Page 1

-772

6IZMWXEMRJSVQEXMZESJMGMEPHIP'SPIKMSHI1ÒHMGSW]'MVYNERSWHI'SWXE6MGE

%ÚS:w:SPYQIRw(MGMIQFVI

0SWEÚSWHIPE

TERHIQME HIPWMHE PP-475

Diagnóstico  )RJIVQIHEHIWGIVIFVSZEWGYPEVIW  'ÌRGIVHITIRI  -RJPYIR^EEZMEV )RTIVWSRE  (VE+MWIPE,IVVIVE1EVXÖRI^


DEL PRESIDENTE

3TSVXYRMHEH  HIWIVZMV H

*SXS=IWWIRME1SRXIVS

(V.SWĂ’*IHIVMGS 6SNEW1SRXIVS

1Ă’HMGSGMVYNERSIWTIGMEPMWXEIR3RGSPSKĂ–E

4VIWMHIRXIHIP'SPIKMSHI 1Ă’HMGSW]'MVYNERSW

2 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

ace dos aĂąos asumĂ­ con orgullo, entusiasmo y dedicaciĂłn la Presidencia del Colegio de MĂŠdicos y Cirujanos, honor encomendado por los colegas que nos favorecieron con su voto. Al tĂŠrmino de este perĂ­odo y haciendo un recuento de estos aĂąos puedo decir con profunda satisfacciĂłn que hemos trabajado a favor de la modernizaciĂłn del Colegio en infraestructura, tecnificaciĂłn, educaciĂłn mĂŠdica continua, imagen y proyecciĂłn de la comunidad mĂŠdica y de nuestro Colegio. TitulĂŠ el primer artĂ­culo que publiquĂŠ en esta revista “Honestidad, responsabilidad y liderazgo: un contrato irrevocableâ€?, al cual nos hemos apegado firmemente y basado nuestro quehacer como miembros de la Junta de Gobierno. Dentro de las primeras acciones llevadas a cabo estuvo el Programa de Salud Integral para el MĂŠdico, con el objetivo de realizar actividades deportivas y recreativas impartidas de forma permanente en el Colegio. La ĂŠtica y la moral son y serĂĄn siempre principios en los cuales descansa y se fundamenta el funcionamiento del Colegio. Siguiendo y cumpliendo el mandato de que el Colegio debe velar porque la profesiĂłn de la Medicina se ejerza con arreglo a las normas de la ĂŠtica, adoptamos la medida de la autorizaciĂłn de la papelerĂ­a, con el fin de que se verifique que los datos incluidos en ella sean los mismos que constan en los expedientes de los mĂŠdicos. Se realizaron mejoras en las instalaciones del Colegio, en primer lugar y por seguridad dispusimos la instalaciĂłn de equipo con circuito cerrado de televisiĂłn y de la utilizaciĂłn de los carnĂŠs para el ingreso de visitantes. Se colocaron puertas automĂĄticas para la comodidad de las personas, se remodelaron las piscinas y se instalĂł el sistema de calefacciĂłn. Se realizaron reparaciones en la casa que estĂĄ anexa al Colegio, con el fin de condicionar oficinas para la Junta del CapĂ­tulo de TecnĂłlogos en Salud, el grupo coordinador de los Profesionales Afines y Asociaciones MĂŠdicas. Como parte del trabajo de modernizaciĂłn en las ĂĄreas del Colegio, la Junta aprobĂł la compra de un

software que consta de 10 diferentes mĂłdulos que permiten la realizaciĂłn de las tareas administrativas de una forma mĂĄs eficiente, en beneficio de los usuarios de nuestros servicios. Igualmente, se modificĂł la red de datos, inalĂĄmbrica y telefĂłnica, ademĂĄs hemos instalado el internet inalĂĄmbrico. Para tales, fines el Colegio realizĂł la compra de cinco enrutadores, ubicĂĄndolos en ĂĄreas estratĂŠgicas, brindando una cobertura del servicio en las siguientes zonas: auditorio, salones, vestĂ­bulo, plataforma de servicio, segundo piso y ĂĄrea de piscinas. Aquellas personas que deseen hacer uso del servicio sĂłlo deben traer su computadora portĂĄtil y conectarse al internet por medio del Colegio de MĂŠdicos. En cuanto a los convenios suscritos, podemos citar: BN Conectividad con el Banco Nacional, con lo que se le brinda al colegiado la opciĂłn para la cancelaciĂłn del pago de la colegiatura. Otro de los convenios es entre el Colegio de MĂŠdicos y Cirujanos de Costa Rica y la empresa Aura Interactiva, que origina el proyecto e-Learning por tecnologĂ­a, el cual consiste en ofrecer conocimiento actualizado y continuo a todos los colegiados independientemente de donde se ubiquen a travĂŠs de un servicio de capacitaciĂłn y actualizaciĂłn. Para la Junta de Gobierno es importante esta alianza, ya que a travĂŠs del servicio que se ofrecerĂĄ los mĂŠdicos obtendrĂĄn un ahorro al capacitarse desde su sitio de trabajo o casa, teniendo acceso a los cursos las 24 horas, los 365 dĂ­as del aĂąo, en cualquier zona del paĂ­s, reforzando asĂ­ la educaciĂłn mĂŠdica continua. Este aĂąo, el programa de educaciĂłn mĂŠdica estuvo conformado por 12 mĂłdulos que correspondieron a dos cursos de actualizaciĂłn, que contaron con una amplia participaciĂłn. Por su parte, el Congreso MĂŠdico de este aĂąo fue uno de los de mayor concurrencia, definimos un costo de inscripciĂłn accesible para los mĂŠdicos. Cuando iniciamos nos comprometimos con la actualizaciĂłn de los Reglamentos del Colegio de MĂŠdicos y poner en ejecuciĂłn aquellos que estaban siendo obviados, ejemplo de ello es el cumplimiento del Reglamento del ComitĂŠ CientĂ­fico. Actualmente, se revisĂł y modificĂł el CĂłdigo de Moral MĂŠdica y el Reglamento de la Ley OrgĂĄnica, en lo concerniente al Tribunal de Elecciones. Las acciones han sido muchas, no obstante quiero brindarles un panorama general del trabajo realizado, el cual no hubiera sido posible sin la dedicaciĂłn y compromiso de mis compaĂąeros de la Junta de Gobierno, al trabajo de los funcionarios del Colegio de MĂŠdicos, a todos los colegas que integran los diferentes ComitĂŠs y Tribunales del Colegio, pero sobretodo debo agradecer a Dios por haberme dado la posibilidad de trabajar para todos ustedes y a cada uno por la oportunidad que me brindaron de servir.


CARTA DE LA DIRECTORA

*SXS=IWWIRME1SRXIVS

2YIWXVE  VIWTSRWEFMPMHEH E

(VE+MSGSRHE &EXVIW1Ă’RHI^

1Ă’HMGSGMVYNERE IWTIGMEPMWXEIR4WMUYMEXVĂ–E

(MVIGXSVE])HMXSVE+IRIVEP

s muy satisfactorio para el personal de la Revista Medicina Vida & Salud completar con este nĂşmero la Ăşltima ediciĂłn correspondiente al aĂąo 2006. Hacer una revista mensual siempre exige velocidad y precisiĂłn en el cumplimiento de los tiempos previstos para su elaboraciĂłn. Hemos realizado nuestro mejor esfuerzo por ofrecer un buen servicio de informaciĂłn, acorde con nuestras obligaciones como revista del Colegio de MĂŠdicos y de todos sus asociados (as). Asumimos los deberes y responsabilidades que tenemos en la direcciĂłn y ediciĂłn de este medio. Uno de esos compromisos va dirigido a los (as) lectores (as) y tiene que ver en primer lugar con publicar puntualmente la revista. En el caso de pequeĂąos atrasos, estos obedecieron a factores ajenos a la direcciĂłn de la publicaciĂłn. Garantizamos que los artĂ­culos fueran de alta calidad, y mantuvimos un formato consistente en cada nĂşmero. La revisiĂłn de los artĂ­culos fue realizada por el Dr. Sergio Herra SĂĄnchez y mi persona, la cual fue puntual y adecuada. Cuando hubo recomendaciones que hacer a algunos autores,

estos recibieron retroalimentaciĂłn pronta y especĂ­fica. La publicaciĂłn es tan solo una parte del objetivo mĂĄs amplio para la divulgaciĂłn de ideas y resultados, por lo que hemos procurado la promociĂłn y difusiĂłn de la revista internacionalmente y en otros medios. Como editora, he revisado minuciosamente cada nĂşmero, en tareas que de seguro van mĂĄs allĂĄ de un editor tĂ­pico. Creo que hemos crecido mucho en estos cinco aĂąos de publicaciĂłn y lo celebramos a lo grande este aĂąo. Ya existe madurez para elaborar un documento sobre los derechos y responsabilidades de la Revista Medicina, Vida y Salud, que se plantea como una meta en el aĂąo 2007. AsĂ­ mismo, hemos de mejorar nuestra diagramaciĂłn para modernizarla y ajustarla a los requerimientos de nuestro pĂşblico. Es claro que nuestros planes han de contar con la colaboraciĂłn de muchas personas, entonces todas las sugerencias serĂĄn bienvenidas. Les deseamos a la honorable Junta de Gobierno y a todos y todas los que nos leen mes a mes, una feliz Navidad y muchos ĂŠxitos en el aĂąo venidero.

,IQSWVIEPM^EHSRYIWXVSQINSVIWJYIV^STSV SJVIGIVYRFYIRWIVZMGMSHIMRJSVQEGMĂ›REGSVHI GSRRYIWXVEWSFPMKEGMSRIWGSQSVIZMWXEHIP'SPIKMS HI1Ă’HMGSW]HIXSHSWWYWEWSGMEHSW EW  Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 3


DE PORTADA

0SWEĂšSWHIPE  TERHIQMEHIPWMHE %RXIGIHIRXIW

'Ă’PYPEMRZEHMHE TSVIP:-,

4 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

A mediados de 1982 aparecieron en Costa Rica las primeras personas con una enfermedad extraĂąa con repercusiones severas y complicaciones fatales. Poco a poco, estos casos coincidieron con los reportes que la literatura mĂŠdica mundial empezaba a difundir, focalizadas las caracterĂ­sticas clĂ­nicas hacia un grupo de personas con preferencias homosexuales, lo que contribuyĂł a su estigmatizaciĂłn asĂ­ como al surgimiento de conceptos morbosos que generaron pĂĄnico en muchos sectores de la sociedad. El 4 de junio de 1981, se reportaron 5 casos de varones homosexuales con neumonĂ­a por Pneumocystis carinii (ahora P jiroveci) y un sĂ­ndrome de inmunodeficiencia adquirida. Poco despuĂŠs en 1983, se aislĂł el temible agente responsable de esta epidemia perteneciente a una familia de virus animales tipo retrovirus, un lentivirus, al cual se le bautizĂł como virus de la inmunodeficiencia humana “VIHâ€? tipo 1 y luego otro tipo 2. El primer caso conocido de VIH en un ser humano se detectĂł en una muestra de sangre recogida en 1959 de un hombre en Kinshasa, RepĂşblica DemocrĂĄtica del Congo (No se sabe cĂłmo contrajo esta persona la infecciĂłn). El anĂĄlisis genĂŠtico de esta muestra de sangre pareciĂł indicar que el VIH-1 puede haber provenido de un virus Ăşnico a finales de la dĂŠcada de 1940 o principios de los 50. El virus ha existido en los Estados Unidos, por lo menos, desde mediados y finales de la dĂŠcada de 1970. Entre 1979 y 1981, mĂŠdicos de Los Ă ngeles y Nueva York reportaron casos poco comunes de neumonĂ­a, cĂĄncer y otras enfermedades en pacientes masculinos que tenĂ­an relaciones sexuales con otros hombres. Estas eran patologĂ­as que no se encontraban en las personas con sistemas inmunolĂłgicos sanos. Desde entonces cientos de cientĂ­ficos se han dedicado a investigar la etiologĂ­a, ciclo vital, patogenia, medios de transmisiĂłn y el desarro-

(V1ERYIP)RVMUYI 6SNEW1SRXIVS

1Ă’HMGSGMVYNERSIWTIGMEPMWXE IR1IHMGMRE-RXIVRE )WTIGMEPMWXEIR-RJIGXSPSKĂ–E .IJI7IVZMGMS,SWTMXEP7ER .YERHI(MSW''77 4VSJIWSVHI1IHMGMRE-RXIVRE 9RMZIVWMHEHHI'MIRGMEW 1Ă’HMGEW 9'-1)(  llo de medicamentos especĂ­ficos para enfrentar este retrovirus.

)PEKIRXI EstĂĄ formado por tres capas concĂŠntricas: una interna, que es un nucleoide de forma de cono truncado de ARN y la nucleoproteĂ­na con las enzimas. La capa intermedia es la cĂĄpside icosahĂŠdrica del nĂşcleo. La capa externa o envoltura es una bicapa lipĂ­dica derivada de la cĂŠlula huĂŠsped. Tiene insertadas glucoproteĂ­nas del virus constituidas por trĂ­meros de gp120 (gp abreviatura de glucoproteĂ­na), formando 72 proyecciones. Los genes principales, que codifican las proteĂ­nas respectivas, corresponden a los antĂ­genos internos comunes de todos los retrovirus. Se denominan gag (de grupo), pol (polimerasas) y env (envoltura). El gen gag codifica las proteĂ­nas del centro (core). El gen pol codifica, principalmente, las enzimas transcriptasa inversa y la proteasa. El gen env se encarga de las proteĂ­nas de la envoltura vĂ­rica. El gag tiene la funciĂłn de constituir la mayor parte de la estructura del viriĂłn, participando en la sĂ­ntesis de ADN y su integraciĂłn y contribuye a ensamblar las partĂ­culas vĂ­ricas y su salida de la cĂŠlula. El pol interviene en la sĂ­ntesis de ADN y su integraciĂłn en el genoma celular. Por medio de la participaciĂłn del env, se produce la asociaciĂłn y entrada del virus en la cĂŠlula, por lo que se considera como el antĂ­geno de entrada. Las proteĂ­nas reguladoras mĂĄs importantes son las Tat y Rev esenciales para la multipicaciĂłn del virus. La Tat actĂşa como transactivadora de las proteĂ­nas y la Rev se encargar de procesar el ARNm y su transporte selectivo en el citoplasma. Otros genes estructurales son el vpr, que acelera el ciclo de replicaciĂłn. Otro llamado nef puede tener una acciĂłn reguladora y posee un papel no bien conocido en la patogenicidad del virus. El vif se asocia con la infectividad de los viriones extracelulares pero no es esencial para la replicaciĂłn. El vpn facilita la salida de los viriones y reduce la formaciĂłn de los sincicios y


DE PORTADA estĂĄ relacionado con la muerte de los CD4. Por Ăşltimo, el tev es el activador de los tat y rev. Un elemento que interviene en la regulaciĂłn de la inducciĂłn es el factor nuclear kappa beta (NF-kB) que es de una familia de proteĂ­nas que regulan la transcripciĂłn de varios genes celulares implicados en los procesos de activaciĂłn y reconocimiento inmunes. Este factor no existe en forma activa en los linfocitos CD4 en reposo y debe ser inducido.

)PGMGPSZMXEP El VIH penetra en la cĂŠlula por medio de la fusiĂłn de las membranas viral y celular. El receptor especĂ­fico y comĂşn a todos los VIH-1 es una proteĂ­na que se encuentra en la superficie de las cĂŠlulas blanco, que es la molĂŠcula CD4, que no es el linfocito CD4. La gp 120 tiene una enorme afinidad. Las cĂŠlulas con este receptor son los linfocitos y los monocitos (macrĂłfagos) CD4+. ‘In vitro’, otras cĂŠlulas pueden infectarse por el VIH pero no todas poseen la molĂŠcula CD4, son CD4 -. Los linfocitos CD8 no expresan en condiciones normales el receptor CD4, pero se ha descubierto que al infectarse con otros virus como el VHH-6 si pueden expresarlo. Recientemente, se han identificado otros correceptores del virus como los receptores celulares del tipo CC o CXC de ciertas quimioquinas. El correceptor CCR5 es utilizado por las cepas del VIH monocitotrĂłpicas mientras que el CXCR4 tiene linfocitotropismo. Este receptor CXC tambiĂŠn se llama fusina y su uniĂłn natural es el SDF-1. Se cree que las cepas inductoras de sincicios pueden utilizar ambos correceptores, aunque predominantemente usan los CXCR4. Otras algunas sustancias, las intracinas, son capaces de bloquear la expresiĂłn de los correceptores a nivel intracelular. TambiĂŠn pueden actuar como receptores los fragmentos Fc de las inmunoglobulinas y receptores del complemento utilizados por complejos antĂ­geno-anticuerpo. Los antĂ­genos HLA o la beta2-microglobulina permiten que, al ponerse en contacto virus y cĂŠlulas, la uniĂłn se realice a travĂŠs de zonas de adhesiĂłn para la uniĂłn gp120-CD4 en los linfocitos o de la gp120-fusina en cĂŠlulas del epitelio rectal e incluso al receptor Gal-C de algunas cĂŠlulas del sistema nervioso y probablemente otros receptores. El viriĂłn tiene la enzima ciclofilina que al actuar con las proteĂ­nas del envoltorio (cĂĄpside) facilitan la denudaciĂłn viral. DespuĂŠs de la interacciĂłn de la gp120 con los receptores, se produce la fusiĂłn entre las membranas de la cĂŠlula y del virus, lo cual es responsabilidad de la gp41, para insertar en la

membrana celular y llevar al interior la nucleocĂĄpside del virus, permitiendo la liberaciĂłn del genoma. AquĂ­ se inicia la reproducciĂłn del virus (replicaciĂłn) por transcripciĂłn inversa o retrotranscripciĂłn, con la enzima transcriptasa inversa del viriĂłn, lo cual lleva a la formaciĂłn de la primera cadena del ADN a partir del ARN viral. La segunda cadena del ADN requiere la acciĂłn de la ribonucleasa H. La doble cadena asĂ­ generada se integra por intermedio de la integrasa viral en el ADN de la cĂŠlula. Sin embargo, una parte del ADN formado puede persistir en el citoplasma de la cĂŠlula sin integrarse dentro del genoma celular. Esta integraciĂłn del ADN proviral en el genoma celular depende del estado de activaciĂłn de la cĂŠlula, pero parece ser inespecĂ­fica. El ADN en los linfocitos no integrado se produce por la entrada de mĂşltiples viriones en la cĂŠlula. Las copias del material genĂŠtico del VIH como ADN se almacenan en el citoplasma de la cĂŠlula, “latencia preintegraciĂłnâ€?, y se incorpora en los cromosomas de la cĂŠlula a medida que pasa el tiempo como consecuencia de estĂ­mulos sobre la cĂŠlula. Esto podrĂ­a explicar en parte las infecciones silenciosas y utilizarse de base para la preparaciĂłn de vacunas con ADN desnudo. Una vez integrado en el material genĂŠtico de la cĂŠlula, el provirus puede permanecer latente o empezar a multiplicarse de una forma controlada o de una forma masiva, en cuyo caso causa lesiĂłn a la cĂŠlula; mientras que en la latencia, producida tras la integraciĂłn del provirus, no se producen esas alteraciones. La activaciĂłn celular se produce por diferentes factores: antĂ­genos, mitĂłgenos, citocinas o virus heterĂłlogos y ocasionar una cascada de acontecimientos que llevan a la expresiĂłn del genoma viral. El NF-bK es el principal factor regulador de la transcripciĂłn del VIH a partir de su estado de latencia para la sĂ­ntesis de ARN del virus a partir del ADN proviral integrado en la cĂŠlula. Participan las proteĂ­nas Tat y Rev. El ensamblaje del core ocurre en la membrana celular y se inicia con la asociaciĂłn de la proteĂ­na p17 de la matriz con el dominio citoplasmĂĄtico de la proteĂ­na gp41. La sĂ­ntesis de las proteĂ­nas de la envoltura viral se lleva a cabo en el retĂ­culo endoplĂĄsmico de la cĂŠlula huĂŠsped a partir de la gp160. En el aparato de Golgi es clivada por una proteasa para producir gp120 y gp41 antes de transportarla a la superficie de la cĂŠlula. El viriĂłn maduro tiene una membrana, que incluye las proteĂ­nas virales gp120 y gp41, ademĂĄs de varias proteĂ­nas celulares, un core que contiene ARN viral, transcriptasa inversa e integrasa.

0SWĂĄPXMQSWVITSVXIW IWXMQERUYIHIWHI EPEJIGLEYRSW QMPPSRIWHITIVWSREW LERWMHSMRJIGXEHEWTSV IWXIZMVYW,ERJEPPIGMHS QĂŒWHIQMPPSRIW %PVIHIHSVHIQMPPSRIW HITIVWSREWHIWGSRSGIR WYGSRHMGMĂ›RSRS WITVISGYTER -RJIGXMZMHEH La vida libre de los viriones es muy corta, de 0,3 a 0,5 dĂ­as (8-12 horas). En 2,6 dĂ­as se realiza un ciclo viral completo desde la salida de la cĂŠlula infectada, vida libre, infecciĂłn de otro linfocito, multiplicaciĂłn intracelular y el egreso de nuevos viriones. Por lo tanto, el humano infectado por el VIH se encuentra como una mezcla de variantes genĂŠticas estrechamente relacionadas que se denominan cuasiespecies. En sangre perifĂŠrica solo estĂĄn infectados entre el 1 y el 10% de los linfocitos T CD4 circulantes; sin embargo, en los Ăłrganos linfoides, especialmente los ganglios linfĂĄticos, se piensa que pueden estar infectados mĂĄs del 40% de los linfocitos CD4 +. Sin embargo, la amenaza a sus vidas continĂşa latente en los sitios inaccesibles a los medicamentos conocidos como santuarios, adonde se mantiene latente el virus por la imposibilidad de su eliminaciĂłn. La infecciĂłn de cĂŠlulas de las mucosas, cĂŠlulas de Langerhans o de los macrĂłfagos de la microglia cerebral, es un reservorio muy pequeĂąo del VIH pero puede jugar un papel trascendental en la transmisiĂłn sexual del virus y en los reservorios virales en pacientes en terapia antirretroviral altamente supresiva. TambiĂŠn se ha demostrado la existencia de un reservorio viral latente en pacientes con viremia plasmĂĄtica no detectable que presentaban ADN proviral integrado, capaz de producir virus infeccioso tras su activaciĂłn celular in vitro, y ADN no integrado en cĂŠlulas Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 5


DE PORTADA

0SWQIHMGEQIRXSW XMIRIRQYGLSWIJIGXSW WIGYRHEVMSWHIPIZI EKVERMQTEGXSIRPE TIVWSREUYITYIHI SFPMKEVEWYGEQFMS TEVEGSRXVSPEVPSW

6 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

infectadas e inactivas, lo que sugiere la persistencia de replicaciĂłn viral activa in vivo. La existencia de cĂŠlulas infectadas en los lugares en los que los medicamentos no logran ejercer bien su acciĂłn (reservorios o santuarios del VIH1 en los que el sistema inmune no es capaz de descubrirlo), principalmente por la presencia de linfocitos CD4, podrĂ­a explicar la resistencia y rebrotes subsiguientes.

0EWMXYEGMÛRQYRHMEP]REGMSREP Este virus se ha convertido en una pandemia por su distribución en todos los continentes. Aún se desconocen aspectos científicos así como los determinantes económicos, sociales y culturales que permiten su avance. Continúa teniendo impacto en las personas, la economía, los servicios de salud y los profesionales encargados de la atención en los tres niveles. Según la OMS, es una emergencia sanitaria mundial. Los últimos reportes estiman que desde 1981 a la fecha unos 65 millones de personas han sido infectadas por este virus. Han fallecido mås de 25 millones. Alrededor de 39 millones de personas desconocen su condición o no se preocupan. Costa Rica no ha estado exenta de sus efectos. Primero se observó una tendencia ascendente de 1983 a 1998: con cerca de 300 casos nuevos de sida anualmente. De 1998 a la fecha se observa una tendencia descendente a unos 75-100 nuevos por aùo. La infección asintomå-

tica por VIH, el portador sano, mantiene una tendencia ascendente contraria a la tendencia en descenso de la enfermedad (sida). Por edad, los de menor riesgo son los niĂąos menores de 9 aĂąos. Los grupos de mayor riesgo son las personas comprendidas entre los 20 y 39 aĂąos. La tendencia es menor en el grupo de 1519 aĂąos. Existe un descenso progresivo de los 40 a 64 aĂąos y pocos casos en personas mayores de 65 aĂąos. Desde su apariciĂłn hasta 1993, el virus “tuvo predilecciĂłnâ€? por los hombres en relaciĂłn de 20 a 1 con respecto a las mujeres y asĂ­ se manifestĂł en nuestro paĂ­s. A partir de 1994, se incrementa el nĂşmero de mujeres con una relacion de 1 a 10, con lo que se demuestra el aumento de la transmisiĂłn heterosexual y perinatal. Las estrictas medidas de vigilancia serolĂłgica de la sangre y sus hemoderivados han eliminado la transmisiĂłn por esta vĂ­a, en especial de los hemofĂ­licos. El riesgo entre mujeres casadas ha aumentado, sean sus compaĂąeros heterosexuales o bisexuales. TambiĂŠn en la madres adolescentes con drogadicciĂłn, especialmente al crack.

%WTIGXSWXIVETĂ’YXMGSW En la primera dĂŠcada, solo se podĂ­a tratar las infecciones oportunistas y tumores. Pero poco tiempo despuĂŠs se logrĂł sintetizar medicamentos para enfrentar el virus, detener su avance y su terrible efecto sobre el sistema inmune. Quince aĂąos despuĂŠs, se lograron sintetizar mĂĄs antivirales dirigidos principalmente contra la enzima transcriptasa reversa y las proteasas. Los potentes antivirales han ido controlando los efectos negativos hacia el sistema inmune, permitiendo a los pacientes recobrar su salud, reintegrarse a sus labores y llevar vida totalmente normal. Algunos inhibidores nucleĂłsidos de la transcriptasa reversa son zidovudina “AZTâ€?, didanosina “DDIâ€?, estavudina “D4Tâ€?, lamivudina “3 TCâ€? y abacavir, entre otros. Inhibidores no-nucleĂłsidos de la transcriptasa reversa incluyen nevirapina, delavirdina y efavirenz. Inhibidores de la protease son: saquinavir, indinavir, ritonavir, nelfinavir, amprenavir, lopinavir/ritonavir, fosamprenavir, atazanavir, tipranavir.

2YIZEWGPEWIWHIQIHMGEQIRXSW Inhibidores de la integrasa, por intermedio de los diketo-åcidos� o DKAs. Inhibidores de la fusión con inyecciones diarias subcutåneas. Inhibidores de CCR-5.


DE PORTADA 8IVETMEERXMVVIXVSZMVEPEGXYEP Tres medicamentos constituyen el estĂĄndar de manejo para adultos o niĂąos. Existen diferentes asociaciones de antirretrovirales: 1. Dos inhibidores nucleĂłsidos TR (NRTI)+ un inhibidor no nucleĂłsido TR (NNRTI). 2. Dos inhibidores nucleĂłsidos TR (NRTI)+ IP. 3. Tres inhibidores nucleĂłsidos de la transcriptasa (NRTI). 4. Existen presentaciones de una sola tableta conocida como AtriplaÂŽ, que incluye efavirenz, emtricitabina y tenofovir. El tratamiento busca la supresiĂłn mĂĄxima y duradera de la carga viral, la restauraciĂłn y preservaciĂłn inmunolĂłgica con la finalidad de mejorar la calidad de vida y reducir la morbimortalidad. El tratamiento reduce rĂĄpidamente los niveles del virus con un aumento gradual de CD, incremento de CD4 de memoria por la redistribuciĂłn de los tejidos linfoides a la circulaciĂłn. No obstante, los medicamentos tienen muchos efectos secundarios de leve a gran impacto en la persona que puede obligar a su cambio para controlarlos, como anemia megaloblĂĄstica, ictericia, urolitiasis, neuropatĂ­a, pancreatitis, lipoatrofia o lipodistrofia y acidosis lĂĄctica fatal.

4VSXSGSPSHIMRMGMSHIXIVETME GSRIRJIVQIHEHWMRXSQĂŒXMGE Pacientes con CD4 menor o igual a 350 cels/mmÂł y carga viral mayor de 55.000 c/ml. Los esquemas de inicio incluyen efavirenz + zidovudina + lamivudina. Los esquemas en la mujer embarazada VIH + utilizan la zidovudina, que se debe iniciar despuĂŠs de la semana 14, cuando no reciben terapia triple. En estas situaciones se debe mantener la terapia, pero teniendo presente que no se deben utilizar efavirenz, estavudina o didanosina por su toxicidad.

0EFSVEXSVMS Se dispone de pruebas como ELISA y confirmaciĂłn con Western blot. DeterminaciĂłn de carga viral y conteo de cĂŠlulas CD4 CD8. Recientemente, los avances de la ciencia han permitido el diagnĂłstico de la resistencia utilizando pruebas sofisticadas de reacciĂłn en cadena de polimerasa, disponibles en nuestro paĂ­s con la alta capacidad de nuestros microbiĂłlogos, a fin de garantizar el tratamiento utilizando el genoti-

:,-7MHE

po para analizar la resistencia del virus y efectuar los cambios apropiados en la terapia.

'SRXVSP Acciones cotidianas son la clave de su control, como las pruebas de VIH rutinarias en los centros mĂŠdicos, rĂĄpidas y seguras. Prevenir nuevas infecciones educando a los estudiantes y las personas a quienes se les ha diagnosticado el VIH y sus parejas. Controlar la transmisiĂłn de VIH de madre a hijo. El tratamiento de las mujeres embarazadas y de sus bebĂŠs puede reducir de manera sustancial su afectaciĂłn al nacer. Estas intervenciones son mĂĄs eficaces lo mĂĄs temprano posible en el embarazo o, ante la ausencia de control prenatal, deben realizarse en el momento del parto.

:EGYRE Se han hecho progresos en este campo. La vacuna ideal debe bloquear, por medio de anticuerpos, los virus libres asĂ­ como los que infectan las cĂŠlulas con inducciĂłn de inmunidad de la mucosa. Los diferentes subtipos de VIH han sugerido que se necesitan “coctelesâ€? de vacunas para obtener una de impacto universal. Existen vacunas que han protegido a animales del VIH del simio y a una quimera del mismo (SHIV) con envoltura del VIH. Algunos voluntarios han desarrollado una fuerte respuesta inmune que augura resultados promisorios.

'SRWMHIVEGMSRIWJMREPIW Esta pandemia se mantiene activa a nivel mundial. Se debe reconocer el esfuerzo de los profesionales de la salud de nuestro paĂ­s que se han mantenido a la vanguardia para enfrentar esta amenaza y cuyo impacto futuro aĂşn es desconocido. Las posibilidades de nuevos brotes o aumento de la incidencia persisten latentes mientras una vacuna no controle su apariciĂłn y la detecciĂłn continĂşe tardĂ­amente. Los costos para nuestro paĂ­s han ido disminuyendo de $7.260,00 anuales a $1.563,00 por paciente, segĂşn las autoridades institucionales. Sin embargo, las medidas de prevenciĂłn no se toman con la rigurosidad que deberĂ­an tener, en especial nuestros jĂłvenes. La enfermedad necesita la participaciĂłn activa de todos los sectores de la sociedad y una dosis total de responsabilidad a fin de ser controlada, minimizada y con la esperanza de erradicarla del planeta, antes de convertirse en la peor tragedia de la humanidad.

&MFPMSKVEJĂ–EVIGSQIRHEHE 1. Hymes KB, Cheung T, Greene JB, et al. Kaposi’s sarcoma in homosexual men: a report of eight cases. Lancet 1981; 2: 598-600. 2. CDC. Kaposi’s sarcoma and Pneumocystis pneumonia among homosexual men – New York City and California. MMWR 1981; 30: 305-8. 3. CDC. Pneumocystis pneumonia-Los Angeles. MMWR 1981; 30: 250-2. Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 7


MEDICINA, VIDA & SALUD

'SVIEHIP2SVXI~GSRXVEIPQYRHS#

%QIRE^E RYGPIEV 6IGMIRXIQIRXILEGVIGMHSPETVISGYTEGMร›R TSVPEWEQFMGMSRIWHI'SVIEHIP2SVXI HIGVIEVEVQEWRYGPIEVIW)WITEร–W]PSW )WXEHSW9RMHSWWIIRGYIRXVERIRYRXIRWS HYIPSI\EGIVFEHSTSVPEWTVYIFEWRYGPIEVIW GSVIEREWHIPQIWHISGXYFVITEWEHS 8 Medicina Vida y SaludรรŒรย‹Yย‹lย–Oรƒlรร–รงรงร‹


MEDICINA, VIDA & SALUD

"AĂƒÂŒAĂ?clÂ’Ă?"AĂƒĂ? lĂƒcAÆĂ?/Âł

L

a reactivaciĂłn del programa de armas nucleares de Corea del Norte ha puesto nerviosos a sus vecinos y a gran parte del mundo. Los Estados Unidos (EE. UU.), China, Rusia, JapĂłn y Corea del Sur presionan fuertemente para que el paĂ­s abandone sus ambiciones nucleares. Mientras que Kim Jong-Il, lĂ­der de los norcoreanos desde 1994, exige un tratado de no agresiĂłn por parte de los Estados Unidos antes de dar cualquier paso, ejerce presiĂłn en un intento para que Washington sea mĂĄs flexible. Por su parte, EE. UU. parece ansioso por alcanzar un suavizamiento de las tensiones, pero mantiene una posiciĂłn firme ante lo que llama un chantaje nuclear de Corea del Norte contra el mundo.

&SQFEHIXMIQTS La comunidad internacional sospechaba que Corea del Norte mantenĂ­a un programa clandestino de desarrollo de armas nucleares desde la dĂŠcada de 1990, ĂŠpoca en que construyĂł un reactor nuclear para producir plutonio, en Yongbyon. Pero el surgimiento de ese paĂ­s asiĂĄtico como un potencial riesgo se clarificĂł a inicios de octubre de 2002, cuando el Secretario de Estado Adjunto de EE. UU., James Kelly, insistiĂł en averiguar sobre las sospechas del lanzamiento de un programa nuclear. En ese momento, segĂşn el artĂ­culo de BBC NEWS, del 16 de octubre de 2006, titulado “Timeline: North Korea nuclear stand-offâ€?, Kelly afirmĂł tener evidencia de un programa secreto de enriquecimiento de uranio, llevado a cabo en contra del Marco de Acuerdo de 1994 relacionado con el tema. Unos dĂ­as despuĂŠs, EE. UU. anunciĂł que, en conversaciones, Corea del Norte habĂ­a admitido tener un programa secreto de armas nucleares. En consecuencia, el Secretario de Estado, Colin Powell, puso en duda el futuro de la ayuda a ese paĂ­s. En primera instancia, la reacciĂłn de los coreanos fue defender su derecho a desarrollar armas, pero luego ofrecieron frenar sus programas nucleares a cambio de ayuda internacional y la firma de un pacto con los EE. UU. de no-agresiĂłn. Las dudas existentes alrededor de la actividad nuclear del paĂ­s asiĂĄtico llevaron a la Agencia Internacional de EnergĂ­a Nuclear de Naciones Unidas (IAEA por sus siglas en inglĂŠs), a sellar la planta de Yongbyon. A inicios de diciembre, el gobierno coreano pidiĂł que dichos sellos y el equipo de vigilancia se retiraran. Al no lograrlo, cerca de finalizar el aĂąo, las autoridades norcoreanas se encargaron de hacerlo ellas mismas. A los dos dĂ­as se iniciaron los arreglos de dicha planta.

(EXSWFĂŒWMGSW

C

orea del Norte se conoce oficialmente como la RepĂşblica Popular DemocrĂĄtica de Corea, y es un paĂ­s del este asiĂĄtico, ubicado en la parte norte de la PenĂ­nsula de Corea. Al norte limita principalmente con la RepĂşblica Popular China y en el extremo noreste del paĂ­s unos 18 kilĂłmetros con Rusia. Al sur limita con Corea del Sur, con la que conformĂł una sola unidad territorial llamada Corea, hasta 1945. DespuĂŠs de la ocupaciĂłn japonesa de Corea, que acabĂł tras la derrota de los nipones en la II Guerra Mundial, el paĂ­s se dividiĂł en dos. La UniĂłn SoviĂŠtica pasĂł a controlar el ĂĄrea en el norte, mientras que los Estados Unidos asumieron control del sur. Aunque el pueblo no fue consultado acerca de la decisiĂłn, la mayorĂ­a recibĂ­a alegre la liberaciĂłn del mando imperial japonĂŠs. Sin embargo, objetaban la nueva imposiciĂłn de regĂ­menes en la penĂ­nsula. El hecho de que los soviĂŠticos y estadounidenses no lograron alcanzar un acuerdo para implementar un mando conjunto, llevĂł al establecimiento de dos gobiernos separados, cada uno llamĂĄndose a sĂ­ mismo el gobierno legĂ­timo de toda Corea. Las tensiones entre ambos gobiernos siguieron en aumento hasta que problemas limĂ­trofes llevaron a la guerra civil conocida como la Guerra de Corea, en junio de 1950. Ă˜l›Ă?l_Ă?:‹‘‹Žlc‹AÂłÂ&#x;ĂƒÂ€

'SVIEHIP2SVXIIW lYRVĂ’KMQIRSTVIWMZS GY]EWTIVWSREW ZMZIRIRIPXIQSV ]PEMRERMGMĂ›Rz +ISVKI;&YWL HIIRIVS Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 9


MEDICINA, VIDA & SALUD

/MQ.SRK-PPĂ–HIV HIPSWRSVGSVIERSW HIWHI

A inicios de 2003, la IAEA emitiĂł una resoluciĂłn exigiendo que Corea del Norte readmitiera a los inspectores de la OrganizaciĂłn de Naciones Unidas (ONU) y abandonara en semanas su programa de armas. De lo contrario, podrĂ­a recibir sanciones del Consejo de Seguridad de la ONU. A cambio, el paĂ­s anunciĂł dĂ­as despuĂŠs que se retiraba del Tratado de No-ProliferaciĂłn Nuclear. A pesar de ello, el Consejo de Seguridad solamente mostrĂł su preocupaciĂłn, pero evitĂł condenar pĂşblicamente los actos. En un intento por alcanzar algĂşn acuerdo, China promoviĂł conversaciones entre EE. UU. y Corea del Norte. A los pocos dĂ­as, una delegaciĂłn de congresistas estadounidenses dijeron que oficiales norcoreanos habĂ­an admitido que el paĂ­s tenĂ­a armas nucleares y acababan de completar la fabricaciĂłn de partes que les permitirĂ­an construir otras mĂĄs. SegĂşn la informaciĂłn de la BBC, las tensiones aumentaron cuando el gobierno coreano anunciĂł pĂşblicamente que construirĂĄ un disuasivo nuclear, “a menos que los EE. UU. abandonara su polĂ­tica hostilâ€?. Los intentos por alcanzar acuerdos continĂşan mediante conversaciones entre diversos paĂ­ses, e incluso con la aceptaciĂłn de Corea del Norte de estar dispuesta a considerar la oferta estadounidense de una garantĂ­a de seguridad a cambio de acabar con el programa nuclear. No obstante, los coreanos aumentaron sus exigencias y pidieron una lista de concesiones a los norteamericanos como condiciĂłn para entablar cualquier conversaciĂłn futura. El resultado: una negativa total del presidente Bush. En julio de 2004, se reunieron el Secretario de Estado estadounidense, Colin Powell, y el Ministro de Relaciones Exteriores coreano, Paek Nam-sun, en lo que constituyeron las conversaciones de mĂĄs alto nivel desde que estallĂł la crisis entre ambos paĂ­ses. Los resultados no fueron fructĂ­feros, y en respuesta a comentarios de Bush describiendo a Kim Jong-Il, el lĂ­der coreano, como un “tiranoâ€?, un mes mĂĄs tarde Corea del Norte describiĂł al presidente Bush como un “imbĂŠcilâ€? y un “tirano que coloca a Hitler en la sombraâ€?.

~)RPIKĂ–XMQEHIJIRWE# Gran parte de la justificaciĂłn coreana detrĂĄs de su programa nuclear se basa en afirmaciones de que las armas son necesarias para la defensa personal en contra de la amenaza nuclear estadounidense. Las relaciones entre Corea del Norte y los EE. UU. a menudo se describen como tensas e impredecibles. El segundo mantiene sanciones econĂłmicas en contra del primero, bajo la Ley de Comercio con el Enemigo, firmada en 1917, que permite restringir el comercio con aquellos paĂ­ses hostiles hacia EE. UU. Desde el alto al fuego de la Guerra de Corea, en 1953, el gobierno coreano ha tenido diferencias con el paĂ­s norteamericano, asĂ­ como con JapĂłn y Corea del Sur. Desde el aĂąo 2000, las relaciones entre el gobierno de George W. Bush y el de Kim Jong-Il sufrieron un gran deterioro y se eliminaron las relaciones diplomĂĄticas entre ambos. Entre los nomina10 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË


MEDICINA, VIDA & SALUD dos por Bush a la SecretarĂ­a de Estado en 2005, Condoleezza Rice identificĂł a Corea del Norte como uno de los “seis bastiones de la tiranĂ­aâ€?, al que los EE. UU. debe ayudar a llevar la libertad. Los otros integrantes de su lista fueron Cuba, Birmania, IrĂĄn, Bielorrusia y Zimbabwe. Este listado se hizo eco del llamado “eje del malâ€?, concepto utilizado en un discurso de Bush en enero de 2002, para describir lo que denominĂł “regĂ­menes que apoyan el terrorâ€?. En ese entonces, la lista de Bush mencionaba Ăşnicamente a Iraq, IrĂĄn y Corea del Norte, pero posteriormente se agregaron Libia, Siria, Zimbabwe, Bielorrusia y Cuba. Responsabilizando al gobierno de Bush de “antagonizar y aislar su programa nuclear a toda costaâ€?, Corea del Norte suspendiĂł por tiempo indefinido su participaciĂłn en cualquier encuentro para discutir el tema, destacando nuevamente la justificaciĂłn de construir su arsenal nuclear en defensa propia. No obstante, en setiembre de ese aĂąo se emitiĂł un histĂłrico comunicado conjunto, en donde Corea del Norte acordaba abandonar todas sus actividades nucleares y reintegrarse al Tratado de No-ProliferaciĂłn, mientras que los EE. UU. decĂ­a nunca haber tenido intenciones de atacar. Para sorpresa del mundo, al dĂ­a siguiente los norcoreanos ignoraron el comunicado conjunto, al afirmar que no eliminarĂ­an su programa hasta no recibir un reactor nuclear para uso civil.

0EQEXIVMETVMQE

E

l uranio es una sustancia radiactiva que se encuentra en la naturaleza, y es el centro de cualquier programa nuclear, tanto civil como militar. Puede extraerse de hoyos abiertos o de minas subterrĂĄneas, y aunque se encuentra en todo el mundo, solo una pequeĂąa cantidad estĂĄ concentrada. Cuando algunos ĂĄtomos de uranio se separan en una reacciĂłn en cadena, se libera energĂ­a en un proceso conocido como fisiĂłn nuclear. En una planta nuclear la fisiĂłn ocurre lentamente, mientras que en un arma nuclear ocurre sumamente rĂĄpido. Los principales productores de uranio son Australia, CanadĂĄ, China, KazajstĂĄn, Namibia, NĂ­ger, Rusia y UzbekistĂĄn.

'VMWMWHIEPMQIRXEGMĂ›R Y es que es precisamente el pueblo norcoreano quien se ve mĂĄs afectado por el conflicto. Ya en 1990 se dio una hambruna que matĂł a alrededor de dos millones de personas. La situaciĂłn actual lleva a muchos grupos de ayuda humanitaria a temer que se repita la crisis de los noventa. SegĂşn informaciĂłn de la BBC, Hazel Smith, profesora de relaciones internacionales en la Universidad de Warwick, experta en Corea del Norte, y visitante de la zona con “World Food Programmeâ€? y Unicef, afirma que la crisis de comida en Corea del Norte es uno de los problemas mĂĄs olvidados del mundo, ya que se desvĂ­a la atenciĂłn por el ĂŠnfasis puesto en su programa nuclear. “Todas las familias en Corea conocen a alguien que ha muerto por desnutriciĂłnâ€?, asegura Smith. SegĂşn el Programa Mundial de Comida de Naciones Unidas (WFP, por sus siglas en inglĂŠs), la encuesta mĂĄs reciente de gran escala sobre el tema, realizada en octubre de 2004 por ellos junto con Unicef y el gobierno norcoreano, encontrĂł que 37 por ciento de los niĂąos menores de seis aĂąos estaba crĂłnicamente desnutrido, y que un tercio de las madres estaba desnutrido y anĂŠmico. Smith afirma que gran parte de los norcoreanos ha subsistido a niveles mĂ­nimos durante 15 aĂąos y que si la actual crisis continĂşa, estarĂĄ en verdadero peligro. De acuerdo a un artĂ­culo de Penny Spiller para la BBC, del 24 de octubre de 2006, se estima que Corea del Norte necesita alrededor de cinco millones de toneladas mĂŠtricas de cereal, arroz y trigo al aĂąo, para poder alimentar a sus 23 millones de habitantes. Sin embargo, en aĂąos de buena cose-

-A›Ă?AĂ?Â›Ă˜YÂ’lAĂƒÂł

Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 11


MEDICINA, VIDA & SALUD 0SWIRWE]SW

A

menudo, los ensayos con dispositivos nucleares se realizan bajo tierra, para prevenir que el material radiactivo que se libera durante la explosiĂłn llegue a la superficie y contamine el ambiente. El sitio para el ensayo se estudia cuidadosamente y, por lo general, se encuentra bien alejado de los centros de poblaciĂłn. El aparato nuclear se coloca en un hueco o tĂşnel entre 200 y 800 metros de profundidad y varios metros de ancho. Una cĂĄpsula recubierta con plomo, con equipo de monitoreo, se coloca por encima del dispositivo. El agujero se sella bien con grava, arena, “gypsumâ€? y otros materiales para contener la explosiĂłn y elementos radiactivos. La detonaciĂłn se realiza por control remoto desde un sitio seguro en la superficie. La explosiĂłn nuclear vaporiza las rocas subterrĂĄneas, y crea una cĂĄmara bajo tierra con gas radioactivo a altĂ­simas temperaturas. Conforme se enfrĂ­a, en el fondo de la cĂĄmara se acumula la roca fundida. Minutos u horas despuĂŠs, al bajar la presiĂłn, la cĂĄmara colapsa y deja ver un crĂĄter en la superficie. Aunque esta prĂĄctica garantiza un cierto grado de discreciĂłn, la radiaciĂłn liberada tras una explosiĂłn nuclear subterrĂĄnea puede dar pistas acerca de la composiciĂłn y el tamaĂąo del dispositivo y asĂ­, de la capacidad nuclear del paĂ­s detrĂĄs de la prueba. En el caso de Corea del Norte, se cree que en el mes de octubre del presente aĂąo realizĂł un ensayo de un dispositivo relativamente pequeĂąo en P’unggye-yok, ubicado en un ĂĄrea remota al este del paĂ­s. Ă˜l›Ă?l_Ă?

Ă?#lĂ&#x;Æ`Ă?ÂœĂ?clĂ?Â&#x;YĂ?Ă˜OĂƒl`Ă?Öçç˳

l)PHMWGYVWSHIP 7V&YWLIWYRE HIGPEVEGMĂ›REFMIVXEHI EKVIWMĂ›RTEVEHIVVSGEV IPWMWXIQEHIPTEĂ–W ]Ă’PIWYRGLEVPEXĂŒR WMRZIVKĂŁIR^Ez 'SQYRMGEHSHI 'SVIEHIP2SVXI HIIRIVS 12 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

cha, el paĂ­s por sĂ­ solo Ăşnicamente puede producir el 85 por ciento de lo requerido y depende de fuentes externas para el millĂłn de toneladas adicionales. Aunado a la crisis polĂ­tica actual, en julio el paĂ­s sufriĂł la pĂŠrdida de alrededor de 100.000 toneladas de cosechas debido a las inundaciones. El WFP opera en 13 condados del paĂ­s, intentando alimentar a alrededor de 1.9 millones de personas que han identificado como necesitadas de ayuda alimenticia. No obstante, la organizaciĂłn pronostica que la cifra puede ascender rĂĄpidamente a seis millones al llegar el invierno. “Los norcoreanos, particularmente en las ciudades y pueblos, dependen casi totalmente del Estado para la distribuciĂłn de alimentos. Y, si los suministros estĂĄn limitados, el gobierno alimentarĂĄ primero a los militares y oficiales de alto rango, antes que a los mĂĄs necesitadosâ€?, asegura Spiller.

)PTVIWIRXIEĂšS De acuerdo a BBC News, en 2006 Corea del Norte emitiĂł amenazas de iniciar un bombardeo nuclear en contra de EE. UU. en caso de un ataque de los norteamericanos. La respuesta de un portavoz de la Casa Blanca fue que la amenaza era “profundamente hipotĂŠticaâ€?. Sin embargo, el dĂ­a de la independencia de EE. UU. los coreanos probaron al menos seis misiles, a pesar de las numerosas advertencias de la comunidad internacional. Al dĂ­a siguiente, probaron otro misil mĂĄs. El costo de dichos ensayos comenzĂł a verse de inmediato. Dos dĂ­as mĂĄs tarde, Corea del Sur suspendiĂł la ayuda alimenticia en protesta por los actos de su vecino. El Consejo de Seguridad de Naciones Unidas, en un voto unĂĄnime, impuso inmediatas sanciones a los norcoreanos. La resoluciĂłn exigiĂł que los paĂ­ses miembros cesen todas las exportaciones e importaciones de materiales relacionados con misiles a Corea del Norte. Asimismo, exigiĂł al paĂ­s frenar su programa de misiles nucleares. El 3 de octubre, el Ministerio de Relaciones Exteriores norcoreano emitiĂł un comunicado donde anunciĂł la realizaciĂłn de una prueba nuclear para aumentar su capacidad de defensa ante la hostilidad estadounidense. Aunque dice que el ensayo se llevarĂĄ a cabo en el futuro, no se detalla la fecha exacta. Menos de una semana mĂĄs tarde, Corea del Norte anunciĂł que ya realizĂł la primera prueba de un arma nuclear en su historia. Noticias de la BBC citan al gobierno catalogando lo ocurrido como “un hecho histĂłrico llevado a cabo de manera segura y exitosaâ€?. Tras pruebas realizadas en manos de oficiales de inteligencia estadounidenses, se informĂł que en el sitio del ensayo se encontraron materiales radiactivos, lo que confirmĂł la explosiĂłn nuclear subterrĂĄnea. El comunicado hablaba de una explosiĂłn de menos de una kilotonelada. Las consecuencias no se hicieron esperar, y el Consejo de Seguridad de Naciones Unidas impuso, unĂĄnimemente, sanciones en armas y financieras. SegĂşn informaciĂłn del 9 de octubre en “Voice of Americaâ€?, el Embajador norcoreano


MEDICINA, VIDA & SALUD

4SHIVIWRYGPIEVIW

H

asta 1998, se hablaba de cinco potencias nucleares en el mundo. En ese aùo, sin embargo, el número ascendió a siete, cuando India y Pakistån anunciaron públicamente que habían realizado numerosas pruebas subterråneas. *VERGME • Primera prueba nuclear: 1960 • Prueba nuclear mås reciente: 1996 • Total de pruebas: 210 (160 subterråneas)

F

rancia realizĂł seis controversiales pruebas entre 1995 y 1996.

6YWME

)WXEHSW9RMHSW • Primera prueba nuclear: 1945 • Prueba nuclear mås reciente: 1992 • Total de pruebas: 1.030 (815 subterråneas)

E

+VER&VIXEÚE • Primera prueba nuclear: 1952 • Prueba nuclear mås reciente: 1991 • Total de pruebas: 45 (24 subterråneas)

L

• Primera prueba nuclear: 1998 • Prueba nuclear mås reciente: 1998 • Total de pruebas: 6

E

T

ste fue el segundo paĂ­s del mundo en efectuar pruebas nucleares.

'LMRE

ste paĂ­s ha realizado mĂĄs pruebas que el resto del mundo y fue el primer y Ăşnico paĂ­s en usar un arma nuclear en tiempo de guerra. Estados Unidos firmĂł el Tratado de ProhibiciĂłn Completa de Ensayos Nucleares (CTBT por sus siglas en inglĂŠs), un acuerdo multilateral que prohĂ­be todas las pruebas con detonaciones nucleares, pero el Senado no lo ha ratificado aĂşn.

a primera prueba britĂĄnica se realizĂł en las Islas Monte Bello, en Australia. Se efectuaron ensayos atmosfĂŠricos hasta 1956. El paĂ­s ratificĂł el Tratado de ProhibiciĂłn Completa de Ensayos Nucleares.

4EOMWXĂŒR

• Primera prueba nuclear: 1949 • Prueba nuclear mås reciente: 1990 • Total de pruebas: 715 (496 subterråneas)

• Primera prueba nuclear: 1964 • Prueba nuclear mås reciente: 1996 • Total de pruebas: 45 (22 subterråneas)

A

ras su tercera guerra con la India, en 1972, PakistĂĄn tomĂł la decisiĂłn de iniciar un programa de armas nucleares que igualara la capacidad de desarrollo de su contrincante. Cuando la India efectuĂł pruebas nucleares en 1998, PakistĂĄn le respondiĂł con el anuncio de haber explotado seis artefactos subterrĂĄneos en la regiĂłn de Chagai, cerca de la frontera con IrĂĄn.

lgunos sostienen que China ayuda a PakistĂĄn en sus esfuerzos nucleares.

-RHME • Primera prueba nuclear: 1974 • Prueba nuclear mås reciente: 1998 • Total de pruebas: 5

E

n 1966, la India afirmĂł que en cuestiĂłn de 18 meses podĂ­a producir armas nucleares. Ocho aĂąos mĂĄs tarde, probĂł un dispositivo de hasta 15 kilotoneladas y se refiriĂł a la prueba como una “explosiĂłn nuclear pacĂ­ficaâ€?. En mayo de 1998, sorprendiĂł al mundo con cinco pruebas nucleares subterrĂĄneas, en Pokharan, Rajasthan, y se declarĂł a sĂ­ misma un Estado nuclear.

Ă˜l›Ă?l_Ă?½0ÂŽlY‹AÂ’Ă?/lÂŽÂ&#x;ĂƒĂ?_Ă?#Â&#x;ĂƒĂ?ˆĂ?Â&#x;ĂƒlA`Ă?#Ă˜YÂ’lAĂƒĂ?2l›Æ‹Â&#x;›ž`Ă? ##ÂłYÂ&#x;–`Ă?Â&#x;YĂ?Ă˜OĂƒlĂ?clĂ?Öçç˳

Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 13


MEDICINA, VIDA & SALUD ante las Naciones Unidas, Pak Gil Yon, dijo que “serĂ­a mejor si el Consejo de Seguridad felicitara a Pyongyang en vez de aprobar resoluciones inserviblesâ€?.

9REPXSGSWXS

0ESVKERM^EGMĂ›RHI HIVIGLSWLYQERSW l,YQER6MKLXW ;EXGLzEJMVQE UYIPEGSQYRMHEH MRXIVREGMSREPIWXĂŒIR TIPMKVSHIGEWXMKEV EPTYIFPSHI'SVIE HIP2SVXITSVIP GSQTSVXEQMIRXS HIWYKSFMIVRS 14 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

Aunque las sanciones impuestas a Corea del Norte tras la prueba nuclear del 9 de octubre especĂ­ficamente excluĂ­an la ayuda humanitaria, algunos observadores han expresado temor del posible impacto que eso puede tener. Spiller, para la BBC, afirma que millones de norcoreanos estarĂĄn en riesgo de morir de hambre al llegar el invierno, debido a la baja en la ayuda humanitaria, a la sombra del furor internacional causado por el ensayo nuclear en el paĂ­s. “Agencias de ayuda dicen que gran parte de la poblaciĂłn ya sobrevive con la raciones bĂĄsicas, y temen que una mayor reducciĂłn en los suministros de comida pueda llevar a que se repita la hambruna de la dĂŠcada de los noventaâ€?, dice Spiller. La ayuda cada vez es menor. Tras la suspensiĂłn en julio de los envĂ­os de Corea del Sur, uno de los principales proveedores de alimentos, el paĂ­s ha sentido la escasez de varios tipos de comidas, y no existe indicaciĂłn de cuĂĄndo SeĂşl piensa reactivarlos. De igual forma, los alimentos provenientes de China, otro proveedor clave, parecen haber bajado un tercio en un aĂąo. El WFP advierte que tiene comida suficiente para llegar hasta enero, y Smith, experta en el paĂ­s, sostiene que el producto nacional no serĂĄ suficiente para llegar al otro aĂąo. Sophie Richardson, de Human Rights Watch, es tajante al decir que “no podemos permitirnos ser cĂłmplices en la inaniciĂłn potencial de millones de personas inocentesâ€?. SegĂşn la Associated Press, el 31 de octubre de 2006, Corea del Norte aceptĂł reiniciar conversaciones sobre desarme. El acuerdo se dio durante la reuniĂłn de representantes estadounidenses, chinos y norcoreanos en Beijing. Se espera que dichas conversaciones den inicio antes de que acabe el aĂąo. Resta ver si las conversaciones y acuerdos llegan a tiempo para impedir la muerte por hambre de cientos de miles de personas. *YIRXIW7IPMK7,EVVMWSRl(MHXLI974VSZSOI2/SVIE# -W/MQ.SRK-PVIEH]XSTVSZSOIEVIKMSREPGVMWMW#z2I[W[IIO -RXIVREXMSREPHISGXYFVI%WWSGMEXIH4VIWWl2SVXL /SVIEXSVINSMRREXMSRRYGPIEVXEPOWzHISGXYFVI4IXIV ,IMRPIMRl97%WOWJSV8SYKL927ERGXMSRW3R2SVXL/SVIEz :SMGISJ%QIVMGEHISGXYFVIl7TIGMEP6ITSVX2SVXL /SVIE2YGPIEV8IRWMSRz'22GSQSGXYFVIl8MQIPMRI 2/SVIERYGPIEVWXERHSJJz&&'2);7HISGXYFVI 4IRR]7TMPPIVl*SSH'VMWMW0SSQWMR2SVXL/SVIEz&&'2I[W HISGXYFVIl*EGXJMPI9RHIVKVSYRHRYGPIEVXIWXMRKz&&' 2I[WHISGXYFVIl2SVXL/SVIEMWWYIWRYGPIEVXLVIEXz &&'HIHMGMIQFVIl2SVXL/SVIEERDMQQMRIRXXLVIEX z '22GSQHIQEV^Sl5 %2/SVIERYGPIEVWXERHSJJz &&'2);7HISGXYFVI9RMXIH2EXMSRW;SVPH*SSH 4VSKVEQl;SVPH,YRKIV/SVIE (46 z:MGXSV('LE] (EZMH'/ERKl8LI/SVIE'VMWMWz*SVIMKR4SPMG]QE]SNYRMS %KIRG]JSV8S\MG7YFWXERGIWERH(MWIEWI6IKMWXV] %87(6  GSRFEWIIR%XPERXE+ISVKMEIWYREEKIRGMEJIHIVEPHIWEPYHHIP (ITEVXEQIRXSHI7EPYH]7IVZMGMSW,YQERSWHIPSW))99


EN PERSONA

*SXS=IWWIRME1SRXIVS

(VE+MWIPE,IVVIVE1EVXĂ–RI^ 6IWTIXS ]IRXVIKE EPSW TEGMIRXIW

ya que al terminar PremĂŠdica le propusieron matrimonio. Al contrario de lo que esperaba, su pareja de ese momento le ayudĂł enormemente a concluir sus estudios. Incluso, ni quedar embarazada en su segundo aĂąo afectĂł su determinaciĂłn.

)TMHIQMEQYRHMEP

MarĂ­a del Mar Cerdas R.

%GEVKSELSVEHI WYTVSTMSGIRXVSHI MRZIWXMKEGMĂ›RGSRWMHIVE WYI\TIVMIRGMEIR IPXVEXEQMIRXS] GSQFEXIHIPWMHEYRE IWGYIPEMRZEPYEFPI 16 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

E

stuvo cerca de dedicarse a los idiomas y no a lo que la habĂ­a apasionado desde niĂąa. Aquella Dama Voluntaria del Hospital MĂŠxico, de tan solo 16 aĂąos, que se fascinaba al presenciar partos y cirugĂ­as mientras las compaĂąeras de su edad se desmayaban, se alejĂł del campo de la Medicina por presiĂłn. En aquel entonces, un novio de juventud decidiĂł que ĂŠl serĂ­a el Ăşnico mĂŠdico de la pareja, por lo que ella debĂ­a elegir otra carrera. Pensando en alternativas, Gisela Herrera contemplĂł la EnfermerĂ­a como opciĂłn, pero esto tampoco funcionĂł. Tras la insistencia de su novio, ingresĂł a estudiar idiomas. “Por suerte terminĂŠ con ĂŠlâ€?, recuerda entre risas la Dra. Herrera. “Tuve que correr muchĂ­simo para alcanzar a mis compaĂąeros de PremĂŠdica, y fue un esfuerzo enorme. LlevĂŠ cursos de verano y dos materias por suficiencia, pero lo logrĂŠâ€?. Al tiempo, sintiĂł de nuevo temor de no llegar mĂĄs allĂĄ del segundo aĂąo de Medicina,

“Todo me gustabaâ€?, recuerda Herrera al hablar sobre la elecciĂłn de su especialidad. “Lo Ăşnico que sabĂ­a que no podĂ­a hacer era ortopedia, porque requerĂ­a de mucha fuerza y me era fĂ­sicamente imposible. La cirugĂ­a tampoco, porque yo usaba lentes de contacto y me daba miedo no tener la precisiĂłn necesariaâ€?. La GinecologĂ­a fue su primera aficiĂłn, pero segĂşn comenta, era una ĂŠpoca en que habĂ­a muy pocas mujeres ginecĂłlogas y la decisiĂłn de quiĂŠnes entrarĂ­an a la especialidad no se decidĂ­a a travĂŠs de exĂĄmenes, sino que estaba a cargo de una sola persona. “Quien debĂ­a elegir me dijo claramente que no aceptarĂ­a mujeres, y se justificĂł con todas las razones propias del machismoâ€?. La siguiente opciĂłn fue InfectologĂ­a. A Herrera le gustaba esta rama porque los pacientes siempre se salvaban, y porque le parecĂ­a una labor detectivesca interesante y un reto dinĂĄmico. Sin embargo, en 1985, al terminar su especialidad, el mundo entero y la joven reciĂŠn graduada recibieron un duro golpe del destino: apareciĂł el sida. Ahora, distinto al pasado, todos los pacientes se morĂ­an. “El sida me hizo aprender mucho, desde aspectos de opciones sexuales hasta comportamiento humano y la muerte. A un paciente le podĂ­a asegurar que en seis u ocho meses iba a morir, y acompaĂąarlo en ese procesoâ€?, recuerda. “Vivimos cosas durĂ­simas. En el Hospital CalderĂłn Guardia no se hacĂ­an exĂĄmenes de sangre de VIH por ignorancia, quizĂĄs. Los colegas no querĂ­an ver a los pacientes. Al principio ni querĂ­an darles de comer. Ahora, en cambio, es totalmente diferente. Fue una gran lucha, no solo por los pacientes que iban a morir, sino con el rechazo de la comunidad que llegĂł al extre-


EN PERSONA

mo de que hubo quienes querĂ­an quemar las casas de los enfermosâ€?. Pero poco a poco se logrĂł educar y convencer a mĂĄs y mĂĄs gente, y las cosas comenzaron a cambiar, en la comunidad y en el hospital. Herrera recuerda cuando en la ĂŠpoca en que Antonio Ă lvarez Desanti fue presidente de la Asamblea Legislativa, ayudĂł con un recurso de amparo planteado primero por un solo paciente con sida y luego por otros dos; ellos defendĂ­an su derecho a que en el hospital se les hicieran exĂĄmenes de sangre. La Sala IV fallĂł a favor del primero, quien lamentablemente muriĂł tres meses despuĂŠs. Pero tambiĂŠn fallĂł positivamente para los otros dos pacientes, lo que significĂł un cambio rotundo en la evoluciĂłn de la enfermedad. “Fue muy interesante porque era vivir la historia. Antes, el pronĂłstico de vida era de seis u ocho meses, y ya no. Por lo menos sabemos que pueden tener una excelente calidad de vidaâ€?, dice la especialista. La doctora reconoce que cambiar las prĂĄcticas sexuales de riesgo no es fĂĄcil, pero que de sus pacientes aprendiĂł a cĂłmo llegar a una relaciĂłn mĂĄs pareja con ellos y cĂłmo son ellos quienes tienen las respuestas. Ella recuerda la lucha de seis aĂąos para obtener las medicinas para los pacientes con VIH, y la lucha que siguiĂł para lograr que se tomaran las cerca de 15 pastillas diarias necesarias.

4EWSJMVQI Tras 15 aĂąos de laborar en el campo de la InfectologĂ­a, especĂ­ficamente en investigaciĂłn clĂ­nica, la Dra. Herrera tomĂł la difĂ­cil decisiĂłn de dejar la Caja Costarricense de Seguro Social (CCSS) para dedicarse a su propio centro de investigaciĂłn. “Fue duro irme, por los pacientes, por todo el tiempo que pasĂŠ con cada uno de ellosâ€?, admite. “Pero aquĂ­ se puede ayudar de forma interesante, en ensayos clĂ­nicos donde se hace todavĂ­a mĂĄs labor social, con medicamentos de altĂ­sima calidad, un sistema mĂĄs estricto y riguroso, seguimientos mĂĄs frecuentes (en la

CCSS eran cada cinco o seis meses, aquĂ­ cada 15 dĂ­as), y un trato a pacientes de altĂ­sima calidad. AdemĂĄs, no solo vemos infectologĂ­a, sino otras afecciones tambiĂŠnâ€?. Al centro llegan algunos pacientes que no encontraron cupo en la CCSS o que fueron devueltos muy rĂĄpido, o bien porque llegaron al tope de posibilidades para su tratamiento en la instituciĂłn. AquĂ­ se les puede ofrecer algo mĂĄs despuĂŠs del “noâ€?. Algo interesante, segĂşn comenta Herrera, es que todo lo que aprendiĂł trabajando con el VIH puede aplicarlo a todas las otras patologĂ­as. Se dio cuenta de que no funcionaba la forma en que les enseĂąaron, de mandar un medicamento y desentenderse. “Es indispensable compenetrarse con el paciente, entender su medio, con quiĂŠn vive, comprender por quĂŠ un paciente sigue el tratamiento mientras que otro no lo haceâ€?, explica. “Se debe oĂ­r al paciente y negociar con ĂŠl. Al aplicar esto a otras enfermedades se puede tener mĂĄs ĂŠxito. TambiĂŠn ayudĂł mucho la experiencia de lidiar con la muerte y el dolor. Incluso fue una escuela para la vida personalâ€?. La experiencia y el hecho de que las compaùías farmacĂŠuticas la pedĂ­an a ella especĂ­ficamente, la llevaron a tomar la decisiĂłn de abrir su propio centro. Para la Dra. Herrera era la mejor manera para cambiar cosas con las que no estaba de acuerdo, como la forma de reclutar pacientes y la calidad del trato, entre otros. El Centro de InvestigaciĂłn ClĂ­nica, CorporaciĂłn GIHEMA, abriĂł sus puertas en abril y estĂĄ en la etapa de consolidaciĂłn. “Es todo un reto y sigue darlo a conocer a las casas farmacĂŠuticas y hacer que confĂ­en en nosotros. Es una etapa difĂ­cil, que exige tener muchos protocolos, un servicio excelente y buenos resultadosâ€?. Los logros despuĂŠs del trabajo le generan una gran satisfacciĂłn a esta mĂŠdico. AdemĂĄs, reconoce que antes estaba muy dividida al trabajar en muchos lugares y en muchas cosas, lo que no le permitĂ­a disfrutar su trabajo; cada conversaciĂłn con los pacientes y colegas, la parte de educaciĂłn, de transmitir los conocimientos adquiridos. Ahora es mucho mĂĄs enriquecedor.

-2:)78-+%'-Âż2()'%0-(%( Nombre: Ă? ‹ÆlÂ’AĂ?lĂƒĂƒlĂƒAĂ?"AĂƒĂ?Œ›lĂĽ Edad:Ă?Ă? {çĂ?AÂ?Â&#x;Æ Estados civil:Ă?Ă? 4›‹ ›Ă?’‹OĂƒl`Ă?/AyAlÂ’Ă? lĂƒÂ›B›clĂĽĂ?°Ă?ĂƒAOAÂ?AĂ?l›Ă? lÂ’Ă?ÆlYĂ?Â&#x;ĂƒĂ?AĂƒĂ?ÂŒĂ†Ă?‹YÂ&#x;Âą Hijos: Ă? AĂƒÂ’AĂ? l ›Ă?°Ñç¹`Ă? A–‹’AĂ?°ŒÊ¹Ă? ĂĄĂ?0lOAÆĂ?‹B›Ă?°Œ~ÂąĂ?lĂƒÂ›B›clĂĽ Medicina general:Ă?4›‹ÞlĂƒĂ†Â‹cAcĂ?clĂ? Â&#x;ÆĂ?AĂ?/‹YAĂ?°4 /Âą Especialidad en InfectologĂ­a:Ă?4 / Lugar de trabajo:Ă? Â&#x;ĂƒÂŽÂ&#x;ĂƒAY‹ ›Ă?"`Ă? l›Ă?ĂƒÂ&#x;Ă?clĂ?›ÞlÆĂ?‹€AY‹ ›Ă? ’Œ›‹YAÂł Pasatiempo:Ă?lÂŽÂ&#x;ĂƒĂ?lƳĂ?YĂ?Ă˜A’–l›Ă?lĂ? ÂŽĂƒAYĂ?‹YAĂ?½ÆŽ‹››‹›€ž`Ă?ÂŽlĂƒÂ&#x;Ă?YÂ&#x;ĂƒĂƒÂ‹Â Ă? cĂ˜ĂƒA›Ă?lĂ?Â–Ă˜YˆÂ&#x;Ă?Ă?‹l–ŽÂ&#x;`Ă?‹›YÂ’Ă˜Ă†Â&#x;Ă? l›Ă?–AĂƒAĂ?Â&#x;›lÆ`Ă?ˆAÆĂ?AĂ?lÂ’Ă?AÂ?Â&#x;Ă?ÖççÖĂ? YĂ˜A›cÂ&#x;Ă?ÆlĂ?Â’lƋÂ&#x;› Ă?Ă˜Â›AĂ?ĂƒÂ&#x;c‹’’AÂł

~59-Âś2)7# Tiempo libre: Ă? Â’Ă?Ă?‹l–ŽÂ&#x;Ă?Â¸Ă˜lĂ?ÂŽĂ˜lcÂ&#x;Ă? clc‹YAĂƒĂ?AĂ?–ŒĂ?–‹Æ–AÂł Estudios:Ă?Ă? -lĂƒÂ–A›l›Ă?lÂł Muerte:Ă?Ă? -AĂƒAĂ?–ŒĂ?lÆĂ?A’€Â&#x;Ă?Â¸Ă˜lĂ? Â¸Ă˜Â‹Ă†Â‹lĂƒAĂ?Â¸Ă˜lĂ?›Â&#x;Ă?yĂ˜lĂƒAĂ? ÆÂ&#x;ĂƒÂŽĂƒlÆAÉĂ?A’€Â&#x;Ă?AދÆAcÂ&#x;`Ă? ÂŽAĂƒAĂ?ÂŽĂƒlÂŽAĂƒAĂƒÂ–lÂł Familia: Ă? ’€Â&#x;Ă?Â¸Ă˜lĂ?clOlĂ?YĂ˜Â’Ă?‹ÞAĂƒĂ†lÂł MĂşsica: 2Â&#x;cÂ&#x;Ă?Â’Â&#x;Ă?Â¸Ă˜lĂ?Ăžl›€AĂ? clÂ’Ă? AĂƒÂ‹OlÉĂ?lÆĂ?Â&#x;ĂĄĂ? ÆlÂ€Ă˜ĂƒAĂ?Â¸Ă˜lĂ?Ă?Ă˜ĂžlĂ?A’€Ù›Ă? A›Ă?lÂŽAÆAcÂ&#x;Ă?clĂ?AÂˆÂŒÂł Placer: Ă? Â&#x;–lĂƒÂł Defecto: Ă? 0lĂƒĂ?Â–Ă˜ĂĄĂ?–A›cÂ&#x;›AÂł Virtud: Ă? -lĂƒĂ†lĂžlĂƒA›Y‹AÂł Si pudiera cambiar una sola cosa del mundo actual: lĂ?Â’Â&#x;Ă?ÂŽlÂ&#x;ĂƒĂ?Â¸Ă˜lĂ?ÆlĂ?cAĂ? lÆĂ?Â’AĂ?c‹ÆYĂƒÂ‹Â–Â‹Â›AY‹ ›Ă?Â‹ĂƒĂƒAY‹Â&#x;›AÂ’Âł El VIH/sida y Ă frica: ˆŒĂ?l–Žlü Ă?Â’AĂ? lŽ‹cl–‹AĂ?Â–Ă˜Â›c‹AÂ’Ă?ĂĄĂ?lÆĂ?Ă˜Â›Â&#x;Ă?clĂ?Â’Â&#x;ÆĂ? YÂ&#x;›Ă?‹›l›Ă?lÆĂ?–BÆĂ?AylYĂ?AcÂ&#x;ÆĂ?ĂĄĂ?YÂ&#x;›Ă?–l›Â&#x;ÆĂ? AĂ?l›Y‹ ›Ă?c‹ÆŽÂ&#x;›‹OÂ’lÂłĂ?-lĂƒÂ&#x;Ă?AĂ?Â’AĂ?ĂžlĂĽ`Ă?lÆĂ?BĂ? cA›cÂ&#x;Ă?Â€ĂƒA›clÆĂ?lݮlÂ?AݟAÆ`Ă?ÂŽÂ&#x;ĂƒĂ?lÂ?l–Ž’Â&#x;Ă? l›Ă?lÂ’Ă?YÂ&#x;›Ă?ĂƒÂ&#x;Â’Ă?clĂ?Ă?ĂƒA›Æ–‹Æ‹ ›Ă?ÂŽlĂƒÂ‹Â›AĂ?AÂ’`Ă? ˆAĂ?cl–Â&#x;ÆĂ?ĂƒAcÂ&#x;Ă?YÂ&#x;ÆAÆĂ?‹›YĂƒlÂŒOÂ’lƳĂ?ٛĂ? ›Â&#x;ÆÂ&#x;Ă?ĂƒÂ&#x;ÆĂ?YÂ&#x;›Ă?Ă?Â&#x;cÂ&#x;ÆĂ?Â’Â&#x;ÆĂ?–lc‹Â&#x;ÆĂ?›Â&#x;Ă? ˆl–Â&#x;ÆĂ?ÂŽÂ&#x;c‹cÂ&#x;Ă?lÆĂ?AOÂ’lYlĂƒĂ?Ă˜Â›Ă?ÂŽĂƒÂ&#x;Â€ĂƒA–AĂ? ÂŽlĂƒÂ‹Â›AĂ?AÂ’Ă?ĂĄĂ?lÂ’Â’Â&#x;ÆĂ?Ă†ÂŒÂłĂ?›Ă?€l›lĂƒAÂ’Ă?YĂƒlÂ&#x;Ă? Â¸Ă˜lĂ?Â’lÆĂ?ˆA›Ă?yAÂ’Ă?AcÂ&#x;Ă?Â&#x;ÂŽÂ&#x;ĂƒĂ?Ă˜Â›Â‹cAclƳ

Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 17


DIAGNĂ“STICO

*SXS=IWWIRME1SRXIVS

)RJIVQIHEHIW  GIVIFVSZEWGYPEVIW

(V6ÛKIV8SVVIW'SVHIVS

1Ă’HMGSGMVYNERSIWTIGMEPMWXEIR2IYVSGMVYKĂ–E ,SWTMXEP7ER.YERHI(MSW''77

H

oy en dĂ­a, todas las personas, especialmente los adultos jĂłvenes, estĂĄn propensas a sufrir muchas enfermedades; pero en los Ăşltimos aĂąos se han venido desarrollando con mucha frecuencia los aneurismas cerebrales, ya que existen 25 casos por cada 100.000 habitantes. Un aneurisma cerebral es una dilataciĂłn anĂłmala (similar a un globo), que se origina en alguna porciĂłn de una arteria cerebral, y que es proclive a un crecimiento desmesurado, o a una ruptura, creando un sangrado cerebral que puede discapacitar o generar la muerte de un importante nĂşmero de personas jĂłvenes. Dicha enfermedad puede ser causada por factores genĂŠticos (anomalĂ­as en la arquitectura de la pared vascular traĂ­das desde el nacimiento), asociados a circunstancias adquiridas como el fumado, traumatismos, infecciones, drogadicciĂłn, alteraciĂłn en el metabolismo de las grasas en sangre, presiĂłn alta, entre otros. En algunas raras ocasiones son detectados durante exĂĄmenes fĂ­sicos rutinarios, siendo aislados en forma accidental durante algĂşn estudio de rayos X, lo cual no siempre ocurre antes de la ruptura del aneurisma. Los aneurismas en la mayorĂ­a de los casos no generan ningĂşn sĂ­ntoma hasta que alcanzan un tamaĂąo importante o se rompen; sin embargo, un nĂşmero no despreciable de personas portadoras de este mal pueden presentar sĂ­ntomas como parĂĄlisis de un nervio craneal, pupilas dilatadas, visiĂłn doble, dolor 18 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

encima y debajo del ojo y dolores de cabeza localizados. Una vez ocurrida la ruptura del aneurisma, la mayorĂ­a de las personas presenta los siguientes sĂ­ntomas: dolor de cabeza explosivo, cuello rĂ­gido, intolerancia a la luz brillante (fotofobia), nĂĄuseas, vĂłmito, ataques (convulsiones), parĂĄlisis y pĂŠrdida de conocimiento. El objetivo del tratamiento es aislar exitosamente el aneurisma de la circulaciĂłn cerebral. Actualmente los aneurismas son tratados por una cantidad de medios que incluyen: Clip quirĂşrgico: Esta operaciĂłn implica cirugĂ­a de crĂĄneo abierta, y es realizada por neurocirujanos; con el fin de acceder al cerebro, una secciĂłn del crĂĄneo llamada lĂĄmina Ăłsea (bone plate) es removida. Un clip pequeĂąo de metal es colocado alrededor del cuello del aneurisma, obstruyendo la entrada de sangre. La lĂĄmina Ăłsea es entonces atada con alambre en su lugar, y el hueco es cerrado. El clip quirĂşrgico es efectivo para ambos aneurismas, rotos y sin romperse, en muchos pacientes. EmbolizaciĂłn endovascular: Es un procedimiento que genera una barrera fĂ­sica que repara la arteria e induce la trombosis espontĂĄnea del aneurisma, sin requerir una cirugĂ­a abierta convencional. El tratamiento de aneurismas con coils ha estado en uso durante muchos aĂąos. Al principio, esta terapia estuvo limitada a tratar aneurismas inoperables, pero a travĂŠs de mejoras en la tecnologĂ­a y la experiencia creciente


DIAGNĂ“STICO del mĂŠdico, la embolizaciĂłn con coil se ha convertido en uno de los mejores tratamientos para los aneurismas. Su propĂłsito es el de sellar el aneurisma fuera del flujo sanguĂ­neo para reducir el riesgo de hemorragia, o nueva hemorragia. Las coils actĂşan no solo como una barrera fĂ­sica, sino tambiĂŠn como agentes trombogĂŠnicos para estimular la formaciĂłn de coĂĄgulos de sangre. Puesto que la embolizaciĂłn de coil es menos invasiva que el clip quirĂşrgico, el estrĂŠs fisiolĂłgico colocado en el paciente puede ser inferior. Adicionalmente, los coils pueden proveer un grado agregado de protecciĂłn al permitir un periodo de recuperaciĂłn antes de que la cirugĂ­a pueda ser llevada a cabo. Debido a que los sĂ­ntomas y signos son completamente inespecĂ­ficos, la Ăşnica forma de estar absolutamente seguro de que se posee o no dicha lesiĂłn es siendo examinado por un especialista calificado en enfermedades del sistema nervioso, que recomiende el estudio diagnĂłstico por imĂĄgenes idĂłneo para cada paciente en forma individual, por ejemplo: angio-tomografĂ­a cerebral, angio-resonancia

cerebral, angiografĂ­a cerebral por sustracciĂłn digital (**ideal), doppler transcraneal. “Hoy hay una nueva esperanza de vidaâ€?, es el lema utilizado para hacer conciencia en los costarricenses acerca de que cualquiera puede sufrir esta enfermedad, pero lo mĂĄs importante, que con este nuevo mĂŠtodo es posible salvarles la vida a muchas personas, cuando los aneurismas son detectados a tiempo.

&MFPMSKVEJĂ–EVIGSQIRHEHE 1- American Heart Association 2002 Heart and Stroke Statistical update Dallas, Textas, AHA (125-132) 2- Stroke “Hope true reserchâ€? Mayo 1999. National Institute or Neurological Disorders and Stroke 25 de julio 2002 pag 227 – 236. 3- Lancet Unruptured intracraneal aneurysm. Natural History, clinical outcome and risk of surgical and endovascular treatment no.362 pag 103-110.

)PGVIGMQMIRXS HIWQIWYVEHSS YREVYTXYVEHIYRE EVXIVMEGIVIFVEPTYIHI HMWGETEGMXEVSKIRIVEV PEQYIVXIHIYR MQTSVXERXIRåQIVSHI TIVWSREWNÛZIRIW

Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 19


DIAGNĂ“STICO

*SXS=IWWIRME1SRXIVS

'ĂŒRGIV  HITIRI (VE1EVĂ–E.SWĂ’>EQSVE1SRXIWHI3GE

1ÒHMGSGMVYNERE 9RMZIVWMHEH%YXÛRSQEHI'IRXVSEQÒVMGE 9%'% %WMWXIRXIHI)QIVKIRGMEW,SWTMXEP'EPHIVÛR+YEVHME''77

E

l cĂĄncer de pene es una enfermedad angustiante para el paciente, por presentar conjuntamente problemas fĂ­sicos, psicolĂłgicos y sexuales. Es una de las neoplasias menos frecuentes del aparato genitourinario en paĂ­ses con buen nivel de desarrollo sanitario como el nuestro. Sin embargo, las complicaciones y aun la mortalidad no son nada despreciables. En Costa Rica, la incidencia de cĂĄncer de pene es de 0,68 por cada 100.000 hombres. Comprendiendo asĂ­ del 2 al 5% de los tumores urogenitales, presentĂĄndose mayormente a partir de la quinta dĂŠcada de vida. El factor etiolĂłgico mĂĄs frecuente es la mala higiene genital. La acumulaciĂłn de esmegma y bacterias, asociada a la presencia de fimosis, puede producir inflamaciĂłn crĂłnica y llevar por medio de carcinĂłgenos no identificados al desarrollo de cĂĄncer de pene. La presencia de virus del papiloma humano (HPV), especialmente los tipos 16, 18, 31, 33 y 45, se ha relacionado tambiĂŠn con el cĂĄncer de pene. El tabaco es un factor de riesgo para padecer cĂĄncer peneano, asĂ­ como la presencia de balanitis xerotica obliterante o lesiones premalignas, como condilomas gigantes, la enfermedad de Bowen, el tumor de Buschke-Lowenstein, y la leucoplaquia entre otros. Se puede localizar anatĂłmicamente en cualquier sitio del pene, con una frecuencia de 48% en el glande, 21% en el prepucio, 9% en glande y prepucio, y 6% en el surco balanoprepucial. Los sĂ­ntomas iniciales pueden ser vagos, "Ă˜lÆĂ?ĂƒAĂ?ÂˆÂ‹Ă†Ă?Â&#x;’ €‹YAĂ?Â¸Ă˜lĂ?ÂŽĂƒlÆl›Ă?AĂ? desde prurito, ardor y ulceraciĂłn del glande o del YAĂƒY‹›Â&#x;–AĂ?lŽ‹clĂƒÂ–Â&#x;‹clĂ?clĂ?ÂŽl›l 20 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

prepucio. ClĂ­nicamente se presenta como una lesiĂłn indurada o eritematosa, palpable, ulcerada y/o vegetante, con o sin secreciĂłn fĂŠtida. En la mayorĂ­a de las ocasiones se asocia a un prepucio fimĂłtico. Es importante hacer un diagnĂłstico diferencial del cuadro clĂ­nico con el chancro sifilĂ­tico, chancroide y condilima acuminado. El 96% de los casos corresponde a carcinoma epidermoide, este se clasifica a su vez en tres categorĂ­as: mal diferenciado, moderadamente diferenciado y bien diferenciado. Los pacientes con tumores bien diferenciados presentan metĂĄstasis linfĂĄticas en mĂĄs del 50% de los casos. Otros tipos incluyen carcinoma basocelular, melanoma, sarcoma de Kaposi o infiltraciones secundarias a linfomas o leucemias. Entre los diferentes tipos de carcinoma in situ se encuentran la enfermedad de Bowen, que tĂ­picamente involucra el prepucio, y la eritroplasia de Queyrat, que se caracteriza por ser una lesiĂłn rojiza con ulceraciĂłn que usualmente involucra el glande. Al momento del dictamen, el 64% de los pacientes presenta adenopatĂ­as inguinales, de las cuales el 45% son metastĂĄsicas y el resto inflamatorias. La presencia de metĂĄstasis a distancia es rara, Ăşnicamente se presenta entre el 1% a 10%. Durante el diagnĂłstico clĂ­nico se debe realizar un examen fĂ­sico detallado y prestar particular atenciĂłn a la lesiĂłn peneana encontrada, palpando minuciosamente el pene, el ĂĄrea proximal a la lesiĂłn con el fin de definir su extensiĂłn y distinguir adecuadamente el cuerpo esponjoso y los cuerpos cavernosos. AdemĂĄs de explorar


DIAGNĂ“STICO con cautela las regiones inguinales y anotar las caracterĂ­sticas de las adenopatĂ­as encontradas si acompaĂąan a la lesiĂłn inicial. Si estas lesiones generalmente se encuentran con sobreinfecciĂłn y no se distinguen con claridad, se aconseja dar tratamiento antibiĂłtico adecuado. Si esta no sanara en 2 a 3 semanas se debe hacer una biopsia, obteniendo muestras de la lesiĂłn del ĂĄrea perifĂŠrica incluyendo en ellas tejido sano. Entre los exĂĄmenes de gabinete adecuados que se deben completar para definir el estadio de la enfermedad, se encuentran los exĂĄmenes de laboratorio completos, el US, el TAC pĂŠlvico, la Rx de tĂłrax y la gamagrafĂ­a Ăłsea, completando asĂ­ el Estadiaje (TNM). La diseminaciĂłn del cĂĄncer de pene se puede dar a travĂŠs de varias vĂ­as: local, que se extiende a los cuerpos cavernosos o uretra; la diseminaciĂłn linfĂĄtica a ganglios femorales e iliacos, y la diseminaciĂłn hematĂłgena al pulmĂłn, hĂ­gado, hueso y cerebro. El pronĂłstico para definir la sobrevida del paciente depende del estadio tumoral y dentro de este, la presencia de enfermedad linfĂĄtica metastĂĄsica o metĂĄstasis a distancia. El sistema TNM describe adecuadamente la invasiĂłn y la extensiĂłn de la neoplasia. La meta terapĂŠutica es la resecciĂłn completa del tumor primario y como tratamiento se propone la penectomĂ­a parcial o total, ya que los tumores epidermoides solo responden bien al tratamiento quirĂşrgico. Este tratamiento siempre se debe complementar 6 semanas despuĂŠs con linfadenectomĂ­a ilioinguinal bilateral modificada, la cual ha mostrado mayor sobrevida comparada con pacientes a los cuales se les ha realizado tardĂ­amente. La quimioterapia y la radioterapia no son el tratamiento de elecciĂłn para los tumores epidermoides, solo se indican en el manejo paliativo, como neoadyuvante en estadios avanzados. Es importante mencionar que la prevenciĂłn y el diagnĂłstico temprano del cĂĄncer de pene a nivel primario y secundario han sido ignorados como problema de salud. Se deben promover medidas higiĂŠnicas bĂĄsicas, el uso masivo de

preservativo; y realizar resecciones de lesiones intraepiteliales neoplĂĄsicas peneanas, y el seguimiento adecuado de cuadros inflamatorios, en particular del liquen esclerosante. La realizaciĂłn de la circuncisiĂłn a temprana edad en pacientes con fimosis y con lesiones condilomatosas, promete prevenir a largo plazo riesgos adicionales en la gĂŠnesis de tumores peneanos. Podemos concluir que el cĂĄncer de pene es un problema y un reto para la salud de nuestro paĂ­s. El mejorar la educaciĂłn sobre la higiene personal podrĂ­a disminuir la incidencia considerablemente. La cirugĂ­a es el Ăşnico tratamiento curativo existente, en algunos pacientes seleccionados se puede preservar el Ăłrgano y asociar tratamientos de radioterapia o lĂĄser paliativos, aunque esto depende del estadio de la enfermedad.

2)340%7-%4)2)%2%90')6%(%

4)2)'831Âş%4%6'-%0= 0-2*%()2)'831Âş%-0-3-2+9-2%0

&MFPMSKVEJÖEVIGSQIRHEHE 1. Campbell´s Urology. Tumor of the Penis. 8th edición. Philadelphia, 2002: 2945-2996. 2. Enfermedades de transmisión sexual. Genital HPV Infection. Vol 7, Nº 1. Marzo 2005; 79:95 3. The Lancet, Oncology. Penile carcinoma. Vol 5. Abril 2004; 240:247 '0%7-*-'%'-¿2812 +ERKPMSW6IKMSREPIW 2

1IXĂŒWXEWMWEHMWXERGME 1

2;Ă?Ă?Ă˜Â–Â&#x;ĂƒĂ?ÂŽĂƒÂ‹Â–AĂƒÂ‹Â&#x;Ă?›Â&#x;Ă?ĂžAÂ’Â&#x;ĂƒAOÂ’l

8YQSVTVMQEVMS 8

#;Ă?A›€’‹Â&#x;ÆĂ?›Â&#x;Ă?ĂžAÂ’Â&#x;ĂƒAcÂ&#x;Æ

";Ă?"lĂ?BÆĂ?AƋÆĂ?›Â&#x;Ă?ĂžAÂ’Â&#x;ĂƒAOÂ’lÆ

2çĂ?›Â&#x;Ă?lދcl›Y‹AĂ?clĂ? Ă?Ă˜Â–Â&#x;ĂƒĂ?ÂŽĂƒÂ‹Â–AĂƒÂ‹Â&#x;

#çĂ?0‹›Ă?–lĂ?BÆĂ?AƋÆĂ? €A›€’‹Â&#x;›AĂƒlÆĂ?

"ç�0‹›�–l�BÆ�AƋÆ�A�c‹Æ�A›Y‹A

2ÂŚĂ?›ÞAclĂ?Ă?lÂ?‹cÂ&#x;Ă? YÂ&#x;›lYĂ?‹ÞÂ&#x;Ă?Ă†Ă˜OlŽ‹Ă?l’‹AÂ’

#ÂŚĂ?A›€’‹Â&#x;Ă?ٛ‹YÂ&#x;`Ă? Â‹Â›Â€Ă˜Â‹Â›AÂ’Ă?Ă†Ă˜ÂŽlĂƒy‹Y‹AÂ’

"Œ�"l�BÆ�AƋÆ�A�c‹Æ�A›Y‹A�

2Ă–Ă?›ÞAclĂ?YĂ˜lĂƒÂŽÂ&#x;Ă? YAĂžlĂƒÂ›Â&#x;ÆÂ&#x;Ă?Â&#x;Ă?lƎÂ&#x;›Â?Â&#x;ÆÂ&#x;

#Ă–Ă?A›€’‹Â&#x;ÆĂ?Â‹Â›Â€Ă˜Â‹Â›AÂ’lÆĂ? Ă†Ă˜ÂŽlĂƒy‹Y‹AÂ’lÆĂ?–Ù’Ă?‹Ž’lÆĂ? Â&#x;Ă?O‹’AĂ?lĂƒAÂ’lÆ

2Ă‘Ă?›ÞAƋ ›Ă?clĂ?Ă˜ĂƒlĂ?ĂƒAĂ?Â&#x;Ă?ÂŽĂƒÂ Ă†Ă?AĂ?A

#Ă‘Ă?A›€’‹Â&#x;Ă?Â‹Â›Â€Ă˜Â‹Â›AÂ’Ă? ÂŽĂƒÂ&#x;yĂ˜Â›cÂ&#x;Ă?Â&#x;Ă?ÂŽm’Þ‹YÂ&#x;Ă? Ă˜Â›Â‹Â’AĂ?lĂƒAÂ’Ă?Â&#x;Ă?O‹’AĂ?lĂƒAÂ’

2‹ÆĂ? AĂƒY‹›Â&#x;–AĂ?‹›Ă?ƋĂ?Ă˜ 2AĂ? AĂƒY‹›Â&#x;–AĂ?ĂžlĂƒĂƒĂ˜Â€Â&#x;ÆÂ&#x;Ă? ›Â&#x;Ă?‹›ÞAÆÂ&#x;Ăƒ

2~Ă?‹›ÞAƋ ›Ă?clĂ?lÆĂ?ĂƒĂ˜YĂ?Ă˜ĂƒAÆĂ? AcĂĄAYl›Ă?lÆ

Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 21


DIAGNĂ“STICO

*SXS=IWWIRME1SRXIVS

-RJPYIR^E  EZMEV

(V3WGEV6SFIVXS'LMRK=Y

1Ă’HMGSGMVYNERS 9RMZIVWMHEH-FIVSEQIVMGERE 92-&)

D

urante toda su existencia, la humanidad ha tenido que convivir con muchos agentes infecciosos de diversos tipos, entre ellos bacterias, hongos, parĂĄsitos y virus. Algunos de ellos han causado grandes enfermedades; para algunas de ellas tenemos una cura. Sin embargo, para otras, aĂşn hoy en dĂ­a y con los grandes avances tecnolĂłgicos en el campo de la Medicina, no tenemos una cura ni mucho menos una vacuna. Uno de los agentes infecciosos mĂĄs importantes son los virus. Se debe recordar que estos microorganismos contienen sĂłlo ADN o ARN, de ahĂ­ su capacidad de recombinar y fusionar su material genĂŠtico con el de su huĂŠsped y de ese modo convertirse en otro, fenĂłmeno llamado deriva genĂŠtica. Algunos ejemplos de virus letales son: virus de la hepatitis, rotavirus, virus de inmunodeficiencia adquirida y la influenza.

8MTSWHIMRJPYIR^E

9RSHIPSWEKIRXIW MRJIGGMSWSWQĂŒW MQTSVXERXIWWSR PSWZMVYW 22 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

En nuestro mundo, existe gran cantidad de tipos de influenza; no obstante, para fines prĂĄcticos solo se harĂĄ menciĂłn de: influenza estacional y la influenza aviar.

-RJPYIR^EIWXEGMSREP Es una enfermedad cosmopolita, caracterizada por epidemias estacionales que se propagan rĂĄpidamente mediante fluidos

respiratorios, en un grupo de población. Esta ha causado gran cantidad de pÊrdidas económicas en todo el mundo. Clínicamente caracterizada como una enfermedad predominante de las vías respiratorias superiores, produce generalmente malestar general, fiebre, mialgia, cefalea, tos seca, autolimitada a 1 semana. En el hombre existen dos tipos: A y B, donde la A es la causante de muertes y se subdividen en H3N2 y H1N1 (Hemaglutinina y Neuroaminidasa). La influenza estacional, por sí sola, ha causado pandemias, las cuales han producido millones de fallecimientos, entre ellos: • Gripe Espaùola (1918 - 1919) 40.000.000 de personas fallecidas. • Gripe Asiåtica (1957) • Gripe de Hong Kong (1968) Aún hoy, no se tienen vacunas 100% efectivas para dicha enfermedad.

-RJPYIR^EEZMEV +IRIVEPMHEHIW La influenza aviar es un virus de tipo ARN de la familia Orthomyxoviridae; en ella podemos encontrar los subtipos A-B y C. El tipo A es el que ha producido muertes en el ser humano y por ello es el mĂĄs agresivo, puede llegar a matar el 100% de las aves en un mismo corral. Este grupo de virus tiene como reservorio los patos salvajes, los cuales son los mĂĄs resistentes; las aves de corral son los animales mĂĄs


DIAGNĂ“STICO

0EWEZIWHIGSVVEP WSRPSWERMQEPIW QĂŒWZYPRIVEFPIWE PEMRJPYIR^EEZMEVRS SFWXERXIIWXIKIVQIR TSHVĂ–EQYXEV]HIIWI QSHSMRJIGXEVESXVSW ERMQEPIWMRGPY]IRHSEP LSQFVIIWXSKVEGMEW EWYHIVMZEKIRĂ’XMGE

vulnerables; no obstante, este germen podrĂ­a mutar y de ese modo infectar a otros animales incluyendo al hombre, esto gracias a su deriva genĂŠtica. El primer contacto con el hombre se dio en la antigua colonia inglesa de Hong Kong, en 1997, causado por el virus H5N1, donde

infectĂł a un total de 18 personas de las cuales 6 de ellos fallecieron. En dicha provincia china, en 3 dĂ­as se eliminaron un aproximado de 1.5 millones de aves de corral; esto segĂşn los cientĂ­ficos redujo las posibilidades de transmisiĂłn directa a la especie humana y evitĂł tal vez una pandemia.

'%7376)4368%(37()-2*09)2>%%:-%64360%36+%2->%'-¿2 192(-%0()7%2-(%(%2-1%0()*)&6)63 0SGEPM^EGMÛR

:MVYW

0SGEPM^EGMÛR

:MVYW

Ă˜Â’Â€AĂƒÂ‹A

{#ÂŚ

"A’AƋA

{#ÂŚ

A–OÂ&#x;ĂĄA

{#ÂŚ

"Â&#x;›€Â&#x;’‹A

{#ÂŚ

/lÂŽĂ™O’‹YAĂ?-Â&#x;ÂŽĂ˜Â’AĂƒĂ?clĂ? ˆ‹›A

{#ÂŚ

#‹€lĂƒÂ‹A

{#ÂŚ

ĂƒÂ&#x;AY‹A

{#ÂŚ

‹’‹Ž‹›AÆ

{

’l–A›‹A

{#ÂŚ

/Ă˜Â–A›‹A

{#ÂŚ

ĂƒlY‹A

{#ÂŚ

/Ă˜Ă†Â‹A

{#ÂŚ

Â&#x;›€Ă?Â&#x;›€Ă?°/- ÂąĂ?

{#ÂŚ

ƒÂ&#x;Ăžl›‹A

{

›cÂ&#x;›lƋA

{#ÂŚ

2A‹Žl‹

{#ÂŚ

ĂƒA‘

{

2A‹’A›c‹A

{#ÂŚ

ĂƒB›

{#ÂŚ

2Ă˜ĂƒÂ¸Ă˜ÂŒA

{#ÂŚ

�A’‹A

{#ÂŚ

4YĂƒA›‹A

{#ÂŚ

{#ÂŚ

9‹l�›A–

{#ÂŚ

AŽ › AĂĽAÂ?‹ÆĂ?B› Â&#x;ĂƒlA AÂ&#x;Æ

{#Ă– {#ÂŚ {#ÂŚ {#Ă– {

7MRXSQEXSPSKĂ–E La sintomatologĂ­a de este cuadro registrada en Hong Kong en 1997 es el siguiente: fiebre, odinofagia, tos, rinorrea y en casos graves: disnea grave; pero tambiĂŠn se puede presentar: diarrea, expectoraciĂłn, mialgias, cefalea, vĂłmitos y dolor abdominal, de orden descendiente.

(MEKRÛWXMGS Las pruebas diagnósticas son relativamente fåciles y fiables; estas deben ser enviadas al Instituto Costarricense de Investigación y Enseùanza en Nutrición y Salud (INCIENSA), para que sean procesadas en el Centro de Control de Enfermedades de Atlanta (CDC), por su nivel de bioseguridad. La muestra mås adecuada es el aspirado nasofaríngeo, pero tambiÊn se pueden utilizar pruebas de laboratorio como los infiltrados pulmonares, aumento de los niveles sÊricos de aminotransferasa, linfopenia y trombocitopenia.

1SVXEPMHEH La mortalidad humana registrada por la OrganizaciĂłn Mundial de la Salud en los Ăşltimos tres aĂąos de casos se calcula en un 50%, por lo cual se ha dado mucha importancia a esta enfermedad no solo por su mortalidad sino tambiĂŠn por su alta contagiosidad. Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 23


DIAGNĂ“STICO '%737=*%00)'-1-)28376)4368%(37()-2*09)2>%%:-%6 4EĂ–W

 'EWSW



1YIVXIW

'EWSW



1YIVXIW

'EWSW



1YIVXIW

'EWSW

8SXEP

1YIVXIW

'EWSW

1YIVXIW

A–OÂ&#x;ĂĄA

ç

ç

ç

ç

~

~

ç

ç

~

~

ˆ‹›A

ç

ç

ç

ç

8

{

~

Ă‘

ÂŚĂ–

8

›cÂ&#x;›lƋA

ç

ç

ç

ç

ÂŚĂŠ

ÂŚÂŚ

8

ĂŠ

Ă–{

ÂŚq

ĂƒA‘

ç

ç

ç

ç

ç

ç

ÂŚ

ÂŚ

ÂŚ

ÂŚ

2A‹’A›c‹A

ç

ç

ÂŚĂŠ

ÂŚĂ–

{

Ă–

ç

ç

Ă–Ă–

ÂŚ~

2Ă˜ĂƒÂ¸Ă˜ÂŒA

ç

ç

ç

ç

ç

ç

ÂŚĂ–

~

ÂŚĂ–

~

9‹l�›A–

Ă‘

Ă‘

Ă–Âœ

Öç

Ă‹ÂŚ

ÂŚÂœ

ç

ç

ÂœĂ‘

~Ă–





















8SXEP

%ĂƒÂ€A›‹üAY‹ ›Ă?"Ă˜Â›c‹AÂ’Ă?clĂ?Â’AĂ?0AÂ’Ă˜c`Ă?ÂŚĂ‘Ă?ylOĂƒlĂƒÂ&#x;Ă?ÖççË

+6°*-'3'96:%())4-()1-%

4VIZIRGMĂ›R]XVEXEQMIRXS A pesar de que no existe vacuna para esta enfermedad debido a que es un ente nuevo para el ser humano, la vacuna de influenza estacional es de gran importancia para disminuir la posibilidad de enfermedad concomitante. Uno de los pilares mĂĄs importantes en la prevenciĂłn de gran cantidad de enfermedades infectocontagiosas es la higiene, con prĂĄcticas bĂĄsicas como el lavado de manos, especialmente en esta se debe evitar el contacto fĂ­sico y tocarse la mucosa oral, nasal y los ojos, utilizar paĂąuelos desechables; en epidemias se debe evitar utilizar objetos pĂşblicos, es necesario el uso de mascarillas en personas sospechosas y el personal de salud debe usar mascarillas N-95, guantes y lentes de protecciĂłn. Dentro del tratamiento de los virus estĂĄn 24 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

los adamantanos, entre ellos la amantadina y rimantadina, y los inhibidores de la neuroaminidasa como el oseltamivir y zanamivir. El medicamento utilizado ante la influenza aviar es el fosfato de oseltamivir, registrado como nombre de patente de Tamiflu de la casa farmacĂŠutica Roche, y tiene como funciĂłn el bloqueo de la replicaciĂłn y la patogenicidad del virus; se debe iniciar en los primeros dos dĂ­as de la enfermedad a una dosis de 75 mg dos veces al dĂ­a por 5 dĂ­as.

4IVWTIGXMZEQYRHMEP]JYXYVS SegĂşn los expertos, la curva que se expone en el grĂĄfico 1. serĂ­a la que seguirĂ­a la enfermedad si se declarara la pandemia, despuĂŠs de lo cual pasarĂ­an 3 meses para recibir

la primera ola de enfermos, que tendrĂ­a una duraciĂłn aproximada de tres meses; luego se darĂ­a una disminuciĂłn de casos durante un perĂ­odo de nueve meses; sin embargo, se esperarĂ­a una nueva ola de cuatro meses para, mĂĄs tarde, regresar a un nivel basal. Mas aĂşn la pregunta mĂĄs importante es: ÂżSucederĂĄ la pandemia? CientĂ­ficos mundiales han coincidido en responder que la pandemia de influenza aviar es inevitable y posiblemente inminente. Por ello, desde este momento se deben tomar medidas de informaciĂłn y prevenciĂłn ante la posible llegada a nuestro continente y nuestro paĂ­s de la influenza aviar, de este modo, a pesar de poseer la Ăşltimas tecnologĂ­as mĂŠdicas y cientĂ­ficas, se debe volver a los principios bĂĄsicos de prevenciĂłn de enfermedades como la higiene y a su vez a los grandes pilares de la salud pĂşblica como la educaciĂłn, prevenciĂłn y promociĂłn de la salud. El Ministerio de Salud de nuestro paĂ­s, desde noviembre del aĂąo pasado, ya tiene listo un Plan de PreparaciĂłn y Respuesta en SituaciĂłn de Pandemia de Influenza, diseĂąado y editado por el Dr. Daniel Salas Peraza, Ministerio de Salud, y Dra. Jenny Lara, INCIENSA.

&MFPMSKVEJĂ–EVIGSQIRHEHE 1. Ministerio de Salud et al. Plan Nacional de PreparaciĂłn y Respuesta en SituaciĂłn de Pandemia de Influenza. San JosĂŠ, Costa Rica. Noviembre 2005. 2. http://www.who.int/csr/disease/avian_ influenza/en/index.html 3. http://www.oie.int/downld/ AVIAN%20INFLUENZA/A_AI-Asia.htm


ACTUALIZACIĂ“N EN ATENCIĂ“N PRIMARIA

%REJMPE\ME

(V%KYWXĂ–R%VKYIHEW5YIWEHE

1Ă’HMGSGMVYNERSMRXIVRMWXE (MVIGXSVQĂ’HMGSIR*EVQEGSPSKĂ–E'PĂ–RMGEHIPWMXMS[[[EQTQHGSQ 'SSVHMREHSVHIPSWGYVWSWIRLMTIVXIRWMĂ›REVXIVMEPHIPTVSKVEQEHI )HYGEGMĂ›R1Ă’HMGE'SRXMRYEHIPE9RMZIVWMHEHHI'SWXE6MGE )P(V%VKYIHEWTSWIIYREQEIWXVĂ–EIR*EVQEGSPSKĂ–E]8IVETĂ’YXMGEHIPE 9RMZIVWMHEHHI'SPYQFME'EREHĂŒ%GXYEPQIRXIPEFSVEGSQSGEXIHVĂŒXMGSIR IP(ITEVXEQIRXSHI*EVQEGSPSKĂ–E'PĂ–RMGEIRPE*EGYPXEHHI1IHMGMREHIPE 9RMZIVWMHEHHI'SWXE6MGE

-RXVSHYGGMÛR

L

a anafilaxia constituye el grupo de manifestaciones clĂ­nicas de la reacciĂłn alĂŠrgica sistĂŠmica mĂĄs severa. Es una verdadera emergencia mĂŠdica y, por ser una condiciĂłn potencialmente mortal, requiere de un reconocimiento temprano y de un manejo apropiado e inmediato. Las personas con episodios previos de anafilaxia tienen el riesgo mĂĄs elevado de sufrir nuevas reacciones en el futuro. Los pacientes con asma o con mĂşltiples alergias tienen tambiĂŠn un riesgo mayor que la poblaciĂłn general. Sin embargo, la anafilaxia no es una condiciĂłn exclusiva de los individuos atĂłpicos.

(IJMRMGMÛRHIPTVSFPIQE La anafilaxia es una reacción alÊrgica severa a diferentes estímulos, con un inicio súbito que afecta a uno o mås sistemas corporales. Ocurre como consecuencia de una liberación masiva de histamina y de otros mediadores almacenados en los mastocitos y/o basófilos. Este proceso es usualmente mediado por mecanismos inmunológicos a travÊs de anticuerpos IgE, despuÊs de la exposición a un antígeno específico en sujetos previamente sensibilizados. Otros eventos similares, pero mås localizados y de mejor pronóstico son la urticaria y el angioedema.

Aunque cualquier sustancia puede potencialmente causar anafilaxia, las que con mayor frecuencia estĂĄn ligadas por IgE son los medicamentos, las picaduras de insectos, y algunas comidas. En el caso de los fĂĄrmacos se considera que el compuesto original, o alguno de sus metabolitos, puede funcionar como un hapteno que forma conjugados inmunogĂŠnicos con las proteĂ­nas del huĂŠsped. Por otra parte, tambiĂŠn se ha descrito anafilaxia mediada por mecanismos distintos, como en los casos idiopĂĄticos o inducidos por el ejercicio. En ese mismo sentido, las reacciones anafilactoides asociadas al uso de opiĂĄceos, antiinflamatorios no esteroideos o medios de contraste son clĂ­nicamente indistinguibles de la anafilaxia, pero no son mediadas por IgE.

-QTPMGEGMSRIW La anafilaxia es una condiciĂłn potencialmente fatal. La muerte es usualmente debida a colapso circulatorio, a obstrucciĂłn de las vĂ­as aĂŠreas, o a ambas condiciones de manera simultĂĄnea. Aunque las implicaciones varĂ­an, es caracterĂ­stica la apariciĂłn de algunas manifestaciones en un lapso de segundos o minutos despuĂŠs de la introducciĂłn del antĂ­geno. Tradicionalmente, se ha creĂ­do que la apariciĂłn mĂĄs temprana de las manifestaciones de

Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 25


ACTUALIZACIĂ“N EN ATENCIĂ“N PRIMARIA 'YEHVS 1ERMJIWXEGMSRIWHIEREJMPE\ME ÂŚÂłĂ? AĂƒc‹Â&#x;ĂžAÆYĂ˜Â’AĂƒlÆ_Ă?ˆ‹ŽÂ&#x;Ă?l›Æ‹ ›Ă? AĂƒĂ?lĂƒÂ‹AÂ’`Ă?Ă?AÂ¸Ă˜Â‹YAĂƒc‹A`Ă?AĂƒĂƒÂ‹Ă?–‹AÆ`Ă?‹›yAĂƒĂ?Â&#x;Ă? clĂ?–‹Â&#x;YAĂƒc‹Â&#x;`Ă?ÂŽAĂƒÂ&#x;Ă?YAĂƒc‹AYÂ&#x;Âł

'YEHVS4VMRGMTEPIW IRXMHEHIWUYIHIFIR GSRWMHIVEVWIIRIPHMEKRĂ›WXMGS HMJIVIRGMEPHIPEEREJMPE\ME ÂŚÂłĂ? ›€‹Â&#x;lcl–AĂ?ˆlĂƒlc‹Ă?AĂƒÂ‹Â&#x;Âł

Ă–ÂłĂ? 9ÂŒAÆĂ?AmĂƒlAÆĂ?Ă†Ă˜ÂŽlĂƒÂ‹Â&#x;ĂƒlÆ_Ă?YÂ&#x;›€lÆĂ?‹ ›Ă? ›AÆAÂ’`Ă?c‹ÆyÂ&#x;›ŒA`Ă?lÆĂ?ĂƒÂ‹cÂ&#x;Ăƒ`Ă?lcl–AĂ? Â&#x;ĂƒÂ&#x;yAĂƒÂŒÂ›Â€lÂ&#x;Ă?Â&#x;Ă?Â’AĂƒÂŒÂ›Â€lÂ&#x;Âł

Ă–ÂłĂ? /lAYY‹ ›Ă?ĂžAÆÂ&#x;ĂžA€AÂ’Ă?Âł

Ă‘ÂłĂ? 9ÂŒAÆĂ?AmĂƒlAÆĂ?‹›ylĂƒÂ‹Â&#x;ĂƒlÆ_Ă?c‹Æ›lA`Ă? OĂƒÂ&#x;›YÂ&#x;lƎAƖÂ&#x;`Ă?Ă?AÂ¸Ă˜Â‹ÂŽÂ›lA`Ă? Y‹A›Â&#x;ƋÆ`Ă?ÂŽAĂƒÂ&#x;Ă?ĂƒlĂ†ÂŽÂ‹ĂƒAĂ?Â&#x;ĂƒÂ‹Â&#x;Âł

~ÂłĂ? Ă†ÂŽÂ‹ĂƒAY‹ ›Ă?clĂ?YĂ˜lĂƒÂŽÂ&#x;Ă?lĂ Ă?ĂƒAÂ?Â&#x;

~ÂłĂ? #lĂ˜ĂƒÂ&#x;’ €‹YAÆ_Ă?–AĂƒlÂ&#x;`Ă?clO‹’‹cAc`Ă? Ă†ÂŒÂ›YÂ&#x;ÂŽl`Ă?YÂ&#x;Â›ĂžĂ˜Â’Ă†Â‹Â&#x;›lƳ

Ă‹ÂłĂ? 2ĂƒAÆĂ?Â&#x;ĂƒÂ›Â&#x;Ă?YÂ&#x;Â›ĂžĂ˜Â’Ă†Â‹ĂžÂ&#x;

{ÂłĂ? -‹lÂ’_Ă?ĂƒĂ˜OÂ&#x;ĂƒĂ?yAY‹AÂ’`Ă?lĂƒÂ‹Ă?l–A`Ă? OĂƒÂ&#x;Ă?lĂ?–AYĂ˜Â’Â&#x;ÂŽAÂŽĂ˜Â’AĂƒ`Ă?ÂŽĂƒĂ˜ĂƒÂ‹Ă?Â&#x;`Ă? Ă˜ĂƒĂ?‹YAĂƒÂ‹A`Ă?A›€‹Â&#x;lcl–A

qÂłĂ? 0Œ›cĂƒÂ&#x;–lĂ?YAĂƒY‹›Â&#x;‹cl

Ă‘ÂłĂ? ƖAĂ?ÆlĂžlĂƒA

{ÂłĂ? –OÂ&#x;’‹Æ–Â&#x;Ă?ÂŽĂ˜Â’Â–Â&#x;›AĂƒ

ĂŠÂłĂ? "AÆĂ?Â&#x;Y‹Ă?Â&#x;ƋÆĂ?ƋÆĂ?m–‹YA

ÂœÂłĂ? 0Œ›cĂƒÂ&#x;–lĂ?clĂ?ˆ‹ŽlĂƒĂžl›Ă?‹’AY‹ ›

Ă‹ÂłĂ? AÆĂ?ĂƒÂ&#x;‹›Ă?lÆĂ?‹›AÂ’_Ă?›BĂ˜Ă†lA`Ă?Þ –‹Ă?Â&#x;Æ`Ă? cÂ&#x;Â’Â&#x;ĂƒĂ?AOcÂ&#x;–‹›AÂ’`Ă?c‹AĂƒĂƒlAÂł

anafilaxia despuĂŠs de la exposiciĂłn al agente desencadenante se relaciona con una mayor severidad del episodio. Esas manifestaciones pueden afectar diversos aparatos y sistemas, pero, como se mencionĂł antes, las consecuencias mĂĄs serias afectan las funciones cardiorrespiratorias. Puede haber obstrucciĂłn de las vĂ­as aĂŠreas altas, con edema y estridor larĂ­ngeo; la obstrucciĂłn mecĂĄnica de la epiglotis y la laringe puede provocar la muerte. TambiĂŠn puede haber obstrucciĂłn de las vĂ­as aĂŠreas bajas, con aumento de las secreciones en la luz de los bronquios, congestiĂłn peribronquial, edema de la submucosa, infiltraciĂłn eosinofĂ­lica, que se manifiesta por sibilancias y obstrucciĂłn bronquial; en los casos fatales hay marcada hiperinflaciĂłn pulmonar. Las implicaciones cardiovasculares incluyen hipotensiĂłn arterial por vasodilataciĂłn perifĂŠrica, congestiĂłn visceral, disminuciĂłn del volumen intravascular efectivo, y colapso cardiovascular. Puede ocurrir un infarto de miocardio como consecuencia de todo lo anterior. Se ha estimado que cerca del 20% de las reacciones anafilĂĄcticas siguen un curso bifĂĄsico en sus manifestaciones. Aunque en la mayorĂ­a de esos casos las manifestaciones reaparecen entre 8 y 10 horas despuĂŠs del evento inicial, se han descrito incidentes en los que ocurren mĂĄs de 24 horas despuĂŠs. Aproximadamente una tercera parte de esas reacciones de segunda fase son mĂĄs severas que la inicial. 26 Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË

)ZEPYEGMÛR Es importante tratar de identificar la sustancia desencadenante del problema. Entre los mås conocidos se encuentran las picaduras de insectos, extractos de polen, comidas (maní, nueces, mariscos, pescado, leche, huevos, trigo, chocolate, etc.), proteínas heterólogas (gamma globulina, insulina, vasopresina), productos de låtex y otras sustancias ocupacionales, y por supuesto los fårmacos (penicilinas, cefalosporinas, hierro dextrån, anfotericina, procaína y otros anestÊsicos locales, tiamina, etc.). Las personas que sufren anafilaxia pueden presentar alergia a una o a varias sustancias. La confirmación de la causa requiere de la evaluación por un alergólogo. Debido a su naturaleza sistÊmica, la historia clínica y el examen físico pueden detectar síntomas y signos que abarcan diversos órganos y sistemas (cuadro 1). Con frecuencia los pacientes describen una sensación de muerte inminente. Por la diversidad de manifestaciones clínicas, muchas otras entidades pueden simular reacciones de anafilaxia (cuadro 2); no obstante, la mayoría de ellas son fåcilmente descartadas al evaluar la situación clínica de manera global. Una de las condiciones mås frecuentes es la reacción vasovagal, que se diferencia porque en ella no ocurren urticaria, angioedema, taquicardia ni broncoespasmo. El angioedema hereditario no cursa con prurito ni urticaria, y suele haber antecedentes familiares por esa misma condición. Finalmente, otro aspecto importante de la evaluación es identificar a los pacientes que

han estado siendo tratados con bloqueadores beta-adrenĂŠrgicos, debido a la refractariedad al tratamiento de la anafilaxia con epinefrina. Por la posibilidad de que aparezca una segunda fase de reactividad, idealmente se recomienda vigilar al paciente por un mĂ­nimo de 24 horas.

%FSVHENIXIVETĂ’YXMGS Debido a su carĂĄcter de emergencia, el abordaje terapĂŠutico debe ser rĂĄpido. El manejo farmacolĂłgico se resume en el cuadro 3. La epinefrina parenteral es la droga de elecciĂłn. Se administra en una diluciĂłn 1:1000. Aunque tradicionalmente se ha aplicado por la vĂ­a subcutĂĄnea, algunas investigaciones recientes indican que la vĂ­a intramuscular es superior. Existen preparados en los que la dosis requerida viene lista para ser aplicada por el propio paciente en caso de que ocurra una situaciĂłn de emergencia. De acuerdo con las necesidades, la administraciĂłn de epinefrina puede repetirse cada 5-15 minutos, hasta que desaparezcan las manifestaciones de anafilaxia o que surjan evidencias de hiperactivaciĂłn adrenĂŠrgica, tales como tremor, palpitaciones, aprehensiĂłn, etc. Por el riesgo de complicaciones cardiovasculares, la vĂ­a intravenosa sĂłlo debe usarse en presencia de choque. Es esencial la infusiĂłn intravenosa rĂĄpida de grandes volĂşmenes de lĂ­quidos para reponer la pĂŠrdida de volumen intravascular. Para ello puede administrarse soluciĂłn salina, lactato de Ringer, plasma o expansores de volumen. Algunos casos requieren del uso de drogas vasopresoras como norepinefrina, dopamina a dosis altas o fenilefrina. AdemĂĄs, es imprescindible establecer y mantener permeables las vĂ­as aĂŠreas, con intubaciĂłn endotraqueal o traqueostomĂ­a si fuera necesario. La epinefrina parenteral o la inhalaciĂłn de agonistas aderenĂŠrgicos selectivos como salbutamol ayudan a contrarrestar el broncoespasmo; se debe brindar oxĂ­geno suplementario en todos los casos. El uso de agentes antihistamĂ­nicos H1 es necesario, pero en la actualidad se recomienda complementarlo con antihistamĂ­nicos H2, pues se ha observado que el bloqueo combinado es mĂĄs eficaz para combatir la sintomatologĂ­a, especialmente la urticaria, el prurito y las manifestaciones gastrointestinales. Se recomienda el uso de glucocorticoides intravenosos para tratar de prevenir o reducir la intensidad de la segunda fase de la reacciĂłn anafilĂĄctica.


ACTUALIZACIĂ“N EN ATENCIĂ“N PRIMARIA GlucagĂłn tiene efectos vasopresores y cronotrĂłpicos e inotrĂłpicos positivos independientes de los receptores beta-adrenĂŠrgicos; ademĂĄs, facilita la liberaciĂłn de catecolaminas endĂłgenas. Por esas razones se administra por la vĂ­a intravenosa a dosis de 5-15 Îźg/minuto en los pacientes que usan beta-bloqueadores y que no responden a la terapia convencional con epinefrina. Al momento del egreso se recomienda prescribir prednisona y un antihistamĂ­nico H1 por 3 Ăł 4 dĂ­as con fines profilĂĄcticos. Aunque esa misma combinaciĂłn se ha usado a largo plazo como tratamiento preventivo en los pacientes con episodios frecuentes y serios de anafilaxia, la terapia mĂŠdica no previene las verdaderas reacciones de hipersensibilidad mediadas por IgE.

'YEHVS 1ERINSJEVQEGSPĂ›KMGSMRMGMEPIRPSWGEWSWHIEREJMPE\ME *ĂŒVQEGS

Ž‹›lyĂƒÂ‹Â›AĂ?ÂŚ_Œççç

‹yl›ˆ‹cĂƒA–‹›A

/A›‹�‹c‹›A

:Ă–EHI EHQMRMWXVEGMĂ›R ›Ă?ĂƒAÂ–Ă˜Ă†YĂ˜Â’AĂƒ`Ă? Ă†Ă˜OYĂ˜Ă?B›lA

›Ă?ĂƒAĂžl›Â&#x;ÆA`Ă? ‹›Ă?ĂƒAÂ–Ă˜Ă†YĂ˜Â’AĂƒ

›Ă?ĂƒAĂžl›Â&#x;ÆA`Ă?Â&#x;ĂƒAÂ’

(SWMWIRPSW EHYPXSW ç`ъç`{�–’

BĂƒÂ–AYÂ&#x;Ă?clĂ?ÂŽĂƒÂ‹Â–lĂƒAĂ? lÂ’lYY‹ ›³ -Ă˜lclĂ?ĂƒlÂŽlĂ?Â‹ĂƒĂ†lĂ?YAcAĂ? {Ă?tÂŚ{Ă?Â–Â‹Â›Ă˜Ă?Â&#x;Æ

{çŠqç�–€

c–‹›‹ÆĂ?ĂƒAĂƒĂ?YĂ˜A›cÂ&#x;Ă?ÆlĂ? ˆAĂĄAĂ?lÆĂ?AO‹’‹üAcÂ&#x;Ă?Â’AĂ? YÂ&#x;›c‹Y‹ ›Ă?clÂ’Ă?ÂŽAY‹l›Ă?lĂ? YÂ&#x;›Ă?lŽ‹›lyĂƒÂ‹Â›AĂ?ĂĄĂ?ĂžÂ&#x;Â’Ă˜Â–l›³ -Ă˜lclĂ?ĂƒlÂŽlĂ?Â‹ĂƒĂ†lĂ? YAcAĂ?~ŠËĂ?ˆÂ&#x;ĂƒAÆ

{çĂ?–€Ă?9`Ă? ÂŚ{çĂ?–€Ă?Â&#x;ĂƒAÂ’

'SRGPYWMÛR Las reacciones de anafilaxia son una verdadera emergencia mÊdica por la posibilidad de provocar la muerte en pocos minutos. El reconocimiento y el tratamiento temprano con epinefrina son especialmente importantes. Deben tomarse precauciones para detectar y tratar de prevenir la segunda fase de reactivación que suele ocurrir varias horas despuÊs del evento inicial en muchos casos. Si fuera posible, la identificación del agente causal es el primer paso para la prevención de futuros eventos.

"lĂ?Â‹Â’ÂŽĂƒlc›‹ÆÂ&#x;Â’Â&#x;›A`Ă? ÂŽĂƒlc›‹ÆÂ&#x;›A

›Ă?ĂƒAĂžl›Â&#x;ÆA Â&#x;ĂƒAÂ’

'SQIRXEVMSW

ŒÖ{�–€ {ç�–€

c–‹›‹ÆĂ?ĂƒAĂƒĂ?YĂ˜A›cÂ&#x;Ă?ÆlĂ? ˆAĂĄAĂ?lÆĂ?AO‹’‹üAcÂ&#x;Ă?Â’AĂ? YÂ&#x;›c‹Y‹ ›Ă?clÂ’Ă?ÂŽAY‹l›Ă?lĂ? YÂ&#x;›Ă?lŽ‹›lyĂƒÂ‹Â›AĂ?ĂĄĂ?ĂžÂ&#x;Â’Ă˜Â–l›³ -Ă˜lclĂ?ĂƒlÂŽlĂ?Â‹ĂƒĂ†lĂ? YAcAĂ?qĂ?ˆÂ&#x;ĂƒAÆ c–‹›‹ÆĂ?ĂƒAĂƒĂ?YĂ˜A›cÂ&#x;Ă?ÆlĂ? ˆAĂĄAĂ?lÆĂ?AO‹’‹üAcÂ&#x;Ă?Â’AĂ? YÂ&#x;›c‹Y‹ ›Ă?clÂ’Ă?ÂŽAY‹l›Ă?lĂ? YÂ&#x;›Ă?lŽ‹›lyĂƒÂ‹Â›AĂ?ĂĄĂ?ĂžÂ&#x;Â’Ă˜Â–l›³ -Ă˜lclĂ?ĂƒlÂŽlĂ?Â‹ĂƒĂ†lĂ? YAcAĂ?Ă‹Ă?ˆÂ&#x;ĂƒAÆ

0EEREJMPE\MEIWYREZIVHEHIVEIQIVKIRGME QĂ’HMGE]VIUYMIVIHIYRVIGSRSGMQMIRXS XIQTVERS]HIYRQERINSETVSTMEHSIMRQIHMEXS

&MFPMSKVEJĂ–EVIGSQIRHEHE 1- Al-Muhsen S, Clarke AE, Kagan RS. Peanut allergy: an overview. CMAJ 2003; 168: 1279-85. 2- Ellis AK, Day JH. Anaphylaxis: diagnosis and treatment. Allergy Asthma 2000; 13: 22-35. 3- Ellis AK, Day JH. Diagnosis and management of anaphylaxis. CMAJ 2003; 169: 307-11.

“Las auto evaluaciones de este texto se encuentran en las publicaciones originales en el sitio:

www.ampmd.com

Medicina Vida y SaludĂ?ĂŒĂ?‹Y‹l–OĂƒlĂ?ÖççË 27

untitled  

está relacionado con la muerte de los CD4. Por último, el tev es el activador de los tat y rev. Un elemento que interviene en la regulación...

Read more
Read more
Similar to
Popular now
Just for you