Page 1

RETROUVEZ DANS CE NUMÉRO TOUTE L’INFORMATION DE VOTRE CMA

Septembre-octobre 2016 • 1,50 €

rtisans

LE MONDE DES

édition

deux-sèvres

Bimestriel n°114

s CMA er au 14 octobre : élection 1 u d

ils cherchent un repreneur p. 37

Trois questions à…

Reconnaissance

Claire Paulic, Présidente de l’ADT des Deux-Sèvres P. 08

Trophée des femmes de l’artisanat P. 13

Deux-Sèvres


UNE BANQUE QUI RECONNAÎT VOTRE ESPRIT D’ENTREPRENEUR, ÇA CHANGE TOUT ! Vous êtes créateur, repreneur d’entreprise ou auto-entrepreneur ? RENDEZ-VOUS SUR : www.entreprendre.creditmutuel.com

CFCMO - SA Coop. de Crédit à Capital Variable - RCS La Roche/Yon B 307 049 015 - Intermédiaire en opérations d’assurance n° ORIAS - 07 027 974, consultable sous www.orias.fr - 34 rue L. Merlet - 85000 La Roche/Yon - Tél. 02 51 47 53 00 Crédit photo : Thinkstock. 2016.

TOYOTA FRANCE - 20, bd de la République, 92420 Vaucresson - SAS au capital de 2 123 127 € - RCS Nanterre B 712 034 040.

NOUVEAU TOYOTA PROACE

Le fourgon qui vous permet d’en faire plus

SP FU 297 X 210 MM _ QUADRI _ TOYOTA PROACE _ LOCAL _ ENCRAGE TOTAL = 220 % _ N° DOSSIER : 017307

TOUJOURS MIEUX TOUJOURS PLUS LOIN

BVCert. 6392448

JUSQU’À 6,6 M3

DE VOLUME DE CHARGEMENT - GARANTIE 3 ANS - 3 LONGUEURS DONT UNE CARROSSERIE COMPACT UNIQUE

Proace Fourgon tôlé Compact Active 95 D-4D

À partir de 159 € HT/mois(1)

MODUWORK DE SÉRIE*

après un premier loyer de 4 800 € HT.

Consommations mixtes (L/100 km) et émissions de CO2 (g/km) : de 5,1 à 5,6 et de 133 à 147 (D) - Hors carrosserie Long. Données homologuées (CE).

Good =bien. * Sur version fourgon tôlé, espace de travail modulable. (1) Location avec option d’achat composée d’un premier loyer majoré de 4 800 € HT suivi de 59 loyers de 158,93 € HT valable pour un Proace Fourgon tôlé Compact Active 95 D-4D au prix remisé de 15 142 € HT (par référence au tar if conseillé n° 11 2 3 du 01 /08/2016). Option d’achat f inale de 3 000 € HT dans la limite de 60 mois et 75 000 km. Coût total en cas d’acquisition au terme du contrat de 17 181 € HT, hors assurances et maintenance facultatives. Modèle présenté : Proace Fourgon tôlé Compact Dynamic 95 D-4D Pack Confort à partir de 178,93 € HT. Option d’achat finale de 3 375 € HT. Coût total en cas d’acquisition au terme du contrat de 18 736 € HT. Dans les mêmes conditions. Offre réservée aux professionnels valable chez les distributeurs Toyota participant à l’opération et portant sur le tarif en vigueur au jour de la souscription du contrat du 1 er août au 30 septembre 2016. Sous réserve d’acceptation par TOYOTA FR ANCE FINANCEMENT - 36 bd de la République 92423 Vaucresson RCS 412 653 180 - n° ORIAS 07 005 419 consultable sur www.orias.fr. (2) Garantie 3 ans ou 100 000 km, à la première des deux limites atteinte.

Assise relevable

Trappe dans la cloison

Tablette amovible

72<27$$L[HQ3URYHQFH Votre contact Business Center NIORT – PARTHENAY – BRESSUIRE Votre contact Business Center Tél. 05 49 08 97 03 72<27$6DLQW9LFWRUHW Edar SEANGAlain THOMAS - Tél. 06 17 44 77 48 www.lesgarageschaigneau.com alain.thomas@lesgarageschaigneau.com 72<27$6DORQGH3URYHQFH 7«O HGDUVHDQJ#SOGDXWRIU 72<27$ 3HUWXLV


S O M M A I R E

Ă&#x2030;VĂ&#x2030;NEMENT

4

Â&#x2039;OHFWLRQVGHVUHSUÂŤVHQWDQWVDX[&0$É&#x2039; DUWLVDQVIDLWHVHQWHQGUHYRWUHYRL[É&#x2039;

ACTUALITĂ&#x2030;S [ 6

(QUDLVRQ GHVÂŤOHFWLRQVGHV SUÂŤVLGHQWVGH&0$ SUÂŤYXHVHQRFWREUH HWGXGURLWGHUÂŤVHUYH OHSUÂŤVLGHQWGHOD&0$ QHVČ&#x2021;H[SULPHUDSDV FRPPHKDELWXHOOHPHQW GDQVVRQÂŤGLWR

[13e Carrefour rÊgional des mÊtiers de bouche et de la gastronomie [Trois questions à Didier Sivadier [*¤WLQH%R[̭XQHDOOLDQFHWRXULVWLTXH et Êconomique

Ă&#x2030; D I T O

[Concevoir, fabriquer et communiquer grâce à un logiciel de conception 3D

J

[TrophĂŠe des femmes de l'artisanat stratĂŠgie [ 17 ['LYHUVLͤFDWLRQVVWUDWÂŤJLTXHVĚ­ qui ne tente rien nâ&#x20AC;&#x2122;a rien [8QL9HUW6$5/Ě­OHMDUGLQLHUSKLORVRSKH

DOSSIER

28

&RPPXQLFDWLRQÉ&#x2039; WUDYDLOOH]YRWUHGLÎ?ÂŤUHQFH

pratique [ 33 [ ProcĂŠdures devant le conseil des prudâ&#x20AC;&#x2122;hommes [Comment utiliser la pĂŠriode dâ&#x20AC;&#x2122;essai pour tester un salariĂŠ ou un apprenti ? [Vos formations pour le dernier trimestre [,OVFKHUFKHQWXQUHSUHQHXUĚ­ [%DF3URFRPPHUFHĚ­OHGLSOÂśPH de la polyvalence et de la rĂŠussite regards [ 42 [3UHVWLJHĚ­OHURLGHODNQDFN [9LHG DUWLVDQVĚ­FHVDUWLVDQVIRUPDWHXUV accompagnent la relève [2SLQLRQĚ­$QWRLQH*LQHVWHW,13,

usquâ&#x20AC;&#x2122;au 14 octobre, lâ&#x20AC;&#x2122;artisanat est appelĂŠ Ă faire entendre sa voix en ĂŠlisant ses reprĂŠsentants aux Chambres de mĂŠtiers et de lâ&#x20AC;&#x2122;artisanat.

Il est essentiel que les artisans prennent très largement part Ă ce scrutin. En eďŹ&#x20AC;et, câ&#x20AC;&#x2122;est sur le taux de participation aux ĂŠlections que reposera la lĂŠgitimitĂŠ de la Chambre de mĂŠtiers et de lâ&#x20AC;&#x2122;artisanat Ă  reprĂŠsenter et Ă  dĂŠfendre les intĂŠrĂŞts des professionnels auprès des pouvoirs publics. Voter, câ&#x20AC;&#x2122;est permettre aux ĂŠlus dâ&#x20AC;&#x2122;agir pour que lâ&#x20AC;&#x2122;entreprise artisanale soit reconnue et prise en compte avec ses spĂŠciďŹ citĂŠs dans les nombreux dĂŠbats, projets et rĂŠformes des prochaines annĂŠes. Voter, câ&#x20AC;&#x2122;est donner les moyens aux ĂŠlus de renforcer une oďŹ&#x20AC;re de services adaptĂŠe aux artisans. Voter est un acte citoyen, dĂŠmocratique, pour donner plus de poids Ă  la Première Entreprise de France. Pour voter, câ&#x20AC;&#x2122;est simple. Pas besoin de se dĂŠplacer. Quelques minutes suďŹ&#x192;sent pour renvoyer son bulletin dans lâ&#x20AC;&#x2122;enveloppe de vote prĂŠ-affranchie au plus tard le 14 octobre 2016 Ă  minuit et faire ainsi entendre la voix de lâ&#x20AC;&#x2122;artisanat.

Ce numÊro comprend des pages spÊcifiques entre les pages 1 à 16 et 33 à 48 pour les abonnÊs des Deux-Sèvres.

Le Monde des artisans n°114 â&#x20AC;&#x201C; Septembre-octobre 2016 â&#x20AC;&#x201C; Ă&#x2030;dition des Deux-Sèvres Č&#x201A;3UÂŤVLGHQWGXFRPLWÂŤGHUÂŤGDFWLRQGHVSDJHVORFDOHVÉ&#x2039;-HDQ0LFKHO%DQOLHUČ&#x201A;$YHFOHFRQFRXUVUÂŤGDFWLRQQHOGHODFKDPEUHGHPÂŤWLHUVHWGHOČ&#x2021;DUWLVDQDWGHV'HX[6ÂŞYUHVČ&#x201A;Â&#x2039;GLWHXU GÂŤOÂŤJXÂŤÉ&#x2039;6WÂŤSKDQH6FKPLWWČ&#x201A;5ÂŤGDFWLRQÉ&#x2039;$7&SRUWÉ&#x2039;HPDLOÉ&#x2039;OHPRQGHGHVDUWLVDQV#JURXSHDWFFRPČ&#x201A;2QWFROODERUÂŤ¢FHQXPÂŤURÉ&#x2039;-HQQLIHU&RJKH%DUEDUD&RODV6RSKLHGH&RXUWLYURQ0DUMRODLQH'HVPDUWLQ&KULVWHOOH)ÂŤQÂŤRQÎ&#x2013;VDEHOOH)OD\HX[ *XLOODXPH*HQHVWH6DPLUD+DPLFKH0ÂŤODQLH.RFKHUW'HOSKLQH3D\DQ6RPSD\UDF6DPRU\D:LOVRQbČ&#x201A;6HFUÂŤWDULDWGHUÂŤGDFWLRQÉ&#x2039;0b$QWKRQ\-&OHVVLHQQH-1HLVVHČ&#x201A;3XEOLFLWÂŤÉ&#x2039;$7&TXDLGH9DOP\b3DULVbČ&#x201A;3XEOLFLWÂŤQDWLRQDOHÉ&#x2039;'LUHFWHXUFRPPHUFLDO 0DWKLHX7RXUQLHU7ÂŤOÉ&#x2039;bbID[HPDLOÉ&#x2039;PWRXUQLHU#JURXSHDWFFRPČ&#x201A;3XEOLFLWÂŤVGÂŤSDUWHPHQWDOHVVXGRXHVWÉ&#x2039;7KLHUU\ 7ÂŤOÉ&#x2039;É&#x2039;É&#x2039;É&#x2039; HW&ÂŤGULF-RQTXLÂŞUHV 7ÂŤOÉ&#x2039;É&#x2039;É&#x2039;É&#x2039; ID[É&#x2039;É&#x2039;É&#x2039;É&#x2039;HPDLOÉ&#x2039;WKLHUU\MRQTXLHUHV# ZDQDGRRIUČ&#x201A;3KRWRJUDSKLHVÉ&#x2039;/DXUHQW7KHHWHQUHVSRQVDEOHLPDJHČ&#x201A;&UÂŤGLWSKRWRVORFDOHVVDXIPHQWLRQVFRQWUDLUHVÉ&#x2039;&0$Č&#x201A;3URPRWLRQGLIIXVLRQÉ&#x2039;6KLUOH\(OWHU7ÂŤOÉ&#x2039;7DULI GČ&#x2021;DERQQHPHQWDQ)UDQFHÉ&#x2039;HXURV7DULIDXQXPÂŤURÉ&#x2039;HXURÂ&#x201A;OČ&#x2021;ÂŤWUDQJHUÉ&#x2039;QRXVFRQVXOWHUČ&#x201A;&RQFHSWLRQÂŤGLWRULDOHHWJUDSKLTXHÉ&#x2039;TEMA|presse7ÂŤOÉ&#x2039;É&#x2039;É&#x2039;É&#x2039;É&#x2039;Č&#x201A;)DEULFDWLRQÉ&#x2039;3L[HO LPDJHÎ&#x2013;b0DUOLQ-0b7DSSHUW7ÂŤOÉ&#x2039;É&#x2039;É&#x2039;É&#x2039;bČ&#x201A;Â&#x2039;GLWHXUÉ&#x2039;$7&UXH'XSRQWGHV/RJHVb0(7=7ÂŤOÉ&#x2039;É&#x2039;É&#x2039;É&#x2039;ID[É&#x2039;É&#x2039;É&#x2039;É&#x2039;Č&#x201A;'LUHFWHXUGHODSXEOLFDWLRQÉ&#x2039;)UDQŠRLV *UDQGLGLHUČ&#x201A;1rFRPPLVVLRQSDULWDLUHÉ&#x2039;7Č&#x201A;Î&#x2013;661É&#x2039;Č&#x201A;'ÂŤSÂśWOÂŤJDOÉ&#x2039;VHSWHPEUHČ&#x201A;Î&#x2013;PSUHVVLRQÉ&#x2039;6RFRVSULQWÎ&#x2013;PSULPHXUVURXWHGČ&#x2021;$UFKHWWHVČ&#x201A;Â&#x2039;SLQDO

03


É

VÉNEMENT [ DEUX-SÈVRES

Les nouveaux représentants des artisans aux Chambres de métiers et de l’artisanat seront élus du 1er au 14 octobre 2016. Plus d’un million de chefs d’entreprise artisanale en France sont appelés à élire les deux mille cinq cents chefs d’entreprise artisanale qui représenteront leurs intérêts pour les cinq prochaines années. Artisans, c’est le moment de vous exprimer à travers votre vote par correspondance.

04

Élections des représentants aux CMA

Artisans, faites entendre YRWUHYRL[Ɉ Une CMA, à quoi ça sert ? La Chambre de métiers et de l’artisanat représente à la fois les intérêts généraux de l’artisanat, accompagne les artisans au quotidien, développe une offre de services de proximité et forme FKDTXHDQQ«HGHVFHQWDLQHVGHMHXQHV et adultes dans ses centres de formation. Participer au développement de l’apprentissage et à la pérennité des entreprises artisanales, en les aidant à concentrer leurs efforts sur leur savoir-faire et leur outil de production, est la mission de votre Chambre de métiers et de l’artisanat.

Le Monde des artisans [ septembre/octobre 2016

Vos représentants élus, qui sont-ils ? Ce sont des artisans tout comme vous. Ils connaissent le monde de l’entreprise artisanale et la réalité du terrain. Pour défendre vos intérêts, il n’y a pas mieux qu’un artisan.

Les cinq bonnes raisons d’aller voter ■ Accomplir un acte citoyen et déPRFUDWLTXH˱ Vous avez l’opportunité unique de pouvoir choisir vos représentants au niveau de votre entreprise. ■ Encourager et soutenir les arti-

sans candidats qui s’impliquent et donnent de leur temps pour défendre l’artisanat. ■ Élire des chefs d’entreprises artiVDQDOHVVS«FL̨TXHVHWUHSU«VHQWDWLIV Eux-mêmes artisans, ils connaissent et comprennent vos besoins. ■ Reconnaître le rôle des femmes dans O˹DUWLVDQDW Chaque liste est composée d’au moins un candidat de chaque sexe par groupe de trois candidats. ■ Montrer l’importance des entreSULVHVDUWLVDQDOHV Vous serez entendu au plus haut niveau grâce à vos représentants qui auront plus de poids et de


LE CALENDRIER Ă&#x2030;LECTORAL

DEUX-SĂ&#x2C6;VRES

POUR RAPPEL

â&#x20AC;˘ Au plus tard le 1erVHSWHPEUH Liste des ĂŠlecteurs arrĂŞtĂŠe â&#x20AC;˘ Du 1erDXVHSWHPEUHËą RĂŠception des candidatures par le prĂŠfet Ě VHSWHPEUHËą #HĆ&#x2019;EJCIGFGUNKUVGUFGECPFKFCVU

LES CHAMBRES DE MĂ&#x2030;TIERS ET DE Lâ&#x20AC;&#x2122;ARTISANAT, Câ&#x20AC;&#x2122;EST CHAQUE ANNĂ&#x2030;Eâ&#x20AC;Ś

CrĂŠation ou reprise de votre activitĂŠ

Recrutement de vos apprentis

1 million

225 000

de personnes

porteurs de projet

reçues

accueillis

169 000

12 000

crĂŠations

reprises

%CORCIPGČ&#x152;NGEVQTCNG

d'entreprises

Ě $XSOXVWDUGOHRFWREUHËą

d'entreprises

Formations

Aide aux Ć&#x2019;PCPEGOGPVU

110 000

120 000

contrats

artisans

F CRRTGPVKUUCIG

QPVDČ&#x152;PČ&#x152;Ć&#x2019;EKČ&#x152;

GPTGIKUVTČ&#x152;U

d'une formation

Conseils juridiques

Vote par correspondance

Ě RFWREUHËą DĂŠpouillement des

votes et proclamation des rĂŠsultats

Ě $XSOXVWDUGOHQRYHPEUH #UUGODNČ&#x152;GIČ&#x152;PČ&#x152;TCNGEQPUVKVWVKXG FGUEJCODTGUĹĄČ&#x152;NGEVKQP des bureaux et des prĂŠsidents

continue

Ě GÂŤFHPEUHËą

personnes

420 000

ont suivi le SPI

formalitĂŠs

#UUGODNČ&#x152;GIČ&#x152;PČ&#x152;TCNG constitutive de lâ&#x20AC;&#x2122;AssemblĂŠe 2GTOCPGPVGFGU%JCODTGU FG/Č&#x152;VKGTUGVFGNŨ#TVKUCPCVĹĄ ĂŠlection du bureau et du prĂŠsident

85 000 ÇąVWFGUFGOCTEJČ&#x152;

DĂ&#x2C6;S MAINTENANT

â&#x20AC;˘ Du 30 septembre DXRFWREUHPLQXLWËą

m3RXUUÂŤSRQGUHDX[GÂŤČ´VGHVFLQTSURFKDLQHVDQQÂŤHV HWFRQVROLGHUODSODFHGXVHFWHXUGHOČ&#x2021;DUWLVDQDWGDQVOČ&#x2021;ÂŤFRQRPLH HWOHVWHUULWRLUHVFKDTXHYRWHFRPSWH} lĂŠgitimitĂŠ auprès des pouvoirs publics SRXU GÂŤIHQGUH YRV LQWÂŤUÂŹWV HW LQÍĽXHU sur les orientations nationales et les dĂŠcisions de dĂŠveloppement local.

Les avancĂŠes dans lâ&#x20AC;&#x2122;artisanat â&#x2013; 6LPSOL̨FDWLRQ HW KDUPRQLVDWLRQ GHV rĂŠgimes de lâ&#x20AC;&#x2122;entreprise individuelle, en crĂŠant un rĂŠgime unique de la micro-en-

treprise et en facilitant lâ&#x20AC;&#x2122;accès Ă lâ&#x20AC;&#x2122;EIRL. â&#x2013;  CrĂŠation des UniversitĂŠs RĂŠgionales des MĂŠtiers et de l'Artisanat (Urma) pour apporter aux artisans, aux ĂŠtudiants et adultes en mobilitĂŠ professionnelle une meilleure visibilitĂŠ des parcours individualisĂŠs de formation. â&#x2013;  Dynamisation des commerces de proximitĂŠ, en rĂŠnovant le rĂŠgime des

05

baux commerciaux. â&#x2013; Favorisation de la diversitĂŠ des commerces dans les territoires, notamment les plus fragiles, en renforçant les leviers des pouvoirs publics et en modernisant lâ&#x20AC;&#x2122;urbanisme commercial. â&#x2013;  Promotion de la qualitĂŠ et des savoir-faireGDQVOĚľDUWLVDQDWHQFODULͤDQW le statut des artisans.

COMMENT Ă&#x2030;LIRE VOS REPRĂ&#x2030;SENTANTS AUX CHAMBRES DE MĂ&#x2030;TIERS ET DE Lâ&#x20AC;&#x2122;ARTISANAT ? Câ&#x20AC;&#x2122;EST TRĂ&#x2C6;S SIMPLE !

 Vous recevez par courrier les listes des candidats.

>

 Ă&#x20AC; l'aide de l'enveloppe retour GÂŤM¢DȧUDQFKLHYRXVUHWRXUQH] OHEXOOHWLQGHYRWUHFKRL[DYDQW le 14 octobre 2016.

>

Proclamation des rĂŠsultats le 19 octobre 2016.

Le Monde des artisans [ septembre/octobre 2016


A

CTUALITĂ&#x2030;S [ DEUX-SĂ&#x2C6;VRES

Rendez-vous

13e Carrefour rĂŠgional des mĂŠtiers de bouche et de la gastronomie

P

lCEČ&#x152;UQWUNGUKIPGFGUĂŽles de lâ&#x20AC;&#x2122;ocĂŠan Indien et ses saveurs, le salon ouvrira ses portes du 1er au 4 octobre RTQEJCKPCWRCTEFGUGZRQUKVKQPUČ&#x192;0KQTV Cette manifestation pour les professionnels GVNGITCPFRWDNKERGWVEQORVGTEJCSWG annĂŠe sur lâ&#x20AC;&#x2122;implication active des apprentis GVHQTOCVGWTUFGUĆ&#x2019;NKČ&#x2039;TGUCNKOGPVCVKQPGV

06

JČ&#x2013;VGNNGTKGTGUVCWTCVKQPFWECORWUFGUOČ&#x152;VKGTUFWEGPVTGFGHQTOCVKQPFGNC%JCODTG de mĂŠtiers et de lâ&#x20AC;&#x2122;aTVKUCPCVFGU&GWZ5Č&#x2039;XTGU DĂŠmonstrations culinaires, concours, battles, expositionsâ&#x20AC;ŚWPGPQWXGNNGČ&#x152;FKVKQPČ&#x192; PGRCUOCPSWGT

i

www.metiersdebouche.info

Rencontres de la transmission dâ&#x20AC;&#x2122;entreprise Ă Parthenay

V

QWUČ?VGUFKTKIGCPVFŨGPVTGRTKUGGV, dans quelques annĂŠes, vous allez cesser votre activitĂŠĹĄ? LC%JCODTGFGmĂŠtiers et de lâ&#x20AC;&#x2122;artisanat et NC%JCODTGFGcommerce et dâ&#x20AC;&#x2122;industrie FGU&GWZ5Č&#x2039;XTGUGPRCTVGPCTKCVCXGENG %TČ&#x152;FKV#ITKEQNG%JCTGPVG/CTKVKOG&GWZ 5Č&#x2039;XTGUXQWURTQRQUGPVWPTGPFG\XQWU incontournable pour prĂŠparer votre transOKUUKQPFŨGPVTGRTKUG#WRTQITCOOGĹĄFGU VČ&#x152;OQKIPCIGUFGEJGHUFŨGPVTGRTKUGC[CPV transmis leur activitĂŠ, des rendez-vous

individuels avec des conseillers spĂŠcialiUČ&#x152;UFGUEJCODTGUEQPUWNCKTGs, notaires, banquiers, experts-comptables et conseillers45+RQWTXQWUCKFGTČ&#x192;RTČ&#x152;RCTGTXQVTG VTCPUOKUUKQP Rendez-vous le 21 novembre prochain Ă 14h15 au campus des mĂŠtiers de Parthenay, 2 rue dâ&#x20AC;&#x2122;Abrantes.

i

Inscription obligatoire | 3OXVGČ&#x2021;LQIRVÉ&#x2039;ZZZFPDQLRUWIU| &RQWDFWÉ&#x2039;(PHULF3RQWRUHDX| 05 49 77 87 82 | e.pontoreau@cma-niort.fr

CafĂŠ de lâ&#x20AC;&#x2122;emploi LA RETRAITE : QUAND ? COMBIEN ? ET COMMENT LA PRĂ&#x2030;PARER ? 3RXUUÂŤSRQGUH¢YRVTXHVWLRQVOD&0$VRXKDLWHYRXVIDLUHEÂŤQÂŤČŚFLHUGHOČ&#x201E;H[SÂŤULHQFHGH VRQSDUWHQDLUHOD0XWXHOOHGHVDUWLVDQV 015$ HQPDWLÂŞUHGHUHWUDLWHHWGHSUÂŤYR\DQFHGDQV OČ&#x201E;HQWUHSULVHDUWLVDQDOH1RXVYRXVFRQYLRQVOHMHXGLQRYHPEUHGHK¢K DXFDPSXVGHVPÂŤWLHUVGH3DUWKHQD\$XSURJUDPPHFRQWH[WHÂŤFRQRPLTXHHWRXWLOV GHJHVWLRQGHV¤JHV FRQWUDWGHJÂŤQÂŤUDWLRQČ&#x152; YRWUHUHWUDLWH OHV\VWÂŞPHOHV¤JHVOHFDOFXO OHVFRXYHUWXUHV SDU-RKDQH$VVHOLQGH%HDXYLOOHH[SHUWHGHOD015$HQSURWHFWLRQVRFLDOH Â&#x201A;OČ&#x201E;LVVXHGHODUÂŤXQLRQHWVXUUHQGH]YRXVGLDJQRVWLFJUDWXLWHWSHUVRQQDOLVÂŤGHYRWUHSURSUH SURWHFWLRQVRFLDOHSDUOD015$

i

ValĂŠrie BrĂŠmaud | 05 49 77 87 83 | v.bremaud@cma-niort.fr

Le Monde des artisans [ septembre/octobre 2016

SALON HABITAT : ÂŤ CONFORTS, MODE Dâ&#x20AC;&#x2122;EMPLOI Âť

.GRTQEJCKP5CNQP*CDKVCVQWXTKTC ses portes du 14 au 17 octobre RTQEJCKPCWRCTEFGUGZRQUKVKQPU FG0KQTV7PPQWXGCWTGPFG\XQWU KPEQPVQWTPCDNGRQWTNGITCPFRWDNKE qui aura la possibilitĂŠ de rencontrer WPITCPFPQODTGFGRTQHGUUKQPPGNU de la construction, de lâ&#x20AC;&#x2122;ĂŠquipement GVFGNCFČ&#x152;EQTCVKQPFGNCOCKUQP

i

www.habitat79.fr

DES FORMATIONS POUR LES NOUVEAUX DIRIGEANTS DU NIORTAIS ET DU MELLOIS 9RXVDYH]FURXUHSULV une entreprise, dÊveloppÊ une QRXYHOOHDFWLYLWGHSXLVPRLQV GHFLQTDQVVXUOHWHUULWRLUHGHOD CommunautÊ d'agglomÊration du Niortais et sur le Pays Mellois ? %QȌFLH]GHVL[PRGXOHVJUDWXLWV GHGHX[KHXUHVFRQŠXVVSFLDOHPHQW pour vous, pour optimiser le quotidien de votre entreprise HWGHYHQLUSOXVFRPSWLWLI

i

3OXVG LQIRVHWLQVFULSWLRQVÉ&#x2039; www.cma-niort.fr


DEUX-SĂ&#x2C6;VRES

UN DES MEILLEURS APPRENTIS DE FRANCE : UNE PLUIE DE MĂ&#x2030;DAILLES DĂ&#x2030;PARTEMENTALES

Trois questions Ă â&#x20AC;Ś

Didier Sivadier

Artisan ĂŠbĂŠniste Ă Pamproux MOF 2004 et prĂŠsident dĂŠlĂŠguĂŠ des Deux-Sèvres de la SociĂŠtĂŠ des Meilleurs Ouvriers de France depuis 2014 Quelle a ĂŠtĂŠ lâ&#x20AC;&#x2122;ĂŠvolution du concours ÂŤ Un des Meilleurs Apprentis de France Âťâ&#x20AC;&#x2030;? Il est nĂŠGPFGNCXQNQPVČ&#x152;FŨWPJQOOG Paul Labourier, Meilleur Ouvrier de France GPUGKIPCPVFW/QTDKJCP&GPKXGCWFČ&#x152;RCT VGOGPVCNRWKUTČ&#x152;IKQPCNGVGPĆ&#x2019;PPCVKQPCN depuis 2001, ce concours a connu une croissance exceptionnelle sur lâ&#x20AC;&#x2122;ensemble FWVGTTKVQKTG+NGUVRCTTCKPČ&#x152;RCTNC5QEKČ&#x152;VČ&#x152; des Meilleurs Ouvriers de France et, pour NCRTGOKČ&#x2039;TGHQKUEGVVGCPPČ&#x152;GNCUGEVKQP FGWZUČ&#x152;XTKGPPGSWGLGRTČ&#x152;UKFGCUQWJCKVČ&#x152; CUUQEKGTNC%JCODTGFGOČ&#x152;VKGTUGVFGNŨCT VKUCPCVFGU&GWZ5Č&#x2039;XTGUGVUGUECORWU FGUOČ&#x152;VKGTUČ&#x192;NCTGOKUGFGURTKZ (lire encadrĂŠ ci-contre)7PGČ&#x152;XKFGPEGNQTUSWGNŨQP connaĂŽt son implication dans la formation GVNGUOČ&#x152;VKGTUFGNŨCTVKUCPCV

La cĂŠrĂŠmonie de remise des prix du concours dĂŠpartemental ÂŤ Un des Meilleurs Apprentis de France Âť a rĂŠvĂŠlĂŠ ses mĂŠdaillĂŠs le 8 septembre dernier. Lâ&#x20AC;&#x2122;occasion de mettre Ă lâ&#x20AC;&#x2122;honneur lâ&#x20AC;&#x2122;excellence, la motivation des apprentis et

iĹĄ&5+8#&+'4

lâ&#x20AC;&#x2122;investissement des employeurs. 1TICPKUČ&#x152;GRQWTNCRTGOKČ&#x2039;TGHQKU par la section dĂŠpartementale de la

07

5QEKČ&#x152;VČ&#x152;PCVKQPCNGk7PFGU/GKNNGWTU Ouvriers de France Âť la soirĂŠe a GWNKGWČ&#x192;0KQTVCWECORWUFGU mĂŠtiers du centre de formation FGNC%JCODTGFGOČ&#x152;VKGTUGV

Comment dĂŠcririez-vous ce concoursâ&#x20AC;&#x2030;? Lâ&#x20AC;&#x2122;objectif est de promouvoir le travail maPWGNGVNCHQTOCVKQPRTQHGUUKQPPGNNGCWRTČ&#x2039;U FGULGWPGUFGNGUKPEKVGTČ&#x192;FČ&#x152;XGNQRRGTNŨKPK tiative personnelle, lâ&#x20AC;&#x2122;esprit de compĂŠtition GVFŨCHĆ&#x2019;TOGTNGWTRGTUQPPCNKVČ&#x152;/QKOČ?OG Meilleur Ouvrier de France, je pense quâ&#x20AC;&#x2122;il faut communiquer lâ&#x20AC;&#x2122;esprit dâ&#x20AC;&#x2122;excellence, le IQĂťt du travail bien fait, source de motivation pour toute une jeunesse qui prend RNCKUKTČ&#x192;VTCXCKNNGT%ŨGUVWPEQPEQWTUSWK OCTSWGCWVCPVNŨGPICIGOGPVFWLGWPGSWG de lâ&#x20AC;&#x2122;entreprise avec le soutien de laquelle KNGUVRNWUHCEKNGFGUGRTČ&#x152;RCTGT

Que souhaitez-vous pour lâ&#x20AC;&#x2122;avenirâ&#x20AC;&#x2030;? /QP GZRČ&#x152;TKGPEG FCPU NGU LWT[U FGU concours professionnels me fait rencontrer FGPQODTGWZLGWPGUVTČ&#x2039;UOQVKXČ&#x152;UGVSWK UŨČ&#x152;RCPQWKUUGPVFCPUNGWTVTCXCKN,GOG

FGNŨCTVKUCPCVFGU&GWZ5Č&#x2039;XTGU

m,OIDXW FRPPXQLTXHUOČ&#x2021;HVSULW GČ&#x2021;H[FHOOHQFHOHJR½W GXWUDYDLOELHQIDLW VRXUFHGHPRWLYDWLRQ pour toute une MHXQHVVHTXLSUHQG SODLVLU¢WUDYDLOOHU}

RCTVGPCKTGFGEGVVGRTGOKČ&#x2039;TGČ&#x152;FKVKQP 5WTNCXKPIVCKPGFGECPFKFCVUCWZ ĂŠpreuves dĂŠpartementales, onze mĂŠdaillĂŠs, apprentis en peinture bâtiment, serrurerie, mĂŠtiers de DQWEJGOGPWKUGTKGGUVJČ&#x152;VKSWGGV UKIPCNČ&#x152;VKSWGCKPUKSWGNGUVKVWNCKTGU FŨWPGOČ&#x152;FCKNNGTČ&#x152;IKQPCNGQW nationale obtenue dans lâ&#x20AC;&#x2122;annĂŠe, QPVČ&#x152;VČ&#x152;OKUČ&#x192;NŨJQPPGWT2CTOKNGU laurĂŠats et mĂŠdaillĂŠs dâ&#x20AC;&#x2122;or, ClĂŠment /CNCIWCRRTGPVKUGTTWTKGTOČ&#x152;VCNNKGT GV,Č&#x152;TČ&#x152;O[2GTQPCRRTGPVK

TČ&#x152;LQWKUFGNCRCTVKEKRCVKQPFGPQUXKPIVVTQKU ECPFKFCVUEGVVGCPPČ&#x152;GGVLŨGURČ&#x2039;TGSWGNG PQODTGKTCETQKUUCPVCWĆ&#x2019;NFWVGORU2QWT cela, je compte sur la mobilisation des centres de formations professionnelles et des entreprises artisanales pour les KPEKVGTČ&#x192;UŨKPUETKTGGVČ&#x192;NGUUQWVGPKT

cuisinier en dessert de restaurant, ont respectivement suivi leur formation aux campus des OČ&#x152;VKGTUFG2CTVJGPC[GVFG0KQTV

i

Le palmarès sur www.cma-niort.fr

Le Monde des artisans [ septembre/octobre 2016


A

CTUALITĂ&#x2030;S [ DEUX-SĂ&#x2C6;VRES

Gâtine Box

Une alliance touristique et ĂŠconomique

L

a Gâtine Box est la nouvelle offre lancĂŠe par lâ&#x20AC;&#x2122;association Gâtinâ&#x20AC;&#x2122;Č&#x152;OQKU GP LWKNNGV FGTPKGT 'NNGRGTOGVFŨCNNGTČ&#x192;NCdĂŠcouverte des acteurs touristiques et ĂŠconomiques FGNC)Č&#x2026;VKPG2QKVGXKPG.C%JCODTGFG OČ&#x152;VKGTUGVFGNŨCTVKUCPCVFGU&GWZ5Č&#x2039;XTGU partenaire de cette vitrine du savoir-faire local, vous propose de la faire dĂŠcouvrir Č&#x192;XQVTGVQWTGPNŨQHHTCPVČ&#x192;XQVTGGPVQWTCIG RTQHGUUKQPPGNQWHCOKNKCN .C )Č&#x2026;VKPG $QZ EŨGUV RQWT NŨCEJGVGWT NG XKUKVGWTQWNŨJCDKVCPVFG)Č&#x2026;VKPGĹĄ

â&#x2013; Ĺ&#x161;Un catalogue de 40 offres exclusives

RTQRQUČ&#x152;GURCTNGUCFJČ&#x152;TGPVUFGNŨCUUQ EKCVKQP â&#x2013; Ĺ&#x161;Un cadeau original pour les visiteurs de la Gâtine Poitevine, avec autant dâ&#x20AC;&#x2122;idĂŠes de sorties et dâ&#x20AC;&#x2122;activitĂŠs inattendues mais CWUUKRQWTNGUJCDKVCPVUFW cruCĆ&#x2019;PFG FČ&#x152;EQWXTKTQWTGFČ&#x152;EQWXTKTNGWTVGTTKVQKTG â&#x2013; Ĺ&#x161;Un chĂŠquier de paiement de 30, 50, 100 ou 150 euros consommables en une QWRNWUKGWTURTGUVCVKQPU â&#x2013; Ĺ&#x161;Un acte citoyen et responsable en HCKUCPVNCRCTVDGNNGČ&#x192;NŨČ&#x152;EQPQOKGNQECNG

GPEKTEWKVEQWTV Ils sont producteurs, artisans FČ&#x152;LČ&#x192; enVTGRTKUGU CTVKUCPCNGU Ć&#x2019;IWTGPV RCTOK NGU CFJČ&#x152;TGPVUEQOOGTČ&#x160;CPVU,GVE La Gâtine Box, câ&#x20AC;&#x2122;est la bonne idĂŠe de FDGHDX SRXU OHV IÂŤWHV GH ̧Q G˸DQQÂŞH )DLWHVHQSUŖWHUYRVFOLHQWVYRVVDOD ULÂŞVYRWUHIDPLOOHË°

i

Pour vous procurer la Gâtine Box, connaĂŽtre la liste des professionnels DGKÂŤUHQWVHWGÂŤFRXYULUOHXURÎ?UH (atelier culinaire, visite et panier JRXUPDQGSDWULPRLQHHWGÂŤWHQWH É&#x2039; www.gatinemois.com

TROIS QUESTIONS Ă&#x20AC; CLAIRE PAULIC iĹĄ29#..%&

08

CONSEILLĂ&#x2C6;RE DĂ&#x2030;PARTEMENTALE DU CANTON DE MAULĂ&#x2030;ON ET PRĂ&#x2030;SIDENTE DE Lâ&#x20AC;&#x2122;AGENCE DE DĂ&#x2030;VELOPPEMENT TOURISTIQUE DES DEUX-SĂ&#x2C6;VRES (ADT 79)

Le Monde des Artisansâ&#x20AC;&#x2030;: Comment est nĂŠe lâ&#x20AC;&#x2122;idĂŠe de la gâtine Box et comment envisagez-vous son dĂŠveloppementâ&#x20AC;&#x2030;? .ŨKPKVKCVKXG GP TGXKGPV Č&#x192; 0CPE[ &GUVefanis-Dupin, Directrice de NC %JCODTG FG OČ&#x152;VKGTU GV FG NŨCTVKUCPCV Ǩ UQP CTTKXČ&#x152;G FCPU NGU &GWZ5Č&#x2039;XTGUGNNGCČ&#x152;OKUNGUQWJCKVFGOGVVTGGPRNCEGWPGkDQZz FČ&#x152;RCTVGOGPVCNG FG V[RG DQZ FŨQHHTGU VQWTKUVKSWGU KPVČ&#x152;ITCPV FG UWTETQČ&#x2018;VFGURTGUVCVKQPUCTVKUCPCNGUČ&#x192;OČ?OGFGTGPHQTEGTNCRTGU ETKRVKQPETQKUČ&#x152;GFGRTQZKOKVČ&#x152;.Ũ#IGPEGFGdĂŠveloppement tourisVKSWG #&6  C UQWVGPW EGVVG KFČ&#x152;G GV UŨGUV GPICIČ&#x152;G Č&#x192; CKFGT Č&#x192; UC EQPETČ&#x152;VKUCVKQP Č&#x192; WPG Č&#x152;EJGNNG KPHTCFČ&#x152;RCTVGOGPVCNG FCPU WP RTG OKGTVGORURQWTHCEKNKVGTEGVVGRTGUETKRVKQPFGRTQZKOKVČ&#x152;%QPPCKU UCPVNGVTCXCKNOGPČ&#x152;FGOCPKČ&#x2039;TGVTCPUXGTUCNG RTGUVCVCKTGUVQWTKU tiques, producteurs locaux, artisans) par ÂŤ Gâtinâ&#x20AC;&#x2122;ĂŠmois Âť en lien avec Tourisme en Gâtine, lâ&#x20AC;&#x2122;ADT a contactĂŠ ces opĂŠrateurs qui ont VQWVFGUWKVGTGNGXČ&#x152;NGFČ&#x152;Ć&#x2019;#WTGICTFFGURTGOKGTUTČ&#x152;UWNVCVUFGU XGPVGUNŨQRČ&#x152;TCVKQPPGFGOCPFGSWŨČ&#x192;Č?VTGTGEQPFWKVGGVČ&#x152;VGPFWGČ&#x192; FŨCWVTGUVGTTKVQKTGUFGU&GWZ5Č&#x2039;XTGU

LMAâ&#x20AC;&#x2030;: De quelle manière les artisans peuvent-ils contribuer Ă lâ&#x20AC;&#x2122;attrait touristique du dĂŠpartement et en faire un levier de dĂŠveloppement de lâ&#x20AC;&#x2122;entrepriseâ&#x20AC;&#x2030;? &CPU WP FČ&#x152;RCTVGOGPV EQOOG NG PČ&#x2013;VTG RNWU GPEQTG SWG FCPU FGUVGTTKVQKTGUSWKLQWKUUGPVFŨWPGKORQTVCPVGKOCIGVQWTKUVKSWG il faut dĂŠmontrer collectivement que le tourisme est la somme FGUQHHTGUSWKHQTIGPVPQVTGKFGPVKVČ&#x152;RTQHQPFGCWFGNČ&#x192;FGPQURC[ UCIGUGVFGPQUUKVGU0QUXKUKVGWTUCVVGPFGPVFGNGWTUXCECPEGU

Le Monde des artisans [ septembre/octobre 2016

GP &GWZ5Č&#x2039;XTGU FGU FČ&#x152;EQWXGTVGU FGU GZRČ&#x152;TKGPEGU ITCVKĆ&#x2019;CPVGU FGUTGPEQPVTGUCXGENGVGTTQKT+NPQWUCRRCTVKGPVFGNGUUWTRTGPFTG en leur dĂŠmontrant toute la variĂŠtĂŠ et lâ&#x20AC;&#x2122;ĂŠtendue des offres dans WPRČ&#x152;TKOČ&#x2039;VTGTGUVTGKPVǨEGVKVTGNGURTQFWKVUNQECWZGVNGUTČ&#x152;CNK UCVKQPUCTVKUCPCNGUTGXČ?VGPVWPECTCEVČ&#x2039;TGFČ&#x152;VGTOKPCPVRQWTkKO pressionner Âť nos touristes, au mĂŞme titre que les festivals, car ils UQPVRCTVKGRTGPCPVGFGPQVTGEWNVWTGǨPQUETČ&#x152;CVGWTUFŨQUGTNGU OGVVTGGPCXCPVGVFGEQPVKPWGTČ&#x192;KPPQXGT

LMAâ&#x20AC;&#x2030;: Comment les actions de lâ&#x20AC;&#x2122;ADT apportent-elles du dynamisme Ă lâ&#x20AC;&#x2122;artisanatâ&#x20AC;&#x2030;? BKGP SWŨKN UQKV FKHĆ&#x2019;EKNG FŨCRRQTVGT WP TGICTF NWEKFG Č&#x192; UQP RTQRTG travail, je crois pouvoir dire que, sous lâ&#x20AC;&#x2122;impulsion de ses ĂŠlus et CXGENGUOQ[GPUSWGNWKQEVTQKGNG%QPUGKNFČ&#x152;RCTVGOGPVCNNŨ#&6 UŨČ&#x152;XGTVWG Č&#x192; kECUUGT NGU ENQKUQPUz GPVTG FGU FQOCKPGU FŨCEVKXK VČ&#x152;SWKQPVXQECVKQPČ&#x192;UGRTGUETKTGOWVWGNNGOGPV0ŨQWDNKQPURCU SWGNGVQWTKUOGGUVWPOQ[GPGVPQPWPGĆ&#x2019;PGPUQKFGOGVVTGGP CXCPVVQWVGUNGUTKEJGUUGUFŨWPVGTTKVQKTGUCPUGZEGRVKQPFGRWKU NC XKUKVG FŨGPVTGRTKUG LWUSWŨČ&#x192; NŨCEJCV FGU RTQFWKVU NQECWZ GP RCU UCPVRCTNŨJČ&#x152;DGTIGOGPV %ŨGUV RQWTSWQKCXGE NGU 1HĆ&#x2019;EGU FGVQW risme, lâ&#x20AC;&#x2122;ADT nâ&#x20AC;&#x2122;a de cesse de faire rencontrer tous les acteurs pour SWŨKNUVTCXCKNNGPVGPUGODNGGVNGUCEEQORCIPGFCPUNŨCOČ&#x152;NKQTCVKQP FGNGWTURTCVKSWGUČ&#x192;FGUVKPCVKQPFGUXKUKVGWTU'VRCTOKEGUXKUK VGWTUFŨGPVTGGWZUČ&#x152;LQWTPGPVEJG\FGURCTGPVUGVCOKUĹĄNGU Deux-SĂŠvriens sont donc les premiers prescripteurs du tourisme GP&GWZ5Č&#x2039;XTGUGVEŨGUVRQWTGWZSWGPQWUCXQPUEQPČ&#x160;WNGFKURQ UKVKHk,ŨCKOGOQPFČ&#x152;RCTVGOGPVLGNGRCTVCIGz


DEUX-SĂ&#x2C6;VRES

ATENA

iĹĄ+0&7564+'$.+%-(161.+#%1/

Concevoir, fabriquer et communiquer grâce Ă un logiciel de conception 3D Lâ&#x20AC;&#x2122;atelier e-numĂŠrique de lâ&#x20AC;&#x2122;artisanat est une plateforme numĂŠrique dĂŠdiĂŠe aux activitĂŠs artisanales de production. Il sâ&#x20AC;&#x2122;agit dâ&#x20AC;&#x2122;un service innovant permettant dâ&#x20AC;&#x2122;utiliser des logiciels mĂŠtiers performants sans achat de licences et de matĂŠriels coĂťteux.

D

ans le cadre du lancement de la RNCVGHQTOGNGRČ&#x2013;NGFŨKPPQXCVKQPFW travail des mĂŠtaux vous propose de XQWUCEEQORCIPGTFCPUNŨKPVČ&#x152;ITCVKQPFŨWP NQIKEKGNFG%#1 EQPEGRVKQPCUUKUVČ&#x152;GRCT ordinateur), pour optimiser le processus de EQPEGRVKQPGVFGHCDTKECVKQPFGXQURTQFWKVU %GRTQITCOOGEQORTGPFWPGHQTOCVKQPCW NQIKEKGNGVWPCEEQORCIPGOGPVFGRNWUKGWTU

OQKU2GPFCPVEGVVGRČ&#x152;TKQFGXQWUDČ&#x152;PČ&#x152;Ć&#x2019;EKGTG\ dâ&#x20AC;&#x2122;une assistance et dâ&#x20AC;&#x2122;un CEEČ&#x2039;UITCVWKVUCWNQIKEKGN Si vous nâ&#x20AC;&#x2122;ĂŞtes pas ĂŠquipĂŠ, du matĂŠriel informatique RQWTTCXQWUČ?VTGRTČ?VČ&#x152; Lâ&#x20AC;&#x2122;atelier e-numĂŠrique de lâ&#x20AC;&#x2122;artisanat est un projet pilote et un service dĂŠXGNQRRČ&#x152;RCTNC%JCODTG de mĂŠtiers et de lâ&#x20AC;&#x2122;artisaPCVFGU&GWZ5Č&#x2039;XTGUGV UQP RČ&#x2013;NG FŨKPPQXCVKQP du VTCXCKN FGU OČ&#x152;VCWZ +N UŨCFTGUUG Č&#x192; VQWVG GPVTGRTKUG CTVKUCPCNG de production, quelle que soit sa situation IČ&#x152;QITCRJKSWG &GWZ5Č&#x2039;XTGUGVCWVTGUFČ&#x152;RCTVGOGPVU 

i

RENCONTRE TECHNIQUE SOUDAGE Ă&#x20AC; PARTHENAY Le 11 octobre, une journĂŠe technique sur le thème du soudage est proposĂŠe aux entreprises artisanales. %QPHČ&#x152;TGPEGUVJČ&#x152;OCVKSWGUCWVQWT

09

FGURTQEČ&#x152;FČ&#x152;USWCNKĆ&#x2019;ECVKQPFGU soudeurs et prĂŠvention des fumĂŠes QTICPKUČ&#x152;GUCXGENC%#45#6 DiffĂŠrentes solutions de captation UGTQPVVGUVČ&#x152;GUGPEQPFKVKQPUTČ&#x152;GNNGU DĂŠcouverte et test du matĂŠriel de FGTPKČ&#x2039;TGIČ&#x152;PČ&#x152;TCVKQPGVXKUKVGFŨWPG

Pour en savoir plus et connaĂŽtre les conditions et les critères GČ&#x2021;ÂŤOLJLELOLWÂŤÉ&#x2039;3LHUULFN6ÂŤFKHU| 06 84 96 91 15 | p.secher@cma-niort.fr |$77(17Î&#x2013;21É&#x2039; Le nombre de places est limitĂŠ.

entreprise de bien dâ&#x20AC;&#x2122;ĂŠquipements pour NGUCEVKXKVČ&#x152;UFGUQWFCIGGVFGEQWRCIG

i

Programme complet et LQVFULSWLRQÉ&#x2039;ZZZLPHWDX[QHW

UNE SOIRĂ&#x2030;E POUR DĂ&#x2030;VOILER LES TALENTS DE Lâ&#x20AC;&#x2122;ARTISANAT .CSWCNKĆ&#x2019;ECVKQPRTQHGUUKQPPGNNGGVNŨGPICIGOGPVFCPUNCHQTOCVKQPFŨCRRTGPVKU ont ĂŠtĂŠ saluĂŠs en juillet dernier lors de la soirĂŠe des Talents de lâ&#x20AC;&#x2122;artisanat CWECORWUFGUOČ&#x152;VKGTUFWEGPVTGFGHQTOCVKQPFGNC%JCODTGFGOČ&#x152;VKGTU GVFGNŨCTVKUCPCVFGU&GWZ5Č&#x2039;XTGUČ&#x192;0KQTV6TGPVGEJGHUFŨGPVTGRTKUGQPVČ&#x152;VČ&#x152;OKU Č&#x192;NŨJQPPGWTEGTVCKPURQWTNGWTVKVTGFGOCČ&#x2018;VTGCTVKUCPFŨCWVTGUFCPUNGECFTG FGNCUČ&#x152;NGEVKQPFWRTKZFČ&#x152;RCTVGOGPVCNFWOCČ&#x2018;VTGFŨCRRTGPVKUUCIG2QWTNC%/# FGU&GWZ5Č&#x2039;XTGUGVUGURCTVGPCKTGUNG%TČ&#x152;FKV#ITKEQNG%JCTGPVG/CTKVKOG &GWZ5Č&#x2039;XTGUGVNC/WVWGNNGFGUTGVTCKVČ&#x152;UFGNŨCTVKUCPCV /04# EGURTKZOCTSWGPV NCTGEQPPCKUUCPEGFŨWPGSWCNKĆ&#x2019;ECVKQPEGTVCKPGNCTČ&#x152;EQORGPUGFŨWPGJCWVG SWCNKVČ&#x152;RTQHGUUKQPPGNNGGVNŨKPXGUVKUUGOGPVCWUGTXKEGFGNŨCRRTGPVKUUCIG

i

Retrouvez-les sur www.cma-niort.fr

Le Monde des artisans [ septembre/octobre 2016


A

LISTE DES PIA

CTUALITĂ&#x2030;S [ PANORAMA

Ĺ°ARDATmv (75 Paris) Association de recherche, dĂŠveloppement et assistance technique pour les mĂŠtiers de la viande |

Laboratoires dâ&#x20AC;&#x2122;idĂŠes

www.boucherie-france.org/ardat_accueil

Seize pĂ´les dâ&#x20AC;&#x2122;innovation labellisĂŠs (PIA)

Ĺ°ATEN (14 Caen) Artisanat et technologies numĂŠriques | www.pole-aten.fr Ĺ°CEPROC (75 Paris) Centre europĂŠen des professions culinaires |

La nouvelle liste des ĂŠtablissements ayant reçu le label ÂŤ PĂ´le dâ&#x20AC;&#x2122;innovation RQWTNŨCTVKUCPCVzCČ&#x152;VČ&#x152;RWDNKČ&#x152;GĆ&#x2019;PLWKNNGV

www.ceproc-cfa.com/pole-innovation Ĺ°CERFAV (54 Vannes-le-Chatel) Centre europĂŠen de recherche et de formation

L

10

Des aides de lâ&#x20AC;&#x2122;Ă&#x2030;tat Parmi les vingt-neuf candidatures dĂŠposĂŠes qui rĂŠpondent au cahier des charges mis en place pour 2016, seize ont ĂŠtĂŠ retenues.

aux arts verriers | www.cerfav.fr Ĺ°CIRBAT (La RĂŠunion) Centre iĹĄPRESCOTT09

a secrĂŠtaire dâ&#x20AC;&#x2122;Ă&#x2030;tat chargĂŠe de lâ&#x20AC;&#x2122;Artisanat, Martine Pinville, a labellisĂŠ en juillet seize pĂ´les dâ&#x20AC;&#x2122;innovation pour lâ&#x20AC;&#x2122;artisanat (cf liste ci-contre). Le plus souvent rattachĂŠes Ă des chambres consulaires ou Ă  des organisations professionnelles, ces structures encouragent le dĂŠveloppement de solutions nouvelles pour mieux rĂŠpondre aux mutations ĂŠconomiques. FondĂŠ en 1991, le label PIA permet ainsi aux artisans dâ&#x20AC;&#x2122;intĂŠgrer des solutions innovantes dans leur activitĂŠ pour gagner en compĂŠtitivitĂŠ et en visibilitĂŠ.

Ce dernier ÂŤ valorise la recherche de synergies, de mutations de projets, dâ&#x20AC;&#x2122;ĂŠchanges et de transferts dâ&#x20AC;&#x2122;expĂŠrience ainsi que le renforcement des outils de suivi et dâ&#x20AC;&#x2122;ĂŠvaluation Âť, prĂŠcise le cabinet de Martine Pinville. Lâ&#x20AC;&#x2122;Ă&#x2030;tat et les ĂŠtablissements sĂŠlectionnĂŠs seront liĂŠs par un contrat de labellisation, listant leurs engagements rĂŠciproques et les actions prioritaires du PĂ´le pour la pĂŠriode du 1er janvier 2016 au 31 dĂŠcembre 2020. Lâ&#x20AC;&#x2122;Ă&#x2030;tat pourra en outre subventionner des missions prioritaires, via des conventions CPPWGNNGUFGĆ&#x2019;PCPEGOGPV

dâ&#x20AC;&#x2122;innovation et de recherche sur le bâti tropical | www.cirbat.re Ĺ°CNIDEP (54 Nancy) Centre national dâ&#x20AC;&#x2122;innovation pour le dĂŠveloppement durable | www.cnidep.com Ĺ°CNIFPD (75 Paris) Centre national dâ&#x20AC;&#x2122;innovation et de formation des prothĂŠsistes dentaires | www.cnifpd.fr Ĺ°CNISAM (87 Limoges) Centre national de lâ&#x20AC;&#x2122;innovation, santĂŠ, autonomie et mĂŠtiers | www.cnisam.fr Ĺ°COPROTEC (68 Sainte-Croix-en-Plaine) Association des professionnels de lâ&#x20AC;&#x2122;ĂŠnergie | www.coprotec.net Ĺ°CTAI (68 Colmar) Centre de technologies et usages numĂŠriques | www.ctai.fr

DE NOUVELLES RĂ&#x2C6;GLES Sâ&#x20AC;&#x2122;APPLIQUENT AU CONTRĂ&#x201D;LE URSSAF Un dĂŠcret en date du 8 juillet 2016 (1) rĂŠforme la procĂŠdure du contrĂ´le Urssaf. Parmi les nombreuses mesures, signalons celles relatives Ă la rĂŠgularisation FGUEQVKUCVKQPUNGUOCLQTCVKQPUFGTGVCTFNCXČ&#x152;TKĆ&#x2019;ECVKQPFGUFČ&#x152;ENCTCVKQPUQW encore les dĂŠlais. Auparavant en cas dâ&#x20AC;&#x2122;erreur, lâ&#x20AC;&#x2122;employeur pouvait la corriger en rĂŠglant progressivement ou annuellement les cotisations dues. DĂŠsormais, Ă  compter du 1erLCPXKGTKNFGXTCTGEVKĆ&#x2019;GTNGVKTNQTUFGNŨČ&#x152;EJČ&#x152;CPEGFČ&#x152;ENCTCVKXG la plus proche. Sâ&#x20AC;&#x2122;agissant des pĂŠnalitĂŠs de retard, lâ&#x20AC;&#x2122;employeur a la possibilitĂŠ FŨQDVGPKTWPGTGOKUGITCEKGWUGUCPUCXQKTČ&#x192;LWUVKĆ&#x2019;GTFČ&#x203A;OGPVUCDQPPGHQKFGRWKU le 11 juillet 2016. Seuls les cas de travail dissimulĂŠ ne le permettront pas. Pour NCXČ&#x152;TKĆ&#x2019;ECVKQPFGUFČ&#x152;ENCTCVKQPUCWer janvier 2017, le contrĂ´le sur pièces dans les locaux de lâ&#x20AC;&#x2122;organisme sera applicable aux entreprises de moins de 11 salariĂŠs (au lieu de 9 salariĂŠs actuellement). Lâ&#x20AC;&#x2122;avis de passage doit dĂŠsormais QHĆ&#x2019;EKGNNGOGPVČ?VTGGPXQ[Č&#x152;Č&#x192;NŨGPVTGRTKUGCWOQKPULQWTUCXCPVNCRTGOKČ&#x2039;TGXKUKVG Rappelons que cet avis comporte obligatoirement la mention de la charte du cotisant dont les dispositions deviennent opposables Ă  lâ&#x20AC;&#x2122;Urssaf Ă  partir du 1 LCPXKGT'PĆ&#x2019;PPQVQPUSWGUKWPGNGVVTGFŨQDUGTXCVKQPGUVČ&#x152;VCDNKG er

Ă lâ&#x20AC;&#x2122;issue du contrĂ´le, elle devra ĂŞtre motivĂŠe par le chef de redressement. (1)

DÊcret n° 2016, 941 du 8 juillet 2016 relatif au renforcement des droits des cotisants (JO du 10).

Ĺ°CTMP (92 Levallois-Perret) Centre technique des mĂŠtiers de la pâtisserie | www.ctmp.org Ĺ°PIA Filière Bois (75 Paris) Institut europĂŠen de la menuiserie, agencement, ĂŠbĂŠnisterie, fusionnĂŠ avec lâ&#x20AC;&#x2122;Institut de la charpente et de la construction bois (Compagnons du devoir) | www.compagnons-du-devoir.com/ expertise-metier Ĺ°INBP (76 Rouen) Institut national de la boulangerie et de la pâtisserie | www.inbp.com Ĺ°IRIS ST (75 Paris) Institut de recherche et dâ&#x20AC;&#x2122;innovation sur la santĂŠ et la sĂŠcuritĂŠ au travail | www.iris-st.org Ĺ°ITEMM (72 Le Mans) Institut technologique europĂŠen des mĂŠtiers de la musique | itemm.fr Ĺ°IFRAM (76 Villers-Ă&#x2030;calles) Institut de formation et de recherche pour les artisanats des mĂŠtaux | ifram.com

Le Monde des artisans [ SEPTEMBRE/OCTOBRE 2016


MĂŠtiers dâ&#x20AC;&#x2122;art

Cap sur le patrimoine Le Carrousel du Louvre accueillera du 3 au 6 novembre la 22e ĂŠdition du Salon international du Patrimoine culturel. Le Monde des Artisans est partenaire de cet ĂŠvĂŠnement, organisĂŠ par Ateliers dâ&#x20AC;&#x2122;Art de France.

Lâ&#x20AC;&#x2122;

ĂŠvĂŠnement a cette annĂŠe pour thème ÂŤ les chantiers remarquables du patrimoine Âť : matĂŠriel ou immatĂŠriel, contemporain ou dâ&#x20AC;&#x2122;ĂŠpoque plus ancienne... Au total, 340 exposants français et internationaux sont attendus, issus dâ&#x20AC;&#x2122;une quarantaine de mĂŠtiers de la restauration et de la sauvegarde du patrimoine. Objectifs : souligner lâ&#x20AC;&#x2122;excellence des savoir-faire de la restauration, et la beautĂŠ des collaborations entre corps de mĂŠtiers (architectes, entrepreneurs du bâti et des mĂŠtiers dâ&#x20AC;&#x2122;art). Le Salon proposera un cycle de confĂŠrences sur la thĂŠmatique de lâ&#x20AC;&#x2122;annĂŠe et les problĂŠmatiques du secteur. Diverses rĂŠcompenses seront remises : les bourses dâ&#x20AC;&#x2122;ĂŠtudes mĂŠtiers dâ&#x20AC;&#x2122;art, recherche et reconversion de la Fondation pour les monuments historiques, le Prix du MĂŠcĂŠnat populaire de la Fonda-

(85((7/2,5

LES ARTISANALES EN MODE ÂŤ MAKER FAIRE Âť tion du Patrimoine ou encore les prix Geste FŨ1T&GUĆ&#x2019;NOURTČ&#x152;UGPVČ&#x152;UNQTUFW(GUVKXCN KPVGTPCVKQPCNFWĆ&#x2019;NOFGUOČ&#x152;VKGTUFŨCTV (+( MA) seront diffusĂŠs.

Du 7 au 10 octobre, les Artisanales de Chartres accueilleront plus de 80 000 visiteurs. Pour cette nouvelle ĂŠdition, lâ&#x20AC;&#x2122;accent est mis sur les nouveaux modes de travail avec un ÂŤ Maker Faire Âť rĂŠgional gĂŠant.

11

Ce concept novateur rassemble

i

Programme complet sur www.patrimoineculturel.com

des passionnĂŠs de nouvelles technologies, des industriels, des ĂŠtudiants, des artistes mais aussi

CONCOURS AVIS AUX GOURMANDS ! RETROUVEZ DANS CE NUMĂ&#x2030;RO TOUTE Lâ&#x20AC;&#x2122;INFORMATION DE VOTRE CMA

6HSWHPEUHRFWREUHČ?Č&#x153;

rtisans

LE MONDE DES

Innover

Lâ&#x20AC;&#x2122;impression 3D, un nouvel enjeu PAGE

22

3RXUFOEUHUFHWDQQLYHUVDLUHUHQGH]YRXVMXVTX DXVHSWHPEUH VXUQRWUHSDJH)DFHERRNHWUSRQGH]¢ODTXHVWLRQVXLYDQWH

NOUVELLE FORMULE !

Bimestriel n°108

La nouvelle maquette du Monde des Artisans a dĂŠjĂ un 1 an !

Bravo Ă lâ&#x20AC;&#x2122;Ă&#x2030;quipe de France des MĂŠtiers P. 14

Dossier

Christophe Roussel : des saveurs et des idĂŠes P. 42

de leur mĂŠtier. Cet espace de 700 m2 sera animĂŠ par lâ&#x20AC;&#x2122;association Betamachine et le conseil dĂŠpartemental de lâ&#x20AC;&#x2122;Eure-et-Loir. En parallèle, plus de 1 000 apprentis se relaieront sur lâ&#x20AC;&#x2122;espace Artiâ&#x20AC;&#x2122;school pour faire dĂŠcouvrir leur mĂŠtier aux visiteurs, 100 m2 seront dĂŠdiĂŠs Ă la reconversion professionnelle. Les artisans et producteurs locaux de la rĂŠgion Centre-Val

Prestige

Convaincre son banquier : de lâ&#x20AC;&#x2122;art de nĂŠgocier P. 29

des artisans revisitant la pratique

Quel artisan chocolatier se cache derrière ces dÊlicieuses bouches qui faisaient la Une du Monde des Artisans 108 ?

de Loire seront ĂŠgalement mis en avant avec un espace ÂŤ made in local Âť. Un calendrier 2017, rĂŠalisĂŠ avec le soutien de la MNRA, avec

$SUÂŞVWLUDJHDXVRUWGL[KHXUHX[JDJQDQWVUHFHYURQW XQEDOORWLQGHFHVSHWLWHVGRXFHXUV%RQQHFKDQFH

douze duos dâ&#x20AC;&#x2122;artisans/apprentis de la rĂŠgion Ă lâ&#x20AC;&#x2122;honneur sera commercialisĂŠ.

www.facebook.com/lemondedesartisans

i

www.les-artisanales.com

Le Monde des artisans [ SEPTEMBRE/OCTOBRE 2016


A

CTUALITĂ&#x2030;S [ DEUX-SĂ&#x2C6;VRES

Reconnaissance

TrophĂŠe des femmes de l'artisanat Parmi les trois laurĂŠates du TrophĂŠe des femmes de lâ&#x20AC;&#x2122;artisanat rĂŠvĂŠlĂŠes et mises Ă lâ&#x20AC;&#x2122;honneur cette annĂŠe par la Chambre de mĂŠtiers et de lâ&#x20AC;&#x2122;artisanat des Deux-Sèvres et son partenaire le CrĂŠdit mutuel OcĂŠan, Alexandra Martin, fleuriste passionnĂŠe et ambitieuse, a remportĂŠ le troisième prix. Rencontre. vet de maĂŽtrise et ensuite devenir maĂŽtre CTVKUCP5GNQPOQKEŨGUVNGVKVTGFGTČ&#x152;HČ&#x152;TGPEGSWKKPURKTGNCEQPĆ&#x2019;CPEGGVRTQWXGNC EQORČ&#x152;VGPEGCWRTČ&#x2039;UFWENKGPV#XGEFČ&#x152;LČ&#x192; WPGUCNCTKČ&#x152;GČ&#x192;#KHHTGULGTGETWVGČ&#x192;PQWXGCWRQWTVGPKTNGOCICUKPFGDQWSWGVU GZRTGUUČ&#x192;%JCWTC[,GXGWZČ&#x152;ICNGOGPV proposer des ateliers dâ&#x20AC;&#x2122;art floral pour les CFWNVGUGVNGUGPHCPVU

i

m)ROOHPHQWČľHXUV}| &KDXUD\É&#x2039;| $LÎ?UHVÉ&#x2039;

12

Palmarès Le choix de ce mĂŠtier estil le fruit du hasard ou une vĂŠritable vocationâ&#x20AC;&#x2030;? 'P VTQKUKČ&#x2039;Oe, je ne savais pas quelle QTKGPVCVKQP RTGPFTG 5WT NGU EQPUGKNU dâ&#x20AC;&#x2122;un professeur, jâ&#x20AC;&#x2122;ai fait une formation GP$GRCXGPVGFGRTQFWKVUJQTVKEQNGUGV simultanĂŠment prĂŠparĂŠ le CAP fleuriste GP ECPFKFCVG NKDTG #RTČ&#x2039;U WP UVCIG GP entreprise, jâ&#x20AC;&#x2122;ai su que mon avenir proHGUUKQPPGNČ&#x152;VCKVFCPUEGOČ&#x152;VKGT2WKUNC EQPĆ&#x2019;CPEGSWGOŨCVČ&#x152;OQKIPČ&#x152;GOQPGORNQ[GWTRGPFCPVNCRTČ&#x152;RCTCVKQPFWDTGXGV professionnel a ĂŠtĂŠ dĂŠterminante pour NCUWKVGFGOCECTTKČ&#x2039;TG

Vous crĂŠez trois boutiques en huit ans. Ă&#x20AC; quoi attribuez-vous ce dĂŠveloppement rapideâ&#x20AC;&#x2030;? ,GPŨCKLCOCKUKOCIKPČ&#x152;SWGEGNCKTCKVUK XKVG%GRGPFCPV,EGUVTQKUOCICUKPUQPV VQWLQWTUČ&#x152;VČ&#x152;OQPQDLGEVKH'VOCNITČ&#x152;NGU FKHĆ&#x2019;EWNVČ&#x152;ULŨ[UWKUCTTKXČ&#x152;G,GTGUUGPUNG besoin de dĂŠvelopper, dâ&#x20AC;&#x2122;aller de lâ&#x20AC;&#x2122;avant et UWTVQWVFGPGRCUTGUVGTFCPUNCTQWVKPG,G

Le Monde des artisans [ septembre/octobre 2016

saisisNGUQRRQTVWPKVČ&#x152;USWKUGRTČ&#x152;UGPVGPV 2CTHQKULŨCRRTČ&#x152;JGPFGLGOŨKPVGTTQIGOCKU LGUCKUEGSWGLGXGWZ'VNQTUSWGNŨQPCWP EQWRFGEÂ&#x2018;WTVQWVGUVRQUUKDNG

ET LES AUTRES LAURĂ&#x2030;ATES SONTâ&#x20AC;Ś

Que faites-vous pour pĂŠrenniser votre activitĂŠâ&#x20AC;&#x2030;?

Titulaire dâ&#x20AC;&#x2122;un CAP de pâtissier et FKRFRODWLHU$QQH/DXUH*DOORLVDFUÂŤÂŤ VRQDFWLYLWÂŤHQ(OOHSURSRVHXQH JDPPHRULJLQDOHHWFRORUÂŤHGHELVFXLWV et de pâtisseries, notamment sur PHVXUHHWVXUFRPPDQGH6HVSURMHWV GÂŤYHORSSHUOHVFRXUVGHOČ&#x201E;DWHOLHU pâtisserie et former un apprenti.

Lorsque lâ&#x20AC;&#x2122;on fait un mĂŠtier de passion, de crĂŠation, lâ&#x20AC;&#x2122;objectif est de travailler pour UQK,ŨCKDGUQKPFWEQPVCEVCXGENCENKGPVČ&#x2039;NGEŨGUVOQPEČ&#x2013;VČ&#x152;EQOOGTČ&#x160;CPVG2QWT Ć&#x2019;FČ&#x152;NKUGTOGUENKGPVULGRTCVKSWGFGRGVKVU prix, je propose des offres promotionnelles GVFGUDQPUECFGCWZ/CKULGUWKUCXCPV tout une artisane et je constate que notre mĂŠtier sâ&#x20AC;&#x2122;est un peu perdu depuis quelques annĂŠes, ce qui explique certaines cessaVKQPUFŨCEVKXKVČ&#x152;U+NHCWVXTCKOGPVTGXGPKT Č&#x192;NCETČ&#x152;CVKQPGVČ&#x192;NCHNGWTHTCČ&#x2018;EJG

Et maintenant, quels sont vos projetsâ&#x20AC;&#x2030;? #RTČ&#x2039;UCPPČ&#x152;GUFCPUEGOČ&#x152;VKGTLŨCKOGTCKU entreprendre une validation des acquis de NŨGZRČ&#x152;TKGPEGRQWTEQPĆ&#x2019;TOGTWPPKXGCWDTG-

1ER PRIX :  Art et Gourmandise  à Saint-LÊger-de-la-Martinière

www.artetgourmandise.e-monsite.com

2E PRIX : ÂŤ La boulange de Rose-Ă&#x2030;lise Âť Ă Sainte-Ouenne

7LWXODLUHGČ&#x201E;XQ'HXJHWGČ&#x201E;XQHOLFHQFH informatique et mathĂŠmatiques, dâ&#x20AC;&#x2122;un CAP boulanger, Rose-Ă&#x2030;lise Delarue DFUÂŤÂŤVRQHQWUHSULVHHQ(OOH RSWHSRXUXQHGÂŤPDUFKHELRORJLTXH ÂŤFRORJLTXHHWÂŤFRQRPLHORFDOH 6HVSURMHWVGÂŤYHORSSHUVDJDPPH de produits, la livraison en magasin bio et former un apprenti. URVHHOLVHGHODUXH#\DKRRIU


* Sous réserve d’acceptation de votre dossier par la Banque Populaire et la Socama. FNS, Fédération Nationale des Socama, association loi 1901, dont le siège est situé 50, avenue Pierre-Mendès-France - 75013 Paris - Réf. 02/2014 - Crédit Photo : ShutterStock, Thinkstock - Création :Tagora - Impression : Les Éditions de l’Épargne.

COMME DES MILLIERS D’ENTREPRENEURS,

BÉNÉFICIEZ DE LA GARANTIE SOCAMA POUR RÉALISER VOTRE PROJET PROFESSIONNEL EN PROTEGEANT VOTRE PATRIMOINE PERSONNEL*

En partenariat avec www.socama.com

NOUVEL UTILITAIRE PEUGEOT EXPERT

SA MISSION : VOTRE BUSINESS

• Portes latérales coulissantes mains libres* • Banquette Moduwork avec trappe accueillant des charges jusqu’à 4 m de long* • Navigation 3D connectée à commande vocale** • Consommations et émissions les plus basses de sa catégorie*** Consommation mixte (en l/100 km) : de 5,1 à 5,5. Émissions de CO2 (en g/km) : de 133 à 144. * En option selon les versions. ** En série ou option selon les versions. *** Mesure menée en avril 2016 sur des véhicules de même catégorie que le Nouveau Peugeot Expert.

BRESSUIRE - Tél. 05.49.74.20.44


D

ROIT DE SUITE

RĂŠforme de la commande publique

Quels changements pour les TPE ? La rĂŠforme de la commande publique a pris effet au 1er avril 2016, elle vient en prolongement dâ&#x20AC;&#x2122;une rĂŠforme engagĂŠe au plan europĂŠen. Elle est notamment censĂŠe offrir un cadre plus favorable aux PME et TPE. Explications avec lâ&#x20AC;&#x2122;APCMA (AssemblĂŠe permanente des chambres de mĂŠtiers et de lâ&#x20AC;&#x2122;artisanat). BARBARA COLAS

14

Des mesures intĂŠressantes Pour lâ&#x20AC;&#x2122;APCMA, certaines mesures sont KPVČ&#x152;TGUUCPVGU OCKU NC FKHĆ&#x2019;EWNVČ&#x152; TČ&#x152;UKFG dans la mise en Ĺ&#x201C;uvre de celles-ci par les acteurs publics. Tout dâ&#x20AC;&#x2122;abord, ÂŤ tous les acheteurs peuvent passer un marchĂŠ public nĂŠgociĂŠ sans publicitĂŠ prĂŠalable si son montant est infĂŠrieur Ă 25 000 euros Âť (contre 15 000 euros auparavant). Cette mesure est positive mais ĂŠtant donnĂŠ la nĂŠcessitĂŠ de rationaliser la commande publique par souci de restriction budgĂŠtaire, les acteurs vont mutualiser un certain nombre de marchĂŠs. En parallèle, lâ&#x20AC;&#x2122;allotissement, câ&#x20AC;&#x2122;est-Ă -dire le dĂŠcoupage des marchĂŠs publics en lots accessibles aux PME, est censĂŠ devenir la règle pour tous les acteurs. Effectivement, cela favoriserait les petites entreprises mais,

Le Monde des artisans [ septembre/octobre 2016

iĹĄRA2 STUDIO

Lâ&#x20AC;&#x2122;

observatoire des achats publics note que si les PME obtiennent 60 % des marchĂŠs publics, cela correspond uniquement Ă 30 % en valeur. ÂŤ Ce plafond de verre de 30 % est rĂŠellement problĂŠmatique pour les petites entreprises artisanales ĂŠtant donnĂŠ le contexte actuel Âť, explique-t-on Ă  lâ&#x20AC;&#x2122;APCMA. VoilĂ  ce que voudrait faire ĂŠvoluer cette rĂŠforme puisque le gouvernement explique dans son dossier de prĂŠsentation, avoir fait ÂŤ de lâ&#x20AC;&#x2122;amĂŠlioration de lâ&#x20AC;&#x2122;accès des PME Ă  la commande publique lâ&#x20AC;&#x2122;un de ses objectifs prioritaires Âť.

dans les faits, il est rarement appliquĂŠ ; ÂŤ les marchĂŠs sont globalisĂŠs par souci de concentration des ressources Âť.

Une dĂŠmatĂŠrialisation trop peu gĂŠnĂŠralisĂŠe

CrĂŠer des espaces dâ&#x20AC;&#x2122;ĂŠchanges ÂŤ Les acheteurs publics sont dĂŠconnectĂŠs du terrain et nâ&#x20AC;&#x2122;osent plus aller voir les entreprises par crainte dâ&#x20AC;&#x2122;ĂŞtre accusĂŠs de conflits dâ&#x20AC;&#x2122;intĂŠrĂŞts. Âť Lâ&#x20AC;&#x2122;APCMA prĂŠconise la crĂŠation ÂŤ dâ&#x20AC;&#x2122;espaces dâ&#x20AC;&#x2122;ĂŠchanges entre eux et les partenaires ĂŠconomiques pour que le critère du prix ne soit plus le seul qui FRPSWHDͧQGHPHWWUHHQDYDQWODTXDOLWÂŤOHV produits locaux ou encore la main-dâ&#x20AC;&#x2122;Ĺ&#x201C;uvre locale Âť. Le fait que beaucoup de grandes entreprises se soient intĂŠressĂŠes aux marchĂŠs des ÂŤ petites Âť reprĂŠsente un autre frein Ă lâ&#x20AC;&#x2122;accès aux marchĂŠs publics pour les TPE. ÂŤ Les entreprises artisanales se retrouvent sous-traitantes de ces grands JURXSHV¢GHVFRQGLWLRQVͧQDQFLÂŞUHVPRLQV intĂŠressantes. Âť

La rĂŠforme ĂŠvoque la gĂŠnĂŠralisation de la dĂŠmatĂŠrialisation. ÂŤ Une enquĂŞte de PwC sur le soutien de la commande publique aux PME, Ă lâ&#x20AC;&#x2122;innovation et au dĂŠveloppement durable datant de septembre 2015, montre que 90 % des entreprises pointent le cĂ´tĂŠ administratif de la commande publique comme le premier surcoĂťt pour elles. Les dĂŠmarches sont lourdes et compliquĂŠes alors quâ&#x20AC;&#x2122;on ne compte que 5 % des marchĂŠs totalement dĂŠmatĂŠrialisĂŠs, et que les plateformes dâ&#x20AC;&#x2122;accès aux diffĂŠrents marchĂŠs se multiplient. Âť Une autre mesure va dans le bon sens, elle concerne lâ&#x20AC;&#x2122;exigence de chiffre dâ&#x20AC;&#x2122;affaires au stade de lâ&#x20AC;&#x2122;analyse des candidatures. ÂŤ DĂŠsormais, elle LA MĂ&#x2030;DIATION ne peut plus dĂŠpasser deux DES ENTREPRISES fois la valeur estimĂŠe ÂŤ Le rĂ´le de mĂŠdiation des entreprises, Ă  laquelle a ĂŠtĂŠ du marchĂŠ. Âť intĂŠgrĂŠe la mĂŠdiation des marchĂŠs publics, est important pour faciliter les relations entre le "pot de terre" et le "pot de fer". Le taux de rĂŠussite avoisine les 80 %, câ&#x20AC;&#x2122;est très positif. Les artisans ne doivent pas hĂŠsiter Ă  solliciter le mĂŠdiateur. Âť

i

www.economie.gouv.fr/mediateur-des-entreprises


LBC FRANCE, SAS au capital de 3.252.490 euros, RCS Paris 521 724 336. 8, rue Lavoisier – 75008 Paris.

– Illustration : Philippe Derrien.

Avec 2,3 millions de visiteurs uniques sur la catégorie emploi chaque mois*, c’est comme si tout Paris passait devant votre annonce.

Petites ou grandes entreprises, artisans, commerçants, professionnels de l’emploi, nous vous accompagnons chaque jour grâce à deux offres conçues spécialement pour répondre au mieux à tous vos enjeux de recrutement. Le Pack Import Emploi vous permet de diffuser automatiquement vos offres d’emploi puis de gérer leurs mises à jour et la réception des candidatures sur le support de votre choix. Si vous souhaitez déposer manuellement vos offres d’emploi, optez alors pour le Pack Annonces Emploi grâce auquel vous pouvez gérer votre budget en fonction de vos besoins de recrutement.

Pour déposer vos offres d’emploi, rendez-vous sur leboncoin.fr

*Médiamétrie Net Ratings Mars 2016.


E

N IMAGES [ DEUX-SĂ&#x2C6;VRES

UN CROISSANT AU TOP ,/6217)$%5,48Â&#x2039; UN POĂ&#x2C6;ME .GECORWUFGUOČ&#x152;VKGTUFG0KQTVCCEEWGKNNKEGVVGCPPČ&#x152;G

NCUČ&#x152;NGEVKQPTČ&#x152;IKQPCNGFWEQPEQWTUFWk/GKNNGWTETQKUUCPV CWDGWTTGFŨ+UKIP[z:CXKGT&CIWKPGV3WGPVKP4KEJCTF en CAP 2eCPPČ&#x152;GDQWNCPIGTKGCWECORWUFGUOČ&#x152;VKGTUFG0KQTV QPVRCTVKEKRČ&#x152;CWZČ&#x152;RTGWXGUCXGEQP\GCWVTGUECPFKFCVUTČ&#x152;IKQPCWZ

.CEČ&#x152;TČ&#x152;OQPKGFGENČ&#x2013;VWTG du 11e concours de lecture et dâ&#x20AC;&#x2122;ĂŠcriture ÂŤ Fabriquez WPRQČ&#x2039;OGzQTICPKUČ&#x152;RCT le Centre du livre et de la lecture a rĂŠvĂŠlĂŠ les dix textes primĂŠs en mai FGTPKGT2CTOKNGUNCWTČ&#x152;CVU Baptiste Mimaud et AmĂŠlie Moreira, tous deux apprentis au campus FGUOČ&#x152;VKGTUFG0KQTV

COIFFURES DE SAISON 7PGUQKTČ&#x152;GUWTNGVJČ&#x2039;OG

16

des quatre saisons pour NGUJQYQTICPKUČ&#x152;GPCXTKN

DĂ&#x2030;FIONS-NOUS DANS LE BOIS

FGTPKGTRCTNGRČ&#x2013;NGEQKHHWTG du campus des mĂŠtiers de 0KQTVCXGENCRCTVKEKRCVKQP

.GEQPEQWTUFWOGKNNGWTCRRTGPVKFGU&GWZ5Č&#x2039;XTGU

des apprentis en brevet

GPOGPWKUGTKGGVEJCTRGPVGQTICPKUČ&#x152;RCTNC(Č&#x152;FČ&#x152;TCVKQP

professionnel et lâ&#x20AC;&#x2122;ĂŠquipe

dĂŠpartementale des mĂŠtiers du bois au campus des mĂŠtiers

RČ&#x152;FCIQIKSWGRQWTFGU

FG2CTVJGPC[CTČ&#x152;XČ&#x152;NČ&#x152;NGUFKZNCWTČ&#x152;CVU+NUQPVFQPPČ&#x152;NGOGKNNGWT

dĂŠmonstrations, la

FŨGWZOČ?OGURQWTTČ&#x152;CNKUGTWPGVCDNGVVGFŨCPINGRQWTNGUWPU

TČ&#x152;CNKUCVKQPFGEJKIPQPU

GVWPGCTČ?VGFGEJCTRGPVGRQWTNGUCWVTGU

GVWPFČ&#x152;Ć&#x2019;NČ&#x152;JCWVGPEQWNGWT

DĂ&#x2030;FI INTERENTREPRISES DES CHAMPIONNES Ă&#x20AC; LA CMA &GWZČ&#x152;SWKRGUFGEQNNCDQTCVTKEGUFGNC%JCODTG FGOČ&#x152;VKGTUGVFGNŨCTVKUCPCVFGU&GWZ5Č&#x2039;XTGU et ses campus des mĂŠtiers ont dĂŠfendu les couleurs NC2TGOKČ&#x2039;TG'PVTGRTKUGFG(TCPEGČ&#x192;0KQTVGPLWKP FGTPKGTČ&#x192;NŨQEECUKQPFWk&Č&#x152;Ć&#x2019;KPVGTGPVTGRTKUGUz GVNŨWPGFŨGNNGUCTGORQTVČ&#x152;NCFGWZKČ&#x2039;OGRNCEGFG NCEQORČ&#x152;VKVKQPHČ&#x152;OKPKPG

Le Monde des artisans [ septembre/octobre 2016


S

OLUTIONS

Diversifications stratégiques

Qui ne tente rien n’a rien

Jean-Claude Jeanson : « Se marier à un événement local ou mondial a des répercussions exceptionnelles en termes de reconnaissance et de publicité. »

Pâtissier, chocolatier, traiteur, cafetier, Jean-Claude Jeanson est un artisan touche à tout qui prend plaisir à se diversifier par opportunité ou par simple envie. À force de curiosité et d’opiniâtreté, il récolte le fruit de ses intuitions.

C’

išF. MARÉCHAL - STARS & MÉTIERS

ISABELLE FLAYEUX

est l’histoire d’une pâtisserie créée en 1939 à Lens, reprise en 1974 par les époux Jeanson, rachetée par leur fils en 1992. Après avoir découvert le plaisir de

transformer la matière première aux côtés de son père,

Jean-Claude Jeanson part pour un tour de France chez les

L’événementiel comme tremplin

plus grands pâtissiers-chocolatiers en tant qu’ouvrier. Il

En 1996, dès que Lens annonce sa candidature pour ac-

apprend le métier chez Pelletier à Paris, fait escale à Lille

cueillir des matchs de la Coupe du monde de football, Jean-

et passe par Toulouse et Lyon. La retraite approchant, ses

Claude Jeanson dépose à l’INPI la marque Le Mondial. « Le

parents lui vendent le pas-de-porte de la pâtisserie-salon

foot représentait la bonne occasion pour le monde ouvrier

de thé familiale. Une reprise compliquée au départ. « La

de se réunir pour faire la fête et sortir de son quotidien. J’ai

deuxième crise pétrolière ne m’a pas épargné. Mon chiffre

anticipé, persuadé qu’il y avait quelque chose à faire. » Dans

d’affaires a baissé les trois premières années en même temps

son laboratoire, il cherche et crée la pâtisserie

dait », souligne l’artisan qui employait neuf salariés à l’époque.

de l’événement. Parfumé à la chicorée, Le Mondial est décoré de ballons et de la mascotte de l’emblématique

Europa Cake, l'une des dernières créations de Jean-Claude Jeanson, lancée à l'occasion de la Coupe d'Europe de football.

išD R

que le milieu industriel lensois se dégra-

Le Monde des artisans [ septembre/octobre 2016

17


S

OLUTIONS

équipe de foot locale, « une recette bien Cocorico régionale ». Mi-97, alors que la participation de Lens est officialisée, les tournées de repérage des journalistes commencent. Le gâteau signé Jeanson suscite la curiosité et entame un tour du monde médiatique, vecteur de visibilité. Profitant de cette notoriété, l’artisan diversifie son activité et devient traiteur officiel de la Coupe du monde. Les commandes affluent, le chiffre d’affaires monte en flèche. L’expérience marque un tournant dans la vie de l’entreprise. « Ce fut une révélation. Se marier à un événement local ou mondial a des répercussions exceptionnelles en termes de reconnaissance et de publicité. »

De pâtissier à cafetier Après 1998, pour garder les dix-huit cuisiniers embauchés en CDI pour la Coupe du monde, il investit à Béthune dans un ancien hôtel particulier qu’il transforme en espace restauration-traiteur, un lieu de réception prestigieux en cœur de ville. Jamais à court d’idées, Jean-Claude Jeanson se lance en 2014 dans de nouveaux projets. Parallèlement à la mise aux normes accessibilité de ses différents sites, il double la surface de restauration de sa maison-mère à Lens en achetant l’immeuble voisin qui se libère. « 50 % du

18

magasin était vide entre 8 h et 16 h, heure à laquelle commençait la fréquentation du salon de thé. J’avais dynamisé dès 2002 en aménageant un espace de restauration, je n’ai

L'artisan a créé un chocolat pour l'arrivée à Lens de l'antenne du Musée du Louvre, il prend place dans un coffret qui retrace l’histoire de la région et de la ville.

pas hésité à monter à soixante couverts. » La même année, une autre opportunité se présente à lui et le transforme en

dans un coffret qui retrace l’histoire de la région et de la ville

cafetier. « J’ai repris avec grand bonheur un café brasserie

de Lens. Pour célébrer la pose de la première pierre en 2012,

PMU dans le quartier très sympathique des mines, en face

il incruste sur un coffret haut de gamme une pièce en laiton

du Musée Louvre-Lens.»

massif gravée et un timbre daté. L’occasion d’approcher et de découvrir de nouveaux métiers. Pour prolonger le succès

Des créations primées

de ses créations et de ses recherches, l’entrepreneur parti-

Investi dans la vie locale, passionné d’histoire, Jean-Claude

cipe régulièrement à des concours régionaux et nationaux.

Jeanson s’engage dans la candidature du bassin minier au

« Pour attirer les clients, il faut faire parler de soi. Gagner

Patrimoine mondial de l’Humanité à la fin des années 2000

des prix apporte à la fois une certaine reconnaissance et un

et crée un coffret de spécialités accompagné d’un livret, le

enrichissement personnel. » Parmi ses dernières nouveautés,

début d’une longue série. Pour l’arrivée à Lens de l’antenne

on trouve le gâteau Europa Cake sorti pour la Coupe d’Eu-

du Musée du Louvre, il met au point un produit unique,

rope de football et l’ouverture prochaine de deux gîtes de

« un bonbon de chocolat à base de praliné non-allergène et

prestige au dernier étage de son établissement de Béthune.

sans sucre, élaboré avec l’aide d’entreprises agroalimentaires spécialisées dans la recherche. » La gourmandise prend place

i

www.patisserie-jeanson.com

DÉPOSER POUR SE PROTÉGER Avoir des idées c’est bien, les protéger c’est mieux, voire indispensable si vous souhaitez en garder l’exclusivité. Pour éviter d’être copié, vous pouvez vous rapprocher de l’Institut national de la Propriété Industrielle ou INPI. L’organisme accompagne les entreprises qui souhaitent déposer un nom, une marque, une image, un design, une recette ou encore un mode de fabrication. Pour être complet, le dossier peut être accompagné d’une photo.

i

www.inpi.fr

Le Monde des artisans [ septembre/octobre 2016

S


Assurer ses risques professionnels, c’est bien. Être conseillé et accompagné, c’est mieux !

Notre métier : assurer le vôtre Contactez-nous vite au 01 45 71 83 30

Découvrez toutes nos solutions d’assurance de personnes (dirigeants et salariés), de biens professionnels et d’activités.

www.groupe-sma.fr

SMABTP15 artisan OK indd 1

SMA SA, société anonyme à directoire et conseil de surveillance, entreprise régie par le Code des assurances, au capital de 12 000 000 € õ,ăñÄõ“ăʯʯʹʕƶȳˎʹȳȴȊǣȴʁˁƬĴǔɁǚƬǜȊʕǣʕʹǮñŘʁǔʊ,ƬƞƬ˾ɍǣ

Crédits photos : stevecoleimages- Tetra images / Février 2016 – PB0923 -

Avec SMABTP, à chaque métier son contrat sur mesure et son conseiller spécialisé. Votre conseiller expert vous recommande PPAB Activité qui couvre tous les risques des artisans en un seul contrat : responsabilité décennale et civile, dommages en cours de travaux, protection juridique et individuelle accidents. Votre couverture d’assurance évolue au rythme de votre entreprise en fonction de son ancienneté et de sa sinistralité. Et parce que chaque profession est unique, nous déclinons nos solutions d’assurance par métier depuis près de 160 ans.

09/02/2016 17:03


FREELANCES

EN SOLO? VENEZ TROUVER DES RÉPONSES À VOTRE SOIF D’INDÉPENDANCE. En partenariat avec :

#SalonSME

Pour les entrepreneurs, les indépendants et tous les audacieux !

4, 5 et 6 octobre 2016 5EPEMWHIW(SRKV²Wƽ5EVMW Votre invitation gratuite sur www.salonsme.com {±ųƋåűĜųåŸkþÏĜåĬŸ

Partenaires Médias

.../en Personne 360 - RCS B 408 684 389 - Mars 2016

COMMENT REUSSIR


T

RANSMETTRE

Apprentissage

Un champ de vision ĂŠlargi AU COMMENCEMENT Ă&#x2030;TAIT Lâ&#x20AC;&#x2122;AGRICULTURE. ET PUIS IL Y EUt LA BOULANGERIE. AVOIR UNE VISION GLOBALE DE LA FILIĂ&#x2C6;RE QUI RĂ&#x2030;UNIT CES DEUX SAVOIR-FAIRE EST POUR LES APPRENTIS, SELON DENIS BRICHET â&#x20AC;&#x201C; BOULANGER ET PRĂ&#x2030;SIDENT DU CFA INTERPROFESSIONNEL DE CHARTRES - UN ATOUT CONSIDĂ&#x2030;RABLE. DES PASSERELLES ONT DONC Ă&#x2030;TĂ&#x2030; CONSTRUITES ENTRE DEUX CENTRES DE FORMATION QUI LES ENSEIGNENT. SOPHIE DE COURTIVRON

M

es apprentis parti-

formation et des cultures expĂŠrimentĂŠes

Un enrichissement mutuel

cipent Ă lâ&#x20AC;&#x2122;ensemble

dans le lycĂŠe agricole, ÂŤ les jeunes ont

Pour les apprentis boulangers, il sâ&#x20AC;&#x2122;agit de

des tâches de lâ&#x20AC;&#x2122;entre-

conduit les apprentis en BP boulangerie

comprendre la matière première utilisÊe,

prise, auprès de toute

jusquâ&#x20AC;&#x2122;Ă la ferme pĂŠdagogique oĂš ils ont

dâ&#x20AC;&#x2122;apprendre comment on prĂŠpare un sol,

lâ&#x20AC;&#x2122;ĂŠquipe ; câ&#x20AC;&#x2122;est comme ça que lâ&#x20AC;&#x2122;on obtient les

pu rencontrer le chef dâ&#x20AC;&#x2122;exploitation et dĂŠ-

comment on le sème ;  faire du blÊ, ce

meilleures compĂŠtences Âť, explique Denis

couvrir le matĂŠriel servant Ă lâ&#x20AC;&#x2122;entretien des

nâ&#x20AC;&#x2122;est pas planter et laisser pousser. Cette

Brichet, boulanger-pâtissier et prÊsident

terres et Ă la culture du blĂŠ Âť. Les

du CFA interprofessionnel de Chartres.

minoteries Viron accueillent

Cette transversalitĂŠ, on la retrouve dans

aussi les deux classes aďŹ n de

les passerelles quâ&#x20AC;&#x2122;il a crĂŠĂŠes voilĂ huit ans

leur expliquer le processus

Les Êlèves en agriculture, eux,

entre son CFA et le lycĂŠe gĂŠnĂŠral, technique

de transformation du blĂŠ

ÂŤ peuvent ainsi mieux connaĂŽtre

et professionnel de la Saussaye. Les jeunes

en farine ; elles restituent

les attentes de la personne en bout

boulangers du CFA (en brevet professionnel

ensuite la farine au CFA et

de chaĂŽne, choisir la bonne va-

boulangerie) sont initiĂŠs aux semis, Ă la

les Êlèves viennent y faire du

riĂŠtĂŠ de blĂŠ, adapter le traitement

rĂŠcolte, tandis que les jeunes futurs agricul-

pain. ÂŤ Câ&#x20AC;&#x2122;est une dĂŠcouverte

de la cultureâ&#x20AC;Ś Âť, poursuit De-

teurs (en bac pro CGEA, conduite et gestion

pour les Êlèves en agriculture ! ,

de lâ&#x20AC;&#x2122;exploitation agricole) se rendent dans

constate Denis.

ÂŤ

annĂŠe par exemple fut mĂŠdiocre, il y a eu trop dâ&#x20AC;&#x2122;eauâ&#x20AC;Ś Ils doivent en avoir conscience Âť.

nis. ÂŤ Nous constatons que ces ĂŠchanges concrets

les fournils... Ce partenariat ÂŤ Du blĂŠ au

entraĂŽnent souvent des

pain Âť se fonde sur une convention signĂŠe

discussions à bâtons

entre le CFA, le lycĂŠe de la Saussaye et la

rompus ! Peut-ĂŞtre

minoterie Viron pour deux annĂŠes consĂŠ-

que demain nos

cutives. ÂŤ Trois sorties pĂŠdagogiques sont organisĂŠes entre les groupes dâ&#x20AC;&#x2122;ĂŠtudiants... Cela suppose des contacts rĂŠguliers entre les professeurs engagĂŠs dans le projet Âť, prĂŠcise Denis Brichet. Lors du premier trimestre 2016, après un exposĂŠ très dĂŠtaillĂŠ de leur

21

jeunes travaille-

Denis Brichet, 46 ans, a formĂŠ 53 apprentis depuis sa première affaire, en 1997. ÂŤ Sept dâ&#x20AC;&#x2122;entre eux ont ĂŠtĂŠ meilleurs apprentis du dĂŠpartement. Âť

ront ensemble via une ďŹ lière blĂŠ-farine-pain locale ? Âť Cette dĂŠmarche pĂŠdagogique pourrait ĂŞtre

transposable Ă

dâ&#x20AC;&#x2122;autres secteurs artisanaux : boucherie

8QSDUWHQDULDWSULPÂŤ

et ĂŠlevage, etc. La vi-

Lâ&#x20AC;&#x2122;UNION FAIT LA FORCE

tendant vers un seul iĹĄFRĂ&#x2030;DĂ&#x2030;RIC PAQUET

/H&)$LQWHUSURIHVVLRQQHOHWOHO\FÂŤHJÂŤQÂŤUDOWHFKQR DJULFROHGH&KDUWUHVRQWSDUWLFLSÂŤHQVHPEOHHQ DXFRQFRXUVQDWLRQDOm&KDPSVHWO\FÂŤHV}axĂŠ sur les pratiques de lâ&#x20AC;&#x2122;agriculture durable,OVRQWWUDYDLOOÂŤVXU ODFXOWXUHGXEOÂŤWHQGUHHQDJULFXOWXUHELRORJLTXHOHXUWUDYDLO intitulĂŠ Le pain bio, avenir ou utopieDREWHQXOHSUHPLHUSUL[

sion globale acquise objectif : la qualitĂŠ.

i www.cfainterpro28.fr/ www.legta.chartres.educagri.fr/

Le Monde des artisans [ septembre/octobre 2016


I

NNOVER

Le design

22 22

S’intéressant aux usages, aux tendances et aux contraintes actuels et futurs, le design est sans conteste un outil intéressant à la disposition des artisans. Collaborer avec un designer pour repenser sa communication, son produit, sa boutique… toutes les possibilités sont envisageables pour répondre au mieux aux attentes de ses clients et se démarquer de la concurrence.

Balmera, le balcon qui apporte de l’espace habitable supplémentaire à un bâtiment et augmente la qualité de vie de ses habitants.

BARBARA COLAS

i

Le témoignage

«

J’

www.hanssen.fr | tamimdaoudi.com

ai rencontré le designer

té doté d’un récupérateur d’eau de pluie,

Donnant-donnant

Tamim Daoudi par l’in-

« Balmera ». Pour ce projet, il demande le

Si l’artisan propose du travail au designer,

termédiaire d’un de mes

concours de Tamim Daoudi.

ce dernier lui apporte aussi des projets. « Il a

prestataires. Il s’intéressait

dessiné des luminaires que j’ai réalisés. C’est

aux objets métalliques », explique Christian

Se différencier

une relation donnant-donnant, lorsque je

Hanssen, artisan métallier basé à Stras-

« Le design est un moyen de se différencier,

vends nos créations, je lui verse une quote-

bourg. « Nous avons rapidement travaillé

de proposer un produit plus adapté aux

part. » Christian Hanssen admet que faire

ensemble sur une gamme de mobilier de-

clients. Il prend en compte l’ergonomie,

intervenir un designer représente un surcoût

sign. » Si le modèle « Fold » qu’ils réalisent

l’usage du produit », confie le métallier.

mais « tout dépend de la demande du client,

n’est pas commercialisé, il reçoit après un

Avec l’intégration de table et rangements

on peut être dans le sur-mesure. Certains

passage à la Paris Design Week, le prix

dépliables, le designer a fait de Balmera

pensent que le design c’est du " beau " mais

Tango Escale de la ville de Strasbourg.

un balcon « multifonction ». « J’ai réfléchi

cela permet surtout de faciliter l’usage, d’aller

Enthousiasmés, ils persévèrent et créent

aux usages et en allant voir les bailleurs

au plus simple ». « Le designer n’a pas la science

des modèles de bancs et de chaises à base

sociaux, j’ai constaté que les balcons deve-

infuse, c’est un caméléon qui doit s’adapter

de tubes cintrés. « Ils ont été exposés par un

naient rapidement une zone de stockage à

à un matériau ou au process de fabrication,

galeriste au Miami Art Basel. Il y a eu des

défaut d’avoir des dispositifs de rangement.

au développement de nouveaux usages, de

publications sur l’exposition et des prises

J’ai donc imaginé un balcon fonctionnel,

nouveaux produits », ajoute Tamim Daoudi.

de contacts pour des ventes en France. » En

modulable et personnalisable », explique

« Cette expérience m’a fait évoluer, je suis plus

parallèle, Christian Hanssen dépose un

Tamim Daoudi. Le produit a été récom-

ouvert d’esprit, plus attentif à comment les

brevet pour un balcon métallique rappor-

pensé par l’Observeur du design 2016.

choses ont été faites », conclut l’artisan.

Le Monde des artisans [ septembre/octobre 2016

išDR

Cerner les attentes des clients


INNOVER [ LE DESIGN

L'enquĂŞte

 Grâce au design, iťBLACKZHEEP

lâ&#x20AC;&#x2122;artisan regarde

Quâ&#x20AC;&#x2122;est-ce que le design ? Que peut-il apporter Ă lâ&#x20AC;&#x2122;artisan ? Quelques ĂŠlĂŠments de rĂŠponse avec StĂŠphane Salord, directeur de lâ&#x20AC;&#x2122;ESDAC (Ă&#x2030;cole supĂŠrieure de Design, dâ&#x20AC;&#x2122;Arts appliquĂŠs et de Communication, implantĂŠe Ă  Aix, Marseille et Montpellier) et Anne-Marie Boutin, prĂŠsidente de lâ&#x20AC;&#x2122;APCI (Agence pour la promotion de la crĂŠation industrielle).

prĂŠsidente de lâ&#x20AC;&#x2122;APCI (Agence pour la promotion

ÂŤ Il faut que lâ&#x20AC;&#x2122;artisan ait envie dâ&#x20AC;&#x2122;avancer et dâ&#x20AC;&#x2122;explorer de nouvelles pistes Âť

de la crĂŠation industrielle). ÂŤ Contrairement aux

ÂŤ Grâce Ă ce type de collaboration, lâ&#x20AC;&#x2122;artisan regarde

idĂŠes reçues, le designer nâ&#x20AC;&#x2122;est pas un artiste refer-

son travail dâ&#x20AC;&#x2122;une autre manière, a une attitude

ÂŤ Le design est une approche qui part du terrain,

iĹĄDR

des individus Âť, explique Anne-Marie Boutin,

mĂŠ sur sa personne, il collabore avec les autres

plus crĂŠative Âť, conďŹ e Anne-Marie Boutin, ÂŤ et

et son environnement Âť, aďŹ&#x192;rme de son cĂ´tĂŠ,

cela quel que soit son mĂŠtier, il faut simplement

StĂŠphane Salord, directeur de lâ&#x20AC;&#x2122;ESDAC (Ă&#x2030;cole

accepter dâ&#x20AC;&#x2122;associer les idĂŠes des autres avec les

supĂŠrieure de Design, dâ&#x20AC;&#x2122;Arts appliquĂŠs et de

siennes Âť. Cependant, trouver le designer avec

Communication).

qui lâ&#x20AC;&#x2122;on a envie de travailler nâ&#x20AC;&#x2122;est pas chose aisĂŠe. ÂŤ Le designer doit, de son cĂ´tĂŠ, respecter le travail

Une ouverture dâ&#x20AC;&#x2122;esprit

de lâ&#x20AC;&#x2122;artisan, il faut que chacun valorise lâ&#x20AC;&#x2122;autre.

ÂŤ Le design dĂŠcloisonne le milieu de lâ&#x20AC;&#x2122;artisanat.

Sâ&#x20AC;&#x2122;il envisage une dĂŠmarche dâ&#x20AC;&#x2122;innovation, lâ&#x20AC;&#x2122;artisan

Lâ&#x20AC;&#x2122;idĂŠe est de partir dâ&#x20AC;&#x2122;un savoir-faire et dâ&#x20AC;&#x2122;une sol-

peut ĂŠgalement intĂŠgrer le design Ă sa rĂŠďŹ&#x201A;exion,

licitation nouvelle du public pour se distinguer

tout simplement Âť, ajoute la prĂŠsidente de lâ&#x20AC;&#x2122;APCI.

des solutions industrielles normatives Âť, dĂŠtaille StĂŠphane Salord. Pour le directeur de lâ&#x20AC;&#x2122;ESDAC,

Mieux se diffĂŠrencier

câ&#x20AC;&#x2122;est un rapprochement ÂŤ naturel Âť : ÂŤ Designer et

ÂŤ Si lâ&#x20AC;&#x2122;artisan veut se renouveler rĂŠgulièrement, se

artisan sont cousins. Ă&#x20AC; lâ&#x20AC;&#x2122;origine, ce sont les mĂŞmes

distinguer de la concurrence, le design est lâ&#x20AC;&#x2122;outil

personnes. Lâ&#x20AC;&#x2122;artisan du XIXe siècle combinait toutes

parfait Âť, souligne StĂŠphane Salord. ÂŤ Pour lâ&#x20AC;&#x2122;instant,

leurs compĂŠtences respectives. Lâ&#x20AC;&#x2122;industrialisation

de notre cĂ´tĂŠ, on est uniquement sollicitĂŠ par certains

a changĂŠ la donne et la nĂŠcessitĂŠ de produire en

secteurs : les mĂŠtiers de bouche, lâ&#x20AC;&#x2122;ameublement,

masse a cantonnĂŠ certains artisans dans des rĂ´les

lâ&#x20AC;&#x2122;amĂŠnagement intĂŠrieur et la mode. Âť Mais ÂŤ de

dâ&#x20AC;&#x2122;assembleurs Âť. Anne-Marie Boutin le rejoint sur

plus en plus de branches sâ&#x20AC;&#x2122;y intĂŠressent Âť, complète

lâ&#x20AC;&#x2122;ouverture dâ&#x20AC;&#x2122;esprit que propose le design : ÂŤ Il

Anne-Marie Boutin. Puisquâ&#x20AC;&#x2122;il prend en compte

va aider lâ&#x20AC;&#x2122;artisan Ă se poser des questions diďŹ&#x20AC;ĂŠ-

les contraintes actuelles, les nouvelles tendances

remment. Le design permet Ă des gens qui ont

mais ĂŠgalement les besoins des utilisateurs, le

des langages, des cultures diďŹ&#x20AC;ĂŠrentes de commu-

design peut permettre Ă lâ&#x20AC;&#x2122;artisan de conquĂŠrir de

niquer entre eux puisquâ&#x20AC;&#x2122;il propose des langages

nouveaux marchĂŠs mais ĂŠgalement de rĂŠinventer

non verbaux Âť.

en partie son mĂŠtier.

son travail dâ&#x20AC;&#x2122;une autre manière, a une attitude plus crĂŠative ÂťFRQČ´H $QQH0DULH%RXWLQ prĂŠsidente de lâ&#x20AC;&#x2122;APCI.

23

ÂŤ Si lâ&#x20AC;&#x2122;artisan veut se renouveler rĂŠgulièrement, se distinguer de la concurrence, le design est lâ&#x20AC;&#x2122;outil parfait Âť, souligne StĂŠphane Salord.

i

www.apci.asso.fr | ecole-esdac.com

Le Monde des artisans [ septembre/octobre 2016


INNOVER [ LE DESIGN

Les chiffres En Île-de-France, Faites-vous accompagner par Le lieu du design Le Lieu du design, créé par la région Île de France, propose aux entreprises des conseils, une analyse des besoins, une sensibilisation au design et un accompagnement de projets innovants dans une stratégie globale de développement d’entreprise. Plusieurs chefs de projet peuvent répondre à ces questions : « Quelle agence de design ou quel designer indépendant choisir ? Où trouver l’équipe projet susceptible d’accompagner l’entreprise et/ou le designer à l’occasion de son intervention (bureau d’études, prestataires recherche & développement, industriels) ? À qui appartiennent les résultats ? Combien coûte un prototype ? Quels sont les moyens de protection (secret, dessins et modèles, marques, brevets…) ? Comment intégrer l’éco-conception dans le développement d’un produit ou d’un service ? Comment identifier

« Au-delà de l’approche traditionnelle de l’innovation, guidée par la technologie, l’approche de l’innovation par le design cherche à conjuguer ce qui est désirable du point de vue du consommateur avec ce qui est techniquement faisable et économiquement viable. » Source : site web de l'APCI

les aides et financements ? » Il propose également un annuaire de designers en ligne.

i

24

40 000

www.lelieududesign.com

DesignerS et artisans en Alsace IDeE est une association à but non lucratif engagée dans la promotion du design ayant pour but « de favoriser la démarche

Il existe 40 000 designers en France dont un tiers travaille pour l’industrie

10

design dans les entreprises ». Composée de 12 designers, elle initie des collaborations entre artisans, industriels et designers sous la forme de groupes de travail afin de valoriser le

http://designers.alsace

i

« La Delo Box, produit prospectif de valorisation du camembert de Normandie, a été réalisée à l’occasion du concours du Meilleur Ouvrier de France 2015 par l’agence de design L’Accent du m pour l’artisan fromager Théo Michel. Prévue pour accueillir un camembert et huit morceaux de pain, la Delo Box, vecteur de communication, n’a pas vocation à être fabriquée en série. »

www.commercedesignlille.fr

14

étudiants

14 étudiants sélectionnés pour la première promotion de la licence professionnelle Artisan designer, feront leur rentrée à Montauban le 16 septembre prochain. Cette formation, unique en France et financée par la Région Occitanie / Pyrénées-Méditerranée via le Fonds social européen (FSE), est construite sur des croisements et articulations disciplinaires (artisanat, design et numérique), pédagogiques (atelier de conception et chantier de fabrication) et institutionnels (Université, CMA Tarn-etGaronne, CFA). « L’objectif est de former un type nouveau de designer autant que d’enrichir le savoir-faire artisanal par les outils pratiques et conceptuels du design. »

i

Le Monde des artisans [ septembre/octobre 2016

réalisations exemplaires

C’est le nombre de réalisations que récompense le concours « Commerce Design Lille ». L’objectif : donner de la visibilité aux commerçants innovants et dynamiques ayant intégré la problématique du design dans le fonctionnement de leur point de vente et ceci afin de booster leurs affaires, rendre les zones de commerce plus attirantes pour les clients et les touristes, concourir à améliorer le cadre de vie.

savoir-faire de ces entreprises.

i

designers

www.cma82.fr


R

ÉUSSITE

KOOKABARRA

Fruit de l’innovation Spécialisée dans la fabrication de jus de fruits longue conservation et de produits du petit-déjeuner, l’entreprise de Jérémie Marcuccilli a su séduire des professionnels renommés. La clé ? Une stratégie basée sur l’innovation, les circuits courts et la qualité des produits.

išPHOTOS DR

SAMIRA HAMICHE

UN PROCÉDÉ INÉDIT L’aventure Kookabarra démarre en 2006. De

Kookabarra, dont le nom fait référence à un oiseau d’Australie, apporte un soin particulier à son image : logo percutant, packagings esthétiques…

retour d’Australie, Jérémie Marcuccilli veut

OBJECTIF ZÉRO STOCK Application, site web : le digital facilite les circuits courts. « Aujourd’hui, on va pouvoir

ouvrir des bars à jus de fruits. « Un univers

DIVERSIFICATION RÉUSSIE

créer des jus de fruits à la semaine et aver-

bio et bien-être », qui plaît au jeune diplômé

Pour Jérémie Marcuccilli, « qualité » ne rime

tir en direct nos clients dans la minute. »

en management. Il va finalement plus loin.

pas forcément avec « luxe » « En se positionnant

Cette commercialisation directe « n’a pas

À l’aide du Centre technique agroalimen-

ainsi, on se coupe d’une frange de la population.

de prix », estime le chef d’entreprise, qui

taire (CTCPA), il développe un procédé de

Or, l’objectif de Kookabarra reste avant tout

travaille à flux tendu. Chez lui, pas ou peu

conservation longue durée (14 jours). Breve-

de proposer au plus grand nombre des pro-

de stock ! Tout est fait sur commande et en

té, il est appliqué à des jus de fruits pressés,

duits d’excellence à prix raisonnable : nectars,

ligne (documents dématérialisés).

sans adjuvant. « Nous sommes partis sur

confitures, miels, fruits coupés. Et ce, grâce à

Aidé par la CMA, Jérémie Marcuccilli veut

quelque chose de totalement innovant, qui

un haut standard qualité. » Pour répondre au

assurer à son équipe des emplois pérennes

répondait à un besoin précis des hôteliers

besoin des clients, Kookabarra a développé une

et une perspective d’évolution. « Les petites

et des consommateurs. La DLC de 14 jours

gamme pour le petit-déjeuner. Le dénomina-

entreprises ne sont rien sans les hommes

permettait un confort d’utilisation inédit. »

teur commun : le sourcing toujours qualitatif

qui la font vivre. C’est le b.a.-ba de notre

Avec, en prime, la praticité : « au lieu d’uti-

des produits. Le volume brassé par l’entreprise

métier, ce pour quoi on se bat. Chaque jour,

liser des bouteilles plastique, nous avons

artisanale est impressionnant : « on a la capa-

je demande à mes équipes de sans cesse

consigné nos jus de fruits en Bag-in-Box ® »,

cité de traiter 3 tonnes de matières premières à

innover et d’aller de l’avant ! »

un emballage qui protège de la lumière et

l’heure ». Cette performance, Kookabarra la

de l’oxydation. La marque conquiert vite

doit notamment à un investissement récent

cafés, hôtels et restaurants haut de gamme.

de plus d’1 million d’euros.

i

25

www.kookabarra.com

LES CONSEILS DE JÉRÉMIE MARCUCCILLI • Croire en son projet,CƒPSWŨKNCDQWVKUUG« Il faut être intimement convaincu, car on va y passer ses jours et ses nuits. » Y croire permet aussi de fédérer autour de soi. • Ne jamais cesser de se former. « Un chef d’entreprise doit toujours s’intéresser, aller chercher les compétences qu’il lui manque. » • Garder un temps d’avance. Anticiper permet de suivre les nouvelles tendances et les nouveaux usages

Le Monde des artisans [ septembre/octobre 2016


TRATÉGIE

iš FRANÇOIS MARÉCHAL - STARS & MÉTIERS

S

Pour l’équipe Uni-Vert, les jardins sont aussi bien des lieux de rencontre avec les autres qu’avec soi-même.

Uni-Vert SARL

Le jardinier philosophe išFRANÇOIS MARÉCHAL

26

Dominique Szulc a été récompensé en 2015 par le prix Stars & Métiers, dans la catégorie Management des ressources humaines.

Il a su „ Gagner en réputation grâce à des créations atypiques, uniques, inspirées

Établi au cœur de l’Alsace depuis 1980, Dominique Szulc conçoit et arrange des jardins. Mieux, il les révèle à eux-mêmes… Attentif à la voix du végétal comme à celle de l’humain, l’artisan a choisi son credo : une entreprise pour la création d’espaces de nature justes et apaisés passe aussi par le bien-être de ses salariés. MÉLANIE KOCHERT

B

êcher, planter, arroser… On

féru de vie en extérieur, aujourd’hui âgé

peut faire un jardin en se

de 60 ans. À Richwiller, le dirigeant d’Uni-

contentant de cela. Ou aller

Vert a trouvé son « lieu idéal ». Dans cette

plus loin. Le penser, le rêver,

petite commune alsacienne dotée d’une

comprendre l’agencement de nature, ses

« forte émulation », l’entreprise est pérenne,

racines et ses expressions, ses variations

et collabore régulièrement « avec d’autres

liées à l’espace, au climat, aux êtres desti-

artisans du cru » : granitiers, ferronniers…

nés à l’investir. L’histoire de Dominique Szulc emprunte ce chemin. L’histoire

Oser le végétal

d’un homme animé par la profondeur du

Mais où se niche donc le plaisir de Domi-

„ Favoriser un management d’entreprise humaniste

concept « jardin » qui s’est installé, voilà

nique en tant que concepteur d’espace ?

36 ans, en tant qu’artisan paysagiste dans

Tout se joue, explique l’intéressé, « dans la

„ Établir des partenariats avec d’autres artisans de sa commune

le Haut-Rhin. Sachant de façon intuitive

recherche d’une cohérence » entre l’archi-

que ce métier le passionnerait toute sa vie...

tecture, le paysage alentour et le mode de

Les années n’ont rien démenti. « C’est

vie des individus qui s’adressent à lui. « On

toujours un plaisir de se lever tous les

est là pour que le lieu qu’on nous confie

matins pour aller travailler », assure ce

devienne vivant, expressif. Notre vocation

„ Se remettre en question pour apprendre à déléguer

„ Voyager à l’étranger pour nourrir sa culture du jardin de traditions emblématiques

Le Monde des artisans [ septembre/octobre 2016


sera de le rĂŠvĂŠler Ă lui-mĂŞme. Âť Cultivant sa rĂŠputation dâ&#x20AC;&#x2122;entreprise crĂŠative, UniVert tend Ă  mettre en Ĺ&#x201C;uvre des chantiers ÂŤ atypiques, personnels, innovantsâ&#x20AC;Ś Âť. Avec un objectif : donner la primeur au vĂŠgĂŠtal. ÂŤ Une tendance qui se perd Âť, estime lâ&#x20AC;&#x2122;artisan. ÂŤ On a tendance Ă  croire, aujourdâ&#x20AC;&#x2122;hui, que le minĂŠral structure un jardin. Or, câ&#x20AC;&#x2122;est bien le vĂŠgĂŠtal qui en construira lâ&#x20AC;&#x2122;âme. Nous essayons donc de mettre celui-ci Ă  lâ&#x20AC;&#x2122;honneur, avec des gestes lisibles, dans iĹĄPHOTOS : DR

un contact privĂŠ, intime avec la nature. Âť

Esprit dâ&#x20AC;&#x2122;ĂŠquipe Le travail ne se faisant jamais aussi bien quâ&#x20AC;&#x2122;Ă plusieurs, Dominique Szulc sâ&#x20AC;&#x2122;est

ĂŠquipe oĂš chacun peut, doit se rĂŠvĂŠler.

entourĂŠ dâ&#x20AC;&#x2122;une ĂŠquipe ďŹ dèle et engagĂŠe.

ÂŤ Notre objectif est dâ&#x20AC;&#x2122;apporter de la joie

ÂŤ Le personnel dâ&#x20AC;&#x2122;Uni-Vert est entièrement

et du bien-ĂŞtre Ă nos clients Ă  travers les

composĂŠ dâ&#x20AC;&#x2122;ex-apprentis que nous avons

jardins. Mais pour en arriver Ă ce rĂŠsultat, il

gardĂŠs comme employĂŠs. Âť Lâ&#x20AC;&#x2122;aĂŽnĂŠ de la

est tout aussi important que les personnes

bande, Bruno, a dĂŠjĂ 27 ans dâ&#x20AC;&#x2122;anciennetĂŠ.

qui travaillent expĂŠrimentent elles-mĂŞmes

ÂŤ Je suis heureux car je crois avoir rĂŠussi Ă

cette joie au quotidien. Le chemin est tout

les emmener tous avec moi dans la passion

aussi important que le but que nous pour-

du jardin et nourrir leurs intĂŠrĂŞts Ă travers

suivons. Âť Lâ&#x20AC;&#x2122;artisan paysagiste a choisi de

notre activitĂŠ. Âť DistinguĂŠ pour sa politique

faire de cette maxime une rĂŠalitĂŠ. ÂŤ Au-

managĂŠriale par le Prix Stars & MĂŠtiers

jourdâ&#x20AC;&#x2122;hui, on ne peut plus passer outre

2015*, le dirigeant fait en eďŹ&#x20AC;et grand cas

lâ&#x20AC;&#x2122;individu dans le monde professionnel.

de ses employĂŠs et de leur bien-ĂŞtre au

Et sa reconnaissance ne va pas Ă lâ&#x20AC;&#x2122;encontre

sein de lâ&#x20AC;&#x2122;entreprise. ÂŤ Chacun est ici recon-

du bon fonctionnement de lâ&#x20AC;&#x2122;entreprise, au

nu pour ce quâ&#x20AC;&#x2122;il est, et ce quâ&#x20AC;&#x2122;il fait. Il nâ&#x20AC;&#x2122;y

contraire ! Âť Dominique Szulc se sent re-

a pas de rivalitĂŠ, dâ&#x20AC;&#x2122;esprit de compĂŠtition.

connaissant. ÂŤ Cette prise de conscience

Jâ&#x20AC;&#x2122;aime lorsque je peux leur donner le re-

lĂ , je la dois Ă  mes gars. Âť

lais pour que des histoires, des projets de jardin sâ&#x20AC;&#x2122;inventent et deviennent rĂŠalitĂŠ. Âť Chez Uni-Vert, chaque chef de projet est responsable et rĂŠalise son chantier de A

27

* Dossier prĂŠsentĂŠ par la Chambre de mĂŠtiers et de lâ&#x20AC;&#x2122;artisanat dâ&#x20AC;&#x2122;Alsace et la Banque Populaire Alsace Lorraine Champagne.

i

http://uni-vert.fr

Ă Z. ÂŤ On prend le temps de faire en sorte que le personnel soit polyvalent, sache tout faire. Câ&#x20AC;&#x2122;est gratiďŹ ant pour tout le monde...

UNE MATIĂ&#x2C6;RE VIVANTE

Et en plus, cela fonctionne. Âť

Dominique Szulc nâ&#x20AC;&#x2122;a pas toujours fonctionnĂŠ comme cela. Il le sait. ÂŤ Avant, il fallait que je contrĂ´le tout. Puis un jour, on se demande : mais pour qui te prendstu ? Âť Introspection et moment de bascule. ÂŤ Lorsque lâ&#x20AC;&#x2122;on rĂŠalise que lâ&#x20AC;&#x2122;on a en face de soi des individus brillants, qui ont des idĂŠes et vous rappellent quâ&#x20AC;&#x2122;ils peuvent les partager Âť, quelque chose changeâ&#x20AC;Ś Le

iĹĄDR

Plus que le but, le chemin

3HQVHUXQMDUGLQFČ&#x201E;HVWOXLGRQQHUXQH GLPHQVLRQGDQVOČ&#x201E;HVSDFHHWGDQVOH WHPSV4XHOOHGHQVLWÂŤYÂŤJÂŤWDOHIHUD ressentir au mieux lâ&#x20AC;&#x2122;intensitĂŠ dâ&#x20AC;&#x2122;un HVSDFHSHWLWRXJUDQG"(WFRPPHQW SUÂŤYRLUVRQGÂŤYHORSSHPHQW"ÂŤ Un jardin est vivant. Quand il est terminĂŠ, RĂŞver le jardin puis lui donner vie sur le papier : câ&#x20AC;&#x2122;est lĂ que tout commence. Il change, une première ĂŠtape essentielle. il ĂŠvolue... On lâ&#x20AC;&#x2122;accompagne mais on ne maĂŽtrise pas totalement ce qui va se passer. Âť/DVXUSULVHIDLWSDUWLHGXMHX ÂŤ Le tout HVWGHELHQUÂŤČ?ÂŤFKLUHQDPRQWSRXUSODFHUOHERQYÂŤJÂŤWDODXERQHQGURLW8QMDUGLQELHQ construit tiendra la route sur 20 ans, 25 ans, 30 ans. Cela ne trompe pas ! Âť

gĂŠrant comprend : une entreprise est une

Le Monde des artisans [ septembre/octobre 2016


D

OSSIER

COMMUNICATION

Travaillez votre différence !

28

VOUS L’IGNOREZ MAIS… VOUS ÊTES À LA MODE. L’ARTISANAT RÉPOND AUX TENDANCES DE CONSOMMATION ACTUELLES : ÉCO-RESPONSABILITÉ, AUTHENTICITÉ, PROXIMITÉ… POUR LE FAIRE-SAVOIR, IL FAUT AGIR. COMMENT BIEN COMMUNIQUER ? DES ARTISANS DE TOUs SECTEURs TÉMOIGNENT ICI, AINSI QUE DES EXPERTS LES AYANT ACCOMPAGNÉS. ILS ONT COMPRIS QU’AUJOURD’HUI LA COMMUNICATION ÉTAIT INÉVITABLE. VOUS VOUS CROYEZ EXEMPTÉ ? DÉTROMPEZVOUS…

L’ébéniste Frédéric Volpon (à gauche) fait découvrir à ses invités les placages de sa cave à bois lors de la matinale de l’« Instant Volpon », un événement qu’il a organisé en juin dernier.

Le Monde des artisans [ SEPTEMBRE/OCTOBRE 2016

išTHIERRY TIJERAS

SOPHIE DE COURTIVRON

L

es artisans croient que leur sa-

contre l’oubli. « La chaîne commerciale,

voir-faire parle pour eux et à

c’est comme la chaîne du froid : il ne faut

travers eux, mais… c’est faux.

jamais la rompre, même si l’entreprise

De plus, « ce n’est pas une va-

tourne », ajoute Laurent Kollen, directeur

leur sûre d’avoir son carnet de commandes

conseil au sein de l’agence Portobello. « Si

plein. Beaucoup d’artisans se reposent sur

quelqu’un de votre village refait son toit,

leurs lauriers (renommée de l’entreprise

il faut que vous soyez dans les entreprises

familiale, etc.), mais la concurrence des

sélectionnées ; pour cela, un seul moyen :

nouveaux métiers et méthodes de travail

une présence régulière. » Comment ? En

implique une remise en question perma-

investissant dans une communication

nente ! », avertit Véronique Martin, direc-

efficace fondée sur votre unicité, mise

trice de l’agence Presstance. Le consom-

en avant grâce à une aide extérieure qui

mateur est en outre tellement sollicité

aura le recul que vous n’avez pas. Voici

que l’artisan doit en permanence lutter

quelques exemples.


DOSSIER [ COMMUNICATION

1. artisanat d'art &RULQQH+DOOLH] FUÂŤDWULFHGHELMRX[ +DXWVGH6HLQH

ÂŤ Jâ&#x20AC;&#x2122;AI APPRIS Ă&#x20AC; SUSCITER Lâ&#x20AC;&#x2122;INTĂ&#x2030;RĂ&#x160;T Âť ÂŤ Bijoux molĂŠculairesâ&#x20AC;Ś Jamais je nâ&#x20AC;&#x2122;aurais osĂŠ lâ&#x20AC;&#x2122;ĂŠcrire ni le dire Âť, avoue Corinne Halliez, ingĂŠnieur en agroalimentaire qui sâ&#x20AC;&#x2122;est lancĂŠe ďŹ n 2013 dans la fabrication de bijoux. Lâ&#x20AC;&#x2122;artisan a suivi plusieurs formations Ă sa CMA, qui lui a recommandĂŠ de faire partie dâ&#x20AC;&#x2122;un groupe de travail dâ&#x20AC;&#x2122;artisans dâ&#x20AC;&#x2122;art animĂŠ par AOC (voir encadrĂŠ cicontre). Grâce Ă  cette agence, elle iĹĄDR

sâ&#x20AC;&#x2122;est constituĂŠ une image, ÂŤ le dĂŠbut de tout Âť, a mis des mots dessus et

a appris Ă parler dâ&#x20AC;&#x2122;elle ; les diďŹ&#x20AC;ĂŠrents outils de communication mis en place en dĂŠcoulent. ÂŤ Jâ&#x20AC;&#x2122;ai un stand original qui accroche le regard et reďŹ&#x201A;ète lâ&#x20AC;&#x2122;ĂŠtat dâ&#x20AC;&#x2122;esprit de mes bijoux : des plots verticaux pour mes lignes architecturalesâ&#x20AC;Ś Il mâ&#x20AC;&#x2122;a apportĂŠ la majoritĂŠ de mes clients : sans lui, je nâ&#x20AC;&#x2122;aurais pas ĂŠtĂŠ sĂŠlectionnĂŠe pour les Salons grand public que jâ&#x20AC;&#x2122;ai faits. Jâ&#x20AC;&#x2122;ai aussi rĂŠdigĂŠ un dossier de presse, dĂŠposĂŠ au Carrousel des mĂŠtiers dâ&#x20AC;&#x2122;art et de la crĂŠation en 2014. Jâ&#x20AC;&#x2122;ai ĂŠtĂŠ contactĂŠe pour faire des photos pour un e-magazine, et suis aussi passĂŠe sur BFM Business et dans le Figaroscope. Âť Corinne va bientĂ´t suivre une formation sur le communiquĂŠ de presse. Ah oui, les bijoux molĂŠculaires ? InspirĂŠs par la molĂŠcule de sucreâ&#x20AC;Ś

analyse de lâ&#x20AC;&#x2122;expert

m&RQQDLVWRLWRLPÂŹPH}

PROBLĂ&#x2030;MATIQUE : PARLER DE SOI ÂŤ Vis-Ă -vis de la concurrence, vous ĂŞtes condamnĂŠs Ă  ĂŞtre dans lâ&#x20AC;&#x2122;exception. Et ce nâ&#x20AC;&#x2122;est pas plus facile pour les artisans dâ&#x20AC;&#x2122;art. Lâ&#x20AC;&#x2122;exception, ce nâ&#x20AC;&#x2122;est pas toujours le produit, ça peut ĂŞtre votre parcours, câ&#x20AC;&#x2122;est ce ÂŤ whaou Âť qui vient de votre histoire. Nous voulons quâ&#x20AC;&#x2122;il nâ&#x20AC;&#x2122;y en ait pas deux comme vous Âť, explique NoĂŤlle Corrier, de lâ&#x20AC;&#x2122;agence AOC, Conseil et formation (Lorient, Nantes), spĂŠcialisĂŠe dans la stratĂŠgie des TPE artisanales. Pour cela, un long travail de fond est nĂŠcessaire ; ÂŤ nous avons conçu des outils de maĂŻeutique*, faisons des brainstormingsâ&#x20AC;Ś Âť. .ŨCTVKUCPCRRTGPFČ&#x192;UGFČ&#x152;Ć&#x2019;PKTUGUXCNGWTUUQPV dĂŠterminĂŠes, il y gagne les mots pour sâ&#x20AC;&#x2122;exprimer auprès des journalistes. ÂŤ Nous traduisons ensuite son monde vis-Ă -vis du grand public avec les outils classiques : site Internet, rĂŠseaux sociaux, Salonsâ&#x20AC;Ś Âť. Le travail de constitution dâ&#x20AC;&#x2122;un ADN prĂŠalable est indispensable ; ÂŤ ne vous jetez pas sur les outils aujourdâ&#x20AC;&#x2122;hui accessibles grâce aux NTIC avec un budget proche de zĂŠro ! Âť. Un stand est gagnant si le client franchit ces trois pas : le produit, la personne, la rencontre (ÂŤ ton produit, ce que tu es, ton histoire Âť). ÂŤ Sâ&#x20AC;&#x2122;il y a cette cohĂŠrence le client adhère, quâ&#x20AC;&#x2122;il aime ou pas. La pire des choses ? Ă&#x160;tre transparent. Âť

29

* Qui proposent grâce aux NTIC des services qui peuvent remplacer le travail dâ&#x20AC;&#x2122;un artisan

QUELQUES CONSEILS EN +

i

Č?-HDQ/XF%HOODOLQ $2& ÂŤ Il y a une notion importante, câ&#x20AC;&#x2122;est celle de "client". Souvent la communication nâ&#x20AC;&#x2122;est pas axĂŠe vers le client, lâ&#x20AC;&#x2122;artisan se fait plaisir : il parle technique au client qui est venu acheter du rĂŞve ! Les artisans ont un lien très fusionnel DYHFFHTXĆľLOVIRQWLOIDXWOHVHQGÂŤWDFKHUSRXUDOOHUFKHUFKHUXQHGLČ&#x203A;ÂŤUHQFLDWLRQ qui sera visible et lisible par les clients, sinon cela ne sert Ă rien. Pour parler Ă  sa cible, RQDGRSWHVRQODQJDJH&HWWHFRPPXQLFDWLRQHVWODEDVHGXFKLČ&#x203A;UHGĆľDČ&#x203A;DLUHV} Č?6WÂŤSKDQH/RXYDUGDUWLVDQÂŤ Il faut faire de la qualitĂŠ ; si vous annoncez "le meilleur croissant", câ&#x20AC;&#x2122;est tous les jours quâ&#x20AC;&#x2122;il doit lâ&#x20AC;&#x2122;ĂŞtre. Si votre communication HVWPDOUÂŤČ?ÂŤFKLHRXVLYRXVQƾWHVSDVFDSDEOHGĆľDVVXUHUVXUOHSURGXLWTXHYRXV mettez en avant, mieux vaut vous abstenir. Âť Č?/DXUHQW.ROOHQ 3RUWREHOOR ÂŤ Les artisans ont besoin de se moderniser, leurs clients ne demandent que ça, or les artisans sont souvent plus modernes dans leur vie personnelle que dans leur travailâ&#x20AC;Ś Cherchez lâ&#x20AC;&#x2122;erreur ! Âť Č?&RULQQH+DOOLH]DUWLVDQÂŤ Il faut communiquer pour avoir une entreprise qui vive. Ne restez pas seul, allez rencontrer des gens qui font le mĂŞme type de mĂŠtier que vous, pas forcĂŠment dans la mĂŞme disciplineâ&#x20AC;Ś Allez voir comment ils sâ&#x20AC;&#x2122;y prennent pour rĂŠsoudre leurs problèmes ; vous arriverez dĂŠcouragĂŠs mais repartirez boostĂŠs ! Âť

La pire des choses, selon NoĂŤlle Corrier : ÂŤ ĂŞtre transparent Âť.

iĹĄDR

www.facebook.com/AOCformation

Le Monde des artisans [ SEPTEMBRE/OCTOBRE 2016


DOSSIER [ COMMUNICATION

2. ALIMENTAIRE

analyse de lâ&#x20AC;&#x2122;expert

6WSKDQH/RXYDUG ERXODQJHUS¤WLVVLHU 3DULV

iĹĄDR

CHOUCHOU DES MĂ&#x2030;DIAS StĂŠphane Louvard, 43 ans, a ga-

ÂŤ Il faut sĂŠduire les journalistes, leur donner envie ; ils reçoivent 200 communiquĂŠs par jour et il faut quâ&#x20AC;&#x2122;ils se disent : ÂŤ celui-lĂ on y va ÂťCHĆ&#x2019;TOG5VČ&#x152;RJCPG.QWXCTFÂŤ Pour faire la campagne de relations presse dâ&#x20AC;&#x2122;un artisan, nous sommes dans une valorisation humaine, du professionnel et de son parcours, ou bien de sa crĂŠativitĂŠ, son originalitĂŠ, ce qui lui permet de se dĂŠmarquer de ses confrères Âť, prĂŠcise Lucile Crouzier, attachĂŠe de presse chez Ă&#x2030;quitable, agence conseils et de communication spĂŠcialisĂŠe en nutrition/santĂŠ/alimentation. ÂŤ Avant de choisir quel outil sera le plus adaptĂŠ SRXUIDLUHSDVVHUQRVPHVVDJHVLOIDXWGͧQLU la stratĂŠgie qui va mettre en avant le produit, lâ&#x20AC;&#x2122;artisan. Nous pourrons ensuite faire un ĂŠvĂŠnement (confĂŠrence de presse, confĂŠrences, dĂŠgustations ou showroom), un dossier de presse, des communiquĂŠs, des rencontres oneto-one, un portage produit. Un ĂŠvĂŠnement peut lancer un produit, mais ĂŠgalement correspondre Ă  une ouverture de magasin ou un engagement sociĂŠtal. Ce qui est clĂŠ dans notre mĂŠtier, câ&#x20AC;&#x2122;est le rĂŠseau de journalistes que nous mettons Ă  disposition de nos clients. Âť

gnĂŠ le prix de la Meilleure galette aux amandes de Paris en 2012, et doublĂŠ ses ventes. En 2013, il dĂŠcide de faire appel Ă une attachĂŠe de presse pour promouvoir ses galettes. ÂŤ Un an après, mon chiďŹ&#x20AC;re a encore doublĂŠ par rapport Ă  lâ&#x20AC;&#x2122;annĂŠe du concours ! Âť, sâ&#x20AC;&#x2122;enthousiasme-t-il. ÂŤ Nous avons envoyĂŠ

iĹĄDR

une soixantaine de galettes dans les rĂŠdactions. Âť Le reportage de Laurent Mariotte (France Info),

venu faire des galettes avec lui, dĂŠclenche le ÂŤ buzz Âť : les chaĂŽnes de tĂŠlĂŠvision (TF1â&#x20AC;Ś) et de radio (Europe 1, RTLâ&#x20AC;Ś) sâ&#x20AC;&#x2122;emballent. StĂŠphane vend des milliers de galettes, il doit sâ&#x20AC;&#x2122;organiser, embaucher deux extras. En 2015, deux ans après,

30

une nouvelle campagne de presse redonne un coup de fouet Ă ses ventes de galettes. ÂŤ Communiquer est important car les franchises arrivent dans mon quartierâ&#x20AC;Ś Câ&#x20AC;&#x2122;est plus facile quand on est artisan car on est plus crĂŠdible. Il ne faut pas raconter dâ&#x20AC;&#x2122;histoire car la communication peut aller très vite dans lâ&#x20AC;&#x2122;autre sens (blogs, etc.). Âť InstallĂŠe dans une zone de bureaux, sa boulangerie est fermĂŠe le week-end, Ă  Pâques, NoĂŤl, etc. Il aimerait donc pouvoir communiquer Ă  lâ&#x20AC;&#x2122;annĂŠe, et pense ainsi ÂŤ mettre en avant des produits normands, parler de traçabilitĂŠâ&#x20AC;Ś Âť

i

'HVMRXUQDOLVWHV triĂŠs sur le volet PROBLĂ&#x2030;MATIQUE : CAPTER LES MĂ&#x2030;DIAS

www.boulangerie-louvard.com

3. bâtiment &KULVWRSKH%DFKGLULJHDQWGH%¤WL%DFK 0D\HQQH

ÂŤ MON INVESTISSEMENT INITIAL INCLUAIT LA COMMUNICATION Âť gens nous prennent au sĂŠrieux. Âť Lâ&#x20AC;&#x2122;agence lui a

ÂŤ Nous sommes en Mayenne mais 70 % de notre

notamment crĂŠĂŠ un logo qui vĂŠhicule les notions

dans le Morbihan Âť, pose Christophe Bach, le di-

de soliditĂŠ et de crĂŠativitĂŠ chères Ă lâ&#x20AC;&#x2122;entreprise, un

rigeant de lâ&#x20AC;&#x2122;entreprise de 6 personnes crĂŠĂŠe ďŹ n

site Internet, des cartes de visites, des marquages

2014. ÂŤ Jâ&#x20AC;&#x2122;ai dĂŠmarrĂŠ en sachant que la clientèle ne

de vĂŠhicules, un publi-reportage, des outils pour

serait pas locale. Je nâ&#x20AC;&#x2122;avais pas de rĂŠseau, pas de

la vente. ÂŤ Quand on vend des maisons qui coĂťtent

clients, il a fallu mâ&#x20AC;&#x2122;en crĂŠer ; mon investissement

de 150 Ă 200 000 euros, on ne vient pas avec une

initial incluait la communication. Âť Lâ&#x20AC;&#x2122;entreprise

petite feuille, jâ&#x20AC;&#x2122;ai une belle plaquette dans laquelle

multitâches (charpente, couverture, zinguerie, etc.) se devait dâ&#x20AC;&#x2122;inspirer conďŹ ance. Lâ&#x20AC;&#x2122;agence Portobello (voir encadrĂŠ ci-contre) a pensĂŠ sa communication comme un projet global. ÂŤ Nous sommes sur la mĂŞme ligne du devis Ă la dernière facture, les

Le Monde des artisans [ SEPTEMBRE/OCTOBRE 2016

iĹĄDR

chiďŹ&#x20AC;re dâ&#x20AC;&#x2122;aďŹ&#x20AC;aires est rĂŠalisĂŠ dans les Yvelines et 30 %

i www.bati-bach.fr www.facebook.com/ batibach53/

je mets le devis. Notre page Facebook est mise Ă jour toutes les semaines avec lâ&#x20AC;&#x2122;ĂŠvolution des travaux. Âť Actuellement, Christophe cible une nouvelle niche de clients. Lâ&#x20AC;&#x2122;idĂŠe existe, comment va-t-il la concrĂŠtiser ? ÂŤ Via des ďŹ&#x201A;yers et des emailings Âť.


DOSSIER [ COMMUNICATION

4. SERVICES

analyse de lâ&#x20AC;&#x2122;expert

Une dynamique interne

0RKDPPHG=DDIDUL VHUYLFHDX[SDUWLFXOLHUV 2LVH

iĹĄDR

iĹĄDR

20 ANS APRĂ&#x2C6;S, UN NOUVEAU SOUFFLE

PROBLĂ&#x2030;MATIQUE : DĂ&#x2030;VELOPPER SA CLIENTĂ&#x2C6;LE

Depuis le 1er avril 2016, lâ&#x20AC;&#x2122;entreprise

ÂŤ Les services Ă la personne sont un marchĂŠ hyper

fondĂŠe par Mohammed Zaafari

concurrentiel, qui ne lâ&#x20AC;&#x2122;ĂŠtait pas il y a quelques annĂŠes,

a changĂŠ de nom aďŹ n de mieux

soumis Ă des contraintes lĂŠgislatives liĂŠes Ă  son sub-

rĂŠunir ses trois entitĂŠs, dont

ventionnement. Dâ&#x20AC;&#x2122;oĂš lâ&#x20AC;&#x2122;importance de se remettre en

ÂŤ Net&SĂťr, service aux particuliers Âť

question rĂŠgulièrementâ&#x20AC;Ś Âť, analyse VĂŠronique Martin,

(10 personnes).

le

directrice de lâ&#x20AC;&#x2122;agence de conseil et dâ&#x20AC;&#x2122;accompagnement

reďŹ&#x201A;et dâ&#x20AC;&#x2122;une refonte totale de la

en communication Presstance (Chantilly, Amiens).

communication de lâ&#x20AC;&#x2122;entreprise,

ÂŤ Nous avons rĂŠďŹ&#x201A;ĂŠchi ensemble au fonctionnement très

dâ&#x20AC;&#x2122;une dĂŠmarche oďŹ&#x20AC;ensive pour

localisĂŠ de Net&SĂťr et, par rapport Ă la concurrence,

aller de lâ&#x20AC;&#x2122;avant. ÂŤ Fin aoĂťt 2015,

nous avons Êtabli un plan de communication à 360°

nous avons posĂŠ tout Ă plat avec

(stratĂŠgie digitale ; outils classiques : plaquettesâ&#x20AC;Ś ; pu-

lâ&#x20AC;&#x2122;agence Presstance. En novembre,

blicitĂŠ : web, mĂŠdias traditionnels, aďŹ&#x192;chage ; relations

Ceci

est

après de nombreux Êchanges, nous avions une stratÊgie à cinq ans et un

presse ; relations publiques) ĂŠchelonnĂŠ sur plusieurs

plan de communication Ă deux ans. Âť Le plan de communication comprend

annĂŠes. Âť Tout ceci est ĂŠminemment stratĂŠgique. ÂŤ La

entre autres une campagne radio, un questionnaire de satisfaction soumis

communication est dâ&#x20AC;&#x2122;abord verbale et Ă partager avec

aux clients et du rĂŠseautage pour le chef dâ&#x20AC;&#x2122;entreprise. Un ĂŠvĂŠnement aura

ses collaborateurs : formuler qui on est et ce quâ&#x20AC;&#x2122;on fait

lieu ďŹ n 2016 pour les vingt ans dâ&#x20AC;&#x2122;existence de Net&SĂťr. La construction du

pour savoir oĂš on va, quelle image on vĂŠhicule, Ă qui

nouveau siège y sera annoncÊe.  Car si nous faisions la refonte de tous nos

on sâ&#x20AC;&#x2122;adresse. Jâ&#x20AC;&#x2122;amène ensuite mon client Ă prendre de

supports sans ĂŞtre visibles, ça ne changeait pas grand-choseâ&#x20AC;Ś Nous allons

la hauteur. Âť Le choix dâ&#x20AC;&#x2122;un prestataire peut sâ&#x20AC;&#x2122;avĂŠrer

donc dĂŠmĂŠnager dans une zone dâ&#x20AC;&#x2122;activitĂŠs très dynamique. Âť Les ĂŠquipes

compliquĂŠ : ÂŤ les agences spĂŠcialisĂŠes vous propose-

ont ĂŠtĂŠ impliquĂŠes Ă tous les stades : ÂŤ pour quâ&#x20AC;&#x2122;une stratĂŠgie fonctionne,

ront leurs outils ; dans lâ&#x20AC;&#x2122;idĂŠal, allez voir votre chambre

les collaborateurs doivent sâ&#x20AC;&#x2122;approprier le projet aďŹ n de le porter plus loin Âť.

consulaire pour faire le tri Âť.

En 2018, Net&SĂťr a prĂŠvu dâ&#x20AC;&#x2122;ouvrir deux agences Ă Compiègne et Amiens.

i

www.net-et-sur.fr

i

31

www.presstance.com www.facebook.com/agence.presstance/

analyse de lâ&#x20AC;&#x2122;expert

5ÂŤHOHWYLUWXHOGHFRQFHUW

PROBLĂ&#x2030;MATIQUE : INSPIRER CONFIANCE

iĹĄDR

ÂŤ Quand les grandes entreprises parlent du modèle idĂŠal de la relation client, elles parlent de lâ&#x20AC;&#x2122;artisanat : VOUS ĂŞtes le modèle idĂŠal. Vous devez donc cultiver ce face-Ă -face unique dâ&#x20AC;&#x2122;un individu Ă  lâ&#x20AC;&#x2122;autre et investir lĂ dessus. En ĂŠtant le plus empathique et le plus transparent possible dans la prĂŠsentation des coĂťts Âť, assure Laurent Kollen, dont lâ&#x20AC;&#x2122;agence Portobello (Laval) compte pour moitiĂŠ des clients artisans et dispense des formations Ă  la CMA. Lâ&#x20AC;&#x2122;artisan doit ĂŞtre sur Internet, ÂŤ dâ&#x20AC;&#x2122;autant plus quand on voit que la dimension locale y est plus importante que tout : on va sur le web pour voir ce quâ&#x20AC;&#x2122;il y a dans le magasin de son village ! Regardez ce que proposent les sites comme AlloVoisins ou Frizbiz qui ubĂŠrisent lâ&#x20AC;&#x2122;artisanat* ! Âť. Les artisans du bâtiment doivent expliquer leur offre, ÂŤ en utilisant le langage du client : des photos et des phrases simples. Sur le site web de Bâti-Bach, nous montrons le EÂŤQͧFHͧQDOQRXVDYRQVWUDYDLOOÂŤO̸DWWUDFWLYLWÂŤ&HWUDYDLOTXDOLWDWLIUDVVXUH}Une page Facebook est intĂŠressante pour le cĂ´tĂŠ viral. LinkedIn et viadeo permettent dâ&#x20AC;&#x2122;exister dans le monde des entreprises (CMAâ&#x20AC;Ś) ; ÂŤ il faut prendre le temps de rencontrer dâ&#x20AC;&#x2122;autres artisans ; un stagiaire en multimĂŠdias pourra par exemple www.portobello.fr i travailler sur plusieurs sites Internet Âť. facebook.com/pages/Portobello-Digital/432778435712

Le Monde des artisans [ SEPTEMBRE/OCTOBRE 2016


DOSSIER [ COMMUNICATION

5. fabrication )UÂŤGÂŤULF9ROSRQÂŤEÂŤQLVWH DJHQFHXU 5KÂśQH

DES Ă&#x2030;VĂ&#x2030;NEMENTS DE QUALITĂ&#x2030; Depuis deux ans, FrĂŠdĂŠric Volpon organise des petits-dĂŠjeuners dans son entreprise (10 personnes). Une ou deux fois par mois, ÂŤ après un moment convivial, nous faisons un tour de table oĂš chacun des 4 Ă 8 invitĂŠs se prĂŠsente, puis nous visitons lâ&#x20AC;&#x2122;atelier et la cave Ă  bois. Rien de mieux Š WILLIAM ROGER

pour communiquer sur notre savoir-faire que de partager notre passion ; les invitĂŠs deviennent nos ambassadeursâ&#x20AC;Ś Âť. FrĂŠdĂŠrique Perrier (voir encadrĂŠ ci-contre) lui a suggĂŠrĂŠ dâ&#x20AC;&#x2122;ĂŠlargir son concept... ÂŤ Nous avons crĂŠĂŠ les Instants Volpon, qui transforment lâ&#x20AC;&#x2122;atelier en lieu de rencontre entre lâ&#x20AC;&#x2122;art et artisanat. Âť Quoi

32

de plus reprĂŠsentatif pour un ĂŠbĂŠniste qui met en avant ses pièces uniques et rĂŠalisations sur-mesure ? Ces Instants Volpon (qui ont eu lieu en mars et juin 2016), intimes le matin, voient ensuite aďŹ&#x201E;uer entre 150 et 200 personnes autour dâ&#x20AC;&#x2122;invitĂŠs exceptionnels, comme notamment Sanja Lopar qui crĂŠe des cigares, la Maison des Rhums pour une dĂŠgustation raďŹ&#x192;nĂŠe et lâ&#x20AC;&#x2122;artiste Rachel Gerin. ÂŤ Les carnets dâ&#x20AC;&#x2122;adresses sont mis en commun (clients, fournisseurs, personnes inďŹ&#x201A;uentesâ&#x20AC;Ś). En connectant les rĂŠseaux, ils se croisent et cela devient intĂŠressant car on devient incontournable. Il faut occuper lâ&#x20AC;&#x2122;espace Âť, constate FrĂŠdĂŠric, qui compte organiser 2 Ă 3 Instants Volpon par an. www.volpon.fr Facebook : Volpon EbĂŠniste - Agenceur

i

analyse de lâ&#x20AC;&#x2122;expert

/Č&#x201E;H[FHSWLRQSRXUDWWLUHUODFUÂŞPH

PROBLĂ&#x2030;MATIQUE : FAIRE VENIR DES CLIENTS POTENTIELS ÂŤ Câ&#x20AC;&#x2122;est dâ&#x20AC;&#x2122;abord via Facebook que jâ&#x20AC;&#x2122;ai rencontrĂŠ FrĂŠdĂŠric Volpon Âť, sâ&#x20AC;&#x2122;amuse FrĂŠdĂŠrique Perrier, du webzine Nuances Art et Culture lancĂŠ en janvier 2014, et qui sâ&#x20AC;&#x2122;occupe aussi de communication (crĂŠation dâ&#x20AC;&#x2122;ĂŠvĂŠnementsâ&#x20AC;Ś) Ă Oullins (RhĂ´ne). ÂŤ Les Instants Volpon, ce sont des personnes totalement diffĂŠrentes qui se retrouvent et qui ont un point commun : lâ&#x20AC;&#x2122;exception. Ce que nous aimons avant tout câ&#x20AC;&#x2122;est lâ&#x20AC;&#x2122;art, la personnalitĂŠ. Ă&#x20AC; nous de trouver la recette qui va prendreâ&#x20AC;Ś Âť, EQPĆ&#x2019;GVGNNG ÂŤ La rĂŠussite est liĂŠe au fait que le rĂŠseautage de chacun prenne avec tout le monde, et que chacun fasse des affaires. Certes LinkedIn, Facebook et Viadeo sont des mines dâ&#x20AC;&#x2122;or mais rien ne vaut la rencontre : voir, toucher, matĂŠrialiser câ&#x20AC;&#x2122;est vĂŠhiculer sa passion. Âť La recette dâ&#x20AC;&#x2122;un succès ? ÂŤ Choisir les bons contacts pour un moment de dĂŠtente et de partage ; lâ&#x20AC;&#x2122;implication de tous les employĂŠs qui parlent de ce quâ&#x20AC;&#x2122;ils font avec le cĹ&#x201C;ur ; communiquer après lâ&#x20AC;&#x2122;ĂŠvĂŠnement (envoi de photos, etc.) ; dĂŠbriefer pour encore sâ&#x20AC;&#x2122;amĂŠliorer. Âť FrĂŠdĂŠrique a aussi aidĂŠ FrĂŠdĂŠric, très prĂŠsent sur Internet, dans la conception dâ&#x20AC;&#x2122;une vidĂŠo ÂŤ Ă  partager en masse Âť. Lâ&#x20AC;&#x2122;artisan, qui appartient en outre Ă  diffĂŠrents organismes (CMA, Only Lyonâ&#x20AC;Ś) est de tous les rĂŠseaux qui peuvent attirer les curieux dans son atelier.

i

www.nuancesartculture.fr

QUELQUES CONSEILS EN + Č?1R­OOH&RUULHU $2& ÂŤ Les artisans nous disent quâ&#x20AC;&#x2122;ils nâ&#x20AC;&#x2122;ont pas le temps mais câ&#x20AC;&#x2122;est faux ! Ils confondent "occupation" avec "manque de temps" car en fait ils mettent parfois leur ĂŠnergie sur des choses qui ne servent Ă â&#x20AC;Ś rien. Âť

Le Monde des artisans [ SEPTEMBRE/OCTOBRE 2016

iĹĄTHIERRY TIJERAS

iĹĄSVETA

Č?/XFLOH&URX]LHU Â&#x2039;TXLWDEOH ÂŤ Il y a souvent une bienveillance naturelle des journalistes envers lâ&#x20AC;&#x2122;artisanat. MalgrĂŠ tout, ce que lâ&#x20AC;&#x2122;on constate, câ&#x20AC;&#x2122;est que les journalistes recherchent avant tout des informations sur des nouveaux produits qui se dĂŠmarquent de lâ&#x20AC;&#x2122;existant. Toutefois, les notions de qualitĂŠ, de plaisir et de gourmandise restent des valeurs sĂťres. Âť


P

RATIQUE [ DEUX-SĂ&#x2C6;VRES

ProcĂŠdures devant le conseil des prudâ&#x20AC;&#x2122;hommes

i

Les nouveautĂŠs Ă connaĂŽtre

PĂ&#x2030;NIBILITĂ&#x2030; : SIX NOUVEAUX FACTEURS DE RISQUES SONT ENTRĂ&#x2030;S EN VIGUEUR

Dans le cadre de la rĂŠforme de la procĂŠdure prudâ&#x20AC;&#x2122;homale impulsĂŠe par la loi Macron, WPFČ&#x152;ETGVRWDNKČ&#x152;GPOCKFGTPKGTOQFKĆ&#x2019;GPQVCOOGPVNGUTČ&#x2039;INGUNKČ&#x152;GUČ&#x192;NŨCUUKUVCPEG et la reprĂŠsentation des parties.

Depuis le 1er juillet dernier, les entreprises doivent prendre en compte six nouveaux facteurs iĹĄ<1.0+'4'-(161.+#%1/

de risques de pĂŠnibilitĂŠ pour leurs UCNCTKČ&#x152;UĹĄNCOCPWVGPVKQPOCPWGNNG FGEJCTIGUNGURQUVWTGURČ&#x152;PKDNGU NGUXKDTCVKQPUOČ&#x152;ECPKSWGUNGUCIGPVU EJKOKSWGUFCPIGTGWZNGUVGORČ&#x152;TCVWTGU GZVTČ?OGUGVNGDTWKV +NUUŨCLQWVGPVCWZSWCVTGFČ&#x152;LČ&#x192;CRRNKSWČ&#x152;U depuis le 1erLCPXKGTČ&#x192;UCXQKTĹĄ le travail de nuit, le travail rĂŠpĂŠtitif, NGVTCXCKNGPOKNKGWJ[RGTDCTGNGVTCXCKN GPČ&#x152;SWKRGUUWEEGUUKXGUCNVGTPCPVGU

ACCESSIBILITĂ&#x2030; DE VOS LOCAUX : ATTENTION AUX CONTRĂ&#x201D;LES ET AUX SANCTIONS .GUOQFCNKVČ&#x152;UFGEQPVTČ&#x2013;NG FWTGURGEVFGUQDNKICVKQPUFG

L

ŨGORNQ[GWTGVNGUCNCTKČ&#x152;RGWXGPV FČ&#x2039;UOCKPVGPCPVUGHCKTGTGRTČ&#x152;UGPVGT FGXCPVNGEQPUGKNFGRTWFŨJQOOGU UCPURQWTCWVCPVFGXQKTLWUVKĆ&#x2019;GTFŨWPOQVKH NČ&#x152;IKVKOGWPGEQPFKVKQPCWRCTCXCPVGZKIČ&#x152;G RCTNG%QFGFWVTCXCKNÇąVCPVRTČ&#x152;EKUČ&#x152;SWG EQOOGRTČ&#x152;EČ&#x152;FGOOGPVNŨGORNQ[GWTGVNG UCNCTKČ&#x152;SWKUQWJCKVGPVUGTGPFTGČ&#x192;NŨCWFKGPEG RGWXGPVUGHCKTGCUUKUVGT 3WCPVCWZRGTUQPPGUJCDKNKVČ&#x152;GUČ&#x192;CUUKU VGTQWČ&#x192;TGRTČ&#x152;UGPVGTNGURCTVKGUKNUŨCIKV comme auparavant des avocats et des GORNQ[GWTU CRRCTVGPCPV Č&#x192; NC OČ?OG DTCPEJG FŨCEVKXKVČ&#x152; OCKU Č&#x152;ICNGOGPV Č&#x192; compter du 1er CQČ&#x203A;VFGUFČ&#x152;HGPUGWTU U[PFKECWZSWKTGORNCEGPVNGUFČ&#x152;NČ&#x152;IWČ&#x152;U RGTOCPGPVUFGUQTICPKUCVKQPUU[PFKECNGU GVRTQHGUUKQPPGNNGU

&GRNWURQWTNGUKPUVCPEGUKPVTQFWKVGUČ&#x192; compter du 1erCQČ&#x203A;VFGXCPVWPGEQWT FŨCRRGNNŨGORNQ[GWTGVNGUCNCTKČ&#x152;FGXTQPV QDNKICVQKTGOGPVČ?VTGTGRTČ&#x152;UGPVČ&#x152;URCTWP CXQECVQWWPFČ&#x152;HGPUGWTU[PFKECN 'PEQORNČ&#x152;OGPVČ&#x192;RCTVKTFGEGVVGOČ?OG FCVG NG HQTOCNKUOG NKČ&#x152; Č&#x192; NC UCKUKPG FW EQPUGKN FG RTWFŨJQOOGU UGTC CNQWTFK 'PGHHGVNGFGOCPFGWTIČ&#x152;PČ&#x152;TCNGOGPVNG UCNCTKČ&#x152;FGXTCTČ&#x152;FKIGTWPGTGSWČ?VGEQPVG nant un exposĂŠ sommaire des motifs FGUCFGOCPFGGVOGPVKQPPCPVEJCEWP FGU EJGHU FG EGNNGEK /CKU UWTVQWV NGU RKČ&#x2039;EGUKPXQSWČ&#x152;GUČ&#x192;NŨCRRWKFGNCFGOCPFG (contrat de travail, bulletin de salaire, relevĂŠ FŨJGWTGUŲ FGXTQPVFČ&#x152;UQTOCKUCEEQORC IPGTEGVVGTGSWČ?VG

33

DÊcret n° 2016-660 du 20 mai 2016, JO du 25

mise en accessibilitĂŠ appliquĂŠes aux ĂŠtablissements recevant du public

'42 UQPVOCKPVGPCPVRTČ&#x152;EKUČ&#x152;GU

/RL7UDYDLO'FUHWHWDUUWGXDR½W

GVRWDNKČ&#x152;GU+NRGWVXQWUČ?VTG

DES PRĂ&#x2030;CISIONS SUR LES CONDITIONS ET MODALITĂ&#x2030;S D'ATTRIBUTION DE L'AIDE Ă&#x20AC; LA RECHERCHE DU PREMIER EMPLOI

FGOCPFČ&#x152;Č&#x192;VQWVOQOGPVFGRTQFWKTG NGUFQEWOGPVULWUVKĆ&#x2019;CPVNGTGURGEV FGUQDNKICVKQPU'PECUFGPQPTČ&#x152;RQPUG ou dâ&#x20AC;&#x2122;envoi de document erronĂŠ ou KPEQORNGVRTQFWKVOCNITČ&#x152;NGUTGNCPEGU XQWUČ?VGURCUUKDNGFŨWPGCOGPFG

i

&RQWDFWÉ&#x2039;9RWUHFRQVHLOOHU&0$ sur www.cma-niort.fr

/Č&#x201E;DLGHHVWUÂŤVHUYÂŤHDX[MHXQHVGHPRLQVGHDQVTXLD\DQWREWHQXOHXUGLSOÂśPHSDU OHVYRLHVVFRODLUHHWXQLYHUVLWDLUHEÂŤQÂŤČŚFLDLHQWG XQHERXUVH(OOHV DGUHVVHÂŤJDOHPHQW DX[SHUVRQQHVD\DQWREWHQXOHXUGLSOÂśPHSDUO DSSUHQWLVVDJH(OOHHVWQRWDPPHQWGH HXURVPHQVXHOVSRXUOHVSHUVRQQHVD\DQWREWHQXXQGLSOÂśPHGHO HQVHLJQHPHQW VFRODLUH¢ČŚQDOLWÂŤSURIHVVLRQQHOOH

Le Monde des artisans [ septembre/octobre 2016


J

URI-PRATIQUE

Questions/RĂŠponses Comment utiliser la pĂŠriode dâ&#x20AC;&#x2122;essai pour tester un salariĂŠ ou un apprenti ? Vous avez dĂŠcidĂŠ de recruter un nouveau salariĂŠ ou apprenti. Si la pĂŠriode dâ&#x20AC;&#x2122;essai vous permet dâ&#x20AC;&#x2122;ĂŠvaluer ses capacitĂŠs professionnelles, elle doit ĂŞtre utilisĂŠe avec prĂŠcautions car cette phase probatoire reste juridiquement encadrĂŠe. Combien de temps dure la pĂŠriode dâ&#x20AC;&#x2122;essai ?

34

La durĂŠe maximale (1)FGNCRČ&#x152;TKQFGFŨGUUCKGUVĆ&#x2019;ZČ&#x152;GČ&#x192;FGWZOQKU pour les ouvriers et employĂŠs, trois mois pour les agents de maĂŽtrise et techniciens et quatre pour les cadres. Des accords collectifs ou le contrat de travail peuvent ĂŠtablir des durĂŠes plus courtes. Cette pĂŠriode se dĂŠcompte de manière calendaire (de jour en jour, dimanche et jours fĂŠriĂŠs compris). Elle peut se renouveler mais il faut quâ&#x20AC;&#x2122;un accord de branche ĂŠtendu le prĂŠvoie(2). De plus, la possibilitĂŠ de reconduction doit ĂŞtre inscrite dans le contrat de travail et le salariĂŠ doit lâ&#x20AC;&#x2122;avoir acceptĂŠ. Pour les CDD(3), la pĂŠriode dâ&#x20AC;&#x2122;essai dure au maximum un mois et elle ne peut ĂŞtre prorogĂŠe.

Peut-on vraiment rompre librement la pĂŠriode dâ&#x20AC;&#x2122;essai ?

iĹĄPHOTOGRAPHEE.EU

En thĂŠorie oui. Mais en pratique, il nâ&#x20AC;&#x2122;est pas possible de rompre la pĂŠriode dâ&#x20AC;&#x2122;essai pour un motif discriminatoire (grossesse, accident de travail, reprĂŠsentant du personnel, etc.). Par ailleurs, la loi exige un dĂŠlai de prĂŠvenance du salariĂŠ (4)UQKVÇĄJGWTGU Ă lâ&#x20AC;&#x2122;avance en dessous de 8 jours de prĂŠsence dans lâ&#x20AC;&#x2122;entreprise

ĹĄJGWTGURQWTNGU%&& ÇĄJGWTGUČ&#x192;NŨCXCPEGGPVTGLQWTU et 1 mois de prĂŠsence ; 2 semaines Ă lâ&#x20AC;&#x2122;avance entre 1 mois et ÇĄOQKUFGRTČ&#x152;UGPEGOQKUČ&#x192;NŨCXCPEGCRTČ&#x2039;UOQKUFGRTČ&#x152;UGPEG Ă&#x20AC; dĂŠfaut de respect du dĂŠlai, lâ&#x20AC;&#x2122;employeur devra rĂŠgler au salariĂŠ des indemnitĂŠs de licenciement.

Quâ&#x20AC;&#x2122;en est-il pour les apprentis ? &GRWKUNCNQK4GDUCOGPFWCQČ&#x203A;VNCFWTČ&#x152;GFGNCRČ&#x152;TKQFG dâ&#x20AC;&#x2122;essai de lâ&#x20AC;&#x2122;apprenti est passĂŠe Ă 45 jours (5). Il faut savoir que seuls les moments oĂš lâ&#x20AC;&#x2122;apprenti se trouve en formation pratique dans lâ&#x20AC;&#x2122;entreprise comptent pour le calcul de la durĂŠe. Le contrat dâ&#x20AC;&#x2122;apprentissage peut ĂŞtre dĂŠfait par lâ&#x20AC;&#x2122;une ou lâ&#x20AC;&#x2122;autre des parties jusquâ&#x20AC;&#x2122;au terme de la pĂŠriode dâ&#x20AC;&#x2122;essai. PassĂŠ ce dĂŠlai, un accord ĂŠcrit entre lâ&#x20AC;&#x2122;employeur et lâ&#x20AC;&#x2122;apprenti pour cesser le contrat sâ&#x20AC;&#x2122;impose. Ă&#x20AC; noter quâ&#x20AC;&#x2122;il est possible de solliciter gratuitement lâ&#x20AC;&#x2122;assistance dâ&#x20AC;&#x2122;un mĂŠdiateur de lâ&#x20AC;&#x2122;apprentissage auprès de la CMA de votre dĂŠpartement. Par ailleurs, lorsque le contrat

Le Monde des artisans [ septembre/octobre 2016

se poursuit auprès dâ&#x20AC;&#x2122;un autre employeur, les pĂŠriodes dâ&#x20AC;&#x2122;essai qui sâ&#x20AC;&#x2122;appliquent correspondent Ă celles dâ&#x20AC;&#x2122;un CDD. Dans tous les cas, il reste possible dâ&#x20AC;&#x2122;interrompre la pĂŠriode dâ&#x20AC;&#x2122;essai pour faute grave du salariĂŠ ou de lâ&#x20AC;&#x2122;apprenti. Articles du Code du travail auxquels fait rĂŠfĂŠrence cet article : (1) Art. L 1221-19. (2) Art. L1221-21. (3) Art. L 1242-10. (4) Art. L 1221-25. (5) Art. L 6222-18

i

Pour joindre votre CMA | www.artisanat.fr | TĂŠl. 0 825 36 36 36 (0,15 â&#x201A;Ź TTC/min)


RUBRIQUE RĂ&#x2030;ALISĂ&#x2030;E PAR SAMORYA WILSON

Vos droits Obtenir le paiement de la dette de votre client particulier Le client refuse de payer les travaux ou la prestation de services que vous lui avez fournis. Vous pouvez rĂŠcupĂŠrer la crĂŠance de diverses manières. Encore faut-il que vous ayez la preuve de ce quâ&#x20AC;&#x2122;il vous doit. Rassembler les preuves Lâ&#x20AC;&#x2122;ĂŠtablissement dâ&#x20AC;&#x2122;un ĂŠcrit reste essentiel pour prouver votre situation de crĂŠancier. En effet, pour toute prestation de dĂŠpannage, de rĂŠparation et dâ&#x20AC;&#x2122;entretien dans le secteur du bâtiment et de lâ&#x20AC;&#x2122;ĂŠquipement de la maison, dont le montant est supĂŠrieur Ă 150 â&#x201A;Ź, le professionnel a lâ&#x20AC;&#x2122;obligation dâ&#x20AC;&#x2122;ĂŠtablir un devis en deux exemplaires (1). Ce devis doit ĂŞtre le plus dĂŠtaillĂŠ possible. Il comporte des mentions obligatoires, notamment sur lâ&#x20AC;&#x2122;identitĂŠ de votre entreprise mais aussi sur NGRTKZGVNCOCPKČ&#x2039;TGFQPVKNCČ&#x152;VČ&#x152;Ć&#x2019;ZČ&#x152; WPKVČ&#x152; FGOGUWTGÇĄJQTCKTGO2 etc.), les frais, la TVA, les dates et la durĂŠe de validitĂŠ de lâ&#x20AC;&#x2122;offre. Une fois signĂŠ par les parties, le devis prend la nature dâ&#x20AC;&#x2122;un engagement contractuel. Pour cela, il faut que le client y inscrive les OGPVKQPUÇĄmbERQSRXUWUDYDX[b} car validĂŠ, ce document ĂŠquivaut Ă  une reconnaissance

de dette. Cependant, il faudra ĂŠgalement que vous rĂŠunissiez tous les moyens de LWUVKĆ&#x2019;GTNCEQPUKUVCPEGFGXQUVTCXCWZWP ENKGPVFGOCWXCKUGHQKRQWXCPVCHĆ&#x2019;TOGTSWG vous nâ&#x20AC;&#x2122;avez pas accompli les prestations convenues.

ProcĂŠdure simplifiĂŠe Vous avez tout intĂŠrĂŞt Ă essayer dâ&#x20AC;&#x2122;ĂŠviter la judiciarisation du conflit en cherchant dâ&#x20AC;&#x2122;abord un règlement amiable avec votre client. Sâ&#x20AC;&#x2122;il persiste dans son refus de payer, vous pourrez alors le mettre en demeure Ă  travers une lettre recommandĂŠe. Par ailleurs, il faut savoir quâ&#x20AC;&#x2122;il existe dĂŠsormais WPGRTQEČ&#x152;FWTGUKORNKĆ&#x2019;Č&#x152;GFGTGEQWXTGOGPV de crĂŠance auprès dâ&#x20AC;&#x2122;un huissier de justice(2) pour les crĂŠances infĂŠrieures Ă  ÇĄ ÇĄ Ĺť XQKTÇĄ ./#   7P HQTOWNCKTG Ă  remplir sur www.petitescreances.fr a

ĂŠtĂŠ ĂŠtabli pour cela. En principe, la saisine de lâ&#x20AC;&#x2122;huissier devrait EQČ&#x203A;VGT 40ĹĄâ&#x201A;Ź et si la procĂŠdure aboutit, un pourcentage des sommes recouvrĂŠes (11,70ĹĄ% au maximum) en plusÇĄ(3). Cependant, ce type de recouvrement nĂŠcessite lâ&#x20AC;&#x2122;accord du dĂŠbiteur ; Ă dĂŠfaut, il reste la voie judiciaire au crĂŠancier.

Injonction de payer Lorsque le client demeure sourd Ă toute sollicitation pour payer, lâ&#x20AC;&#x2122;injonction de RC[GTÇĄ(4) reste un moyen dâ&#x20AC;&#x2122;obtenir une exĂŠcution forcĂŠe. Il sâ&#x20AC;&#x2122;agit dâ&#x20AC;&#x2122;un titre exĂŠcutoire dĂŠlivrĂŠ par le juge. Il sâ&#x20AC;&#x2122;obtient auprès du tribunal de proximitĂŠ lorsque la crĂŠance GUVKPHČ&#x152;TKGWTGČ&#x192;ÇĄÇĄĹťCWRTČ&#x2039;UFWVTKDWPCN FŨKPUVCPEGLWUSWŨČ&#x192;ÇĄĹťGVCWFGNČ&#x192;FG cette somme câ&#x20AC;&#x2122;est le tribunal de grande instance qui devient compĂŠtent. Ă&#x20AC; ce stade, il convient de se faire accompagner par un professionnel du droit dâ&#x20AC;&#x2122;autant plus quâ&#x20AC;&#x2122;une rĂŠforme du droit des contrats entrera en vigueur au 1er octobre 2016. (1)

35

ArrĂŞtĂŠ du 2 mars 1990

ArrĂŞtĂŠs du 3 juin 2016 : lâ&#x20AC;&#x2122;un ĂŠtablissant un modèle FGNGVVTGGVHQTOWNCKTGUGPOCVKČ&#x2039;TGFGRTQEČ&#x152;FWTGUKORNKĆ&#x2019;Č&#x152;G de recouvrement des petites crĂŠances et lâ&#x20AC;&#x2122;autre la mise en Ĺ&#x201C;uvre par voie ĂŠlectronique de la procĂŠdure.

iĹĄBEEBOYS

(2)

i

(3)

Art. A444-32 du Code de commerce

(4)

Articles 1405 Ă 1424 du Code de procĂŠdure civile

LE CRĂ&#x2030;DIT Dâ&#x20AC;&#x2122;IMPĂ&#x201D;T TRANSITION Ă&#x2030;NERGĂ&#x2030;TIQUE EST RECONDUIT Alors quâ&#x20AC;&#x2122;il devait sâ&#x20AC;&#x2122;ĂŠteindre le 31 dĂŠcembre 2016, le gouvernement a annoncĂŠ le 1er juillet dernier la reconduction du crĂŠdit dâ&#x20AC;&#x2122;impĂ´t pour transition ĂŠnergĂŠtique (CITE) pour 2017. Une bonne nouvelle pour le secteur du bâtiment. Rappelons que le CITE permet aux personnes rĂŠalisant des travaux en faveur de la transition ĂŠnergĂŠtique dans leur rĂŠsidence principale FGDČ&#x152;PČ&#x152;Ć&#x2019;EKGTFŨWPETČ&#x152;FKVFŨKORČ&#x2013;VFG%GUVTCXCWZFQKXGPVČ?VTGGHHGEVWČ&#x152;URCTWPRTQHGUUKQPPGN4)' TGEQPPWICTCPV de lâ&#x20AC;&#x2122;environnement) et Ă condition que le logement ait ĂŠtĂŠ construit au moins deux ans avant lâ&#x20AC;&#x2122;exĂŠcution des ouvrages.

Le Monde des artisans [ septembre/octobre 2016


P

RATIQUE [ DEUX-SÃ&#x2C6;VRES

i

Chef dâ&#x20AC;&#x2122;entreprise, conjoint dâ&#x20AC;&#x2122;artisan

LE PORTAIL DES ARTISANS : UNE MEILLEURE VISIBILITÃ&#x2030; POUR VOTRE ENTREPRISE

Vos formations pour le dernier trimestre INFORMATIQUE Actualiser son site internet 1 jour RFWREUHRXQRYHPEUH à Parthenay Comment être présent sur le web quotidiennement HWVRXVWRXWHVVHVIRUPHV 2 joursRFWREUHHWQRYHPEUH à Parthenay &U«HUVDSDJHSURIHVVLRQQHOOH Facebook 1 jourQRYHPEUH¢3DUWKHQD\

Le portail des artisans

36

FW2QKVQW%JCTGPVGUCÈ&#x152;VÈ&#x152; NCPEÈ&#x152;RQWTHCEKNKVGTNCTGEJGTEJG FŨWPRTQHGUUKQPPGNRCTWPRCTVKEWNKGT Référencement sur un annuaire GPNKIPGUKVGXKVTKPGGVUKVGKPVGTPGV la CMA vous propose une offre complète pour valoriser votre entreprise. â&#x2013; Pour le consommateur, YYYCTVKUCPURQKVQWEJCTGPVGUHT est le site de référence pour trouver rapidement et en toute sérénité, le professionnel auquel il pourra HCKTGCRRGN â&#x2013;  Pour lâ&#x20AC;&#x2122;artisanKNUŨCIKVFŨWPG QHHTGFGUGTXKEGUEQORNÈ&#x2039;VGRQWT mieux faire connaître son entreprise

Créer et animer son site internet MRXUVHWQRYHPEUH RXerG«FHPEUH¢3DUWKHQD\ Découvrir et maîtriser internet 1 jourQRYHPEUH¢3DUWKHQD\

GESTION, COMMERCIAL ET RESSOURCES HUMAINES Lire et interpréter ses documents comptables 1 jour RFWREUH¢3DUWKHQD\ Développer ma stratégie commerciale 2 joursHWRFWREUH¢1LRUW &RPPXQLTXHUHȪFDFHPHQW avec mes salariés 1 jour RFWREUH¢1LRUW Savoir gérer son temps 1 jourQRYHPEUH¢3DUWKHQD\ Tuteur et maître dâ&#x20AC;&#x2122;apprentissage 1 jour RFWREUH¢1LRUW

2UJDQLVHUVHVLQIRUPDWLRQV avec les outils Google 1 jour G«FHPEUH¢3DUWKHQD\

ENVIRONNEMENT

Se développer grâce au web PDUNHWLQJHWDX[U«VHDX[VRFLDX[ 1 jour RFWREUH¢3DUWKHQD\

Ã&#x2030;tiquetage alimentaire P«WLHUVGHERXFKH

1 jour RFWREUH¢1LRUW

6È&#x2020;LQLWLHU¢ODUHWRXFKHGÈ&#x2020;LPDJHV 2 jours HWRFWREUH¢3DUWKHQD\

HACCP 2 jours HWRFWREUH RXHWQRYHPEUH¢1LRUW

i

Toutes les formations interpros sur www.cma-niort.fr | 3RXUVÈ&#x2021;LQVFULUHHWHQVDYRLUSOXVÉ&#x2039; Valérie Brémaud au 05 49 77 87 83 ou formation-artisan@cma-niort.fr

HYGIÃ&#x2C6;NE, SÃ&#x2030;CURITÃ&#x2030;,

Prévention des risques Document Unique 1 jour QRYHPEUH¢3DUWKHQD\

et pour sâ&#x20AC;&#x2122;assurer une meilleure XKUKDKNKVÈ&#x152;CWRTÈ&#x2039;UFWEQPUQOOCVGWT ITÈ&#x2026;EGCWTÈ&#x152;HÈ&#x152;TGPEGOGPVITCVWKV

CXGENQIQFWVKVTGFGSWCNKÆ&#x2019;ECVKQP artisan ou maître artisan), au site XKVTKPGGVCWUKVGKPVGTPGV

i

Francis Tempéreau | 05 49 71 26 22 | f.tempereau@cma-niort.fr

Le Monde des artisans [ septembre/octobre 2016

9RXVVRXKDLWH]FRPSO«WHU YRVFRQQDLVVDQFHVÉ&#x2C6;"9RXVSRXYH] VXLYUHGHVIRUPDWLRQVm¢ODFDUWH} JU¤FH¢GHVPRGXOHVWK«PDWLTXHVDGDSW«V ¢YRVDWWHQWHV FR½W¢ODFKDUJHGHOÈ&#x2021;HQWUHSULVHÉ&#x2C6; È&#x153;MRXUHWSDUSDUWLFLSDQW 


B

i

OURSE DES ENTREPRISES [ DEUX-SĂ&#x2C6;VRES

Vous avez un projet de WUDQVPLVVLRQGČ&#x2021;HQWUHSULVHÉ&#x2039;" 'LÎ?XVH]YRWUHDQQRQFHJUDWXLWHPHQW| &RQWDFWÉ&#x2039;

,OVFKHUFKHQWXQUHSUHQHXUÉ&#x2C6; 8QWUCXG\WPRTQLGVFGTGRTKUGFŨGPVTGRTKUGĹĄ!%QPUWNVG\NGUCPPQPEGUEKFGUUQWUCXGENGWTUTČ&#x152;HČ&#x152;TGPEGUUWTNGUKVGFG6TCPUEQOOGTEG6TCPU#TVKUCPCV

YYYVTCPUEQOOGTEGEQOYYYVTCPUCTVKUCPCVEQO QWUWTNGUKVGFGNC$QWTUG0CVKQPCNGFŨ1RRQTVWPKVČ&#x152;U#TVKUCPCNGU YYYDPQCPGV  Gâtine

Bocage

Salon de coiffure (792A3885)

Menuiserie (793A4647) Vends ent. menuiserie bâtiment et intĂŠrieur. $Č&#x2026;VKOGPVFGĹĄOq CVGNKGT bureau), 1 ha de terrain. 16 salariĂŠs + le gĂŠrant. CA entre 2,2 et 2,5 millions F GWTQU4Č&#x152;UWNVCVĹĄMĹť '$' TGVTCKVČ&#x152;ĹĄMĹť 2TKZFGXGPVGĹĄ RCTVUUQEKCNGUĹĄMĹťGVDČ&#x2026;VKOGPVĹĄ MĹť QWNQ[GTFGĹĄĹťOQKU  Fleuriste (793A3769)

Vends salon de coiffure mixte Ă Parthenay, proche commerces et ĂŠtablissements scolaires, passage très important. Local lumineux, spacieux et aux normes (accessibilitĂŠ handicapĂŠs). UCNCTKČ&#x152;GĆ&#x2019;FČ&#x2039;NGČ&#x192;N GPVTGRTKUG CA stable. Prix du fonds 80 000 â&#x201A;Ź, DCKNEQOOGTEKCNĹĄĹĄĹť66% Aucun frais Ă  prĂŠvoir. Plomberie Chauffage Ă&#x2030;lectricitĂŠ (792A0760) Vends fds ou parts sociales plomberie-chauffage (50 %), Č&#x152;NGEVTKEKVČ&#x152;  %NKGPVČ&#x2039;NGĆ&#x2019;FČ&#x2039;NG dont collectivitĂŠs. Bonne rentabilitĂŠ. UCNCTKČ&#x152;QWXTKGTČ&#x152;NGEVTKEKGPSWCNKĆ&#x2019;Č&#x152; Label RGE Bois-Air, Bois-Eau, PAC. %QPEWTTGPEGHCKDNG2TKZFWHFUĹĄ ĹĄĹťGVXGPVGRQUUKDNGFGURCTVU .Q[GTĹĄĹť*6RQUUKDKNKVČ&#x152;XGPVG ĹĄĹť*6.QECNCXGEJCNNFGXGPVG

Vends fonds fleurs et dĂŠcoration, situĂŠ dans galerie marchande grande surface. Passage clients important. /CICUKPOqGVTČ&#x152;UGTXGOq Magasin climatisĂŠ. Pas de travaux Ă prĂŠvoir. AdhĂŠrent Florajet. Clientèle Ć&#x2019;FČ&#x152;NKUČ&#x152;G2CUFGUCNCTKČ&#x152;2TKZHFUĹĄ MĹť UVQEM.Q[GTĹĄĹť66% Peinture (793A3921) Vends cause retraite, fonds peinture, revĂŞtements sols et murs, façade et autres petits travaux associĂŠs. Entreprise de

bonne notoriĂŠtĂŠ. Actuellement CRRTGPVKGP%#2%#-Ĺť TČ&#x152;UWNVCVĹĄ-ĹťRTKZHFU-Ĺť

Mellois Boucherie-charcuterie-traiteur (794A0798)

Vends fds boucherie charcuterie traiteur dans centre bourg commune ĹĄJCD2CTMKPIRTQEJG 2CUF KPXGUVKUUGOGPVUČ&#x192;RTČ&#x152;XQKT VĂŠhicule rĂŠfrigĂŠrĂŠ en bon ĂŠtat. Pas de salariĂŠ. Clientèle locale de particuliers et collectivitĂŠs. ActivitĂŠ traiteur Ă dĂŠvelopper. .QECVKQPNQECNRTQHGUUKQPPGNĹĄĹť OQKU JCDKVCVKQPĹĄĹťOQKU &GTPKGT%#ĹĄ-Ĺť2TKZHFUĹĄĹť

Niortais MĂŠcanique Carrosserie Peinture (791A3942) Ă&#x20AC; vendre en prĂŠvision dĂŠpart retraite, titres de SAS. Atelier rĂŠp. mĂŠcanique, carrosserie, peinture agrĂŠĂŠ. Vente vĂŠh. occasion.

28 ans dâ&#x20AC;&#x2122;activitĂŠ. Bien situĂŠ dans ZA CXGPWGFG2CTKU*CNNGZRQDWTGCWZ commerciaux et expo extĂŠrieure ĹĄOqCVGNKGTUĹĄOqRCTMKPI ĹĄOqUCNCTKČ&#x152;U%#ĹĄ/Ĺť2TKZĹĄ nous consulter avec engagement FGEQPĆ&#x2019;FGPVKCNKVČ&#x152;.QECVKQPOWTU ĹĄĹť#EEQORCIPGOGPVČ&#x192;FČ&#x152;Ć&#x2019;PKT Restauration-traiteur (791A3695) Vends fonds de restaurationtraiteur, service en salle de OqHTCČ&#x2018;EJGOGPVTČ&#x152;PQXČ&#x152;G Č&#x192; EQWXGTVU CXGEVGTTCUUGFGOq (50 couverts). Bon agencement. 2TKZHFUĹĄĹĄĹť UCPUXČ&#x152;JKEWNG  ĹĄĹť CXGEXČ&#x152;JKEWNG  Pension chiens chats-toilettage (791A3970) Le Complexe Canin GV(Č&#x152;NKPĹĄCPUF GZRČ&#x152;TKGPEG Offre services et produits pour propriĂŠtaires de chiens et de chats. Ă&#x2030;ducation canine. Pension, toilettage, vente accessoires et aliments. 1 gĂŠrant, 1 toiletteuse et OQPKVGWTECPKPDČ&#x2026;VKOGPVOq 4 bâtiments hĂŠbergement pour EJKGPU OqEJCEWP DČ&#x2026;VKOGPV CPPGZGRQWTČ&#x152;FWECVKQPECPKPGOq Clientèle de particuliers autour de

0KQTVGV4Č&#x152;IKQP2%2TKZXGPVGOWTUĹĄ ĹĄĹť2TKZHFUĹĄĹĄĹť

Thouarsais Boucherie-Charcuterie-Traiteur (795A3200) Vends fds boucherie charcuterie-traiteur dans commune touristique. Laboratoire remis Ă neuf en 2003. Bon CA avec potentiel dĂŠveloppement sur partie traiteur et tournĂŠes. Local commercial ĹťOQKUCXGEDCPEUQWUNGU halles. Poss. achat murs et location JCDKVCVKQPCVVGPCPVG ĹťOQKU  2TKZHFUĹĄĹĄĹť ĹĄĹťCXGE vĂŠhicule de marchĂŠ panoramique, tout ĂŠquipĂŠ de 2011).

Haut val de sèvre Fleuriste (796A0751) Vends fonds artisan fleuriste, membre agrĂŠĂŠ rĂŠseau Interflora. DĂŠcoration moderne et sobre. ProximitĂŠ Niort sur artère principale entre Poitiers et Niort. Proche RCTMKPIUITCVWKVUGVEQOOGTEGU /CVČ&#x152;TKGNHQPEVKQPPGNEJCODTGHTQKFG caisse, mobilierâ&#x20AC;Ś Ouverture journĂŠe EQPVKPWG%#OQ[GPMĹť 2CUFGUCNCTKČ&#x152;$CKNEQOOGTEKCNNQ[GTĹĄ ĹťOQKU2TKZHFUĹĄĹĄĹť

37

entreprise.kia.com

8 OFFRE LLD AVEC MAINTENANCE äł&#x153; SANS APPORT sur 48 mois / 40 000 Km

Consommations mixtes et missions de CO2 des mod les pr sent s : Kia Rio : de 3,8 5,0 l /100 km äł? de 98 115 g/km. (1) Exemple däł&#x201C;offre de Location Longue Dur e sans option däł&#x201C;achat portant sur un v hicule Kia Rio Origins 5 portes 1.2 essence 85 ch BVM5 avec peinture m tallis e et hors autres options. Mod le pr sent Kia Rio Origins Premium 5 portes 1.2 essence 85 ch ISG BVM5 avec option peinture m tallis e et hors offres autres options offre LLD 204 ä´ś TTC par mois. Offres dict es sur la base du tarif au 01/09/2016. Le contrat de location longue dur e sera imp rativement souscrit pourune dur e de 48 mois et un kilom trage de 40 000 km pour une Kia Rio Origins et Origins Premium incluant n cessairement les prestations entretien - assistance, gestion des pertes totales. Carte grise non incluse. Bonus ou Malus ventuels non inclus. Offre valable pour toute commande adress e valablement par crit Kia Lease avant le 31/12/2016, sauf modifications du tarif constructeur, des taux financiers directeurs ou de la r glementation en vigueur et notamment de la r glementation fiscale (variation du taux de TVA, etc...). Offre de location longue dur e sans option däł&#x201C;achat et de services associ s r serv e aux professionnels, r gie par les conditions g n rales de location longue dur e et des services optionnels disponibles aupr s de TEMSYS et sous r serve däł&#x201C;acceptation du dossier par TEMSYS, soci t anonyme au capital de 66 000 000 EUR, si ge social : 15, all e de läł&#x201C;Europe - 92110 Clichy, RCS NANTERRE 351 867 692. Soci t de courtage däł&#x201C;assurances - Garantie financi re et assurance de responsabilit civile professionnelle conformes aux articles L512-6 et L512-7 du code des assurances N ORIAS 07 026 677. Offres valables chez les concessionnaires participants.


R

EPĂ&#x2C6;RES [ CONJONCTURE

49 %

38



des dirigeants de TPE dĂŠclarent ĂŞtre prĂŠsents % sur Internet (+6 points par rapport Ă 2014), dont 69,9 % par le biais de leur propre site (+14,4 %). Pour valoriser leurs produits et services, 55,1 % des entrepreneurs font conďŹ ance aux sites des groupements professionnels, 54,4 % aux rĂŠseaux sociaux, 52 % aux sites collectifs et 51,1 % aux blogs professionnels. 22,8 % aďŹ&#x192;rment utiliser le site Internet de leurs partenaires - en prioritĂŠ celui de leur banque pour gĂŠrer leurs comptes Ă  distance -, 51,1 % se rendent ponctuellement sur les pages de leurs fournisseurs et 49 % sur celles des centres de gestion agrĂŠĂŠs. 63 % des dirigeants utilisent rĂŠgulièrement la messagerie ĂŠlectronique.

des chefs dâ&#x20AC;&#x2122;entreprise se dĂŠclarent optimistes pour leur propre activitĂŠ (+7â&#x20AC;&#x2030;points par rapport Ă avril). Lâ&#x20AC;&#x2122;indicateur de situation ďŹ nancière progresse de 4 points en trois mois. 73 % des dirigeants de TPE prĂŠvoient un maintien ou une augmentation de leurs ventes pour le trimestre Ă  venir. Ce regain dâ&#x20AC;&#x2122;optimisme se ressent sur les embauches avec une crĂŠation nette dâ&#x20AC;&#x2122;emplois de +2 %. La part des CDI sâ&#x20AC;&#x2122;ĂŠlève Ă  35 % tandis que la part des contrats dâ&#x20AC;&#x2122;apprentissage sâ&#x20AC;&#x2122;ĂŠtablit pour le 2e trimestre 2016 Ă 

Source : Observatoire de la petite entreprise n° 61 FCGA - Banque Populaire

QUALITĂ&#x2030; Au prix, les consommateurs dĂŠclarent privilĂŠgier la qualitĂŠ (quel que soit le secteur Ă lâ&#x20AC;&#x2122;exception des tĂŠlĂŠcommunications et des ĂŠquipements de loisirs) : 78 % dĂŠclarent ainsi que la qualitĂŠ est le critère le plus pertinent pour le choix des produits alimentaires. Treize caractĂŠristiques incitant Ă  payer plus cher ont ĂŠtĂŠ LGHQWLͤHV3DUPLHOOHVODͤDELOLWÂŤOĚľHÍŚFDFLWÂŤOHJR½WHWODV½UHWÂŤSUÂŤGRPLQHQW Les 18-24 ans en revanche plĂŠbiscitent la nouveautĂŠ et le design. CĂ´tĂŠ alimentation, les Français font partie des EuropĂŠens les plus exigeants. Au-delĂ  de la provenance gĂŠographique (des productions de lâ&#x20AC;&#x2122;Hexagone), les consommateurs recherchent aujourdâ&#x20AC;&#x2122;hui des facteurs ÂŤ rassurants Âť tels que les produits issus de lâ&#x20AC;&#x2122;agriculture biologique, naturels et des produits bruts fabriquĂŠs Ă  proximitĂŠ.

10 % des recrutements. Cette situation sâ&#x20AC;&#x2122;accompagne dâ&#x20AC;&#x2122;une baisse des demandes de crĂŠdit bancaire (de 17 Ă 13 %). Source : 63e Baromètre des TPE / IFOP, Fiducial

Source : CRĂ&#x2030;DOC, Consommation et modes de vie, n° 283, juin 2016

LES PME INVESTISSENT

Les statistiques de la Banque de France signalent Ă la ďŹ n juin 2016 une augmentation de lâ&#x20AC;&#x2122;encours des crĂŠdits accordĂŠs aux TPE de 4,4 % en un an, ainsi quâ&#x20AC;&#x2122;un recul du taux dâ&#x20AC;&#x2122;intĂŠrĂŞt des nouveaux crĂŠdits infĂŠrieurs Ă  250 000 â&#x201A;Ź (2,1 %).

Lâ&#x20AC;&#x2122;APPRENTISSAGE REMONTE Dâ&#x20AC;&#x2122;après la Dares, les contrats dâ&#x20AC;&#x2122;apprentissage ont connu une hausse de 5 % entre juillet 2015 et juin 2016 (283 953 nouveaux contrats). Au 1er semestre 2016, les entrĂŠes dans le secteur public et le secteur privĂŠ ont progressĂŠ respectivement de 46 % et 4 %.

Le Monde des artisans [ septembre/octobre 2016

82 FAD Šť

CRĂ&#x2030;DITS : +4,4 %

i

Selon la 63e enquĂŞte de conjoncture de la Bpifrance, 47 % des PME ont rĂŠalisĂŠ des investissements depuis dĂŠbut 2016 ou pensent le faire dâ&#x20AC;&#x2122;ici la ďŹ n de lâ&#x20AC;&#x2122;annĂŠe (contre 45 % il y a un an et 60 % en moyenne avant la crise de 2008).

LE COMMERCE PROGRESSE Lâ&#x20AC;&#x2122;Insee rĂŠvèle que lâ&#x20AC;&#x2122;activitĂŠ du commerce accĂŠlère en 2015 grâce, notamment, Ă la croissance de lâ&#x20AC;&#x2122;investissement des entreprises et Ă  lâ&#x20AC;&#x2122;accĂŠlĂŠration de la consommation. Lâ&#x20AC;&#x2122;activitĂŠ du petit commerce alimentaire (dont artisanat commercial) poursuit sa progression (+ 2,7 % en volume).


DĂ&#x2030;COUVREZ UNE OFFRE UNIQUE DE SOLUTIONS :

15-18 NOVEMBRE 2016 EUREXPO LYON, FRANCE

Exploitation forestière / Bois Ênergie

ES LES DAT NOUVEL

Machines et ĂŠquipements pour la 1ère transformation Machines et ĂŠquipements pour la 2nde transformation Fournitures pour lâ&#x20AC;&#x2122;industrie du meuble et lâ&#x20AC;&#x2122;agencement MatĂŠriaux bois

HOTLINE VISITEURS +33 (0)4 78 176 216 hotlinevisiteurs@gl-events.com SUIVEZ-NOUS

www.eurobois.net

lisa.neverre.fr - Fotolia

LE SALON DES Ă&#x2030;QUIPEMENTS ET DES TECHNIQUES DE LA TRANSFORMATION DU BOIS ET DU BOIS MATĂ&#x2030;RIAU

DEMANDEZ VOTRE BADGE SUR WWW.EUROBOIS.NET AVEC LE CODE PMMDA

Abonnez-vous au Monde des artisans $WNNGVKPČ&#x192;TGPXQ[GTCXGEXQVTGTČ&#x2039;INGOGPVČ&#x192;#6%5GTXKEGCDQPPGOGPVUTWG&WRQPVFGU.QIGUÇĄ/GV\(CZÇĄĹĄĹĄĹĄĹĄ Abonnement en ligne sur www.kiosque-atc.com/presse-pro-artisans.html CRĂ&#x2030;ER, ENTREPRENDRE ET RĂ&#x2030;USSIR

DANS LES MĂ&#x2030;TIERS

rtisans

6HSWHPEUHRFWREUHČ?Č&#x153;

LE MONDE DES

Oui, je mâ&#x20AC;&#x2122;abonne au Monde des artisans pour deux ans (12 numĂŠros) CWVCTKHRTČ&#x152;HČ&#x152;TGPVKGNFGÇĄGWTQU CWNKGWFGGWTQU

rtisans.fr Suivez-nous : www.lemondedesa

STRATĂ&#x2030;GIE

Le bien-être au travail : ça se cultive !

PrĂŠnom ..................................................................................................................................... Nom ................................................................................................................................................

PAGE

26

Profession ........................................................................................................................... Nombre de salariÊs .................................................................................................. Adresse ................................................................................................................................... ........................................................................................................................................................... Bimestriel n°114

TĂŠlĂŠphone ........................................................................................................................... DU 1ER AU 14 OCTOBRE : aux urnes, DOSSIER ĂŠvĂŠnement

Label EPV, dix ansâ&#x20AC;Ś et des projets ! P. 04

artisans ! p.06

Communication : travaillez votre diffĂŠrence P. 28

Fax ................................................................................................................................................ E-mail ......................................................................................................................................

â&#x153;

* Prix de vente au numĂŠro. Offre valable jusquâ&#x20AC;&#x2122;au 31/12/2016. Tarif dâ&#x20AC;&#x2122;abonnement 1 an, France : 9 euros. En application de la loi n° 78-17 du 6 juin 1978, vous disposez dâ&#x20AC;&#x2122;un droit dâ&#x20AC;&#x2122;accès et de rectification aux informations vous concernant reproduites ci-dessus. LMA vous prĂŠcise quâ&#x20AC;&#x2122;elles sont nĂŠcessaires au bon traitement de votre abonnement. Aucun abonnement ne sera souscrit sans votre règlement.


F

OCUS [ DEUX-SÃ&#x2C6;VRES

Bac Pro commerce

Le diplôme de la polyvalence et de la réussite pour votre entreprise .CHQTVGEQPEWTTGPEGÈ&#x192;NCSWGNNGNŨGPVTGRTKUGCTVKUCPCNGFGEQOOGTEGFQKVHCKTGHCEGGVNŨKORQTVCPEGFGNCÆ&#x2019;FÈ&#x152;NKUCVKQP de la clientèle impliquent lâ&#x20AC;&#x2122;adaptabilité des salariés et des jeunes diplômés aux évolutions sociétales, économiques et technologiques. Un enjeu auquel la formation peut répondre grâce au Baccalauréat professionnel commerce proposé au campus des métiers du centre de formation de la Chambre de métiers et de lâ&#x20AC;&#x2122;artisanat des Deux-Sèvres. Vincent Drochon, responsable du pôle services, en charge des formations commerce, répond à nos questions.

40

Le poids deNCITCPFGFKUVTKDWVKQPFCPUNG EQOOGTEGGUVVTÈ&#x2039;UKORQTVCPV.GUOQ[GPU OCTMGVKPIOKUGPÂ&#x2018;WXTGUQPVEQPUKFÈ&#x152;rables avec en particulier une pratique FŨCEJCVGPITQUSWKGPIGPFTGWPGEQPEWTrence KPÈ&#x152;ICNG UWT NGU RTKZ RQWT NG RGVKV EQOOGTEG2QWTUâ&#x20AC;&#x2122;adapter, les entreprises artisanales doivent développer une straVÈ&#x152;IKGSWKVKGPV compte de leur dimension, FGNGWTUOQ[GPURQWTEQPVTKDWGTÈ&#x192; leur RTQRTGGUUQT%GRGPFCPVGNNGUPGRGWXGPV pas toujours accéder au développement FG EGU PQWXGNNGU HQPEVKQPU FKHÆ&#x2019;EWNVÈ&#x152;U liées principalement au recrutement des EQORÈ&#x152;VGPEGUPÈ&#x152;EGUUCKTGU

LMA : Quelle réponse la formation apporte-t-elleâ&#x20AC;&#x2030;? La formation par alternance en contrat FŨCRRTGPVKUUCIGQWFGRTQHGUUKQPPCNKUCtion est la réponse que nous apportons, notamment avec le baccalauréat professionnel « commerce z#EEGUUKDNGGP troisCPUCRTÈ&#x2039;UWPGVTQKUKÈ&#x2039;OGQWGPdeux CPUCRTÈ&#x2039;UQDVGPVKQPFŨWP%#2EQPPGZG Les commerces traditionnels de vente alimentaire (DQWNCPIGTKGRÈ&#x2026;VKUUGTKG FG RTQFWKVUFŨWUCIGEQWTCPV(tabac-pressejeux, prêt-È&#x192;-porter)OCKUCWUUKNCITCPFG distribution et NG EQOOGTEG KPVÈ&#x152;ITÈ&#x152; [ trouvent leur compte pour que lâ&#x20AC;&#x2122;alternant puisse vendre, animer et assurer NCIGUVKQPEQOOGTEKCNG2QWTcela, nous

Le Monde des artisans [ septembre/octobre 2016

iš/10-';$75+0'55(161.+#%1/

Le Monde des Artisans : Comment se porte le secteur de la venteâ&#x20AC;&#x2030;?

comptons bien évidemment sur les entreprises pour quâ&#x20AC;&#x2122;elles recrutent et forment RCTCNNÈ&#x2039;NGOGPVNGUCRRTGPVKUECPFKFCVUÈ&#x192; ce PKXGCWFGHQTOCVKQP

LMA : Quel est le parcours de formation en vente proposé au campus des métiers ? 0QWU proposons un parcours complet, du CAP qui permet dâ&#x20AC;&#x2122;acquérir les compétences indispensables pour EQOOGPEGTÈ&#x192;GZGTEGTFCPUEGUGEVGWT dâ&#x20AC;&#x2122;activité, LWUSWŨCW $CE RTQHGUUKQPPGN %ŨGUVWPFKRNÈ&#x2013;OG qui permet dâ&#x20AC;&#x2122;entrer sur NGOCTEJÈ&#x152;FGNŨGORNQKFŨCEEÈ&#x152;FGTÈ&#x192;FGU RQUVGUÈ&#x192;TGURQPUCDKNKVÈ&#x152;OCKUCWUUKFG RQWTUWKXTGFGUÈ&#x152;VWFGUXGTUFGUFKRNÈ&#x2013;OGU UWRÈ&#x152;TKGWTUFGV[RG$65

LA FILIÃ&#x2C6;RE COMMERCE UN PARCOURS DIPLÃ&#x201D;MANT AU CAMPUS DES MÃ&#x2030;TIERS â&#x20AC;¢ Niveau V %#2GORNQ[È&#x152;FGXGPVGURÈ&#x152;EKCNKUÈ&#x152; option A produits alimentaires %#2GORNQ[È&#x152;FGXGPVG spécialisé option B RTQFWKVUFŨWUCIGEQWTCPV %#2GORNQ[È&#x152;FGEQOOGTEG multispécialités

â&#x20AC;¢ Niveau IV

Bac pro commerce

i Plus dâ&#x20AC;&#x2122;infos pour se former et apprendre un métier HQYHQWHÉ&#x2039;ZZZFPDQLRUWIU


pour passer votre

publicité dans LE MONDE DES

rtisans RMATION DE

RO TOUTE Lâ&#x20AC;&#x2122;INFO

DANS CE NUMÃ&#x2030;

VOTRE CMA

rtisans

RETROUVEZ Juillet-août 2016

â&#x20AC;¢ 1,50 â&#x201A;¬

LE MONDE DES

édition

es deux-sèvr age Apprentiss

La rentrée se prépare ! PAGE

04

Septembre-octo bre 2016 â&#x20AC;¢ 1,50

â&#x201A;¬

RETROUVEZ

FRQWDFWH]É&#x2C6;

THIERRY JONQUIÃ&#x2C6;RES ƪƯƷƫƩƹƫƺƷƪƫÇ&#x17E;ƺƨƲƯƩƯƹʤ 7«O

DANS CE NUM

Ã&#x2030;RO TOUTE Lâ&#x20AC;&#x2122;INF

rtisans édition

Bimestriel n°113

i

LE MONDE DES

ORMATION DE

VOTRE CMA

deux-sèvr es

neur p. 37

t un repre

ils cherchen

prix goût et à â&#x20AC;¦

tions ard-Favrelière, Florence Tav centre de Directrice du 06 la CMA 79 P. formation de

Trois ques

CÃ&#x2030;DRIC JONQUIÃ&#x2C6;RES ƩƮƫƬƪƫÇ&#x17E;ƺƨƲƯƩƯƹʤ 7«O

ntis santé des appre

pour Un podium le campus des rt P. 06 métiers de Nio

Deux-Sèvres

élections CMA

Bimestriel n°114

du 1er au 14 octobreâ&#x20AC;&#x2030;:

U

1ER

CTOB

QUI MIEUX QU

ils cherchen

Trois ques

tions à â&#x20AC;¦

Claire Paulic, Présidente de lâ&#x20AC;&#x2122;ADT des Deux-Sèv res P.

08

Reconnaissa nce

t un repreneu r p. 37

Trophée des femmes de lâ&#x20AC;&#x2122;artisanat P. 13 Deux-Sèvres


P

RESTIGE

Établi à Haguenau (67) où il a repris l’entreprise familiale, JeanLuc Hoffmann est à la tête d’une boucheriecharcuterie hyperconnectée. En phase avec son époque, l’Alsacien visionnaire a su savamment lier tradition et enjeux d’actualité.

išPHOTOS : MÉLANIE KOCHERT

MÉLANIE KOCHERT

42

JEAN-LUC HOFFMANN, BOUCHER-CHARCUTIER

m1RXVDYRQVEHDXFRXSWUDYDLOO«DĀQ de rendre le métier plus accessible, plus “sexy” et moins pénible pour les jeunes. » Un établissement centenaire

La maison Hoffmann a fêté ses 100 ans en 2015. Jean-Luc Hoffmann, 50 ans, est le 4e représentant d’une longue lignée de bouchers-charcutiers remontant à son arrière-grand-père. Lorsqu’il reprend l’entreprise avec son épouse en 1998, l’artisan rêve de travailler « à sa façon ». Comprenez avant tout : moderniser l’image traditionnelle du boucher « avec un crayon derrière l’oreille et le tablier taché de sang ». Mais aussi de donner à son enseigne un rang de référence régionale. « L’artisan est le pilier de l’économie locale. Sans lui, il n’y a plus de lien social », estime celui qui entend bien faire concurrence à la grande distribution avec son activité, grâce à des produits de qualité.

Le Monde des artisans [ septembre/octobre 2016

Former la relève

Jean-Luc Hoffmann s’occupe également de la formation au métier, qu’il préside au sein de la Fédération des bouchers-charcutiers d’Alsace. Assistant à l’ensemble des jurys, il connaît tous les apprentis du territoire. « Le métier était en tension il y a encore quelques années. Mais nous avons beaucoup travaillé CƒPFGNGTGPFTGRNWU accessible, plus “sexy“ et moins pénible pour les jeunes. Il y a clairement des débouchés pour eux aujourd’hui », estime le professionnel investi.


knack 2.0 Le roi de la

1915 CrĂŠation de lâ&#x20AC;&#x2122;entreprise par son arrièregrand-père. 1998 Jean-Luc Hoffmann prend la suite FĂŠru de nouvelles technologies

2QWTF[PCOKUGTNŨCEVKXKVČ&#x152;GVĆ&#x2019;FČ&#x152;NKUGTUGUENKGPVUEG chef dâ&#x20AC;&#x2122;entreprise exigeant imagine de nouveaux UGTXKEGUECTVGFGĆ&#x2019;FČ&#x152;NKVČ&#x152;UCEUKUQVJGTOGUCWZEQWleurs de lâ&#x20AC;&#x2122;enseigne, vente en ligneâ&#x20AC;Ś ÂŤ Un indĂŠpendant TČ&#x152;CNKUGOGUCHĆ&#x2019;EJGUOGUHN[GTUOCPGYUNGVVGTOQP site Internet et mon application smartphone. Âť Son e-boutique, reliĂŠe aux terminaux de caisse, permet aux clients de se faire livrer les plats du jour ou de rĂŠserver puis de rĂŠcupĂŠrer leur commande en magasin. Toujours Ă lâ&#x20AC;&#x2122;affĂťt de nouveautĂŠs, lâ&#x20AC;&#x2122;artisan ĂŠlabore dĂŠjĂ  sa prochaine ĂŠtape : des campagnes de communication par SMS auprès de sa clientèle dâ&#x20AC;&#x2122;habituĂŠs. Le rĂŠsultat est lĂ  : depuis la reprise, le chiffre dâ&#x20AC;&#x2122;affaires a ĂŠtĂŠ multipliĂŠ par quatre.

de lâ&#x20AC;&#x2122;entreprise

Reconnu pour sa dynamique et ses produits

familiale

Artisan et stratège commercial, Jean-Luc Hoffmann a ĂŠtĂŠ distinguĂŠ par le Prix national Stars & MĂŠtiers 2015* dans la catĂŠgorie dynamique commerciale. Une belle manière de saluer une stratĂŠgie de dĂŠveloppement et une dĂŠmarche originale dans la gestion de lâ&#x20AC;&#x2122;entreprise : ĂŠvĂŠnementiels, concours, spĂŠcialitĂŠs de saison, appui numĂŠrique et communication. Son prix sâ&#x20AC;&#x2122;expose en boutique aux cĂ´tĂŠs de toutes les autres rĂŠcompenses qui ont, jusquâ&#x20AC;&#x2122;ici, honorĂŠ lâ&#x20AC;&#x2122;homme et lâ&#x20AC;&#x2122;ĂŠtablissement : TrophĂŠe dâ&#x20AC;&#x2122;Or de lâ&#x20AC;&#x2122;Accueil, Knack dâ&#x20AC;&#x2122;Or, Jambon dâ&#x20AC;&#x2122;Or, PâtĂŠ dâ&#x20AC;&#x2122;Argent... Des rĂŠfĂŠrences sur lâ&#x20AC;&#x2122;autel de la gloire.

(4e gĂŠnĂŠration), accompagnĂŠ de son ĂŠpouse

43

Pascale. 2004 Ouverture dâ&#x20AC;&#x2122;une

* Dossier prĂŠsentĂŠ par la Chambre de mĂŠtiers et de lâ&#x20AC;&#x2122;artisanat dâ&#x20AC;&#x2122;Alsace et la Banque Populaire Alsace Lorraine Champagne.

succursale au centre de Haguenau. 2011 La boutique mère est entièrement refaite Ă neuf. Le chiffre dâ&#x20AC;&#x2122;affaires de

Une rĂŠfĂŠrence

Pour faire rayonner son enseigne, Jean-Luc Hoffmann prend des emplacements sur les marchĂŠs des environs. Il ouvre un deuxième point de vente en centre-ville de Haguenau, un espace stratĂŠgique pour sa vitrine. En NGOCICUKPRTKPEKRCNTQWVGFG5QWHHNGPJGKODČ&#x152;PČ&#x152;Ć&#x2019;EKGČ&#x152;ICNGOGPVFŨWPGXCUVGTČ&#x152;PQXCVKQPRQWTNGSWGN lâ&#x20AC;&#x2122;artisan choisit dâ&#x20AC;&#x2122;investir : pas moins de 900 000 â&#x201A;Ź pour ce chantier de 800 m2. ÂŤ Je voulais crĂŠer un ĂŠcrin de vente Âť, explique lâ&#x20AC;&#x2122;intĂŠressĂŠ, dĂŠsignant les 16 mètres de linĂŠaires oĂš sâ&#x20AC;&#x2122;alignent knacks et viandes Ă la FČ&#x152;EQWRG.GEJGHFŨGPVTGRTKUGGPRTQĆ&#x2019;VGRQWTTGPFTGUCDQWVKSWGRNGKPGOGPVCEEGUUKDNGCWZRGTUQPPGUČ&#x192; mobilitĂŠ rĂŠduite : rampe dâ&#x20AC;&#x2122;accès, bandes podotactiles, places handicapĂŠs...

lâ&#x20AC;&#x2122;entreprise fait un bond de 25 %.

i

ZZZERXFKHULHKRÎ?PDQQIU

Le Monde des artisans [ septembre/octobre 2016


V

IE D'ARTISANS

Ces artisans formateurs

Transmettre et partager Certains artisans aiment sortir de leurs ateliers pour former et accompagner la relève, les futurs porte-drapeaux de mĂŠtiers amenĂŠs Ă ĂŠvoluer. Ils sâ&#x20AC;&#x2122;investissent auprès des jeunes au sein des centres de formations. Ces pĂŠdagogues ne cherchent pas Ă  imposer leur technique, ils laissent la place Ă  lâ&#x20AC;&#x2122;expĂŠrimentation. DELPHINE PAYAN SOMPAYRAC

Garry Taffin, fleuriste

 Emmener les Êlèves le plus loin possible 

44

)CTT[6CHĆ&#x2019;PCCVVGKPVNGITCCNGPFGXGPCPVOGKNNGWTQWXTKGT de France en art floral. Enseignant Ă lâ&#x20AC;&#x2122;Urma dâ&#x20AC;&#x2122;Arras depuis 5 ans, il est dĂŠsormais dans le rĂ´le du transmetteur de passion, en essayant de rendre aux futurs artisans ce quâ&#x20AC;&#x2122;il a reçu Ă  lâ&#x20AC;&#x2122;ĂŠpoque. Dans lâ&#x20AC;&#x2122;ĂŠchange et le partage. Garry 6CHĆ&#x2019;PRQTVGWPTGICTFTČ&#x152;CNKUVGUWTUQPOČ&#x152;VKGTHNGWTKUVGGV sur la relève assurĂŠe par les ĂŠlèves quâ&#x20AC;&#x2122;il forme. ÂŤ Lâ&#x20AC;&#x2122;idĂŠe qui me guide, câ&#x20AC;&#x2122;est celle de transmettre ma passion et de bien expliquer le fond du mĂŠtier. Devenir fleuriste nâ&#x20AC;&#x2122;est pas une simple activitĂŠ professionnelle dans un environnement qui sent bon. Câ&#x20AC;&#x2122;est bien diffĂŠrent des images que lâ&#x20AC;&#x2122;on sâ&#x20AC;&#x2122;en fait : il faut travailler les dimanches et jours fĂŠriĂŠs, avoir rĂŠgulièrement les mains dans lâ&#x20AC;&#x2122;eau et ĂŠvoluer dans des tempĂŠratures plutĂ´t fraĂŽches. Câ&#x20AC;&#x2122;est un mĂŠtier passion, pour lequel on ne compte pas ses heures. Pour ma part, jâ&#x20AC;&#x2122;ai commencĂŠ par travailler dans une boutique,

Le Monde des artisans [ septembre/octobre 2016

i Facebook : *DUU\7DÉ?Q

et je suis devenu vacataire, puis enseignant, lorsque jâ&#x20AC;&#x2122;ai vendu mon affaire. Aujourdâ&#x20AC;&#x2122;hui, jâ&#x20AC;&#x2122;essaie dâ&#x20AC;&#x2122;emmener les ĂŠlèves, jeunes et moins jeunes, de 16 Ă 52 ans, le plus loin possible, vers les diplĂ´mes tels que le CAP, le BP ou dans leur souhait de reconversion professionnelle. Je me rends compte que tous nâ&#x20AC;&#x2122;ont pas mon ambition. Jâ&#x20AC;&#x2122;avais envie de passer des concours comme celui de MOF par FČ&#x152;Ć&#x2019;RGTUQPPGN0QWUUQOOGUFGUCTVKUCPUCXCPVVQWV FQPEUKNGUČ&#x152;NČ&#x2039;XGUUQPVĆ&#x2019;GTUFŨCXQKTWPHQTOCVGWT/1( tous ne prĂŠtendent pas suivre ce chemin. Ă&#x20AC; lâ&#x20AC;&#x2122;Urma dâ&#x20AC;&#x2122;Arras, nous disposons dâ&#x20AC;&#x2122;un très bel outil pour apprendre le mĂŠtier. Certains jeunes deviendront vendeurs en boutique, dâ&#x20AC;&#x2122;autres ouvriront leur enseigne, certains, comme MĂŠlanie Louchart, en 1re annĂŠe de BP, iront encore plus loin. Elle vient de dĂŠcrocher le titre de MAF Ă  Albi. Mon TČ&#x2013;NGGUVFŨCEEQORCIPGTVQWUNGURTQĆ&#x2019;NUz


VIE D'ARTISANS [ TRANSMETTRE ET PARTAGER

Steven LeprizĂŠ, ĂŠbĂŠniste

ÂŤ Les jeunes souhaitent laisser une trace, faire ĂŠvoluer le mĂŠtier Âť

le mĂŠtier, en passant aussi du temps dans la rĂŠflexion, la crĂŠation, la recherche et le dĂŠveloppement. Si le rĂŠsultat est que lâ&#x20AC;&#x2122;on sâ&#x20AC;&#x2122;inspire de nos produits, câ&#x20AC;&#x2122;est que nous avons rĂŠussi. Âť i

www.arca-ebenisterie.fr

45

iĹĄKARINE DEMEYER

Steven LeprizĂŠ, ĂŠbĂŠniste formĂŠ Ă lâ&#x20AC;&#x2122;ĂŠcole Boulle, y revient dĂŠsormais pour transmettre les gestes, un ĂŠtat dâ&#x20AC;&#x2122;esprit, WPGEWNVWTGFGNCOCVKČ&#x2039;TG.ŨCTVKUCPUGFČ&#x152;Ć&#x2019;PKVNWKOČ?OG comme nâ&#x20AC;&#x2122;ĂŠtant pas le roi des pĂŠdagogues. Pourtant, il aspire Ă  transmettre au maximum la culture qui est la sienne, celle du compagnonnage. ÂŤ Je nâ&#x20AC;&#x2122;ai pas intĂŠgrĂŠ le circuit, mais je considère que cet ĂŠtat d'esprit est une question de culture. Je suis devenu ĂŠbĂŠniste par IQČ&#x203A;VFWEQPETGVLGUQWJCKVCKURTQFWKTGSWGNSWGEJQUG inspirĂŠ par mes parents, restaurateur et entrepreneur. Aujourdâ&#x20AC;&#x2122;hui, au sein de lâ&#x20AC;&#x2122;atelier machines de lâ&#x20AC;&#x2122;ĂŠcole Boulle, jâ&#x20AC;&#x2122;ĂŠpaule les ĂŠlèves Ă  lâ&#x20AC;&#x2122;usinage, jâ&#x20AC;&#x2122;aide Ă  la modĂŠlisation 3D. Dans mon entreprise, depuis 2009, jâ&#x20AC;&#x2122;ai ĂŠgalement pris avec moi trois apprentis. Il y a toujours des stagiaires avec nous qui travaillent sur des sujets dĂŠjĂ  en crĂŠation, ou des projets de maquette, croquis, matĂŠriaux, et qui puisent dans nos innovations leurs propres crĂŠations, comme une nourriture qui permet de pĂŠrenniser les gestes, le mĂŠtier. Tous les jeunes que je cĂ´toie sont comme nous tous, artisans : ils souhaitent laisser une trace, faire ĂŠvoluer le mĂŠtier dans ce quâ&#x20AC;&#x2122;il a de pointu et moderne. Notre mission est de miser sur le matĂŠriau de FGOCKPEGNWKSWKUGTCUWHĆ&#x2019;UCOOGPVWPKSWGRQWTKPVČ&#x152;resser les investisseurs amateurs de bois, dâ&#x20AC;&#x2122;innovation, de qualitĂŠ et de savoir-faire. Les artisans de demain qui rĂŠussiront dans le mĂŠtier sont ceux qui ĂŠvolueront avec

CONSEILS Dâ&#x20AC;&#x2122;EXPERT GILLES LANGLO,

DIRECTEUR DU CAMPUS DES MĂ&#x2030;TIERS ET DE L'ARTISANAT DE LA CMA D'INDRE-ET-LOIRE Voici ses conseils pour devenir artisan formateur : Ne pas confondre le formateur en CFA et le formateur en entreprise. Les deux peuvent ĂŞtre excellents, mais ils ne font pas le mĂŞme mĂŠtier. De la mĂŞme manière, un excellent artisan ne fait pas toujours un bon pĂŠdagogue. Lâ&#x20AC;&#x2122;inverse est vrai aussi. Nul besoin dâ&#x20AC;&#x2122;ĂŞtre MOF pour ĂŞtre bon pĂŠdagogue par exemple. Lâ&#x20AC;&#x2122;objectif du formateur ne doit pas ĂŞtre de montrer ce quâ&#x20AC;&#x2122;il sait faire et chercher Ă le faire reproduire Ă  tout prix, puisque lâ&#x20AC;&#x2122;essence mĂŞme de lâ&#x20AC;&#x2122;entreprise artisanale est dâ&#x20AC;&#x2122;ĂŞtre dans lâ&#x20AC;&#x2122;innovation permanente, lâ&#x20AC;&#x2122;adaptation continue, la gestion de lâ&#x20AC;&#x2122;inattendu. Le formateur doit repĂŠrer chez lâ&#x20AC;&#x2122;apprenant ce qui fonctionne dans ses compĂŠtences et accompagner son expĂŠrience et son tour de main : ÂŤ fais-toi toi-mĂŞme Âť plutĂ´t que ÂŤ tais-toi et regarde Âť. Devenir formateur est rĂŠgi par le Code du travail selon ces critères : le diplĂ´me doit ĂŞtre ĂŠgal ou supĂŠrieur Ă  celui visĂŠ par les apprentis, il faut au moins deux ans dâ&#x20AC;&#x2122;expĂŠrience au cours des dix dernières annĂŠes, avoir une candidature solide pour contacter les CFA, chambres consulaires ou sites de recrutement. RĂŠflĂŠchissez avant de vous lancer. Sâ&#x20AC;&#x2122;il est tout Ă  fait honorable dâ&#x20AC;&#x2122;ĂŠprouver le dĂŠsir de partager votre capital personnel, lâ&#x20AC;&#x2122;essentiel pour un bon formateur est de tĂŠmoigner de sa compĂŠtence aux autres qui en feront leur grain.

Le Monde des artisans [ septembre/octobre 2016


O

PINION

« L’artisanat est un vivier de l’innovation » L’INPI L’Institut national de la propriété industrielle est un établissement public CWVQƒPCPEȌRNCEȌUQWUNCVWVGNNG du ministère de l’Économie, de l’industrie

išDR

ANTOINE GINESTET En charge des Indications géographiques artisanales à l’INPI.

et du numérique. Il a notamment pour mission de recevoir les dépôts et de délivrer les titres de propriété industrielle comme les créations techniques (brevets) ou les signes

46

En donnant un monopole d’exploitation pour une période déterminée, la propriété industrielle fournit à l’entrepreneur des moyens d’agir contre les contrefacteurs et les pratiques déloyales. Différentes protections existent et, depuis peu, les indications géographiques pour produits non-alimentaires. PROPOS RECCUEILLIS PAR SOPHIE DE COURTIVRON

LMA : L’artisanat est-il concerné par la propriété industrielle ?

LMA : Quelles solutions existent pour les artisans ?

Antoine Ginestet : Nous vivons dans un monde de plus en plus juridique et judiciaire. L’artisan doit se poser cette question : « suis-je bien sûr de n’avoir rien à protéger ? » Aux États-Unis, on a vu des inventeurs isolés copiés par des marques parvenir à faire reconnaître leurs droits après trente ans de combat ! Celui qui a protégé sa marque ou son invention a un droit à faire valoir en justice ; il aura gain de cause. La garantie juridique est le but du jeu de toute propriété industrielle, qui est aussi dissuasive. L’artisanat est un vivier de l’innovation ; depuis dix ans le métier de cadreur de vélo renaît ; le Concours de machines d’Ambert – présentant les innovations des constructeurs – n’avait pas eu lieu depuis 1949 et est ressuscité en 2016…

A. G. : Le dépôt de brevet concerne des entreprises plutôt importantes car il requiert une culture de la propriété industrielle. Pour le dépôt de marque ou de nom, nous avons un très fort pourcentage de petites sociétés ou de personnes privées ; EGNCEQțVGGWTQURQWTdix ans. Nous avons vingt délégations régionales sur le terrain qui ciblent les petites entreprises et les artisans et proposent une gamme de prestations, comme le pré-diagnostic, gratuit, qui comprend la visite d’un expert.

Le Monde des artisans [ SEPTEMBRE/OCTOBRE 2016

LMA : Quid des indications géographiques ? A. G. : Leur but est de trier le bon grain de l’ivraie. Nous avons un partenariat avec l’APCMA et avec le label EPV* pour KFGPVKƒGTNGURTQFWKVUȌNKIKDNGU. À ce jour,

distinctifs (marques, noms de domaines, appellations d’origine, indication de provenance).

i

www.inpi.fr

150 le sont, quatre demandes sont en cours (les sièges de Liffol-le-Grand, les espadrilles de Mauléon, deux pour le savon de Marseille) et une vingtaine à venir. C’est une personne morale - association, syndicat professionnel… - qui fait la demande. Le cahier des charges comprend 12 points dont 4 principaux : le lien entre le produit et le territoire ; la description du procédé de fabrication (le tronc commun entre toutes les entreprises)š; un plan FG EQPVTȖNG FȌƒPK avec l’organisme de EQPVTȖNGNCFȌƒPKVKQPFGNC\QPG géographique. J’échange beaucoup en amont avec les entreprises pour les conseiller et faciliter l’examen du dossier. Je travaille l’aspect juridique, sollicite tel ou tel spécialiste… La procédure dure entre 10 et 20 mois. Quand la première homologation sortira, cela fera du bruit ! * Entreprise du patrimoine vivant


Chef d’entreprise ?

Exigez un expert-comptable qui connaisse votre métier

PRÉVISIONNEL D’ACTIVITÉ

ASSISTANCE JURIDIQUE

COMPTABILITÉ DE PROXIMITÉ

SUIVI ANALYTIQUE

PARTENAIRE CONSEIL

DÉCLARATIONS FISCALES

SOCIAL & PAIE

CROISSANCE D’ACTIVITÉ

TABLEAUX DE BORDS

Gestélia Deux-Sèvres 1 Rue d’Abrantès 79200 Parthenay

Tél : 05.49.71.28.00 INSCRIT AU TABLEAU DE L’ORDRE DES EXPERTS-COMPTABLES

NOUVEAU NISSAN NAVARA King Cab dCi 160 OPTIMA

NISSAN NV200 FOURGON 4 PORTES dCi 90 OPTIMA

RETROUVEZ-NOUS SUR GESTELIA.FR

NISSAN e-NV200 FOURGON 100% ELECTRIQUE

NISSAN NV400 FOURGON L1H1 2T8 dCi 110 OPTIMA

**

5 ANS DE GARANTIE SUR NOS UTILITAIRES*. JOUEZ LES PROLONGATIONS AVEC NISSAN.

Nissan, partenaire officiel de l’UEFA Champions League.

Rendez-vous dès maintenant sur nissan-entreprise.fr

NISSAN CARLIANCE RUE DES GUILLÉES - NIORT/CHAURAY - 05 49 08 28 88 FLEURY AUTO SAS - AGENT SERVICE - FONTENAY-LE-COMTE - 02 51 69 23 76 BMSO – AGENT SERVICE – THOUARS – 05 49 96 18 18


Le terminal de paiement électronique sans fil à connecter à votre smartphone*. Smart TPE est une offre monétique soumise à conditions générales et tarifaires, qui nécessite la signature préalable d’une convention de compte et d’un contrat d’acceptation de paiement de proximité avec votre Caisse régionale ainsi qu’un contrat de service et un contrat de vente avec Monecam. L’utilisation de Smart TPE suppose le téléchargement d’une application sur un smartphone, connecté en mode Bluetooth à un lecteur de cartes bancaires. Offre monétique distribuée et gérée par Monecam, société du Groupe AVEO, SAS au capital de 160 000 €, dont le siège social est situé 2, quai du Commerce à Lyon (69009), immatriculée au RCS de Lyon sous le no 384 804 258. * Téléphone intelligent.

ca-cmds.fr

Dans la limite ibles. des stocks dispon

Efficacité, rentabilité, sécurité. Faites la course en tête. Mercedes-Benz Sprinter. La solution de transport idéale.

Saint-Jean-d’Angély 05 46 59 03 03 Lagord 05 46 67 78 05 Niort 05 49 33 90 00

Distributeur Mercedes-Benz

(1) Prix conseillé clés en main pour un Sprinter Worker Fourgon 210 32N 3t0. Offre exclusivement réservée aux professionnels, hors loueurs et flottes, valable pour tout Sprinter Worker Fourgon 210 32N 3t0 commandé avant le 31/12/2016 et livré avant le 30/04/2017. Offre non cumulable. Modèle présenté : Sprinter 210 CDI 37S au tarif conseillé de 24 370 €HT clés en main au 01/04/2015 + portes AR W54 rabattables à 270° + peinture métallisée argent adamentin 9744.

Crédit Photos : Thinkstock

# SMART TPE

0 8 / 2 0 16 - C 3 9 0 5 1 - É d i t é p a r C a i s s e R é g i o n a l e d e C r é d i t A g r i c o l e M u t u e l d e C h a r e n t e - M a r i t i m e D e u x - S è v r e s Société Coopérative à Capital Variable agréée en tant qu’établissement de Crédit. Siège social : 12 boulevard Guillet Maillet 17117 SAINTES CEDEX - 399 354 810 RCS Saintes (jusqu’au 30 septembre 2016) et 14 rue Louis Tardy 17140 LAGORD - 399 354 810 RCS La Rochelle (à partir du 1er octobre 2016). Société de Courtage d’Assurance Immatriculée au Registre des Intermédiaires en Assurance sous le numéro : 07 023 464..

Où que j’aille, les règlements de mes clients suivent.

Le monde des artisans n°114 - septembre octobre 2016  
Le monde des artisans n°114 - septembre octobre 2016  

Le magazine des artisans - édition des Deux-Sèvres.

Advertisement