPOLIS BACILÖ. LAS METROPOLIS BACILÖ SON LUGARES DONDE POBLACIONES ENTERAS PERCIBEN ESPIRITUALMENTE LA EVOLUCIÓN Y LO SAGRADO QUE HAY EN BACILÖ. SUS RESIDENTES RECONOCEN LA EVOLUCIÓN Y CRECIMIENTO DE SÍ MISMOS COMO INDIVIDUOS, DEL RESTO DEL GRUPO Y DE TODA LA EXISTENCIA, DEDICANDO A ELLO SU VIDA. EN OTRAS PALABRAS, DEDICAN LA VIDA A SERVIR AL PLAN BACILÖ, ENCONTRANDOSE COMO MINIMO EN EL NIVEL DE CONSCIENCIA DEL ILUSTRE BACILÖ. LA TIERRA, JUNTO CON VUESTRO ANILLO SOLAR, SOIS LOS ULTIMOS DEL SISTEMA BACILÖ EN REALIZAR ESTE CAMBIO. EL RESTO DE LOS SIETE ANILLOS SOLARES BACILÖ, LAS SIETE HERMANAS, ESTAN AHORA MISMO AL DIA EN CUANTO A ESCUELAS MISTÉRICAS Y SEDES DE METROPOLIS DE BACILÖ; CADA UNO DE ESTOS SIETE ANILLOS SOLARES SE ELEVARÁ PARA CUMPLIR SU PRÓXIMA FUNCIÓN NATURAL EN UN ESTADO EVOLUTIVO SUPERIOR CUANDO EN EL 2013 EMPIECE LA NUEVA DANZA LLAMADA LA ERA DE BACILÖ.


VIOLENCIA CONCEPTUAL BACILÖ UNIVERSO CONCEPTUAL BACILÖ ENERGIA CONCEPTUAL BACILÖ CIRCO CONCEPTUAL BACILÖ

El núcleo de la eventoterapia consiste en una sesión audiovisual en directo que parte de una estructura serena y más o menos nítida que progresivamente se hará más intrincada e incluso confusa hasta llegar a un ritmo trepidante y estridente caracterizado por la profusión de imagenes y sonidos a modo de descargas eléctricas. Esta progresión puede pasar por momentos de tedio o agotamiento que frenan en el paciente su natural inercia hacia la percepción e identificación de lo espectacular. Dichos momentos no son un error, sino una ruptura burda y consciente de Bacilö necesaria para una adecuada entrada del paciente en un nuevo estado. Durante la sesión terapéutica, la integración del paciente en este circo paranóico no será sólo como receptor sino también como emisor y actor. Es cuando el paciente se transforma en haciente. Para conseguir esta mutación, los operarios-doctores, además de manipular el Cerbro/Máquina y ejecutar a través de ésta la partitura ritualística, "provocan" a los pacientes a formar parte activa de dicha partitura e incluso a convertirse en líderes o guías de la terapia. En un trance exitoso la sensación general es de nerviosa excitación, exaltación eufórica y alteración del ritmo cardiaco y cotidiano. La sesión finaliza de manera brusca, sacando al paciente de un golpe de su personal trance. Con esto Bacilö potencia el efecto que, por contraste, producirá el ritual, un despertar seco del sueño hipnótico, cuyos efectos secundarios más comunes son el de confusión, tremenda excitación visual y auditiva al tiempo que un inhabitual sosiego. Pero el efecto realmente poderoso de estas terapias se manifestará en la vida cotidiana de cada uno de los pacientes en los días venideros. BACILÖ, 4 DICIEMBRE 2007.


Imagen de la última acción {CON PÚBLICO} conocida de Bacilö


SHTXHÂłD,1752'8&&LÂ&#x2022;1HMHPSORGH(9(1727(5$3,$ULWXDO/Â&#x153;',&2 WHUDSÂŤXWLFR&+$0Â&#x192;1L&2,&Â&#x2022;1,&2IHVWLYD  VersiĂłn en espaĂąol://_ BacilĂś viene desarrollando, a travĂŠs de sus Laboratorios, desde hace algunos aĂąos un producto en forma de performance artĂ­stica ficticia/real que denominamos eventoterapia ( algo asĂ­ como terapias de acciĂłn que suceden en un lugar y momento determinado), donde un nĂşmero X de pacientes [que previamente han aceptado mediante la firma de un contrato las condiciones de la sesiĂłn], son sometidos a un ritual inusual para combatir el estrĂŠs y el aletargamiento del IMOMI*. Mediante la maquinaria paranoica BacilĂś, compuesta por dispositivos audiovisuales de alta y baja tecnologĂ­a interconectados entre sĂ­, los operarios bacilĂś introducen a sus pacientes en un mundo de saturaciĂłn audiovisual haciĂŠndoles perder sus nociones de realidad y materialidad. Como protagonistas de un reality-show, son objeto y sujeto de estudio, pacientes portadores de una enfermedad de la que no son conscientes. La maquinaria bacilĂś manipulada por sus operarios funciona a modo de electro shock y pĂŠndulo hipnĂłtico que hace traNspasar al paciente la barrera de una realidad que siente como referente incuestionable hasta ese momento para despertar en una nueva realidad que no deja de ser una ficciĂłn mĂĄs dentro de nuestra ficciĂłn cotidiana. Para ello la mĂĄquina bacilĂś y los operarios-doctores se sirven de los medios y los mĂŠtodos utilizados por la sociedad de consumo para conseguir adictos/adeptos sin voluntad. En este ritual la mĂĄquina hace continuas demostraciones de poder que van in crescendo hasta apoderarse de la voluntad de sus pacientes. Llegados al punto culmen los pacientes estĂĄn preparados para enfrentarse de nuevo a su realidad cotidiana a la que ya nunca verĂĄn de la misma manera. BacilĂś es ciencia Y ficciĂłn, mediante su ritual de lo deshabitual instala un virus invisible en los rincones mĂĄs escondidos del subconsciente, filtro y antĂ­doto para una reinterpretaciĂłn de la realidad. Estas terapias-rituales, tras sus inicios en el aĂąo 2003, han sido experimentadas de diversas formas, con nĂşmeros variables de pacientes (de 1 a 100) y espacios diferentes. El nuevo formato comprimido que proponemos en este ejemplo estĂĄ aĂşn en fase de desarrollo. Se trata de sesiones rituales terapĂŠuticas para grupos muy reducidos (5 pacientes por sesiĂłn como mĂĄximo), en espacios reducidos y duraciĂłn reducida (sesiones de unos 30 minutos). Desarrollo / fases / plan de trabajo. La realizaciĂłn de este proyecto consta de 2 fases: - Fase 1: Laboratorio - Fase 2: Ritual Fase 1: Laboratorio Es la fase preparatoria donde se genera todo el material audiovisual que serĂĄ utilizado posteriormente en el ritual. AquĂ­ se compone la partitura, la estructura del discurso y se ensaya el producto antes de su presentaciĂłn. Esta fase tiene lugar un mes antes del ritual en la sede de los Laboratorios BacilĂś. Fase 2: Ritual de lo deshabitual Es la performance en sĂ­ que se desarrolla en 2 partes cada una de las cuales tiene lugar en 2 espacios contiguos y comunicados pero aislados acĂşstica y visualmente entre sĂ­. Espacio1- Sala de espera: en este espacio se convoca a todos aquellos que deseen experimentar y ser sometidos al ritual. Es un espacio pĂşblico de acceso


libre donde se pone a disposición de todo aquel que se acerque, material audiovisual informativo sobre nuestro producto a modo de stand promocional. En la sala de espera es donde el asistente que decide convertirse en paciente debe firmar el contrato de aceptación de las condiciones (ejemplares de dicho contrato se encuentran en una mesa a disposición del público). Tras la firma del contrato se le asigna un número, ahora sólo queda esperar a que su número sea nombrado a través de la megafonía de la sala… Los pacientes serán convocados por su número identificativo en grupos de un máximo de 5 personas. El grupo convocado pasa entonces al Espacio 2- Sala operativa. Es el espacio de la terapia-ritual, se trata de una habitación de dimensiones reducidas que contiene los siguientes elementos: - Expositor de máscaras. Al entrar en la sala operativa, el paciente deberá elegir una de las máscaras que se le ofrecen en esta zona. Las máscaras tienen entre sus objetivos proteger el anonimato del paciente y ayudar en la reducción de su EGO. Una vez escogida y endosada la máscara, un operariodoctor conduce al paciente y lo acomoda en un diván. - Divanes. 5 cómodos asientos a ser posible reclinables frente a uno de los muros de la sala operativa donde se proyectan los impulsos audiovisuales del ritual. Es la zona exclusiva de los pacientes desde la que reciben la terapia. - El Cerebro / la Máquina ritualística. Es el organismo humano-tecnológico que genera y proyecta la terapia-ritual sobre los pacientes. Está compuesto por un conjunto complejo de dispositivos audiovisuales conectados entre sí que es manipulado por los operarios_doctores_operadores. - Operarios_doctores_operadores. Realizan dos trabajos: Como Operariosoperadores son los controladores y manipuladores de la Máquina Ritualística. Son los encargados de lanzar el flujo de información a modo de impulsos videosónicos sobre los pacientes. Como Doctores atienden directamente a los pacientes y los guían en su camino hacia la revelación bacilö utilizando para ello métodos inductivos que abarcan sencillos ejercicios físicos y mentales, masajes simbólicos, instrucciones y comandos básicos,… Proporcionan herramientas a los pacientes que les facilitan su viaje. Paralelamente son los Doctores los que estudian y documentan in situ el paso del paciente de una realidad a otra. Son los encargados de precipitar a éste de una manera personalizada en la desmaterialización de su EGO y la virtualización de su NUEVA conciencia.

IMOMI: Individuo Medio O Medio Individuo


pasaje 284-b: va a tener lugar LA LLAMADA y el sacrifico de un PELUCHE vivo

pasaje 284-b.07: ....y surge el trance Con el fuego


invitaciรณn a ciclo de eventoterapias realizado entre las etapas RELIGIร“N y CIENCIA de la era bacilรถ

Trance de iluminaciรณn bacilรถ


diagrama operativo de sesi贸n por un operario_doctor_operador


Imagen que capta UNO de los momentos después de una sesión de efecto euforizante. sin contubernios

LA PROPUESTA QUE NINGÚN AGENTE CULTURAL SE HA ATREVIDO A PROGRAMAR


CONTABILIDAD BACILÖ  

Documento que contiene gran parte del trabajo del proyecto CONTABILIDAD de Corporación Bacilö, excluido a última hora de la programación de...

Read more
Read more
Similar to
Popular now
Just for you