Issuu on Google+

The End Of The Year Issue !"#$%&'(%)"$%*%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&+,--%!./01%2134%5#67$(%89/0":(%;#1$%<<<<'%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%=>3.#%'-&? @@@$ABC/A.3AD.0$A"E%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%FG>39//%51G%H.IC%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%J*K?L%<'<M-<K-

Seniors got spirit !"#$%&'())

PHOTO BY SABRINA GAGGIA

PHOTO SUBMITTED BY SOPHIA MARCHETTI

PHOTO BY ANNA SCHIFTER

PHOTO BY DANIELLE BUSH

PHOTO SUBMITTED BY OSWALDO RODRIGUEZ

PHOTO SUBMITTED BY SHARI BUSH

!CAUSE WE"RE HAPPY: (clockwise from top left) Melissa Raudt dressed up for "90s day. Dara Herman (left), Madison Danoff (center) and Kat MacNeal dress up as the PowerPuff Girls for "90s day. (from left to right standing) Victoria Arevalo, Ivanna Hurtado, Oswaldo Rodriguez, Yovama Lanz, Catherine Jimenez, (from left to right kneeling) Paola Lozano and Sara Velez wear black for the blackout. Some of the senior class wear their college apparel on college day. (from left to right) BRACE adviser Shari Bush, Shelby Graff, Jennifer Miller, Alex Weiss, Jessica Stuart and Rachel Lesnik wear University of Michigan apparel for college day. (from left to right) Sophia Marchetti, winner of the week long contest, and Gina D!Onofrio dress up for pajama day.

Changes to SAT will impact Class of 2017 and beyond BY ALEXA STEINLAUF EDITOR-IN-CHIEF

When the College Board announced that changes were going to be made to the SAT, many students believed the test was going to be easier, but Broward Tutorial Services tutor Mike Eldeiry said that is one of the common misunderstandings about it. â&#x20AC;&#x153;I think one of the big misconceptions

is that people think that are dumbing the test down, and that is really not the case,â&#x20AC;? Mr. Eldeiry said. â&#x20AC;&#x153;It is still going to separate kids based on their level. It will just require more critical thinking skills rathHU WKDQ Ă DVKFDUGV JLPPLFNV DERXW KRZ many questions to answer.â&#x20AC;? The new SAT will be taken by the Class of 2017 and will be more of a similar test to the ACT. The writing is now a strictly optional component. The score

is going to be based out of 1600 instead of 2400, and students will no longer get a quarter of a point off for every wrong answer. BRACE adviser Shari Bush said the FKDQJHVZLOOEHEHQHĂ&#x20AC;FLDOWRWKHVWXGHQWV and they will perform better on this exam. â&#x20AC;&#x153;I think that it may be a little easier,â&#x20AC;? Mrs. Bush said. â&#x20AC;&#x153;I think students will do better and then colleges will have to change the range of scores that they are

looking for. Traditionally, most of the better schools have only been looking at the reading and the math scores anyway, so this will just make it a little easier for them.â&#x20AC;? Mr. Eldeiry said although he agrees with some of the changes made to the test, he believes the SAT changed the test for the wrong reasons. SAT story, page 9

inside OPINION: Cypress Bay should offer summer courses for students.

ALMOST THERE: Everyone!s thoughts are on summer.

13

16

PROMPOSALS: Students get creative when asking their dates to prom.

19


2

NEWS

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

APRIL 2014

Testing schedule saves class time BY ALEX ZEIDEL

Day 1: Biology Day 2: Algebra 1 Day 3: Geometry

/DVW \HDU &\SUHVV %D\ ZDV WKH Ă&#x20AC;UVW school to try condensing the 15 end-ofyear exam days into three. This year, 12 schools in Broward County will be following in its footsteps. â&#x20AC;&#x153;Cypress has been going to district meetings in which numerous schools saw the success we had,â&#x20AC;? reading specialist Adrienne Maisel said. End of Course (E0C) exams began on April 28 and so far students have taken the Biology exam. The next two Mondays will also be designated for EOC testing, Algebra being on May 5 and Geometry on May 12. Students who do not have tests on these days still can come to school, but not for their normal classes. Instead there will be practice exams for AP and AICE classes, as well as SAT and ACT exams available. Mrs. Maisel said all exams will be taken on the computer with approximately 1,000 students testing for Biology, 900 students for Algebra and 1,000 students for Geometry. Parent volunteers, JROTC students and students taking the computer class will be checking the computers to make sure all 600 will be working for testing days, Mrs. Maisel said. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re focusing this year on making sure all students know exactly where and what time they will be needed to test. We want all students to know before the day of the test where to be,â&#x20AC;? Mrs. Maisel said. Sophomore Maria Cardenas said having set days for EOC testing helps stuGHQWV IRFXV MXVW RQ WKH VSHFLĂ&#x20AC;F WHVW DQG not have to worry about other classes.

Practice Tests: -AP English Language -AP English Literature -AP Art -AP Art History -AP Biology -AP Comparative Government -AP Computer Science -AP Economics -AP European History -AP French -AP Human Geography -AP Italian -AP Latin -AP Music -AP Physics -AP Spanish Language -AP Spanish Literature -AP US History -AP Psychology -AP Chemistry -AP Environmental Science -Algebra EOC Practice -Geometry EOC Practice -SAT/ACT Practice Test -AICE General Paper -AICE Business Studies -AICE Spanish -AICE Music -AICE Biology -AICE Language -AICE Thinking Skills

Practice Tests: -AP English Language -AP English Literature -AP Art -AP Art History -AP Biology -AP Comparative Government -AP Computer Science -AP Economics -AP European History -AP French -AP Human Geography -AP Italian -AP Latin -AP Music -AP Physics -AP Spanish Language -AP Spanish Literature -AP US History -Geometry EOC Practice -SAT/ACT Practice Test -AICE General Paper -AICE Business Studies -AICE Spanish -AICE Music -AICE Biology -AICE Language -AICE Thinking Skills

Practice Tests: -AP Comparative Government -AP Economics -AP European History -AP Human Geography -AP Italian -AP Spanish Literature US History -AP US Government -SAT/ACT Practice Test -AICE Business Studies -AICE Music -AICE Biology -AICE Thinking Skills

GRAPHIC BY BEATRIZ GALDONA AND ALYSSA LEVIN

â&#x20AC;&#x153;I couldnâ&#x20AC;&#x2122;t imagine having to come to school to take my EOC and then have to go back to a normal day of school,â&#x20AC;? Cardenas said. â&#x20AC;&#x153;Taking the EOC can be tiring and after Iâ&#x20AC;&#x2122;m done all I want to do is go home.â&#x20AC;? Mrs. Maisel said deciding to move testing a week earlier allows students to have the opportunity to have review exams for all classes. ´/DVW\HDUWKHĂ&#x20AC;UVW0RQGD\RI(2& testing was also the day of testing for the AP Psychology exam, so these students didnâ&#x20AC;&#x2122;t have the opportunity to take the practice exam. This year everyone has

the opportunity to have at least one day of choosing any exam offered,â&#x20AC;? Mrs. Maisel said. Sophomore Jonathan Nudelman said the practice tests being offered is a great way for him to get extra preparation. â&#x20AC;&#x153;I will be taking the ACT practice exam because soon I will be taking the actual test. Getting a little practice in before will prepare for whatâ&#x20AC;&#x2122;s to come,â&#x20AC;? Nudelman said. Mrs. Maisel said there will be 700 students taking the AP Psychology exam and 300 students taking the AP Spanish exam on the same day as EOC testing.

â&#x20AC;&#x2DC;This works out because it minimizes students having to miss class due to having days set to just testing,â&#x20AC;? Mrs. Maisel said. Buses will be making two rounds in the morning and three rounds in the afternoon, which gives students testing in both sessions guaranteed transportation to arrive and leave according to whatever time they need to test. Sophomore Danielle Nicolay said the numerous bus rounds gives her the opportunity to come later to school if she is testing in the second session. â&#x20AC;&#x153;I really like how Cypress has organized the buses to come back to the bus stops around 8:30 for second session students, because it allows me to sleep in and be fully rested for my test,â&#x20AC;? Nicolay said. â&#x20AC;&#x153; Knowing there is a sweeper bus [at the end of the day], also relieves the stress if I take a little extra time on my test.â&#x20AC;? Geometry teacher Ana Alonzo said she highly favors the new testing schedule because it leads to fewer disruptions in her classroom. She feels students as well as teachers following this testing schedXOHEHQHĂ&#x20AC;WLQKDYLQJPRUHWLPHOHDUQLQJ and teaching. â&#x20AC;&#x153;Having only three days for testing helps me because it only takes away from three days of me teaching my students math they need to know,â&#x20AC;? Mrs. Alonzo said. â&#x20AC;&#x153;In previous years when testing was for 15 days, either I had to be proctoring or my students would be pulled out of the classroom to test. This would interfere for at least a month of me teaching.â&#x20AC;?

CBTV hosts Camp Cypress to help underprivileged children BY ANA BEATRIZ GONCALVES

Senior and co-chair Nathalia Iole watched the bright yellow school busses pull up with 200 smiling children inside, DZDLWLQJWKHDFWLRQĂ&#x20AC;OOHGGD\DKHDG2Q Saturday, April 5, CBTV hosted its fourth annual Camp Cypress. â&#x20AC;&#x153;Camp Cypress is CBTVâ&#x20AC;&#x2122;s largest community service event,â&#x20AC;? Iole said. â&#x20AC;&#x153;We invite children from the inner cities and let them come to Cypress to just enjoy themselves.â&#x20AC;? More than 200 elementary school kids from the inner city were invited to this event that took place all over campus. â&#x20AC;&#x153;They come from rough places in Fort Lauderdale and come for a day to do camp activities,â&#x20AC;? said co-chair Agustina Biasutto, a sophomore. â&#x20AC;&#x153;Personally, to know that I am making a difference to these kids makes it all worth the effort.â&#x20AC;? Camp Cypress is meant for kids to enjoy themselves and forget about their troubles. This year, the students came from North Fork Elementary School. â&#x20AC;&#x153;They come from underprivileged areas ,â&#x20AC;? Iole said. â&#x20AC;&#x153;So for them to come

to Cypress and bounce in some bounce houses, eat snow cones, play games, do arts and crafts, itâ&#x20AC;&#x2122;s just a good way for them to have all that and have fun.â&#x20AC;? Since CBTV hosts it, Camp Cypress is completely student-run with minimal staff assistance. â&#x20AC;&#x153;My only part in this is making sure everything is â&#x20AC;&#x2DC;legalâ&#x20AC;&#x2122;,â&#x20AC;? said CBTV adviser Kurt Doster. â&#x20AC;&#x153;The chairs and co-chairs are the ones who plan absolutely everything. My only job is to sign the check and make sure that the task is correct and according to school policy.â&#x20AC;? Despite being hosted by CBTV, Camp Cypress, invites counselors from all parts of the Bay. â&#x20AC;&#x153;Most people think that since CBTV hosts Camp Cypress, we only get counselors from CBTV,â&#x20AC;? Biasutto said. â&#x20AC;&#x153;We donâ&#x20AC;&#x2122;t. We want the entire school to participate and be counselors and have fun with the kids as much as we do.â&#x20AC;? CBTV is always looking for counselors every year from all over the Bay and unlike the common belief, do not discriminate if applicants are not from TV Production.

PHOTO SUBMITTED BY CBTV

HANG IN THERE: Elana Gold carries a child from North Fork Elementary. More than 200 children were invited to the event on April 5.

â&#x20AC;&#x153;CBTV is a really warm and inviting group,â&#x20AC;? said senior Dara Herman, one of the non-CBTV counselors. â&#x20AC;&#x153;They welcome you with open arms to Camp Cypress and encourage other people to join. And it is really worth joining. When you

see the kids at the end of the day going home, you know that you made a difference by giving them just this one day.â&#x20AC;? Camp Cypress is scheduled to happen again next year in mid-April.


ADVERTISEMENT

APRIL 2014

WWW.CBHSCIRCUIT.COM

THE CIRCUIT

5,000

$

IN SCHOLARSHIPS

Write an essay to apply. APPLY BY

MAY 30

YoungFreeFlorida.com

CURRENCY MARKETING Job # FL

Bleed None

Filename

Account Executive: Kate Davies FL - Scholarship 2014 10x15.indd Cyan Magenta

Last Modified Initials Date

4-2-2014 8:53 AM

Prev. User

PROOF 2 Kevin Castillo / Kevin Castillo

D O C U M E N T PAT H Groups:currency:Active:Young & Free:FL - Tropical Financial:Creative:2014 Scholarship:FL - Scholarship 2014 10x15.indd

3


4

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

NEWS

APRIl 2014

Blood drive screens for bone marrow BY TARA BAGHERLEE

Closing off the year with its last blood drive, Future Medical Practitioners (FMP) held the fourth quarterâ&#x20AC;&#x2122;s blood drive on April 15-16 in the OneBlood â&#x20AC;&#x153;Blood Busâ&#x20AC;? and in room 207 with a special purpose added on to its usual mission: a bone marrow screening for Dorcileo Contro, husband of Cristina Contro, who is a secretary and general clerk in the IURQWRIĂ&#x20AC;FH 0U &RQWUR LV FXUUHQWO\ LQ UHPLVVLRQ from acute myeloid leukemia, searching for a bone marrow match to his A negaWLYHEORRGW\SH ´2Q 'HF   &KULVWPDV QLJKW ZHIRXQGRXWJRLQJWRWKH(5WKDWKHKDV OHXNHPLDÂľ 0UV &RQWUR VDLG ´+LV W\SH RIOHXNHPLDLVYHU\DJJUHVVLYH,W¡VFDOOHG acute myeloid leukemia, and he really QHHGVDWUDQVSODQW:LWKRXWDWUDQVSODQW KHFDQ¡WVXUYLYHÂľ 0U &RQWUR ZDV XQGHUJRLQJ KLV VHFond round of chemotherapy at the time of the blood drive, and he was in good conGLWLRQ$WĂ&#x20AC;UVWKHUKXVEDQGZDVLQWKHKRVpital for a long time, but now his state is LPSURYLQJDVKHVWD\VLQUHPLVVLRQ FMP sponsor and Anatomy and PhysLRORJ\WHDFKHU1RUL6XDUH]VDLG0U&RQtro is extremely fortunate, and that remission is the time to begin screening for a GRQRU ´+HU KXVEDQG LV OXFN\ WR EH LQ UHmission, and once youâ&#x20AC;&#x2122;re in remission is ZKHQ\RXFDQDFWXDOO\JHWWKHPDWFK6R VFUHHQLQJ LV WKH EHVW PHWKRG RI Ă&#x20AC;QGLQJ WKHPDWFKDVVRRQDVSRVVLEOHÂľ0V6XDUH]VDLG OneBloodâ&#x20AC;&#x2122;s community relations coRUGLQDWRU 5KRQGD 0F.HQ]LH H[SODLQHG the bone marrow screening is completed by swabbing the inside of oneâ&#x20AC;&#x2122;s cheek ZLWKDFRWWRQEDOO7KURXJKWKHVZDELWLV easy to detect oneâ&#x20AC;&#x2122;s DNA and antigens to VHHLIWKH\Ă&#x20AC;WWKHPDWFK â&#x20AC;&#x153;A lot of people donâ&#x20AC;&#x2122;t understand or GRQ¡W NQRZ WKH VLJQLĂ&#x20AC;FDQFH RU WKH LPportance of being a bone marrow donor,â&#x20AC;? 0V 0F.HQ]LH VDLG ´7KHVH SHRSOH FDQ

PHOTO BY TARA BAGHERLEE

HOW TO SAVE A LIFE: Junior Nico Calderon was willing to donate blood while also being screened for bone marrow.

RQO\ Ă&#x20AC;QG D PDWFK ZKLFK LV RQH LQ HYHU\9HU\UDUHO\\RXĂ&#x20AC;QGDPDWFK 7KH PRUH SHRSOH WKDW UHJLVWHU WKH EHWter chance they have at curing cancer or VLFNOHFHOOGLVHDVHVDQGĂ&#x20AC;QGLQJDPDWFK IRUWKHPÂľ 0UV &RQWUR VDLG EHVLGHV KDYLQJ D matching blood type, possible donors must share other aspects of their blood ZLWK 0U &RQWUR DV ZHOO LQFOXGLQJ SURWHLQV7KHUHDUHSURWHLQVLQWKHEORRG and the donor has to have at least eight of those proteins matching with the person ZKRLVJRLQJWRUHFHLYHWKHERQHPDUURZ 0UV &RQWUR VDLG VKH ZRXOG GR DQ\WKLQJWRĂ&#x20AC;QGDGRQRU ´7KLV SHUVRQ ZRXOG VDYH P\ KXVEDQG¡V OLIHÂľ 0UV &RQWUR VDLG ´, GRQ¡W NQRZZKDW,ZRXOGGR,ZRXOGGRHYHU\WKLQJ,ZRXOGJLYHP\OLIHWRWKHSHUVRQ LI,FRXOGÂľ 0V0F.HQ]LHVDLGWKHUHDUHWZRSURcedures to extract bone marrow, although the peripheral blood stem cells (PBSC) method is much more modern and works

just as well as the traditional â&#x20AC;&#x153;extracting of bone marrow,â&#x20AC;? which is done through WKHSHOYLFERQH â&#x20AC;&#x153;Peripheral blood stem cell is done through the vein, just like a blood donation, but it separates the white from the UHJXODU ZKROH EORRGÂľ 0V 0F.HQ]LH VDLG´)LYHGD\VEHIRUH\RXUDFWXDOGRQDWLRQ\RXJHWDVKRWRIDGUXJFDOOHGĂ&#x20AC;OJUDVtim which will boost up your white blood VWHPFHOOVÂľ 0V 0F.HQ]LH DOVR VDLG UDFH SOD\V DODUJHUROHLQĂ&#x20AC;QGLQJDPDWFKIRUERQH PDUURZGRQDWLRQV ´,W¡VYHU\LPSRUWDQWWKDWDORWRISHRSOHUHJLVWHU,W¡VYHU\HWKQLFVSHFLĂ&#x20AC;FÂľ0V 0F.HQ]LH VDLG ´)RU H[DPSOH &DXFDVLDQV RQO\ PDWFK &DXFDVLDQV +LVSDQLFV RQO\ PDWFK +LVSDQLFV EHFDXVH LW¡V \RXU EORRG'1$WKDWWKH\¡UHPDWFKLQJÂľ 6HQLRU /DXUHQ 5H\QROGV SDUWLFLSDWHG in the bone marrow screening because 0V6XDUH]KHUWHDFKHUHQFRXUDJHGKHU FODVVHVWRGRVR ´,KDYH0V6XDUH]DVDWHDFKHUDQG

VKHZDVVD\LQJKRZ0U&RQWURKDVVXFK a big opportunity to survive, but they QHHGHG SHRSOH VR , ZDQWHG WR KHOSÂľ 5H\QROGVVDLG 0V 6XDUH] VDLG WKH %D\ KDV KRVWHG blood drives previously where they would offer screenings for someone in need of ERQHPDUURZVSHFLĂ&#x20AC;FDOO\VWXGHQWV ´7KHVWDIIDQGWKHIDFXOW\KHUHDW&\SUHVV%D\LVOLNHDIDPLO\VR,NQRZDIWHU teaching Anatomy and Physiology, how GLIĂ&#x20AC;FXOW LW FDQ EH WR Ă&#x20AC;QG WKH ULJKW ERQH PDUURZPDWFK6RVHHLQJDV0UV&RQWUR is one of our own, one of our family, itâ&#x20AC;&#x2122;s WKDWPXFKPRUHLPSRUWDQWÂľ0V6XDUH] VDLG 5H\QROGVVDLGLIVKHZHUHWKHRQHZKR PDWFKHG ZLWK 0U &RQWUR¡V EORRG W\SH VKHZRXOGJRWKURXJKZLWKWKHSURFHGXUH ´,W¡VVFDU\EXW,FRXOGVDYHVRPHRQH¡V OLIHÂľ5H\QROGVVDLG´,W¡VDELJWKLQJ,W¡V VRPHRQH¡V OLIH 6RPHRQH ORYHV WKH SHUVRQ 7KH\ KDYH D IDPLO\ 7KH\ KDYH D FKDQFH6RZK\QRW"Âľ

Health, physical education students sell smoothies upon request She started selling the smoothies because many people skip breakfast and it is ,W¡VDPDQGWKHEOHQGHUis whir- the perfect way to incorporate nutritional ULQJ LQ .LP /RYH¡V FODVVURRP %ULJKW meals or snacks into the diets of those on green smoothies are being prepared for FDPSXV â&#x20AC;&#x153;Studies show that the more fruit and VWXGHQWVDQGVWDIIDOODURXQGWKHVFKRRO 6WXGHQWVZRUNLQJZLWK0UV/RYHDUHDV- vegetables you eat, the less chance one sembling all of the necessary items onto ZLOOJHWDGLVHDVHÂľ0UV/RYHVDLG Spanish teacha cart, and they are er Paola Barregetting ready to go â&#x20AC;&#x153;Students should be ra said she never around campus to has breakfast, so those who have re- aware of the healthy the shakes proTXHVWHGDYLVLW foods that are good for vide a great source .DOH VPRRWKyou, and not only the of protein in the ies are being sold PRUQLQJIRUKHU DW  WR VWX- food that gives you no ´, WU\ WR KDYH dents and staff ev- nutrition.â&#x20AC;? one every day as HU\ GD\ 6WXGHQWV a meal replacer to are assigned by -sophomore Maria PDNHVXUH,JHWWKH 0UV /RYH KHDOWK Eseverri right amount of and physical eduvegetables for the cation teacher, to go around to classrooms during third pe- GD\ÂľVKHVDLG 0UV%DUUHUDVDLGVKHLVUHOLHYHGWKDW riod by request only to ensure that healthy DQGQXWULWLRQGULQNVDUHDQRSWLRQIRUDOO after all of the cookies and empty caloâ&#x20AC;&#x153;Any students that are interested in ries sold at school, one person is trying the smoothies will be able to contact to make a change about the food that is me through their teacher to request the EHLQJRIIHUHG Sophomore Maria Eseverri said it is VPRRWKLHV WR FRPH WR WKHLU FODVVÂľ 0UV a fantastic way to get the word out about /RYHVDLG BY ARIELA COHN

PHOTO BY ARIELA COHN

SHAKE UP: Junior Leeanna Fletcher (right) and another student, who are in Mrs. Loveâ&#x20AC;&#x2122;s class, try to promote healthy eating by delivering smoothies during third period to Mrs. Barreraâ&#x20AC;&#x2122;s room.

KHDOWK\IRRGV â&#x20AC;&#x153;Students should be aware of the healthy foods that are good for you, and not only the food that gives you no nutriWLRQÂľVKHVDLG

0UV/RYHVDLGWKHUHLVVPDOOSHUFHQWage of students who know about healthy HDWLQJ%\SURYLGLQJNDOHVKDNHVIRUWKH school, she is encouraging students to imSURYHWKHLUHDWLQJKDELWV


APRIL 2014

NEWS

THE CIRCUIT

5

WWW.CBHSCIRCUIT.COM

;LHJOLYZĂ&#x201E;UKOLHS[O`S\UJOVW[PVUZ BY LISA BURGOA NEWS EDITOR

For behavior specialist Julian Haring, OXQFKWLPH EULQJV WDQWDOL]LQJ Ă DYRUV DQG swirling aromas of zucchini pasta, chickHQ WDFRV DQG IUHVK YHJHWDEOHV GUL]]OHG with spices. She, along with 10 members of the IDFXOW\KDYHKDGWKHLUOXQFKHVKDQGGHOLYHUHGWRWKHPVLQFH0DUFKE\WKH1DNHG *RXUPHWD%RFD5DWRQEDVHGFRPSDQ\ ZKLFKVSHFLDOL]HVLQWKHFUHDWLRQDQGGHOLYHU\RISUHPDGHRUJDQLFPHDOV

â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s nice that Iâ&#x20AC;&#x2122;m feeling more comfortable in my own skin, but the important thing is that Iâ&#x20AC;&#x2122;m taking the steps to lead a longer, healthier life.â&#x20AC;? -behavior specialist Julian Haring â&#x20AC;&#x153;For me, lunchtime was bit of a hasVOH EHFDXVH , ZRXOG HLWKHU QRW HDW DW DOO RUUHVRUWWRHDWLQJMXQNIRRGÂľ0V+DULQJ VDLG´%XWLW¡VVRQLFHWRKDYHWKHVHPHDOV GHOLYHUHGWRPHDXWRPDWLFDOO\,VWDUWHGWR WHOOVRPHRIP\IULHQGVKHUHLQWKHRIĂ&#x20AC;FH DERXWLWDQGWKH\JRWUHDOO\LQWRLWWRRÂľ Due to her enthusiasm for the compaQ\0V+DULQJZDVSURPRWHGWRDQDPEDVVDGRUIRU1DNHG*RXUPHWDQGKDVDGYRFDWHGWKHPHDOSODQDPRQJWKHDGPLQLVWUDWRUVLQWKHIURQWRIĂ&#x20AC;FH With a $50 Teacher Lunch Box option,

PHOTOS BY LISA BURGOA

BON APPETIT: (top) Security specialist Liza Sandoval enjoys a cup of quinoa freshly delivered by Naked Gourmet. (left) Lunch boxes for teachers and staff are left on the counter for them to pick up.

ZKLFKSURYLGHVWKUHHVPDOOPHDOVDQGD VQDFNIRUIDFXOW\DQGVWDIIDWDVFKRROWKH FRPSDQ\FDWHUVWRWKHQHHGVRIWHDFKHUV DQGIDFXOW\ZKRPD\QRWEHJHWWLQJWKH proper nourishment in a school setting, 1DNHG*RXUPHWIRXQGHUDQG&(2$OLFLD 7HUUHOOVDLG ´1DNHG*RXUPHWLVDPRWLYDWLRQRUJDQL]DWLRQ¾VKHVDLG´:HZDQWHGWRUHZDUG WKHSHRSOHZKRZRUNWKHKDUGHVWDQGGR some of the most important jobs in our

VRFLHW\Âľ  )RXQGHG LQ 0DUFK  1DNHG *RXUPHW GHOLYHUV PHDOV IRU 0RQGD\ 7XHVGD\DQG:HGQHVGD\HYHU\0RQGD\ DQGPHDOVIRU7KXUVGD\DQG)ULGD\HYHU\ 7KXUVGD\ )RFXVLQJ RQ RIIHULQJ VPDOOHU SRUWLRQVPRUHWLPHVDGD\WKHFRPSDQ\ promotes a healthier lifestyle. ´, DOZD\V JHW H[FLWHG ZKHQ , VHH WKH EODFN EDJV GHOLYHUHG , FDQ VPHOO WKHP DUULYLQJIURPP\RIĂ&#x20AC;FHÂľVDLGJXLGDQFH

7YPUJPWHSYLX\LZ[ZJS\IZZLSSSLZZ\UOLHS[O`MVVK HZWLY4PJOLSSL6IHTHÂťZOLHS[O`SP]PUNPUP[PH[P]L BY ELANNA HEDA COPY EDITOR

&DQG\ER[HVOROOLSRSVFRWWRQFDQG\ FRRNLHV&OXEVDWWKH%D\KDYHEHHQVHOOLQJ MXQN IRRG IRU IXQGUDLVHUV VLQFH WKH VFKRRORSHQHGEXWQH[W\HDULQKRQRURI 0LFKHOOH 2EDPD¡V KHDOWK\ OLYLQJ LQLWLDWLYH3ULQFLSDO6FRWW1HHO\LVDVNLQJHYHU\ FOXEWRGRLWVSDUWDQGWU\WRVHOOKHDOWKLHU RUQRQIRRGLWHPV ´,WZRXOGEHDUHDOO\FRROWKLQJLIRXU VFKRRO FRXOG VWDUW KHDGLQJ LQ D GLIIHUHQW GLUHFWLRQÂľ VDLG ,QWHULRU 'HVLJQ DQG '(&$ WHDFKHU 'DQLHOOH 1DVFLPHQWR ´1RWWRVD\WKDWKH¡VJRLQJWRVD\QRWR things. You know, if people want to still GRWKHLUWUDGLWLRQDOFDQG\VDOHWKDWZLOOEH DOORZHGEXWKH¡GORYHIRUFOXEVWRGRRWKHU WKLQJVWRRÂľ '(&$RIĂ&#x20AC;FHUDQGSUHVLGHQWRI%XLOG RQ +RSH &OXE /DXUHQ %DELW] KRZHYHU VDLGWKDWDFKDQJHLQWKHV\VWHPZRXOGEH too costly. â&#x20AC;&#x153;I feel that the consequences far out-

ZHLJKWKHEHQHĂ&#x20AC;WVQRWRQO\IRUWKHFOXEV ,¡P LQYROYHG LQ EXW DOVR IRU WKH PXOWLSOH FOXEV WKURXJKRXW &\SUHVV %D\ DQG WKURXJKRXW)ORULGDWKDWDUHIDFLQJVLPLODU VLWXDWLRQVÂľVDLG%DELW]DMXQLRU´7KHVH IXQGUDLVHUV DUH WKH SULPDU\ VRXUFHV RI UHYHQXHIRUPRVWRIWKHVHFOXEVDQGWKH ORVV RI WKHP ZRXOG UHDOO\ FULSSOH WKHVH FOXEVÂľ &%79¡V YLFH SUHVLGHQW RI IXQGUDLVLQJ/DXUHQ)HUQDQGH]VDLGVKHLVXQVXUH DERXWWKHSURVDQGFRQVRIQRORQJHUVHOOLQJMXQNIRRG ´,W¡VKDUGWRVD\ZKHWKHUWKHVHGLIIHUHQWIXQGUDLVHUVZLOOEHEHQHĂ&#x20AC;FLDOIRURXU FOXEV DW &\SUHVV %D\Âľ VDLG )HUQDQGH] D VHQLRU ´,W¡OO EH D GLIĂ&#x20AC;FXOW DGMXVWPHQW since some clubs are known for their funGUDLVHUVVXFKDV'(&$FOXELVNQRZQIRU '(&$ FRRNLHV DQG &%79 KDV KDG OROOLSRSVDURXQGIRUDZKLOH6WXGHQWVORRN IRUZDUG WR WKHVH WUHDWV HVSHFLDOO\ VLQFH '(&$FRRNLHVMXVWUHWXUQHGÂľ ,QWHULRU 'HVLJQ DQG '(&$ WHDFKHU 'DQLHOOH1DVFLPHQWRVDLGZLWKDERXW

clubs at the school, competition can be WRXJK+RZHYHUVKHVDLGWKLVQRWLRQZLOO ERRVWFUHDWLYLW\DQGFUHDWHWKHRSSRUWXQLW\IRUFOXEVWRUHGXFHWKHLURZQFRPSHWLWLRQE\YHHULQJDZD\IURPWUDGLWLRQDOIXQGUDLVHUVVXFKDVFDQG\ER[VDOHV â&#x20AC;&#x153;I think a lot of our clubs lean on those W\SHRIIXQGUDLVHUVDVDW\SHRIFUXWFKÂľ VKH VDLG ´/LNH ÂśRK ZKDW GR , GR" 2K OHW¡VMXVWVHOOOROOLSRSV¡,W¡VNLQGRIOLNHD FUXWFK6RLWFRXOGJHWVRPHQHZWKLQJV LQWKHUHÂľ %DELW]VDLGWKHVHOOLQJRIFDQG\ER[HVDQGRWKHUWRSVHOOLQJVZHHWVKHOSVQHZ PHPEHUVLQFOXEVJHWLQYROYHGDQGJDLQ FRQĂ&#x20AC;GHQFH ZKLFK KHOSV WKH FOXE DV D whole. â&#x20AC;&#x153;The business strengthens the chapter, EHFDXVHPHPEHUVZKRZRXOGQ¡WW\SLFDOO\ JHWLQYROYHGWDNHWKHRSSRUWXQLW\WRVWHS XSDQGWKHSURĂ&#x20AC;WDOORZVPHPEHUVWRERQG WUDYHO FRPSHWH OHDUQ DQG JLYH EDFN WR WKH FRPPXQLW\Âľ %DELW] VDLG ´0DQ\ RI RXUPRVWLQYROYHGPHPEHUVĂ&#x20AC;UVWGHFLGHG WRVWHSXSWKURXJKWKHFRRNLHEXVLQHVVÂľ

FRXQVHORU0HOLVVD%RRURP´,W¡VGHĂ&#x20AC;QLWHO\VRPHWKLQJWKDW,ORRNIRUZDUGWRHYHU\ GD\ ZKLFK FDQ¡W EH VDLG RI P\ OXQFKHV EHIRUH,JRWRQWKH1DNHG*RXUPHWSURJUDPÂľ 7KRXJK WKH PHDOV IROORZ JXLGHOLQHV HVWDEOLVKHGE\DFXOLQDU\VSHFLDOLVW0V 7HUUHOOVDLGWKDWWKHPHDOSODQVDUHDGMXVWable to the interests of a customer. ´:HGHVLJQPHDOSODQVZKLFKJRDORQJ ZLWK D WHDFKHU¡V VSHFLĂ&#x20AC;FDWLRQÂľ VKH VDLG â&#x20AC;&#x153;If they have allergies, we take that into account. If you have something that you just will not eat, we take that into account. $WWKHFHQWHURIHYHU\PHDOWKDWWKH\HDW LW¡VDOODERXWWKHPÂľ  6HFUHWDU\  VSHFLDOLVW /L]D 6DQGRYDO VDLGVKHLVVDWLVĂ&#x20AC;HGZLWKWKHDFFRPPRGDWLRQVVKHUHFHLYHVZLWK1DNHG*RXUPHW â&#x20AC;&#x153;You can take somthing as simple as TXLQRDDQGWXUQLWLQWRDGHOLFLRXVPHDOÂľ VKHVDLG´ $VDĂ&#x20AC;WQHVVFRDFKZKRLVMXVWQRZYHQWXULQJLQWRWKHEXVLQHVVRIRUJDQLFIRRG 0V7HUUHOOVDLGVKHLVWRXFKHGE\WKHUHsponses she has been getting from the Bay. ´7KH EHVW SDUW IRU PH LV GHĂ&#x20AC;QLWHO\ hearing what the teachers have to say DERXW KRZ GHOLFLRXV WKH PHDOV DUH DQG KRZ PXFK SURJUHVV WKH\¡UH PDNLQJ LQ OHDGLQJDKHDOWK\OLIHVW\OHÂľVKHVDLG 0V+DULQJVDLGVKHLVDOUHDG\VHHLQJ UHVXOWVDORQJZLWKWKHFKDQJHRIKHUGLHW ´-XVWDFRXSOHRIZHHNVLQ,¡PDOUHDG\ GRZQWZRGUHVVVL]HVÂľVKHVDLG´,W¡VQLFH WKDW ,¡P IHHOLQJ PRUH FRPIRUWDEOH LQ my own skin, but the important thing is WKDW,¡PWDNLQJWKHVWHSVWROHDGDORQJHU KHDOWKLHUOLIHÂľ

How will less junk food sales affect the school?

´2IFRXUVHLW¡VDJRRGLQLWLDWLYHKH¡V taking, but it will have a negative afIHFWRQWKHFOXEV¡IXQGVDQGEXGJHWV¾ -junior Yumi Rivas

´7KHFOXEVZRQ¡WKDYHHQRXJKPRQH\EHFDXVHQRERG\ZLOOEX\ -freshman Samuel Lapuerta

´,WKLQNWKHVFKRROZRXOGEHKHDOWKLHU DQGWKHVWXGHQWVZRXOGVDYHPRQH\¾ -senior David Aponte


6

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

NEWS

APRIL 2014

Senior wins contest for driving commercial BY JENNIFER SCHONBERGER ONLINE ARTS & ENTERTAINMENT EDITOR

Out of almost 900 students nationwide who entered Scholasticâ&#x20AC;&#x2122;s Drive2Life Contest, the Bayâ&#x20AC;&#x2122;s senior Emily Mochel won the Grand Prize, and four other students from English teacher Joyce Seigelâ&#x20AC;&#x2122;s creative writing class were recognized as being part of the top 25 entries. The contest was open to students in grades 6-12 and required participants to create a storyboard or written script for a 30-second public service announcement (PSA) that shows how teen passengers and drivers can prevent, avoid, or get out of an impaired-driving situation. Mochel received $1,000 along with a trip to New York City and a stay at the Kimberly Hotel for two days and three QLJKWVWRZULWHĂ&#x20AC;OPDQGGLUHFW

her PSA. She went from March DQGĂ&#x20AC;OPPDQ\WDNHVIURPGLIIHU31 to April 3 and said she had ent angles so we could have a lot an amazing experience. to work with,â&#x20AC;? Mochel said. â&#x20AC;&#x153;We â&#x20AC;&#x153;I want to go into advertis- even did a screen test and audiing as a career, so this was a tioned local high school students great chance for me to try out to be in the PSA.â&#x20AC;? storyMrs. Seigel, who b o a r d â&#x20AC;&#x153;I want to go into informed her stuw r itdents of the contest, ing and advertising as a won a classroom subpitching career, so this was scription to a Schomy own a great chance for lastic magazine for id e a s,â&#x20AC;? the 2014-2015 school Mo ch el me to try out year along with a said. storyboard writing $25 iTunes gift card, S h e and pitching my thanking her for engot the couraging students to c h a n c e own ideasâ&#x20AC;? be aware of the possito be in- -Emily Mochel ble damages of drinkvolved ing and driving. in every â&#x20AC;&#x153;I encourage my step of students to enter conthe commercial making pro- tests because I believe they give FHVVIURPĂ&#x20AC;OPLQJWRHGLWLQJ students an opportunity to exâ&#x20AC;&#x153;Since the PSA takes place pose their writing and to pracDW D KRXVH SDUW\ ZH Ă&#x20AC;OPHG tice meeting different challengat the director Alan Weissâ&#x20AC;&#x2122;s es of the workplace,â&#x20AC;? Mrs. Seihouse. I got to set up the props gel said. â&#x20AC;&#x153;I always stress that we

3+27268%0,77('%<(0,/<02&+(/

DIRECTORâ&#x20AC;&#x2122;S CUT: 6HQLRU(PLO\0RFKHOĂ&#x20AC;OPVDFRPPHUFLDO in New York after winning the Scholasticâ&#x20AC;&#x2122;s Drive2Life Contest. 7KHFRPPHULFDOLVDVHFRQGSXEOLFVHUYLFHDQQRXQFHPHQW helping teenagers avoid impaired-driving situations.

donâ&#x20AC;&#x2122;t write to win, because we win when we write.â&#x20AC;? 6HQLRU-DFN*RUĂ&#x20AC;QNHOVDLGKH was surprised when he found out that he placed in the top 25 contest entries and received a $25 iTunes gift card in the mail. â&#x20AC;&#x153;I took the contest as a challenge. Advertising is not interesting to me, so I had to make it interesting by adding a fantasy side to it,â&#x20AC;? he said. â&#x20AC;&#x153;My idea for the PSA had to do with two friends arriving at a house par-

ty. One friend drinks and every time he takes a sip, something changes about him. By the end, his body canâ&#x20AC;&#x2122;t move because his legs and arms have turned into cans.â&#x20AC;? Mochelâ&#x20AC;&#x2122;s PSA is set to air on an episode of the educational newsmagazine series â&#x20AC;&#x153;Teen Kids Newsâ&#x20AC;? sometime in May, but she has not yet been given an exact date.

Junior selected for prestigious award in Washington D.C. BY JORDAN FRIEDMAN ONLINE NEWS EDITOR

Representing Cypress Bay and the state of Florida, junior Lisa Burgoa has been selected to attend the Al Neuharth Free Spirit and Journalism Conference program in Washington, D.C., from June 21-26, with all expenses paid. â&#x20AC;&#x153;It is such a great opportunity because I get to meet very passionate and dedicated kids from across the country and I get to hear all the ideas they have from their publications,â&#x20AC;? Burgoa said. â&#x20AC;&#x153;Also, it is occurring on my birthday. Itâ&#x20AC;&#x2122;s the best gift. I canâ&#x20AC;&#x2122;t imagine anything better for my birthday than to be in a beautiful place, meet a bunch of different people and do what I love â&#x20AC;&#x201C; journalism.â&#x20AC;? PHOTO BY DIEGO CLAVIJO Only one student from each state is chosen after an extensive NATIONAL NOMINATION: Lisa Burgoa, who was selected to attend the Al Neuharth Free Spirit and application process. It required -RXUQDOLVP&RQIHUHQFHLQ:DVKLQJWRQ'&LVZRUNLQJRQWKHĂ&#x20AC;QDOQHZVSDSHUSXEOLFDWLRQRIWKH\HDU two letters of recommendation, â&#x20AC;&#x153;It is an incredible honor to projects editor for the â&#x20AC;&#x153;Washing- was able to solidify my interest three samples of work, and two meaning. It wasnâ&#x20AC;&#x2122;t something I essays. Burgoa said she worked just sat down and wrote. I really win this award because they ton Post,â&#x20AC;? graduated from Cy- in news,â&#x20AC;? he said. â&#x20AC;&#x153;I made a lot only select one person from SUHVV LQ  DQG ZDV WKH Ă&#x20AC;UVW of friends and connections. One on the application from the min- took a long time.â&#x20AC;? J o u r each state. So this really says student to be chosen. of the most concrete takeaways ute she found a lot about how â&#x20AC;&#x153;The people I met was prob- was meeting the publisher, at the out about it special Lisa is,â&#x20AC;? ably the most memorable part, time, of the â&#x20AC;&#x2DC;Miami Herald.â&#x20AC;&#x2122; He in October to â&#x20AC;&#x153;I didnâ&#x20AC;&#x2122;t want it to Mrs. Weiss said. both the students and journalist passed along my contact inforwhen it was be empty words, so â&#x20AC;&#x153;I know she has a speakers,â&#x20AC;? Mr. Linch said. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve mation, which led to a free-lancdue in JanuI wrestled with the really large body remained friends with them ing opportunity and then an inary. of work in jour- for almost 10 years. There is a ternship at the â&#x20AC;&#x2DC;Miami Herald.â&#x20AC;&#x2122;â&#x20AC;? â&#x20AC;&#x153;For me, words to make sure nalism, both for bunch of free spirits in D.C. that Monika Rowinska-Burgoa, I felt that every word carried â&#x20AC;&#x2DC;The Circuitâ&#x20AC;&#x2122; and I still see.â&#x20AC;? Lisaâ&#x20AC;&#x2122;s mother, said she is exout of evoutside publicaMr. Linch said the best advice tremely proud of her daughter. erything, the weight and meaning.â&#x20AC;? tions, and she al- he can give is to prepare, if posâ&#x20AC;&#x153;I always believed in her and Lisa Burgoa essays were -junior Lisa Burgoa ways does high qual- sible, by looking up the speakers I think in the future this will nalism what really and getting in some research be- open up many opportunities for t e a c h e r ity work.â&#x20AC;? conveyed my Mrs. Weiss said Burgoa is the fore meeting them, asking a lot her,â&#x20AC;? she said. passion,â&#x20AC;? she said. â&#x20AC;&#x153;I didnâ&#x20AC;&#x2122;t want Rhonda Weiss wrote one of Burit to be empty words, so I wres- goaâ&#x20AC;&#x2122;s letters of recommendation second student from Cypress to of questions and having quality tled with the words to make sure and has been her teacher for two be chosen for this program. Greg conversations. Linch, who is now the local data â&#x20AC;&#x153;One takeaway was that I every word carried weight and years.


APRIL 2014

NEWS

THE CIRCUIT

7

WWW.CBHSCIRCUIT.COM

:LUPVYZ[VH[[LUK4HYJOVM[OL3P]PUN BY EMILY CHAIET

'XULQJ WKH +RORFDXVW FRQFHQWUDWLRQ FDPSSULVRQHUVWRRNSDUWLQGHDWKPDUFK HVDFURVV(DVWHUQ(XURSH1RZDERXW \HDUV ODWHU -HZLVK SHRSOH IURP DURXQG WKHZRUOGDUHSDUWLFLSDWLQJLQDQDQQXDO PDUFKLQPHPRU\RIWKRVHWUDJLFHYHQWV 7KH 0DUFK RI WKH /LYLQJ LV D WZR ZHHNSURJUDPRSHQWR-HZLVKMXQLRUVDQG VHQLRUV LQ KLJK VFKRRO ZKR WUDYHO ZLWK +RORFDXVWVXUYLYRUVWRIRUPHUFRQFHQWUD WLRQFDPSVLQ3RODQGDQGWRXULVWGHVWLQD WLRQVLQ,VUDHO 7KLV \HDU·V WULS ZLOO EH WDNHV SODFH IURP$SULOWR0D\7HQVHQLRUVIURP WKH %D\ ZLOO EH DWWHQGLQJ 5DFKHO /H VQLFN 0LFKDHO &RPRUD /DXUHQ *HOOHU $OH[D %HUQVWHLQ $OH[D 6WHLQODXI $OH[ :HLVV$YHU\=DIIRV+LODU\6DYLW](OOLH $FNHUPDQDQG'DYLG5RWKÃ&#x20AC;HOG 7KH\ ZLOO EH DPRQJ WKH  VWXGHQWV DQG  DGXOWV DWWHQGLQJ IURP %URZDUG &RXQW\(DFK\HDUWKHWULSKDVWR SDUWLFLSDQWV ´7KH 0DUFK RI WKH /LYLQJ LQFUHDVHV NQRZOHGJH DERXW WKH +RORFDXVWµ VDLG 5RFKHOOH%DOWXFKDVVRFLDWHH[HFXWLYHGL UHFWRU RI WKH 2UORII &HQWUDO $JHQF\ IRU -HZLVK (GXFDWLRQ LQ %URZDUG &RXQW\ ´7KHVXUYLYRUV·JUHDWHVWIHDULVWKDWWKHLU VWRULHVZLOOGLHZLWKWKHP7KLVLVDQRS SRUWXQLW\IRUSDUWLFLSDQWVWRFRQWLQXHWKH OLQNWRWKHIXWXUHµ 7KHWULSEHJLQVLQ3RODQGZKHUHSDU WLFLSDQWV ZLOO YLVLW WKH FLWLHV RI :DUVDZ .UDNRZ DQG /XEOLQ 2Q +RORFDXVW 5H PHPEUDQFH 'D\ WKH SDUWLFLSDQWV ZLOO

PHOTO SUBMITTED BY ROCHELLE BALTUCH

MARCH ON: Broward County students from last yearâ&#x20AC;&#x2122;s March of the Living walk LQPHPRU\RIWKH+RORFDXVW7KLV\HDUÒ&#x2039;VWULSLVIURP$SULOWR0D\

PDUFK WKUHH NLORPHWHUV IURP $XVFKZLW] WR%LUNHQDXZKHUHWKHUHZLOOEHDFHUH PRQ\KRQRULQJWKHVXUYLYRUVRQWKHWULS ´:HPDUFKLQUHPHPEUDQFHRIWKRVH ZKRWRRNWKHGHDWKPDUFKHVRQO\ZHDUH KHUHWRVKRZZHDUHDOLYHµ0V%DOWXFK VDLG 7KHWULSHQGVLQ,VUDHOZKHUHWKHSDU WLFLSDQWV FHOHEUDWH ,VUDHOL ,QGHSHQGHQFH 'D\ ZKLFK 0V %DOWXFK VDLG LV D PL[ RI)RXUWKRI-XO\0DUGL*UDVDQG1HZ <HDU·V(YH ´:HDUHJRLQJWRFHOHEUDWHOLIHLQ,V UDHOµVDLGVHQLRU/DXUHQ*HOOHUZKRZLOO EHDWWHQGLQJWKLV\HDU·VWULS´,·PORRNLQJ IRUZDUGWRJRLQJWR,VUDHODQGYLVLWLQJWKH :DUVDZ *KHWWR DQG VHHLQJ ZKDW KDS SHQHGWKHUHµ

0V%DOWXFK·VMRELVWRUHFUXLWDQGJHW WKHZRUGRXWDERXWWKHSURJUDPSURFHVV DSSOLFDWLRQVLQWHUYLHZWKHDSSOLFDQWVDQG VWDIIPHPEHUVFRRUGLQDWHWKHHGXFDWLRQ DOSURJUDPDQGSODQWKHLWLQHUDU\ 6WXGHQWVKDGWRJRWKURXJKLQWHUYLHZV DQGDSSOLFDWLRQVWREHVHOHFWHGIRUWKHWULS 7KHVHOHFWHGVWXGHQWVDUHUHTXLUHGWRDW WHQGVHYHQFODVVHVZKLFKPHHWRQ6XQGD\ DIWHUQRRQVIRUWKUHHDQGDKDOIKRXUV ´:H OHDUQ ZKDW OHG XS WR WKH +ROR FDXVW ZKDW KDSSHQHG GXULQJ WKH +ROR FDXVW ZKDW KDSSHQHG DIWHUZDUGV DQG ZKDWKDSSHQHGDWWKHJKHWWRVDQGFRQFHQ WUDWLRQFDPSVµ*HOOHUVDLG´:H·UHJRLQJ WRVHHDOORIWKDWDQGEHWKHUHZKHUHLWKDS SHQHG7KH\ZDQWXVWRKDYHDEHWWHUXQ GHUVWDQGLQJRIZKDWZH·UHJRLQJWRVHHµ

*HOOHUIRXQGRXWDERXWWKHWULSODVW\HDU LQWKH+LVWRU\RIWKH+RORFDXVW7HDFKHU /HVOLH5KHLQJROGUHTXLUHVWKDWDOORIKHU VWXGHQWVZKRDWWHQGWKHWULSGRDSUHVHQWD WLRQE\VKRZLQJSLFWXUHVDQGWHOOLQJWKHLU H[SHULHQFHVDIWHUWKH\FRPHEDFN ´,W·V DQ LQFUHGLEOH RSSRUWXQLW\ WR H[ SHULHQFHZKDW-HZVZHQWWKURXJKDVWKH\ ZHQW RQ WKH GHDWK PDUFKHV WRZDUGV WKH HQGRIWKHZDUµ0V5KHLQJROGVDLG´, KDYHQHYHUPHWDQ\RQHZKRGLGQ·WKDYHD OLIHFKDQJLQJH[SHULHQFHµ *HOOHUVDLGVKHZDQWHGWRJRRQWKHWULS EHFDXVHVKHLVLQWHUHVWHGLQ+RORFDXVWDQG *HQRFLGH6WXGLHVDVDIXWXUHFDUHHU ´,Ã&#x20AC;JXUHGVLQFH,·PLQWHUHVWHGLQ+R ORFDXVWVWXGLHVWKHPRVWDPD]LQJZD\WR XQGHUVWDQGZKDW,ZDQWWRUHVHDUFKLVWR JRWKHSODFHZKHUHLWDOOKDSSHQHGµVKH VDLG 6HQLRU 0LFKDHO &RPRUD VDLG KH LV DWWHQGLQJ WKH WULS EHFDXVH KLV SDUHQWV WKRXJKW LW ZRXOG EH D JRRG H[SHULHQFH +H VDLG HYHQ WKRXJK LW ZDV KLV SDUHQWV· LGHDWRDWWHQGKHLVVWLOOORRNLQJIRUZDUG WRJRLQJ 0V %DOWXFK VDLG WKH JRDOV RI WKH 0DUFKRIWKH/LYLQJWULSDUHWROHDUQZKDW KDWUHG FDQ GR DQG WR EHWWHU XQGHUVWDQG WKH+RORFDXVW6KHVDLGLWLVDOVRWROHDUQ DERXWWKH6WDWHRI,VUDHODQGFDUU\RQWKH VWRULHVRIWKHVXUYLYRUVRQWKHWULS ´3DUWLFLSDQWVFRPHDZD\ZLWKDJUHDW HUXQGHUVWDQGLQJRIWKH+RORFDXVWµ0V %DOWXFKVDLG´7KH\OHDUQWKDW\RXFDQQRW VLWE\ZKHQLQMXVWLFHVDUHEHLQJFRPPLW WHG7KH\DOVRFRPHEDFNZLWKDJUHDWHU VHQVHRI-HZLVKLGHQWLW\DQGSULGHµ

*VTWL[P[VYZYLHJOÃ&#x201E;UHSZPU L]LY`L]LU[THRLKLIH[LOPZ[VY` BY DANIELLE BUSH ONLINE PHOTO EDITOR

/LJKWQLQJ 'HEDWH EHFDPH WKH Ã&#x20AC;UVt WHDP LQ )ORULGD )RUHQVLF /HDJXH ))/  KLVWRU\WRKDYHDQLQGLYLGXDOPDNHLWWR WKHÃ&#x20AC;QDOVLQHYHU\HYHQWDW1RYLFH6WDWHV RQ $SULO  7KLUW\VL[ QRYLFHV WUDY HOHG WR $SRSND DQG FRPSHWHG LQ  HYHQWV ´,W ZDV VR FRRO WR KDYH D FRPSHWL WRUDQGLQPRVWFDVHVPDQ\LQWKHÃ&#x20AC;QDO URXQGVµGHEDWHFRDFK0HJDQ:HVWVDLG ´,W UHDOO\ VKRZV WKHLU SRWHQWLDO DQG ,·P ORRNLQJIRUZDUGWRWKHLUPDQ\VXFFHVVHV WKURXJKRXWWKHLUGHEDWHFDUHHUVµ )UHVKPDQ 6WHUOLQJ :HUWDQ]O ZDV WKH FKDPSLRQLQ2UDO,QWHUSUHWDWLRQ:HUWDQ ]OSHUIRUPHGLQSURVHDQGLQSRHWU\+HU ZLQQLQJSRHWU\SLHFHZDV´:HOFRPHWR $PHULFDµ ´,WZDVWKHPRVWDPD]LQJWKLQJHYHUWR ZLQ1RYLFH6WDWHVEHFDXVH,KDGZDQWHG WKLVVLQFHWKHPRPHQW,VWDUWHGGHEDWHµ :HUWDQ]OVDLG´,WZDVVRJUHDWWRVHHP\ WHDP FKHHULQJ P\ QDPH ,W ZDV DOPRVW WRRJRRGWREHWUXHµ )UHVKPDQ&DPLOD7XVVLHSODFHGVHF RQGSODFHLQ2ULJLQDO2UDWRU\7XVVLHSHU IRUPHGDSLHFHFDOOHG´$OLHQDWLRQRIDQ

$OLHQ1DWLRQµ ´,WZDVDEVROXWHO\LQFUHGLEOHWRVHHDOO RIWKHWLPHZHSXWLQWRGHEDWHWKURXJKRXW WKHHQWLUH\HDUSD\RIIµ7XVVLHVDLG´7R UHSUHVHQWRXUVFKRRODQGPDNHKLVWRU\LQ WKHSURFHVVZDVMXVWDPD]LQJµ $FFRPSDQ\LQJ WKH QRYLFHV WR WKH WRXUQDPHQW ZHUH  YDUVLW\ WHDP PHP EHUVDQGHYHQWFRDFKHV7KH\DVVLVWHGLQ ODVWPLQXWHSUHSDUDWLRQDQGZDWFKHGWKH SHUIRUPDQFHV 6HQLRU'\ODQ:DUQHUVDLGKHZDVH[ FLWHG WR JR RQ WKH WULS WR 1RYLFH 6WDWHV WR VXSSRUW KLV WHDP :DUQHU WKLV \HDU·V 6WDWH4XDOLÃ&#x20AC;HUVFKDPSLRQDQGD1DWLRQ DOV 4XDOLÃ&#x20AC;HU LQ /LQFROQ 'RXJODV ZDV HDJHUWRKHOSWKH\RXQJHUPHPEHUVDQG ZDWFKWKHPFRPSHWH ´,ZDQWHGWRJRRQWKHWULSEHFDXVHDVD YDUVLW\PHPEHUSDUWRIRXUUROHLVWRKHOS FRDFKWKHQRYLFHVWRHQVXUHWKH\DUHVXF FHVVIXOµKHVDLG 6HQLRU -RVK 8OLQR DOVR DWWHQGHG WKH 1RYLFH 6WDWHV WULS ZLWK KLV WHDP 8OLQR VDLGKHZDVHDJHUWRLQVWLOOWKHHGXFDWLRQDO YDOXHRIGHEDWHKHKDVOHDUQHGLQRWKHUV ´6LQFH , ZDV D IUHVKPDQ , KDYH UH FHLYHGDWUHPHQGRXVDPRXQWRIHGXFDWLRQ IURPGHEDWHDQGDVDYDUVLW\PHPEHU, KDYHEHHQDEOHWRHQVXUHRXUQRYLFHVLQ

PHOTO SUBMITTED BY STERLING WERTANZL

IN IT TO WIN IT: The debate team novices hold up their trophies after making KLVWRU\E\KDYLQJDWOHDVWRQHFRPSHWLWRULQHYHU\Ã&#x20AC;QDOURXQG

WKH)ORULGDGHEDWHFRPPXQLW\DUHDEOHWR UHFHLYH WKH VDPH DPRXQW RI HGXFDWLRQµ 8OLQRVDLG )UHVKPDQ SROLF\ WHDPV RI %ULDQ %RVVHPDQG0LFKDHO9DOODGHUHVDVZHOO DV $OLFH 9LHUD DQG 0HODQLH ;LD FORVHG RXWWKHÃ&#x20AC;QDOURXQGW\LQJIRUÃ&#x20AC;UVWSODFH ´$IWHU Ã&#x20AC;QGLQJ RXW WKDW ZH KDG WKUHH RXWRIIRXUWHDPVLQWKHVHPLÃ&#x20AC;QDOURXQGV LWZDVDFUD]LQJIHHOLQJWRNQRZWKDWLIP\ SDUWQHU DQG , ZRQ RQH PRUH URXQG ZH ZRXOGFORVHRXWIRUWKHVWDWHFKDPSLRQ VKLSµ%RVVHPVDLG´/RRNLQJDWWKHRQO\

WKUHH WHDPV XS WKHUH DOO IURP WKH VDPH VFKRROSXWVVDWLVIDFWLRQWRDOORIRXUKDUG ZRUNµ )RXURIWKHGHEDWHWHDPQRYLFHVPDGH LWWRWKHÃ&#x20AC;QDOURXQGLQ&RQJUHVVLRQDO'H EDWH IUHVKPHQ +DQQDK *XWQHU 5DFKHO *XWQHU6DPP\6UHEQLFNDQGVRSKRPRUH 5DTXHO%HMDQ\ ´,W·VVRQLFHWRNQRZWKDWDOORI\RXU KDUGZRUNDQGGHGLFDWLRQKDVSDLGRIIµ %HMDQ\ VDLG ´%HLQJ ZLWK WKUHH RI P\ WHDPPDWHVRQO\UHLQIRUFHGWKHVHQVHORYH DQGXQLW\ZHKDYHRQWKLVWHDPWRJHWKHUµ


8

NEWS

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

APRIL 2014

Music, art supplies generate creative atmosphere at Style Your Sole event BY JORDAN FRIEDMAN ONLINE NEWS EDITOR

The One for One TOMS event is three for three: three successful annual Style Your Sole events have occurred, the most recent on March 14 in the cafeteria. Art Honor Society (AHS) sponsored the event and also provided the art supplies people used to decorate their TOMS shoes. President of AHS Sarah Ortiz-Monasterio, a junior, said Kim Morales started the event three years ago. It is open to all members of the community and this year about 80 shoes were sold. â&#x20AC;&#x153;We really wanted to promote the arts via a hands-on exSHULHQFHWKDWEHQHĂ&#x20AC;WWHGQRWRQO\ a personâ&#x20AC;&#x2122;s creative abilities but LWDOVREHQHĂ&#x20AC;WWHGDJRRGFDXVHÂľ she said. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m really pleased that we had such a good turnout and that people were really able to show their creative side and be with their peers in a great enviURQPHQWÂľ TOMS is a brand that for every purchase of a pair of shoes, another pair is given to a person in need. With a combination of music by the Funky Monks band, art supplies and food that was donated, sophomore Lacey

Larson, who attended the event, said the cafeteria took on an ambiance of art and inspiration. â&#x20AC;&#x153;The music breeds a creative DWPRVSKHUHÂľVKHVDLG´,¡PYHU\ involved in creative things like Photo Club and the art scene, so I thought I would enjoy creating my own pair of shoes and I did. I really like the message of buying something and someone else EHQHĂ&#x20AC;WWLQJ,KDYHRWKHU7206 shoes and merchandise like JODVVHVDQGDEDJÂľ The Style Your Sole event allows a pair of TOMS shoes to become a blank canvas. Everyone can personalize the TOMS by decorating them with any art materials or designs. The goal is to attract attention with the unique design so that people ask about it and the TOMS movement spreads. Larson said she NQRZV IURP Ă&#x20AC;UVWKDQG H[SHULHQFHWKHEHQHĂ&#x20AC;FLDOLPSDFWDSDLU of shoes can have. â&#x20AC;&#x153;I worked a lot with sending shoes, though they were not TOMS shoes, to Ecuador and I VDZ WKH GLUHFW HIIHFWÂľ VKH VDLG â&#x20AC;&#x153;Shoes actually protect people from diseases. We take them for granted as such a stylish pair of VKRHVÂľ Biology teacher Jessica Copertino said she decided to come this year after seeing Cynthia

SOLE PURPOSE: (Clockwise from above) Shoes designed by Julie Forgeng, a friend of biology teacher Jessica Copertino. Junior Alex Herrera is sewing buttons onto his TOMS. Sophomore Lacey Larson paints a message onto her TOMS shoes.

Josephâ&#x20AC;&#x2122;s decorated TOMS from ODVW\HDUDQGZLOOGHĂ&#x20AC;QLWHO\FRPH again. She also brought a friend of hers, Julie Forgeng, to the event. â&#x20AC;&#x153;Ms. Joseph did it last year and hers turned out so cute so I ZDQWHGWRSDUWLFLSDWHWKLV\HDUÂľ Mrs. Copertino said. â&#x20AC;&#x153;They are also playing music from when we were in high school so we are

PHOTOS BY JORDAN FRIEDMAN

ORYLQJLWDQGWKHDWPRVSKHUHÂľ Sophomore Angelica Herrera said there is a story behind the way she decorated her TOMS (with hieroglyphics and Egyptian Gods). â&#x20AC;&#x153;When I was younger, â&#x20AC;&#x2DC;The Prince of Egyptâ&#x20AC;&#x2122; was my favor-

LWH PRYLH DQG , ZDWFKHG LW Ă&#x20AC;YH WLPHVDGD\,NLG\RXQRWÂľVKH said. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve never really gotten the lyrics of â&#x20AC;&#x2DC;The Plagueâ&#x20AC;&#x2122; out of my head. So Iâ&#x20AC;&#x2122;m writing those lyrics on my shoes in hieroglyphics. Iâ&#x20AC;&#x2122;ve actually never written anyWKLQJRXWLQKLHURJO\SKLFVÂľ

National Honor Society spends day, night at track walking for Relay for Life BY DANIELLE BUSH ONLINE PHOTO EDITOR

The National Honor Society participated in the annual Relay for Life event hosted at the Bay. Over 80 members participated in the event and more than 30 students stayed overnight on April 12. NHS contributed $400 of the quarter of million dollars raised overall during the event. Senior and vice president of NHS Isabella Paretti headed the event for NHS. Paretti said she believes that it is a worthy cause to raise money for the American Cancer Society. â&#x20AC;&#x153;Because NHS was one of the largest teams at the event, we are able to make a huge differHQFHÂľ3DUHWWLVDLG´$VDQKRQor society rooted in service, it is crucial that we get involved in the community and help those LQQHHGÂľ At the Relay for Life event,

PHOTO BY ANNA SCHIFTER

STEP BY STEP: (Left to right) Seniors Julia Zuckerman, Ignacio Sabate and Bianka Ukleja and juniors Fran Angulo, Juan Diego Yanez and Rachel Newman at Relay for Life.

NHS members sold pizza and baked goods in addition to doing face painting. Throughout the night, there was at least one NHS member symbolically walking the track to signify the core tenant of the event, â&#x20AC;&#x153;cancer QHYHUVWRSVÂľ

Other Clubs That Participated in Relay for Life Key Club

American Sign Language

Paretti said her favorite part about the event was walking around the track and seeing Cypress Bay clubs, Weston businesses and local families representing the common goal to raise money for cancer research. â&#x20AC;&#x153;To walk around the track

and see all of the clubs and organizations raising money for the cancer patients was truly DPD]LQJÂľ 3DUHWWL VDLG ´7KLV LV such a worthy cause and one that is especially dear to my heart. Nothing makes me happier than seeing all those people coming together to raise money for an DPD]LQJRUJDQL]DWLRQÂľ During the event, there were activities taking places such as a Miss Relay drag queen show and dance groups performing on the main stage. Paretti said not only were members participating for the great cause, but also they had a lot of fun along the way. â&#x20AC;&#x153;It truly was a great experience, and as such a large club, we are able to make a huge difIHUHQFHÂľ3DUHWWLVDLG Junior Yumi Rivas participated in the Relay for Life and stayed throughout the day and overnight. Rivas said she enjoyed the entertainment and activities. â&#x20AC;&#x153;I loved watching the He-

Color Guard

Tri-M Music Honor Society

roes of Hip Hop perform because they were all so expressive and passionate while they were GDQFLQJÂľ5LYDVVDLG NHS adviser Shari Bush said Relay for Life is an event that NHS is planning on participating in the years to come because, due to the size of the club, they can really make an impact in the community. â&#x20AC;&#x153;We are grateful enough to have over 100 members and each member has the opportunity to SDUWLFLSDWH PDNH D GLIIHUHQFHÂľ Mrs. Bush said. â&#x20AC;&#x153;We were able to get a lot of members involved in the Relay for Life event and UDLVHPRQH\IRUDJUHDWFDXVHÂľ Treasurer Janae Bell, a senior, said her favorite part of Relay was when the groups walked together around the track to sigQLI\WKHLUĂ&#x20AC;JKWDJDLQVWFDQFHU â&#x20AC;&#x153;It was really special to see families, clubs and organizations walking together for their loved ones that have passed or to symEROL]H WKHLU XQLĂ&#x20AC;FDWLRQ IRU WKH Ă&#x20AC;JKWDJDLQVWFDQFHUÂľ%HOOVDLG

Interact Club

JROTC

HOSA French Honor Society CBTV


APRIL 2014

NEWS

THE CIRCUIT

9

WWW.CBHSCIRCUIT.COM

New SAT to be implemented in 2016 SAT from Page 1 â&#x20AC;&#x153;I am very cynical about why they are changing it,â&#x20AC;? he said. â&#x20AC;&#x153;They are doing it because the ACT has passed them. In the ODVWWZR\HDUVLWKDVEHHQWKHĂ&#x20AC;UVWWLPHLQ history that more kids took the ACT than the SAT. So they are trying to make it look more like the ACT in the hopes that more people will take it.â&#x20AC;? +HVDLGWKRXJKWKH6$7LVDQRQSURĂ&#x20AC;W he still thinks they are driven by money. â&#x20AC;&#x153;I actually think it is possible that this ZLOOEDFNĂ&#x20AC;UHRQWKHPDQGZLOOGULYHPRUH people to the ACT,â&#x20AC;? he said. â&#x20AC;&#x153;The ACT has more momentum right now and for DWOHDVWWKHĂ&#x20AC;UVW\HDURUWZRWKDWWKHWHVWLV out students are just going to want to take the ACT and not take a test that they do not know that much about.â&#x20AC;? Freshman Paige Gorodetzky said she is happy that they decided to change the SAT, but thinks it could have a negative impact on her when she applies to college. â&#x20AC;&#x153;The fact that we will not get penalized for leaving an answer blank will benHĂ&#x20AC;WXVJUHDWO\Âľ*RURGHW]N\VDLG´,WKLQN colleges are going to expect the Class of 2017 to do very well, which could be a problem for us because the test is new.â&#x20AC;? Mr. Eldeiry said one of the best chang-

es on the new SAT is that it will not include the sentence completion section. â&#x20AC;&#x153;The fact that students will not have to study vocabulary words will be good,â&#x20AC;? he said. â&#x20AC;&#x153;They are getting rid of the sentence completions, so they are not going to test vocab, but they will still test reading.â&#x20AC;? Sophomore Lexi Stoloff, who will not be taking the new SAT because she is in the Class of 2016, said that she thinks she would do better on the new SAT because it will not have the sentence competition section. â&#x20AC;&#x153;I do wish that I didnâ&#x20AC;&#x2122;t have to take the vocab section,â&#x20AC;? Stoloff said. â&#x20AC;&#x153;Donâ&#x20AC;&#x2122;t get me wrong, the vocab is good to learn, but many of the words that they test us on are very random and hard, and nobody would need to use half in real life.â&#x20AC;? Not only will the essay on the new SAT be made optional, but the type of essay students will write is also going to change. â&#x20AC;&#x153;The current essay is very open ended and students can pretty much write what they want, so in some respects it rewards kids for making things up,â&#x20AC;? Mr. Eldeiry said. â&#x20AC;&#x153;The new essay is analyzing a source, so everyone is reading the same document and answering a question based on it. We will have to teach the students how to pull out what is important from the source material and write about

GRAPHIC BY ERIN YOO

that, rather than come up with examples from personal experience.â&#x20AC;? Mr. Eldeiry said that many people have misunderstood that even though the SAT is making the essay optional, most colleges are still going to make it mandatory because they will not accept the score without the essay. He said students will need to prepare differently for this test because it is going to force them to think more critically. â&#x20AC;&#x153;We are going to have to get the kids to think more critically about why answers, as opposed to what answers,â&#x20AC;? he

said. â&#x20AC;&#x153;The students will also have to approach the test differently and now answer every question, since they wonâ&#x20AC;&#x2122;t be penalized for guessing.â&#x20AC;? He noted another big change is that the SAT is partnering with Kahn Academy to provide free online tutoring; however, he does not think this will affect his business. â&#x20AC;&#x153;It is going to be a long time before computers can replace people, and at some point students are going to need someone to guide them and tell them what they are doing wrong,â&#x20AC;? he said.

Regular decision ushers in record no. of Ivy League acceptances BY JENNIFER SCHONBERGER ONLINE ARTS & ENTERTAINMENT EDITOR

This yearâ&#x20AC;&#x2122;s senior class was hit with a wave of acceptances when colleges released their regular admission decisions late March and early April. BRACE adviser Shari Bush said some of the schools are Harvard, Cornell, Yale, Dartmouth, Brown, Emory, University of Chicago, Vanderbilt, and more. â&#x20AC;&#x153;Typically, applying early decision is exciting because for many kids itâ&#x20AC;&#x2122;s their dream school that theyâ&#x20AC;&#x2122;ll be committing to, and chances of being accepted are a little bit more increased,â&#x20AC;? Mrs. Bush said. â&#x20AC;&#x153;But this year, Iâ&#x20AC;&#x2122;d say we had an equal amount of students getting in regular decision as we did early decision.â&#x20AC;? Senior Ana Lujan was accepted regular decision to Columbia, Duke, Cornell and the University of Pennsylvania and said she chose to apply regular decision EHFDXVHRIWKHĂ H[LELOLW\LWSURYLGHV â&#x20AC;&#x153;I didnâ&#x20AC;&#x2122;t have an absolute favorite school, so applying to my top choices gave me the opportunity to take into acFRXQWWKHĂ&#x20AC;QDQFLDODLGHDFKSURYLGHGDQG do more research on which one would be WKHEHVWĂ&#x20AC;WIRUPHÂľVKHVDLG Lujan said her deadline to make a decision on which school she will attend is May 1, but she is still in between schools. â&#x20AC;&#x153;My top schools are Columbia, Duke DQG 8QLYHUVLW\ RI 3HQQV\OYDQLD ,W GHĂ&#x20AC;nitely is a hard decision because they are all amazing schools and I feel honored to be accepted,â&#x20AC;? she said. Senior Josh Ulino, who will be attending Vanderbilt University, said he

ILLUSTRATION BY ABBY MORGAN

KDGWRDSSO\UHJXODUGHFLVLRQIRUĂ&#x20AC;QDQFLDO like to have a good time and be social, reasons. Ulino received the Cornelius but when it comes time for our studies we Vanderbilt scholarship, which is a full tu- also have the ability to focus on that,â&#x20AC;? he ition scholarship that the school gives to said. Senior Bianka Ukleja applied â&#x20AC;&#x153;early about 126 students a year. â&#x20AC;&#x153;Vanderbilt has been my dream school action restricted,â&#x20AC;? to Yale, which is nonfor as long as I can remember, but I didnâ&#x20AC;&#x2122;t binding, and was accepted in December. know if I had the ability to pay for the After regular decisions were released school,â&#x20AC;? he said. â&#x20AC;&#x153;I had to wait and see if and Ukleja was accepted to Harvard and I got the scholarship, and I was fortunate Georgetown, she had to narrow her decision down to her top three choices of enough to receive it.â&#x20AC;? Ulino said when he visited Vanderbilt Yale, Harvard, and Georgetown. â&#x20AC;&#x153;I was ecstatic to hear back from three LQ1DVKYLOOHIRUWKHĂ&#x20AC;UVWWLPHKHWKRXJKW LWZDVH[DFWO\ZKHUHKHZRXOGĂ&#x20AC;WLQDQGKH incredible schools in their own respect,â&#x20AC;? she said. â&#x20AC;&#x153;I still have goose bumps.â&#x20AC;? is excited to be a student there. Ukleja said she went with her gut feelâ&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m looking forward to the even mix between the social and the academic life ing when picking Yale. â&#x20AC;&#x153;I applied to Yale early for a reason, at Vanderbilt and being with a lot of people who are similar to myself in that we NQRZLQJWKDWLWZDVWKHEHVWĂ&#x20AC;WIRUPHDFD-

demically and spiritually. It sounds funny, but itâ&#x20AC;&#x2122;s true. My advice to anyone is that WKHEHVWĂ&#x20AC;WIRU\RXLVZKHUH\RXFDQUHally see yourself being happy and making the most out of your college experience,â&#x20AC;? she said. Mrs. Bush said this yearâ&#x20AC;&#x2122;s senior class has been particularly ambitious and hardworking, and have supported each other throughout the journey. â&#x20AC;&#x153;This is the second year in a row that weâ&#x20AC;&#x2122;ve been eight for eight with all the Ivies, but this year we have more kids in each one and also in a lot of other top tier schools,â&#x20AC;? she said. â&#x20AC;&#x153;Whatâ&#x20AC;&#x2122;s also exciting is that this year we had six kids get in HDUO\GHFLVLRQWR'XNHDQGĂ&#x20AC;YHLQWR0,7 which is a record high.â&#x20AC;? Mrs. Bush said she is excited that colleges are starting to recognize Cypress Bay as a school that sends quality students that are really up to the standards once they get there. â&#x20AC;&#x153;Whatâ&#x20AC;&#x2122;s really come to fruition this year is that a lot of our students who have been going to these good schools, like MIT and Harvard, have been doing very well,â&#x20AC;? she said. â&#x20AC;&#x153;I think the college advisLQJRIĂ&#x20AC;FHLVUHDOO\SXWWLQJDORWRIHQHUJ\ into making sure that colleges recognize the caliber of our kids.â&#x20AC;? Mrs. Bush said she hopes next yearâ&#x20AC;&#x2122;s seniors do as well as this yearâ&#x20AC;&#x2122;s if not better. â&#x20AC;&#x153;I hope next yearâ&#x20AC;&#x2122;s seniors are as ethical and authentic throughout the process and that they work with me, because I cannot be an advocate for them if I donâ&#x20AC;&#x2122;t know them,â&#x20AC;? she said.


10

NEWS

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

APRIL 2014

Student body elects :.(VMĂ&#x201E;JLYZ BY INES ACOSTA

TKHQHZVWXGHQWJRYHUQPHQWRIĂ&#x20AC;FHUVDQQRXQFHGRQ April 17, are: junior Taylor Bakalar, president; sophoPRUH $OH[DQGUD 4XLQWDQD Ă&#x20AC;UVW YLFH SUHVLGHQW VRSKRmore Ashley Callahan, second vice president; sophoPRUH -RVHĂ&#x20AC;QD &ROO WKLUG YLFH SUHVLGHQW VRSKRPRUH Alexis Cao, recording secretary; sophomore Camila Colon, corresponding secretary; and sophomore Max Ramer, treasurer. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m excited for some new leadership and for them to really just make things happen,â&#x20AC;? said SGA sponsor Danielle Nascimento. â&#x20AC;&#x153;With every new team is new excitement and new goals and new opportunities. Iâ&#x20AC;&#x2122;m looking forward to see what the new team will bring to the table.â&#x20AC;? To be able to run, each candidate must have a minimum 2.5 unweighted GPA, obtain 50 signatures from classmates who support his or her candidacy and be enrolled in a Leadership Skills class for the following year. He or she must also follow a set of rules for campaigning, which help keep the campaigns fair, limit the amount of money spent and help keep the school clean from an exFHVVLYHDPRXQWRIĂ LHUV0UV1DVFLPHQWRVDLG â&#x20AC;&#x153;Studentsâ&#x20AC;&#x2122; budgets could be larger than others if they ZDQWHGWREXW,WU\WRNHHSDSUHWW\IDLUSOD\LQJĂ&#x20AC;HOGÂľ she said. â&#x20AC;&#x153;As far as hanging things around the school, we try to keep the integrity of the school by keeping things neat.â&#x20AC;? 0V1DVFLPHQWRVDLGEHLQJDQRIĂ&#x20AC;FHUDW6*$LVRIWHQ DJRDOWKHVWXGHQWVVHWIRUWKHPVHOYHVZKHQWKH\Ă&#x20AC;UVWHQ-

ter the program. â&#x20AC;&#x153;A lot of opportunities can open up,â&#x20AC;? she said. â&#x20AC;&#x153;Being able to have a vehicle to maybe make a difference at school, I think is probably the best perk of all.â&#x20AC;? Outgoing SGA third vice president Sydney Schepps, a senior who was in charge of coordinating the election, said this yearâ&#x20AC;&#x2122;s 18 candidates is more than there have been in previous years. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s nice to know that so many people want to be involved and step up in SGA,â&#x20AC;? Schepps said. As president, Bakalar will be overseeing the SGA class and all SGA-related events and activities â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m really lucky that I got the position,â&#x20AC;? Bakalar said. â&#x20AC;&#x153;I hope to be able to improve the school to be more comfortable for the students as well as making the next year the best yet.â&#x20AC;? Callahanâ&#x20AC;&#x2122;s job will entail communications outside of school, such as county-level and state-level meetings. 6KHIHHOVLWLVDSHUIHFWĂ&#x20AC;WIRUKHU â&#x20AC;&#x153;I love communicating with people from other schools, and this job is really centered on that fact,â&#x20AC;? she said. â&#x20AC;&#x153;I enjoy meeting new people.â&#x20AC;? Callahan, who ran unopposed for second vice president, said the other candidates were more interested in other positions, and despite the easy campaign, she wishes she would have had competition. â&#x20AC;&#x153;It would have been fun to have someone to run against and get the whole election vibe, but its also nice having a stress-free election,â&#x20AC;? Callahan said.

Taylor Bakalar President

Alexandra Quintana First Vice President

Ashley Callahan Second Vice President

-RVHĂ&#x20AC;QD&ROO Third Vice President

Camila Colon Corresponding Secretary

Alexis Cao Recording Secretary

Max Ramer Treasurer

Televised trivia competition tests knowledge of Brain Bowl team BY ANA BEATRIZ GONCALVES

Senior Craig Covitz held his hand over the buzzer, awaiting the next question and making sure that either he or one of his team members knew the answer. Looking forward, he saw the shiny lens of the television cameras in front of them and proudly displayed his Cypress Bay team uniform. The Brain Bowl team competed on BECONâ&#x20AC;&#x2122;s televised program â&#x20AC;&#x153;School Duelâ&#x20AC;? taped the school year. They started Ă&#x20AC;OPLQJGXULQJWKHVHFRQGPRQWK of school and continued on. The winners will receive a $1,000 cash prize for each member. However, the results for â&#x20AC;&#x153;School Duelâ&#x20AC;? championships will not be aired until midJune. So Students can tune into BECON-TV on channels 19 and 63 to follow the progress. â&#x20AC;&#x153;There isnâ&#x20AC;&#x2122;t just one day for Ă&#x20AC;OPLQJÂś6FKRRO'XHO¡ÂľVDLG&Rvitz, the captain. â&#x20AC;&#x153;This program is paid for by the Broward County school district, so they tried to take us out only on half days and days off. We only had to miss one full day.â&#x20AC;? â&#x20AC;&#x153;School Duelâ&#x20AC;? is only a small part of Brain Bowlâ&#x20AC;&#x2122;s competi-

BECON STUDIOS PHOTO

BRAIN BRAWL: (from left to right) Senior Craig Covitz, senior Matthew Kessler, junior Jake Ukleja and senior William Christou compete in BECONâ&#x20AC;&#x2122;S televised program â&#x20AC;&#x153;School Duel.â&#x20AC;?

tions, said Covitz. They participate in four other competitions and the Lightning team wins many of them. â&#x20AC;&#x153;I feel that people get that PLVFRQFHSWLRQ WKDW Âś6FKRRO Duelâ&#x20AC;&#x2122; is the only thing the club does,â&#x20AC;? Covitz said. â&#x20AC;&#x153;However, weâ&#x20AC;&#x2122;re also one of the only public schools that compete in these competitions and thatâ&#x20AC;&#x2122;s a really big deal for us.â&#x20AC;? In addition to â&#x20AC;&#x153;School Duel,â&#x20AC;? there is the History Bowl, which competes three times a year,

Quiz Bowl, and Brain Bowl. â&#x20AC;&#x153;Each competition gets their own little team from Brain Bowl,â&#x20AC;? club adviser Jim Wurster said. â&#x20AC;&#x153;And in each competition we do really well. I know that Craig Covitz really prides himself on the clubâ&#x20AC;&#x2122;s success. Private schools get to purchase a lot of materials in order to prepare themselves, and [Covitz] gets all the material and preparations he can for free. The fact that they can still win against these really prepared private schools says a

lot about our team.â&#x20AC;? The selection process to determine which members will appear onscreen is involves a test that Covitz himself created. They are only allowed to bring in four competitors and an alternate. â&#x20AC;&#x153;I found an episode online RIÂś6FKRRO'XHO¡IURPODVW\HDU and transcribed all the questions. Then I printed them out and gave it to all the members, testing them and seeing which ones, based on that episodeâ&#x20AC;&#x2122;s

questions, did the best,â&#x20AC;? he said. Alternate Juan Federico Trigo, a junior, was really excited to even have a chance at playing. â&#x20AC;&#x153;I didnâ&#x20AC;&#x2122;t get to go on screen,â&#x20AC;? he said, â&#x20AC;&#x153;but I was super proud of myself for my accomplishments and getting selected out of the other members of Brain Bowl. And even though I didnâ&#x20AC;&#x2122;t get to compete, I got to cheer on my teammates and we did really well compared to most other schools.â&#x20AC;?


NEWS

APRIL 2014

THE CIRCUIT

11

WWW.CBHSCIRCUIT.COM

PHOTO BY BEATRIZ GALDONA

MAKING THE GRADE: Underclassmen receive awards for academic excellence in each department, Top Scholar and Book Awards and scholarships.

Underclassmen awarded for excellence BY EMILY CHAIET

Freshman, sophomores and juniors gathered in the auditorium on April 8 as over 300 awards were handed out at the Underclass Awards Night. â&#x20AC;&#x153;We have the awards to honor our underclass students and their achievements, hard work and dedication to their studies,â&#x20AC;? said guidance counselor Sheryll Wilson, who coordinated the event. Students had received notice of their nominations on March  7KH\ GLG QRW Ă&#x20AC;QG RXW ZKDW award they earned until the night of the event. To receive an award, a student had to be nominated by his or her teacher. â&#x20AC;&#x153;The award is given for outstanding performances, high grades and improvement,â&#x20AC;? Ms.

Wilson said. â&#x20AC;&#x153;It doesnâ&#x20AC;&#x2122;t have to be all Aâ&#x20AC;&#x2122;s, just to show the student did well in a subject.â&#x20AC;? The categories were the achievement awards for each department subject area, Common Knowledge Scholarship Foundation Award, Youth Leadership Broward Award, Top Scholar Award and Book Award. Department awards were given to students in Career and Technical Education, Fine Arts, Language Arts, Mathematics, Physical Education, Science, Social Studies and World Languages. Each department also included separate awards for some electives. ´,W¡V D GLIĂ&#x20AC;FXOW GHFLVLRQ IRU teachers to narrow down the students to nominate,â&#x20AC;? English department head Joyce Seigel

said. â&#x20AC;&#x153;There are too many stars among us.â&#x20AC;? The English and World Language departments had the most awards given. Ms. Seigel said teachers in the English department nominated students based on their GPA and dedication to the subject. â&#x20AC;&#x153;Students need to go the extra mile such as contest recognition or English Honor Society participation,â&#x20AC;? she said. â&#x20AC;&#x153;We have so many high achieving students. Itâ&#x20AC;&#x2122;s hard to narrow down who will get the award.â&#x20AC;? Geometry and Algebra 2 teacher Ana Alonzo said she nominated the most well-rounded students. â&#x20AC;&#x153;I nominate students when they are not only smart but also hard working with great moral

values and a good work ethic,â&#x20AC;? she said. â&#x20AC;&#x153;Some students have all Aâ&#x20AC;&#x2122;s but it doesnâ&#x20AC;&#x2122;t mean they deserve the award.â&#x20AC;? Sophomore Emily Levine received an award for Spanish 4. She said she was surprised to receive the nomination. â&#x20AC;&#x153;I think itâ&#x20AC;&#x2122;s really cool to receive an award for Spanish because Iâ&#x20AC;&#x2122;ve been taking it for almost four years,â&#x20AC;? Levine said. â&#x20AC;&#x153;I didnâ&#x20AC;&#x2122;t do anything special in particular to receive the award, but I think Iâ&#x20AC;&#x2122;ve just been working really hard this year, and now Iâ&#x20AC;&#x2122;m recognized for it.â&#x20AC;? The Top Scholar Awards ZHUH JLYHQ WR WKH WRS Ă&#x20AC;YH VWXdents in ninth, 10th and 11th grades. The 11th grade recipients of the Top Scholar Award also received Book Awards. Ju-

nior Alison Huang received the Wellesley College Book Award. â&#x20AC;&#x153;The Book Awards are different and each given for special characteristics,â&#x20AC;? Huang said. â&#x20AC;&#x153;I knew I would win the Top Scholar award, but I didnâ&#x20AC;&#x2122;t know which Book Award I would win.â&#x20AC;? Freshman Camila Tussie was nominated for four awards: AP Spanish, AICE Thinking Skills, AICE General Paper and the ninth grade Top Scholar Award. â&#x20AC;&#x153;I was absolutely thrilled. I felt like all the hard work paid off,â&#x20AC;? Tussie said. â&#x20AC;&#x153;I was surprised that I got so many awards. Itâ&#x20AC;&#x2122;s a huge honor. Itâ&#x20AC;&#x2122;s great that teachers recognize your hard work.â&#x20AC;?

Countywide prom fosters feelings of acceptance among LGBTQ youth BY LISA BURGOA NEWS EDITOR

Senior Manu Osorio relishes the rites and rituals that accompany prom season: scrounging around for the perfect dress, searching for the right palette of makeup, and nervously anticipating a â&#x20AC;&#x153;promposalâ&#x20AC;? â&#x20AC;&#x201C; from her girlfriend. But rather than attending Cypress Bayâ&#x20AC;&#x2122;s school-sponsored prom, Osorio is opting for the third year in a row to attend the Ă&#x20AC;IWK DQQXDO /*%74,QFOXVLYH Prom on June 14 at Fort Lauderdaleâ&#x20AC;&#x2122;s Sanctuary Church. Coordinated by SunServe, a nonSURĂ&#x20AC;W RUJDQL]DWLRQ WKDW FDWHUV to South Floridaâ&#x20AC;&#x2122;s gay community and its allies, the dance is WKHRQO\/*%74 /HVELDQ*D\ %LVH[XDO7UDQVH[XDO4XHVWLRQing) prom to be offered in Broward County. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve been to the prom the past two years, and it was an awesome experience,â&#x20AC;? said Osorio, who is the president of the Bayâ&#x20AC;&#x2122;s chapter of the Gay6WUDLJKW$OOLDQFH *6$ ´'HĂ&#x20AC;nitely my favorite part was being able to hold my then-girlfriendâ&#x20AC;&#x2122;s hand and receiving compliments instead of death stares.â&#x20AC;? With tickets at $35 at www. youthpromtickets.com until May 15 and $40 at the door, part of the promâ&#x20AC;&#x2122;s allure derives from its affordability, Osorio said. Com-

paratively, a prom ticket at the Bay fetches upwards of $170. â&#x20AC;&#x153;I would like to go to the [school] prom, but I canâ&#x20AC;&#x2122;t afford it,â&#x20AC;? Osorio said. â&#x20AC;&#x153;Thatâ&#x20AC;&#x2122;s another cool thing about SunServeâ&#x20AC;&#x2122;s prom. Itâ&#x20AC;&#x2122;s a really doable price.â&#x20AC;? Originally founded by sponsors of the Broward chapters of the GSA in 2012, the â&#x20AC;&#x153;Once Upon A Dreamâ&#x20AC;?-themed dance strives to foster an atmosphere of acceptance for South Florida youths of all sexual orientations, said SunServe events specialist Andii Viveros, who helped coordinate the event. â&#x20AC;&#x153;The goal of the event is for all youth to celebrate being themselves,â&#x20AC;? she said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s only getting to be bigger and better each year.â&#x20AC;? With over 200 attendees aged 13-21 anticipated to attend the event, Ms. Viveros said she hopes the prom draws the issue of sexual identity to the forefront of the communityâ&#x20AC;&#x2122;s consciousness. The location of Sanctuary &KXUFKZDVVSHFLĂ&#x20AC;FDOO\VHOHFWHG to make a statement about the union between religious instituWLRQVDQGWKH/*%74LGHQWLW\ â&#x20AC;&#x153;We are hoping by showing so much diversity at our prom, that youth will go back to their schools and show the need for inclusiveness at their own prom,â&#x20AC;? Ms. Viveros said. â&#x20AC;&#x153;I believe it is very symbolic that our proms

are held in churches, because they are very safe spaces and it is awesome to know that religious community supports our efforts in creating equality for the LG%74FRPPXQLW\Âľ Senior Noah Schtupak, who is openly gay, said he is relieved /*%74 \RXWK DUH SUHVHQWHG with the opportunity of attending prom within an accepting atmosphere. â&#x20AC;&#x153;I think itâ&#x20AC;&#x2122;s great that gay teens have a place to feel welcomed, especially if they are not comfortable to be themselves at their own school,â&#x20AC;? he said. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m fortunate enough to have everyone be supportive of who I am and I felt comfortable enough to come out in the beginning of my freshman year. I know everybody is not as accepting as in Cypress Bay, so itâ&#x20AC;&#x2122;s good gay kids can go to their own prom with their boyfriend or girlfriend.â&#x20AC;? As someone who doesnâ&#x20AC;&#x2122;t like to label her sexual identity, Osorio said the prom offers a haven for others like her. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a beautiful event because it gives LGBT youth a safe place since many are afraid to come out or are bullied if they do,â&#x20AC;? she said. â&#x20AC;&#x153;The prom allows us to see that there really is a more accepting world out there to be discovered.â&#x20AC;? Behind the scenes, Ms. Vive-

PHOTO SUBMITTED BY MANU OSORIO

FEELING INCLUDED: Senior Manu Osorio poses with her prom date, Cailtlin Hogan, at last yearâ&#x20AC;&#x2122;s LGBTQ-Inclusive Prom. This year over 200 attendees are anticipated to partake LQDQHYHQLQJĂ&#x20AC;OOHGZLWKHQWHUWDLQPHQWIURP3RZHUUDGLR including performances from DJ Zog and Lisa Lopez as emcee.

ros said the coordinators are securing catering and sponsors for the event and planning live entertainment acts from Power 96 radio, including performances from DJ Zog and Lisa Lopez as emcee. â&#x20AC;&#x153;As always, we aim to have a successful evening of fun, food, entertainment and music,â&#x20AC;? she said. â&#x20AC;&#x153;Last year we had a total blast, with catering from Whole Foods and great performances,

so we want to see if we can beat that this year.â&#x20AC;? Osorio said she harbors high expectations for this yearâ&#x20AC;&#x2122;s prom. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m looking forward to seeing the performances. I love seeing the extravagant dancers,â&#x20AC;? she said. â&#x20AC;&#x153;I am expecting to meet more interesting people and hopefully see some old friends. I also hope more people from Cypress can go, since itâ&#x20AC;&#x2122;s a very good bonding experience.â&#x20AC;?


OPINION

12 THE CIRCUIT

WWW.CBHSCIRCUIT.COM

APRIL 2014

Good education missing true value The value of a good education is priceless. Priceless, that is, until one accounts for an $80 tutoring session before the next Pre-Calculus exam. Or for the $1,000 SAT prep course. Or for the $50 dues for honor society membership as a mandatory embellishment for a college resume. As evidenced by the near ubiquitous Ă DVK RI SULFH\ L3KRQHV DQG GHVLJQHU clothes of Bay students, the Weston community is far from even the basest form of squalor. But itâ&#x20AC;&#x2122;s easy to imagine families EXFNOLQJXQGHUWKHĂ&#x20AC;QDQFLDOVWUDLQRISXWting a kid through school, especially with the mounting competition to stay at the top of the class. Whether these investments are worthwhile is arguable, but students with these monetary resources are put at an indisputable advantage. The SAT in particular is skewed toward high-income level students, no doubt as a result of a willingness RIPRUHDIĂ XHQWSDUHQWVWRVKHOORXWFDVK for prep classes. Statistics provided by the College Board show an unsettling correlation between income and test performance. The average student score in a family earning $60,000 to $80,000 is just shy of 1470. Wealthier counterparts, who rake in more than $200,000, have scores skyrocket to a whopping 300-point difference. Even in the classroom, the disparity is evident. If Student A and Student B are equally knowledgeable in their Chemistry Honors class, Student A will undoubtedly SHUIRUPEHWWHUDIWHUWKHEHQHĂ&#x20AC;WRIDWXWRUing session. Ethically, tutoring presents a dilemma. At a public school, everybody should be afforded with an equal opportunity

ILLUSTRATION BY LAURA MUNEVAR

to thrive in the classroom. In that sense, the Bay is just an extension of the outside world itâ&#x20AC;&#x2122;s supposed to be preparing its students for. And just like the world beyond these halls isnâ&#x20AC;&#x2122;t fair, the classrooms are jam-packed with students who arenâ&#x20AC;&#x2122;t receiving the same resources as their peers. While these pitfalls are largely unavoidable, there are a few ways to rectify this. For starters, a policy de-empha-

sizing tutoring can be put in place at the school. Teachers, particularly in math and science courses, should be receptive to questions from students during and after classes, so students wonâ&#x20AC;&#x2122;t feel the pressure to be tutored. 7KH VFKRRO LWVHOI FRXOG DOOHYLDWH Ă&#x20AC;nancial stress by offering free SAT or ACT classes. Currently, Cypress Bay offers prices much lower than through pri-

vate services, but not everybody will have equal opportunity to succeed until free SAT classes are available to all students. At a public school, families shouldnâ&#x20AC;&#x2122;t IHHOFUXVKHGZLWKĂ&#x20AC;QDQFLDOSUHVVXUHLQRUder for students to maintain good grades, especially with college expenses looming so close in the future. Ultimately, one canâ&#x20AC;&#x2122;t slap a price tag on securing a bright future.

Flash of Brilliance YES I do believe college basketball athletes should be allowed to declare for the draft after one year. Players can contribute to the college they commit to by helping them win. For example, Carmelo Anthony helped lead Syracuse to the 2003 National Championship as a freshman. This is great because it helps colleges with popularity and leads to more people applying to the school that does well that year. Also, for those players coming out of high school from inner city areas, making money as soon as possible is important for them to support their family. If people are allowed to enter the army before college, players should be able to enter the NBA draft and make a living only after one year. Entering the army is a much bigger commitment and responsibility than playing in the NBA. This clearly shows players should be able to enter the draft after one year. There is no other profession other than professional sports that restricts people from doing what they want in life. So after just one year in college, it makes sense for players to have the chance to pursue their dream of playing professional basketball. - Spencer Rheingold

Should college basketball players be allowed to declare for the NBA draft after one year?

GRAPHIC BY ERIN YOO

NO Playing one year of college basketball and then declaring for the NBA draft is a ridiculous system. The purpose of college basketball is to prepare young athletes to go professional, physically and mentally. In the rare case that there is an athlete under the age of 20 ready to perform in the NBA, there should be a system similar to the MLB, in which high school students may be drafted. But if they decide to go to college, they must stay for at least three years. In the NCAA basketball tournament, experience has proven NH\ DV ZHOO ,Q WKH  Ă&#x20AC;QDOV WKH University of Connecticut beat the University of Kentucky. Kentucky KDGĂ&#x20AC;YHIUHVKPHQVWDUWLQJIRUWKHP while Connecticut had none. A reason for this is because Kentucky coach John Calipari recruits top high school prospects who join the NBA after one year, leaving no experience on the roster. Furthermore, athletes who decide to go to the NBA may not know how to manage their money. Going from basically broke to thousands of dollars is a large change, and many athletes love to blow their money on cars, houses, and more.Staying in college can secure the future of an athlete. - Jake Fuhrman


OPINION

APRIL 2014

THE CIRCUIT

13

WWW.CBHSCIRCUIT.COM

The Bay should offer summer courses â&#x20AC;&#x153;Good morning teachers and students, please pardon this interruption.â&#x20AC;? For the past couple of months during second and eighth period, the Bay has been hearing interruptions on the loud speaker about signing up for college-level summer courses at Broward College. Instead of making students go through the process of taking summer classes in a different and unfamiliar school, the Bay should offer its students summer courses on its own campus. Signing up for classes at Broward College requires making an account, spending countless hours in guidance and providing SAT, ACT or PERT test VFRUHVPDNLQJLWDGLIĂ&#x20AC;FXOWSURFHVVWR enroll. A good alternative could be to have summer classes offered at the Bay, and have them include various levels instead of only having Advanced Placement (AP) classes. This would make completing credits a faster process, which would then allow students to sign up for more electives and classes they enjoy. Providing summer courses would not only aid in bringing GPAs higher, but it would also make studentsâ&#x20AC;&#x2122; academic careers more impressive. Although for high school students the classes offered at Broward College are free, they are all college level courses, which include more rigorous assignments. Students should be able to choose between regular, honors or AP classes, not just AP classes. Having summer courses should only help the student body, not hurt them, which is why the Bay should offer courses that are easier than AP level classes. This would give the students a variety of classes and levels, which would improve their academic careers. After all, the more than 4,000 kids who attend Cypress Bay do not all have equal mental capabilities; the summer classes offered should not combine students into only one category. Archbishop McCarthy High School offers its students classes dur-

ILLUSTRATION BY LAURA MUNEVAR

ing summer, as do other private high schools in South Florida such as Cardinal Gibbons, Monsignor Edward Pace and St. Thomas Aquinas. Archbishop McCarthyâ&#x20AC;&#x2122;s summer courses are about three to four weeks long, depending on the course and each cost $550. There is a morning and an afternoon session, each three hours with

three breaks. The Bay should look into raising money for these courses so they wonâ&#x20AC;&#x2122;t be as pricey, but even if students do have to pay, LWZLOOEHZHOOZRUWKLWDQGEHQHĂ&#x20AC;FLDOWR their academic careers. Compared to the time-consuming schedule students endure during the school year, summer courses are short,

sweet and to the point. Although most students celebrate the thought of not stepping into school for about two months, after a couple weeks of summer, desperation kicks in. Having a summer school at the Bay would give students something academic to do during the days off along with a light routine.

Letters to the editor The student parking lot OHZ[VVT\JO[YHMĂ&#x201E;J

Teachers should give less work as quarter ends

The student parking lot is too overcrowded. Even though I do not have my license, my friend drives me home and ZHKDYHWRVLWLQWKHWUDIĂ&#x20AC;FHYHU\GD\, do not understand why they canâ&#x20AC;&#x2122;t just open the second gate near the back of the parking lot. On the rare days that they do open it, I get home 10 to 15 minutes earlier than when the gate is closed. It does not make sense that the school does not take the few extra minutes to open the second gate and choosHVWRKDYHWRQVRIH[WUDWUDIĂ&#x20AC;F,NQRZ I am not the only person frustrated by WKH WUDIĂ&#x20AC;F DQG WLPH VSHQW LQ WKH VWXdent parking lot after school. Cypress VKRXOG GHĂ&#x20AC;QLWHO\ GR VRPHWKLQJ WR Ă&#x20AC;[ this problem. -sophomore Emily Levine

It seems as though the quarter begins to come to an end, the work load and assessments become more. Teachers should be conscious of the amount of tests and quizzes they are distributing to students and also aware of the studentsâ&#x20AC;&#x2122; remaining classes. Students who have been working hard all through the marking period and have borderline grades at the end of the quarter might start to panic at assessments being assigned last minute, which could either make or break their grade. End of the quarter should signify less ZRUNORDGEHQHĂ&#x20AC;WLQJERWKWKHVWXGHQWDQG teacher. -junior Alessandra Bregante

EOC schedule gives students time to prepare

RQHZHZRXOGQ¡WĂ&#x20AC;QGRXWDQ\WKLQJDERXW our school. The staff is doing a wonderful job keeping up with stories about the school and what goes around. I really en7KLVLVP\Ă&#x20AC;UVWWLPHH[SHULHQFLQJWKH joy reading the newspaper because the EOC days and I am quite happy. Instead stories in it are so interesting. of getting a whole entire week of taking -sophomore Nicole Rothman tests back to back, itâ&#x20AC;&#x2122;s now going to give me time to study because of it being on Letters to the editor are encouraged Mondays. The best thing about this is that as part of The Circuitâ&#x20AC;&#x2122;s mission ,FDQĂ&#x20AC;QDOO\WDNHWKHWLPHRIVWXG\LQJDQG as a public forum. Submissions learning in class and apply it on the EOC. should not exceed 300 words;Íž they I hope the school board will keep allow- should be dropped off in Room ing this because I believe it helps the stu- 428 or mailed to the school to the dents create a plan to manage their time attention of adviser Rhonda Weiss. 7KH DXWKRU ZLOO KDYH WKH Ă&#x20AC;QDO VD\ of practicing and studying. in phrasing of the letter, but letters -freshman Marcelle Zaccour are subject to editing for length, clarity, punctuation and grammar. Anonymous letters will not be Newspaper receives printed and the writerâ&#x20AC;&#x2122;s identity positive review ZLOO EH FRQĂ&#x20AC;UPHG SULRU WR WKH publication. Any material deemed I appreciate having a newspaper staff libelous, obscene, disruptive or at Cypress Bay because if we didnâ&#x20AC;&#x2122;t have unlawful to minors will not be published.


14

THE CIRCUIT

OPINION

APRIL 2014

Bittersweet high school experience coming to an end

Following my long-term dreams helped me stay motivated

,W LV RIÀFLDOO\ WKDW WLPH RI WKH \HDU PRUQLQJDUHDERXWWRFRPHWRDFORVH0\ :KDWWKH\VDLGDERXWWKLV´GLVHDVHµLV FKLOGKRRGLVDOPRVWRYHU SHUFHQWWUXHVHQLRULWLVKDVIXOO\WDNHQDG:KHQ,ÀUVWVWHSSHGRQWRFDPSXVIRXU YDQWDJHRIPH:LWKFROOHJHGHFLVLRQVED- \HDUVDJREHFRPLQJDKLJKVFKRROVHQLRU VLFDOO\VHWLQVWRQHJUDGHVKDYLQJPLQL- VHHPHGOLNHDJDOD[\DZD\DQGWKDWWKRVH PDOHIIHFWRQP\IXWXUHWKHKRPHVWUHWFK GD\VZRXOGQHYHUFRPH IRUPHDQGRWKHUVHQLRUVDWWKH%D\ :HOOORRNDWWKDW,DPKHUHLQDKHDUWLVXSRQXV EHDWDQGWKDWZHQWE\IDVWHUWKDQ,HYHU 7KH SURWKRXJKW 3HUFUDVWLQDKDSV WKH WLRQLVZRUVH My tank is on the verge of PRVW LPWKDQHYHU DV empty, with just enough gas to SRUWDQW IRXU , DP FXU\HDUVRIDKXUHQWO\ ZULW- get me through the next few PDQ EHLQJ·V LQJ WKLV RQ weeks of my life, weeks that OLIH DUH LQ WKHÀQDOGD\ will consist of milestones in my KLJK VFKRRO DQGÀQDOSH,W VHHPV WR ULRG RI RXU young life that I will be able to EH WKH SODFH QHZVSDSHU·V tell my children one day, like the ZKHUH D SHUG H D G O L Q H  last day of school, prom and VRQ ÀQGV KLV DQG P\ LQRU KHU SDVWHUHVW IRU graduation. VLRQ KLV HDFK VXEMHFW RU KHU WUXH LV JUDGXDOO\ IULHQGV DQG GHFOLQLQJ SHUKDSV HYHQ 0\WDQNLVRQWKHYHUJHRIHPSW\ZLWK KLV RU KHU IXWXUH , FHUWDLQO\ KDYH HQYLMXVWHQRXJKJDVWRJHWPHWKURXJKWKHQH[W VLRQHGPLQH IHZZHHNVRIP\OLIHZHHNVWKDWZLOOFRQ6RP\DGYLFHWRWKHVHQLRUFODVVLVWR VLVWRIPLOHVWRQHVLQP\\RXQJOLIHWKDW, SHUKDSVWKLQNWZLFHDERXW´ZDQWLQJWRJHW ZLOOEHDEOHWRWHOOP\FKLOGUHQRQHGD\ RXWRIKHUHDOUHDG\µDQG´VWDUWLQJOLIHRYHU OLNH WKH ODVW GD\ RI VFKRRO SURP DQG IURP VFUDWFKµ DV WKRVH DUH VRPH RI WKH JUDGXDWLRQ SKUDVHVWKDWFORJP\VRFLDOPHGLDIHHGV ,WLVVRPHWLPHVKDUGWRIDWKRPDQGDF- RQDGDLO\EDVLV FHSWWKHSRLQWZKHUH,FXUUHQWO\VWDQGLQ 7KHVHGD\VDUHEDVLFDOO\DOOEXWJRQH P\ DFDGHPLF FDUHHU $OPRVW IRXU \HDUV DQGWKH\DUHQHYHUFRPLQJEDFN2QFHZH FRQVLVWLQJ RI HQGOHVV KRPHZRUN HYHU\ ZDONDFURVVWKDWVWDJHDWWKH%DQN8QLWHG QLJKW VWDQGDUGL]HG WHVWV WKDW ZLOO XQ- &HQWHURQ-XQHDQGWKURZRXUFROOHJH IRUWXQDWHO\  EH D PDMRU IDFWRU LQ GHFLG- GHFRUDWHGFDSVLQWRWKHDLULWZLOOWKHQEH LQJZKHUH,ZLOOVSHQGWKHQH[WIRXU\HDUV WLPHWRGHSDUW&\SUHVV%D\DQGEHJLQWR RI P\ OLIH DQG JHWWLQJ XS DW  HYHU\ OLYHWKHFROOHJHH[SHULHQFH

,W·V OLNH EHLQJ LQ DQRWKHU ZRUOG (Y- KDXVWHG ZDVQ·W SUHIHUDEOH EXW DV , SURHU\WKLQJSLOHVRQDQGRQXQWLOWKHEUHDN- JUHVVHGWKURXJKKLJKVFKRRO,OHDUQHGWDFLQJSRLQW²FKDRVRUFODULW\+LJKVFKRRO WLFVWRFDOPWKHDQ[LHW\)RUPH,QHHGLVDMRXUQH\HYHU\RQHOHDUQVWKHEDVLFV² HGDQRXWOHW7KHJ\PPLQGOHVVKRXUVRI PDWK(QJOLVKVFLHQFH²EXWLQP\VKRUW 1HWÁL[DQGMXVWEHLQJDURXQGP\IULHQGV IRXU\HDUV,OHDUQHGPRUHDERXWKRZWR WDPHGWKHZLOGVWUHVV %HFDXVH&\SUHVV%D\KDVVXFKDQHGXSXVKP\VHOIDQGVWD\PRWLYDWHG FDWLRQFUDYLQJFRPPXQLW\SXWWLQJP\DOO )RXU \HDUV EURNHQ XS LQWR  QLQH ZHHNTXDUWHUVFUDPPHGZLWKPRUHVWUHVV LQWRHYHU\WKLQJZDVQ·WRXWRIWKHRUGLQDU\ DQGDQ[LHW\,FRXOGKDYHHYHUDQWLFLSDWHG DPRQJP\SHHUV(YHQDV,HQWHUHGP\VHEXW,ZRXOGQ·WWDNHDQ\RILWEDFN%HLQJ QLRU\HDUP\PLQGVHWZDVWKHVDPHKLJK DPHPEHURIWKH&\SUHVV%D\FRPPXQL- PRWLYDWLRQIRUVFKRRO,ÀQLVKHGDOORIP\ FROOHJH DSSV E\ W\ KDV LQGXFHG PLG2FWREHU H[PH WR FRPPractically since the womb SHULHQFHG PLQLSHWH QRW RQO\ PDO SURFUDVWLQDDJDLQVW P\ my parents planned for me WLRQ DQG GLGQ·W FODVVPDWHV EXW to follow in their footsteps HQGXUH SUDFWLDOVRP\VHOI FDOO\ DQ\ IRUP and become a baby Gator. %XW ZKDW LV RIVHQLRULWLVXQWLO WKHNH\WRPR)HE WLYDWLRQ" :HOO 1RW EHFDXVH LW ZDV 9DOHQWLQH·V 'D\ IRU PH LW ZDV IROORZLQJ P\ GUHDP RQH QRWEHFDXVHLWZDV6HQLRU6NLS'D\EXW GD\DWDWLPH 3UDFWLFDOO\VLQFHWKHZRPEP\SDUHQWV EHFDXVHLWZDV8)GHFLVLRQGD\)LQDOO\ SODQQHGIRUPHWRIROORZLQWKHLUIRRWVWHSV DWSPWKHGHFLVLRQVZHUHUHOHDVHGDQG DQGEHFRPHDEDE\*DWRU7KHQDWWKHHQG ,VDZWKDWHYHU\ELWRIZRUN,SXWLQWRWKH RIP\IUHVKPDQ\HDUP\EURWKHUDVHQLRU SDVWIRXU\HDUVZDVFRPSOHWHO\ZRUWKLW DW WKH WLPH GHFLGHG WR WDNH KLV WDOHQWV $QGWKDWZDVWUXO\DQDPD]LQJIHHOLQJ (YHQVLQFHGHFLVLRQGD\,·PVWLOODYWR *DLQHVYLOOH 6LQFH WKHQ ,·YH NQRZQ ZKHUH,ZDQWWREHDQG,ZRXOGGRDQ\- LGO\ ZRUNLQJ LQ DOO RI P\ FRXUVHV DQG WKLQJDQGHYHU\WKLQJWRPDNHP\IDQWDV\ \HVWKHUHLVVRPHVWUHVVHYHQWKRXJK,·P JUDGXDWLQJLQDPDWWHURIZHHNV(YHQDV DUHDOLW\ ,ZRUNHGHQGOHVVO\DQGSXWP\DOOLQWR ,ZULWHWKLVFROXPQ,·PLQDVWDWHRIVWUHVV P\FRXUVHVDQGH[WUDFXUULFXODUDFWLYLWLHV EHFDXVHRIWKHDPRXQWRIZRUN,KDYHWR HYHQ ZKHQ , RYHUZRUNHG P\VHOI WR WKH FRPSOHWHEHIRUH0D\WKHRIÀFLDOHQG SRLQWWKDW,ZDVPHQWDOO\SK\VLFDOO\DQG WRP\KLJKVFKRROFDUHHU 1RZDVWKHUHPDLQLQJGD\VRIP\KLJK HPRWLRQDOO\EXUQWRXW<HWWKHWKRXJKWLQ WKHEDFNRIP\PLQGGUHDPLQJRIWKHIX- VFKRROFDUHHUGZLQGOH,ORRNEDFNSURXG RIKRZPXFK,·YHJURZQVLQFHEHLQJWKDW WXUHNHSWPHJRLQJ <HVRIFRXUVHEHLQJEXUQWRXWDQGH[- OLWWOHIUHVKPDQZDONLQJRQFDPSXVIRUWKH ÀUVWWLPH

,QWKHQHZVSDSHUFODVVURRPWKHFRPSHWLWLRQ SUDFWLFDOO\ SLHUFHG WKURXJK WKH ZDOOVGXULQJHGLWRUSRVLWLRQZHHNLQWKH WKUHH\HDUV,ZDVSDUWRIWKHVWDII+RZHYHULWDOZD\VSXVKHGPHWRWU\P\EHVW ,WGURYHPHWRFRQWLQXHFOLPELQJXSWKH HGLWRUWRWHPSROHXQWLO,UHDFKHGWKHWRS DQGEHFDPHWKHWRSHGLWRUIRUWKHSDSHU WKHHGLWRULQFKLHI 6RPHWHDFKHUVDQGDGPLQLVWUDWRUVVD\ WKHFODVVRIKDVEHHQRQHRIWKHPRVW LI QRW WKH PRVW FRPSHWLWLYH FODVVHV WKDW KDV HYHU EHHQ DW WKH %D\ $QG , ZRXOG QRWDUJXHZLWKWKDWVWDWHPHQWFRQVLGHULQJ ZH DUH HLJKWIRUHLJKW LQ KDYLQJ DW OHDVW RQH SHUVRQ DFFHSWHG WR HDFK RI WKH ,Y\ /HDJXHVFKRROVDQGZHKDYHVWXGHQWVDGHORIFRPSHWLWLRQDWP\VFKRROGLGIRUPH PLWWHGWRDOPRVWDOOWKHWRSXQLYHUVLWLHV , TXLFNO\ UHDOL]HG WKDW LQ RUGHU WR LQWKLVFRXQWU\ DFKLHYH VXFFHVV LQ D FODVV IXOO RI VWX+RZHYHU , GR EHOLHYH WKDW WKLV OHYHO GHQWV HDJHU RI FRPSHWLWR EH DW WKH WLRQ , H[SHWRS , ZRXOG I quickly realized that in order to ULHQFHG GXUQHHGWRFKDO- achieve success in a class full LQJ P\ IRXU OHQJH P\VHOI \HDUVRIKLJK LQHYHU\DUHD of students eager to be at the VFKRRO KDV , FRXOG 6R top, I would need to challenge IXOO\ SUH, GHFLGHG WR myself in every area I could. SDUHG PH MRLQ QHZVSDIRU FROOHJH SHU DQG WKH 7 K L Q N L Q J YDUVLW\ ODEDFN WR P\ FURVVHWHDP MXQLRU \HDU , UHPHPEHU WKHUH ZDV RQH %RWKRQWKHÀHOGDQGLQWKHFODVVURRP QLJKWZKHUH,KDGOD\RXWIRUQHZVSDSHU WKHFRPSHWLWLRQZDVVLOHQWEXWGHDGO\2Q ODFURVVH SUDFWLFH DQG WZR KRXUV RI $3 WKHODFURVVHWHDPRIVWXGHQWVHYHU\RQH (QJOLVKKRPHZRUN ZDVDOZD\VFRPSHWLQJWREHJXDUDQWHHG , ZDV VR FORVH WR JLYLQJ XS EXW DV , RQHRIWKHVSRWVRQWKHVWDUWLQJOLQH WKRXJKWDERXWDOOWKHRWKHUVWXGHQWVLQP\

Being in a competitive class made me better prepared for college , YLYLGO\ UHPHPEHU P\ ÀUVW GD\ RI KLJK VFKRRO $V P\ ÀUVW SHULRG WHDFKHU EHJDQWRFDOOWKHQDPHVRIIKHUURVWHU, KHDUGWKHQDPHRIDER\ZKRKDGQHYHU UHFHLYHGOHVVWKDQDSHUFHQWRQDWHVW DQG WKHQ D JLUO ZKR KDG EHHQ WKH RQO\ HLJKWKJUDGHUWRSODFHLQWKHVWDWHVFLHQFH IDLUFRPSHWLWLRQ 7KHQWKHUHZDVPHDVWXGHQWZKRDOZD\VWULHGKHUEHVWEXWQHYHUUHFHLYHGD SHUFHQWRQKHUPDWKWHVWRUHYHQSODFHGDW WKHVFKRROOHYHOIRUWKHVFLHQFHIDLU $IWHUZDONLQJRXWWKHGRRUVRIP\ÀUVW SHULRGWKDWGD\,QHYHUWKRXJKW,ZRXOG VXFFHHGLQDJUDGXDWLQJFODVVZLWKDOHYHO RIFRPSHWLWLRQWKLVKLJK ,WKDVEHHQSURYHQWKDWH[FHVVLYHOHYHOV RIFRPSHWLWLRQFDQFDXVHIHDUEXWKHDOWK\ FRPSHWLWLRQFDQOHDGWRLPSURYHPHQWDQG VXFFHVV7KHODWWHULVH[DFWO\ZKDWWKHOHY-

FODVVZKRZHUHRIFRXUVHJRLQJWRGRWKHLU KRPHZRUNDQGJHWDQ$RQWKHWHVWWRPRUURZ,EHFDPHPRWLYDWHGWRQRWMXVWGRLW DOOEXWGRLWZHOO 7KLVVHQVHRIFRPSHWLWLRQSXVKHGPH WRWDNHPRUH$3FODVVHVMRLQPRUHKRQRU VRFLHWLHVDQGFOXEVEXWPRVWRIDOOWRDOZD\VGRP\EHVW %HFDXVHRIWKLV,ZLOOQRORQJHUVK\ DZD\IURPWKH´KDUGHUµFODVVHVLQFROOHJH DQG,ZLOODOZD\VEHPRWLYDWHGWRWU\P\ EHVWDQGDFKLHYHVXFFHVV $OWKRXJK,DPQRWRQHRIWKHVWXGHQWV LQP\FODVVWKDWZLOOEHDWWHQGLQJRQHRI WKHHLJKW,Y\/HDJXHVFKRROV,FDQWKDQN WKRVHVWXGHQWVLQDOOP\FODVVHVIRUSURYLGLQJPHZLWKDKHDOWK\OHYHORIFRPSHWLWLRQWKDWDOZD\VEURXJKWRXWWKHEHVWLQPH DQGSXVKHGPHWRHQGXSZKHUH,DPWRGD\DV,KHDGWRWKH8QLYHUVLW\RI)ORULGD

For more Cypress Bay coverage visit www.cbhscircuit.com.


APRIL 2014

OPINION

THE CIRCUIT

15

WWW.CBHSCIRCUIT.COM

Windy City experience was memorable

The â&#x20AC;&#x153;windy cityâ&#x20AC;? was the perfect place to be for the multiple sporting events and for the platters of ethnic food that my family and I consumed during the Kessler family bar mitzvah trip for my younger brother Brian, who selected the trip and location instead of having a party. He picked a place that is incredibly different from Florida, which made the experience culturally enriching. My dad, my two brothers (Matt and %ULDQ DQG,VHWRXWWR&KLFDJRIRUDĂ&#x20AC;YH night spring break vacation that included an itinerary of three professional sporting events, and meals of some of the most fa mous food in the country. From a tour of famous Soldier Field where the Bears play, to electric atmo spheres at the United Center for the Chi cago Blackhawks and the Chicago Bulls JDPHV &KLWRZQ KDV VRPH RI WKH PRVW PDJQLĂ&#x20AC;FHQWYHQXHVIRUWKHLUWHDPV Inside these stadiums Chicago has un believable fan bases for each of their be loved teams. For a regular season game against below average teams, the Chicago Bulls and the Blackhawks had full capac ity crowds. 'XULQJWKH1%$DQG1+/ seasons, the Hawks and the Bulls lead their respective leagues in average home attendance per game. Down in the Sun a Bulls and Blackhawks fan even though shine State, the Florida Panthers are 29th I loathe both of these teams. Outside of the sporting events, Chi RXWRI1+/WHDPVLQDYHUDJHKRPHDW tendance and the Miami Heat, who are cago supplied my family and me with EDFNWREDFN1%$FKDPSLRQVDUHUDQNHG scrumptious meals that were unforget table. Chicago is fourth in the known for their 1%$ LQ DY GHHSGLVK SL]]D erage home Chicago is a wonderful which has a unique environment for the attendance. thick piecrust style. The at combination of sports and We visited Chica mosphere was incredi food that my family took part goâ&#x20AC;&#x2122;s own Giorda noâ&#x20AC;&#x2122;s Pizzeria. The ble through in over spring break. countless layers of out the cheese in one slice games we of the pizza made attended. me full after only two slices. The elation that was displayed when their $GGLWLRQDOO\ZHWRRNRXUWDVWHEXGVWR team succeeded was contagious to my family and me. I found myself becoming Gibsons, which has housed countless ce

PHOTOS SUBMITTED BY EVAN KESSLER

6RSKRPRUH(YDQ.HVVOHU DERYHULJKW SRVHV BALLING LIKE MJ: with his brothers in front of the Michael Jordan statue at the United Center in Chicago. Kessler also visited some of the Windy Cityâ&#x20AC;&#x2122;s major monuments. OHEULWLHVRYHULWV\HDUKLVWRU\*LEVRQV is famous for their massive portions of steak, and the restaurant was the setting for the pilot of the television show â&#x20AC;&#x153;The /HDJXHÂľ 2XU ZDLWHU ZKR KDG ZRUNHG there for 17 years recalled stories of wait ing on Michael Jordan multiple times, DQGVDLGWKH\JRE\DĂ&#x20AC;UVWQDPHEDVLV My family and I all chose different VW\OHV RI EHHI IURP 1HZ <RUN VWULS WR SRUWHUKRXVH DQG Ă&#x20AC;OHW PLJQRQ (DFK RI WKH VWHDNV ZDV PDJQLĂ&#x20AC;FHQW DQG ZH DOO agreed that it was the best meal we have ever eaten. Chicago is a wonderful environment for the combination of sports and food that my family took part in over spring break. The city has a cleaner feeling than any other major city I have visited includ

EDITORS Editor-in-Chief: Alexa Steinlauf The Circuit is the student newspaper of Cypress Bay High School. The opinions expressed in the paper are not necessarily those of the adviser, administration, or advertisers. The publication of advertisements in The Circuit does not imply endorsement.

Managing Editor: Jake Marsh Copy Editor: Elanna Heda Copy Editor: Reid Ovis News Editor: Lisa Burgoa Features Editor: Avery Zaffos

The Circuit is a free publication available to 4,400 students and 292 staff members of Cypress Bay High School. The publication prints 4,500 copies seven times per year. The Circuit is recognized as a Columbia Scholastic Press Association Silver Crown Winner, National Scholastic Press AssociationAll American publication and Florida Scholastic Press Association All-Florida publication. TO CONTACT US: CALL (754) 323- 0350, ext. 3075 cypressbaycircuit@gmail.com OR VISIT cbhscircuit.com

Arts & Ent. Editor: Chloe Lipkin Sports Editor: Chad Daniels-Rosenberg Layout Editor: Sophia Marchetti

ONLINE EDITION EDITORS Editor-in-Chief: Ilana Sperling Managing Editor: Brittany Zeidel Copy Editor: Lisa Altman Copy Editor: Rachel Lesnik News Editor: Jordan Friedman Features Editor: Meredith Sheldon Arts & Ent. Editor: Jen Schonberger Sports Editor: Zack Lender

Photo Editor: Anna Schifter

Photo Editor: Danielle Bush

Photo Editor: Sabrina Gaggia

Photo Editor: Taylor Fellman

Graphic Designer: Paula Martins

Graphic Designer: Jessica Schein

PR Manager: Emily Gitten

Multimedia Editor: Juana Capelluto

Ad Manager/Ad Designer: Allison Blake Business Manager: Morgan Martin Adviser: Rhonda Weiss

LQJ1HZ<RUNDQG%RVWRQ The people are considerate and they are supportive of their athletes regardless RIWKHLUSHUIRUPDQFHRQWKHSOD\LQJĂ&#x20AC;HOGV Chicago is a welcoming city, and it is a must see for sport and food fanatics.

STAFF WRITERS Ines Acosta, Maria Araya, Maria-Isabelle Aguilar, Marissa Babitz, Tara Bagherlee, Zoe Birger, Carolina Bou, Rotem Bronfman, Juanita Castro, Marioly Chacon, Emily Chaiet, Diego Clavijo, Ariela Cohn, Adrianna Cole, -RVHĂ&#x20AC;QD &ROO 5DIDHOOD 'HO 6RODU 0LFKHOOH Eisenberg, Cara Friedman, Jake Fuhrman, Beatriz Galdona, Matthew Gallagher, Monica Garcia, Emma Goetzinger, Ana Beatriz Goncalves, Amanda Grapin, Alainna Hall, Haley Harding, Kaila Hurley, Hannah Jaffe, Evan Kessler, Samantha Krauss, Erica Lachman, Jacob Lender, Nicolas Leon, Alyssa Levin, Jake Levy, Marilynn Lindsey, Zue Lopez-Diaz, Stefania Markowicz, Amanda Masaro, Connor McNeil, Brooke Miller, Mykaela Miller, Abigail Morgan, Laura Munevar, Chase Ochrach, Alyssa Orr, Dylan Pulitano, Leah Reich, Tori Reiser, Spencer Rheingold, Lisa Rienhardt, Ricardo Risquez Tomadin, Valeria Salgado, Carly Schreidell, Samantha Shapiro, Amanda Soler, Alex Solomon, Evan Teich, Naomi Thompson, Hannah Wilhjelm, Cole Winton, Erin Yoo, Alexandra Zeidel, Camila Ziadi


16 THE CIRCUIT

FEATURES

APRIL 2014

Seniors ‘promposals’ have been seen on campus, page 19

WWW.CBHSCIRCUIT.COM

Being a camp counselor brings its own personal rewards BY ALYSSA LEVIN

Sophomore Samantha Staropoli spent her last two summers working as a volunteer for Camp Sagemont. As a leader-intraining (LIT), her days were spent running around in the hot sun or chaperoning DYDULHW\RIÀHOGWULSV Like Staropoli, there are students at the Bay who have chosen to try a different experience. Rather than spending their summer breaks going on college or teen tours or maybe even sitting on their couch doing nothing, students have chosen to spend their time off from school working as a camp counselor. “I chose this opportunity instead of going on an educational summer program because it offered service hours, DQG,GHÀQLWHO\QHHGHGWKHH[SHULHQFHLQ case I decided to become a counselor the following summer,” Staropoli said. “Also, WKHZRUNH[SHULHQFHZRXOGEHEHQHÀFLDO for me in my future resumes.” Staropoli said she feels that there are a lot of important life lessons taught through working in these jobs. “It’s important to work because it teaches responsibility and punctuality,” Staropoli said. “Last summer, I had to look after young children and chaperRQHÀHOGWULSV,ZDVDOVRUHTXLUHGWREHDW work at a certain time every day, no matter what.” Lorin Rodman, the assistant director at Pine Crest Day Camp, said a job such as working as a counselor offers a bal-

PHOTOS SUBMITTED BY SAMANTHA STAROPOLI

FUN IN THE SUN: (above) Sophomore Samantha Staropoli (on the right of $OYLQWKH&KLSPXQN DQGKHUIHOORZ/,7VZHOFRPHWKHFDPSHUVRQWKHÀUVWGD\ of summer session at Camp Sagemont. Staropoli and LITs pose for a photo to remember the summer.

ance between responsibility and fun for students. “I think summer camp is the perfect summer job for a young adult,” Mrs. Rodman said. “It is a great way to learn responsibility, meet friends and create fun. It will be one of the best jobs you will ever have. You fall in love with your campers and meet some really great friends.” Junior Morgan Adler worked at American Heritage Day Camp as a counselor last summer. She said this sort of job teaches teens to be more independent and take on new responsibilities. “I wanted the chance to make my own money at a job over the summer, since I

don’t have a lot of time during the school year to work,” Adler said. Staropoli said her summer job didn’t even feel like work because every day was something new. There was always a different activity to participate in or a new ÀHOGWULSWRJRRQZLWKWKHFDELQ “For me, working was enjoyable because I had the chance to meet new people, and I feel like it gave me a sense of purpose,” Staropoli said. “I found the best part of volunteering was interacting with the campers. They were all sweet and grateful for anything that the counselors did for them. It always put a smile on my face when they would make cards or pic-

tures for me and the other counselors.” Mrs. Rodman said every year the camp receives dozens of hopeful applicants looking for a summer job. Since the FRPSHWLWLRQLVVRÀHUFHWKH\EHJLQHYDOuating their applicants the moment they ask for an application. “We like for our applicants to call by themselves and communicate with us directly,” Mrs. Rodman said. “Also, since this job involves caring for children, we expect them to be kind and warm. We always look for the activities the teen is involved with and their level of responsibility. Balance is a huge part of volunteering here at PCDC.”

Summer break edges closer as excitement builds around campus BY ABBY MORGAN

Senior Katherine Harris is excited to end the year and start a new adventure. She is dorm room shopping and going to FROOHJHVWRVHHZKLFKFROOHJHÀWVKHUSHUsonality as the end of the school year approaches. Florida is commonly considered the state where the sunny weather never goes away. Even so, many have a mind toward the break coming up and are thinking about getting through the last few weeks of school. +DUULVVDLGVKHLVPRWLYDWHGWRÀQLVK the year on a high note by telling herself that if she can just hold out until summer, she will be able to have a fun and relaxing break. “I am looking forward to the end of this year,” Harris said. “I can’t wait to just sit back, enjoy not having responsibilities like school, hang out with friends and prepare for college by getting all of my stuff together to move out.” Angela Galvez, a math teacher, has to prepare not only herself for the end of the year but also her students. “I prepare for the end of the year student wise by reviewing material with the EOC coming up and trying to keep them motivated,” Ms. Galvez said. “For me it’s just wrapping up things and packing up my room.” Sophomore Manuela Chaves said she is focusing on her classes and trying to push the thought of relaxing in the warm sunny weather to the back of her mind. 6KHVDLGIRXUWKTXDUWHULVWKHWLPHWRVWDUW wrapping up the year.

“I am going to get more sleep this TXDUWHU VR , FDQ SHUIRUP P\ EHVW DW school,” Chaves said. “I will also manage my time more wisely by not procrastinating and I am going to delete all of my social media apps on my phone until the last day of school so that I will be completely focused on school and not get distracted on what people posted on Instagram and Twitter.” Ms. Galvez said that although she looks forward to enjoying her summer and waking up later, she does not like the stress that precedes it. ´,ÀQGWKHHQGRIWKH\HDUPRUHVWUHVVful because the kids are all stressing out and that tends to add to our stress and it all comes back to unfortunately the scores on tests,” Ms. Galvez said. Senior Javier Carrillo said he tries not WR VODFN LQ WKH IRXUWK TXDUWHU E\ GRLQJ the assignments he is supposed to do and not procrastinating. He is trying to make memorable moments with friends in his ODVWTXDUWHURIKLJKVFKRRO ´,ÀQGWKDWWKHHQGRIWKH\HDULVELWWHUVZHHWEHFDXVHZHDUHÀQDOO\JUDGXDWing and starting a new chapter of our life. But we are leaving behind our old memories and friends that we spent the last four years with. It’s not easy to move on,” Carrillo said. Freshman Alessio Fabbrocini said he motivates himself by knowing there will EH D ELJ UHZDUG LI KH ÀQLVKHV WKH \HDU strong. “In order to motivate myself at the end of the year, I tell myself that school is almost over,” Fabbrocini said. “Also, if I get a good grade on them I can ask my

PHOTO ILLUSTRATION BY ABBY MORGAN

parents to go on a trip to Italy, Spain or to the World Cup.” Fabbrocini said he looks forward to seeing his friends over the summer here and in Italy since school prevents him from hanging out with his friends as

much as he wants to. “Once the year ends, I am looking forward to forgetting about school and having a clear mind to relax,” Fabbrocini said. “I want to play soccer and go on a trip to Italy to see my friends there.”


APRIL 2014

FEATURES

steps  to  a  â&#x20AC;&#x2DC;5â&#x20AC;&#x2122;

THE CIRCUIT

17

WWW.CBHSCIRCUIT.COM

AP teachers utilize different methods of review to help their students for upcoming exams. BY TARA BAGHERLEE

As the month of May approaches and the looming dates of AP exams are getting closer, teachers are taking various approaches to preparing their students for the exam. â&#x20AC;&#x153;I think most kids really pick up the pace after spring break, in April,â&#x20AC;? said Eric Adzima, who teaches AP European History and U.S. History. â&#x20AC;&#x153;Thatâ&#x20AC;&#x2122;s when they start really getting their acts together and organizing and so on.â&#x20AC;? For a subject such as history, Mr. Adzima said its large amount of information requires more preparation than other AP classes. â&#x20AC;&#x153;I think for a class like mine, which has a very large content, they need to start an earnest amount of studying,â&#x20AC;? he said. â&#x20AC;&#x153;Theyâ&#x20AC;&#x2122;re both very content-heavy. Thereâ&#x20AC;&#x2122;s only so many ways that you could pound information in your brain. Itâ&#x20AC;&#x2122;s not a secret. Youâ&#x20AC;&#x2122;ve just got to look at it over and over again till you get it.â&#x20AC;? Mr. Adzima said he does drills such as timelines that help enforce the large amount of information and dates found in both AP Euro and APUSH. â&#x20AC;&#x153;We do any activity, like timelines, that force kids to pull information from various chapters and put them together into one graphic organizer,â&#x20AC;? he said. Although every student has the same material to study, it is important to study to oneâ&#x20AC;&#x2122;s interests, whether the student prefers studying in a group or alone, Mr. Adzima said. â&#x20AC;&#x153;For certain students, working in groups is good,â&#x20AC;? he said. â&#x20AC;&#x153;Quizzing each other, doing information drills, that type of thing. For the â&#x20AC;&#x2DC;loner,â&#x20AC;&#x2122; I think that they should seriously practice test questions, go over their notes in the textbook.â&#x20AC;? AP Psychology teacher Kimberly Patterson said she tries to start reviewing six to nine weeks prior to the exam and recommends students divide the material into units and study it in chunks. â&#x20AC;&#x153;My big approach is to split it up into different sections, and to review two to three chapters at a time, so that students can relearn the material through notes, online activities and home studying,â&#x20AC;? Ms. Patterson said. On her class website, pattypsych.com, she has links and videos for review with the purpose of reinforcing material. She said the most important time of the year is review, since relearning is important to keep from forgetting information. â&#x20AC;&#x153;I think AP review is so pivotal because of the research on relearning,â&#x20AC;? Ms. Patterson said. â&#x20AC;&#x153;If itâ&#x20AC;&#x2122;s material that weâ&#x20AC;&#x2122;ve learned all the way back in August, during WKHĂ&#x20AC;UVWWZRZHHNVRIVFKRRO,NQRZWKDWDORWRIVWXGHQWV are going to have a hard time knowing and remembering it because they have a natural forgetting curve.â&#x20AC;? Ms. Patterson said she highly recommends a video INFORMATION COMPILED BY TARA BAGHERLEE FROM AP TEACHERS series called Standard Deviants because of the way the GRAPHIC BY ERIN YOO material is presented. The videos can be found at public libraries in different topics, whether AP or general classes because it provides a lot of practice questions. that are there consistently will get 5â&#x20AC;&#x2122;s.â&#x20AC;? subjects. AP Calculus AB and BC teacher Jessica Stillman Mr. Adzima said he recommends when students go â&#x20AC;&#x153;I think theyâ&#x20AC;&#x2122;re fabulous because they utilize visual said she likes the Barronâ&#x20AC;&#x2122;s review book series for her into the exam, they stay calm and do not let nerves get imagery and mnemonics,â&#x20AC;? she said. â&#x20AC;&#x153;It does help really classes because of the number of practice questions as the best of them. Ms. Patterson also said she stresses eathone in on some of the well. ing well before the exam to prevent hunger during the most important conâ&#x20AC;&#x153;For Calculus, the Barronâ&#x20AC;&#x2122;s test. cepts and materials â&#x20AC;&#x153;I think AP review is so pivotal book tends to be the best, but â&#x20AC;&#x153;Make sure you eat something,â&#x20AC;? she said. â&#x20AC;&#x153;Make sure that have not changed because of the research on none of them are per say bad. Just you eat a lot of something. Make sure you have somethrough the years.â&#x20AC;? Barronâ&#x20AC;&#x2122;s is typically the one that thing with sugar. Bring a Capri Sun if you have a test As for review relearning. If itâ&#x20AC;&#x2122;s material that we recommend,â&#x20AC;? Mrs. Stillman with a break, or even a candy bar, or one of the granobooks, Ms. Patter- weâ&#x20AC;&#x2122;ve learned all the way back said. la bars with chocolate chips, something thatâ&#x20AC;&#x2122;s going to son does not recomHer review for both her classes make you feel comforted, happy and relaxed.â&#x20AC;? PU(\N\Z[K\YPUN[OLĂ&#x201E;YZ[[^V mend them to her is usually practice tests, whether She added that students should not review material students, unlike most weeks of school, I know that she makes it a group assignment the day of the exam, since it can cause more test anxiety Advanced Placement a lot of students are going to or an individual one. and can be confusing. teachers. â&#x20AC;&#x153;We really just do a lot of â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t think last minute cramming the day of your â&#x20AC;&#x153;I think students have a hard time knowing and practice tests, just drill and kill,â&#x20AC;? exam is good,â&#x20AC;? she said. â&#x20AC;&#x153;I think it confuses and mixes rely on them and donâ&#x20AC;&#x2122;t remembering it because they she said. â&#x20AC;&#x153;We do a practice test, things up inside of a studentâ&#x20AC;&#x2122;s head.â&#x20AC;? use the other review have a natural forgetting curve.â&#x20AC;? we go over it, some of them are Mrs. Stillman also said students should not study materials provided take home tests, some of them much the night before the exam. to them. And I think -AP Psychology teacher are in class. Just practice until you â&#x20AC;&#x153;Really, the time you should be studying is weeks they especially donâ&#x20AC;&#x2122;t Kimberly Patterson know it.â&#x20AC;? coming up to the test, not just the night before,â&#x20AC;? she said. complete any of the 6KHVHHVWURQJEHQHĂ&#x20AC;WVLQGR- â&#x20AC;&#x153;Thirty minutes, look at your formulas, etc. dates, whatonline activities when ing the reviews. ever the subject is, get a good night of sleep and come they are utilizing re´,Ă&#x20AC;QGWKDWWKHVWXGHQWVWKDWFRPHWRFODVVGXULQJWKH in ready.â&#x20AC;? view books,â&#x20AC;? she said. review session do the best,â&#x20AC;? she said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s the students Mr. Adzima said he recommends the REA review who have a lot of absences during the review session, book series (also known as â&#x20AC;&#x153;Crash Courseâ&#x20AC;?) for his those are my students who get 3â&#x20AC;&#x2122;s and 4â&#x20AC;&#x2122;s. The people


18

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

ADVERTISEMENT

APRIL 2014


FEATURES

APRIL 2014

THE CIRCUIT

19

WWW.CBHSCIRCUIT.COM

SEEN ON CAMPUS: PROMPOSALS

PHOTO BY AMANDA MASARO

PHOTO SUBMITTED BY DAVID ROTHFIELD

6HQLRU'DYLG5RWKĂ&#x20AC;HOG ULJKW DVNHGVHQLRU$QGLH :DOGPDQZLWKGRQXWVDQGĂ RZHUV

6HQLRU1LFRODV/R]DQRDVNHGMXQLRU<XPL5LYDVRQ$SULO 7KHFDUZDVFRYHUHGLQ6WLFNLHQRWHVZLWK´3URP¾ ZULWWHQRQWKHP

PHOTO SUBMITTED BY ELI MARTINEZ

6HQLRU0D[6FKZDUW] ULJKW DVNHGVHQLRU(OL 0DUWLQH]WRSURP

6HQLRU7\OHU *LEEVDVNHG$OH[D 6WHLQODXI RQ $SULO  7KH   TXHVWLRQ PDUN ZDV VKDSHG ZLWK%DNHGE\ 0HOLVVD FXSFDNHV LQ WKH WUXQN RI KHU FDU

:LWKWKHKHOSRI IULHQGVVHQLRU &DOHE&RXYHUWLHU DVNHGVHQLRU 9DOHULH7UHQFKRQ $SULO3HRSOH ZHUHFURZGHG DURXQGWKHEDQQHU DIWHUWKLUGSHULRG

PHOTO BY ALEXA STEINLAUF

PHOTO SUBMITTED BY ALAINNA HALL

PHOTO BY ZOE BIRGER

PHOTO SUBMITTED BY SAMANTHA BORNSTEIN

6HQLRU-XDQ&DPLOR OHIW DVNHGVHQLRU$ODLQQD 6HQLRU*HUDUGR3DUUDJD OHIW DVNHGIUHVKPDQ +DOOWRSURP&DPLORZURWHRXW´SURP¾RQDVXUI 6DPDQWKD%RUQVWHLQ%RUQVWHLQZDVVXSULVHGZKHQVKH ERDUG DUULYHGKRPHIURPVRFFHUSUDFWLFH

PHOTO SUBMITTED BY SESCILY CONNELL

6HQLRU'DQQ\7ULYLQR ULJKW DVNHGVRSKRPRUH 6HVFLO\&RQQHOO&RQQHOOZDVDWZRUNZKHQ 7ULYLQRZDONHGLQZLWKDEDQQHU

Prom sparks creativity among students BY DANIELLE BUSH ONLINE PHOTO EDITOR

Serenades in classes, car decorations and scavenger hunts are just some of the creative ways that students are being asked to prom. Whether date hopefuls are asking their childhood best friend or a boyfriend or girlfriend, the prom spirit has taken over the Bay. Senior Kat MacNeal was asked to prom by her boyfriend Matthew Butler who attends St. Thomas Aquinas. McNeal said Butler planned a whole scavenger KXQWZLWKVLJQLĂ&#x20AC;FDQWORFDWLRQVIURPWKHLU relationship. â&#x20AC;&#x153;It was really cute and each place

was special,â&#x20AC;? MacNeal said. â&#x20AC;&#x153;We went since childhood and attended pre-school WR%XUJHU)LZKHUHZHKDGRXUĂ&#x20AC;UVWGDWH prom together. Winderman found a picand all the way to ture from that longSouth Plantation High ago event and sur6FKRROZKHUHZHĂ&#x20AC;UVW â&#x20AC;&#x153;I was really prised Herman at her met at a track meet.â&#x20AC;? house with the picture surprised, and it will MacNeal said at EORZQXSDQGĂ RZHUV the end of the scaven- be something I will â&#x20AC;&#x153;I thought it would ger hunt, Butler was remember forever.â&#x20AC;? be a good idea beZDLWLQJ ZLWK Ă RZHUV it was some-senior Kat MacNeal cause standing on rocks at thing unique. Thatâ&#x20AC;&#x2122;s the beach. what makes it memâ&#x20AC;&#x153;I was really surorable,â&#x20AC;? Winderman prised, and it will be something I will re- said. member forever,â&#x20AC;? she said. Herman had just returned from a vaJake Winderman asked Dara Her- cation and said she wasnâ&#x20AC;&#x2122;t expecting anyman. The two seniors have been friends thing but was excited when she opened

the door. â&#x20AC;&#x153;I thought it was a really creative idea and I am really looking forward to going,â&#x20AC;? she said. Senior Michael Rizzo asked sophomore and fellow debate team member Lacey Larson at her church on Sunday, April 6. Larson said she was surprised to see Rizzo come to her church because it was something she never expected. However, she thought it was a creative idea and is looking forward to prom. ´6HHLQJKLPZLWKDERXTXHWRIĂ RZHUV after church was a nice surprise,â&#x20AC;? Larson said. â&#x20AC;&#x153;It was something really special and unique.â&#x20AC;?


20

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

FEATURES

APRIL 2014

FEATURES

APRIL 2014

GIVES BACK ONLINE FEATURES EDITOR

Whether he is walking for a cure at the annual Relay for Life event or serving steaming food to 250 hungry people at the Cooperative Feeding center in Fort Lauderdale, senior Ignacio Sabate is constantly donatLQJKLVOHLVXUHWLPHWREHQHÀWLQJKLV community. With over 54 clubs and 4,700 students, the Bay is comprised of dedicated and caring students who throughout the year have been actively volunteering through different clubs to give back to their hometown. “Whenever there is something in Weston, we are always there,” said Sabate, president of National Honor Society (NHS). “I like giving back to the community because whatever I am doing, even if it is the smallest act, it is helping someone who doesn’t have the same opportunities. So it is a nice thing to do.” This year, the 286 members of NHS participated in a multitude of service projects, one of those being a 5K Color Run at the BB&T Center for the I Care I Cure (ICIC) cancer organization. Aimed at funding cures for pediatric cancer, the orgaQL]DWLRQ EHQHÀWWHG IURP WKH DLG RI NHS volunteers, accumulating over $150,000 at the event. “Cheering on the runners and seeing them persevere and smile was worthwhile,” said junior Richard Soon, also an NHS member. “It was fun to help out and cheering on the toddlers was really funny and cute because they really reacted to the cheers.”

At least once a month, sopho- on the residents’ day.” more Hannah Levinson and the The residents love sharing their members of the Habitat for Human- stories, talking about their grandity help build houses with that orga- children and simply being in the nization and organize materials at presence of the happy and lively the Habitat Restore center in Fort members, White said. Lauderdale. “By planning, organizing and at“We had a bench-build at school tending the elderly trips, I feel I am a couple of months ago. The bench- giving back to my community by es were used on site for the Habitat creating a cheerful and fun environbuild days,” said Levinson, an am- ment where residents can play, talk bassador for the club. “When I am and stay mentally active,” she said. participating in these events, I feel “I have personally received so much extremely happy. It is a great feeling positive feedback from the residents, to see others smile.” so I am sure that they appreciate our For the English Honor Society visits more than we know.” (EHS), junior Lauren White venEnglish teacher and sponsor of tures to the EHS CeActive Secilia Fonnior Liv- “I like giving back to the seca said ing Center community because the club in Tama- whatever I am doing, even members rac twice participate a month to if it is the smallest act, it in commuent er t a i n is helping someone who nity serthe senior vice that doesn’t have the same citizens EHQHÀWVWKH opportunities. So it is a nice Bay as well there. W h ite, thing to do.” as the Broalong with ward ComÀYH (+6 -Ignacio Sabate, National munity. m e m b e r s Honor Society president “We go per trip, about once play Bina month to go, decorate cupcakes and engage in Indian Trace Elementary School, arts and crafts to put a smile on the where the EHS members read books faces of residents. to one of the after-school groups and “After attending so many elder- set up a literary style activity along ly trips, I have become so comfort- with a craft,” Ms. Fonseca said. able at Active Senior Living center,” “The students also visit the elderly said White, Eldery-Chair for the which is meant to enhance commuclub. “It’s such an amazing feeling nication between generations. The to walk in and be greeted by a room activities usually consist of a theme full of smiles and to truly see the craft meant to have everyone interpositive impact that EHS is having act.”

WWW.CBHSCIRCUIT.COM

PHOTO SUBMITTED BY RICHARD SOON

Clubs participate in volunteer activities throughout year EHS also participates in book drives to supply books to students who cannot afford them. “We collect gently used books for the English department for the school and they must be books that have been read in the students’ school careers,” she said. “We also collect and donate books to the Broward County Library.” Another prominent club that participates in community service is Best Buddies, which is an organization that provides students with disabilities the opportunity to socialize and bond with other students. Not only do members of Best Buddies volunteer their time at dances or fundraising events, but they also spend quality time forming relationships with their buddies who have special needs. “I myself have created many friendships with these students and I hope I have made a difference in their lives,” said junior Gabrielle Solovay, secretary for the club. “I bonded with two of the girls, Alison and Kate, and we sometimes go out to the movies or for dinner and ice FUHDP,IHHOH[WUHPHO\VDWLVÀHGDQG happy that I am possibly making an enormous impact on the buddies in this club.” Levinson said she hopes the club will prosper even more next year. “In the future, I hope we will have more volunteer opportunities for members to participate in building events and hold more fundraisers to increase the amount of money we raise,” she said.

21

1

CYPRESS BAY

BY MEREDITH SHELDON

THE CIRCUIT

2

3 4

PHOTO SUBMITTED BY MARIANNA GARCIA

PHOTO SUBMITTED BY LAUREN WHITE

PHOTO SUBMITTED LAUREN WHITE

THE GIVING TREE: (Clockwise pictures 1 and 2) Juniors Gabrielle Solovay, Rebecca Solovay, Richard Soon, Meredith Sheldon and Rachel Newman and seniors Marianna Garcia and Dylan Warner celebrate after successfully spraying paint on runners at the I Care I Cure 5K walk for cancer. 3. Juniors Jocelyn Gordon visits Blanche Smith at the Active Senior Living in Tamarac as a part of English Honor Society’s monthly visits to interact with those living there. 4. (From left to right) Juniors Jennifer Schonberger. Gabrielle Solovay and Rebecca Solovay and senior Danielle Johnston dress up for the Best Buddies Halloween party.

GRAPHIC BY SOPHIA MARCHETTI LAYOUT BY SOPHIA MARCHETTI AND PAULA MARTINS


22

FEATURES

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

APRIL 2014

Student Spotlight is a recurring segment that showcases a student every month who is selected randomly to illustrate that every student has a story. â&#x20AC;&#x153;The Circuitâ&#x20AC;&#x2122;sâ&#x20AC;? Reid Ovis was waiting for the Ă&#x20AC;UVWSHUVRQWRZDONWKURXJKWKHFDIHWHULDGRRUVZKHQ+DQQDK*OLFNZDONHGLQ2YLVDSSURDFKHGKHU DQGLQWHUYLHZHGKHUIRUWKLVPRQWK¡VSURĂ&#x20AC;OH

Seniorâ&#x20AC;&#x2122;s mom beats cancer BY REID OVIS COPY EDITOR

Reaching beyond college applications and senioritis, senior Hannah Glickâ&#x20AC;&#x2122;s last \HDULQKLJKVFKRROKDVEHHQĂ&#x20AC;OOHGZLWK stress that, to her, has put everything else into perspective. Many Cypress Bay students might NQRZ *OLFN¡V PRP $P\ IURP VRFLDO PHGLD SRVWV VXSSRUWLQJ ´$P\¡V $UP\Âľ RUKDYHKHDUGDERXWWKHKDUGIRXJKWEDWWOH VKHKDVZRQDJDLQVWFDQFHU +RZHYHU PRVW SUREDEO\ GR QRW UHFRJQL]HMXVWZKDW+DQQDK¡VPRWKHUKDGWR RYHUFRPHWRUHWXUQWRKHDOWKIRUKHUORYing and supportive Weston community. To Hannah, her motherâ&#x20AC;&#x2122;s story is just DVLPSRUWDQWWRKHUDVWKHRXWFRPHRIKHU Ă&#x20AC;JKWDJDLQVWDPXOWLWXGHRIREVWDFOHV ´7R VWDUW IURP WKH EHJLQQLQJ P\ PRP ZDV GLDJQRVHG ZLWK 31+ 3DUR[\VPDO1RFWXUQDO+HPRJORELQXULDDOLIH WKUHDWHQLQJ GLVHDVH RI WKH EORRG  ZKHQ VKHZDVLQKHUPLGV7KDWPHDQWWKDW she couldnâ&#x20AC;&#x2122;t have kids so she adopted me DQGP\EURWKHUÂľVDLG+DQQDKPHQWLRQLQJKHUEURWKHU'DQZKRFXUUHQWO\DWWHQGV 8QLYHUVLW\RI&RORUDGRDW%RXOGHU +DYLQJSHULRGLFDOEORRGWUDQVIXVLRQV IRU31+VLQFHVKHZDV$P\ZDVVWLOO OLYLQJDUHODWLYHO\QRUPDODQGKHDOWK\OLIH

´7KHQ ODVW )HEUXDU\ VKH ZDV GLDJQRVHG ZLWK DSODVWLF DQHPLD DQRWKHU EORRG GLVRUGHUÂľ *OLFN VDLG ´7KH WUDQVIXVLRQVZHUHQ¡WZRUNLQJDQ\PRUHVRWKH GRFWRUVQHHGHGWRĂ&#x20AC;QGVRPHWKLQJHOVHWR WUHDWKHUZLWKÂľ $OUHDG\EDWWOLQJWZREORRGGLVRUGHUV +DQQDK¡V PRP ZDV DOUHDG\ VWDUWLQJ WR VKRZWKDWVKHZDVDZDUULRU ´)LQDOO\LQ$XJXVWODVWVXPPHUWKH\ WROG KHU VKH KDG O\PSKRPD ZKLFK LV D blood cancer. Her other treatment still ZDVQ¡WZRUNLQJVRVKHVWLOOKDGWKH31+ DSODVWLF DQHPLD DQG QRZ O\PSKRPDÂľ VKHVDLG´$IWHUKHDULQJWKDWVKHKDGO\PSKRPD VKH ZHQW WR WKH 0' $QGHUVRQ FDQFHU LQVWLWXWH LQ +RXVWRQ 7H[DV IRU WUHDWPHQWÂľ $OWKRXJK ZRUULHG IRU KHU PRWKHU Hannah became adamant about staying SRVLWLYHWKURXJKWKHZKROHWKLQJ ´,ZDVVFDUHG7KH\VDLGVKHRQO\KDG DSHUFHQWFKDQFHWROLYHEXW,NQHZVKH ZRXOGJHWWKURXJKDQ\WKLQJ6KH¡VDZDUULRUÂľVKHVDLG´6KHDOVRKDGDKXJHVXSSRUWV\VWHP$OORIKHUIULHQGVDQGIDPLO\ IURPKRPHKDGKHUEDFNÂľ Receiving chemotherapy and needing D ERQHPDUURZ WUDQVSODQW $P\ *OLFN ZDVGHVSHUDWHIRUDERQHPDUURZPDWFK ´/XFNLO\KHUVLVWHUZDVDPDWFKDQGLW ZDVDZHVRPHEHFDXVHLW¡VUHDOO\KDUGWR Ă&#x20AC;QG D ERQHPDUURZ GRQRU WKDW PDWFKHV \RXURZQÂľ*OLFNVDLG 8QIRUWXQDWHO\WKHFRPSOLFDWLRQVFRQtinued. ´6KHWKHQKDGDJUDIWYHUVXVKRVWGLVHDVHZKLFKLVDEDGUHDFWLRQEDVLFDOO\WR

WKHERQHPDUURZWUDQVSODQWÂľVKHVDLG )LQDOO\DIWHUEDWWOLQJĂ&#x20AC;UVW31+WKHQ DSODVWLFDQHPLDO\PSKRPDDQGDJUDIW versus-host-disease, Hannahâ&#x20AC;&#x2122;s mother VWDUWHG WR VKRZ LPSURYHPHQW +DQQDK VDLGKHUPRPQHYHUJDYHXSDQGZDVDOZD\V RQH VWHS DKHDG RI WKH WKLQJV WKDW ZHUHWU\LQJWREULQJKHUGRZQ 1LQH PRQWKV DIWHU DUULYLQJ LQ +RXVWRQWRUHFHLYHWUHDWPHQWIRUKHUO\PSKRma and blood disorders that gave her, acFRUGLQJ WR GRFWRUV D  SHUFHQW FKDQFH RI OLYLQJ DQG UHFHLYLQJ D ERQHPDUURZ WUDQVSODQW$P\*OLFNLVFDQFHUDQGGLVRUGHUIUHH 6KH UHWXUQHG KRPH WR D VXSSRUW V\VWHP Ă&#x20AC;OOHG ZLWK IULHQGV DQG IDPLO\ WKDW brought tears to everyoneâ&#x20AC;&#x2122;s eyes, and she VKRZHGWKHFRPPXQLW\MXVWKRZPXFKRI DĂ&#x20AC;JKWHUVKHLV      ´6KH¡V KRPH DQG LQ UHPLVVLRQÂľ *OLFNVDLG´6KH¡VFDQFHUIUHHDQG31+ IUHH DQG DQHPLD IUHH , IHHO DZHVRPH 6KH¡VP\LQVSLUDWLRQDQGQRWKLQJLVJRLQJ WRVWRSKHUHYHUDJDLQÂľ $P\DIWHUUHWXUQLQJKRPHZDQWHG WRVKRZKHUJUDWLWXGHIRUDOOWKHVXSSRUW JLYHQWRKHUE\KHUIULHQGVDQGIDPLO\YLD KHUZHEVLWH ´<RXKDYHQRLGHDKRZPXFK\RXDOO PHDQWRPHDQGKRZJUHDWLWIHHOVWRNQRZ KRZPXFK\RXFDUHÂľVKHSRVWHGRQKHU ZHEVLWH´$V,¡YHPHQWLRQHGEHIRUH\RXU ORYLQJVXSSRUWKDVEHHQWUXO\HPSRZHULQJDQG,FDQ¡WWKDQN\RXHQRXJKÂľ

PHOTO SUBMITTED BY HANNAH GLICK

AMYâ&#x20AC;&#x2122;S ARMY: Senior Hannah Glick (left) and her mom Amy Glick celebrate Mrs. Glickâ&#x20AC;&#x2122;s return home from Houston after battling PHN, aplastic anemia, lymphona and graft-versus-host disease.

Think Your Child May Be Academically Challenged? Or Gifted? WÄ&#x17E;Ć&#x152;Ć?ŽŜÄ&#x201A;ĹŻĹ?Ç&#x152;Ä&#x17E;Ä&#x161;Ä&#x201A;Ä?Ä&#x201A;Ä&#x161;Ä&#x17E;ĹľĹ?Ä?Ć&#x161;Ä&#x17E;Ć?Ć&#x161;Ĺ?ĹśĹ?ĹŠĆľĆ?Ć&#x161;Ä&#x161;Ĺ˝Ç ĹśĆ&#x161;Ĺ&#x161;Ä&#x17E;Ć&#x152;Ĺ˝Ä&#x201A;Ä&#x161;ĨĆ&#x152;ŽžtÄ&#x17E;Ć?Ć&#x161;ŽŜ Your childÂ&#x2019;â&#x20AC;&#x2122;s learning potential is more than just a number or a diagnosis. A LOT more. We pride ourselves in providing the most insightful, holistic approach in all our evaluations, so that you, the parent, set the stage for your child or teenÂ&#x2019;â&#x20AC;&#x2122;s optimal learning. And your child or teen has the tools to thrive.

&Ĺ?ĹśÄ&#x161;ŽƾĆ&#x161;žŽĆ&#x152;Ä&#x17E;Ä&#x201A;Ä?ŽƾĆ&#x161;ŽƾĆ&#x152;Ć?Ä&#x17E;Ć&#x152;Ç&#x20AC;Ĺ?Ä?Ä&#x17E;Ć?Í&#x2122; x

Academic placement testing

x

Cognitive evaluations

x x

Collaborative assessment Parenting support and education

/LYH<RXU7UXH3RWHQWLDO

954-434-1886 www.psychfitness.com 10% discount on testing with this advertisement

The Center for Psychological Fitness, PA

10400 Griffin Rd. #109 Cooper City FL 33328


APRIL 2014

ADVERTISEMENT

THE CIRCUIT

23

WWW.CBHSCIRCUIT.COM


24

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

FEATURES

APRIL 2014

Where  are  they  now?

Alumni  Strike

Max Thilen Class of 2013

Recent graduate creates self-owned T-shirt company for cyclers BY MEREDITH SHELDON ONLINE FEATURES EDITOR

Cycling up the mountains of Durango, pedaling down the snowy streets of Forest Avenue and riding through the corridors of the Fort Lewis College campus in Colorado, Cypress Bay alumnus Max Thilen is on the move, not only with his cycling, but also with his own business. Since November 2013, Thilen has been running his own company, The Max Factory, where he creates, produces and sells his own T-shirts that are marketed to cyclers. After successfully owning an auto detailing company while he attended the Bay, Thilen said his passion for business and designing now meshes with his love for cycling. â&#x20AC;&#x153;I started the Max Factory to help support my cycling career,â&#x20AC;? said Thilen, who graduated from the Bay in 2013. â&#x20AC;&#x153;I needed money to be able to travel but no one here in Durango would hire me because of how frequently I travel. In hindsight, no one wanting to hire me was a good thing because it motivated me to start something on my own.â&#x20AC;? $IWHU Ă&#x20AC;YH \HDUV RI WUDYHOLQJ DURXQG the world for competitive cycling, Thilen is now a member of the Airgas Development Cycling team, which is a semi-professional team. He is also a member of the second best Division1 collegiate cycling team at Fort Lewis. â&#x20AC;&#x153;My experience with bikes has been in a more competitive setting, but I love the way bicycles offer a sense of freedom to kids. More than anything, thatâ&#x20AC;&#x2122;s what I would love to promote,â&#x20AC;? he said. Since his company is still growing, Thilen said for the moment he is only producing T-shirts. However, he plans to branch out to produce hats, beanies and other accessories. ´:KHQ,Ă&#x20AC;UVWVWDUWHG,ZDVIRFXVLQJ solely on cycling related designs, but now Iâ&#x20AC;&#x2122;m trying to branch out past that niche,â&#x20AC;? he said. â&#x20AC;&#x153;I want to build my brand as a street wear clothing company and hopefully become known for my playful designs.â&#x20AC;? Thilenâ&#x20AC;&#x2122;s cycling team director Chris Johnson of Airgas Pro Cycling said he works closely with Thilen and helps him expand his business. Johnson said Thilenâ&#x20AC;&#x2122;s ambition and creativity has allowed the business to expand at a rapid rate. â&#x20AC;&#x153;Starting your own business is a great learning experience and I could see that Max was already putting the pieces together and realizing that it was feasible,â&#x20AC;? Johnson said. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m continually impressed with the designs and the materials he produces to promote his company.â&#x20AC;? Thilen said the shirts he creates are all produced in the United States, sweatshop free. He said his main focus is ensuring high quality in his products. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve spent a lot of time and money focusing on little details like hand-stitched hem tags and screen-printed size labels,â&#x20AC;? he said. â&#x20AC;&#x153;There are plenty of things that , FRXOG KDYH GRQH WR ZLGHQ P\ SURĂ&#x20AC;W

PHOTOS SUBMITTED BY MAX THILEN

ITâ&#x20AC;&#x2122;S T-SHIRT TIME: (above) Alumnus Max Thilen stands in between two of his friends who are all wearing T-shirts from his new company, The Max Factory. Thilen creates and produces his own shirts DQGXVHVWKHSURĂ&#x20AC;WVWREHQHĂ&#x20AC;WKLV cycling career.

margins and decrease my overhead, but I wanted to create a product that I believe in. Attention to detail is incredibly important to me. I think that this is really evident when you see my shirts.â&#x20AC;? In addition to making sure his company produces the highest quality shirts, Thilen said he also tries to appeal to his customers by shipping a special surprise gift with every purchase. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve worked to create an experience for my customers,â&#x20AC;? he said. â&#x20AC;&#x153;To create this experience, all shirts come gift wrapped in a custom box. Since everyone loves surprises, every order comes with a special gift. The gift always changes. It might EHDEXWWRQFDQG\RUD/HJRĂ&#x20AC;JXUHÂľ Johnson said Thilen truly cares about his work, and that shines through his business. â&#x20AC;&#x153;I think that the energy Max brings to The Max Factory is one of the obvious traits that has helped propel his business forward,â&#x20AC;? he said. â&#x20AC;&#x153;He doesnâ&#x20AC;&#x2122;t take shortcuts and from his products to his packaging you can tell that he cares about what he is doing and that means a lot.â&#x20AC;? Thilen advertises his company through social media. â&#x20AC;&#x153;Almost all of my marketing is through social media and word of mouth. I think

that in this day and age, if you want to start a business you donâ&#x20AC;&#x2122;t really need to pay for advertising,â&#x20AC;? he said. Even though the majority of the publicity his company gets is online, he said his preferred form of advertising is talking directly with a customer in person. â&#x20AC;&#x153;I always carry promo cards and buttons with me to hand out whenever I meet new people,â&#x20AC;? he said. â&#x20AC;&#x153;I want to create a personal feel with my brand which is what led me to use my face as a logo. I think that when people know the story behind my brand and that theyâ&#x20AC;&#x2122;re buying something from a college kid rather than some big box online retailer, theyâ&#x20AC;&#x2122;re more willing to spend money on a shirt.â&#x20AC;? Not only does Johnson serve as Thilenâ&#x20AC;&#x2122;s mentor for cycling, but also for running the business. â&#x20AC;&#x153;I try and help Max by being someone he can shoot ideas off and I try to listen a lot and then also give ideas and encourage him,â&#x20AC;? he said. â&#x20AC;&#x153;Starting your our business is a roller coaster and I have just tried to be there for Max as a mentor. Max has asked me about a number of issues rangLQJIRUVSHFLĂ&#x20AC;FGHVLJQVWRPRUHJHQHUDO business decisions.â&#x20AC;? Thilen said he receives tremendous support for his business from his family.

â&#x20AC;&#x153;Currently, I get most of my web trafĂ&#x20AC;F WKURXJK VRFLDO PHGLD UHIHUUDOVÂľ KH said. â&#x20AC;&#x153;Whenever Iâ&#x20AC;&#x2122;m getting ready to release a new shirt, my friends and family help a lot by offering their opinions on the new designs.â&#x20AC;? Although he is not currently working with any charities or organizations, Thilen said he plans on contributing to a FKLOGUHQ¡VIRXQGDWLRQZLWKWKHSURĂ&#x20AC;WVKH receives from his company. ´,¡YHEHHQWU\LQJWRĂ&#x20AC;QGWKHULJKWIRXQdation but Iâ&#x20AC;&#x2122;d like to work with a charity that donates bikes to underprivileged kids,â&#x20AC;? he said. â&#x20AC;&#x153;Because of the impact bicycles have had on my life, Iâ&#x20AC;&#x2122;d love to be able to help make bicycles a part of more childrenâ&#x20AC;&#x2122;s lives. Hopefully, I can make shirts for charity and really make an impact is a huge goal of mine.â&#x20AC;? Even though he is currently training on the developmental team for Airgas Cycling, Thilen said he has hopes to eventually move up the ranks and become a member of the professional team. â&#x20AC;&#x153;If I do well this season, Iâ&#x20AC;&#x2122;m on a team where I could jump right up to the professional team,â&#x20AC;? he said. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;d like to move up in the future, but I am struggling with a knee injury right now. Moving up would happen hopefully this following season.â&#x20AC;?


FEATURES

APRIL 2014

THE CIRCUIT

25

WWW.CBHSCIRCUIT.COM

Q&A with... a current student

Syracuse University is a private research university located in Syracuse, New York. Katherine Arts, originally from Delray Beach, Florida is currently a junior. She spoke to The Circuitâ&#x20AC;&#x2122;s Evan Teich via phone about her experiences. dent in a larger university that has students studying law. I get What is your favorite part to interact with people that have about the school? completely different types of inI went to art school in high terests than I have. school, so coming to SU was like a complete change from What is your least favorite what I was used to. I am com- part about the school? LQJIRUWKHĂ&#x20AC;UVWWLPHLQP\OLIHWR The winters. It is so unbelieva school that actually has sports ably cold here. It was rough adteams. It is a kind of community justing to the winter climate. My that merges all of these different Ă&#x20AC;UVWZLQWHUKHUHZDVQRWWHUULEOH types of communities. We have but being from Florida what I courses/majors that span such wasnâ&#x20AC;&#x2122;t used to was the lack of a huge array of different areas sunlight because the days are to study, so I can be an art stu- shorter. There are days when you

PHOTO WITH PERMISSION FROM SYRACUSE UNIVERSITY

wake up, the sun comes up at 8 in the morning and goes down around 4 oâ&#x20AC;&#x2122;clock in the afternoon. There is a complete lack of sunlight. It is a little on the dreary side. What is some advice you would give to an incoming freshman? Get involved. Getting great grades and being academic is great, but you can do that anywhere. The school has so much to offer in the way of extracurricular activities. There are so many different ways to get involved

with so many different things. Coming to Syracuse gives you so much more than just getting DGHJUHH,ZRXOGGHĂ&#x20AC;QLWHO\UHFommend the abroad program to anyone who is thinking of coming to SU. We have an amazing abroad program and you should GHĂ&#x20AC;QLWHO\ WU\ LW DW OHDVW RQH VHmester. That is an experience you will never get outside of college.

7KLVLVWKHĂ&#x20AC;UVWZDUPGD\ZH have had in a while. It hasnâ&#x20AC;&#x2122;t been above 50 degrees since October. Today it was 54 out and there were people on the quad throwing Frisbees and people building a jungle gym. You are walking around and there are people behind you speaking Spanish, and people in front of you speaking Korean. It feels like a huge camSXVZKHQ\RXĂ&#x20AC;UVWJHWKHUHEXW the more time you spend here, How would you describe the LWEHFRPHVDGHĂ&#x20AC;QLWHO\PDQDJHschool campus on a general able and interesting place to be. weekday?

-HTPS`\WIYPUNPUNZPUĂ&#x2026;\LUJLZ[\KLU[ZÂťKLJPZPVUZVU^OLYL[VH[[LUKJVSSLNL BY RACHEL LESNIK ONLINE COPY EDITOR

As senior Andie Waldman looks through albums of baby pictures, she sees herself dressed in orange and blue. As a baby, Waldman was already being raised in the hopes of becoming a Gator. Many college bound seniors have a similar experience. Parents instill a pride in their children for their alma mater. Due to her dad and two siblings attending the University of Florida, Waldman said she entered her senior year with the goal of going to UF. ´,ZDVGHĂ&#x20AC;QLWHO\UDLVHGWREH a Gator fan,â&#x20AC;? Waldman said. â&#x20AC;&#x153;I have UF clothes now that Iâ&#x20AC;&#x2122;ve had since I was 7 years old, but I was never forced. It was just something that was always present in our house, especially on game days.â&#x20AC;? Similar to Waldman, senior Max Udine said he was born â&#x20AC;&#x153;bleedingâ&#x20AC;? blue and orange. â&#x20AC;&#x153;Ever since I was a little kid, my parents always had me dressed in Gator apparel,â&#x20AC;? he said. â&#x20AC;&#x153;I have always been a Gator fan and canâ&#x20AC;&#x2122;t imagine rooting for anyone else.â&#x20AC;? Udine said he applied to several colleges, but UF was always

his No. 1 choice. â&#x20AC;&#x153;I was strongly considering going to Michigan, but when I saw my UF acceptance, there was no doubt in my mind that I was going to Florida,â&#x20AC;? Udine said. â&#x20AC;&#x153;I couldnâ&#x20AC;&#x2122;t turn down being a Gator.â&#x20AC;? Although students may follow the path of their family, some break the trend. While her whole family attended Cornell University, senior Janae Bell said she is still unsure if she will go even though she has been accepted there. â&#x20AC;&#x153;I havenâ&#x20AC;&#x2122;t actually committed on a school yet so itâ&#x20AC;&#x2122;s not 100 percent that Iâ&#x20AC;&#x2122;m not going. But surprisingly, despite the fact that my family did attend there, they have no special preference on what school I attend,â&#x20AC;? Bell said. â&#x20AC;&#x153;Cornell is still in the runQLQJEXWEHFDXVH,IHHOFRQĂ&#x20AC;GHQW of the programs offered, not beFDXVHRIIDPLO\LQĂ XHQFHÂľ Senior Jessica Stuart, who committed to the University of Michigan regardless of the fact that every woman in her family has attended Tulane University, said she decided it was time for a new path. â&#x20AC;&#x153;I was never raised to like Tulane. My family was all for me going wherever I wanted,â&#x20AC;? she said. â&#x20AC;&#x153;However, they would have

PHOTO SUBMITTED BY ANDIE WALDMAN

GATOR BAIT: Senior Andie Waldman (right) poses with her older brother William Waldman OHIW DWWKH%HQ+LOO*ULIĂ&#x20AC;QVWDGLXPDWWKH8QLYHUVLW\RI)ORULGD:DOGPDQZLOOEHDWWHQGLQJWKH 8QLYHUVLW\RI)ORULGDLQWKHVXPPHUIROORZLQJWKHIRRWVWHSVRIKHUEURWKHU

loved if I joined the Tulane family.â&#x20AC;? Stuart said her decision to choose Michigan was bittersweet. â&#x20AC;&#x153;I always felt a small obligation to go to Tulane because my family raves about it and how awesome it would be if I went,â&#x20AC;? she said. â&#x20AC;&#x153;Once I got over the guilt, I decided to go with my heart and choose Michigan. I am excited to have a fresh start at a

new school.â&#x20AC;? Following in the footsteps of his eldest sister, senior David 5RWKĂ&#x20AC;HOGZLOOEHFRPHD1RUWKwestern Wildcat in the fall. â&#x20AC;&#x153;I decided to apply to Northwestern early decision because my sister recently graduated and not only had the best college experience, but is also very successful,â&#x20AC;? he said. 5RWKĂ&#x20AC;HOGVDLGKHKDGWKHRSportunity to visit his sister, thus

he knew a little of what to expect if he had the chance to attend. â&#x20AC;&#x153;When I was deciding where I wanted to go, Northwestern was already on the top of my list because I had been many times and loved it,â&#x20AC;? he said. â&#x20AC;&#x153;I think WKDWLQĂ XHQFHGPHWRDSSO\HDUly decision because I was able to get a sense of what my future will be like.â&#x20AC;?


26

FEATURES

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

APRIL 2014

Promises are made for season of Lent BY CAROLINA BOU

Sophomore Valentina Dioguardi has two choices every time she goes out with her friends: eat junk food like everyone else or keep her Lent promise to eat healthy. She has gone the healthy route every time, deciding not to break her promise for Lent. â&#x20AC;&#x153;People have tried to make me cheat,â&#x20AC;? she said. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve gone out with my friends while theyâ&#x20AC;&#x2122;ve eaten junk food, and I havenâ&#x20AC;&#x2122;t done it. I order a steak or salad instead.â&#x20AC;? Every year, Christians worldwide celebrate the season of Lent for 40 days to prepare for Easter, which was on April 20 WKLV\HDU0DQ\IXOĂ&#x20AC;OODSURPLVHWRJLYH up something during the season, give back to the community, or both. Catholics in Action adviser Selma Benitez said /HQW LV D VHDVRQ DERXW JLYLQJ VDFULĂ&#x20AC;FH and improvements. â&#x20AC;&#x153;The season of Lent is a season where you look on the inside and wonder â&#x20AC;&#x2DC;How from the past year can I improve?â&#x20AC;&#x2122;â&#x20AC;? she said. â&#x20AC;&#x153;It is more now on looking back on ZKDW \RX ZDQW WR Ă&#x20AC;[ DQG LPSURYH DV D Christian, what you want to do better as a human being.â&#x20AC;? Dioguardi said she decided to give up junk food so she will be able to live a healthier lifestyle. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m trying to make a commitment to the gym, and if I eat junk food I wonâ&#x20AC;&#x2122;t see results,â&#x20AC;? she said. â&#x20AC;&#x153;My momâ&#x20AC;&#x2122;s a personal trainer, so Iâ&#x20AC;&#x2122;m trying to make her proud by making my eating habits better.â&#x20AC;? Dioguardi is not the only person who decided to give up something this season. Catholics in Action president Clarisse El Khouri gave up some of her favorite TV shows, including â&#x20AC;&#x153;The Walking Dead.â&#x20AC;?

lot of time with my little sisters, which I usually donâ&#x20AC;&#x2122;t do, but this time of Lent Iâ&#x20AC;&#x2122;ve been trying to do and itâ&#x20AC;&#x2122;s helped me a lot, too.â&#x20AC;? Despite cravings, Dioguardi said she WKLQNVWKDWJLYLQJXSMXQNIRRGKDVGHĂ&#x20AC;nitely been worth it. â&#x20AC;&#x153;I feel less tired since Iâ&#x20AC;&#x2122;ve been eating a lot less sugar,â&#x20AC;? she said. â&#x20AC;&#x153;My bodyâ&#x20AC;&#x2122;s a lot better and ,¡PDORWPRUHĂ&#x20AC;WDVZHOOÂľ While some people may give up their favorite things for Lent, others give back to the community. Freshman Hope Brunner has been giving back more frequently during this season. â&#x20AC;&#x153;I started volunteering more often since I have time,â&#x20AC;? she said. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve been doing a good deed every day. Iâ&#x20AC;&#x2122;ve been opening the door for people, complimenting them and just being nice to them in general.â&#x20AC;? Brunner said giving back makes her feel like she is doing something good for her community. â&#x20AC;&#x153;It makes me feel like a better person,â&#x20AC;? she said. â&#x20AC;&#x153;People see that Iâ&#x20AC;&#x2122;m helping and seeing them happy makes me feel happy. You get to see how truly grateful people are.â&#x20AC;? Mrs. Benitez said Lent is the ILLUSTRATION BY LAURA MUNEVAR perfect opportunity for people to things.â&#x20AC;? stop and improve themselves and their By giving up TV and leisure time, El relationships with others. Khouri said she has found a way to help â&#x20AC;&#x153;Part of a human being is not only around the house and become more efdoing what you have to do, but itâ&#x20AC;&#x2122;s so Ă&#x20AC;FLHQW much to learn, and Lent is a perfect time â&#x20AC;&#x153;I stopped procrastinating, which is to stop, look at yourself, where you want amazing,â&#x20AC;? she said. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve been helping to be in life and what you want to learn my mom around the house, spending a â&#x20AC;&#x153;I feel like [giving up TV] has something to do with my morality,â&#x20AC;? said El Khouri, a sophomore. â&#x20AC;&#x153;I know itâ&#x20AC;&#x2122;s going to affect my lifetime and the way I see God. The way I give up watching TV is going to help the way I look at different

ATTENTION SENIORS WHO PURCHASED A YEARBOOK: THERE WILL BE A YEARBOOK SIGNING PARTY TH

MAY 9

DURING EIGHTH PERIOD AND AFTER SCHOOL INVITATIONS WILL BE GIVEN OUT THROUGH YOUR FIRST PERIOD TEACHERS.

spiritually,â&#x20AC;? she said. El Khouri said giving up TV has helped her to value how she looks at things. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t need TV, and I usually think to myself â&#x20AC;&#x2DC;Oh, I need TV, I need leisure

â&#x20AC;&#x153;It makes me feel like a better person. People see that Iâ&#x20AC;&#x2122;m helping and seeing them happy makes me feel happy. You get to see how truly grateful people are.â&#x20AC;? -freshman Hope Brunner time,â&#x20AC;&#x2122; but you donâ&#x20AC;&#x2122;t need that,â&#x20AC;? she said. â&#x20AC;&#x153;You just need to put your trust in God, and thatâ&#x20AC;&#x2122;s pretty much what Iâ&#x20AC;&#x2122;m learning throughout this time of Lent.â&#x20AC;? El Khouri said she has been trying to raise awareness about Lent season by reading the Gospel to the club and also going out and volunteering during the season. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve done more activities during Lent like going to the Joe DiMaggio Childrenâ&#x20AC;&#x2122;s Hospital and visiting kids with cancer,â&#x20AC;? she said. Mrs. Benitez said being able to visit the hospital on April 26 helped the students learn the value of life and how important the season of Lent really is. â&#x20AC;&#x153;Not only can we value what we have but our spirits get richer by the love that comes from those kids,â&#x20AC;? she said. â&#x20AC;&#x153;And we try to give them love back.â&#x20AC;?

Ike's Barber Shop LOcated at 1690 Market Street in Town Center Call 954-389-1155 Ikeâ&#x20AC;&#x2122;s wishes you a fun and safe summer


APRIL 2014

FEATURES

THE CIRCUIT

27

WWW.CBHSCIRCUIT.COM

Senior accepted to West Point ing to West Point gives me the opportuniW\WREHDQRIĂ&#x20AC;FHUDQGJHWDFROOHJHHGXFDtion while getting paid a military salary,â&#x20AC;? During early March senior Cody Ak- Akers said. ers was sitting in his car when he got a Akers said the rigorous West Point apphone call that changed his life. Rep. Deb- plication process consists of three parts. bie Wasserman Schultz was on the other â&#x20AC;&#x153;First, thereâ&#x20AC;&#x2122;s a medical aspect, and line informing Akers that he had been you just go in and get everything checked accepted to the United States Military WRPDNHVXUH\RX¡UHPLOLWDU\TXDOLĂ&#x20AC;HGÂľKH Academy at West Point in New York, just said. â&#x20AC;&#x153;Thereâ&#x20AC;&#x2122;s also a physical part which like his older brother Josh Akers was three they make you do stuff like a mile run, years ago. pull-ups and sit-ups. â&#x20AC;&#x153; W h e n You also need a nomishe called I â&#x20AC;&#x153;Going to West Point nation from a congresswas alone in gives me the opportunity man, congresswoman, my car and I senator or vice presistarted cry- [VILHUVMĂ&#x201E;JLYHUKNL[H dent.â&#x20AC;? ing when she JVSSLNLLK\JH[PVU^OPSL Rep. Wasserman told me. Then NL[[PUNWHPKHTPSP[HY` 6FKXOW]¡V RIĂ&#x20AC;FH VDLG I got out of the they get about 25 to 30 car and started ZHSHY`š applicants a year. Out sc r ea m i ng,â&#x20AC;? ZLUPVY*VK`(RLYZ of those applicants they Akers said. can choose to nominate Rep. Was10 students per slot. serman Schultz said calling the nominees This year Rep. Wasserman Schultz was to let them know they have been accepted given one slot. is one of her favorite parts of her job. â&#x20AC;&#x153;First they go through a nominaâ&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s one of the best things I get to do. tion process in which they have to come Delivering news like telling someone and set up an interview with my military who has been dreaming of attending a academy commission. Thatâ&#x20AC;&#x2122;s made up of military academy that they were accept- veterans, and they interview candidates ed and hearing their reaction is so excit- and review their score,â&#x20AC;? Rep. Wasserman ing and rewarding for me,â&#x20AC;? she said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s Schultz said. â&#x20AC;?The applicants have to an opportunity to let someone know they write an essay and after they go through are going to be able to serve their country, the interviewing process, my academy which is an incredibly good feeling.â&#x20AC;? commission decides whether they are goAlthough Akers said he has always ing to give them a nomination.â&#x20AC;? wanted to go to the military, he started Although Akers has to move to New becoming interested in West Point dur- York and face the cold he is not fond of, ing seventh grade. he said he does not really mind because â&#x20AC;&#x153;I have always wanted to serve my he will be with his brother, who attends country and be a part of the military. Go- West Point. BY SABRINA GAGGIA PHOTO EDITOR

PHOTO SUBMITTED BY CODY AKERS

â&#x20AC;&#x2DC;MERICA: Senior Cody Akers (left) stands with his older brother Josh Akers. %RWKER\VDUHKROGLQJWKHLU&HUWLĂ&#x20AC;FDWHVRI$FFHSWDQFHWRWKH8QLWHG6WDWHV0LOLWDU\$FDGHP\DW:HVW3RLQWLQ1HZ<RUN

â&#x20AC;&#x153;My family was really excited because they know thatâ&#x20AC;&#x2122;s what I want to do but theyâ&#x20AC;&#x2122;re kind of upset at the same time because they know that if you go to West Point or the military you donâ&#x20AC;&#x2122;t really get to be with your family for a long time, so itâ&#x20AC;&#x2122;s hard for them,â&#x20AC;? Akers said. Akersâ&#x20AC;&#x2122; father, Brian Akers, said although the application process was timeconsuming and consisted of many parts, it was professional. â&#x20AC;&#x153;Working with Mike [Rep. Wasserman-Schultzâ&#x20AC;&#x2122;s district press secretary]

DQG'HEELH¡VRIĂ&#x20AC;FHZDVDQGLVDOZD\VD great experience,â&#x20AC;? Mr. Akers said. â&#x20AC;&#x153;Mike and I are like brothers after going through this process twice.â&#x20AC;? Mr. Akers said when they heard Cody got accepted to West Point, they were very proud. â&#x20AC;&#x153;This is an accomplishment because of Codyâ&#x20AC;&#x2122;s hard work and good achievements that paid off and made us proud,â&#x20AC;? he said. â&#x20AC;&#x153;We both knew he worked his whole life for this.â&#x20AC;?


28

ARTS & ENTERTAINMENT

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

APRIL 2014

Film industry relying too hard on novels for ideas

PHOTOS BY JUANITA CASTRO

ONE FISH, TWO FISH: AMT1 students performed â&#x20AC;&#x153;Seussical: The Musicalâ&#x20AC;? for three nights, starting on April 11. For PDQ\VWXGHQWVWKLVZDVWKHLUĂ&#x20AC;UVW&\SUHVV%D\SURGXFWLRQ

(4;JHZ[YLĂ&#x2026;LJ[ZHM[LY performance of â&#x20AC;&#x2DC;Seussicalâ&#x20AC;&#x2122; BY LISA RIENHARDT

DQGKRZPXFKWKH\ZDQWHGWROHDUQQHZ techniques. ´7KH\KDYHIDUH[FHHGHGZKDW,HYHU 0LQXWHV EHIRUH VRSKRPRUH 'DQLHOOD 6DOD]DUKDGWRWDNHWKHVWDJHVKHKDGD WKRXJKW WKH\ ZRXOG GRÂľ 0UV /XWZLQ VDLG ´7KH\ ZDQWHG WR OHDUQ DQG WKH\ frog in her throat. 0HPRULHVRIWKHSUHYLHZVKRZFDPH soaked up everything. The shows were UXVKLQJEDFNWRKHU7KH&DWSOD\HGE\ DPD]LQJÂľ )UHVKPDQ $OH[D <RXQJ ZKR SOD\HG VRSKRPRUH 6HEDVWLDQ 'LD] DFFLGHQWDOO\ tore off the Velcro piece that holds her -RMR ZDV SOHDVHG WKDW WKH FDVW ZDV DEOH IHDWKHUV DQG 6DOD]DU ZKR SOD\V *HU- to put any personal differences aside in WUXGH KDG WR FRQWLQXH KHU SHUIRUPDQFH order to produce a quality show. ´,WKLQNZHSURGXFHGDVKRZWKDWZDV ZLWKRXWWKHPRVWLPSRUWDQWSLHFHRIWKH MXVWDVJRRGDVWKH$07NLGV2XUVZDV FRVWXPH JUHDW TXDOLW\ , 'HVSLWHWKH think we realFDVW¡V QHUYHV â&#x20AC;&#x153;The hardest part was ly proved our&\SUHVV %D\¡V KLĂ&#x201E;UP[LS`[Y`PUN[VNL[T`ZLSM VHOYHVÂľ <RXQJ $07  SURJUDP GHOLY- PU[V[OLTPUKZL[VMHSP[[SLIV` said. 5DPLUH]VDZ ered â&#x20AC;&#x153;Seussi- JVUZPKLYPUN[OH[0ÂťTH the hard work FDOÂľ RQ $SULO [LLUHNLNPYS[OH[PZQ\Z[ pay off dur11. For all the ing his favorite FDVW PHPEHUV L_[YLTLS`NPYS`š QXPEHU RI WKH this show was MYLZOTHU(SL_H@V\UN QLJKW´7KH3HRWKH Ă&#x20AC;UVW &\ple versus HorSUHVV%D\SURGXFWLRQLQZKLFKWKH\SDUWLFLSDWHGDQGLW WRQWKH(OHSKDQWÂľ ´,JUHZDORWDVDQDFWRULQWKHPHDQV ZDVDOVR$07¡VODVWSHUIRUPDQFHRIWKH WKDW,OHDUQHGKRZWREHPRUHLPDJLQDWLYH year. ´7RQLJKW¡VVKRZZDVSUREDEO\WKHEHVW LQ P\ DFWLRQV DQG UHDFWLRQVÂľ 5DPLUH] WKDW ZH¡YH HYHU SHUIRUPHG Âś6HXVVLFDO¡ , said. 'LD]IRXQGJHWWLQJLQWRKLVFKDUDFWHU KDG D ORW RI IXQ DQG WKHUH ZDV D ORW RI HQHUJ\Âľ VDLG IUHVKPDQ 'LHJR 5DPLUH] to be the hardest part of the rehearsal proZKRSOD\HG+RUWRQ´,UHDOO\HQMR\HGSHU- cess. ´,RQO\IRXQGWKHFKDUDFWHUSUREDEO\D IRUPLQJHVSHFLDOO\ZLWKVXFKDQDPD]LQJ PRQWKDJRÂľVDLG'LD]ZKRXVHGDORWRI FDVWÂľ $07 WHDFKHU &\QWKLD /XWZLQ ZDV H[DJJHUDWHG PRYHPHQWV DQG UXQQLQJ LQ LPSUHVVHGZLWKKRZKDUGWKHFDVWZRUNHG his portrayal of the character. â&#x20AC;&#x153;The Cat is

DFWXDOO\DORWOLNHPHLQUHDOOLIHÂľ <RXQJ DOVR VDLG VKH IRXQG JHWWLQJ into character to be the hardest part of preparing for the show. ´7KHKDUGHVWSDUWZDVGHĂ&#x20AC;QLWHO\WU\LQJWRJHWP\VHOILQWRWKHPLQGVHWRID OLWWOHER\FRQVLGHULQJWKDW,¡PDWHHQDJHJLUOWKDWLVMXVWH[WUHPHO\JLUO\ÂľVKH said. 'HVSLWHWKHFKDOOHQJHRIJHWWLQJLQWR FKDUDFWHU<RXQJVDLGVKHDOVRKDGWR deal with nerves before going on stage. ´%HIRUH WKH VKRZ , JHW YHU\ YHU\ QHUYRXV , WKLQN RI DOO WKH GLIIHUHQW ZD\VWKDW,FDQPHVVXSÂľ<RXQJVDLG ´7KHUHZHUHVRPDQ\GLIIHUHQWWKLQJV WKDW,FRXOG¡YHPHVVHGXSRQEXWRQFH ,¡PRQVWDJHDOOP\IHDUDQGQHUYRXVQHVVJRDZD\Âľ All the preparations paid off and the DFWRUVZHUHDEOHWRJURZJHWRYHUWKHLU fears and learn new techniques. ´7KHUH LV DQ HQWLUH HQVHPEOH WKDW ,GRQ¡WSHUVRQDOO\HYHUVSHDNWREXW, UHDFWWRHYHU\WKLQJWKH\VD\Âľ5DPLUH] VDLG´,OHDUQHGKRZWREHPRUHLPDJLQDWLYHLQP\DFWLRQVDQGUHDFWLRQVÂľ 0UV/XWZLQVDLGVKHKRSHVKHUVWXGHQWVEULQJDOHYHORISURIHVVLRQDOLVPWR DOOIXWXUH$07SURGXFWLRQV ´,WKLQNWKLVH[SHULHQFHZLWKWKHP SXWWLQJRQWKHSOD\KDVPDGHWKHPPDWXUHDQGWKH\JRWWKHH[SHULHQFHIURP EHJLQQLQJWRHQGRISXWWLQJRQDPDMRU PXVLFDOZKLFK,WKLQNLVLQYDOXDEOHWR WKHPÂľ0UV/XWZLQVDLG

$ODFNRIFUHDWLYLW\H[LVWVLQWKHĂ&#x20AC;OP LQGXVWU\ DV PRUH DQG PRUH QRYHO VHULHV are going to the big screen. What started with Harry Potter quickO\OHGWRPRUH\RXQJDGXOWQRYHOVEHLQJ DGDSWHG WR PRYLHV :KHWKHU LW¡V MXVW D GHHSORYHIRUWKHQRYHOVRULIWKHPRYLH PDNHUVKDYHVLPSO\UXQRXWRILGHDVWKHUH LVFHUWDLQO\DQLQĂ X[RIĂ&#x20AC;OPVEHLQJPDGH based on books. 2QHRIWKHEHVWSDUWVRIPRYLHVLVWKH VKRFNYDOXHRIVXUSULVHVEXWZKHQHYHU\ PRYLHLVEDVHGRQDVWRU\WKDWHYHU\RQH LVDOUHDG\IDPLOLDUZLWKWKDWHOHPHQWQR longer exists. While it is exciting to see WKH ERRN \RX¡YH ORYHG IRU \HDUV Ă&#x20AC;QDOO\ JDLQDFNQRZOHGJHPHQWDQGPDNHLWLQWR WKHDWHUVLW¡VPRUHIXQWREHVXUSULVHGE\ the actions of new characters. Even though this is not a new concept PRYLHVEDVHGRQFRPLFVKDYHEHHQEHLQJ PDGHIRU\HDUV Ă&#x20AC;OPVDGDSWHGIURPUHDGLQJVDQG\RXQJDGXOWQRYHOVLQSDUWLFXODU KDYHEHFRPHSRSXODUDWWKHER[RIĂ&#x20AC;FH Author Nicolas Sparks (â&#x20AC;&#x153;The Last 6RQJÂľ´'HDU-RKQÂľ KDVKDGHLJKWRIKLV  SXEOLVKHG QRYHOV WXUQHG LQWR PRYLHV DQGDXWKRU-RKQ*UHHQKDVKLVĂ&#x20AC;UVWPRYLH ´7KH)DXOWLQ2XU6WDUVÂľ FRPLQJWR WKHDWHUVVRRQZLWKDQRWKHUDOUHDG\LQWKH ZRUNV ´3DSHU7RZQVÂľ  The large fan bases of both authors KDYHOHGWRWKHGHYHORSPHQWRIWKHLUVWRULHVLQWRPRYLHV%XWEHFDXVHHDFKLQGLYLGXDO¡V VW\OH GRHVQ¡W GHYLDWH PXFK EHWZHHQ HDFK ERRN WKH PRYLHV EHJLQ WR VHHPUHSHWLWLYH )RUDXWKRUVLWVXUHO\PXVWEHH[FLWLQJ to see their work acknowledged and apSUHFLDWHGEXWVXUHO\LWFRXOGEHIUXVWUDWLQJWRKDYHWROLVWHQWRRWKHUVPDQLSXODWLQJDQGFKDQJLQJ\RXUVWRU\IRUĂ&#x20AC;OP 7KHUHFHQW'LVQH\Ă&#x20AC;OP´6DYLQJ0U %DQNVÂľ WHOOV WKH VWRU\ RI :DOW 'LVQH\ WXUQLQJWKHERRNYHUVLRQRI´0DU\3RSSLQVÂľLQWRDĂ&#x20AC;OP7KHĂ&#x20AC;OPVKRZVDXWKRU 3/ 7UDYHUV¡ KHVLWDQFH DQG IUXVWUDWLRQ ZKHQ KDYLQJ WR FRQIRUP WR +ROO\ZRRG ideals. :KHQDERRNLVVRSRSXODUPRYLHSURducers see dollar signs and an opportuQLW\WRUHDSDORWRIEHQHĂ&#x20AC;WVZLWKRXWKDYLQJWRGRQHDUO\DVPXFKZRUNDVLWZRXOG UHTXLUH WR FRPH XS ZLWK DQ LGHD IURP VFUDWFK7KH+ROO\ZRRGER[RIĂ&#x20AC;FHLVVXFK a large business that they do anything to keep a successful series going. $V DQ H[DPSOH +DUU\ 3RWWHU ZDV D VHYHQERRN VHULHV EXW ZDV PDGH LQWR HLJKW PRYLHV $QG WKH ODVW H[WUD PRYLH DORQHPDGHRYHUELOOLRQZRUOGZLGH 6LQFH PDMRU PRWLRQ SLFWXUHV KDYH EHHQLQSURGXFWLRQVLQFHWKHHDUO\V it is understandable that it feels like evHU\PRYLHKDVDOUHDG\EHHQPDGH:KLOH ERRNVKHOSIDFLOLWDWHWKHĂ RZRIQHZLGHDV DQGPDNHPRYLHSURGXFWLRQHDVLHUWKHUH VKRXOGEHDFDSRQWKHQXPEHURIERRNV WXUQHGLQWRPRYLHV


APRIL 2014

ARTS & ENTERTAINMENT

THE CIRCUIT

29

WWW.CBHSCIRCUIT.COM

Arts scholarship recognizes seniors a 3 year old,â&#x20AC;? she said. â&#x20AC;&#x153;By the time I was 10, though, I knew I Five seniors from the Bay was serious about it.â&#x20AC;? won Arts for the Future ScholarDevoting much of her time to ships at the Stars on Parade Cel- dance in high school, Norman ebration at the Broward Center said she was truly honored to for the Performing Arts on April win the scholarship. 2. The event recognized outâ&#x20AC;&#x153;Since I donâ&#x20AC;&#x2122;t have any venue standing students in the areas of through which I could perform visual, performing, musical, and often (at most, I have two or three technical arts. shows a year), being the only Katherine Harris, Ryan graduating dancer in the county Kramer, Samantha Norman, Ja- to be recognized was humbling net Pagliuca, and Michelle Yu DQGIXOĂ&#x20AC;OOLQJÂľVKHVDLG each won a $1,000 scholarship. Norman said she is likely goElizabeth Jenkins, an art ing to attend Fordham Universiteacher at the Bay since it opened ty at Lincoln Center, which has in 2002, currently teaches Nor- an undergraduate partnership man, Harris, and Pagliuca in her with the Alvin Ailey American AP Art class. Dance Theatre School. â&#x20AC;&#x153;Winning the award validates â&#x20AC;&#x153;I plan to pursue dance in the level of talent each has,â&#x20AC;? she my future, but maybe not as a said. â&#x20AC;&#x153;It shows their desire and career, since itâ&#x20AC;&#x2122;s an intense and dedication to pursuing advanced short-lived one,â&#x20AC;? she said. â&#x20AC;&#x153;I study in the arts by their follow- have a friend who graduated LQJWKURXJKZLWKĂ&#x20AC;OOLQJRXWWKH from Fordham application, with a dual mawriting the â&#x20AC;&#x153;My hope is that jor in dance and essays, and math, so anys u b m it t i ng people will be able thing is possithe required to connect with ble!â&#x20AC;? artworks and my work through Another letter of recwinner, Harris, o m m e n d a - their own personal who will be attion.â&#x20AC;? experiences and tending UniNor ma n, versity of Censituations.â&#x20AC;? who won in tral Florida in the Perform- -senior Katherine the fall, said ing Arts cate- Harris she feels a real gory, said she sense of acstarted danccomplishment ing when she for receiving was 3 years old. a scholarship in the visual arts â&#x20AC;&#x153;I did ballet along with a category. bunch of other activities one â&#x20AC;&#x153;Winning this scholarship would be pushed into trying as makes me feel appreciated for BY EVAN TEICH

PHOTO SUBMITTED BY ELIZABETH JENKINS

A HEART FOR ART: (From left) Katherine Harris, Samantha Norman, Janet Pagiluca, Michelle Yu, and Ryan Kramer are awarded Arts for the Future Scholarships valued at $1,000.

the effort Iâ&#x20AC;&#x2122;ve put into my art over the past years,â&#x20AC;? she said. â&#x20AC;&#x153;The scholarship I won will help me pay for college and ensure my continuing education in art.â&#x20AC;? Harris said that she has been an artist for as long as she can remember. â&#x20AC;&#x153;My dad is an artist so Iâ&#x20AC;&#x2122;ve been exposed to art since a young age and have always loved creating art,â&#x20AC;? she said. Having been exposed to art IRUPRVWRIKHUOLIHVKHĂ&#x20AC;QGVWKDW art gives her the ability to showcase her emotions in a unique manner. â&#x20AC;&#x153;I love that art allows me to express myself in ways I canâ&#x20AC;&#x2122;t express myself in words,â&#x20AC;? she said. â&#x20AC;&#x153;My hope is that people will be able to connect with my work through their own person-

al experiences and situations.â&#x20AC;? Along with performing and visual arts, the Bay produced winners in the musical category. â&#x20AC;&#x153;It shines a good light on the program seeing kids achieve things musically and it was an honor for our chorus to perform at the ceremony,â&#x20AC;? said music teacher Brad Franks. Kramer, a winner in the musical category who will be attending Duke University this coming fall, said receiving the scholarship was something special. â&#x20AC;&#x153;Winning this scholarship JLYHV PH FRQĂ&#x20AC;UPDWLRQ WKDW , am taking my musical abilities in the right direction,â&#x20AC;? he said. â&#x20AC;&#x153;Being recognized for my passion is truly rewarding.â&#x20AC;? Kramer said that he has been

playing piano since a young age and he competes every year in multiple categories at the state level. In addition to playing the piano, he has used his musical interest to assist those in need throughout the community. ´, KDYH P\ RZQ QRQSURĂ&#x20AC;W organization called Ryanâ&#x20AC;&#x2122;s Song that aims to provide musical instruments to underprivileged children who cannot afford them,â&#x20AC;? he said. With the help of the staff and the hard work of the students at the Bay, Mrs. Jenkins said that the art program as a whole at the school has become incredible. â&#x20AC;&#x153;The art program at our school is constantly winning awards and accolades,â&#x20AC;? she said. â&#x20AC;&#x153;We are fortunate to have the program we do.â&#x20AC;?

Movie sequels, classic remakes recieve mixed reviews from fans addresses abandonment and friendships,â&#x20AC;? Mrs. Seigel said. â&#x20AC;&#x153;I am anxious to see As time progresses, classic movies are how the remake turns out.â&#x20AC;? transformed into modern remakes. Junior After reading the â&#x20AC;&#x153;Hunger Gamesâ&#x20AC;? seGillian Grossen, who has watched both ries, sophomore Jessica Kline had expecthe original and the 1996 remake of â&#x20AC;&#x153;Ro- tations set for the movie and the recently meo and Juliet,â&#x20AC;? said she prefers the clas- released sequel â&#x20AC;&#x153;Catching Fire.â&#x20AC;? sic version because it stays true to its stoâ&#x20AC;&#x153;I thought both movies were amazryline. ing,â&#x20AC;? Kline said. â&#x20AC;&#x153;I enjoyed â&#x20AC;&#x2DC;Catching â&#x20AC;&#x153;My ninth grade teacher showed my Fireâ&#x20AC;&#x2122; a little better because the movie was class a remake of â&#x20AC;&#x2DC;Romeo and Julietâ&#x20AC;&#x2122; exactly like the book.â&#x20AC;? with Leonardo DiCaprio in it and I hated Kline said that even though it is a chalit. It was really random and not much of lenge to bring the book to life, the direcit made sense,â&#x20AC;? Grossen said. â&#x20AC;&#x153;An earlier tor Gary Ross did remake of the stoan amazing job. ry that my teacher â&#x20AC;&#x153;A weird remake isnâ&#x20AC;&#x2122;t â&#x20AC;&#x153;I thought it also showed was a would be hard lot more tradition- what they want to see. to remake all the al and followed the They want to see the things from the actual story more, story they know.â&#x20AC;? books,â&#x20AC;? Kline said. which I like a lot â&#x20AC;&#x153;Everything I read -junior Gillian Grossen better.â&#x20AC;? in the book and exGrossen said pected to see in the when directors removie happened.â&#x20AC;? make a story and try to make it original Junior Stephanie Espinosa read the it can sometimes drive away an audience â&#x20AC;&#x153;Twilightâ&#x20AC;? series and watched each book because it is unfamiliar. on the big screen. â&#x20AC;&#x153;A weird remake isnâ&#x20AC;&#x2122;t what they want â&#x20AC;&#x153;I think they stayed with the same stoto see. They want to see the story they ryline as the books,â&#x20AC;? Espinosa said. know,â&#x20AC;? Grossen said. Espinosa said she found the middle English teacher Joyce Seigel said with movies, â&#x20AC;&#x153;New Moonâ&#x20AC;? and â&#x20AC;&#x153;Eclipse,â&#x20AC;? borremakes the artists are modernizing and ing because nothing exciting happened changing settings and making more use during those books. of technology that is now available. ´7KHĂ&#x20AC;UVWPRYLHZDVJRRGEXWWKHODVW â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m aware that â&#x20AC;&#x2DC;Frankensteinâ&#x20AC;&#x2122; is the one was the best,â&#x20AC;? Espinosa said. PRVWUHFHQWUHPDNHRIDFODVVLFĂ&#x20AC;OPWKDW BY CARLY SCHREIDELL

GRAPHIC BY PAULA MARTINS


30

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

ARTS & ENTERTAINMENT

APRIL 2014

5  Minutes  with

Hector Brignone Junior Hector Brignone is the drummer of The Funky Monks, an alternative band that also has junior Fernando Clemente and senior Ricky Risquez as members. The band, formed at the beginning of this school year, has had achievements such as winning the DQQXDOWDOHQWVKRZZKLFKZDVLWVĂ&#x20AC;UVW performance. Staff writer Monica Garcia spoke to Brignone about his band. Whatâ&#x20AC;&#x2122;s your favorite part of being in a band? The feeling of being part of one sound with Fernando and Ricky is a feeling that I cannot explain. The music just becomes a smooth melody and it takes over your body. +DV LW EHFRPH GLIĂ&#x20AC;FXOW IRU \RX WREDODQFHWKHWLPH\RXVSHQGZLWK \RXUEDQGDQGVFKRRO" /DWHO\ LW KDV EHFRPH GLIĂ&#x20AC;FXOW WR Ă&#x20AC;QG WLPH WR SUDFWLFH EHFDXVH RI WKH amount of schoolwork I have and other daily occupations, such as family activities and hanging out with friends. Is being a musician something \RXSODQWRSXUVXH" Financially it is just really risky to go into, but it is something I would GHĂ&#x20AC;QLWHO\OLNHWRGRIRUIXQ :KDWFDUHHUSDWKZRXOG\RXOLNH WR IROORZ LI EHLQJ D PXVLFLDQ GRHV not work out for you? Iâ&#x20AC;&#x2122;d probably like to be an audio engineer because itâ&#x20AC;&#x2122;s still involved in the music industry and itâ&#x20AC;&#x2122;s the next best think to playing live, but isnâ&#x20AC;&#x2122;t as risky as being a full on musician. Have you had any major shows? Weâ&#x20AC;&#x2122;ve played in the talent show and the fashion show, but outside of school we also play at parties every now and then and itâ&#x20AC;&#x2122;s a lot of fun.

PHOTO BY LAURA MUNEVAR

GET ARTSY: Junior Marialejandra Feliciani uses color to convey feelings of being swept away by the wind.

:[\KLU[Ă&#x201E;UKZWHZZPVUPUHY[ KHUVHOIJUDSKLFDOO\Âľ6PLWKVDLG Feliciani said she is inspired by modAs a young girl growing up in Venezu- ern art and digital art, and that she wants ela, junior Marialejandra Feliciani was in- to become a concept artist. Ă XHQFHGE\WKHFUHDWLYHZRUNRIKHUPRWK´,W¡V LQFUHGLEOH KRZ DUW KDV HYROYHG er and the artistic works of her 17-year- from pencil sketches and color pencil to ROGIULHQG%ODQFD6PLWK6KHKDGQ¡WUHDO- whatâ&#x20AC;&#x2122;s digital right now, which is basicalized her artistic ability until the age of 12 ly everything in the world,â&#x20AC;? Feliciani said. ZKHQVKHSLFNHGXSRQHRI6PLWK¡V´+RZ ´0RVWRIWKHDUWFUHDWHGQRZLVGLJLWDO,W¡V to Drawâ&#x20AC;? books used in books, in and began sketchmovies, and in â&#x20AC;&#x153;Illustration is basically ing on her own. video games.â&#x20AC;? -XVW Ă&#x20AC;YH \HDUV everything. You can go Feliciani later, Feliciani has wants to become anywhere with that. You become an asa concept artist piring artist who can get into animation, for video games hopes to turn her game design, and also be and animated hobby into a promovies where she a graphic designer.â&#x20AC;? fessional career. can apply her love ´,MXVWEDVLFDO- -junior Marialejandra for digital art. ly started draw- Feliciani ´,OOXVWUDWLRQ LV ing one day little basically everyanime characters thing. You can go out of nowhere, and then anywhere with that. You my mom liked what I was can get into animation, doing so she put me in an game design, and also be art class,â&#x20AC;? Feliciani said. a graphic designer,â&#x20AC;? she 6PLWKDVHOIWDXJKWSKRsaid. tographer and graphic deFeliciani said she also signer, inspired her to begin got the chance to work drawing and has continuwith history teacher Eric ously supported and helped Adzima to come up with a her and her artwork. unique logo for his music ´,QUHDOLW\,WKLQNDUWGRHVQ¡WLQĂ XHQFH business. The design combines Mr. AdziKHUVKHLQĂ XHQFHVDUWWKURXJKKHULGHDV PD¡VĂ&#x20AC;UVWDQGODVWQDPH and her way of thinking and expressing ´:H ZRUNHG WRJHWKHU WR FRPELQH D BY LAURA MUNEVAR

A&E Favorite

'R \RX SOD\ DQ\ RWKHU LQVWUXments besides the drums?

An ongoing feature that showcases teachersâ&#x20AC;&#x2122; favorite TV shows, novels and movies.

Geometry and Algebra 1 teacher Lauren Bender is currently watching ´6XUYLYRUÂľWKHUHDOLW\JDPHVKRZWKDWĂ&#x20AC;UVWEHJDQWRDLULQ0D\ &RPSHWLWRUVOLYHLQGLIĂ&#x20AC;FXOWFRQGLWLRQVLQH[RWLFSODFHVLQRUGHUWRZLQPRQH\ and other prizes. The current season takes place in Palau Island in the Philippines.

I am a percussionist and I play the guitar. Is there any other instrument WKDW\RXDUHLQWHUHVWHGLQOHDUQLQJ WRSOD\"

â&#x20AC;&#x153;I  love  the  show  itself  because  not  only  does  it   involve  puzzles  and  complex  challenges  for  the   contestants  but  it  also  makes  the  viewer  think   and  participate  as  well.  These  contestants  have  no   food  or  blankets,  so  this  makes  it  so  much  more     exciting.  My  favorite  thing  about  it  is  that  the   games  and  the  challenges  really  make  you  think.â&#x20AC;?

I think maybe just get better at playing the guitar. Do you have any inspirations and if so why? 'HĂ&#x20AC;QLWHO\&KDG6PLWKZKRLVWKH drummer for the Red Hot Chili Peppers. They just have great energy. Everythingâ&#x20AC;&#x2122;s great about them.

successful form and texture and came up with something cool,â&#x20AC;? Mr. Adzima said. )HOLFLDQLVDLGKHU8QLWHG6WDWHVKLVWRU\ class has inspired her to voice her opinion toward modern-day society through her DUWZRUN 6KH FKRVH WKLV FRQFHSW DV KHU FRQFHQWUDWLRQ D VSHFLĂ&#x20AC;F WKHPH IRU KHU portfolio, in her AP Art class. ´6KHLVDYHU\XQLTXHDQGWDOHQWHGDUWLVW6KHKDVDYHU\GLVWLQFWLYHVW\OHÂľ$3 Art teacher Elizabeth Jenkins said. ´:DWFKLQJ VRFLHW\ ULJKW QRZ HYHU\thing is really corrupt,â&#x20AC;? Feliciani said. ´,W¡VQRWIXQKDYLQJHYHU\RQHEHLQJGLYLGed by technology and societyâ&#x20AC;&#x2122;s standards. My concentration represents the effects of society and cities on people. It represents the cities growing on them physically like a disease.â&#x20AC;? Feliciani said in addition to music and other forms of art, the world continuously inspires her. ´%DVLFDOO\\RXFDQĂ&#x20AC;QGLQVSLUDWLRQLQ SUDFWLFDOO\ HYHU\WKLQJÂľ VKH VDLG ´$Q\thing that exists is a point of reference for inspiration.â&#x20AC;? Although many people have tried to sway her decision in pursuing art because it wasnâ&#x20AC;&#x2122;t considered a stabilized career Feliciani said she is certain of following her dreams and continuing on this path. ´$UWLVVRPHWKLQJLQZKLFK\RX¡UHDEOH to let go of all your frustrations,â&#x20AC;? she said. ´,W¡VOHWWLQJJRRIHYHU\WKLQJWKDWERWKHUV PHRUPDNHVPHVDG²DUHĂ HFWLRQRIP\ emotions on a piece of paper.â&#x20AC;?

Lauren Bender


APRIL 2014

ARTS & ENTERTAINMENT

Do it for the six seconds of fame BY IGNACIA ARAYA

Sophomore Daniel Diaz started making 6-second videos on vine when the app ÀUVWFDPHRXWEXWKHKDVUHFHQWO\PDGH KLVZD\WR¶YLQHIDPH·,QKLVIUHHWLPH KHSXWVDSDLURIER[HUVRYHUKLVKHDGDQG LPLWDWHVKLVPRWKHULQERWK(QJOLVKDQG 6SDQLVK/LNHRWKHU¶YLQHUV·KHDOVRWDONV DERXWUHODWDEOHWRSLFVLQVHFRQGV7KHVH YLGHRV KDYH ODQGHG KLP  IROORZHUV¶9LQHIDPH·KDVEHFRPHYHU\FRPPRQDFURVVWKHDSS 6L[ VHFRQGV PD\ QRW VHHP OLNH D ORW RIWLPHWRJHWDSRLQWDFURVVEXWDSRSXODUDSSFDOOHG9LQHKDVJLYHQPLOOLRQVRI XVHUVWKHRSSRUWXQLW\WRHDUQODXJKVDQG EHFRPH´9LQH)DPRXVµ ´,ORYHPDNLQJSHRSOHODXJKDQG,ORYH WKDW,FDQGRLWWKURXJK9LQHµ'LD]VDLG ´,QHYHUWKRXJKWP\YLGHRVZRXOGJHWPH IROORZHUVEXWWKH\GLGDQGLWVFUD]\WKDWSHRSOHNQRZPHIRUP\YLGHRVµ 9LQH FHOHEULWLHV DOO LQWHUDFW DPRQJ HDFK RWKHU DV ZHOO 7KLV FUHZ LQFOXGHV QDPHV VXFK DV -HURPH -DUUH ´-DFN DQG -DFNµ &DPHURQ 'DOODV 1DVK *ULHU 7KHVH QDPHV PLJKW VHHP XQIDPLOLDU WR VRPHEXWVRSKRPRUH*DEULHOOH)XUJHVRQ VDLGWKHVHFHOHEULWLHVNHHSKHUHQWHUWDLQHG RQDGDLO\EDVLV ´,OLNHKRZLQDFRXSOHRIVHFRQGV\RX FDQODXJKVRPXFKZKHQ\RXVHHVRPHWKLQJUHDOO\UHODWDEOHDQGIXQQ\µ)HUJXVRQVDLG )HUJXVRQVDLGVKHORYHVWRFKHFNKHU 9LQHDSSOLFDWLRQWRVHHZKDW·VJRLQJRQ ´,JRRQYLQHPRVWO\HYHU\QLJKW,W·V

VRHQWHUWDLQLQJµVKHVDLG 9LQH EHFDPH DYDLODEOH RQ WKH DSS VWRUHIRUVPDUWSKRQHV-DQXDU\EXW GXULQJVXPPHURI9LQHJRWDPDNHRYHUZLWKWKHDGGLWLRQRIWKH´UHYLQHµEXWWRQ 7KLV DOORZHG XVHUV WR UHSRVW YLQHV WKDW WKH\ OLNH DQG KHOSHG WKH VSUHDG RI SRSXODU VL[VHFRQG FOLSV WKDW OHG VRPH ¶YLQHUV·WRWKHLUIDPH ´0\IDYRULWHYLQHULV$OH[-DPHV+LV YLQHVDUHDOZD\VUHDOO\IXQQ\DQGVDVV\µ IUHVKPDQ$Q\D%HUULVDLG %HUULVDLGVKHOLNHVKLVYLQHVEHFDXVH VKHÀQGVWKHPUHODWDEOHDQGKLODULRXV ´7KH YLGHRV KH PDNHV DUH HYHU\GD\ WKLQJVWKDWKDSSHQWRKLPZLWKDQQR\LQJ SHRSOHDQGHYHQWVµVKHVDLG 6RPH RI WKHVH YLQH FHOHEULWLHV KDYH PHHWDQGJUHHWV ZLWK WKHLU IROORZHUV ZKLFKDOORZVIRUDPRUHSHUVRQDOFRQQHFWLRQ2QHPHHWXSLQ:DVKLQJWRQ6TXDUH 3DUN LQ 1HZ <RUN IDFLOLWDWHG WKH UHODWLRQVKLS EHWZHHQ 9LQH FHOHEULWLHV -HVVL 6PLOHVDQG&XUWLV/HSRU)UHVKPDQ3D[WRQ 7HUULV VDLG KH KDV NHSW XS ZLWK WKLV YLQH UHODWLRQVKLS E\ ZDWFKLQJ WKH YLQHV WKH\ SRVWHG DQG WKH FRQYHUVDWLRQV WKH\ KDGYLDVHFRQGYLGHRVRQWKLVIRUPRI VRFLDOQHWZRUNLQJ ´&XUWLV DQG -HVVL·V UHODWLRQVKLS ZDV HQWHUWDLQLQJDQGIXQQ\ZKLOHLWODVWHG, ÀQGLWFUD]\WKDWWKH\PHWRQWKLVDSSDQG WKDWIROORZHUVJRWWKHRSSRUWXQLW\WRPHHW WKHLU IDYRULWH YLQHUVµ 7HUULV VDLG ´,W·V FRRO WKDW WKH\ FDUH DERXW WKHLU IROORZHUVHQRXJKWRWDNHWKHWLPHWRÁ\DFURVV WKHFRXQWU\WRKDYHDPHHWXSZLWKDOORI WKHPµ

31 WWW.CBHSCIRCUIT.COM THE CIRCUIT

who is your favorite vine star and why? “KC James. His dinosaur ÄUNLYOHUKNHTLZHYL OPSHYPV\Z¹ ZLUPVY*OYPZ[VWOLY*OPU ¸;PUH[VV[\YU[ILJH\ZLZOLPZ H^R^HYKS`OPSHYPV\ZHUK MHI\SV\Z¹ ZVWOVTVYL4HUU`7LUH ¸5HZO.YPLYILJH\ZLOL»Z J\[LHUKOLKVLZHSSVMOPZ ]PULZ^P[OOPZSP[[SLZPZ[LY¹ ZLUPVY+L]`U+VOULY ¸:WLJPHS2/LZLLTZSPRLH WYL[[`JVVSN\`¹ Q\UPVY;YL`:LHYZ

Lee  and  Amtzis      P.L. $WWRUQH\VDW/DZ %RFD)LQDQFLDO3OD]D *ODGHV5RDG6XLWH %RFD5DWRQ)/   $UHDVRI3UDFWLFH &RPPHUFLDO %XVLQHVV/LWLJDWLRQ (PSOR\PHQW/LWLJDWLRQ 6HFXULWLHV/LWLJDWLRQ 5HDO3URSHUW\'LVSXWHV 0HGLDWLRQ &LYLO$SSHOODWH3UDFWLFH 6WDWH )HGHUDO&RXUWV

:D\QH+6FKZDUW](VT 'RUL6RORPRQ(VT :HVWRQ5HVLGHQWV


32

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

ARTS & ENTERTAINMENT

Christina Perriâ&#x20AC;&#x2122;s album â&#x20AC;&#x2DC;Head or Heartâ&#x20AC;&#x2122; makes hearts melt Head or Heart BY ELANNA HEDA COPY EDITOR

Singer-songwriter Christina Perriâ&#x20AC;&#x2122;s third album, â&#x20AC;&#x153;Head or Heart,â&#x20AC;? is a pleasant mixture of upbeat, peppy songs and slow, calming songs. The CD was such a hit that it soared to No. 3 on iTunes and No. 10 on Amazon by its third day on the market, giving Perri her deserved standing at the top of

the charts. Perri started her career by posting videos on YouTube showing all the work she did in her attempt to get her music out to the world. She demonstrated the amount of time and energy that went into every song, proving just how much effort and how hard she worked to earn her fame. Like most musicians, she was an underGRJZKRPDQDJHGWRĂ&#x20AC;QGKHURZQZD\ to the top. After surging to fame in 2011 when her breakout song â&#x20AC;&#x153;Jar of Heartsâ&#x20AC;? was played on â&#x20AC;&#x153;Dancing with the Stars,â&#x20AC;? PerULVROLGLĂ&#x20AC;HGKHUUHSXWDWLRQDVDORYHVRQJ writer. This album maintains the theme with her question of whether to think with

her head or her heart, and every song depicts her indecision and weighs the pros and cons of both. The album starts off slow with â&#x20AC;&#x153;Trustâ&#x20AC;? but picks up with â&#x20AC;&#x153;Burning Gold,â&#x20AC;? which is a perky twist for Perri who usually favors slower songs, but her range helps her pull it off. â&#x20AC;&#x153;Be My Foreverâ&#x20AC;? featuring Ed Sheeran can only be described as pretty, so it is a nice change, despite how repetitive it becomes. Perri does a fabulous job of keeping with her typical beats and styles and buildups while still bringing new patterns to the music. The album ends with â&#x20AC;&#x153;Shot me in the Heart,â&#x20AC;? which is similar to â&#x20AC;&#x153;Jar of Heartsâ&#x20AC;? in its musical stylings. This is a nice homage to the song that brought her to fame.

While the more upbeat songs are unusual for her, Perri manages to pull them off and continues to amaze with her belting ability. She makes every song soothing in its own right. Her music is good enough for the songs to be pleasant in the background but her lyrics are nice enough to be focused on. For fans of the album, Perriâ&#x20AC;&#x2122;s â&#x20AC;&#x153;Head or Heartâ&#x20AC;? tour began on April 7 in Sioux Falls, S.D., and she will be in Orlando on May 2 and St. Petersburg on May 3. Released on April 1, â&#x20AC;&#x153;Head or Heartâ&#x20AC;? depicts Perriâ&#x20AC;&#x2122;s excellent ability to experiment with different styles while remaining within her pop genre.

THE CIRCUIT RECOMMENDS Young Volcanoes Fall Out Boy

Ready Aim Fire Imagine Dragons

Gold Dust

John Newman

Glitter in the Air

P!nk

National Anthem Lana Del Rey

The Town

Macklemore

Kangaroo Court

APRIL 2014

â&#x20AC;&#x2DC;This Star Wonâ&#x20AC;&#x2122;t Go Outâ&#x20AC;&#x2122; tells true story of teen battling cancer This Star Wonâ&#x20AC;&#x2122;t Go Out BY INES ACOSTA

â&#x20AC;&#x153;This Star Wonâ&#x20AC;&#x2122;t Go Out,â&#x20AC;? written by Esther Earl, and her parents Lori and Wayne, is an inspiring true story of a teen dealing with cancer that ultimately ends in her tragic death at 16. This book, while showing her experience with the disease, also shows the troubles of a teen in the modern age, including WKHGHVLUHIRUDĂ&#x20AC;UVWURmantic kiss. In spite of knowing that Esther will die, readers will still both laugh and cry as the book illustrates the importance of family values and friendships through one simple, heart-breaking story. The book is a compilation of Estherâ&#x20AC;&#x2122;s MRXUQDOVSLFWXUHVĂ&#x20AC;Ftion and sketches. She was diagnosed with thyroid cancer at 12, and the book details how she faces the problems that come with facing a lifethreatening disease. From the beginning, Esther talks about how she wanted to make a difference in the world so that she could be remembered after her death. Throughout the story there are also entries from the CaringBridge journal, a website that allows family and friends to send their ill loved ones messages, and update others on her progress while battling cancer. Although Estherâ&#x20AC;&#x2122;s journal entries are funny and captivating, some passages are lengthy and could have been left out without taking away from the book as a whole. The book also doesnâ&#x20AC;&#x2122;t always follow chronological order, which, unless one pays close attention to the dates and times when an entry was written, can be confusing. Regardless of the length of the book, it shows the power and strength of love through the relationships Esther forms.

Estherâ&#x20AC;&#x2122;s parents support her and help her with her medical needs, and she watches TV shows such as â&#x20AC;&#x153;Doctor Whoâ&#x20AC;? with her little brother, while her two older sisters keep in touch with her through text messages while they are in college. Also, in her last few years, Esther meets a couple of friends on the Internet, and ends up forming friendships that last the remainder of her life. She participates in Make-A-Wish, an organization that grants one wish to every child who is diagnosed with cancer, and uses her wish to bring all these friends together along with one celebrity guest, John Green, author of

â&#x20AC;&#x153;The Fault in Our Stars.â&#x20AC;? Green wrote the introduction to Estherâ&#x20AC;&#x2122;s book, and he helps readers fall in love with her story. He uses personal anecdotes that demonstrate their friendship throughout the years. (They met at a Harry Potter convention.) He also shares how he felt when she died. This is a heart-warming, inspiring story of young Estherâ&#x20AC;&#x2122;s life as she faces her cancer. It beautifully demonstrates the cycle of life and death from a young personâ&#x20AC;&#x2122;s perspective, and it presents an incredibly realistic story about the struggles of Esther and her family and friends as they attempt to prolong her life through a mixture of medications and new memories.

An ongoing feature that includes lesser known songs by popular artists and songs from up and coming artists. This monthâ&#x20AC;&#x2122;s playlist was compiled by Stefania Markowicz.

All I Need AWOLNATION

I See Fire

Ed Sheeran

Strawberry Bubblegum Justin Timberlake

Renegade Daughtry

Capital Cities

After All

Walking On Air

Michael Buble

Just A Feeling

Ribs

Maroon 5

Katy Perry

Lorde


APRIL 2014

ARTS & ENTERTAINMENT

THE CIRCUIT

33

WWW.CBHSCIRCUIT.COM

Ultra attracts talented DJs, fans Ultra Music Festival BY SAM KRAUSS

Three days of music, dancing and partying in Bayfront Park in Miami, Ultra Music Festival 2014 was an expensive ZHHNHQG EXW GHĂ&#x20AC;QLWHO\ ZRUWK WKH SULFH The festival took place on March 27-29 DQGVWDUWHGDWDURXQGSPHDFKGD\DQG ended at midnight on Friday and SaturGD\DQGRQ6XQGD\ The lineup of DJs was awesome at the GLIIHUHQWVWDJHVDURXQGWKHSDUN2Q)ULday, Zedd killed it on Main Stage with his hit, â&#x20AC;&#x153;Stay the Night,â&#x20AC;? and Borgore was the best at the Worldwide stage that QLJKWZLWKKLVSRSXODUVRQJ´'HFLVLRQVÂľ Both artists had amazing sets that got the FURZGFUD]\DQGZLOG The setup of Ultra consists of multiple stages featuring different artists all at the same time so there are many options to choose from to decide whom you want to VHHDQGZKHUH\RXZDQWWRJR Since DJ Avicii was hospitalized before Ultra, Deadmau5 took his place on Saturday night to close the show on 0DLQVWDJH,WZDVDELJGLVDSSRLQWPHQW but Dillon Francis was the best act to see at Worldwide stage on Saturday night because of his remixes of the songs â&#x20AC;&#x153;PurVXLWÂľDQG´*HW/RZÂľ(YHQWKRXJKVRPH

rain came down toward the end of the night, it was nice to cool off and have fun in the rain and still enjoy the great music LQWKHFURZG 'XULQJWKHGD\WLPHĂ&#x20AC;JKWLQJIRUIURQW row was the way to go to get the best expeULHQFH.UHZHOODDQG: :JRWWKHFURZG very engaged and excited with their perIRUPDQFHVDQGWKHĂ&#x20AC;UHDQGVPRNHFRPing from the stage added to the intense YLEHLQWKHFURZG For most, Ultra tickets came up to about $500, plus a hotel or a ride to the IHVWLYDO ZKLFK FDQ JHW SULF\ $OVR WKH overpriced water for $5 a bottle adds up for the weekend making the Ultra expeULHQFHYHU\H[SHQVLYHEXWZHOOZRUWKLW The festival can get very crowded and overwhelming at times, but there are places to get away and cool down when you need a break by the bathrooms or out RIWKHFURZGE\WKHWUHHVRURQWKHJUDVV The number of people makes the line to get in very long but once inside, the hassle is worth it because of how much fun the IHVWLYDOLV (YHU\\HDUWKHUHDUHDOZD\VLQMXULHVDW Ultra; however, this year a security guard was trampled and put in the hospital in critical condition from crazed fans trying WRUDPWKHLUZD\LQZLWKRXWWLFNHWV7KLV event might lead to either canceling Ultra in 2015 or changing the location to someZKHUHRWKHUWKDQ0LDPL(YHQVRWKHUH is a petition to keep Ultra in Miami next \HDU Most who attended this year didnâ&#x20AC;&#x2122;t know about the security incident and still

PHOTO BY SAM KRAUSS

ULTRA BIG: Ultra Music Festival took place March 27-29 at Bayfront Park in downtown Miami. The biggest crowds surrounded the main stage (pictured above).

ZHUH DEOH WR HQMR\ WKH IHVWLYDO ,W ZDV D ed, but with memories, pictures and buzzgreat experience that left people exhaust- LQJHDUV

â&#x20AC;&#x2DC;Oculusâ&#x20AC;&#x2122; frightens audience but Novel gives insight into life entertains with great soundtrack with deadly disease Oculus BY ANA BEATRIZ GONCALVES

Hang onto your seats and donâ&#x20AC;&#x2122;t you GDUH ORRN LQ WKH PLUURU ´2FXOXVÂľ ZLOO scare audiences out of their minds and provide an insightIXOSORW ,Q 0LNH )ODnaganâ&#x20AC;&#x2122;s new horURUĂ&#x20AC;OPDEURWKHU and sister return to their childhood home to lay to rest a malevolent spirit possessing and murdering LQQRFHQWSHRSOH ´ 2 F X O X V Âľ is the story of Tim (Brenton Thwaites) and .D\OLH 5XVVHOO .DUHQ *LOOLDQ  siblings who are on the search for truth after a trauPDWLFH[SHULHQFH Their father shot and killed their mother, so in reVSRQVH7LPNLOOHGKLVIDWKHU&RQYLQFHG that the antique mirror hanging in their home was the cause of the death and destruction in the family, Tim was sent to a PHQWDODV\OXP Years later, still convinced of the mirrorâ&#x20AC;&#x2122;s guilt, Tim is released from the institution, and with his sister, sets off to their

childhood home to discover the truth and FOHDU7LP¡VQDPH 7KH XVH RI Ă DVKEDFNV DOORZV YLHZers to experience the confusion faced by 7LPDQG.D\OLHDVWKH\WU\WRGLVFRYHUWKH WUXWKRIWKHSDVW7KHPLUURU¡V´VSLULWXDO energyâ&#x20AC;? also distorts the present, creating D SV\FKRORJLFDO WKULOOHU ZKHUH WKH Ă XLGity of the distortion of reality and fantaV\FDXVHVWKHĂ&#x20AC;OP¡VQRQVHQVHWRDFWXDOO\ PDNHVHQVH ´2FXOXVÂľ VWDQGV RXW DPRQJ LWV KRUror counterparts because it is one RI WKH IHZ Ă&#x20AC;OPV able to take place in the present without presenting itself as 100 percent unrealistic, keeping mundane details that the audience can UHODWHWR The audiences experience the same kind of psychological manipulation that the main charDFWHUV XQGHUJR The small cast seems complex, and character development progresses quickly \HWWKRURXJKO\ With smooth plot development and a JUHDWVRXQGWUDFNWKLVĂ&#x20AC;OPZLOOOHDYHKRUURUIDQVZDQWLQJPRUH7KHHQGLQJSHUfectly wraps up in a way that leaves audiHQFHV VDWLVĂ&#x20AC;HG ´2FXOXVÂľ LV VXUH WR KRUULI\DQGH[FLWHWKHPRVWDYLGKRUURUIDQV

Side Effects May Vary BY ERIN YOO

-XOLH 0XUSK\¡V ´6LGH (IIHFWV 0D\ Vary,â&#x20AC;? is a coming-of-age novel that allows readers to see the world through the eyes of 16-year-old Alice, an unapologetic teen battling lymphoF\WLF OHXNHPLD 7KH storyline, although confusing at times, is able to give a precise portrayal of the emotions of a troubled WHHQDJHU DQG LV GHĂ&#x20AC;QLWHO\ZRUWKWKHUHDG The novel circulates around Alice as she goes through a vengeful bucket list to exact revenge on all those who wronged KHU$LPLQJWRHVFDSH the impending consequences of her actions, Alice considers her terminal cancer her ticket out; however, her doctorâ&#x20AC;&#x2122;s announcement of her remission changes all of WKDW $OO WKRVH XQIRUgiving actions she takes for revenge are QRZUHWXUQLQJWRKHUZLWKUHSHUFXVVLRQV Murphy is able to create a cold and unbelievably true representation of the W\SLFDOUDVKHPRWLRQVRIDWHHQDJHU+HU writing is well executed and she is able to portray great depth in each character LQWKHQRYHO%\GRLQJVRVKHFUHDWHVDQ

unlikely relationship between the readers DQGWKHPDLQFKDUDFWHU$OLFH The storyline and writing is able to convey the emotions Alice is feeling and KHUWKRXJKWVWKURXJKWKHĂ&#x20AC;UVWSHUVRQQDUrative in such a way that readers begin to dislike Alice instead of feeling pity or V\PSDWK\7KLVLVDVWUDQJH\HWLQWHUHVWingly new way of representing the teenEDWWOLQJFDQFHUVFHQDULR The plot and story come out rather confusing at times; some readers may be left bewildered and frustrated by how the story is playing RXW :KHQ writing about Aliceâ&#x20AC;&#x2122;s emotions, Murphy is able to do so perfectly, but the portrayal of her relationship with her love interest, Harvey, is done rather FUXGHO\ (YHQ VR the novel is able to keep readers turning the pages and wondering ZKDW$OLFHZLOOGRRUIDLOWRGR Murphy is able to deliver a strong message to young adults and in the process writes a truthful showcase of intricate reODWLRQVKLSVDQGUDVKWHHQDJHHPRWLRQV


34 THE CIRCUIT

SPORTS

APRIL 2014 WWW.CBHSCIRCUIT.COM

Student takes up lacrosse as new sport, page 35

Athlete succeeds despite injuries BY ANA BEATRIZ GONCALVES

LACE IT UP: (From left to right) Sydney Kelleher, Paola Leon, Melissa Bruno-Pivenger, Christina Humphries, pose together before a track meet.

A popular saying these days is to never run away from oneâ&#x20AC;&#x2122;s problems, but to junior Melissa Bruno-Pivenger, thatâ&#x20AC;&#x2122;s exactly what she does. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve been involved in track since my freshman year,â&#x20AC;? Bruno-Pivenger said. â&#x20AC;&#x153;My father encouraged me in the beginning, but I grew used to it as a means of â&#x20AC;&#x2DC;de-stressingâ&#x20AC;&#x2122; after school. Also, itâ&#x20AC;&#x2122;s just really fun for me.â&#x20AC;? 6KHNQRZVWKDWPRVWSHRSOHĂ&#x20AC;QGUXQning tedious, and although she understands why, she provides her own reasons for putting herself through the tiring sport. â&#x20AC;&#x153;I like to run in the sun with my friends from track. Itâ&#x20AC;&#x2122;s just one hour out of my day where I donâ&#x20AC;&#x2122;t have to worry about my next test and just relax. Thatâ&#x20AC;&#x2122;s where the â&#x20AC;&#x2DC;de-stressingâ&#x20AC;&#x2122; happens,â&#x20AC;? she said. She has been involved in track since she went to Western High School during her freshman and sophomore years. DurPHOTO SUBMITTED BY MELISSA BRUNO-PIVENGER ing her time there, she competed in the mile (1600m) and won district champion- cused athlete,â&#x20AC;? track coach Joseph Monks hard and involve a lot of time devoted to ships both times. This year, however, she said. â&#x20AC;&#x153;I love the dedication she has for her them.â&#x20AC;? chosen sport. She is always willing to get She also enjoys guitar and martial competed in the 800m. Despite her love of running, Bruno- and become a better athlete as listens at- arts. â&#x20AC;&#x153;I used to be involved in Judo but that, Pivenger has encountered problems that tentively to her coach and most of all follows through.â&#x20AC;? along with guitar, track, and school, behave hindered her ability to compete. Coach Monks said this was evident came way too much work for me and I â&#x20AC;&#x153;During the last year, I was out most of the season because I got injured and at districts, as the girls became district had to drop it. However, that did teach me how to balance my time and become the WRUHDPXVFOHQHDUP\ORZHUVKLQVSHFLĂ&#x20AC;- champions. â&#x20AC;&#x153;I advised my girls that they were best at everything I can do,â&#x20AC;? she said. cally near my ankle,â&#x20AC;? she said. â&#x20AC;&#x153;And then Bruno-Pivenger, despite her busy in January this year, I got my asthma back catching up on the competition and they need to nail the top eight positions to VFKHGXOHDOZD\VĂ&#x20AC;QGVWLPHWRPDNHQHZ and found score points,â&#x20AC;? friends. out that I had Coach Monks â&#x20AC;&#x153;We met in track. She just came from an irregu- â&#x20AC;&#x153;In January this year, I got my said. â&#x20AC;&#x153;[team Western and sheâ&#x20AC;&#x2122;s still getting used to lar heartbeat. asthma back and found out captain] Kath- things,â&#x20AC;? senior Lauren Reynolds said. I couldnâ&#x20AC;&#x2122;t that I had an irregular hearterine MacNeal â&#x20AC;&#x153;Sheâ&#x20AC;&#x2122;s really dedicated to track and goes start practicreiterated this to every day to practice. And she herself is ing as ear- beat. I couldnâ&#x20AC;&#x2122;t start practicMelissa as they a really outgoing person. Sheâ&#x20AC;&#x2122;s always ly as the rest ing as early as the rest of the jogged to the happy and sheâ&#x20AC;&#x2122;s really funny. Whenever of the team, team.â&#x20AC;? starting line.â&#x20AC;? something tense is going on, she knows and when I Bruno-Piv- exactly how to crack a joke and make us was able to, I -junior Melissa Bruno-Pivenger enger said that all smile.â&#x20AC;? couldnâ&#x20AC;&#x2122;t work running is her Bruno-Pivenger is ready to greet new as hard. It was only toward the end of the season that I began to get back my way to relieve herself of stress from her people with a smile on her face. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m a very outgoing and talkative strength from the prior year, but it was a busy schedule. Despite her love of the afWHUVFKRROVSRUWVKHVWLOOĂ&#x20AC;QGVWLPHGRVLW person and I love forming relationships bit too late.â&#x20AC;? with people, but, like anyone else, I do enDespite her struggles, she was still down and do all her work. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m in AP United States History, AP joy having some quality time and think able to keep an optimistic spirit and purEnglish Language, Calculus Honors, and deep thoughts,â&#x20AC;? she said. â&#x20AC;&#x153;Although, that sue her passion. â&#x20AC;&#x153;Melissa is a very determined and fo- Physics honors,â&#x20AC;? she said. â&#x20AC;&#x153;Theyâ&#x20AC;&#x2122;re really just might be me being weird.â&#x20AC;?

Sports are beacon for happiness Sports bring out the best of the worst situations. They can give people something to cheer for when there is nothing to be happy about. A year after the Boston Marathon bombing, a memorial and service took place to honor and pay tribute to all of the lives that were lost and changed forever during the tragedy. The world of sports was heavily moved by the events that occurred. Boston sports teams rallied and went on winning streaks that no one foresaw. The Red Sox won the World Series, the Bruins made it to the Stanley Cup, and the Patriots and Celtics both made it to the playoffs. This gave hope to the Bostonian people in a time of tragedy. The tragedy of Sandy Hook touched sports as well. New York Giants wide receiver Victor Cruz reached out to a family affected by the shooting and became a symbol of hope for them as they were forced to deal with the pains. During the 2013 March Madness tournament, Louisville player Kevin Ware broke his leg in the middle of a TXDUWHUĂ&#x20AC;QDOV JDPH 7KH WHDP UDOOLHG around their fallen teammate and went on to win the tournament in spite of these hard times. Every year thousands of soldiers are reunited with their families through the help of sports teams at games. The inĂ XHQFH RQ WKHVH IDPLOLHV WKDW VSRUWV have brought them is tremendous. In the wake of wars, countries set aside their differences and compete in the Olympics. Countries that have disliked each other for years compete against each other in a moment of peace. Sports provide hope to people that have nothing to be happy for. It gives them something to cheer for and rally DURXQG$OWKRXJKVSRUWVFDQQRWĂ&#x20AC;[HYerything, they help to momentarily help people going through hard times.

Varsity baseball pounds Piper, advances to district playoffs BY EVAN KESSLER

The Bronx Bombers made pinstripes famous, but on Wednesday, April 9 the varsity baseball team, wearing pinstripes, looked and played like the New York Yankees by pounding the Piper Bengals LQĂ&#x20AC;YHLQQLQJV Shortstop Danny Cepeda and designated hitter Alex Valladares led the offensive onslaught for the Lightning, by combining for two home runs and six runs batted in. Third baseman Raul Quintero also had two hits and two RBIâ&#x20AC;&#x2122;s. This mercy rule win clinched the second seed in the district playoffs for the Lightning, who were awaiting the district game as The Circuit went to print. â&#x20AC;&#x153;Going into the district playoffs we need to improve our focus late in games and we need to execute precisely on all of our opportunities,â&#x20AC;? Quintero said. 7KHWHDPKDGZRQĂ&#x20AC;YHVWUDLJKWDVRI April 17 and was focusing on districts. â&#x20AC;&#x153;We need to play a complete game by producing more runs and generate more

PHOTO BY EVAN KESSLER

BATTER UP: Sophomore catcher Devin Ramirez gets ready for the incoming pitch against Piper on April 9. Varsity baseball defeated Piper 13-3 and clinched the second seed for the district playoffs.

scoring chances to succeed in districts,â&#x20AC;? Valladares said. At the Piper game, Valladares put the Lightning ahead early with a two-run KRPHUXQLQWKHĂ&#x20AC;UVWDQG&\SUHVVEURNH WKH JDPH RSHQ ZLWK D Ă&#x20AC;YHUXQ WKLUG LQning. Valladares drove a fastball on a 3-2 FRXQWWROHIWĂ&#x20AC;HOGWRVHWWKHWRQHIRUWKH Lightning early on.

â&#x20AC;&#x153;I sat on the fastball and I was able to get on top of it and I drove it over the fence,â&#x20AC;? Valladares said. The Lightning caught a break during the top of the second inning, when a Piper runner was called out on a runnerâ&#x20AC;&#x2122;s interference call. This eliminated a run scored for Piper that would have tied the game at three, and it resulted in the Lightning

getting out of the inning only conceding one run. â&#x20AC;&#x153;Alex [Rodriguez], our starting pitcher, was struggling early but once the interference call happened and gave us a second chance, we made sure to make them pay,â&#x20AC;? catcher Devin Ramirez said. â&#x20AC;&#x153;He really began to zone in and we were able to give him a lot of insurance runs.â&#x20AC;? Rodriguez picked up his fourth win of the season by recovering from four earlyinning walks to striking out three and allowing only one hit over four innings. The Bay was set to face Western in the Ă&#x20AC;UVWURXQGRIWKHSOD\RIIVDQGLURQLFDOO\ was to be the home team, even though the tournament was to be held at Western on April 22. (For more updates on this, visit cbhscircuit.com.) â&#x20AC;&#x153;Being the home team gives us the chance to have the last at bats and we know how many runs we need to win the game,â&#x20AC;? Quintero said. Due to weather problems, Senior Night, which was supposed to be held during the Miramar game, was cancelled.


APRIL 2014

SPORTS

THE CIRCUIT

35

WWW.CBHSCIRCUIT.COM

Lacrosse players set to play at next level after his sophomore year, Loporto has had the idea of college lacrosse surroundThe Bay is used to producing ath- ing him ever since he was a freshman. letes that take their sport to the next level, “It’s always been a dream of mine whether it’s football, baseball or basket- to get the chance to play in college, and ball. However, a sport that hasn’t been playing lacrosse is my life,” Loporto said. contributing over the last few years is laLoporto also said the Bay gives him crosse, but this year that will change. the right mindset and skills to be able to Three seniors on the current boys la- achieve his dream. crosse team will be taking their talents “Playing at Cypress has given me a lot to the next level: seniors Mikey Men- of opportunities and the coaches and the della (Roanoke College, Virginia), Tyler athletic director were very involved,” he Loporto (Norwich University,), and Evan said. Trabosh (Asbury University, Kentucky). Cypress Bay lacrosse didn’t produce Mendella, a defender, has been at the only one collegiate goalie. Evan Trabosh Bay for two years after he transferred also looks forward to going to Asbury to from Western High, but he has already play and get to know his new team. PDGH HQRXJK LPSDFW RQ WKH ÀHOG WR EH “I’m excited most about being able to named the team’s captain for the season. live in a dorm with all my teammates, Although his main priority is the high and getting a strong bond with all of school season, Mendella can’t help but them,” he said. look forward Although to the future. all players have “I’m really “Playing at Cypress bright futures happy to be has given me a lot of ahead of them, able to play at opportunities and the they all said the next levthey will never el. It’s a fast- coaches and the athletic forget the times er game,” he director were very involved.” they have had said. and lessons they -senior Tyler Loporto Mendel la learned here at believes that Cypress. the Lightning “Cypress improgram has pacted my career by teaching me respongreatly impacted his future in lacrosse in sibility and how to be a better leader,” a positive way. Trabosh said. “Cypress competes with some of the Coach Geoff Swinerton said these best teams in the state every year, and three players really impact the team, and PHOTO BY ANNA SCHIFTER those teams are full of athletes playing that they show promise and are capable READY, AIM, FIRE: Senior Mikey Mendella (left) takes a shot at the goal. He college lacrosse,” Mendella said. LQJRLQJWRWKHGLVWULFWDQGUHJLRQDOÀQDOV and two other seniors on the boys lacrosse team will be taking their talents to Goalie Tyler Loporto couldn’t be more “This team shows a lot of promise, play college lacrosse. excited to play lacrosse in college. Trans- and I really enjoy how far we have come ferring from high-powered St. Thomas along this season,” Coach Swinerton said. BY DYLAN PULITANO

Junior switches sports, becomes new leader on lacrosse team BY SAM KRAUSS

but a really hard worker,” Patruno said. Patruno has played with Couture for After playing soccer most of her life, two varsity high school seasons and they junior Gillian Couture took up lacrosse now play travel together, too. as her new sport a little over a year ago “The team wouldn’t be the same and fell in love with the game. She has without Gill,” she said. always had an interest in lacrosse and Couture moved to Weston from Bosgot involved with it because a few of her ton 10 years ago and her mom had told friends encouraged her to give it a try. her to stick to one sport, soccer. She then “I knew trying out for a varsity sport took up lacrosse in high school when her without barely knowing the game was PRPÀQDOO\JDYHLQDQGERXJKW*LOOLDQ very risky, but I was willing to try my KHUÀUVWODFURVVHVWLFN hardest to improve my skill level and be“Gillian was a good soccer player come part of the team,” Couture said. but she is a much better lacrosse playCouture plays defense for the Prae- er, I think, because she enjoys that game torians and much more than socEast Coast cer,” her mother KarReds, which “Gillian was a good en Couture said. “I are both high regret not letting her soccer player, but she is school travplay years ago when el teams. She a much better lacrosse VKHÀUVWDVNHGµ also plays for player, I think, because Mrs. Couture said Cypress Bay that Gillian worked during the she enjoys that game very hard to learn laschool season. much more than soccer.” crosse and make the “I love that -mother Karen Couture varsity team. When it is a team VKH ÀUVW VWDUWHG SOD\sport and I’m ing, she practiced at lucky to be the walls at Tequesta able to play Trace Park, and her with such a great group of girls,” Couture hard work paid off when she made the said. team. Junior Sabrina Patruno, who plays at“One of my greatest joys is to go to PHOTO SUBMITTED BY GILLIAN COUTURE tack, said she loves having Couture as a her games and watch her play and cheer CRADLE, CRADLE, CRADLE: Junior Gillian Couture (left) defends the pass teammate because of her great attitude her and her team on,” Mrs. Couture said. against the opposing team. She has taken up the sport of lacrosse, and she has and fun personality. “Gillian is a wonderful team player and become a leader on the varsity lacrosse team. “She is a huge contributor to stopping when she makes a commitment to a a bunch of goals. And as a teammate, team she gives it 100 percent.” tunities to improve her game and contrib- a valuable part of Cypress Bay’s girls lashe’s awesome because we can laugh Gillian is a very focused lacrosse ute to the team, said her coach Brian Ray. crosse team,” he said. about anything. She’s super easygoing, player who is always looking for oppor“Gillian is a pleasure to coach and is


36

SPORTS

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

APRIL 2014

MLB scouts watch senior play ball BY SABRINA GAGGIA PHOTO EDITOR

As senior Daniel Cepeda walked RQWRWKHEDVHEDOOÃ&#x20AC;HOGKHPHQWDOO\ SUHSDUHGKLPVHOIIRUWKHQHUYHZUDFNLQJ H[SHULHQFHWKDWZDVDKHDGRIKLP+H NQHZWKHUHZRXOGEHDPDMRUOHDJXH EDVHEDOOWHDPVFRXWLQWKHFURZGDORQJ ZLWKFKHHUIXOIULHQGVDQGIDPLO\ 0XFKWRKLVDQGKLVFRDFKHV·VXUSULVH QRWMXVWRQHEXWVL[PDMRUOHDJXHEDVHEDOO WHDPVFRXWVDWWHQGHGWKHKRPHJDPHYV :HVW %URZDUG +LJK 6FKRRO RQ 0DUFK  DORQJ ZLWK DQ DZD\ JDPH YV 6RXWK 3ODQWDWLRQ+LJK6FKRRORQ0DUFK7KH <DQNHHV %UDYHV &XEV :KLWH 6R[ 1D WLRQDOVDQG0DULQHUVZHUHWKHWHDPVWKDW FDPHWRZDWFK&HSHGDSOD\ 'XULQJ VSULQJ EUHDN &HSHGD WUDY HOHGWR6DQIRUGIRUDEDVHEDOOWRXUQDPHQW ZKHUHWKH&DUGLQDOVDOVRVDZKLPSOD\ ´:HZHQWWR6WDQIRUGIRUWKHVFKRRO·V EDVHEDOOWHDPDQGZHSOD\HGIRXUJDPHV VREDVLFDOO\P\HQWLUHVSULQJEUHDNFRQ VLVWHG RI EDVHEDOOµ &HSHGD VDLG ´,·YH EHHQGRLQJUHDOO\ZHOOWKLV\HDUDQG,DOVR GLG YHU\ ZHOO ODVW \HDU VR ,·P JXHVVLQJ WKH\IRXQGRXWDQGFDPHWRVHHPHSOD\µ &HSHGD VDLG KLV FRDFK WROG KLP WKH VFRXWVZHUHFRPLQJWRVHHKLPSOD\DIHZ KRXUVEHIRUHWKHJDPH ´,KDGQRLGHD,ZDVLQVFKRRODQGP\ FRDFKFDOOHGPHGRZQDQG,WKRXJKW,ZDV LQWURXEOHEHFDXVHRIP\JUDGHV%XWWKHQ KH WROG PH WKDW VFRXWV ZHUH FRPLQJ WR ZDWFKPHµKHVDLG´,RQO\KDGOLNHWZR KRXUVWRPHQWDOO\SUHSDUHP\VHOIEHFDXVH ,ZDVVRQHUYRXVµ

%DVHEDOO FRDFK 3DXO /LRWWL VDLG RQO\ RQHWHDP·VVFRXWZDVVXSSRVHGWRDWWHQG WKH JDPH EXW ZKHQ WKH\ DUULYHG WKHUH ZHUHVL[RIWKHP ´:KHQ,JRWWRWKHÃ&#x20AC;HOGDQGVDZDOO WKHVFRXWVWKHUH,WKRXJKWLWZDVJUHDWQRW MXVW IRU 'DQQ\ EXW IRU WKH SURJUDP WKH VFKRRO$QGLW·VJUHDWIRUWKHRWKHUSOD\ HUVµ&RDFK/LRWWLVDLG´8OWLPDWHO\WKHP EHLQJWKHUHWRVHH'DQQ\LVMXVWJUHDWIRU KLVIXWXUHµ &HSHGD VDLG WKDW DOWKRXJK WKLV KDV EHHQDGUHDPRIKLVLWDOOVWLOOPDGHKLP QHUYRXV ´:KHQ>WKHVFRXWV@WDONHGWRPHWKH\ WROGPHWKDW,GLGZHOODQGQRSUHVVXUH %XW HYHU\ WLPH , ZHQW WR KLW HYHU\RQH WRRNRXWWKHLUYLGHRFDPHUDVµKHVDLG´, ZDVVRQHUYRXVEXW,KDGWRWDNHLWOLNH DPDQµ 3ULQFLSDO6FRWW1HHO\VDLGKDYLQJWKH VFRXWVFRPHRXWWRVHH&HSHGDSOD\LVDQ KRQRUIRUWKH%D\DQGIRUKLVIDPLO\ ´$OOWKH\HDUVRIKDUGZRUNDQGGHGL FDWLRQWKDWGRHVQ·WMXVWKDSSHQ$OORIXV ZKRKDYHEHHQLQDVSRUWDQGKDYHTXLWLW OLNHPHEHFDXVHLWJHWVKDUGHUDV\RXJR RQNQRZZKDWWUXHKDUGZRUNJHWV\RXµ 0U1HHO\VDLG´$QDWKOHWHOLNHKLPRQO\ FRPHVDURXQGRQFHLQDZKLOHµ 'DQQ\·V IDWKHU &DUORV &HSHGD VDLG WKHH[SHULHQFHKDVEHHQH[WUHPHO\H[FLW LQJDQGKHLVYHU\SURXGRIKLVVRQ·VKDUG ZRUN ´7KLVH[SHULHQFHZDVDYHU\JRRGRS SRUWXQLW\ WR JHW KLV QDPH RXW WKHUH DQG KRSHIXOO\ KHOS KLP JHW WR WKH QH[W OHY HODQGPDNHKLVGUHDPFRPHWUXHµ0U &HSHGDVDLG

LESS PAINFUL THAN CONVENTIONAL WAXING

HOMECOMING OFFER FIRST TIME CUSTOMERS

For HER

For HIM

FREE Regular Bikini or Brazilian* or Full Bikini* *(front & back)

Back and Shoulders

$25.99

EXISTING

CUSTOMERS

$34.99 For BOTH FREE Upper Lip or Underarms or Nostrils

10% OFF on any single service. Bring a friend and RECEIVE $5 OFF

Can not be combined with other offers. - Must present Cypress Bay student ID. - Must mention this ad. - Valid through 11/15/13

2217 N. Commerce Parkway Weston FL 33326

308 S. Federal Hwy #91A Boca Raton FL 33432

954.659.0033

561.367.7323

www.greenwavebodywaxing.com

GRAPHIC BY JESSICA SCHEIN STATISTICS AS OF APRIL 17, 2014

'DQQ\ VDLG KH LV ZDLWLQJ XQWLO WKH 0/%GUDIWLQ-XQHWRVHHLIKHJHWVGUDIW HGRXWRIKLJKVFKRRO ´,I,JHWGUDIWHGHDUO\,·OOJR,GRQ·W KDYH D SUHIHUHQFHµ KH VDLG ´, UHDOO\ ZRXOGQ·WPLQGPRYLQJDQ\ZKHUHµ &RDFK/LRWWLVDLGKHZDVYHU\SURXG RI &HSHGD DQG FRDFKLQJ VRPHRQH WKDW WDOHQWHGPHDQVDORWWRKLP ´'DQQ\ LV YHU\ WDOHQWHG $QG DO WKRXJKWKHUHDUHVWLOODORWRIPRXQWDLQV

WRFOLPEKHKDVWKHDELOLW\WRJRIDUµKH VDLG 0U&HSHGDVDLGKHZRXOGORYHWRVHH KLVVRQDFKLHYHKLVJRDOV ´:H KDYH EHHQ ZRUNLQJ KDUG VLQFH KHZDV\HDUVROG+HKDVORYHIRUWKH JDPHDQGWKDW·VYHU\LPSRUWDQWµKHVDLG ´,ZRXOGORYHIRU'DQLHOWRJRWRWKHQH[W OHYHOFROOHJHRUSUR7KDWZRXOGEHDPD] LQJµ


APRIL 2014

SPORTS

THE CIRCUIT

37

WWW.CBHSCIRCUIT.COM

Cheerleading team holds tryouts placed by current assistant coach Jordan Leland and biology teacher Melissa Pimentel-Reyes, Over 65 girls tumbled, chant- said she chose the cheerleading ed and cheered their way into the team based on girls who will cheerleading team after tryouts best represent the school after concluded on April 17. she is gone. Besides being evaluated by “I’m not going to be here next a panel of coaches and senior year, but I know that the girls cheerleaders on enthusiasm, en- will be enthusiastic and carry on ergy and coordination, teacher the spirit next year,” she said. “I recommendations and academ- have very high expectations for ic performance were taken into them, account and my in deter- “The most important part of goal is mining for them whet h- the tryouts is remembering to keep er girls to smile, projecting your on getw o u l d voice, having tight smiles ting betbe seter.” lected to and a positive attitude.” Ju join the -sophomore Marisa n i o r va rsit y Kalie Aleguas football, Manivarsiglia said ty basher two years of experience gave ketball or junior varsity cheer her a slight edge during tryouts, teams. where she was selected to cheer “The most important part for the varsity football team. of the tryouts is remembering “I usually pick up the cheer to smile, projecting your voice, and dance fast, which gives me having tight smiles and a posi- time to perfect my movements tive attitude,” said sophomore and I don’t let nerves get to me Marisa Aleguas, who will serve which made the tryout out go as a varsity football cheerleader smoother,” she said. “I also next year. “But it’s the practice worked really hard at getting my and effort you put into the tryout tumbling for this year, so even that make the difference.” as a former cheerleader I know I Coach Erica Wells, who will shocked some of my coaches by be pursuing a doctorate in child pulling that surprise out of the clinical psychology at Florida bag. Although, tumbling is not State University and will be re- required to be a member of the BY LISA BURGOA NEWS EDITOR

PHOTOS BY PAULA MARTINS

GOT SPIRIT: (above left) Sophomores Lynzi Bernstein and Amanda Masaro train for their cheerleading tryouts in the courtyard. (above right) Cheerleaders stretch before tryouts. The tryouts concluded on April 17 and in the end 65 girls were chosen either the varsity football, junior varsity football, or varsity basketball team.

team.” In order to help prospective cheerleaders prior to the tryouts, clinics were offered at the school for the girls to hone their skills. Tequesta Trace Middle eighth grader Alyssa Salbe, who will join the JV team her freshman year, said the clinics helped her prepare. “I went to the clinics and learned a cheer and dance so that my skills would be perfected for tryouts,” she said. “I wanted to be well-prepared, and I’m proud and honored to be selected to

cheer for our awesome athletes.” Maniglia said though the tryouts are over, she still aspires to ascend to the status of varsity football cheerleading captain next year, a decision that is made by the coaches during cheer camp over the summer. “Next year I am hoping I get to be Varsity football cheer captain and that I’ll be able to choreograph a really great halftime routine to perform at our games,” she said. “Cheerlading became my focus freshman year

since my mom closed her dance studio, and it’s something I really want to be.” Aleguas said she has high hopes for both the cheerleaders and the athletes next year. “It feels amazing to be a cheerleader and represent Cypress bay because the feeling of the pulse of the crowd and in the stands on game day is indescribable,” she said. “I haven’t been able to stop smiling just thinking of me representing the school next year.”

$QRQSURÀW organization dedicated to giving back to Haiti, especially its children. For volunteer opportunities or to make a donation visit www.timounlakayfoundation.org


38

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

ADVERTISEMENT

APRIL 2014


APRIL 2014

SPORTS

cutesy

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

Why did you start playing water polo? I was a swimmer for four years and my heart just wasnâ&#x20AC;&#x2122;t in it anymore. So when one of my teammates suggested that I play water polo, I decided to try it.

How did you get into water polo? My friend told me to join his local team in WKJUDGHDQGZKHQ,SOD\HGIRUWKHĂ&#x20AC;UVWWLPH I felt a special connection with it, and Iâ&#x20AC;&#x2122;ve been playing ever since.

Do you see yourself playing water polo in the future? I love the sport, so I want to play it as much as possible. But I wouldnâ&#x20AC;&#x2122;t want to play professionally because I feel like that would take the fun out of it.

How do you balance water polo with school? ,WLVKDUGEXWVFKRROFRPHVĂ&#x20AC;UVWVR,GRDOORI my schoolwork, and then practice four times a week for two hours. How has water polo affected you? I became a better swimmer and it also taught me to manage my time with school and be more responsible.

What do you enjoy most about water polo? I love how itâ&#x20AC;&#x2122;s always changing. Every game is different, and you have to learn how to adapt to each situation. It requires a lot of skill and strategy, which keeps the game interesting.

Do you have any pre-game rituals? I go to bed the night before early so I have a good rest. On game day I listen to Electric Dance Music, clean my goggles in hot water, stretch, and swim laps. 'UHZ*HIĂ&#x20AC;Q

-Spencer Rheingold

SPRING SEASON STATISTICS* Final District Standings

District Standings

Varsity

(Boys Lacrosse)

(Girls Lacrosse)

Baseball Schedule

Team Cypress Bay Archbishop McCarthy Flanagan Cooper City West Broward Pines Charter

Overall District 15-3 8-0 8-9 5-2 10-6 6-7 5-8 0-7

5-4 2-4 2-5 0-7

Boys Lacrosse Schedule Spanish River

L, 10-11

Cooper City

W, 15-4

South Plantation

W, 17-2

Western

W, 18-4

Pines Charter

W, 18-1

Stoneman Douglas

L, 1-6

Archbishop McCarthy

W, 11-7

Pine Crest

W, 8-7

Taravella

W, 13-4

University School

L, 7-10

South Plantation

W, 14-2

Naples

W, 19-6

West Boca Raton

W, 15-6

West Broward

W, 17-1

Archbishop McCarthy

W, 14-10

39

Team Overall District Cypress Bay 8-5 6-1 West Broward 7-8 4-3 Cooper City 6-7 3-3 Flanagan 1-9 0-6

Girls Lacrosse Schedule

Coral Glades

W, 5-4

Northeast

W, 10-0

South Broward

W, 13-6

Cooper City

W, 7-3

Coral Springs

W, 9-3

Pembroke Pines Charter

L, 0-4

Piper

W, 10-3

Western

L, 0-3

West Broward

W, 5-4

Flanagan

W, 18-7

South Plantation

W, 15-5

Cardinal Gibbons

L, 7-9

Western

L, 2-3

West Broward

W, 10-9

Cooper City

W, 7-6

Cooper City

L, 2-3

South Plantation

W, 8-6

McArthur

W, 9-5

Flanagan

W, 18-6

South Plantation

W, 6-2

Western

L, 10-13

Everglades

W, 5-4

West Broward

W, 14-13

Piper

W, 13-3

Cooper City

W, 9-8

Fort Lauderdale

W, 5-4

Taravella

W, 13-12

South Plantation

L, 10-14

Stoneman Douglas

L, 7-18

West Broward

L, 10-11

*All information as of April 22, 2014


40

THE CIRCUIT

WWW.CBHSCIRCUIT.COM

ADVERTISEMENT

APRIL 2014


April issue 2014