Page 1

A BUSINESS MAGAZINE FOR TODAY’S ENTREPRENEURS

NOVEMBER / DECEMBER 2013 / VOL-7 NO:11

NOV / DEC 2013

VOLUME-7 NO.11

www.maxmediaco.com

Y R E L L JEWE A I B A AR 2013 EDITION

Jordan: JOD 3 - RiyalQatar:Riyal 20.00 - Oman:Riyal 2.00 - UAE:Dirhams 20.00 - Kuwait:KD 2 - Saudi Arabia:Riyal 20.00 - Bahrain:BD 2

Business IN GULF

PUBLICATION


I M P E R I A L E

C O L L E C T I O N


Moda Mall: 17534444 Al-Aali Mall: 17581444 Seef Mall: 17587888 Ritz- Carlton Hotel: 17580123 City Centre: 17179009 www.asiajewellers.com

TURBINE CHRONO, A3036/1 WWW.PERRELET.COM

DOUBLE ROTOR TECHNOLOGY


Contents Business IN GULF

NOVEMBER / DECEMBER 2013

COVER STORY 50

Jewellery Arabia 2013 -HZHOOHU\$UDELDKDV´UPO\HVWDEOLVKHG LWVHOIDVWKHELJJHVWDQGPRVWSUHVWLJLRXV MHZHOOHU\H[KLELWLRQLQWKH0LGGOH(DVW SURYLGLQJLQWHUQDWLRQDOMHZHOOHU\KRXVHV ZLWKXQULYDOOHGGLUHFWDFFHVVWRWUDGH EX\HUVDQGSULYDWHFROOHFWRUVIURP WKURXJKRXWWKLVVHFWRU:HEULQJ\RXD VQHDNSHHNRIZKDWWRH[SHFW

FEATURE 54 Glitz, Glamour & Intricate Designs $UDELDQ([KLELWLRQ0DQDJHPHQWKDV EHHQRUJDQL]LQJWKH-HZHOOHU\$UDELD ([KLELWLRQULJKWIURPLWVLQFHSWLRQLQ :HVSHDNWR$(0&(26WHSKHQ .H\WR´QGRXWPRUHDERXWZKDWWR H[SHFWDWWKLV\HDU­VH[WUDYDJDQ]D 12

NOVEMBER / DECEMBER 2013

50

Jewellery Arabia 2013

54

Glitz, Glamour & Intricate Designs


Thank you my friend

Celebrate your Christmas moments

Gift from my husband

Wishing upon a star

DISCOVER THE NEW CHRISTMAS COLLECTION! Twinkling with stars to celebrate special Christmas moments. Visit the PANDORA store to ďŹ nd your perfect gift. BAHRAIN CITY CENTRE, Tel: +973 17 405 400


72

70

The Make Up Manual

A Winning Campaign

40

AmCham Bahrain Celebrates Growth

48

HRM Summit 2013 Organized

ENTREPRENEURS

EVENTS

70

40

A Winning Campaign :DID2EDLGDWLVRQHRIWKH\RXQJHVW HQWUHSUHQHXUVLQWKH.LQJGRPZLWKKHU YHQWXUH2EDL +LOO:KDWPDNHVWKH´UP PRUHH[FLWLQJLVWKHIDFWWKDWLWLVDQDOO ZRPDQDJHQF\6KHWHOOVXVPRUH

72

AmCham Bahrain Celebrates Growth $UHFHSWLRQZDVKHOGWRFHOHEUDWHWKH QHZJURZWKDQGJRDOVRIWKH$PHULFDQ &KDPEHURI&RPPHUFHLQ%DKUDLQDW WKHKRPHRI4D\V+=X­EL3UHVLGHQW $P&KDP%DKUDLQ

83

Igniting Innovation

SECTIONS 83

Igniting Innovation ,QQRYDWLRQPDQDJLQJWUDQVLWLRQDQG NHHSLQJDKHDGRIFRPSHWLWRUVDUHDOO LPSRUWDQWWRSLFVIRUDQ\RUJDQL]DWLRQ WRDGGUHVV7KLVDUWLFOHSURYLGHVWKH RSSRUWXQLW\IRU\RXWRUHµHFWXSRQZD\V \RXURUJDQL]DWLRQHQFRXUDJHVLQQRYDWLRQ

The Make Up Manual

48

0DLDO0RD\\HGVWDUWHGEORJJLQJWR VKDUHKHUSDVVLRQIRUPDNHXS,WSURYHG VRSRSXODUWKDWVKHZDVLQVSLUHGWRWDNH FODVVHV1RZVKHHYHQWUDYHOVWR'XEDL DQGRWKHUFRXQWULHVWRWHDFK:H´QG RXWKHUVWRU\

HRM Summit 2013 Organized

124

+XPDQUHVRXUFHVWKRXJKWOHDGHUVIURP DURXQGWKHZRUOGFRQYHUJHGLQ%DKUDLQ IRUWKH)LIWK$QQXDO+XPDQ5HVRXUFHV 0DQDJHPHQW +50 6XPPLW

<RXUJXLGHWRWKH.LQJGRP­V KRWHORXWOHWVIRUGLQLQJVKRSSLQJ QLJKWOLIHDQGVSD

14

NOVEMBER / DECEMBER 2013

Hotel Outlet Guide


With November comes my favorite time of the year: yes Winter but more importantly, itâ&#x20AC;&#x2122;s the time for every womanâ&#x20AC;&#x2122;s fantasy, the Jewellery Arabia 2013. With exquisite jewellery and big brands from across the world converging to Bahrain, the exhibition promises to exceed all expectations. The first time it was ever held was in 1992, and in just two decades, it has grown to become the most exciting event on the regionâ&#x20AC;&#x2122;s jewellery industry calendar. This year, it will be 10% bigger than last year and boasts of international bigwigs like Bulgari, Mouwad and Chopard. Big Players of Bahrainâ&#x20AC;&#x2122;s Jewellery Industry are also getting ready to showcase their best. We give you a sneak peak at whatâ&#x20AC;&#x2122;s in store. We believe that entrepreneurs are those who will change the nation and we bring to you some of the most successful young entrepreneurs in the Kingdom. Do let us know if you come across someone who is worthy of a feature. And drop us a line to tell us what fascinated you the most at Jewellery Arabia 2013! Reach out to us via social media. Until next time, Happy Reading! Dilraz Kunnummal

Deputy Editor dilraz@maxmediaco.com

Contributors

a

MAXMEDIA PUBLICATION

Business IN GULF

Bahrainâ&#x20AC;&#x2122;s premier entreprenurial lifestyle magazine PUBLISHER / EDITOR IN CHIEF Sameer Uchi MANAGING PARTNER / GROUP EDITOR Mohd. A. Kayani DEPUTY EDITOR Dilraz Kunnummal EDITORIAL COORDINATOR Jakrapong Saengnuan SALES & MARKETING DIRECTOR Tarek Rashdan SALES & MARKETING MANAGER Christelle Yaacoub PRODUCTION MANAGER Sachan Chandran GRAPHIC DESIGNER Haroon Rasheed

Neil Fogarty is an international speaker, business writer and consultant. Currently running his 12th company, Neil has written about his experiences in the books â&#x20AC;&#x153;Kill Your Salesmanâ&#x20AC;? and â&#x20AC;&#x153;#CrackOnâ&#x20AC;?. For further details you can check him out at www.neilfogarty.com

Dr. Clare Beckett-McInroyLVDFHUWLĂ&#x20AC;HGSURIHVVLRQDO&RDFKDQG3V\FKRPHWULVW who works with individuals and organisations to enable them to reach their potential. She is also president of Bizladies GCC. Bahrain@bizladies.org, clare@ beckett-mcinroy.com

Kelly Armatage Director of â&#x20AC;&#x153;Kelly Armatage Incâ&#x20AC;?. &RDFKLQJ6HVVLRQV&RUSRUDWH7UDLQLQJ6HOI'HYHORSPHQW6HPLQDUV3XEOLF Speaking and Meditation Classes.T: +973 17002320 / M: +973 39931399

PHOTOGRAPHER Honey Sharma DISTRIBUTION CONTROLLER Salah Abdulla Hassan

Please e-mail us any form of business, banking, financing, investments or entrepreneurial news. email us on: big@maxmediaco.com

SUBSCRIPTION

HEREâ&#x20AC;&#x2122;S HOW TO GET IN TOUCH PHONE

Subscription enquires: +973 17402482 ext-143 (Mob: +973 36665633) Editorial: +973 17402482 ext-112/145 Advertising enquires: +973 17402482 ext-125 (Mob: +973 36977111)

FAX +973 17402483

EMAIL

Publisher: sameeru@maxmediaco.com Group Editor: mohammedk@maxmediaco.com Advertising: tarek@maxmediaco.com Subscription: subscription@maxmediaco.com

WEBSITE www.maxmediaco.com

ADDRESS

16

P.O. Box 108 Bldg. 428, Road 84, Block 407, Tashan, Shk. Salman Highway. Bahrain

NOVEMBER / DECEMBER 2013

Annual Subscription to BIG; Bahrain BD15 ($40.000) GCC Subscription is BD25 ($66.000) for 1 year. Foreign Subscription is BD35 ($93.000) for 1 year. BIG is published 12 times a year. 3 easy ways to subscribe e-mail: subscription@maxmediaco.com  Online at www.maxmediaco.com Call +973 17402482, Fax +973 17402483 

B.I.G is published monthly and is available in all Supermarkets and book stores across the GCC. If you cannot find our magazine in your area, please give us a call on Bahrain (973) 17 402-482 and weâ&#x20AC;&#x2122;ll tell you where you can get a copy. Remember to always ask for B.I.G. Licence no: CBIG 712 Copyright: 433\04 B.I.G Magazine all rights reserved. Reproduction in any form is prohibited without our written permission. The content of this publication is the exclusive property of MAXMEDIA CO. W.L.L and must not be reproduced in any form without written permission. Every effort has been made to ensure the accuracy of the information contained in this publication. However, MAXMEDIA CO. W.L.L and all its publications cannot accept legal responsibility for any error or omission.


{ASK BIG}

WHAT’S A BRILLIANT OFFLINE RESOURCE ENTREPRENEURS CAN USE TO BUILD THEIR PERSONAL BRANDS? Question by: Lisa

G8:BFE K?<GI<JJ

=8:<KF=8:< JK@CCNFIBJ

NFIBN@K? JG<8B@E>8><E:@<J

;I8=K8JK<G$9P$ JK<G>L@;<

JK8IKPFLI FNED<<KLG

"For us, the best way to build brand offline has been by engaging traditional media. Whether that means doing an interview for a paper or TV show about the topics that touch our business, or writing a piece ourselves for a relevant industry publication, it's really worked wonders in building our brand and credibility -- not only among older generations but among Gen Y as well." - Lauren Friese | Founder, TalentEgg

"There is still no better way to build your brand than getting out there, being visible and meeting people. Attend networking events, charity events, industry conferences, and any events that are consistent with your brand identity. Making a solid first impression in person is still the most effective way to build relationships." - Richard Lorenzen | CEO, Fifth Avenue Brands

"While online resources can be helpful in building a brand, they often lack something that is best accomplished in person: connection. Joining a speaking agency allows you be a viewed as an expert AND to interact with people who are interested in your area of expertise. Once in front of this audience you, as a speaker, have the opportunity network and nurture a community of potential evangelists." - Kent Healy | Founder and CEO, The Uncommon Life

"As much as tech blogs would like you to believe that everything print is dead, local print newspapers still have high readership volume. Plus, they struggle to fill their pages with compelling stories. Consider writing a guest editorial about the state of your industry or a "How-to" based on your specific skill set for a newspaper; and don't be afraid to contact "local" dailies in other cities." - Aaron Schwartz | Founder and CEO, Modify Watches

"If a meetup in your area of interest doesn't exist, put in the time to start one and make it killer. If you can organize something good enough that people will come to you and get value from it, you'll be well on your way to establishing yourself as someone meaningful in the space." - Derek Flanzraich | CEO and Founder, Greatist

;FEËK=FI><K KFMFCLEK<<I

E<KNFIBN@K? B<PJK8B<?FC;<IJ

K8CBKFPFLI :FCC<8>L<J

9<:FD<8 >L<JK<OG<IK

"There was no greater boost to my image of Mark Wahlberg than when I found him next to me serving meals at a soup kitchen line. So the brilliant resource here is authentic, personal service for others, a resource that everyone has a wellspring of without having to look anywhere outside of themselves." - Luke Burgis | Director, ActivPrayer

"Face time is more valuable tool today than it ever has been before. Business leaders and founders should make time to visit with clients and other key stakeholders as a means of promoting and getting feedback on their businesses. Personal interaction costs little more than your time and cannot be replaced by online resources." - Christopher Kelly | Co-Founder, Principal, Convene

"Part of my consulting practice is helping professionals build their personal brands. One of the best ways to build your brand is to make sure you understand perception of your work. Email ten current and former colleagues individually and ask for their feedback on your greatest strengths and areas of development. Choose clients, co-workers and team members. Look for areas that align and surprise." - Susan Strayer LaMotte | Founder & Principal Consultant,exaqueo

"TV media is an excellent platform to launch and build your personal brand. Becoming a regular contributor for local and national news programs is an excellent way to build your credibility and watch your fame rise." - Melissa Cassera | President and CEO, Cassera Communications

JGI<8;K?<JN8> "Offer people swag that they will use. People don't throw out useful stuff. It gets your personal brand in people's faces and keeps it there. For example, at Tax Receipts, we give away wallet-sized cards loaded with tax information, such as a handy guide for business expenses you're allowed to claim, so you can remember to save the right receipts." - Nick Reese | CEO, Elite Health Blends

The Young Entrepreneur Council (YEC) is an invite-only organization comprised of the world’s most promising young entrepreneurs.

18

NOVEMBER / DECEMBER 2013


WWW.THEDOMAINHOTELS.COM The Domain, Diplomatic Area, Manama, Bahrain Tel: +973 16 000 000 /thedomainbahrain

@domainbahrain

@domainbahrain


NEWS

Alba wins IT Team of the Year Award BAHRAIN: Aluminium Bahrain B.S.C. (Alba)’s Information Technology Department won the IT Team of the Year Award at the ICT Achievement Awards 2013 that took place at the Godolphin Ballroom, Jumeirah Emirates Tower, Dubai. IT Manager, Esam Hadi was at the ceremony to receive the IT Team of the Year award on behalf of the team. Commenting on the IT Team winning the award in Dubai, Esam Hadi said: “I would like to congratulate the Team on winning this prestigious award and demonstrating the kind of success that can be achieved through effective team work. Over the years, the IT Team has

followed a clear principle in strengthening the information technology backbone of our operations, namely, speed, agility and simplicity. It has enabled them to play a supportive role in bolstering the overall production processes at the plant as well as in boosting interaction and communication between departments and external organisations.” In April 2013, Alba was praised for its information technology initiatives at the Bahrain International e-Government Forum and IT Expo 2013 where Alba emerged as the winner of the e-Government Excellence Award 2013 in the e-Economy category.

Top UK firms set to boost trade with Bahrain BAHRAIN: Scores of leading

businesses in the UK are looking to boost trade with Bahrain at a major event being held to mark the longstanding relationship between the two countries, a report said. The companies will arrive in Manama to showcase their products and help build on the positive bilateral trade ties in the Great British Week, which will be held between January 15 and 22 2014. ´This is the Àrst celebration of British business and innovation in Bahrain in a generation and we are very excited at the

prospect of putting on and supporting a whole range of events that showcase the wide-ranging, longstanding and close relationship between our two countries,” said British Ambassador Iain Lindsay at the launch of the event at the British Embassy. The event is being held under the patronage of His Majesty King Hamad and will take place in conjunction with the third Bahrain International Air Show. It is being jointly organized by the embassy, the Bahrain British Business Forum (BBBF) and the British Council.

Batelco Provides Surveillance System for Schools INCREASE IN EXPAT EMPLOYMENT BAHRAIN: The employment growth among expatriates in Bahrain was more than 40 per cent higher than the locals during the second quarter of the year, said a report. The expatriate workforce now stands at 509,622, an increase of 8.1 per cent from the same period last year, according to the latest Àgures released by Labour Market Regulatory Authority (LMRA). It compares to 152,245 Bahrainis in work, which grew by only 4.5 per cent over the

20

same period, the report stated. The Labour Market Indicators report revealed the LMRA issued 40,641 visas during the second quarter, of which 32,181 were for work visas, 260 for investors, 386 for temporary workers and 7,814 for dependents. “The number of renewed visas during this quarter reached 39,754, of which 28,210 were for regular workers, 278 for investors, 210 for temporary workers and 11,056 for dependents,” it said.

NOVEMBER / DECEMBER 2013

BAHRAIN: Batelco has installed an internationally recognised CCTV security & surveillance system for a secondary school as part of the Ministry of Education’s commitment to protect people and property at Bahrain’s local government schools. Batelco works hand in hand with key partners to deliver world-class products and services to the public and private sector in the Kingdom. To meet the requirements of the Ministry of Education, Batelco delivered a versatile solution, which is currently being used by thousands of organisations worldwide and has been proven to ensure the protection of people and assets at a wide range of facilities. Batelco and the Ministry of Education have selected a recognised international brand as it provides the most versatile

Email your business news to big@maxmediaco.com

solution for video enabling operations, managing risks, reducing costs, optimizing processes and protecting people and assets. The surveillance solution is built on HD Megapixel IP cameras with the cameras supporting true day and night features, with the ability to record in pitch-dark conditions and offer complete protection against environment and vandalism. The surveillance solution also includes monitoring entry and exit points as well as corridors across multiple stories.


The All-New Nissan PathямБnder. The Next Generation SUV.

YOU USED TO LOOK BACK, NOW YOU LOOK FORWARD. BIRD'S EYE VIEW FOR EASY PARKING.

,995

0 From BD 1

Remote Engine Starter

Sitra, Tel: 17 732732 www.nissanbahrain.com


NEWS

Midnight Launch of IPhone 5S & 5C BAHRAIN: VIVA announced

it had started selling Apple’s two new models, iPhone 5s and 5c, with an exclusive midnight launch that witnessed customers queuing up at VIVA’s Áagship store in Bahrain City Centre mall. Bringing to Bahrain the world’s most forward-thinking smartphone (iPhone 5s) and the most colorful smartphone available today (iPhone 5c), VIVA will be offering the devices with a range of attractive plans including Unlimited Smart 20, Smart 25 and Smart 30. These unique price packages from VIVA will provide customers with more value for money allowing

them to get the iPhone 5s and 5c on a monthly subscription whilst enjoying unlimited on-net voice and data on the Kingdom’s fastest network, as well as enjoy a special free number, among many other beneÀts. Moreover, customers can get the iPhone 5c available in an array of colors including blue, green, pink, yellow and white, in 16GB model for free with VIVA’s Unlimited Smart 20, Smart 25 or Smart 30 plan. The iPhone 5c 32GB version comes free with Unlimited Smart 25 or Smart 30 plans and for BD 39 upfront payment on Unlimited Smart 20 plan on 18-months contract.

BAHRAIN AIRPORT TO UNDERGO EXPANSION BAHRAIN: Plans have

been revealed to expand Bahrain International Airport so it can handle 13.5 million passengers a year. The government’s cabinet also heard that a new airport will also be built in the Kingdom to meet air travel demand by 2030. The plans were announced at

the cabinet meeting chaired by Prime Minister Prince Khalifa bin Salman Al Khalifa. Ministers discussed and approved a memorandum presented by the country’s Transport Minister which included a comprehensive upgrade of the current departure building and all its facilities.

WAITROSE CHAIN PULLS OUT OF BAHRAIN BAHRAIN: High-end

Bapco seals 2014 gasoil, jet term contracts BAHRAIN: Bahrain

Petroleum Co (Bapco) has Ànalized its 2014 jet fuel and gasoil term contracts with several companies, with premiums set at lower levels than this year’s. Term premiums were set lower as buyers expected reduced import demand from Saudi Arabia and more supply from the Middle East next year due to new reÀning capacity and expansion of existing plants, the sources said. Bapco’s negotiation, one of the Àrst to be Ànalized for next year, is expected to set the tone for term negotiations by other reÀners in the Middle East.

22

Bapco set the gasoil term prices for 2014 at a premium of $2.50 a barrel above Middle East quotes and the jet fuel term prices at a premium of $2.15 a barrel, sources involved in the discussions said.

NOVEMBER / DECEMBER 2013

supermarket chain Waitrose is pulling out of Bahrain just two years after opening its Àrst store in the country, the company’s regional partner said. Poor sales were cited as the reason for the decision, which has left two outlets at The Lagoon in Amwaj Islands and The Walk in Riffa already closed. “Despite strong customer loyalty to the brand, the sales required for sustainable business

Email your business news to big@maxmediaco.com

were not achieved,” said communications manager Colette Shannon from Supa Save Bahrain, which runs Bahrain’s Waitrose shops under franchise. “As such, Supa Save Bahrain has made their decision to exit the market and is in discussion with several interested parties to take over the stores. “Supa Save and Waitrose wish to thank their customers, suppliers and staff for their support over the past few years.”


NEWS

Tamkeen launches Enhanced Career Progression Program BAHRAIN: As part of its efforts to support Bahrainis and businesses to grow and develop, Tamkeen unveiled the enhanced Career Progression Program, which is a program that helps employers address performance gaps of their Bahraini employees by providing high-quality training opportunities to allow them to develop competencies related to their work. Through the program, Tamkeen offers Bahraini employees a series of specialized and high-level training courses to help them improve their

performance and advance in their careers. The training programs are designed based on detailed analysis conducted by a dedicated Tamkeen team in cooperation with the employers to identify performance gaps among their Bahraini employees by conducting Training Needs Analysis (TNA) and agreeing on a Personal Development Plan (PDP) for each employee. Once the training program is completed successfully, the beneĂ&#x20AC;ting employee will receive a subsidized salary increment by Tamkeen.

Fun at The K Hotel BAHRAIN: The K Hotel organized a cocktail reception for members of the media at the Kenza Lounge to put on record their appreciation for their constant support.

Thalassa Treats At Sofitel BAHRAIN: SoĂ&#x20AC;tel Bahrain

Zallaq Thalassa Sea & Spa organized a cocktail reception at their Thalassa Sea and Spa. During the course of the evening, guests were given a taste of the new treatments that have been introduced at the spa.

24

NOVEMBER / DECEMBER 2013

Email your business news to big@maxmediaco.com


NEWS

VIVA and Ministry of Health sign agreement during GITEX 2013 BAHRAIN: VIVA Bahrain has signed a strategic agreement with

the Ministry of Health (MoH) as part of its participation in GITEX Technology Week 2013, held in Dubai. The agreement will see both organizations working collaboratively to further strengthen Bahrain’s health system and the end-to-end patient experience. VIVA’s innovation will assist the MoH and related health entities stay ahead of the technology curve by providing best-in-class global ICT solutions. Through this agreement, VIVA will provide the latest in technology and ICT solutions to assist in building the capacity and skills needed within the MoH. Both organizations will also work together to identify and prioritize technology related challenges faced by the MoH, and will jointly deploy VIVA’s latest technology for local health entities to adopt global best practice and clinical operating models. Eng. Ulaiyan Al Wetaid , VIVA’s Chief Executive OfÀcer, said: “VIVA has been long engaged and working closely with leading

26

NOVEMBER / DECEMBER 2013

organizations who have global expertise in the health domain to ensure delivering global capability to the MoH. With VIVA’s knowhow and expertise in the health sector there is the potential for MoH to bring the scalability and repeatability of health solutions in shorter timescales and at lower costs to Bahrain’s health sector. We are proud to announce this partnership with the Ministry of Health which highlights Bahrain’s potential to be the health capital of the GCC and we look forward to achieving that together”. Dr Aysha Buaneq, MoH Undersecretary, commented: “Through this strategic partnership jointly with the VIVA, we envision to deliver a major transformation in the Kingdom’s health sector by investing in resources, expertise and future technologies.” “The collective aim is to adopt best practice and clinical operating models through the deployment of technology to enhance the way we work and serve our patients to drive better and faster outcomes, which will have a truly positive impact on their lives.”

Email your business news to big@maxmediaco.com


All new Outlander. 9LÃ&#x201E;ULKHUKYLHK`MVYHK]LU[\YL

Starting from BD 8,750 ;OLUL^6\[SHUKLYPZKLZPNULK[VLHNLYS`YLZWVUK^P[OZVSPKKLWLUKHIPSP[`HUKJVUÃ&#x201E;KLUJL;OLTVKLSJVTLZ LX\PWWLK^P[OHUHSSUL^[YPVVMJ\[[PUNLKNLZHML[`MLH[\YLZ^OPJOPUJS\KLZ3HUL+LWHY[\YL>HYUPUN:`Z[LT (KHW[P]L*Y\PZL*VU[YVSHUK-VY^HYK*VSSPZPVU4P[PNH[PVU ;LZ[KYP]L[OL6\[SHUKLYH[AH`HUP4V[VYZ[VKH`HUKL_WLYPLUJL[Y\L1HWHULZLZRPSSHUKPUNLU\P[`H[P[ZILZ[ Winner of Top Safety Pick from Insurance Institute Of Highway Safety 10 years or 1 million kms warranty on all our cars

VISIT US FOR A TEST DRIVE TODAY. Maâ&#x20AC;&#x2122;ameer 17 703 703 4P[Z\IPZOP)HOYHPU

Arad 17 465 533 4P[Z\IPZOP)HO

www.zmotors.com Mitsubish_bah


NEWS

BUSINESS IN GULF MAGAZINE PARTNERS WITH EO BAHRAIN BAHRAIN: Bahrain’s

Entrepreneurs Organization Chapter have entered into a strategic partnership with BiG magazine that will enable both entities to extend shared beneÀts to its customers and members respectively. Starting from November 2013, BiG magazine will start publishing interviews and stories of EO members Bahrain to show and encourage other would be entrepreneurs to follow path. “We are always looking for ways to promote and encourage entrepreneurships in our Kingdom, and we hope that this is the Àrst step in becoming the voice of all of the brilliant business minds in our country”, said Mr. Sameer Uchi, Publisher of BiG magazine. EO Bahrain Strategic Alliances Chair, Mr. Nezar Raees said, “This partnership is the meeting of two teams which are consistently committed to empowering entrepreneurs in the Kingdom.”

PineBridge acquires Dubai school property BAHRAIN: Bahrain-based

PineBridge Investments Middle East (PBME), a global multi-asset class investment manager, has acquired a UAE-based school campus operated by global education services provider GEMS Education in a sale and leaseback transaction. Under the terms of the agreement, GEMS Education will lease the school campus for a term of over 20 years. There will be no change to the school’s operations, and faculty, management and support staff will remain the same with no disruption to

28

pupils or their studies, said a statement from PBME. The move is part of PineBridge’s regional strategy to acquire income-generating real estate assets in the GCC. With its regional headquarters in Bahrain, PBME covers the Middle East, North Africa and Turkey region. “We see signiÀcant regional demand for proprietary real estate and private equity investments. Our platform allows us to provide one source of capital to fund our partners’ growth, as well as unlock value in their real estate holdings,” remarked.

NOVEMBER / DECEMBER 2013

FRANCE VOWS STRONG BAHRAIN INVESTMENT TIES FRANCE: Bahrain and France pledged to bolster economic partnerships and exchange investments. This came during a dinner banquet marking the acquisition of French Compin Front Ends & Composites by BFG International. Addressing the event, Bahrain Ambassador to France Dr Nasser Al Balooshi hailed strong bilateral relations bonding Manama and Paris. Dr Al Balooshi stressed the two countries’ strong desire to bolster joint co-operation and boost exchanges.

Email your business news to big@maxmediaco.com

He commended Bahrain’s position as a strategic hub and a gateway to the Gulf market. He hailed the success of BFG International, describing the Àrm as a model reÁecting steadily growing industries.


NEWS

Carl Gould shares “5 Ways to Generate Revenue for Business” at EO Bahrain event BAHRAIN: The Bahrain Chapter of

Entrepreneurs’ Organization (EO), under the sponsorship of Tamkeen, hosted an exclusive evening with Carl Gould, an internationally renowned speaker, turnaround specialist and author of “The 7 Stages of Small Business Success”. The business mentor and award-winning coach spoke on “5 ways to generate revenue for your business in the next 90 days”. In light of the volatile economic conditions and changing purchasing habits of consumers,

businesses need to “make the promise that no one else in your niche has the guts to make”. According to Gould, customers are empowered through Áexible consumption by providing smaller modules and bundles. The importance of refreshing one’s message to keep pace with the times was also stressed upon. Finally, Gould highlighted the value of aligning with those who provide complementary services to a business’ ideal clients, increasing chances of client retention.

A2Belladonna Opens Outlet BAHRAIN: Dikkan

A2Belladonna was recently inaugurated at the Riyadat Mall. Guests got an opportunity to network with the management and check out their latest collections.

30

NOVEMBER / DECEMBER 2013

This helps get a prospect off the fence and buy their products, increase prices and fees to earn more, generate greater levels of client loyalty and increase the frequency of customer purchases. Carl is an EO member, serving on the board for the New Jersey Chapter. The Bahrain Chapter of the Entrepreneurs’ Organization currently has 32 members who collectively employ over 5,700 employees and whose businesses turn over more than US$200 million in annual revenue.

Esprit Opens in Seef Mall BAHRAIN: Leading

international fashion brand Esprit has launched its new signature store at the Seef Mall as part of its regional expansion strategy. With 21 stores in Saudi, eight in the

Email your business news to big@maxmediaco.com

UAE, three in Egypt, two stores in Lebanon and one each in Kuwait and Bahrain, Esprit has plans to expand its presence in the region over the next few years, said a senior official.


NEWS

WIN FORD MUSTANG AT BIC An Expensive Drink BAHRAIN: Motorsport

fans are counting down the days to the World Endurance Championship (WEC) Six Hours of Bahrain at the Bahrain International Circuit (BIC), but the circuit has turned up the excitement levels by announcing the fantastic grand prize of its Six Hours of Bahrain promotional draw.

Fans who buy tickets to the Six Hours of Bahrain will all enter a grand prize draw for a chance to drive away in an amazing Ford Mustang! One lucky winner will have an unforgettable day at the circuit when their name is announced during all the excitement of the Six Hours of Bahrain ² the grand Ànale of this year’s WEC calendar.

DUBAI: The world’s most

expensive bottle of red wine, priced at $195,000 a bottle, has gone on sale in Dubai airport, with only three of the limited edition bottles made available for purchase. The 12 litre bottles were produced by the 400-year-old Château Margaux vineyard in the Bordeaux region of France and have gone on display at the Le Clos wine store in Dubai International Airport. The Château Margaux vineyard is renowned as one of the world’s greatest vineyards and the 2009 vintage is considered to be one of the best ever produced by the estate. Only six Balthazars, which are 12 litre bottles, have been produced, and three have been offered for sale in the Dubai outlet, which is located in the A380 concourse.

“To mark this fantastic vintage, we are delighted to create a unique opportunity by partnering with Le Clos to offer three Balthazars to the world’s most discerning wine buyers. Château Margaux’s history stretches back over 400 years, during which the estate has produced some of the world’s best wines time and again. The Château Margaux 2009 vintage is one of the Ànest we have ever produced, hence why we chose to bottle it in this magniÀcent format,” Paul Pontellier, chief winemaker and managing director of Château Margaux said in a statement issued by Le Clos. Priced at $195,000, the bottles are reported to be the most expensive ever sold, while the price tag also includes a Àrst class ticket to France to visit the Château Margaux estate.

UK sandwich chain eyes ME market

DUBAI: Baguette Express, a leading sandwich chain network in the UK, plans to open its outlets in the Middle East as part of its global expansion plans. The UK franchise success story is now seeking international master franchise and area developer partners to take its awardwinning business global, said a senior ofÀcial. The baguette and sandwich chain network, which has around 50 stores in the UK and which has recently opened in Republic of Ireland and Dubai, is looking for master licensees and area developers in the Middle East.

big -tionary Describing business WHUPLQRORJ\

32

FRAUD

Act or course of deception, an intentional concealment, omission, or perversion of truth, to (1) gainunlawful or unfair advantage, (2) induce another to part with some valuable item or surrender a legalright, RU  LQÀLFWLQMXU\LQVRPHPDQQHU

NOVEMBER / DECEMBER 2013

UAE Citizens Might Not Require Schengen Visa BRUSSELS: The Civil Liberties Committee at the European Parliament (EP) has unanimously endorsed a proposal to add the UAE to the list of countries whose nationals are exempt from the Schengen visa requirements. UAE Ambassador to the European Union Sulaiman Al Mazrouei described the EP’s move as an achievement for the UAE diplomacy and a reÁection of the country’s strong ties with the EU.

Email your business news to big@maxmediaco.com

“If implemented, the Schengen visa waiver would ease travel of the UAE citizens to the Schengen states. The UAE would be the first Arab country whose citizens are exempt from Schengen visa,” said Al Mazrouei. “Today’s vote is a huge step towards Ànalizing legislative requirements and moving to negotiations and subsequent waiver implementation,” he added.


NEWS

ERP WINS CERTIFICATION FROM WINDOWS

The new version of AlAmthalâ&#x20AC;&#x2122;s Optimum ERP system (Version 11.0) has gained Windows Server 2012 CertiĂ&#x20AC;cation by Microsoft in September 2013, which makes it the Ă&#x20AC;rst Middle Eastern developed ERP of its kind to become certiĂ&#x20AC;ed for Window Server 2012. The Amthal Group, a Bahrain based technology and information services provider with ofĂ&#x20AC;ces in Bahrain, Saudi Arabia, Qatar and Oman, announced that its new version of Optimum ERP product (Version 11.0) has received the Microsoft CertiĂ&#x20AC;cation for Windows Server 2012, making it the Ă&#x20AC;rst Middle Eastern developed product of its kind to receive the latest Microsoft server certiĂ&#x20AC;cation. The Microsoft Server 2012 certiĂ&#x20AC;cation demonstrates that the OPTIMUM ERP (Version 11.0) solutions meets Microsoftâ&#x20AC;&#x2122;s highest technical bar for Windows fundamentals and platform compatibility.

CALZEDONIA OPENS IN BAHRAIN BAHRAIN: Prominent Italian

fashion brand Calzedonia recently hosted a fun event to mark the opening of its new boutique at Bahrainâ&#x20AC;&#x2122;s Seef Mall. The event was held under the patronage of the Italian Ambassador, Alberto Vecchi and his wife, Romina as well as Lebanese Ambassador, Ibrahim Assaf. Also in attendance were Azadea partners Jawad Al Hawaj and Abdulwahab Al Hawaj.

Vapiano Introduces Specials BAHRAIN: To celebrate the launch of Vapianoâ&#x20AC;&#x2122;s

BAHRAIN CHAMBER APPOINTS CEO Bahrain Chamber for Dispute Resolution board of trustees has appointed Professor Naseeb Ziyadah as the chamber â&#x20AC;&#x2122;s chief executive. Prof Ziyadah holds both Lebanese and Chilean nationalities and has more than 15 yearsâ&#x20AC;&#x2122; experience in international legal procedures, management and international court development.

new seasonal specials menu, Vapiano organized an exclusive press event at Vapiano on the Ă&#x20AC;rst Ă oor of Bahrain City Centre. The event included a behindthe-scenes tour of the Vapiano kitchen, along

big -tionary Describing business WHUPLQRORJ\

34

NOVEMBER / DECEMBER 2013

with a live cooking demonstration of the specials. Distinguished members of the press were invited to experience the specials by adding the toppings and garnishes of the dishes themselves. After adding their own twist, they tasted the specials.

MUTUAL FUND $QLQYHVWPHQWYHKLFOHPDQDJHGE\ÂżQDQFHSURIHVVLRQDOVWKDWUDLVHVFDSLWDO E\VHOOLQJVKDUHV FDOOHGXQLWV LQDFKRVHQDQGEDODQFHGVHWRIVHFXULWLHV WRWKHSXEOLF$PXWXDOIXQGÂśVFDSLWDOLVLQYHVWHGLQDJURXS SRUWIROLR RI FRUSRUDWHVHFXULWLHVFRPPRGLWLHVRSWLRQVHWFWKDWPDWFKWKHIXQGÂśV REMHFWLYHVGHWDLOHGLQLWVSURVSHFWXV

Email your business news to big@maxmediaco.com


Offshore & Onshore Company Formation Since 1987 our worldwide network of ofďŹ ces have provided corporate structures for many thousands of discerning clients around the world.

Company incorporation and management Trust Services Personal and corporate tax planning

Call us now for an initial chat, free of obligation or charge: Nabil Khoury: +973 17 15 15 71, Wassim El Sayegh: +973 17 15 15 72 Sovereign Trust & Consultancy (Bahrain) W.L.L., 5th Floor GBCORP Tower, Bahrain Financial Harbour, Manama, The Kingdom Of Bahrain Bahrain@SovereignGroup.com

Succession planning Offshore banking Free Zone set up services Offshore credit cards Property holding structures Asset management Mutual fund set up and licensing Yacht registration Accounting Insurance Services

www.SovereignGroup.com Providers of Intelligent Offshore Tax Planning for 25 Years

Abu Dhabi, Bahamas, Bahrain, British Virgin Islands, China, Curaçao, Cyprus, Denmark, Dubai, Gibraltar, Guernsey, Hong Kong, Isle of Man, Malta, Mauritius, Portugal, Seychelles, Singapore, South Africa, Switzerland, The Netherlands, Turks & Caicos Islands, United Kingdom.

Trademark Registration & Franchise Services


NEWS

MERCURE TURNS FORTY

BAHRAIN: Mercure Grand Hotel Seef

celebrated a 40th anniversary of Mercure brand on the 21st of October. 746 French hotels named Mercure in 51 countries have launched the campaign of the brand 40th anniversary celebration with a series of gastronomic and cultural surprises including 40% discount for guests keen to enjoy local experiences. The campaign took place over the period of 40 days from September 16 to October 25. Surprises are different in every country. As a part of its 40th anniversary initiative, Mercure Grand Hotel Seef

organized a cocktail reception at the swimming pool on the top Ă oor of the hotel, in the presence of Mr. Jassim Al - Zayani the owner of Mercure Grand Hotel Seef. In respect that Mercure brand originated in Paris, France, HE Christian Testot Ambassador of France to the Kingdom of Bahrain took the event under his honorary patronage. Along with HE Christian Testot the reception witnessed the presence and participation of distinguished diplomats from various embassies, Media and Business representatives.

Ramee Grand Hotel & Spa Opens Doors BAHRAIN: The Minister of

Culture, Shaikha Mai bint Mohammed Al-Khalifa opened Ramee Grand Hotel & Spa in Seef. At a special ceremony. Acting Assistant-Undersecretary for Tourism Shaikh Khalid bin Humood Al-Khalifa attended the ceremony alongside diplomats, investors and journalists. Addressing the opening ceremony, she hailed the new hotel as an added value to Manama, Capital Arab Tourism 2013. The minister stressed the need to attract global tourism investments,

36

NOVEMBER / DECEMBER 2013

pointing out the important location of Ramee Grand Hotel & Spa. She expressed delight at choosing the Tree of Life as an emblem, which reĂ ects the genuine Bahraini environment of the new hotel. Ramee Grand Hotel & Spa General Manager Salvatore Romano thanked Culture Minister Shaikha Mai bint Mohammed Al-Khalifa for attending the inaugural ceremony. Faisal Ali also addressed the event on behalf of hoteliers wishing the new Ramee Grand Hotel & Spa success.

Email your business news to big@maxmediaco.com


BREAKDOWN OF NEWS AND NUMBERS FROM AROUND THE GLOBE

SNIPPETS Bahrain will open 10 new ambulance stations across the country to improve emergency response time, said a top government official.

Middle East has a billionaire population of 157 with a total wealth of $354 billion, according to the inaugural Wealth-X and UBS Billionaire Census 2013.

.$',

10 4.9% 157 60 49,000 141% Bahrain-based Investcorp has stated that it has acquired a group of offices and retail properties in the United States for $250 million.

The number of illegal expatriate workers in Bahrain, most of who come from India, Pakistan and Bangladesh, has reached 49,000, a senior government official said.

38

NOVEMBER / DECEMBER 2013

Dubaiâ&#x20AC;&#x2122;s economic growth accelerated in the first half of 2013 to 4.9 percent year-on-year, buoyed by strong expansion of trade and tourism, the governmentâ&#x20AC;&#x2122;s statistics department said.

Aluminium Bahrain (Alba) has launched a new batch of Vocational Training (VT) program. Organized in conjunction with Tamkeen, the program recruited 60 young Bahrainis - 20 secondary school graduates and 40 National Diploma holders - who will undergo a two-year training program in various aspects of Alba operations.

Bahraini retail and commercial bank BMI has reported a net profit of BD0.88 million ($2.34 million) for the first nine months, up 141 per cent compared to a net profit of $1 million last year.


Benvenuti a casa.

Tel. : 17 564444 - Fax : 17 564466 - email: phodecor@batelco.com.bh Seef district, facing Ritz Carlton Entrance - Palace Palms Bldg

follow us


AMCHAM BAHRAIN CELEBRATES GROWTH A reception was held to celebrate the new growth and goals of the American Chamber of Commerce in Bahrain at the home of Qays H. Zu’bi, President AmCham Bahrain.

A

mCham Bahrain, an independent, private, non-proÀt, non-political business association, was formed in 2006 to capitalize on the newly implemented Free Trade Agreement between the US and Bahrain with the purpose

40

NOVEMBER NOVEMBER // DECEMBER DECEMBER 2013 2013

to help companies take advantage of the new markets and beneÀts that came from this signiÀcant agreement. AmCham has been working ever since to promote trade, investment and goodwill between the United States of America and the Kingdom of Bahrain.


STAY FIT, HAVE FUN

AND BE HEALTHY

S

heraton Bahrain Hotel welcomes you to the new concept of total wellbeing at Sheraton Fitness. With state-of-the-art cardio machines, fully equipped gym, treatment rooms, sauna and steam room facilities for men and women, temperature controlled Jacuzzi and swimming pool, tennis court and aerobic studio combined with personalized service.

The fitness center facilities are first class, and the trainer is available at all times. Whatever your needs, be it a light work out to wake your body up in the morning or a weight loss regimen, Sheraton Fitness can customize a system that works just for you! Keeping in mind the culture of the land, Sheraton also offers a state of the art facility for women.

They also offer personal training, massage treatments for a complete relaxation and swimming lessons during summer. Staying Àt can be difÀcult, but with their Àrst-class Àtness center will make sure that you feel great whenever you train with them.

Membership Rates Membership

1 Month

3 Months

6 Months

1 Year

Single Membership

BHD 175

BHD 255

BHD 355

BHD 580

Couple Membership

BHD 235

BHD 350

BHD 470

BHD 820

Family Membership

BHD 285

BHD 440

BHD 560

BHD 870

(including 3 children below 15 years old)

NOVEMBER / DECEMBER 2013

41


CHALLENGES WHEN

GOING

PUBLIC

BFBA Hosts Seminar at Monthly Meeting

B

ahrain Family Business Association (BFBA) hosted their monthly meeting at the K Hotel. The keynote speaker for the evening was Mr. Rusell Taylor and he held a seminar on the topic, ‘Challenges Faced When Going Public’. During the events, BFBA President Mr. Khalid Mohammed Kanoo presented the update on the BFBA activities for the beneÀt of the members.

42

NOVEMBER / DECEMBER 2013


THE

DOMAIN HOSTS VIPS

T

he Domain Bahrain Hotel organized a special event for Ambassadors, Ministers, Chairmen and CEOs of corporates at their contemporary Japanese Restaurant and Lounge, Imari to mark its launch. On the menu were sizzling robata grill skewers, sudhi and sashimi, among others; all served in typical izakaya style.

44

NOVEMBER NOVEMBER // DECEMBER DECEMBER 2013 2013


UNDER THE PATRONAGE OF HIS ROYAL HIGHNESS

PRINCE KHALIFA BIN SALMAN AL KHALIFA PRIME MINISTER OF THE KINGDOM OF BAHRAIN

Chopard Haute-Joaillerie Collection: sapphire & diamond necklace

The 22nd Middle East Jewellery & IInternational In nt nt Watch Exhibition

19-23 November 2013 Bahrain International Exhibition & Convention Centre

Pre-register online at:

info@jewelleryarabia.com T: +973 17 550033

www.jewelleryarabia.com

‫اﻟﺸﺮﻛﺔ اﻟﺮ اﺋﺪة ﻟﻘﺒﻮل اﻟﺒﻄﺎﻗﺎت‬

‫ر اﻋﻲ ﻛﺒﺎر اﻟﺸﺨﺼﻴﺎت واﻟﺘﺴﺠﻴﻞ‬

Official Card Acquirer

VIP & Registration Sponsor


GERMAN BUSINESS

NETWORK RECEPTION HELD A

German Business Round Table hosted a business network reception in Elements Pool & Lounge at the InterContinental Regency Bahrain. The event was held under the patronage of H.E. Sabine Taufmann, Ambassador of the Federal Republic of Germany and sponsored by Siemens and RMA Middle East.

46

NOVEMBER / DECEMBER 2013

Key decision makers from various companies were invited to further build relationships. Dr. Bernd Hoefer from Siemens quoted that “We’ve got very positive feedback all the way and everyone found it was a very inspiring event at a great location. I was absolutely impressed by the dedication of your entire team.”


HRM SUMMIT 2013 ORGANIZED

H

Key Summit Brings HR Professionals From Across the Region

uman resources thought leaders from around the world converged in Bahrain for the Fifth Annual Human Resources Management (HRM) Summit 2013. Held under the patronage of Minister of State for Electricity and Water Affairs Dr Abdulhussain Mirza, the event was dedicated to specialized human capital

48

NOVEMBER / DECEMBER 2013

management, performance, retention and training needs of a fast-developing marketplace. Event organizer Roshcomm said HRM 2013 is the only integrated networking event focused on providing deep insights into human resources development and management life cycles, with particular emphasis on the application of international best practices tailored to the Middle East market.


NOVEMBER / DECEMBER 2013

49


BE DAZZLED! JEWELLERY ARABIA 2013

T

he 22nd edition of the Middle Eastâ&#x20AC;&#x2122;s premier jewellery and watch exhibition, Jewellery Arabia 2013, is set to take place from 19 to 23 November 2013 at the Bahrain International Exhibition and Convention Centre under the patronage of His Royal Highness Prince Khalifa bin Salman Al Khalifa the Prime Minister of the Kingdom of Bahrain. The exhibition has significant support from the Ministry of Industry and Commerce and the Bahrain Exhibition and Convention Authority.

50

NOVEMBER / DECEMBER 2013


This 5-day spectacular will feature over 600 exhibitors from 30 nations who will spread their precious wares across an area of 16,500 square metres. On display will be a huge range of Ànished jewellery, luxury timepieces, precious stones, antiques, objets d’art, jewellery packaging and technology from across the globe.

EXCITING NEW PARTICIPANTS Jewellery Arabia 2013 is set to be 10% bigger than the previous year’s exhibition and visitors can look forward to a number of new and exciting multi-national high-end participants. Jewellery Arabia 2013 will also witness the Àrst ofÀcial group participation from the United Kingdom, coordinated by British Allied Trades Federation (BATF), and Singapore, coordinated by the Singapore Association of Small & Medium Enterprises (ASME). NOVEMBER / DECEMBER 2013

51


Eminent jewellery houses will be making a return appearance at Jewellery Arabia 2013, including major brand names. Watches also continue to remain a prominent feature in the 2013 show. Visitors can Ànd the latest in design and manufacture from a vast range of important and innovative brands. Many of these high proÀle international jewellery and watch brands will use the exhibition as a platform to introduce exclusive collections and limited edition pieces to the Middle East collector’s market.

NATIONAL DELEGATIONS

Complementing these iconic brands are large national groups of retailers, designers and manufacturers from leading jewellery export countries. National groups at Jewellery Arabia 2013 include Brazil, Hong Kong, India, Malaysia, Singapore and the United Kingdom. 52

NOVEMBER / DECEMBER 2013

Collectively, these groups of companies reÁect the very best manufacturing capabilities, design expertise and gemmological resources that their respective countries have to offer. “Over the last 22 years, Jewellery Arabia has steadily evolved into the single most important jewellery and watch exhibition in the Middle East. Its reputation, size, quality of exhibits and sheer variety is unique in the region. The show is seen as an essential buying event for private collectors and the trade. Extraordinary designers choose Jewellery Arabia as their sole platform in the Middle East, whilst many more use the exhibition as an opportunity to showcase exclusive and new collections. We are looking forward in all conÀdence to yet another outstanding event,” said Arabian Exhibition Management’s Director of Sales and Marketing Fawzi Al Shehabi.


New Timings for 2013 Jewellery Arabia will open from 16.00 to 22.00 on Tuesday 19 November to Friday 22 November. On Saturday 23 November 2013 the exhibition will open from 12.00 to 22.00.

BIG NAMES FROM BAHRAIN

Joining international brands and national groups are and a host of independent companies from all over the world, led by a selection of Bahrain’s leading jewellers. Last year’s show attracted over 46,300 visitors. Of the total, 25% were drawn from the region’s single largest jewellery market - Saudi Arabia, with signiÀcant support also coming from Kuwait, Qatar, Oman, the United Arab Emirates and other neighbouring countries.

THE 9th MIDDLE EAST WATCHES, JEWELLERY AND PEN AWARDS Further highlighting the importance of Jewellery Arabia to the Middle East jewellery and watch industry, for the ninth successive year, the Middle East Premier Awards for Watches, Jewellery and

Pens will be held on the sidelines of the exhibition at the Ritz Carlton Hotel Bahrain on 19 November 2013. Hosted by MPP ME, publishers of the industry magazine title Arabian Watches and Jewellery (AWJ), the Awards are the culmination of an online public voting system and the analysis of an elite committee comprising of watch, jewellery and pen experts. Fostering cohesion amongst Jewellery Arabia participants whilst also acknowledging their individual contribution to the industry, the ceremony will be a star-studded event with the expected presence of specially invited dignitaries and senior professionals representing the international and regional watch, jewellery and pen industries. NOVEMBER / DECEMBER 2013

53


GLITZ, GLAMOUR &

INTRICATE

DESIGNS Getting Set for Jewellery Arabia 2013 The Arabian Exhibition Management is pulling all stops to ensure that the upcoming Jewellery Arabia 2013 Exhibition exceeds all expectations. We spoke to Arabian Exhibition Management CEO, Stephen Key to find out more. N_XkdX[\pflcXleZ_A\n\cc\ip 8iXY`X]fik_\m\ip]`ijkk`d\6

The very first Jewellery Arabia was held in 1992. Back then, the country was facing tough times. Recession was setting in. There were very few exhibitions and other such events. As always, we were looking to do something unique and interesting. Some of my team, including me, noticed that this region had a fascination with jewellery. There were a large number of outlets and women here loved to wear gold, diamonds and other gems. And we thought why not have something that caters to that market. There was no such exhibition in the entire region. As we started learning and researching more, we realized it could work. Soon after, one of the biggest jewellery exhibitions was happening in Switzerland. I decided to pay a visit to see if we would get any support. Not surprisingly, most of the market players I met with offered their backing and said they were looking for a way into the Middle East market, and so, albeit small scale, the first Jewellery Arabia Exhibition was held. 54

NOVEMBER / DECEMBER 2013

N_pj_flc[fe\m`j`kA\n\cc\ip 8iXY`X)'(*6

Over the last 22 years, Jewellery Arabia has steadily evolved into the single most important jewellery and watch exhibition in the Middle East. Its reputation, size, quality of exhibits and sheer variety is unique in the region. The show is seen as an essential buying event for private collectors and the trade. Incredible designers choose Jewellery Arabia as their sole platform in the Middle East, whilst many more use the exhibition as an opportunity to showcase exclusive and new collections. Jewellery Arabia has firmly established itself as the biggest and most prestigious jewellery exhibition in the Middle East; it provides international jewellery houses with direct access to trade buyers and private collectors from throughout this sector. We are looking forward in all confidence to yet another outstanding event.

?fndXepflkc\kjXi\gXik`Z`gXk`e^ k_`jp\Xi6 There are almost 600 companies participating this year, and they come from across thirty countries. We are definitely going to see some diverse and eclectic collections this year. It will be spread over an area of 16,500 square meters. On display will be a huge range of finished jewellery, luxury timepieces, precious stones, antiques, objet d’arts, jewellery packaging and technology from across the globe.

8i\k_\i\Xep`ek\ieXk`feXceXd\j gXik`Z`gXk`e^6 Every year since the first, we have had the opportunity to host big names in the Jewellery business. This year too is not different. We have with us Bulgari,

Mouwad, Chopard, Gaspari and Staurino Fratelli. Apart from these iconic brands, there will be contingents of retailers, designers and manufacturers from leading jewellery export countries. Delegations from countries like Brazil, Hong Kong, India, Malaysia, Singapore and the UK. Joining international brands and national groups are and a host of independent companies from all over the world, led by a selection of Bahrain’s leading jewelers. They include Bahrain Jewellery Centre, Asia Jewellers, Al Mahmood Pearls, Al Zain and Devji among others.

Gc\Xj\k\ccljjfd\k_`e^XYflkk_\ 0k_D`[[c\<XjkNXkZ_\j#A\n\cc\ip Xe[G\e8nXi[j% The Middle East Premier Awards for Watches, Jewellery and Pens will be returning for its 9th consecutive year. Hosted by MPP ME, publishers of the industry magazine title Arabian Watches and Jewellery (AWJ), the Awards are the culmination of an online public voting system and the analysis of an elite committee comprising of watch, jewellery and pen experts.

“There is a 10% increase in the number of exhibitors participating this year.”


:fdgXi\[kfcXjkp\Xi# _fndlZ_klieflkXi\pfl \og\Zk`e^k_`jp\Xi6

There is a 10% increase in the number of exhibitors participating this year. Last year’s show attracted over 46,300 visitors, 25% of this being from Saudi Arabia and we are positive that we will have a great turnout at this exhibition.

N_XkXi\k_\le`hl\Z_Xe^\j n\Ëccj\\k_`jp\Xi6 This year, one of the additions we have is the workshops, which are being held by the Gemological Institute of America. They will be doing seminars to help the participants understand their gems better; even the 4 Cs which govern a gem: color carat, clarity and cut. Experts will explain it further, thus allowing our visitors to make a judgment for themselves. The other change is in the timing of the exhibition. Jewellery Arabia will open from 16.00 to 22.00 on Tuesday 19 November to Friday 22 November. On Saturday 23 October the exhibition will open from 12.00 to 22.00. We have realied that the last day always sees a peak in the amount of business done, and decided to extend the working hours, to ensure that everyone gets the best deal.

:Xepflk\ccljXc`kkc\ XYflk8iXY`Xe<o_`Y`k`fe DXeX^\d\ek6

Arabian Exhibition Management is an affiliate of Allworld Exhibitions, which is under the umbrella of our worldwide representative office, Overseas Exhibition Services Ltd based in London. Since its inception in 1977 in Bahrain, Arabian Exhibition Management has successfully staged over 150 events and has managed to become one of the most well-known and respected organizers in the region. One of the biggest advantages we have is the fact that we have a worldwide network, thus allowing us to source resources required for any event. We can bring in both high quality suppliers as well as clientele.

N_Xk`jk_\e\okY`^k_`e^fe 8<DËjJZ_\[lc\6 After Jewellery Arabia, we will get in full gear to work on Autumn Fair, which will be held in January. NOVEMBER / DECEMBER 2013

55


THE DEVJI HERITAGE Since its establishment in 1950, Devji has been carving a niche for itself, creating L_X\PZP[LM\ZPVUQL^LSSLY`,]LY`WPLJL[OL`THRLPZÄ[MVYHWYPUJLZZ!PU[YPJH[L designs, studded with beautiful stones and workmanship of a superior kind. We speak to the Managing Director of Devji Aurum, Mr. Mahesh Devji[VÄUKV\[TVYL What is the inspiration behind setting up Devji Aurum?

Devji Aurum, the luxury brand draws inspiration from our founder and my father Late Shri Devji Ramji Sagar who infused high standards of excellence in everything he did. His meticulous eye to details from designing, crafting to customer satisfaction underpins the values that Devji Aurum stand for. It signiÀes an exclusive mix of passion, creativity and a constant quest to push beyond the limits of design and production.

We have a lot of clients asking us for ethnic fusion; where elements from the past are combined with the latest techniques and pattern to give a very different and distinctive look. What makes it more interesting and exciting is the fact that it is being done in different colors as well, like yellow, rose and white.

What are your thoughts on Bahrain’s growing jewellery industry?

What makes Devji Aurum different from other jewelry brands?

Every individual is unique, everyone is special and everyone is beautiful in their own way. We believe real happiness is found in being true to oneself. The Devji brands believe in enhancing an individual’s beauty and perception of self. Our brands are very similar in character. Our core principles: values of innovation, creative excellence, craftsmanship and integrity are the four pillars that deÀne Devji Aurum and form the basis of its existence. As for our jewels, each piece is a result of a journey among cultures and multi ethnic inÁuences. Most of our pieces are crafted with care and attention to detail by our own craftsmen right here in the Kingdom.

Who would you say is the ideal Devji Aurum customer?

The world is no longer what it was. It is fast-paced, demanding and technologically savvy. And our customers are those in the know. They travel and are educated and know and recognize the value of something beautiful. They understand artistry, splendor and elegance and are on thr constant lookout to acquire an object of timeless beauty. Devji Aurum is constantly setting the pace seeking to transcend the borders of innovation, exceeding customer’ expectations. Our R & D wing is aware and understands the customer’s thirst for excellence and leaves no stone unturned in meeting the keen eye for the desired craftsmanship.

Can you tell us something about the latest collection? In this day and age, there are endless possibilities. One of the key aspects to our latest collection is the blend of innovation and tradition. A collection that values our heritage and culture yet has the element of modern technology in the way it is designed and built. 56

NOVEMBER / DECEMBER 2013

come up with the concept. Our team of experts then get to designing the piece; they work out factors like the size, the color combination of the article, the number of layers it will require, among others. After that, it is up to our craftsmen to make the vision a reality. Depending on the item, it may take a week to three or four months for a team of Àve to Ànish the product, and Ànally its Ànishing and gleaming is done. Every step is done to meet the client’s tastes and perspective.

The Business has grown tremendously over the last few decades. Can you tell us about three of the most significant factors, which helped you get here?

All through the years, we have committedly worked towards building the vision of our founder, my father. And every step of the way, we ensure that we never compromised on our core values and principles. In fact, they were our guidelines and that has helped us grow stronger and better each day. Another aspect I would attribute to our success is that we truly believe customer is king and his or her wish is our command. Our priority has been and will be customer satisfaction. And most deÀnitely, we will not be where we are today if it was not for our team. We have a team of committed and hard working individuals, who are always looking or an opportunity to make the company better.

Can you tell us something about the process of picking the final pieces that are sold at the stores? Every piece that is designed and crafted is always done keeping the clients in mind. The piece should meet the expectations and aspirations of our client. Therefore the process starts with the client, then we

Bahrain has always been known as a place of hospitality and smiles. The people of this beautiful country are welcoming and they embrace the arrival of people from different cultures and backgrounds, thus making this a home to outsiders very quickly. It is also a country, which genuinely appreciates arts and crafts in any form. It is a land where a plethora of arts and crafts come together, and one where people have the freedom to express their creativity and talent in whichever way they choose. This unique characteristic has paved the way for the growth of the jewellery business, which at the end of the day, is another form of expression. I believe that going forward, we will see the development of all industries, including jewellery in this noble land.

What plans for the future?

We are deeply rooted in the social and cultural fabric of Arabia. We are proud and remain loyal to our beginnings– our Arabian connection - We have left no stone unturned with our state of the art design and manufacturing facility. It is our dream to take the brand forward and make it revered in the international market whilst not compromising in its principles and its value system.

Any advice for young Bahrainis who want to get into the jewellery business? Jewellery is all about passion, the will to succeed and the patience to make something beautiful out of a lump of a metal. For the youngsters, my advice would be to develop an eye for detail and excellence; Have passion and faith in the rich traditions of exquisite Bahraini Jewellery and success will reÁect in the happiness you get from every creation.


Heritage of Excellence NOVEMBER / DECEMBER 2013

57


OPENING

PANDORAâ&#x20AC;&#x2122;S BOX International Jewellery Chain Launches First Outlet in Bahrain

PANDORA designs, manufactures and markets hand-finished and modern jewellery made from genuine materials at affordable prices. It is sold in more than 70 countries on six continents through approximately 10,300 points of sale, including approximately 950 concept stores. And it is now available in Bahrain. We speak to Mrs. Suhair Al-Awadhi to find out more. 58

NOVEMBER / DECEMBER 2013


N_XkdX[\pfl cXleZ_GXe[fiX6

During my constant travels to Europe, my daughters, and I Àrst noticed Pandora and the admiration for this brand started then. The concept, the jewellery designs and the beautiful stores along with the worldwide brand success attracted our attention. We started researching the company and learned more about the Pandora story and the brand history, it’s a brand that grows on you. We became determined to bring this brand to Bahrain. We knew that this will Àt perfectly in Bahrain’s market and will be another Pandora success story. Pandora was launched in the Middle East (UAE) in late 2010 so we wanted to seize the opportunity and bring the brand to the women of Bahrain.

N_XkdXb\jGXe[fiX [`]]\i\ek]ifdfk_\i a\n\cipYiXe[j6

The Pandora design is very distinct and beautiful, but it is the concept, which really puts Pandora in a different league to other brands. The fact that women design the jewellery themselves combining different charms to create their own individual pieces, Àtting their style and telling their story. Pandora is a very personal brand, in addition to being very accessible jewellery. Pandora enables women to express their own style, to tell her story through her jewellery selection and they way she wears them. Jewellery, which let women express their story and individuality, which is a beautiful idea.

N_fnflc[pfl jXp`jk_\`[\Xc GXe[fiXZljkfd\i6

With the variety in the range of Pandora jewellery as well as the bracelet & charms selections, all women have their stories to tell, express who they are and Àt their style, any time of the day and any occasion.

“PANDORA ENABLES WOMEN TO EXPRESS THEIR OWN STYLE, TO TELL HER STORY THROUGH HER JEWELLERY SELECTION AND THEY WAY SHE WEARS THEM.” :Xepflk\cclj jfd\k_`e^XYflkk_\ cXk\jkZfcc\Zk`fe6

The latest collection is the fall and winter collection. A celebration of winter – cool, crisp and clean – the collection invites inside the magic of the season. The reÁective sheen of polished metals lights up a new spell of glamour. Sparkling pavé set stones on rings, earrings and charms add a bold splash of colour, and shine brightly in the cool air. The transient beauty of ice crystals and snowÁakes are captured in crystal blue hued Murano glass earrings and pavé set charms. And playful animal print melds with deep purple to lend on-trend reÀnement to the season.

?fnZXeZljkfd\ij]`e[ flkdfi\XYflkpfl6

Our well-trained staff in the Pandora store in Bahrain City Centre is always happy to explain the concept and story behind the brand, and of course ready to help customers picking charms, building and designing their bracelets, stacking their rings and combining the necklaces and earrings. In the very near future the ofÀcial Pandora website for Bahrain will also be active for women to go and explore the jewellery, new collections and concept.

N_XkgcXej]fi k_\]lkli\6

We are looking forward to expanding the brand presence in Bahrain and getting the wonderful jewellery and concept out to the women of Bahrain. With the global and particularly Middle Eastern accomplishments of Pandora, we have seen great precedence for what can be done with the brand, and I am sure that with our passion and drive it will be a great success in Bahrain as well.

NOVEMBER / DECEMBER 2013

59


Since 1860, leading Swiss brand Chopard has been manufacturing spectacular watches and jewellery. Here’s a glimpse of what you can expect at Jewellery Arabia 2013.

Ð

CALIBER USB 01.01-L HAPPY SPORT MEDIUM AUTOMATIC &ŽƌϮϬLJĞĂƌƐ͕ƚŚĞ,ĂƉƉLJ^ƉŽƌƚ ǁĂƚĐŚĞƐďLJŚŽƉĂƌĚŚĂǀĞ been appealing to devotees of ĐŽŶƚĞŵƉŽƌĂƌLJ͕ĚĂƌŝŶŐ͕ĂŶĚƐƵďƚůLJ ƵŶĐŽŶǀĞŶƟŽŶĂůƟŵĞƉŝĞĐĞƐ͘dŽ ŵĂƌŬƚŚŝƐũƵďŝůĞĞLJĞĂƌ͕ƚŚĞŝĐŽŶŝĐ ĐŽůůĞĐƟŽŶǁĞůĐŽŵĞƐĂŵĞĐŚĂŶŝĐĂů ŝŶƚĞƌƉƌĞƚĂƟŽŶŝŶƚŚĞƐŚĂƉĞŽĨƚŚĞ ŶĞǁ,ĂƉƉLJ^ƉŽƌƚDĞĚŝƵŵƵƚŽŵĂƟĐ͘

Ð

Machined from brass, circular-grained, engraved, gilded, rhodium plated and ĮŶĂůůLJĂƐƐĞŵďůĞĚǁŝƚŚƐĐƌĞǁƐĨĞĂƚƵƌŝŶŐ ƉŽůŝƐŚĞĚŚĞĂĚƐŝŶŚĂƌŵŽŶLJǁŝƚŚƚŚĞ ĂĞƐƚŚĞƟĐĐƌŝƚĞƌŝĂŽĨƚŚĞWŽŝŶĕŽŶĚĞ 'ĞŶğǀĞƋƵĂůŝƚLJŚĂůůŵĂƌŬ͕ƚŚĞďŽĚLJŽĨ ƚŚŝƐƵŶƵƐƵĂůh^ĚĞǀŝĐĞ͕ŶŝĐŬŶĂŵĞĚ “Caliber USB 01.01-L” has been produced ŝŶƚŚĞŚŽƉĂƌĚǁŽƌŬƐŚŽƉƐũƵƐƚĂƐǁĂƚĐŚ ƉůĂƚĞƐŽƌďƌŝĚŐĞƐǁŽƵůĚďĞ͘/ƐƐƵĞĚŝŶĂ 2,000-piece numbered limited series, ƚŚŝƐƉƌĞĐŝŽƵƐŽďũĞĐƚʹĂŶŽĚƚŽŚŽƉĂƌĚ͛Ɛ ĞdžƉĞƌƟƐĞĂŶĚǁĂƚĐŚŵĂŬŝŶŐƚƌĂĚŝƟŽŶƐʹ ŚĂƐĂŶϴ'ŵĞŵŽƌLJ͕ŵĞĂƐƵƌĞƐϯϵŵŵŝŶ ĚŝĂŵĞƚĞƌĂŶĚϭϬŵŵŝŶƚŚŝĐŬŶĞƐƐ͘

MILLE MIGLIA &ŽƌƚŚĞƉĂƐƚϮϱLJĞĂƌƐ͕ŚŽƉĂƌĚŚĂƐ ĨĂŝƚŚĨƵůůLJƉĂƌƚŶĞƌĞĚƚŚĞDŝůůĞDŝŐůŝĂƌĂĐĞ͘ dŚŝƐĐŽŶƐƚĂŶĐLJƚĞƐƟĮĞƐƚŽƚŚĞĐůŽƐĞƟĞƐ ďĞƚǁĞĞŶƚŚĞ'ĞŶĞǀĂͲďĂƐĞĚ,ŽƵƐĞĂŶĚ ƚŚĞǁŽƌůĚŽĨŵŽƚŽƌƐƉŽƌƚƐ͘dŚĞĞŶƟƌĞůLJ ƌĞĚĞƐŝŐŶĞĚ'DdĐŚƌŽŶŽŐƌĂƉŚĐĞůĞďƌĂƟŶŐ ƚŚĞϮϬϭϯĞĚŝƟŽŶŽĨ͞ůĂĐŽƌƐĂƉŝƶďĞůůĞĚĞů mondo” is a nod to the design of historical ƌĂĐŝŶŐĐĂƌƐ͘ƌŐŽŶŽŵŝĐ͕ĨƵŶĐƟŽŶĂůĂŶĚ ƐŽƉŚŝƐƟĐĂƚĞĚ͕ƚŚĞDŝůůĞDŝŐůŝĂϮϬϭϯŝƐĂ ůŝŵŝƚĞĚĞĚŝƟŽŶƚŚĂƚŚĂƐƌĂĐŝŶŐŝŶŝƚƐŐĞŶĞƐ and in its gear trains.

Ð

SUPERFAST dŚĞůĂƐƐŝĐZĂĐŝŶŐĐŽůůĞĐƟŽŶ͕ ĞŶĐŽŵƉĂƐƐŝŶŐŵŽĚĞůƐŝŶƐƉŝƌĞĚďLJƚŚĞ ǁŽƌůĚŽĨĐĂƌƌĂĐŝŶŐ͕ŝƐŶŽǁĞŶƌŝĐŚĞĚǁŝƚŚ ƚŚƌĞĞƐƵƉĞƌůĂƟǀĞǁĂƚĐŚĞƐŚĞƌĂůĚŝŶŐ ĂŶĞǁĞƌĂĨŽƌŚŽƉĂƌĚ͘dŚĞ^ƵƉĞƌĨĂƐƚ ƵƚŽŵĂƟĐ͕^ƵƉĞƌĨĂƐƚWŽǁĞƌŽŶƚƌŽů and Superfast Chrono are indeed the ĮƌƐƚǁĂƚĐŚĞƐŝŶƚŚŝƐŝĐŽŶŝĐĐŽůůĞĐƟŽŶƚŽ ďĞĞƋƵŝƉƉĞĚǁŝƚŚŚŽƉĂƌĚŵŽǀĞŵĞŶƚƐ ĞŶƟƌĞůLJĚĞƐŝŐŶĞĚ͕ĚĞǀĞůŽƉĞĚĂŶĚ assembled in-house, in the Fleurier ďĂƵĐŚĞƐǁŽƌŬƐŚŽƉƐ͘

60

NOVEMBER / DECEMBER 2013


Ð

FOR YOU tŚĂƚŝĨůŽǀĞŚĂĚƚŚĞƉŽǁĞƌƚŽƉƌŽƚĞĐƚ ĂůŽǀĞĚŽŶĞ͍dŚĞ,ŽƵƐĞŽĨŚŽƉĂƌĚ ŝŶƚƌŽĚƵĐĞƐĂŶĞǁ,ĂƵƚĞ:ŽĂŝůůĞƌŝĞĐŽůůĞĐƟŽŶ named For You and composed of talisman ũĞǁĞůůĞƌLJĂĚŽƌŶĞĚǁŝƚŚƉƌĞĐŝŽƵƐƐƚŽŶĞƐ ŝŶƚĞŶĚĞĚƚŽďƌŝŶŐŐŽŽĚůƵĐŬ͘džƉůŽƌŝŶŐ ƚŚĞǁŽƌůĚŽĨĞŵŽƟŽŶƐ͕ĞdžƉƌĞƐƐŝŶŐƚŚĞŝƌ ŝŶƚĞŶƐŝƚLJĂŶĚĐŽŶǀĞLJŝŶŐƚŚĞŝƌŵĞƐƐĂŐĞ͗ ŐĞŵƐĂƌĞŝŶƟŵĂƚĞůLJďŽƵŶĚǁŝƚŚƉĂƐƐŝŽŶĂƚĞ ĨĞĞůŝŶŐƐʹĂƚŚĞŵĞƚŚĂƚĨƌĞƋƵĞŶƚůLJ ŝŶƐƉŝƌĞƐŚŽƉĂƌĚĐƌĞĂƟŽŶƐ͘dŚĞŶĞǁ&Žƌ zŽƵĐŽůůĞĐƟŽŶĞŶƚĞƌƐĂƚĞƌƌŝƚŽƌLJǁŚĞƌĞ ũĞǁĞůůĞƌLJƐƚĂŶĚƐĂƐĂƉůĞĚŐĞŽĨƉĂƐƐŝŽŶĂƐ ǁĞůůĂƐĂĨĂǀŽƵƌĂďůĞŽŵĞŶ͘

Ð

HAPPY DIAMONDS Once upon a time there ǁĂƐĂŶŝĐŽŶŝĐĐŽůůĞĐƚŝŽŶ͕ ,ĂƉƉLJŝĂŵŽŶĚƐ͕ƚŚĂƚŐĂǀĞ diamonds a unique space ŝŶǁŚŝĐŚƚŽƐŚŝŶĞŝŶĂůůƚŚĞŝƌ ĚĂnjnjůŝŶŐƌĂĚŝĂŶĐĞ͘/ƚƉĂǀĞĚƚŚĞ ǁĂLJĨŽƌƐƉĂƌŬůŝŶŐĂŶĚƉŽĞƚŝĐ ĐƌĞĂƚŝǀŝƚLJʹĂƐĞůŽƋƵĞŶƚůLJ ƚĞƐƚŝĨŝĞĚďLJƚŚŝƐŶĞǁũĞǁĞůůĞƌLJ interpretation composing a tribute to infinite love. With its three hearts and three diamonds, each representing time past, present and ĨƵƚƵƌĞ͕ƚŚĞŶĞǁ,ĂƉƉLJ ŝĂŵŽŶĚƐĐŽůůĞĐƚŝŽŶĐŽŶǀĞLJƐ the promise that life has no restriction or limit on feelings.

NOVEMBER / DECEMBER 2013

61


Swiss luxury watchmaker Patek Philippe to offer their latest at Jewellery Arabia 2013.

Ð

CALATRAVA For decades, the Calatrava – the prototype of the classic round wristwatch, ŝŶĐůƵĚŝŶŐŝƚƐKĸĐĞƌ͛ƐͲƐƚLJůĞ ǀĂƌŝĂƟŽŶƐǁŝƚŚĚƵƐƚĐŽǀĞƌƐ over the case back – has ranked among the most ŝĐŽŶŝĐĐƌĞĂƟŽŶƐŽĨWĂƚĞŬ WŚŝůŝƉƉĞ͘hŶŝƟŶŐƚŚĞŬĞLJ ĐŚĂƌĂĐƚĞƌŝƐƟĐƐŽĨƚŚŝƐǁĂƚĐŚ family, the new Calatrava ZĞĨ͘ϱϮϮϳŶŽǁĨĞĂƚƵƌĞƐĂ display back protected with ĂƐĞƉĂƌĂƚĞĚƵƐƚĐŽǀĞƌ͘dŚĞ ƐƉĞĐŝĂůƚǁŝƐƚ͗dŚĞĞŶƟƌĞ hinge is on the inside of the cover, making it invisible ĞǀĞŶƚŽƚŚĞĐŽŶŶŽŝƐƐĞƵƌ͘ ƚWĂƚĞŬWŚŝůŝƉƉĞ͕ ĚĞƐŝŐŶŝŶŐĂŶĚĐƌĂŌŝŶŐ cases has always been just as important as caliber engineering, which for most people is the essence ŽĨǁĂƚĐŚŵĂŬŝŶŐ͘^ŽŝƚŝƐ not surprising that the manufacture has had its own casemaking department for decades and masters all disciplines in this domain

62

ĨƌŽŵƚŚĞǀĞƌLJĮƌƐƚƐŬĞƚĐŚĞƐƚŽ ƚŚĞŇĂǁůĞƐƐůLJƉŽůŝƐŚĞĚĐĂƐĞƐ͕ ŝŶĐůƵĚŝŶŐƚŚĞĚŝĂŵŽŶĚͲƐĞƚ ǀĞƌƐŝŽŶƐ͘dŚĞĐĂƐĞďůĂŶŬƐ ʹƐŽůŝĚŐŽůĚ͕ƉůĂƟŶƵŵ͕Žƌ ƐƚĂŝŶůĞƐƐƐƚĞĞůʹĂƌĞĐƌĂŌĞĚ ǁŝƚŚƚƌĂĚŝƟŽŶĂůĐŽůĚͲĨŽƌŵŝŶŐ ƚĞĐŚŶŝƋƵĞƐŝŶŚŝŐŚͲƚŽŶŶĂŐĞ hydraulic presses using precision dies also made ŝŶͲŚŽƵƐĞ͘dŚĞĮŶĞŚŝŶŐĞƐ ŽĨƚŚĞĚƵƐƚĐŽǀĞƌƐĮƩĞĚƚŽ ƚŚĞĐŽǀĞƚĞĚKĸĐĞƌ͛ƐͲƐƚLJůĞ ǁĂƚĐŚĞƐĂƌĞĂůƐŽĐƌĂŌĞĚ in this department, partly ǁŝƚŚŚŝŐŚͲƚĞĐŚƉƌŽĚƵĐƟŽŶ resources, but mostly by hand, then adjusted to ĨƌĂĐƟŽŶƐŽĨĂŵŝůůŝŵĞƚĞƌĂŶĚ ĂƐƐĞŵďůĞĚƚŽƉĞƌĨĞĐƟŽŶ͘ ĐĐŽƌĚŝŶŐůLJ͕WĂƚĞŬWŚŝůŝƉƉĞ͛Ɛ ĐĂƐĞŵĂŬĞƌƐǁĞƌĞŵŽƟǀĂƚĞĚ by the assignment of designing a Calatrava case featuring a dust cover to be ĂƩĂĐŚĞĚƚŽƚŚĞƐĂƉƉŚŝƌĞͲ crystal case back of the watch with an invisible ŚŝŶŐĞ͘dŚĞLJŵĂƐƚĞƌĞĚƚŚĞ ƚĂƐŬǁŝƚŚďƌĂǀƵƌĂ͘

NOVEMBER / DECEMBER 2013


Watches from Officine Panerai are a natural blend of Italian Design, Swiss Technology and Passion for the Sea. Their latest offerings will be on show at Jewellery Arabia 2013.

Ð

RADIOMIR PLATINO Officine Panerai presents the Radiomir Platino – 47mm and Radiomir Oro Rosso – 47mm, two exquisite new Special Edition models inspired for the first time by a rare example of the Radiomir dating from the late 1930s.

OFFICINE PANERAI – BREVETTATO

ƚƚŚĞƐĂŵĞƟŵĞĂƐŝƚǁĂƐƐƵƉƉůLJŝŶŐƚŚĞ Italian Navy with watches designed for the underwater missions of its commandos, the Panerai store in Florence made a few examples of the Radiomir with a special ϭϮͲƐŝĚĞĚďĞnjĞů͕ĐĂƌƌLJŝŶŐƚŚĞŝŶƐĐƌŝƉƟŽŶ “OFFICINE PANERAI – BREVETTATO”. The ƉƌĞƐĞŶĐĞŽĨƚŚŝƐŝŶƐĐƌŝƉƟŽŶ͕ƌĞĨĞƌƌŝŶŐƚŽƚŚĞ patent of the luminous substance Radiomir which later gave its name to the watch itself, suggests that these models were not ĨŽƌƵƐĞŝŶǁĂƌƟŵĞŽƉĞƌĂƟŽŶƐďƵƚƌĂƚŚĞƌĨŽƌ ƉƌĞƐĞŶƚĂƟŽŶƚŽƚŚĞŵŝůŝƚĂƌLJĂƵƚŚŽƌŝƟĞƐǁŚŽ ǁĞƌĞƚĞƐƟŶŐƚŚĞŶĞǁŝŶƐƚƌƵŵĞŶƚƐ͘ The new Radiomir watches faithfully reproduce the 12-sided bezel of the historic models but the engraving appears only on the back, surrounding the sapphire window

through which the movement can be seen, as in the original model. The case reproduces ƚŚĞƚŚƌĞĞͲƉŝĞĐĞƐƚƌƵĐƚƵƌĞŽĨƚŚĞƟŵĞ͕ǁŝƚŚ the bezel and back screwed directly to the ĐĂƐĞďĂŶĚ͗ĂƚLJƉĞŽĨĐŽŶƐƚƌƵĐƟŽŶŵĂŬŝŶŐŝƚ quicker to assemble the watch and easier to replace internal components where ŶĞĐĞƐƐĂƌLJ͘DĂĚĞŽĨƉůĂƟŶƵŵŽƌƌĞĚŐŽůĚ͕ƚŚĞ ĐĂƐĞŚĂƐƐůĞŶĚĞƌǁŝƌĞůŽŽƉƐƚƌĂƉĂƩĂĐŚŵĞŶƚƐ that are removable for replacing the strap and the same diameter of 47 mm as the original examples. The vintage character of the watch is reinforced by its original spherical winding crown.

MAXIMUM CLARITY

As in every Panerai, the dial has a strong, clean design giving it the maximum clarity and legibility, aspects enhanced by the elegant contrast between the dark brown of the dial and the ecru of the luminous substance placed between the two superimposed discs forming the ƚƌĂĚŝƟŽŶĂůƐĂŶĚǁŝĐŚĐŽŶƐƚƌƵĐƟŽŶ͘dŚĞ dial is surrounded by the 12-sided bezel ǁŝƚŚďƌƵƐŚĞĚĮŶŝƐŚ͕ĐŽŶƚƌĂƐƟŶŐǁŝƚŚƚŚĞ polished case, and it is protected by a slightly cambered Plexiglas® crystal, as in the historic models. dŚĞƐŽƉŚŝƐƟĐĂƚĞĚKWyys//ĐĂůŝďƌĞŚĂƐ been built on a Minerva 16-17 base, a hand-wound movement strongly associated

ǁŝƚŚƚŚĞŚŝƐƚŽƌLJŽĨƚŚĞ&ůŽƌĞŶƟŶĞŵĂŬĞƌ͘ dŚĞƌĞůĂƟŽŶƐŚŝƉďĞƚǁĞĞŶWĂŶĞƌĂŝĂŶĚ Minerva certainly already existed in the 1920s, as is shown by an invoice of 1927 issued by the Orologeria Panerai store to ƚŚĞƌĐŚďŝƐŚŽƉƌŝĐŽĨ&ůŽƌĞŶĐĞƌĞůĂƟŶŐƚŽ the supply of two Minerva watches. The ĐŽůůĂďŽƌĂƟŽŶŚĂƐŝŶĐůƵĚĞĚŶŽƚŽŶůLJǁĂƚĐŚĞƐ ďƵƚĂůƐŽƟŵĞƌƐĨŽƌƟŵŝŶŐŵĞĐŚĂŶŝƐŵƐ used in torpedoes and other explosive ĚĞǀŝĐĞƐ͘dŚĞKWyys//ĐĂůŝďƌĞ͕ĂůƌĞĂĚLJƵƐĞĚ ďLJKĸĐŝŶĞWĂŶĞƌĂŝŝŶŽƚŚĞƌƌĂƌĞ^ƉĞĐŝĂů ĚŝƟŽŶƐŽŶĂĐĐŽƵŶƚŽĨŝƚƐŚŽƌŽůŽŐŝĐĂů quality, has a balance wheel with screws ŝŶƚŚĞƌŝŵĨŽƌĂĚũƵƐƟŶŐƚŚĞƌĂƚĞ͕ĂďĂůĂŶĐĞ spring with Phillips curve and a precision swan-neck regulator. With 18 jewels and ƐĐƌĞǁͲŝŶũĞǁĞůƐĞƫŶŐƐ͕ŝƚŚĂƐŶŝĐŬĞůͲƐŝůǀĞƌ ďƌŝĚŐĞƐǁŝƚŚĐƀƚĞƐĚĞ'ĞŶğǀĞĮŶŝƐŚĂŶĚĂ power reserve of 55 hours.

LIMITED EDITIONS

/ĚĞŶƟĮĞĚďLJƚŚĞƌĞĨĞƌĞŶĐĞWDϬϬϱϮϭĂŶĚ PAM00522 (engraved between the lugs), ƚŚĞŶĞǁZĂĚŝŽŵŝƌWůĂƟŶŽĂŶĚZĂĚŝŽŵŝƌKƌŽ ZŽƐƐŽĂƌĞďĞŝŶŐŵĂĚĞŝŶůŝŵŝƚĞĚĞĚŝƟŽŶƐŽĨ one hundred units each and are supplied with a brown alligator strap fastened by a folding clasp of white gold or red gold ƌĞƐƉĞĐƟǀĞůLJ͘/ŶƐƉŝƌĞĚďLJƚŚĞǁĂƚĞƌͲƌĞƐŝƐƚĂŶƚ originals, the new models are waterresistant to about 50 metres.

NOVEMBER / DECEMBER 2013

63


PANDORA designs, manufactures and markets hand-finished and modern jewellery made from genuine materials at affordable prices. A sneak peak at their collection for Jewellery Arabia 2013.

Ð

WINTER WONDERLAND The cool beauty of winter and the ĨĞƐƟǀĞĐŚĞĞƌŽĨŚƌŝƐƚŵĂƐĂƌĞŝŶƚĞƌƉƌĞƚĞĚ ŝŶWEKZ͛ƐŶĞǁĐŽůůĞĐƟŽŶŽĨ seasonal jewellery. ƐƚŚĞŵĞƌĐƵƌLJĚƌŽƉƐ͕WEKZůŽŽŬƐ ƚŽĂůůƚŚŝŶŐƐǁŝŶƚƌLJĂŶĚǁŽŶĚĞƌĨƵů͕ŝŶǀŝƟŶŐ ĨĂŵŝůLJĂŶĚĨƌŝĞŶĚƐƚŽƵŶŝƚĞŽǀĞƌĂĐŽůůĞĐƟŽŶ ŽĨŝŶĚƵůŐĞŶƚĂŶĚǁŚŝŵƐŝĐĂůũĞǁĞůůĞƌLJƚŚĂƚ ƉŽƌƚƌĂLJƐƚŚĞŵĂŐŝĐŽĨƚŚĞƐĞĂƐŽŶ͘&ŝůůĞĚ ǁŝƚŚĚĞůŝŐŚƞƵůĐŽŶƚƌĂƐƚƐ͕ƚŚĞŶĞǁƐĞĂƐŽŶ ĐŽůůĞĐƟŽŶŝƐĂĐĞůĞďƌĂƟŽŶŽĨƚŚĞďĞĂƵƚLJŽĨ winter. Lustrous gold and shining sterling ƐŝůǀĞƌĞŵďĞůůŝƐŚĞĚǁŝƚŚƐƉĂƌŬůŝŶŐƉĂǀĠƐĞƚ ƐƚŽŶĞƐŝůůƵŵŝŶĂƚĞƐĚĂƌŬĚĂLJƐĂŶĚŶŝŐŚƚƐ͕ĂŶĚ ƚŚĞĞƉŚĞŵĞƌĂůďĞĂƵƚLJŽĨŝĐĞĐƌLJƐƚĂůƐĂŶĚ ƐŶŽǁŇĂŬĞƐĂƌĞŝŵŵŽƌƚĂůŝƐĞĚŝŶĞĂƌƌŝŶŐƐ͕ ƉĞŶĚĂŶƚĂŶĚĐŚĂƌŵƐƚŚĂƚŚĂŶŐĚĞůŝĐĂƚĞůLJ ĨƌŽŵŐůĞĂŵŝŶŐŵĞƚĂůƐ͘^ƉĂƌŬůŝŶŐƉĂǀĠƐĞƚ ƐƚŽŶĞƐŝŶĚƌĂŵĂƟĐĐŽůŽƌƐĂĚĚĂĚŽƐĞŽĨ ŐůĂŵŽƵƌƚŽƚŚĞƉĂƌƚLJƐĞĂƐŽŶ͕ĂŶĚƚƌĂĚŝƟŽŶĂů LJƵůĞƟĚĞƐLJŵďŽůƐʹƐƚƌŝƉĞĚĐĂŶĚLJĐĂŶĞƐ͕ ŚƌŝƐƚŵĂƐďĞůůƐĂŶĚǁŽŽůĞŶŵŝƩĞŶĐŚĂƌŵƐʹ ĂƌĞũŽLJĨƵůĂĚĚŝƟŽŶƐƚŽƚŚĞŶĞǁĐŽůůĞĐƟŽŶ͘

64

NOVEMBER / DECEMBER 2013


Ð

ICE BLUE GLASS SS The faceted surface of Italian Murano glass ŝƐƐĐƵůƉƚĞĚŝŶƚŽƚĞĂƌĚƌŽƉƐŚĂƉĞĚĞĂƌƌŝŶŐƐ ĂŶĚƉĞŶĚĂŶƚƐƚŚĂƚĐĂƉƚƵƌĞƚŚĞĐŽŽůƐƉŝƌŝƚŽĨ ǁŝŶƚĞƌ͘>ŝŬĞĚƌŽƉůĞƚƐŽĨǁĂƚĞƌ͕ĨƌŽnjĞŶŝŶƚŚĞ ĐŽůĚǁŝŶƚĞƌǁĞĂƚŚĞƌ͕ƚŚĞƐĐƵůƉƚĞĚďůƵĞŐůĂƐƐ ŝƐƐƵƐƉĞŶĚĞĚĨƌŽŵƐƚĞƌůŝŶŐƐŝůǀĞƌĞĂƌƌŝŶŐ ŚŽŽŬƐĂŶĚƉŽůŝƐŚĞĚƐŝůǀĞƌƉĞŶĚĂŶƚůŽŽƉƐ͘ ^ŚŝŵŵĞƌŝŶŐƐŚĂĚĞƐŽĨŝĐĞďůƵĞĂƌĞƌĞŇĞĐƚĞĚ ŝŶƚŚĞĨĂĐĞƚĞĚƐƵƌĨĂĐĞŽĨƚŚĞŐůĂƐƐ͕ůĞŶĚŝŶŐ ĂůƵŵŝŶŽƵƐůŽŽŬƚŽLJŽƵƌƐĞĂƐŽŶĂůƐƚLJůĞ͘dŚĞ ƉƌĞƩLJŝĐĞĚŐĞŵũĞǁĞůůĞƌLJƌĞĨĞƌĞŶĐĞƐƚŚĞ ethereal beauty of winter and fashion’s ĐƵƌƌĞŶƚĨĂƐĐŝŶĂƟŽŶǁŝƚŚďůƵĞͲŚƵĞĚ ĞŵďĞůůŝƐŚŵĞŶƚĂŶĚĐƌLJƐƚĂůͲůŝŬĞŵĂƚĞƌŝĂůƐ͘

Ð dŚĞŵĂŐŝĐĂŶĚŵLJƐƚĞƌLJŽĨƉƵƌƉůĞŝƐĂǁŽŬĞŶ ŝŶWEKZ͛ƐŶĞǁƐĞĂƐŽŶƉĂǀĠũĞǁĞůůĞƌLJ͘ ƌĂŌĞĚĨƌŽŵƐƚĞƌůŝŶŐƐŝůǀĞƌ͕ĚƌĂŵĂƟĐƉƵƌƉůĞ ĐƵďŝĐnjŝƌĐŽŶŝĂƐƚŽŶĞƐĂƌĞƉĂǀĠƐĞƚďLJŚĂŶĚ ƚŽĞdžĂĐƟŶŐƐƚĂŶĚĂƌĚƐŽŶĐŚĂƌŵƐ͕ƌŝŶŐƐĂŶĚ ĞĂƌƌŝŶŐƐ͘^LJŵďŽůŝnjŝŶŐĂŇŽǁĞƌŽŶƚŚĞǀĞƌŐĞ ŽĨďůŽŽŵ͕ƚŚĞĞůĞŐĂŶƚĐŽĐŬƚĂŝůƌŝŶŐ͛ƐƐƚƵŶŶŝŶŐ ƉŽĚͲůŝŬĞĐĞŶƚĞƌƉŝĞĐĞĨĞĂƚƵƌĞƐϯϳŐůŝƩĞƌŝŶŐ ƉƵƌƉůĞƐƚŽŶĞƐ͘ƌŝŶŐŽĨƵŶĚƵůĂƟŶŐǁĂǀĞƐŽĨ ƐƚĞƌůŝŶŐƐŝůǀĞƌŝƐĞŵďĞůůŝƐŚĞĚǁŝƚŚϴĐůƵƐƚĞƌƐŽĨ ϴƉĂǀĠƐĞƚƉƵƌƉůĞĐƵďŝĐnjŝƌĐŽŶŝĂ͘ůĞŐĂŶƚƉĂǀĠ ƐƚƵĚĞĂƌƌŝŶŐƐŚŽůĚϭϰƉĂǀĠƐĞƚƐƚŽŶĞƐ͕ĂŶĚĂ ƐƚƵŶŶŝŶŐƐƚĞƌůŝŶŐƐŝůǀĞƌĐŚĂƌŵŝƐĚĞĐŽƌĂƚĞĚ ǁŝƚŚϵϰƐƉĂƌŬůŝŶŐƉƵƌƉůĞƐƚŽŶĞƐ͘WĞƌĨĞĐƚǁŽƌŶ ĂůŽŶĞŽƌƐƚĂĐŬĞĚ͕ƚŚĞŶĞǁƉƵƌƉůĞƉĂǀĠƌŝŶŐƐ showcase one of this season’s color stories ŽŶƚŚĞŝŶƚĞƌŶĂƟŽŶĂůĐĂƚǁĂůŬƐ͕ĂŶĚĐŚĂƌŵƐ ĂŶĚĞĂƌƌŝŶŐƐŽīĞƌĂƟŵĞůĞƐƐƐŽƉŚŝƐƟĐĂƟŽŶ ĂŶĚĂƚŽƵĐŚŽĨĚƌĂŵĂƟĐŐůĂŵŽƵƌƚŚĂƚŐŽĞƐ beyond seasonal trends.

Ð

MAJESTIC &+(&"&,É

GOLD PA,É CHARMS >ƵƐƚƌŽƵƐŐŽůĚŝƐƌĞǁŽƌŬĞĚƚŽƐŚŽǁĐĂƐĞĂ ƐƚƵŶŶŝŶŐŶĞǁƐĞĂƐŽŶƉĂǀĠĐŚĂƌŵĨƌŽŵ ƚŚĞƐĞĂƐŽŶ͛ƐŵŽƐƚƉŽƉƵůĂƌƉƌĞĐŝŽƵƐŵĞƚĂů͘ dŚĞůƵdžƵƌŝŽƵƐĂƉƉĞĂůŽĨŐŽůĚŝƐƐŚĂƉĞĚ ŝŶƚŽĂϭϰŬŐŽůĚĐŚĂƌŵĞŵďĞůůŝƐŚĞĚǁŝƚŚ ϵϰŚĂŶĚͲĮŶŝƐŚĞĚƉĂǀĠƐĞƚĐƵďŝĐnjŝƌĐŽŶŝĂ͘ dŚĞŵĞƚĂůůŝĐƐŚŝŶĞŽĨƚŚĞƉƌĞĐŝŽƵƐŵĞƚĂůŝƐ ƉĞƌĨĞĐƚůLJŽīƐĞƚďLJƚŚĞŝƌŝĚĞƐĐĞŶƚƐŚĞĞŶŽĨ ĐƵďŝĐnjŝƌĐŽŶŝĂƐƚŽŶĞƐ͕ĂĚĚŝŶŐĂǁĞůĐŽŵĞ ĚŽƐĞŽĨŐůĂŵŽƵƌƚŽƚŚĞǁŝŶƚĞƌƐĞĂƐŽŶ͘ dŚĞĚĂnjnjůŝŶŐĐŚĂƌŵƉĞƌĨĞĐƚůLJŝůůƵƐƚƌĂƚĞƐ WEKZ͛ƐůĞŐĂĐLJŽĨŚŝŐŚƋƵĂůŝƚLJ͕ĂīŽƌĚĂďůĞ ŚĂŶĚͲĮŶŝƐŚĞĚũĞǁĞůůĞƌLJĂŶĚŝƐĂŶŽŶͲƚƌĞŶĚ ĂĚĚŝƟŽŶƚŽLJŽƵƌďƌĂĐĞůĞƚ͘

NOVEMBER / DECEMBER 2013

65


Ð

Unmatchable exquisite jewellery is Devji Aurum’s promise. With their collection for Jewellery Arabia 2013, they definitely keep their word.

ELEGANT GANTLY VIIBRANT BRANT The smile of the blushing bride, the spark of a joyous new beginning, the beauty of trust and the magic of love. A bride deserves the best on her wedding day, ĂŶĚǁŝƚŚĞǀũŝƵƌƵŵ͛ƐƌŝĚĂůĐŽůůĞĐƟŽŶ͕ ƐŚĞĐĂŶŚĂǀĞƚŚĞĮŶĞƐƚũĞǁĞůůĞƌLJĂƐƐŚĞ

66

NOVEMBER / DECEMBER 2013

ƐĞƚƐŽīƚŽĞŵďƌĂĐĞŚĞƌĚƌĞĂŵ͘/ŶƚƌŝĐĂƚĞ ĐƌĂŌƐŵĂŶƐŚŝƉƵƐŝŶŐŐŽůĚ͕ĚŝĂŵŽŶĚƐ͕ rubies, sapphires, emeralds and other gemstones makes it an exquisite and ǀŝďƌĂŶƚĐŽůůĞĐƟŽŶ͘ For those looking for a splash of youthfulness, Devji Aurum offers delicate pieces set with colors like Emerald green and Ruby red. And for those who are looking for elegance and grandeur, Devji Aurum has distinctive collections

set in gold with precious gemstones like diamonds. Devji Aurum signifies an exclusive mix of passion, creativity and a constant quest to push beyond the limits of design and production. Our jewels are a mix of fantasy, intuition, creative exuberance and aesthetic sensitivity. Each piece is a result of a journey among cultures and multi ethnic influences, between echoes from the past and projections into the future.


Ð

NOVEMBER / DECEMBER 2013

67


An antique pocket watch, provided with a strap to wear on the wrist was the inspiration behind Gaga Milano’s first collection. For Jewellery Arabia 2013, they showcase their latest trends. GaGà Milano, a brand known for its brilliant ĐƌĞĂƟǀŝƚLJĂŶĚŶĂƚƵƌĂůĞůĞŐĂŶĐĞ͕ƐŚŽǁƐŝƚƐŶĞǁ ƉƌŽĚƵĐƚƐĂƚƚŚĞŐůŝƩĞƌŝŶŐĨĞƐƟǀĂůŝŶĂŚƌĂŝŶ͗ ͞:ĞǁĞůůĞƌLJƌĂďŝĂϮϬϭϯ͘͟ 'Ă'ăDŝůĂŶŽŝƐĂĐŽŵƉĂŶLJĨŽƵŶĚĞĚ ŝŶϮϬϬϰƚŚĂŶŬƐƚŽƚŚĞǀĞƌƐĂƟůĞĐƌĞĂƟǀŝƚLJ ŽĨZƵďĞŶdŽŵĞůůĂ͖ŝƚŽǁĞƐŝƚƐŶĂŵĞƚŽĂ ƉĂƌƟĐƵůĂƌǁĂLJŽĨůŝǀŝŶŐ͕ůŽŽŬŝŶŐĂƚĂŶĚĚĞĂůŝŶŐ ǁŝƚŚƚŚĞǁŽƌůĚ͘ ͞'ĂŐă͟ŝƐĂŶŽůĚͲĨĂƐŚŝŽŶĞĚĞdžƉƌĞƐƐŝŽŶ͕ ǀĞƌLJƉŽƉƵůĂƌŝŶƚŚĞ͚ϱϬƐ͕ƚŽĚĞĮŶĞĂŬŝŶĚ ŽĨŵĂŶŵŽƌĞƟŵĞůLJƚŚĂŶĞǀĞƌ͗ĞůĞŐĂŶƚďƵƚ ƋƵŝƌŬLJ͕ĐĂƌĞĨƵůĂďŽƵƚĨĂƐŚŝŽŶƚƌĞŶĚƐ͕ĂůǁĂLJƐ ƌĞǀŝƐĞĚǁŝƚŚŝƌŽŶLJĂŶĚĞůĞŐĂŶĐĞ͕ǁŝƚŚŽƵƚ ŶĞŐůĞĐƟŶŐĚĞƚĂŝůƐ͘ /ŶĂƐŚŽƌƚƟŵĞƚŚĞĐŽŵƉĂŶLJŚĂƐŐƌŽǁŶĂŶĚ ĚĞǀĞůŽƉĞĚƚŽŝŶƚĞƌŶĂƟŽŶĂůĂĐĐůĂŝŵ͕ŽƉĞŶŝŶŐ ƐƚŽƌĞƐŝŶƚŚĞŵŽƐƚĞdžĐůƵƐŝǀĞůŽĐĂƟŽŶƐŝŶ/ƚĂůLJ ĂŶĚĂƌŽƵŶĚƚŚĞǁŽƌůĚ͘'Ă'ăDŝůĂŶŽŚĂƐ ĂůƐŽŝŶĐƌĞĂƐĞĚŝƚƐƉƌĞƐƟŐĞƚŚƌŽƵŐŚĂƐƚƌŽŶŐ ĞdžƉĂŶƐŝŽŶŽĨƚŚĞŐůŽďĂůŵĂƌŬĞƚŝŶƵƌŽƉĞ͕ ƐŝĂ͕ĨƌŝĐĂĂŶĚŵĞƌŝĐĂ͘ dŚŝƐŚĂƐďĞĞŶĂǀĞƌLJŝŵƉŽƌƚĂŶƚĂŶĚ ƵŶĞdžƉĞĐƚĞĚƐƵĐĐĞƐƐ͕ǁŚŝĐŚŚĂƐůĞĚƚŽƉŽƐŝƟǀĞ ŶƵŵďĞƌƐĂŶĚďƵĚŐĞƚĂƌLJĚĂƚĂŐƌŽǁŝŶŐĞǀĞŶ ĚƵƌŝŶŐƚŚĞĞĐŽŶŽŵŝĐĚŽǁŶƚƵƌŶ͘ dŚĞŶĞǁǁĂƚĐŚĞƐƌĞƚĂŝŶƚŚĞďƌĂŶĚ͛Ɛ ĚŝƐƟŶŐƵŝƐŚŝŶŐĨĞĂƚƵƌĞƐ͕ƐƵĐŚĂƐƚŚĞĨŽŶĚŶĞƐƐ ĨŽƌĐŽůŽƌƐ͕ƚŚĞĐŽŶƐŝĚĞƌĂďůĞƐŝnjĞŽĨƚŚĞĐĂƐĞ ĂŶĚ͕ŶĂƚƵƌĂůůLJ͕ƚŚĞŝŵƉŽƌƚĂŶƚĐƌŽǁŶĂƚϭϮ͘

68

NOVEMBER / DECEMBER 2013


Ð

Ð

THIN 46MM

MANUAL 48MM

dŚĞĂďƐŽůƵƚĞŶŽǀĞůƚLJŝƐƌĞƉƌĞƐĞŶƚĞĚďLJ dŚŝŶϰϲŵŵǁŚŝĐŚƐŚŽǁƐĂϰϲŵŵƵůƚƌĂ ŇĂƚĐĂƐĞ͕ϳ͘ϱŵŵƚŚŝĐŬĂŶĚĐŽŶƚĂŝŶƐĂ ^ǁŝƐƐŵĂĚĞƋƵĂƌƚnjŵŽǀĞŵĞŶƚ͘dŚĞŝĐŽŶŝĐ ƐĐƌĞǁͲĚŽǁŶĐƌŽǁŶŝƐĂůǁĂLJƐĂƚϭϮ͕ďƵƚ ƚŚĞĚŝĂůĚŝīĞƌƐĨƌŽŵƚŚĞƵƐƵĂůĨŽƌŵĨŽƌ ƚŚĞƵŶƵƐƵĂůĚŝŐŝƚƐ͗ŝŶĨĂĐƚ͕ŶƵŵďĞƌƐϯ͕ϲ͕ ϵĂŶĚϭϮƐŚŽǁĂƐƚLJůŝnjĞĚĂŶĚƐŝŵƉůĞůŝŶĞ͕ ƌĞƚĂŝŶŝŶŐĂƐŝŐŶŝĮĐĂŶƚƐŝnjĞǁŚŝĐŚŐŝǀĞƐĂ ƉĂƌƟĐƵůĂƌĞůĞŐĂŶĐĞƚŽƚŚĞǁŚŽůĞŽďũĞĐƚ͘ dŚŝƐŵŽĚĞůŝƐĂǀĂŝůĂďůĞǁŝƚŚĐĂƐĞ ŵĂĚĞŽĨƐƚĞĞůŽƌŐŽůĚ͕ďŽƚŚǁŚŝƚĞŽƌ ƉŝŶŬ͕ĂƐǁĞůůĂƐďĞnjĞů͕ůƵŐƐĂŶĚĐƌŽǁŶ ĞŵďĞůůŝƐŚĞĚǁŝƚŚĚŝĂŵŽŶĚƐƉĂǀĠƚŚĂƚĐĂŶ ŝůůƵŵŝŶĂƚĞƚŚĞŐŽůĚǀĞƌƐŝŽŶƐ͘ǀĞŶƚŚĞĐŽŝƌ ǁĂƚĐŚƐƚƌĂƉƐĂƌĞƐƵŐŐĞƐƚĞĚŝŶƚƌĂĚŝƟŽŶĂů ĐŽůŽƌƐ͕ŝŶƐŚĂĚĞƐĐŽŵƉůŝŵĞŶƟŶŐƚŚĞĚŝĂůƐ ĨŽƌĂĮŶĂůĞīĞĐƚŽĨŐƌĞĂƚƌĞĮŶĞŵĞŶƚ͘

EĞǁĐŽůŽƌƐĨŽƌƚŚĞDĂŶƵĂůϰϴŵŵƚŽŽ͕ ŽĨǁŚŝĐŚĮǀĞƵŶƌĞůĞĂƐĞĚǀĞƌƐŝŽŶƐĂƌĞ ƐƵŐŐĞƐƚĞĚ͘dǁŽŽĨƚŚĞŵĂƌĞŐŽůĚƉůĂƚĞĚĂŶĚ ŚĂǀĞƚǁŽĚŝīĞƌĞŶƚĚŝĂůƐ͕ƚǁŽŵŽƌĞŚĂǀĞ ďĞnjĞůĂŶĚĐƌŽǁŶŵĂĚĞŝŶďůĂĐŬƉǀĚ͕ŽŶĞ ǁŝƚŚĂƐƚĞĞůĐĂƐĞĂŶĚƚŚĞŽƚŚĞƌŐŽůĚƉůĂƚĞĚ͖ ƚŚĞůĂƐƚŽŶĞĐŽŵƉůĞƚĞůLJŵĂĚĞďLJďůĂĐŬƉǀĚ͘

Ð

SLIM 46MM

Ð

ŶĞǁůŽŽŬĨŽƌƚŚĞ^ůŝŵϰϲŵŵůŝŶĞ͕ ǁŚĞƌĞƌĂďĂŶĚZŽŵĂŶŶƵŵďĞƌƐƐŚĂƌĞ ƚŚĞƐĂŵĞĚŝĂůƐƉĂĐĞŚĂƌŵŽŶŝŽƵƐůLJ͘dŚĞ ŵĞƐŚƐƚƌĂƉ͕ǁŝƚŚǁŚŝĐŚƚŚĞ^ůŝŵϰϲŵŵ ŚĂƐĂůǁĂLJƐďĞĞŶŽīĞƌĞĚƵŶƟůŶŽǁ͕ŐŝǀĞƐ ǁĂLJƚŽƚŚĞŇĞdžŝďŝůŝƚLJŽĨůĞĂƚŚĞƌƚŚĂƚŝƐ ĂǀĂŝůĂďůĞŝŶĚŝīĞƌĞŶƚĐŽůŽƌƐƚŽŐŝǀĞĂ ŵŽƌĞůŝǀĞůLJƚŽƵĐŚ͘

TOURBILLON TBR10 dŚĞŇĂŐƐŚŝƉŽĨŶĞǁ'Ă'ăDŝůĂŶŽ ƉƌŽĚƵĐƚƐŝƐĚĞĮŶŝƚĞůLJƚŚĞŚŝŐŚůLJ ĂŶƟĐŝƉĂƚĞĚdŽƵƌďŝůůŽŶdZϭϬ ǁŝƚŚŝƚƐ^ǁŝƐƐŵĂĚĞŵŽǀĞŵĞŶƚ ĂŶĚƉŽǁĞƌƌĞƐĞƌǀĞŽĨϱĚĂLJƐ͘dŚŝƐ ůŝŵŝƚĞĚĞĚŝƟŽŶŽĨϭϬƉŝĞĐĞƐ͕ŝƐŝŶ ŬĞĞƉŝŶŐǁŝƚŚĂůůƚŚĞƚLJƉŝĐĂůĐĂŶŽŶƐ ŽĨƚŚĞďƌĂŶĚ͗ƚŚĞĐĂƐĞƉŝŶŬŐŽůĚϭϴ Ŭƚ͘ǁŝƚŚƐƉĂƌŬůŝŶŐǁŚŝƚĞĚŝĂŵŽŶĚƐ ϭϱĐƚƐŝŶĂůůŝƚƐƉĂƌƚ͕ŝŶĐůƵĚŝŶŐƚŚĞ ĚŝĂů͛ƐƉĂǀğ͕ŝƐŚŝŐŚůŝŐŚƚĞĚďLJƚŚĞ ďůĂĐŬĐŽůŽƌŽĨƚŚĞůĂƩĞƌ͕ŝŶŶƵĂŶĐĞ ǁŝƚŚĂŶƵŶďĞůŝĞǀĂďůĞƐƚƌĂƉŽĨ ĐĂŽƵƚĐŚŽƵĐ͘ĚĞƚĂŝůƚŚĂƚƐƵƌĞůLJ ǁŽŶ͛ƚŐŽƵŶŶŽƟĐĞĚ͘

NOVEMBER / DECEMBER 2013

69


THE WINNING CAMPAIGN! Obai & Hill Brings the Latest in PR & Design

70

OCTOBER / NOVEMBER NOVEMBER / DECEMBER2013 2013


ENTREPRENEUR

O

ne of Bahrain’s youngest entrepreneurs, Wafa Obaidat, the Creative Director of Obai & Hill considers clients and employees as family, which means that the company is about more than just PR and design. Obai & Hill has built an outstanding reputation as a great agency run by the strongest women in the country! B.I.G spoke to Wafa to get more insight in to the startup journey and how Obai & Hill has grown to be what it is today.

What is Obai & Hill known for?

Obai and Hill is a design and PR agency based in Bahrain, which I started it back in 2010. We were in London and moved to Bahrain 3 years ago. It’s a woman-based agency so we have about six women working at the agency with the exception of one man who is an IT developer. Our unique selling point or what we’re recognized for is the fact that we solve our client’s problems creatively, sometimes coming out of our scope of work to cater for the clients.

Tell us about the start up journey.

In one word, it was quite exhausting. My first venture in 2009 was the Sketchbook Magazine, which is a digital publication that supported the local emerging scene. We managed to establish quite a big network in the UK and I started attracting clients who wanted my services as a creative director and an editor. So it got divided into an agency that provides services for clients as well. Apart from just being the Creative Director, I also had to serve as the complete director on some projects. Moving back

to Bahrain was a difficult but necessary step. I had a lot of clients in the region and I truly believed it worthwhile to move our base closer to them. But in the Kingdom itself, there was no demand for my services; add to it the bureaucracy and paperwork involved in launching a company; it was a really tough time. One of the facts that made it tougher for me was that I was doing it all on my own. I did not want any support from my family, and I did not want to take a loan from the bank. Slowly, one step at a time, I managed to get a few accounts and we were lucky to get rent-free space from Zaid Al Zoubi for a year. He really set the platform for me to work up my foundation and hire staff.

What are the background education/experiences that allowed you to set up such a business? I studied interior design at the Chelsea College of Arts and Design in the UK, and just being in the school was really inspiring. I got to meet filmmakers, artists and visual artists, designers on a daily basis. This really helped me become a well-rounded designer in a way. I got to meet all these different people at college and I think that allowed me start Sketchbook, which was a type of support for arts and designers. I also worked in Fashion while I was a student and I managed to develop skills in sales, PR and buying in design. I got a fantastic mentorship with a designer who I worked with at the time along with the Editor of Big Show magazine. After I graduated, I decided to start my own publication. Being in a design school in a good city like London, which is a design capital really helped as I had access to galleries, museums and the theatre.

What do you think sets Obai & Hill apart from the rest? Just like at the Sketchbook Magazine, I believe we have a very thorough approach to agency and publishing. We choose not to be intimidating;

we try to be friendly and accommodating. We offer great customer service and we look at our clients as a family. We undertake projects of clients who believe in our vision and want to take risks with us in the creative and PR field or services related to PR and design. We have a great work culture and even within our company, we look at each other as a family so it’s a much more emotional way of approaching business rather than a corporate direction.

What has been the most exciting moment so far?

There are too many to count. This year, we landed the Bahrain Flour Mill account. We’re very excited about the rebranding of such a great company and that itself was a huge highlight this year in terms of business. A huge milestone was just in developing the team we have; a great team of women under the agency. Another milestone was working on the Khaleejesque account and the Muneera Obaidli Account; developing the brands from scratch and helping them in the process.

What are some of the challenges that you face?

One of the challenges was coming to Bahrain, obtaining a CR, waiting a few months to get the registration, building up the company on my own, office space, you need to apply to get Tamkeen funding. It’s very tough but once you get the ball rolling, things move much faster. I’m very grateful to Zaid Al Zoubi, when he saw me struggling he offered me a free rent space for a year, which allowed me to save on my expenses, hire some great staff and land a few more clients to be able to afford the rent. I’m very grateful to him for mentoring me and helping me in the process.

Can you tell us about some of the more interesting campaigns that you have worked on?

Right now we’re about to launch a fantastic campaign with Burger Lounge, it’s called the local celebrity burger where we are getting local celebrities or

local entrepreneurs and putting them as the face of the brand. We ask them to design their own burger for Burger Lounge, which will be sold for one month. What’s exciting is it’s about collaboration; it’s the first time we are collaborating with such a large number of people in a virtual compound. It’s basically putting the entrepreneurs and people on the ground in Bahrain as the face of the brand. We don’t need to fly people from abroad; we just need to look at our local scene and at what’s happening here.

Has there been any recent event/ campaign that you wish Obai & Hill had a role to play in?

Right now I’m working on all the projects I want to work on and there isn’t anybody specific I’d like to work with. I do believe that if there is anything supporting the design and art local scene, we would love to be part of it. The agency loves to collaborate and support in any way we can, including any initiative that supports local entrepreneurs as well.

Any advice for young entrepreneurs?

Don’t suffer; I think that’s very important. A lot of people suffer in jobs they don’t want to work and hate and they only do what they love at night or weekends. They need to find what they love in life. Take the lead when you’re younger and follow your passion. If you want to think about what you want to do in life, then start testing and follow your principles. Don’t stay unhappy in a job you don’t like. I’m a big advocate of entrepreneurship and I’d pick that any day over an employee position especially if it’s something you don’t like.

What plans for the future?

To grow the company, to have more staff; we’re about to hire three more people. To expand to the UAE, to have offices there and write a book about tips on how to start a business and to share the story of the journey of the Agency’s start up just to share that knowledge with other people.

NOVEMBER OCTOBER / DECEMBER NOVEMBER 2013

71


THE MAKEUP MANUAL

Mai Almoayyed’s Mission To Bust Makeup Myths 72

OCTOBER / NOVEMBER NOVEMBER / DECEMBER2013 2013


ENTREPRENEUR

W

hen Mai AlMoayyed started her blog back in June 2011, the only purpose was to share her passion for make up and a few tricks and techniques. Over time and due to high demand, she started teaching classes. Little did she know that it would gain so much popularity that she would need to travel across the GCC taking classes and workshops on makeup techniques. We speak to her to find out more. What is THEMAKEUPMANUAL known for? The MAKEUPMANUAL is more about passion, than about the business aspect. I am very passionate about make up and I started blogging about some tricks and techniques on application, and managing the tools; the blog soon become a full fledged website where I would share my knowledge. Finally I started teaching classes, and thanks to the demand, I teach classes across the GCC. I think what brings people to me is the fact that I am brutally honest when it comes to anything make up related.

Tell us about your start up journey? I was a banker, with a makeup addiction. With the full time job, I was only able to give a little time to the classes and my blog. But I knew for sure that I had to give more time for my passion, so I quit banking and here I am. So far so good. The demand keeps me going. I have had two big workshops to start with, then I started teaching weekly ones. Now I travel to Dubai and other places to teach.

What sets THEMAKEUPMANUAL apart from the numerous make up gurus that are starting their classes? We have a lot of makeup gurus at the moment. But I do believe that I am very different. The way I explain in class (my teaching method) is very unique. My Instagram posts are creative. The major difference is that I tell my students the makeup secrets that many don’t reveal. All girls deserve to know secrets of how to become pros in their makeup. It is all about the quality of information and the quality of the service you provide to your students.

Can you tell us about your background experiences that allowed you to launch THEMAKEUPMANUAL as a business? I have a degree in business management and a Masters in finance. This really helps me from the business perspective of THEMAKEUPMANUAL . Also, I am a certified Make Up Artist - and I know the techniques of the different makeup brands out there. This helps me guide my students better.

“Creating a name and a reputation was the most challenging and it took me 2 years in the making to do it.”

How has the response been so far? It has been amazing! I’m really thankful for the great feedback and demand for my classes!

What has been the most exciting moment so far? I would say the Dubai classes. My classes there are huge- up to 80 students per class. The thrill of teaching a big group and in another country is fantastic!

What are the challenges that you face? As a makeup artist and teacher, I can’t say that I’m facing any challenges. But as a business - it is really challenging! Creating a name and a reputation was the most challenging and it took me 2 years in the making to do it.

Do you have any advice for young entrepreneurs? If you are passionate about something and have the guts and power to make a career out of it, you should go ahead with it and nothing must stop you. You will face obstacles and negativity, but you should just keep on going. You shouldn’t worry about financial obstacles, as there are many available options for startups. But to be successful you need to be 100% into it and put all the effort in as well. You will sacrifice your time and holidays for the success of your business. But it is worth it in the end.

What plans for the future? I am currently working on it! Just wait and see what I will unveil soon!

Do you have role models in the region? To be honest, I do look up to many amazing MUA’s and beauty teachers - but not in this region. NOVEMBER OCTOBER / DECEMBER NOVEMBER 2013

73


GET SET GO!

Training Bahrain’s Steffi Graff & Pete Sampras 74

NOVEMBER / DECEMBER 2013


ENTREPRENEUR

F

ounded by Joseph Henriques and Hussain Kadhem, the JC’s Tennis Academy aims to seek out, train, and nurture local and regional potential worldclass tennis players to compete on the international circuit in a themed concept. We speak to Joseph to find out more. What is JC’s Tennis Academy known for?

JC’s Tennis Academy is known for making a person, young or old, a little better at becoming an athlete of life each and every day.

What inspired you to set it up & when was it set up?

I think it takes more than a single moment to compel both Hussain and me to do something unusual and risky. For me, it was a series of things that compelled us to pursue opening our own Tennis Academy. Firstly, I was sick of seeing our children in the Kingdom losing faith in their athletic abilities and being told that there was really nothing anybody could do about it. Then there were the little happy moments I’d get, every now and again, when I saw our kids improving and taking our sport seriously; this melted our hearts and we knew then that we had to do something. After watching all the other parents have the same happy moments as us, we realized that the tennis academy was a chance for us to create a kind of place where we can put athletes together; especially those who really wanted to achieve. It’s something that I think we were yearning for and now we get to make it a reality for everyone else. JC’s, the world’s first themed tennis academy, was therefore born in the Kingdom of Bahrain on the 14th September 2011.

Take us through some of the highs and lows you have faced so far as entrepreneur.

I cannot really put my foot on it specifically, but first and foremost, we are on an emotional rollercoaster ride unlike anything we have ever experienced. If you do not have the right staff you flip rapidly from day-to-day; one day you are euphorically convinced you are going to own the world, to a day in which doom seems only months away. There is so much uncertainty and so much risk around practically everything you are doing; especially if our country has economical problems, which means less people. The level of stress that you’re under generally does magnify things to the incredible highs and unbelievable lows at whiplash speed. Sound like fun huh? But I would not have it any other way.

What about your own background experiences that enabled you to launch such a business.

I was born in Lambeth, London and attended school in Crawley in Sussex. Ever since I was a kid, I tinkered with all sports. It was my hobby, my passion, and my way of learning. Like most kids, I enjoyed competition and I always wanted to be the leader, the captain, the organizer. I did a paper round in the mornings before school so that I could buy my first tennis racquet; it took me almost a year. I then went on to teach myself the basics of the game of tennis. By the time I graduated from college in the States, I knew I wanted to teach for a living. From that point on, everything fell into place. My life revolved around tennis. By my senior year at Los Angeles Trade Tech, I decided I wanted to work for a major tennis academy to learn from the great man Nick Bollettieri in Florida. I hounded him until he agreed to take me on at the world’s most famous tennis academy. Now I felt I was ready to build my own academy.

I started at the Wimbledon Indoor tennis Center, nowhere near the leafy All England Club. It was a rundown white elephant of a place and I managed to turn it around. Then came Belfast, Northern Ireland, a place divided by years of sectarian violence between Catholics and Protestants. I was told an academy for members of both sects playing together would never work. But it did, successfully, giving me more experience in handling programming. Next up was Istanbul, Turkey. After two years working at a facility I realized once again that the city needed a tennis academy. Partnering with the WTA’s Teksilkent my academy was the home of the very first professional tournament for women. The academy took me to places I would never have experienced, back in the UK. I later helped Istanbul win the end of year masters featuring the top 8 players in the world. This then brought me to my spiritual home, Bahrain. Within weeks I was in love and inevitably with all the experience at my disposal, Hussain and I put together the JC’s Tennis Academy.

Is Bahrain a viable market for sports related ventures?

Already, Bahrain has demonstrated its global importance by hosting the Formula 1. Its tremendous success created demand from local Bahraini entrepreneurs to start their own businesses and we should be happy and glad to welcome them as our global ambassadors. So you can imagine if we had more sports related ventures. So my answer is yes, Bahrain is a viable sports related market and should relaunch itself as “ Sports Friendly Bahrain” instead of “Business Friendly Bahrain’. That said, we need the government and the corporate sector to get behind us to achieve this so that we can create more entrepreneurs and more global ambassadors.

“Bahrain is a viable sports related market and should relaunch itself as ‘Sports Friendly Bahrain’.” How has the response you have received been so far?

JC’s Tennis Academy was an instant hit, attracting droves of customers. We wanted to reinvent how tennis academies should be run.

Are you the only trainer at the institute? We currently have 8 trainers. I much prefer to call them teachers of the art of creating athletes for life, mentors and educators.

How can people find out more about you?

We have a great website www.jcstennis.com which has over 30,000 hits per month and a Facebook page with close to a 1000 followers. Our offices are at the Unisono Tower in Sanabis and the tennis academy is currently at Riffa Views.

Any advice for young entrepreneurs?

My advice for young entrepreneurs would be to follow through on a great idea. I think if you’ve got an idea, you just need to just give it a try and if you fall flat on your face, pick yourself up and try again. Learn from mistakes and remember, you’ve got to make a real difference in people’s lives if you’re really going to be successful.

Where do you see yourself in five years from now?

Five years from now I want JC’s, at its core, to become one of Bahrain’s much loved brands that will act as a conduit to successfully expand our vision through breathtaking programs, collectible fashions, and a great rock ‘n’ roll attitude to sport.

NOVEMBER / DECEMBER 2013

75


FROM CANVAS TO COVERS

How Fatema Majdi started her own Artwork Business 76

OCTOBER / NOVEMBER NOVEMBER / DECEMBER2013 2013


ENTREPRENEUR

F

atema Majdi, a 19-year-old interior design student has managed to turn her passion for art in to a creative business. She takes her paintings and illustrates them on to phone covers, designing a line of delightful and trendy accessories. What started out as a hobby, has now prospered in to a revenue of sales for this vibrant entrepreneur. Her paintings can also be bought separately. Here is her story. What is your business known for? I sell artistic and unique phone and tablet covers as well as paintings.

Tell us about the start up journey.

I’m actually in my second year in university in Malaysia, majoring in Bachelors of Arts in Interior Design in Limkokwing University of Creative Technology but my major is sponsored by an Australian university named Curtin. However, I’m having my training semester early and I decided to do it in my home country - Bahrain. While searching for a job I was spending all of my free time painting and that’s when it hit me that I want to start taking my art hobby more seriously. Thankfully my family was very supportive and as usual I also faced negative people, but it really depends on you if you let the negativity pull you down or make you work harder. I

worked harder and harder until I started to bloom in the industry of art. As soon as I decided to sell my paintings, I utilized Instagram for that purpose. Initially I started my business based on just selling paintings, but after a little while and a bit of research in this field I innovated the idea to print my paintings on phone covers as well as editing them and coming up with more graphic design ideas. Hence, everything that I do at the moment is enhanced by technology or effected by it.

What are the background education/ experiences that allowed you set up such a business? As a girl who just turned 19 years old I believe that I have had more experiences than I could have planned for. When I was 16 years old I worked in Gulf Pharmacy Co. to purchase my own camera with my own money. After purchasing it I went to two courses of photography and I ended up getting awarded a trophy from the School of Photography sponsored by Youth Society 2030. In addition to being a freelance photographer for local makeup artists and fashion designers, I was appointed head of yearbook photographers at the Modern Knowledge School - class of 2011-2012. These experiences along with a family that supports my hobbies hundred percent, have allowed me to gain trust in myself - that I can actually make it in the industry.

What do you think sets your business apart from the rest?

It’s something innovative and that is what the society now-a-days are looking for, the next new thing. Phone Covers are now treated as a part of the outfit so they have to be trendy and reflective of one’s style.

What has been the most exciting moment?

Making my family proud, earning my own money, knowing that people are carrying my art all around and now this interview made me realise where I stand and it makes me feel quite proud of myself.

What are some of the challenges that you face?

The first week I started selling only painted canvases, I had a lot of people interested in my art but not willing to purchase it. Having someone purchasing your art isn’t all about the money, it gives you a feeling that makes you feel people are appreciating your work enough to have it for themselves. Plus another major challenge are those negative people, the ones who tell you “you’re not good enough” or “ this will not last”. But I’m glad that I faced all those challenges, it only made me better so I am thankful.

What inspires you when you paint?

My feeling at that very moment, I paint what I feel. Usually, I paint right before I sleep, as in around midnight because that is when you are most in touch with your feelings.

Are there any artists in the region you admire?

There There are many. I’d hate to name them in case I forget some. Since I admire artists in every field of art. There is the traditional, abstract, animation, calligraphy and etc. I have the same equal respect for every single category and its artists.

Any advice for young entrepreneurs?

A lot of young entrepreneurs think they can’t make it due to perhaps, a clash with their education or work but in fact ideas such as this will only help enhance your experiences. All you need is passion, patience, innovating the idea and time management. Dream big and work harder.

What plans for the future?

I’m in the process of making a logo and an identity for my business. I am also expanding it to t-shirts, notebooks, handbag mirrors, keychains, mugs, fabric bags and many more accessories. I already have orders from customers all over the Gulf but I will have to drag my business to Malaysia as I will be returning to complete my studies. I am trying to get my sister interested enough to take over the business here so we can keep it going strong without losing momentum. I have already spotted Art Galleries in Malaysia too, who are willing to publish and sell my paintings. As for the future after my education; hoping one day to open my own interior design office where it will also have space for an Art Gallery.

NOVEMBER / DECEMBER 2013

77


THE CHERRY ON THE CAKE The entrepreneur behind Sarollina Sweets

78

OCTOBER / NOVEMBER NOVEMBER / DECEMBER2013 2013


ENTREPRENEUR

S

arollina Sweets, is better known as the Bahraini Instagram account with sensational cake designs. Sara is not only the entrepreneur behind the business but also makes the cakes by herself. Her orders are the perfect example of personal determination and dedication baked up, covered with cream and expressed with every slice. Whether it is cakes in the shape of cars, lipsticks, phones or handbags, Sarollina Sweets caters to any creative demand. We find out more. What is Sarollina Sweets known for? Our homemade sweets, cupcakes and cakes as well as our unique cake decorations have made Sarollina a popular name. I try and incorporate any and every creative idea that the client has into the final look of the cake.

Tell us about the start up journey. I launched my business three years ago. I have always enjoyed working with my hands and I wanted to launch a business, where I could put that to good use. I started

out making handicrafts; I practiced by shaping clay into different molds; unfortunately the idea was not successful. After that, I got into decorating hair accessories; but that idea was not successful either. Meanwhile, homemade cupcakes were becoming a rage in Bahrain. I liked the idea and wanted to give it a try. My close family supported me and I started making ordinary cupcakes with cream topping and I got a positive response. But as business grew my customers demanded cupcakes with intricate designs for different occasions. And that became the focus of my business. I kept going forward, learning and adapting.

What are the background education/ experiences that allowed you set up such a business? I did not have any previous experience or knowledge of the subject, except my gifted skills and my ambitions for it. Once I started, I enhanced my knowledge by reading books and searching the Internet. I got further practice from the continuous work on my orders.

What do you think sets Sarollina Sweets apart from the rest? Most importantly, I think it is the good relationship I have built with my clientele; they know that I will give them my utmost commitment and honesty in everything I do. I also think I have managed to carve a niche for myself in doing exquisite and highly artistic designs on the cakes, and selling them at a reasonable rate.

What has been the most exciting moment so far? Once I received an order from a woman in Saudi Arabia to make a cake for her birthday. She came all the way to Bahrain just to collect the cake. I was on top of the world, to have that kind of appreciation from outside our Kingdom.

What are some of the challenges that you face? We require a number of tools to carve out the fancy work on the cakes and a lot of those tools and instruments are not available in the Kingdom. I am forced to order them and have them shipped and that involves huge costs and a lot of time.

Do you have a team in place, to help you with the cakes? So far, it have been a one-woman show. I do all the shopping for raw materials, I mix the dough, I bake the cake and I do the frosting and designing as well. When I am swamped with orders, I pull in my closest ally and biggest critic, my mother, to help me out.

What are some of Sarollina Sweetâ&#x20AC;&#x2122;s popular cake orders? Well, we do a lot of themed birthday cakes. But we also cater to all kinds of occasions including weddings, graduations, engagements, baby showers, you name it...we do it.

Any advice for young entrepreneurs? Always work on something you are passionate about and something you have the skills for. Find out where the gap in the market is and cater to the needs of the customers. It is important that you start small, test the waters and then move on to bigger steps. And use all methods available to you to get the word out, and be willing to learn, evolve and adapt.

What plans for the future? I hope to set up my own little bakery someday. And ofcourse, to be known as the best patisserie in the region.

NOVEMBER OCTOBER / DECEMBER NOVEMBER 2013

79


TRIPLE

BOTTOM LINE

Why Sustainable Development Should Matter! 80

OCTOBER / NOVEMBER NOVEMBER / DECEMBER2013 2013


ENTREPRENEUR

T

here has never been a more ambitious partnership than this brother and sister duo. Leena and Tariq Al Olaimy are the founders of 3BL Associates; the first and only company that focuses on sustainability in Bahrain and the Mena region. 3BL or Triple Bottom Line helps other companies and entrepreneurs in setting up or improving their corporate social responsibility. In addition to this, they have participated in several global programs where they work on social entrepreneurship and youth innovation including the recent 2013 UNESCO Youth Forum, in which they secured the first place. B.I.G spoke to Leena and Tariq to get more insight. What is 3BL Associates known for? Leena: 3BL ‘Triple Bottom Line’ Associates is Bahrain’s first social impact consultancy and think-do-tank. Established in 2010 the company aims to further multi-stakeholder sustainable and regenerative development in the MENA region, using a systems approach. Most people that know of our work associate us with Corporate Social Responsibility (CSR), Sustainability and Social Entrepreneurship. However, our work spans the wider sustainable development agenda, which also includes issues like health, education, peace and climate change.

What does 3BL stand for and what’s the story behind the name? Tariq: ‘3BL’ stands for Triple Bottom Line, which is a term coined by British academic and corporate sustainability godfather, John Elkington. Essentially, unlike the traditional ‘bottom line’, which is profit; a triple bottom line posits that you must measure and perform at the intersection of Social Equity, Environmental Sustainability, and Economic Prosperity to achieve sustainable development. It’s also commonly known as the 3 P’s: People, Planet, Profit.

Why is sustainable development important in Bahrain?

Tariq: Sustainable development is a global issue. In the MENA region, some of our challenges include the highest carbon emissions per capita; lack of affordable housing; sectarianism and intolerance; education systems that teach our youth what to think, not how to learn; obesity and diabetes prevalence; desertification; bio-diveristy loss; depleted natural water sources; job creation….If we want to achieve long-term growth, then development models must consider the natural resources upon which we draw, the wellbeing of the societies in which we operate -- in addition to economic growth. What is wealth without wellbeing? If I can refer to our name 3BL, which stands for ‘triple bottom line’, it’s the notion that any organization (corporate or government) cannot operate and be sustainable in the long-term without considering social, environmental and financial or economic dimensions. Anything else is simply not viable in the long-term.

Tell us about the start up journey. Leena: Tariq was completing his Bsc. in Risk Management and Investment at Cass Business School in London, while I was completing my MA in Globalization Studies at Dartmouth in the US. At Cass, Tariq co-founded a number of social entrepreneurship community projects in London. He then worked for Jumpstart-up, a social enterprise that supports and funds seed level high impact social ventures, and upon his

return to Bahrain, he became the first person to hold regular social enterprise workshops in the country. In my case, while I had always been very involved in the NGO and philanthropy world--as well as being one of the first people to implement CSR through my communications consulting career--I discovered social enterprise during my first class at Dartmouth. It was a Global War and Peace class and Muhammad Yunus, who is the godfather of micro finance and one of the most famous social entrepreneurs, had just won the Nobel Peace prize. His approach to solving social issues through a business model that placed the beneficiary at the core really resonated with me. I was like—YES! This is exactly how I think; now I can identify myself with other people who think like this: social entrepreneurs. Although Tariq and I would catch up over Skype, I didn’t know he and I had somehow become interested in the same field(s) until he gifted me a Kiva (online micro-lending platform) certificate on my 28th birthday! We both moved back to Bahrain one year later, and there just wasn’t an outlet for the hybrid kind of work that we wanted to do. We really see ourselves as an organization that straddles private, public, and civil society sectors, and academia.

What are the background education/experiences that allowed you set up such a business? Tariq: I think one of the most influential factors in enabling our business and our thinking is that we have had very multidisciplinary backgrounds. Leena worked as a communications consultant—which in and of itself can span multiple industry sectors like health, government,

labour, finance, FMCG. Then she worked in event management organizing everything from pre-Grammy parties in New York City, to pivotal international events like Forum for the Future in Bahrain. She worked in tech during startup phases of TradeArabia and Jobs4Bahrainis. She worked at the Ministry of Foreign Affairs and even volunteered as a Communications Officer for the World Health Organization Iraq Office. Her academic background includes a B.Sc. in Culture and Communications from New York University in the United States; a Masters in Globalization Studies which encompassed economic development, politics, sociology, and philosophy; and she also studied at Harvard Business School. Leena: Tariq has a track record as a change maker within international development and non-profit organizations; one of the founding leaders of the MENA regions largest climate change movement’ a diabetes education activist under the umbrella of the International Diabetes Federation; a winner of local and regional entrepreneurship competitions; recognized by the World Economic Forum for raising awareness of social entrepreneurship in the Gulf’ and an alumnus of global leadership organizations such as AIESEC, BMW Foundation Young World Leaders, Common Purpose and One Young World. In addition to studying Investment and Financial Risk Management at Cass business school in London, Tariq is also among the first 100 people in the world to achieve a specialist certification in the field of Biomimicry, which is a science that studies and emulates nature’s best models, systems, ideas, processes and technologies, NOVEMBER / DECEMBER 2013

81


to solve some of the greatest challenges facing humanity. Ultimately, our backgrounds have made us not only aware of varied sustainable development issues, but most importantly, their cross-cutting and interconnected nature in a world that is still largely operating in silos.

What has been the most exciting moment so far? Leena: Too many to choose from!  Last year we were named one of the top 15 startups doing social good in the Middle East in Wamda  The diabetes.bh portal we incubated, which is the first online education and community platform for Diabetes in Bahrain, was selected as 1 of 15 global winners of the 2013 World Summit Youth Award. The award recognises social entrepreneurs who use internet and mobile technology to put the UN Millennium Development Goals into action.  Another of our think-do-tank projects which focuses on social entrepreneurship for at-risk youth was shortlisted by UNESCO for the 8th World Youth Forum.  We have been quoted in Forbes Middle East; invited to the historic Rio+20 UN Sustainable Development Summit; tracked negotiations at the UN Climate Talks; we are the only Bahraini organization invited to attend the Skoll World Forum on Social Entrepreneurship at Oxford University—widely regarded the Davos of social innovation—and have been blessed to meet some of the greatest minds and hearts in our field, including John Elkington, Nobel Laureate Muhammad Yunus, Archbishop

82

NOVEMBER / DECEMBER 2013

Desmond Tutu, Bill Drayton and so many others.  We have been invited to speak and share our expertise in one form or another on five continents. But ultimately what really thrills us is when we see our thinking--and all that we try to bring in service of humanity-reach the hearts and minds of those we work with. Whether they are clients, interns, partner organizations or just transactional meetings. We love it when people say we have really shifted their thinking or that we have opened new doors in their minds.

What are some of the challenges that you face?

Tariq: Based on our answer to the previous question, the reason it thrills us so much to shift mindsets is because it is our biggest challenge. It is difficult to get people to think more sustainability in a region where energy is heavily subsidized. It is unfamiliar for companies to view CSR as more than a PR and marketing tool and something that is both strategic and can enrich economic growth I.e. Profit, and simultaneously enrich society and the planet. It is hard to get NGOs to become more entrepreneurial and to address root causes rather than symptoms of social issues—and challenging for society to accept that you can be a business for social good.

Can you tell us about some of the more interesting activities that you have worked on? Leena: Our engagements and work have including dealing with sectors such as Energy, Housing, Health, Education,

Banking, Climate, Heritage, Aviation, Retail, Media and (Semi) Government.  We are currently developing a sustainability strategy for Majaal, an SME focused warehouse complex in the Bahrain Investment Wharf.  We are the only non-government entity invited to be part of developing Bahrain’s national social business strategy, upon recommendation of Grameen Creative Labs and advisor to Muhammad Yunus. For this year’s Social Business Week (28-31 October), we conducted and presented research on behalf of the Ministry of Social Development, on the most pressing socio-economic issues in Bahrain that were ripe for social enterprise solutions.  Earlier this year 3BL launched the 1st Bahrain Responsible Business Survey Report. The research, which was launched in media partnership with Arabic Knowledge@ Wharton, the online journal of the Ivy League Wharton School of Business, is the first of its kind, and assesses the Kingdom’s responsible business landscape.  Incubating and co-founding Diabetes.bh, the first online education and community platform for Diabetes in Bahrain.The platform serves to; Educate in the prevention and management of diabetes and its related issues; Provide a support network to the diabetes community of Bahrain which is made up of experienced individuals and professionals in the fields of diabetes and its related issues; and Create a freely accessible online platform to support national and local initiatives for the prevention and management of diabetes and its related issues.  Working to help create the Arab Youth Climate Movement (AYCM) locally and regionally. AYCM is an independent body that works to create a generation-wide movement across the Middle East & North Africa to solve the climate crisis, and to assess and support the establishment of legally binding agreements to deal with climate change issues within international negotiations.

 Getting involved in the Adopt

A Negotiator Project, which is a platform for young policy experts to track country and regional roles in the United Nations Framework Convention on Climate Change (UNFCCC) negotiations. Also working on Arab World Policy Position Paper for this years main climate negotiation summit in Poland.  Conducting on-going research on reimagining social business organizations and co-operative leadership models, using the systems and principles found across nature; including social insects, animals, and plants.

Any advice for young entrepreneurs?

Leena:It is not for the fainthearted! You must be passionate about what you’re doing because you can only work 90+ hours a week if you absolutely LOVE what you’re doing! But to give some less generic advice, I think one of the most important things to cultivate is mindfulness. You need to be self-aware, introspective and act from your heart’s core; filter through the clutter and make strategic decisions and the choices towards your life’s purpose with as much clarity as possible. It’s very easy to fall into what is known in the social impact sphere as “mission drift”. You also need to be grounded, patient, and have the ability to deal with a substantial amount of uncertainty and ambiguity. But know that as you go through the lows, there are some very exhilarating highs!

What plans for the future?

Leena: For a start, we will be launching 3BL Community Projects to get more people involved in value creation for our societies and planet. So many people are interested in the work we do and we would really love to involve everyone in some way, shape or form. Anyone who’s interested should contact us on impact@3BLAssociates.com Tariq: In 2014, we will also start operating on a more regional and global level so it’s a very exciting time! We also have a couple of projects under incubation but we will save those for another interview in the future.

NOVEMBER / DECEMBER 2013

82


IGNITING INNOVATION IN INDUSTRY

Innovation, managing transition and keeping ahead of competitors are all important topics for any organization to address. This article provides the opportunity for you [VYLÅLJ[\WVU^H`Z`V\YVYNHUPaH[PVULUJV\YHNLZPUUV]H[PVUHUKP[^PSSSLH]L`V\ ^P[OHUPUZPNO[PU[V`V\YV^UZRPSSZL[HZ^LSSHZPKLHZ[VHJ[PVU\WVU[VWYVTV[L VYNHUPZH[PVUHSPUUV]H[PVU[OYV\NO[LHT^VYRHUKYLÅLJ[PVU NOVEMBER / DECEMBER 2013

83


tŚLJŝƐŝŶŶŽǀĂƟŽŶ important?

Innovation enables you to generate new ideas to solve problems or produce new products, services and processes. It’s about stepping out of the box, consciously steering away from your comfort zone and thinking divergently. Divergent thinking, the ability to make mental connections between unrelated matters, can work as an indicator of creative capacity.

Kit car – this person can play the devil’s advocate by questioning ideas, costs and benefits, they can be blunt ‘bottom liners’.

Family car – this person is flexible and uses their intuition or gut reaction when making decisions. They are pretty grounded.

Innovation is important because it y Promotes efficiency y Increases productivity y Improves quality y Encourages competition y Accelerates change

Skills, knowledge and behaviors to ŝŐŶŝƚĞŝŶŶŽǀĂƟŽŶ

To encouraging the right skill set, environment, knowledge-sharing and behaviors for innovation to ‘ignite’, you need a no-blame culture where ideas are valued. This applies to all sectors from marketing to manufacturing and education to banking.

/ŵĂŐŝŶĂƟŽŶĂŶĚ Metaphors – steering the right way

It’s always useful to use metaphors to understand concepts. Consider, for example what you drive, metaphorically or physically. Which is your most preferred ‘vehicle’? Have you considered trying your least preferred vehicle in different work settings to address your development areas?

“Energy is made up of the positive emotions from a team or organisation: the passion, excitement and cognition.” 84

NOVEMBER / DECEMBER 2013

Tank – this person is methodical, they follow a road map and don’t mind getting ‘stuck in’.

/ŶŶŽǀĂƟŽŶ/ŶĚĞdž

As well as the way we are innovative as a habit, discovered through intrapersonal awareness, we also need to consider how we think about, and work with, innovation. Thankfully, we are all different, and yet, the more awareness we have about our own thought processes, the more we can develop our abilities whilst encouraging our teams to develop theirs too. Below are six different types of innovators. Together they form an ‘innovation index’ or typologies. Ideally, we need all these different innovative personality types to ensure true creativity. We tend to work with clients by delivering psychometric proÀling tools so that they can discover their abilities and personality traits as well as their development areas, the things that their KPIs need them to work upon. We have devised a short psychometric tool related to innovation, for this exact purpose. Discover your preferred type, whilst also understanding your development areas to increase your innovative strength and endurance. Each of these cognitive dimensions has its strengths and development areas as can be seen below.

Mini bus – this person likes to make everyone happy. They nurture teams and bring the tea and biscuits!

ůĂƌŝĮĞƌ

Investigative, checks understanding, puts things in context SO WHAT YOU MEAN IS… And they won’t want to move on until they understand!

^ƚƌĂƚĞŐŝƐƚ Sports Car – this person thinks fast, they are pace setters and ensure things get done.

Examines patterns, visualizes outcomes, transformer, imaginative, assertive, examines meaning WHAT’S THE LONG-TERM GOAL? And they don’t like Àne details…

ƌŝƟƋƵĞ

Looks for blind spots, evaluative, reasons, resilient, checks for accuracy and relevance, assertive, seeks blind spots AND WHAT IF… And they may slow decisions down… Motor bike – this person is a free spirit, they have tons of ideas and need to ensure they work with people who can roll those ideas out.

Adaptor

Experiment, doer, often sociable, open to change, supportive, uses transition management skills, open-minded, Áexible, experimenter WHAT’S NEXT? And they may start more things than they can Ànish!


dĹ&#x161;Ä&#x17E;orĹ?Ć?t

Thinker, can develop and re-design, may work as an individualist, structured, re-examines, likes theory and facts WHATâ&#x20AC;&#x2122;S WORKED BEFORE AND HOW CAN WE IMPROVE IT? And they donâ&#x20AC;&#x2122;t always consider practical implicationsâ&#x20AC;Ś

WÄ&#x17E;rĆ?pÄ&#x17E;Ä?Ć&#x;Ç&#x20AC;Ä&#x17E;Ć?WÄ&#x17E;rĆ?oĹś

Free Ă ow of ideas, non judgmental, Ă exible, non linear, can work under pressure, inĂ uencer, sees different perspectives WHAT ELSE CAN WE DO? And they question things but may be overly Ă exible.

â&#x20AC;&#x153;Being innovative leads to a dramatically different way of playing the game in an existing business...â&#x20AC;?

We have looked at the skills and knowledge that support innovation. Next we examine behaviours and environments that impact innovative ability. Innovation is inĂ uenced by everything, the clothes we ware, the colors we are around, the weather, the food we eat, the temperature, the environment we work in. Be aware of when you are most innovative to understand what works for you. Innovation is also about supporting and building upon othersâ&#x20AC;&#x2122; ideas. This means that we have to work in no blame, non-judgmental ways that

allow us to fully develop as colleagues and organisations. This can be done by having a place for ideas on a board where others can add to suggestions to further develop them. This can encourage positive energy. Also make sure you allowing the freedom of time and resources to support innovation.

Something to take awayâ&#x20AC;Ś

As a leader, when you say you need creative ideas from your teams, try and encourage y a non- judgmental approach y a no blame culture y availability of time to enable creativity y the right environment(s) y wild ideas across the whole spectrum are considered y consideration of company strategy y support for individual ideas to be developed y equal relationships equal eliminating power/influence y access to finances and other resources.

Dr. Clare Beckett-McInroy is a FHUWLÂżHGSURIHVVLRQDO&RDFK DQG3V\FKRPHWULVWZKRZRUNV ZLWKLQGLYLGXDOVDQGRUJDQLVDWLRQVWRHQDEOHWKHPWRUHDFK WKHLUSRWHQWLDO6KHLVDOVR SUHVLGHQWRI%L]ODGLHV*&& %DKUDLQ#EL]ODGLHVRUJFODUH# EHFNHWWPFLQUR\FRP

NOVEMBER / DECEMBER 2013

85


START

UP! A w

small percentage of people progress from “I have a great idea” to actually doing something about it – once the entrepreneur has gone through the IF stage (and this can be re-visited as situations change), they will either give up on that particular idea or progress into ‘STARTUP’. STARTUP is the time when actions are being taken and the idea starts to be realized. At STARTUP, the entrepreneur is committing himself or herself to an action and is balancing the enthusiasm for the idea with the practicality of details – introducing some harsh reality to the table! Part of this commitment is Ànancial (whether their own money or through investors) but a huge part of this is mental: will 86

NOVEMBER / DECEMBER 2013

they set aside the time to pursue it; will they cope with early failures; will the keep on going when their initial motivation wanes? In many entrepreneurial ventures, the business is high-activity which means that it might not have sufÀcient vision to anticipate problems – some are pretty obvious (late payment by a customer) but some may be less obvious (late payment being due to collapse of the customer’s business). Whereas the IF stage is visionary and forward-looking, STARTUP can be quite shortsighted as key tasks need to be done to move things forward. If the entrepreneur is not careful, the business moves out of their control as they lose that wider vision – they react to

The First Step of Entrepreneurship


circumstances rather than drive the organization on – hours are long, stress is high, money is tight. At times like this, the entrepreneur is relying on Collaborative Intelligence (CQ) – using enthusiasm, rapport and relationships to create spot-partnerships to get key things done. The entrepreneur cannot (but may have to) do things all on their own. During STARTUP, it can be hard for the entrepreneur to delegate – whether with colleagues or partners – creating artiÀcial bottlenecks as they try to do everything themselves but this will inhibit the growth of the business and they will learn to ‘let go’ (either through common sense or through a business failure). There may be a need for processes to be put into place (the policies of the business probably rest in the entrepreneur’s head until asked) – but process is important as it ensures that everyone who joins in the future understands how things work. As the Startup is ‘owned’ by the entrepreneur, it can grow at the founders’ pace – they may be able to sell enough to ‘get by’ as they develop. However, their personal expectations,

plus those of such external Ànanciers as bankers and investors mean that there is an enormous pressure to sell more and more as the expected Return On Investment (ROI) and Rate Of Return (ROR) start to bite. So, in a fairly short time, the entrepreneur is striving to develop the idea; balance funding; satisfy Ànanciers; document what they do (process); delegate tasks to others; nurture partnerships; work with good customers as well as bad customers.

What this can lead to is deterioration in the business before it has really got off the ground: ¾ When a sale is carried out, it may not be

deliǀered on Ɵme or saƟsĨactorily͖

¾ ad customers blocŬ access ;in terms oĨ

Ɵme and resourcesͿ to Őood customers͖

¾ dhe business becomes reacƟǀe rather

than ƉroacƟǀe͖

At STARTUP, the entrepreneur is at a bridging point – moving from the territory of the idea into being able to (consistently) sell it in the market – they need ‘more of everything’ but do not have ready access to it. This may be a time when the entrepreneur needs to know more about intellectual property (IP) and trademarks or international Ànance, cross-border legal documents, etc. – even the registration of the business name and website can be problematic as we become more of a global community. In my experience, the majority of entrepreneurs are pitching their ideas before they have even got them fullyformed – they have gone through IF, started to work in STARTUP and are already trying to sell it.

¾ dhe lacŬ oĨ business rules conĨuses

ƉeoƉle interacƟnŐ ǁith the comƉany͖

¾ ntreƉreneur ĨaƟŐue as the days

Őet lonŐer͖

¾ dhe business is Ĩocused around the

entreƉreneur ʹ decisions hit a boƩlenecŬ͖

¾ s decisionͲmaŬinŐ becomes imƉeraƟǀe,

details are oǀerlooŬed͖

¾ Entrepreneur can obsess on the product

ͬ serǀice to such a deŐree that it stalls ͬ Ĩails to launch

Neil Fogarty is an international speaker, business writer and consultant. Currently running his 12th company, Neil has written about his experiences in the books “Kill Your Salesman” and “#CrackOn”. For further details you can check him out at www.neilfogarty.com

NOVEMBER / DECEMBER 2013

87


THE MINDSET OF AN ENTREPRENEUR Kelly Armatage; Coach, Speaker, Writer and Seminar Facilitattor outlines her empowering techniques on how to think, feel and behave like an Entrepreneur.

88

NOVEMBER / DECEMBER 2013


ntrepreneurs see opportunity for business success and capitalise, build and cultivate that opportunity until it lucratively blooms. There are no limitations on becoming an Entrepreneur; each and every one of us can win the interview for that position. However, to really create the mindset of an Entrepreneur, the following methods have to be adopted:-

1

Empowered Thinking

This is the most important step of all. How we think creates how we feel, which then creates our action or non-action, which, like it or not, manifests every single outcome in our lives. The mindset of an Entrepreneur is utterly positive, utterly rich in conÀdent thoughts and utterly fearless. Entrepreneurs think like victors, they know that they are entirely responsible for the creation of their success. They know that with a positive thought such as “I can achieve this” come the emotions of allowance, of inspiration, of motivation. Once these emotions are felt deeply, action is easy. Huge actions become effortless, because when we are feeling positive, everything Áows, opportunities, situations, events and people show up to assist us with the completion of the goal at hand. Entrepreneurs work daily on improving the positive vibration of their thinking patterns, which improves the positive vibration of their behaviour.

“If we never take risks,, we will never know what the outcomes could have been.”

2

Encouragement

When Alexander Graham Bell had the idea to invent the telephone, how do you think others reacted when he said “I have an idea to invent a device that will ensure we can communicate via a machine”? I am sure the responses were along the lines of “that’s impossible, we do not communicate via machines, we communicate via postcard which is sent to the next town via horseback”. He would have received a huge amount of negative feedback. Yet, did that stop his self encouragement? Did that stop his faith? Did that stop his motivation to carry out every single task, in order to create the telephone? Alexander Bell continued to self talk in such an encouraging and empowering way, that he indeed, constructed one of the greatest inventions of all time. Entrepreneurs never, ever self criticise or listen to the negative opinions of others. Entrepreneurs support themselves continually in the face of adversity. They know that encouragement to themselves and also to others breeds amazing success.

the risk will pay off. Steven Spielberg, the great Hollywood Director knocked on the door of hundreds of recording studios willing to be an intern, in the early part of his career, yet every one turned him down. The risk of knocking on that one last door, of what could be another ‘rejection’, Ànally paid off.

Development 4 Self Courses/Training It has been proven statistically that CEO’s spend more money on self development than entertainment. Why is this? Well CEO’s and Entrepreneurs know Àrmly that working on improving the mind via training, coaching, therapy and meditation will improve self beliefs and thinking patterns, which will eventually create massive action towards success.

The mindset of an Entrepreneur is exactly that; a mind set in positivity, set on achievement, set on success and set on obtaining nothing but the very best.

3 Become A Risk Taker

If we never take risks, we will never know what the outcomes could have been. By having the courage to take risks, we are showing faith in positive outcomes. We are showing conÀdence in our deservedness for success. By willing to overcome all obstacles, we become in harmony with victory. Entrepreneurs thrive on taking risks, because they know that eventually

Kelly Armatage Director of “Kelly Armatage Inc”. Coaching Sessions, Corporate Training, Self Development Seminars, Public Speaking and Meditation Classes. T: +973 17002320 / M: +973 39931399 www.kellyarmatage.com

NOVEMBER / DECEMBER 2013

89


OOPS! 5 WEBSITE MISTAKES THAT ARE COSTING YOU CUSTOMERS

by Nathalie Lussier

You love your website like your baby. It represents your startup perfectly except when it doesn’t. Your website might not be delivering the message you thought it was. Here are five of the most common startup website mistakes that I see founders make when creating their own website or hiring a designer to create it for them - and what to do about each:

1

DESIGNING FOR THE “COOL” FACTOR

You want your startup to stand out from all the others out there, so you design your logo and your site with lots of Áair. Figuring that a Áashy design will stick in people’s minds, you forgo clarity. While people may think your site looks good, they won’t remember what your service or product is all about. They might not even grasp your concept while they’re on your site, which will cause them to hit the back button or move on without a second thought. Ouch. Visitors can be Àckle, so make sure to focus on explaining what your startup does and how it will help make your customers’ lives better.

2

ON-PAGE OVERWHELM

In an effort to tell people all the reasons they need to sign up for your service or product, you might go overboard and cause more harm than good. If you have more than three major pieces of information or options on a page, you’re likely overdoing it. When it comes to designing effective websites, keeping the visual options to a minimum always results in better conversions. Instead of packing your website with the 20 different reasons to try your product, focus on the big three beneÀts that you can deliver. Think of what your startup helps people get more or less of, whether that’s sleep or anxiety.

3

NOT TESTING ON ALL DEVICES

Your website looks great on your computer and maybe your phone. But have you tested it on a variety of different devices? Have you considered making it design responsive, so that it will resize based on the dimensions of the screen? These are all great questions to consider before you hit publish on your new startup website, but it’s worth going back and checking different browsers and devices even if your site is live.

90

NOVEMBER / DECEMBER 2013


4

FORGETTING TO ASK FOR CONTACT DETAILS

Most visitors who land on your website will not buy your product or service. It’s just not going to happen ³ but it doesn’t mean that you should let these curious folks walk away into their busy lives, never to return. Instead, make sure you have a simple and prominent way for them to stay in the loop with your startup’s progress. Make the offer to join your email list an inviting one by focusing on what beneÀts they will get from hearing about your startup. If you can’t think of anything, consider creating free content in the form of articles or videos that you think will be of interest to your ideal customers. No one can turn down a highly targeted freebie that’s designed to solve their exact problems.

5

NOT OFFERING A TASTE BEFORE ASKING FOR THE SALE

Speaking of freebies, do you have anything on your website that people can try before they buy? Depending on your product or service, you might be able to offer a taste before asking them to commit by plunking down their credit card details.

If you offer an ongoing service, it’s a great idea to let people get used to your software or services. They’ll be hooked and won’t want to stop using it. Try offering a free trial, and be generous ³ if you did your job right in creating your offering, people will take you up on your paid version, too. Think outside the box on this one, because offering a sample is one of the best ways to get people open to buying from you.

DO YOU MAKE ANY OF THESE MISTAKES? Now that you know what to watch out for when creating or updating your startup website, it’s time to be honest with yourself and assess your own site. And if you need an unbiased opinion, ask a friend or colleague ³ someone who isn’t as close to your “baby” as you are. The Young Entrepreneur Council (YEC) is an invite-only organization comprised of the world’s most promising young entrepreneurs.

Nathalie Lussier got her Bachelors in Software Engineering then promptly turned down a “stable” job on Wall Street to start her own online business. She’s a sought after digital strategist who teaches people how to get techy with their business. Get your Free Website Checkup at http://GetTechyNow.com.

NOVEMBER / DECEMBER 2013

91


Lucky Number Seven Carl Gould & The 7 stages of Small Business Success

A

uthor and Entrepreneurial Mentor, Carl Gould recently visited Bahrain at the invitation of the Entrepreneur Organization’s Bahrain Chapter and B.I.G had the opportunity to speak to him about him and his work. He is known as one of the most influential global Business mentors and a powerful public speaker. Gould’s upcoming book “The 7 Stages of Small Business Success” has been anticipated to be the ultimate guide to managing business and being a successful entrepreneur. He tells us more. What do you like most about your visit to Bahrain?

The hospitality of the Bahraini people. There is a certain warmth and the welcoming nature makes us feel very comfortable. From when I landed up until now I have met the nicest and kindest people. Bahrain also has an interesting array of restaurants and eateries and I have thoroughly enjoyed the gastronomical variety available.

How long have you been an entrepreneur?

I’ve been an entrepreneur for 30 years. I started my Àrst business when I was 16 years old and hired my Àrst employee when I was 17. It was a construction company and I continued in the same business for many years.

Did you have a mentor?

Yes. I’ve had many mentors and coaches but one mentor of mine has been guiding me for 30 years. He was a friend of my father’s and I looked up to him very much. He had already done most of the things that I wanted to do so I always relied on the advice he gave. 92

NOVEMBER / DECEMBER 2013


“Be open-minded. Imagine you’re

on a plane and you have to jump out. Your mind is the parachute and you need to open it.” What inspired you to become a business mentor? When I was running my construction company, I also did life coaching. It was such a fulÀlling feeling and I saw that the people I inÁuenced most were in business. So I decided to focus on business mentoring.

What are some of the trainings your team of coaches give?

We train on 5 levels of progression. With each level, there are a different set of issues we tackle. The Àrst level is basic and it keeps progressing up to the Àfth level, which is based on a more intimate relationship with the person we are training. On this 5th level we aim to Ànd the core of issues rather than symptoms.

tŚĂƚŝƐƚŚĞĮƌƐƚĂĚǀŝĐĞLJŽƵ give to your disciples when you ŝŶŝƟĂůůLJďĞĐŽŵĞƚŚĞŝƌŵĞŶƚŽƌ͍ Be open-minded. Imagine you’re on a plane and you have to jump out. Your mind is the parachute and you need to open it.

tŚĂƚĂƌĞƐŽŵĞŽĨƚŚĞŽďũĞĐƟǀĞƐ behind your upcoming book The 7 stages of small business success? The objectives behind my book are to instruct business owners on leadership and how to run a business. As the title mentions, it walks the readers through 7 stages that guide them on the principles they need to follow for their business to succeed. It focuses on many key factors such as how to be a leader, work ethics, how to treat employees, business strategies and so on.

Who is the audience your ŬŝƐƚĂƌŐĞƟŶŐ͍

We have a term for our audience: BOE. B and O stand for Business owners and E stands for executives.

Can you describe your book in 3 words? Simple, profound and easy.

As a globally renowned public speaker, how do you think is ƚŚĞďĞƐƚǁĂLJƚŽŝŶŇƵĞŶĐĞĂ large audience?

When you speak to a large audience you need to connect with them. The information you give shouldn’t be generic since everybody can give information by just looking online. You need to have really good information that is relevant to the audience as well. Because if it isn’t, then a Bahraini audience for example will say ‘Oh this has nothing to do with Bahrain.’ The other thing is that the presentation should be fun and engage the audience because as I said everybody likes to have fun.

What accomplishment are you most proud of?

On a personal level I’m very proud of my kids and my ability to have a family. On a professional level, I am most proud of my decision to switch my life around and become a business mentor.

What plans for the immediate future?

Well I have two books coming out. One of them is called ‘Biz Dev mad eazy.’ All the words are misspelled and it basically means Business development made easy. The point of a title like this is that after reading the book you’d know how to spell it correctly. I’ll also be travelling a lot.

Where can entrepreneurs reach LJŽƵĨŽƌŵŽƌĞŝŶĨŽƌŵĂƟŽŶĂďŽƵƚ your mentoring programs?

They can reach me on the website www. carlgould.com. There are two surveys. When you take one, we then contact you to set up a training program.

What advice would you give Bahrain’s entrepreneurs?

Make your work enjoyable and fun. Everyone likes to have fun. If you enjoy what you do and are passionate about it, it will become less strenuous and you will become more productive.

Which country did you most ĞŶũŽLJǀŝƐŝƟŶŐĂŶĚǁŚLJ͍

Well I have travelled to almost everywhere and I will have to pick a favorite from each region. In Europe, I liked Copenhagen very much. In the Far East, Shanghai was incredible and I also very much liked my visit to Australia. I haven’t travelled much in the Middle East so I can’t pick a favorite yet.

What would you do if you had a million dollars? First off I would put aside some money to ensure that my kids’ education and college education is taken care of. Then I’d just take a long break and write.

If you could try out any job for a day, what would you like to try?

I’d like to be a submarine captain! That has always been one of the things I haven’t had the opportunity to try. NOVEMBER NOVEMBER / DECEMBER / DECEMBER 2013 2013

93 93


STAY. WORK.

PLAY.

4 "&#''s Mantra Mixes Work With Pleasure The recently opened The Domain Bahrain Hotel stands out, because of its status as a social club. It is the perfect place for clients to stay, work and play. The Domain’s Managing Director tells us why such a concept is much needed in today’s times. What does The Domain Bahrain stand for?

The Domain Bahrain is more than just a luxury five star hotel. Right from the beginning, it was conceptualized and created to be a social club, inhabited by a luxury boutique hotel. Nowadays, we often see people around us engaged with on-line social media, communicating with people in different locations around the world. And often their friends and family members are sitting right across the table from them! The Domain experience is all about providing opportunity for “real-time social engagement”. Within our walls we have a total of nine social spaces, ranging from restaurants to lounges. With the food we serve, there is always has a sharing option, inviting people around the table. Apart from being an opportunity to try dishes they may not have come across before, it also often becomes a conversation starter. Online social engagement is not a bad thing, and The Domain provides ample opportunity for its members and guests to use their tablets and iPads to engage with the world around them, but we believe that we should also try and get back to a more “off-line” mode of interaction. Quality time with family and friends should be given priority and that is the main focus of The Domain. We are a luxury boutique hotel, which provides a perfect ambience for our customers to mix business with pleasure. Our target audience is one with a higher than average spending power, who appreciate the blurred lines between work and leisure time. That is where we come in. We aim to provide a level of service that takes away the boring chores of travel, such as packing and unpacking your luggage. Domain Managers and Domain Butlers are on hand to assist in making our Guest’s stay as comfortable and easy as possible, making the divide between private and public domain virtually seamless. The team is trained to provide intuitive service; there when you need it, and invisible when our guests wants to be left alone.

What sets The Domain Bahrain apart from the other 5star hotels in the Kingdom?

First of all, The Domain is a homegrown concept, owned by the Chic & Unique Hotels Group. Proud of our heritage and aware of the importance of supporting the Bahrain economy, we have – where possible - tried to source locally when it came to procurement of - for instance – construction materials, furniture, and interior design elements.

94

NOVEMBER / DECEMBER 2013


The club aspect really puts us in a different league. The members’ club will have a unique set of activities lined up. We will also be launching The Conversation — a trade-marked social media platform intended to foster community by allowing Domain residents and members to “speak” to each other. With nine restaurants and lounges, we have a large number of interesting social spaces, which allows for quality time with family, friends and colleagues. The experiences that one can have at The Domain revolve around sharing food, fun and stories. Our location also places us in the midst of the city itself. This particular building was originally designed as an office building, but we have been able to successfully transform it into the club-hotel it is today. 50 percent of The Domain’s room inventory consists of suites. This, too, makes for quite a different hotel operation. All rooms and suites are serviced by a team of Domain Managers and Domain Butlers. This poses as an opportunity and an obligation. An obligation for my team to sell more suites, but also an opportunity to create long-standing relationships, by serving our guests with the very best hotel experience.

Can you tell us a little bit about your experiences, before you arrived to head The Domain Bahrain? After graduating from Hotel School The Hague, I started my international career as a hotelier in London back in 1994 with Forte/Le Meridien. In 1995, I landed in Bahrain for the first time, but shortly thereafter I moved to Dubai. The next sixteen years I worked all over the Middle East region with – amongst others - Hyatt International, Jumeirah Group and Kempinski. For a couple of years I developed a private business, but my career has always revolved around marketing strategy, communications, and – for the last eight years – hotel development. When presented with the opportunity to develop a luxury hotel concept and brand from scratch, I happily jumped on board. And here we are – two years later! Surrounded by a fantastic team and managing a really exciting new business venture.

In three words how has the experience at The Domain Bahrain been so far?

STAY. WORK. PLAY. I honestly believe that these three words are very important and they can be explained in so many ways. Our guests instantly understand The Domain’s mantra. They react very enthusiastically to our offering and enjoy how we let Work and Play merge almost seamlessly. But the same ethos also works for our Colleagues. We are committed to providing them with a work environment in which they will want to Stay and Work. And there always should be an element of Play in our working life. I try to apply these three words to everything we develop at The Domain, and we find that – as a result – we have created not only a very interesting product, but also a very conducive corporate culture for our team.

What has been the most exciting aspect of being a part of The Domain Bahrain?

No two days are the same. There are so many facets to the development of a business as exciting as The Domain. You get involved in so many different aspects, and that’s what I love about my job. As yet, I have not had a single moment of boredom, since I arrived in Bahrain. I am a business developer at heart, and I am constantly looking for new ways and opportunities to further develop our concept. The hotel industry stands for hard work and long hours, but it is never boring. Seeing a business idea coming to fruition after you have worked on it for many months is a very exciting experience. An opportunity for me to Stay, Work and Play.

Can you tell us about some of the challenges that hotel industry faces?

Not just the hotel industry but the Bahrain Tourism Sector at large faces quite a number of challenges at the moment. And these challenges can not be tackled by just a few actors in the market place. What Bahrain really needs is a Destination Development Strategy, supported by all the different tourism stakeholders. Recently, the Tourism Sector of the Kingdom’s Ministry of Culture organized - in cooperation with a visiting UNWTO delegation - a number of workshops. Attended by hoteliers, tour operators, travel agents, event organizers and representatives of various government departments, the objective was to identify the future strategy for Bahrain’s Tourism Industry.

It was a very positive discussion and I look forward to seeing the Tourism Sector launching its destination marketing and tourism development strategy in the coming months. Bahrain has a lot to offer, but somehow has not been able to take full advantage of its opportunities in recent years, whilst other destinations in the region continued to grow. We discussed both short, mid and long term strategies and I am definitely looking forward to seeing them being put in place. There is a lot of work to be done, but there is also a lot of very positive energy in the air.

In a small country like Bahrain, there are quite a number of five star hotels. What do you think makes Bahrain a favorable location for these hotel chains to set up base? Bahrain’s location right next to Saudi Arabia’s eastern province poses an enormous opportunity. Investors in hotel development projects take a more long-term view, when investing in hotels and with the right tools and business development strategies in play, Bahrain certainly is positioned really well to take full advantage of this opportunity.

What is your favorite dish among all the restaurants at The Domain? At the beginning of my professional career I had the opportunity to work as a Chef. I love spending time in the kitchen, and over the years I have been exposed to so many different cuisines, so it is really difficult to pick one dish. But since I am forced to pick one, it would have to be a dish that fuses different food cultures.. My wife hails from Vietnam and Korea, but she spent most of her life in the Middle East. I on the other hand come from The Netherlands, so you can understand how many different cuisines come across our dining table. The other day I tried a new dish in IMARI, our newly opened Japanese Restaurant and Lounge. It combined Vietnamese and Japanese cuisine… so light and yet tasty. A simple sheet of rice paper wrapped around an explosion of taste. That would have to be my favorite dish… today.

Do you have any advice for youngsters who want to get into the hotel business? Having worked in most other Gulf countries in recent years, I am pleasantly surprised by the number of Bahrainis we see applying to various vacancies at The Domain. Some work in the kitchen, others in our restaurants and at the Front of House, side by side some 35 different nationalities. Our working hours are long but never tedious. If you like a career with the opportunity to travel around the world, the hospitality is a great choice. But you have to be passionate about hospitality. It is an industry that provides so many different opportunities that you never stop learning. But don’t forget to Play!

Can you give us a sneak peak into the future plans?

Currently, we are working the last remaining component of The Domain, its Spa and Wellness Center called “Vie Lifestyle Lab”. We aim to offer a wellness program that goes well beyond what is usually offered by hotel spas. So apart from relaxing massages and invigorating facials, we will be introducing a program of treatments, exercises and classes focused on revitalization of the body and mind. Whether your objective is to detox, lose weight or improve your self-image, Vie will have a solution for you. NOVEMBER / DECEMBER 2013

95


FRESHENING UP The Crowne Plaza Bahrain Gets Set To Launch Their Refurbished Wing

O

ne of the earliest business hotels in the Kingdom, the Crowne Plaza Bahrain is currently undergoing major refurbishments and changes in one of its wings. The Hotel’s GM, Pascal Eggerstedt tells us what can be expected once it is launched.

Can you tell us a little bit about your experiences?

I knew from an early age that the hotel business was where I wanted to be and I followed this dream relentlessly, eventually obtaining a Degree in Hotel Management from the Hotelschool The Hague in the 96

NOVEMBER / DECEMBER 2013

Netherlands. Since then, I have been passionately engaged in the hospitality industry for the last 15 years working with InterContinental Hotels Group (IHG) which provided me the opportunity to work in many different parts of the world. I spent 7 years in Asia Pacific and subsequently Europe prior to moving to the Middle East, where I worked previously in Dubai, Beirut and Oman before coming to the beautiful Kingdom of Bahrain. Throughout my tenure with IHG, I worked almost half of my career in the Global and Regional Corporate Office and the other half, I had the pleasure of working and gaining experience in our InterContinental and Crowne Plaza brands of hotels. To have been able to “see both sides of the fence” the Corporate as well Hotel Operations side of the business - has indeed been a great learning school for me. In a nutshell, I love the hospitality business and I am looking forward to contributing to the business for many more years to come!

How long have you been at the Crowne Plaza, and in three words how has the experience been so far?

I have been in Crowne Plaza for a little over 3 years joining in late 2010. To describe this in only three words is very challenging but I’ll give it a try…. Exciting, Educational And Taste For More…oops those were 5 words…

What has been the most exciting aspect of being part of Crowne Plaza?

Being part of one of the earliest and reputable business hotels in the Kingdom with its rich heritage and history adds to the excitement, not to mention being able to reinvent ourselves to keep up with the current trends and opportunities. To think of creative and practical solutions to problems in a fast-paced environment, keeping guests, owners and team members


happy and having the opportunity to work with a great team that is multicultural, dedicated and passionate in everything they do makes everyday a grand journey. One of the exciting highlights of this year is that we are “Freshening Up” and are nearing completion of a full refurbishment for one of our wings and as planned, the first brand new rooms will be launched in the market from November 2013 onwards. We are very excited and we can’t wait to launch our new rooms and to have our guests experiencing our new product!

Can you tell us about some of the challenges that the hotel industry faces.

In the past few years the region went through some turbulent times and this has adversely impacted the perception from abroad; thus affecting inbound travel to the region. One of the fist sectors that will feel any reduction in travelers is the hotel industry. Having said that, I believe that the region and in particular, the Kingdom of Bahrain is extremely resilient and there are great signs of growing numbers of visitors, be it business or leisure, coming to visit Bahrain and experience the great hospitality and many interesting sights and activities the island has on offer. And due to Bahrain’s excellent and expanding infrastructure, major investment in current and planned tourism related projects and favorable business climate; the Kingdom is fast becoming a world class business and leisure destination. Therefore I am very positive about the future of the hotel industry in the Kingdom and am very excited to be part of this journey.

In a small country like Bahrain, there are quite a number of Äve star hotels. What do you think makes Bahrain a favorable location for these hotel chains to set up base?

Over the years Bahrain has taken substantial measures to create the most open, favorable economic conditions, thus making it easy for investments and businesses. Fortunately, by virtue of its strategic location, Bahrain has the advantage of being the gateway to the Gulf market. Just think about the country’s proximity to the Kingdom of Saudi Arabia and the easy access by the causeway; these are all key drivers for many corporations to choose Bahrain as the ideal business destination. Also, the island is rich in history, culture and heritage, which attract many visitors from all over the world. Bahrain is truly a unique place in the region with an ancient heritage and culture that spans many centuries. It has a great mix of a modern and cosmopolitan vibe but with a great feel of the Arabic culture. Bahrain recently held very prestigious positions in the region such as the ‘Capital of Arab Culture in 2012’ and the ‘Capital of Arab Tourism 2013”. The Bahrain International Airport is also

continuing the work on its expansion programme this year, which will increase passenger capacity to more than 13.5 million visitors over the coming years. It will definitely be a great boost for the hotel industry in general and undoubtedly a very bright future for the Kingdom.

passion for hospitality and business with you to the table and a real desire to succeed even when many obstacles are thrown at you. Over the years I had some great leaders I had the pleasure to work with and learn from. One of the elements you see coming back in great leaders is that they are themselves, have a real passion in what they do and know how use that “leadership brand” to motivate people around them. You are as good as your team. It’s all about team work!

What is your favorite dish among all the restaurants at Crowne Plaza?

Certainly! As mentioned earlier, one of the highlights of this year is that we are nearing completion of a full renovation of one of our hotel wings and as planned the first brand new rooms will be launched in the market from November 2013 onwards. This is extremely exciting as this is a great opportunity to showcase our ongoing commitment to growth initiatives and the provision of exemplary personalized service. Our goal is to excel at exceeding our guests’ expectations and deliver a truly differentiated brand experience. The new rooms in combination with our 1700 sqm Conference Facilities in the hotel will further strengthen our reputation as a great destination for Meetings, Incentives, Conference and Events (MICE) business. There are absolutely many more exciting projects in store for the very near future to further position Crowne Plaza as the preferred hotel for business and leisure in Bahrain but although I would love to talk about this it is probably a bit too early at this stage. I’d say “watch this space”!

That’s a tricky question because I have many favorites! But if I had to choose, I would probably say the Malaysian Seafood Laksa from our Waves Seafood Restaurant. This is one of our tasty Signature dishes from our Malaysian Executive Chef Saravanan Gurusamy and I would encourage all seafood lovers to come and try out this spectacular dish and judge for yourself!! I am sure they will come back for more!

Do you have any advice for youngsters who want to break into the hotel business?

Actually, it’s the same mantra I preach; it is always about - Passion! Passion! Passion! When passion and skill work together, the end result is often a masterpiece. When you’re passionate, you’re engaged and being engaged is everything when it comes to being successful. You need to bring a

Can you give us a sneak peak into the future plans?

NOVEMBER / DECEMBER 2013

97


MASSAGE AWAY

THE BLUES Š›‘Ƥ–‡Žǯ•ŠƒŽƒ•ƒ’ƒ•Š‘—Ž†„‡‘‘—”‰‡†ƒǨ

Sofitel Bahrain Zallaq Thalassa Sea & Spa is the only Thalassa Spa in the region, and they offer an array of treatments and massages which will definitely get your batteries recharged. We spoke to the Thalassa & Recreation Director, Moussa Lahlali to find out more. N_Xk`jJf]`k\cK_XcXjjXjgX befne]fi6

The SoÀtel Bahrain Zallaq Thalassa Sea & Spa is the Àrst hotel within the GCC to offer Thalassotherapy with an aim to provide you with a totally new seawater therapy experience. Thalassa Sea & Spa is the wellness brand from Accor Hospitality whose one aim is to provide the best innovative seawater therapy experience. It helps you to take care of your body, to lastingly protect it through a comprehensive approach that combines therapy, sports activities and healthy diet through the use of seawater and aquatic plants.

Like a real concentrate of life, the sea contains all the trace elements, minerals and vitamins that are vital to the balance of our organs. These virtues have long been recognized and exploited by man.

N_Xkj\kj`kXgXik]ifdk_\fk_\i clolipjgXj`ek_\B`e^[fd6

SoÀtel Bahrain’s Thalassa Sea & Spa brings forth the best of spa care to offer you unrivalled treatments with lasting positive effects. It is a place to give yourself over to enjoyment, share with the experts and let the individual care adapted to suit your needs gently bring you to better health, improved well-being or a trimmer Àgure.

“The spa provides the ultimate in thalassotherapy and wellbeing and is the place to go to relax and rejuvenate.” 98

NOVEMBER / DECEMBER 2013

Over and above its beneÀts, thalassotherapy is also a unique opportunity to replenish body and soul deep-down, to enjoy a break of well-being and pleasure. We are located in a protected area with crystal-clear turquoise waters of the Arabian Gulf away from the hustle and bustle of the mainland. The spa provides the ultimate in thalassotherapy and wellbeing and is the place to go to relax and rejuvenate, to pamper body and soul and recuperate from the hassles and stresses of modern life. In addition to this, the spa is designed with the utmost care, with two Áoors which separate the male and female section, to ensure privacy and tranquility for every guest. Its sea side location helps to enhance a feeling of escape and promote perfect harmony between body and mind. We also offer some of the traditional massages that you can Ànd in most spas around the world e.g. Swedish massage, aromatherapy, thai massage and hot stone massage.


:Xepflk\ccljXYflkjfd\ f]k_\gfglcXiki\Xkd\ekj Xkk_\jgX6 Some of Thalassotherapy’s star treatments include;

Whirlpool Bath – essential oils are added to a multi-jet bath. Ideal to replenish the body, loosen muscles and aid in relaxation.

Underwater Shower

In a bath-tub filled with sea-water, the hydro-therapist massages the whole body with a jet, dwelling on each area. This is a sculpture massage that relaxes, shapes and drains. It is ideal for stiff muscles and joints, heavy legs and cellulite.

Affusion Shower

In a lying position, your body receives a fine shower of seawater combined with a gentle sweeping action. This treatment promotes physical and mental relaxation because it works on the skin’s nerve ends and replenishes through the absorption of trace elements. It is ideal for soothing action in cases of nervousness, overwork or extreme fatigue.

Jet Shower

The hydro-therapist massages each part of the body with a jet of seawater. Depending on the effects you are looking for, the temperature of the water and the power and tempo of the jet will vary. It is ideal to tone, sculpt, improve blood flow and aid in relaxation.

Sea-Plant Wrap

After the application of a warm sea-plant cream, you are wrapped and covered in a blanket, like in a cocoon, to facilitate perspiration and the absorption of mineral salts and trace elements. Laminarian sea-plant is a fabulous way to replenish the bodyand to relieve pain and aching joints.

Pressure therapy

Inflatable boots help drain the system by very light compressions from the feet to the thighs. The Cool Tinning Gel for Legs from our Marine Cosmetics Line adds fresh coolness and boosts this treatment’s effectiveness.

The Thalassa Sea & spa Beauty area has its own brand of cosmetics, Aquascience and skinceuticals- created from 100% natural ingredients, combining the beneÀts of marine spring water with the recognized virtues of seaweed and oligo-elements. The product draws its richness and effectiveness from the Marine environment. This line of treatments features cosmetics for the face &body, shower and bath for both genders. All designed to prolong the pleasure and sheer experience of your Thalasso therapy stay. The Beauty Centre also offers guests a wide range of facial and body treatments, as well as soothing relaxation treatments, such as the four-hands massage and head massage.

:Xepflk\ccljXYflkpfli fnegi`fi\og\i`\eZ\j Y\]fi\Xii`m`e^`e9X_iX`e6 My journey started 9 years ago in Morocco and I have since travelled, worked and occupied progressive roles in Thalassotherapy, spas and recreation in different countries such as Tunisia, Egypt, Phuket in Thailand, Bali in Indonesia, and at present Sofitel Bahrain Zallaq Thalassa Sea & Spa. The highlight within my career would be pioneering the opening of two prominent wellness brands; the Àrst being, Cerzner, at the Mazagan Beach Resort in Morocco and Thalassa Sea & Spa at SoÀtel Agadir Thalassa Sea and Spa, Morocco.

N_Xk`jk_\dfjk\oZ`k`e^ Xjg\Zkf]nfib`e^Xk Jf]`k\c9X_iX`e6

Apart from the dreamy views of the turquoise Arabian Gulf waters, the “CAN DO” attitude of all the ambassadors in meeting and exceeding guests expectations, the fact that SoÀtel Bahrain is the pioneer and only place where Thalassa Sea & Spa can be experienced in the GCC is exciting. Since the whole concept of Thalassa is somewhat unfamiliar to many residents off the GCC, I have the opportunity to educate our guests on the lasting beneÀts of seawater treatments. The response has been spectacular, such that we have introduced monthly Thalassa Nights whereby we invite our guests to tour the spa, sample some of the treatments and discuss with our therapists to get more insight on the product.

N_XkXi\k_\X[[`k`feXc j\im`Z\jk_Xkpflgifm`[\6

We have also designed daily unique kids’ workshops in our kids club, which cater to our younger guests starting 4 years till 12 years old. These include daily workshop schedules for the kids to sample and get introduced to Thalassa Spa, cook with the chefs, learn how to swim and also participate in various craft and painting activities. The spa also offers pilates and zumba classes in the separate studios located in the spa while the beach club offers a fully equipped state of the art gym, tennis and squash courts and a private beach with non-motor powered beach activities such as kayaks and pedalos with plans for more varieties in the near future. NOVEMBER / DECEMBER 2013

99


RELAX

&

REJUVENATE

Kempinski’s Pure Spa Introduces Spa Membership

K

empinski Grand & Ixir Hotel Bahrain City Centre’s spa and wellness centre, Pure Spa, is pleased to introduce a spa membership package for the beneÀt of its frequent guests. Members will beneÀt of complimentary spa amenities and free access to the spa facilities, the gym and the pool. Special discounted rates apply for Spa and Hammam treatments, as well as Nasmat poolside restaurant. A complimentary personal training session with a qualiÀed personal trainer is also included. Members can invite their friends to experience the luxurious spa as two complimentary day passes are included in the membership.

;<920://(44(4

The recently opened largest Turkish Hammam in the Kingdom offers an ancient cleansing ritual that fully revitalizes the mind and body. Introduced and transformed over thousands of years from the magniÀcent Ottomans of ancient Turkey, the Turkish Hammam is a unique cleansing ritual that is as much a relaxation experience as a social gathering for close friends and business associates. Within a spacious steam chamber and an impressive, arching dome, at the hands of a trained professional, enjoy a full-body scrub with the traditional Turkish kese mitt before becoming enveloped in delicate foam and wrapped in a luscious body mask to leave your skin supple and your soul revitalized. Choose between a selection of treatments to enhance your Traditional Turkish Hammam experience with body wraps and masks. The health beneÀts of the Turkish Hammam are numerous. The prolonged exposure to the steam allows the body to dilate its pores and sweat out toxins built up in the body. The heat within the Hammam chamber causes the liver and kidneys, which are the body’s Àltration systems, to work harder to emit these toxins. Once the body is further heated with alternating temperatures of warm water, a scrub using the traditional kese mitt allows dead skin cells to be peeled off the body, and the foam massage gives the skin extra nourishment. The medical, physical and spiritual beneÀts of the Turkish Hammam are irrefutable, leaving the mind and body fully relaxed and revitalized.

/630:;0*;9,(;4,5;:

Pure Spa offers holistic treatments with organic ingredients and exclusive Àve-star spa services. The spa features 10 elegantly stylish treatment rooms with designated male and female zones plus a lavish private couple’s Spa Suite. Guests enjoy memorable signature therapies with an extensive array of exclusive and hand selected products which include ‘Elemental Herbology’ and Bahrain’s very own ‘Green Bar’. Pure Spa features unique naturally-rejuvenating treatments and rituals including bespoke massages from around the world, facials, scrubs, cocoons, body polishes and wraps, which are created with these very special products. Pure Spa boasts of hand-picked skilled and speciÀcally trained therapists who are committed to delivering the optimum results in every treatment with knowledge, passion and Áair to create an invigorating experience for spa aÀcionados. Pure Spa offers spa enthusiasts a sanctuary for all the senses, and is a place for reclaiming and retaining physical, mental and spiritual vitality. The spa features additional relaxation facilities such as a sauna, steam and Jacuzzi and it beneÀts from a terraced inÀnity open-air pool and restaurant Nasmat, which can be enjoyed before or after treatments. Please contact Pure Spa directly to apply for your membership.

± Venue: Pure Spa, Kempinski Grand & Ixir Hotel Bahrain City Centre Date: Open daily

Time: ϭϬ͗ϬϬĂŵƚŽϭϬ͗ϬϬƉŵ͖ƐƉĞĐŝĮĐŵĂůĞĂŶĚĨĞŵĂůĞƟŵĞƐĨŽƌdƵƌŬŝƐŚ,ĂŵŵĂŵ &ŽƌĂĚĚŝƟŽŶĂůŝŶĨŽƌŵĂƟŽŶŽƌƌĞƐĞƌǀĂƟŽŶƐ͗ (+973) 1717 1122 or spa.bahrain@kempinski.com, www.kempinski.com/bahrain

&ŽůůŽǁƵƐŽŶ&ĂĐĞŬΘdǁŝƩĞƌ͗ ĨĂĐĞŬ͘ĐŽŵͬŬĞŵƉŝŶƐŬŝŚŽƚĞůďĂŚƌĂŝŶ ĂŶĚƚǁŝƩĞƌ͘ĐŽŵͬ<'/,

100

NOVEMBER / DECEMBER 2013


(Clockwise From Above): Pure Spaâ&#x20AC;&#x2122;s Couple Suite, The Kempinski Grand & Ixir Hotel Bahrain City Centre, Pure Spa Turkish Hammam, Pure Spa Turkish Hammam Wet Lounge, Pure Spa Relaxation Area.

NOVEMBER / DECEMBER 2013

101


NO WEEKEND

PLANS?

HEAD TO BIC FOR WORLD ENDURANCE CHAMPIONSHIP (WEC) SIX HOURS OF BAHRAIN The Kingdom of Bahrain is in the grip of motorsport fever, as the clock counts down to the nation’s penultimate motorsport and entertainment event – the World Endurance Championship (WEC) Six Hours of Bahrain. This year, Bahrain International Circuit (BIC), has the privilege of hosting the WEC’s all-important season-ending round, giving motorsport fans from around the region plenty of thrills and excitement to look forward to.

M

otorsport fans from around the world will descend on the Kingdom when the Six Hours of Bahrain takes place at BIC on November 29 and 30. As such, the grand endurance spectacle presents an ideal chance for combining business with pleasure; an exciting platform for liaising with clients and networking with business partners in a setting that’s dynamic, engaging and unforgettable – “the Home of Motorsport in the Middle East.” The plush exteriors of BIC’s exclusive Le Mans Spirit Club offer superior vantage points, and the rare chance to peer into the heart of the action – the Pit garages, where the behind-the-scenes adjustments and modifications take place. BIC has laid out attractive Corporate Packages to give discerning fans a chance to experience every second of the grand finale up-close, and in the lap of luxury. The BIC 6 Hours of Bahrain corporate package includes the club’s

unrivalled hospitality over the two days, as well as VIP car parking, for seamless transition from the car park to the club. Fans will also have the option to wander various grandstands, if they prefer another viewing angle. As part of the VIP treatment, the package includes an exclusive pre-race grid walk, that allows fans to get as close as possible to the drivers and their state-of-the-art sports cars. The corporate package is priced at BD200 per person for both days of the action. Bookings for tables of 10 will enjoy a 10 per cent discount. Tickets for race day alone, meanwhile, cost BD180. The Six Hours of Bahrain is an apt platform for sports fans to loosen their ties, kick back and take in all the thrilling race action. Don’t miss this perfect opportunity to network with members of the corporate fraternity. Combine business with pleasure as you entertain your clients, conduct meetings, discover new opportunities, share ideas, and expand your customer base.

BIC’s Corporate Sales (+973) 17451086 for enquiries and booking. www.bahraingp.com

102

NOVEMBER / DECEMBER 2013


A Delightful Meal Lunch Buffet at the Sheratonâ&#x20AC;&#x2122;s Al Safir Restaurant gets a Thumbs Up!

L

ocated in the heart of the city, The Sheraton Bahrain Hotel is a perfect spot to head to for a meal during work hours. With an array of interesting restaurants, one is truly spoilt for choice. Our pick of the day was the lunch buffet at their Al Safir Restaurant. One of the best aspects of this particular restaurant is the ambience, its soothing to the mind, and relaxes you with their soft lilting music, and the sheer amount of natural light coming through. The meal itself is well worth the Ă&#x20AC;ve star rating. It is a mix of local and international cuisine. For the starters, you can pick from the delicious soups or the mezze or the interesting salads available. My choice of starter was the hummous, and the samosas. Both, as expected was exceptional.

Top Image: The buffet section DWWKH$O6DĂ&#x20AC;U 5HVWDXUDQW6KHUDWRQ %DKUDLQ+RWHO Facebook: SheratonBahrainHotel Twitter: SheratonBahrain Instagram: SheratonBahrain

As for the main course, where do we start! From India to Iran, from America to our little Kingdom, there is something from everywhere. And each dish is so delicious and delightful, each better than the next. I picked the mutton and dal curry, some rice, the Indian bread, some pasta and the mashed potatoes. It was indeed quite a feast and a scrumptious one at that. And Ă&#x20AC;nally, it was time for our favorite part of the meal. The desserts. The Umm Ali at the Sheraton Bahrain is the absolute best available on the island. It brings you a sense of warm welcome and of belonging, of being home. The other desserts too were equally good. The Al SaĂ&#x20AC;r buffet is outstanding in presentation, variety of choice, taste and value for money. Would we go back there? Oh Yes! Most DeĂ&#x20AC;nitely! NOVEMBER / DECEMBER 2013

103


HUNGRY?

Check out Al Bandar’s Friday Brunch

Al Bandar Hotel & Resorts is the one place you must head to on Friday, to enjoy their delicious brunch.

A

l Bandar Hotel & Resort, with its serene view of the sea and the pristine sands has always been a favorite hotspot for Bahrain’s citizen’s and expats alike. It has been a popular destination not only for couples, families and tourists but also for businessmen who plan to combine business with pleasure. It is the perfect spot for some quality family time during the weekend and it just got better. With the Friday Brunch at the Café Marisol, a weekend trip to the Resort has become both treat for the eyes and a treat for the tummy.

104

NOVEMBER NOVEMBER/ /DECEMBER DECEMBER2013 2013


As you enter the cafe, the aroma of the delicious buffet gets you salivating. The live entertainment only adds to the exciting ambience. Guests can choose to sit inside but the outside seating will tend to prove more popular, now that the weather is changing. The sea front view takes you on a soothing and relaxing journey. As for the food, it is a good thing that the brunch is from 12.30pm to 4.30pm, because there is quite a bit to eat. There are separate stations for Turkey and Beef Wellington, Pasta and even Mexican Burritos and Tacos. The starter selection is fabulous and the seafood soup is highly recommended. The interesting array of seafood allows you to make you own salad as well.

The main course takes you across the world and gives you a taste of multiple cuisines. There is even an outdoor barbecue setup, where you can order your squids and prawns grilled to perfection. There are different kinds of rice, to Ă&#x20AC;t your taste palate. And it comes with unique and interesting gravies from different countries to complement it. The dessert station is unbelievable too! From chocolate mousse to carrot cake, from Um Ali to mango pudding, there is enough to satisfy your sweet craving. And you can enjoy any drink of your choice to wash down the delicious meal. If you are going with children, they are clowns and balloon designers to keep them occupied as well. This is one buffet that you must not miss!

NOVEMBER NOVEMBER/ /DECEMBER DECEMBER2013 2013

105


THE ITALIAN ALTERNATE FLAGSHIP MASERATI CAN BLITZ 307KPH. ENOUGH SAID!

The flagship of the Maserati product range, the Quattroporte is larger, lighter, more luxurious and more practical than the globally acclaimed car it replaces. With a 307km/h top speed, itâ&#x20AC;&#x2122;s also as fast as most two-door supercars.

106

NOVEMBER NOVEMBER/ /DECEMBER DECEMBER2013 2013


T

he sixth-generation Quattroporte delivers a leap forward that not only sets the high-technology tone for Maserati’s upcoming new-model onslaught, but also remains faithful to Maserati’s long history in luxury sports sedans.

CRAFTSMANSHIP

The Quattorporte delivers new standards in quality in every area from design, development, fabrication and process controls. It is produced in a new plant that combines Maserati’s traditions of craftsmanship with cutting-edge technologies that are able to guarantee outstanding quality by controlling even the tiniest details. Traditional hand crafted detailing continues in the Quattroporte’s cabin, and this has been added to with even more interior space in all seats and both four- and Àve-seat layouts. Cabin luxury leaps forward technically, too, with features like the Maserati Touch Control screen, adjustable pedals (left hand drive only), reversing cameras and the optional 15-speaker Bowers & Wilkins audio system, as well as WLANbased WiFi and compatibility with most modern mobile phone systems.

BARNSTORMING PERFORMANCE

The powerful engine and the large cabin are at the core of the Quattroporte’s design, dominated by a long, powerful nose and a concave Trident grille and providing a clear link to both the outgoing Quattroporte and the GranTurismo.

AT A GLANCE Â All-new, Maserati-designed 3.8-litre,

twin turbo V8 and 3.0-litre, twin turbo V6 engines

 Direct-injection V8 delivers 390kW

(530CV) of power and up to 710Nm of torque

 Class-leading specific power output

(139CV/litre) and specific torque output (171Nm/litre). Class-leading weight-to-power ratio (3.6kg/hp)

 V8 twin turbo 0-100km/h

acceleration in 4.7 seconds

 V8 twin turbo top speed of 307km/h

(191mph)

 V6 twin turbo delivers 301kW

(410CV) and its 550Nm is greater than the torque peak in the outgoing Quattroporte Sport GT S

 V6 twin turbo accelerates to

0-100km/h in 4.9 seconds and its 285km/h top speed is just 2km/h lower than the Sport GT S.

 V8 kerb weight has been reduced by

almost 100 kg

 Both V8 and V6 models use an

eight-speed automatic transmission and deliver rear-wheel drive agility or all-wheel drive security (V6)

 Traditional handling excellence

assured with 50:50 weight distribution

 Longer wheelbase creates increased

leg and shoulder room

 Five or four-seat layouts available,

including work space and entertainment options

 New cabin features include WiFi

WLAN hotspot, up to 15 speakers of Bowers and Wilkins premium surround system, 8.4” Maserati Touch Control screen

 Designed and engineered by

Maserati and manufactured to new benchmark quality standards in its all-new plant in Torino

Even with all of its new technology, the new Quattroporte remains true to Maserati’s roots. Its V8 twin turbo makes it not only the fastest four-door Maserati ever built, but also the most powerful and the most economical as well. The direct-injection engine family will boast a 3.8-litre V8 and a 3.0-litre V6, both of which are all new, twin turbo charged, designed by Maserati Powertrain and assembled by Ferrari at Maranello. The 3.8-litre V8 engine provides Maserati’s new performance benchmark, reaching 100km/h in just 4.7 seconds and achieving a 307km/h top speed. It is 20km/h faster than the Quattroporte Sport GT S and has up to 200Nm more torque as well. The V6 twin turbo doesn’t lack for performance, either, reaching 285km/h. With an eight-speed automatic transmission and both rear-wheel drive and all-wheel drive conÀgurations(V6), it is also the most secure all-weather performance car in Maserati’s history.

HANDLING COMPONENT

The all-new architecture retains the Quattroporte’s traditionally exquisite handling thanks to its 50:50 weight distribution, a double-wishbone front suspension and a state-of-the-art Àve-link rear suspension. It can now deliver the added security and all-weather assurance of all-wheel drive as well. With the original Quattroporte in 1963, Maserati invented the concept of the luxury sports sedan and the new Quattroporte continues to be the benchmark for high quality engineering, supercar performance and limousine comfort.

NOVEMBER//DECEMBER DECEMBER2013 2013 NOVEMBER

107


THE FRENCH DIP

BIG gets behind the wheel of the much awaited Peugeot 508.

A

t first glance, the new Peugeot 508 appears to be a car in no-man’s land. Well that’s because it was built in order to fill in the gap of the 407 mid-sized cars and Peugeot’s 607 flagship. Now as you can see, the all new Peugeot 508 is not just smart to look at, but it comes along with impressive economy, competitive pricing and sensible equipment levels to court to the massive fleetbuying audience. And as we all know – “What’s good for fleets is also good for family buyers! 108

NOVEMBER / DECEMBER 2013

EXTERIOR

Gone is the awkward, big-nosed, gaping-mouthed look of the Peugeot 407 for a far more cohesive, balanced style. Now, the new 508 certainly has a solid premium look about it. The love-it-or-hate-it gaping mouth grill of previous Peugeots has given way to a far more conservative look that borders on plain from some angles.

INTERIOR

Inside, the 508 comes along with a neat fascia with simple, clear instrumentation that gives you an easy driving environment. Opt for GT spec and you’ll not need the instruments, as a colour heads-up display is standard (it is offered optionally on Active and Allure models) and not just that but you even get stylish chrome rimmed dials with white backlights; all of this is backed up by the ambient lighting through the cabin, soft-touch materials on the dash, leather seats,


frosted chrome door handles and an amazing looking centre console. Rear seat passengers are generously accommodated, with plenty of legroom, headroom and an amazing view of the world outside thanks to the panoramic glass roof!

GOODIES

The prestige look is complemented by an impressive amount of equipment that includes things like a four-zone air conditioning with controls for the back seat passengers, Bluetooth with audio streaming and a USB plug, a smart key, an electric park brake, Bi-xenon headlights with adaptive beams (the headlights use a camera to detect oncoming cars and dim the high beams), parking sensors and GPS. Standard safety features on all models include front, side and curtain airbags, ABS with EBD, stability control and automatic hazard lights on emergency braking.

RIDE & HANDLING

Some of the dynamism exhibited by RCZ’s coupé has been incorporated into the 508. Certainly it’s among the best handling Peugeots of recent times, with Àne balance mixing with decent ride comfort for an accomplished all-round drive. We’re not talking

the engaging brilliance of Peugeot chassis of old, but it’s secure and competent with the ability to provide entertainment away from its natural motorway habitat. Thank the steering for that, as the 508 reacts quickly to input at the wheel and provides a degree of feel.

ENGINE

Whatever engine you opt for - be it one of the petrol choices (1.6L VTi 120bhp – Semi Automatic or 1.6L THP 156bhp – Speed Automatic) - the 508 is quite reÀned. Despite the car’s size, the engine propels the 508 deftly and responsively; and the power comes in a smooth and immediate manner, whenever needed.

SUMMARY

This is something of a return to form from Peugeot, with the 508 offering serious competition to not just the mainstream players, but also some of the premium brands. It’s basically a Àne package, that’s neatly styled inside and out, well priced and sensibly speciÀed. So at the end of the day, if you’re out on the hunt for a vehicle that not only looks good, but feels good too; then this all new Peugeot 508 is just the thing you’ve been waiting for.

NOVEMBER / DECEMBER 2013

109


KOREAN

PRIDE T

It’s spacious, luxurious and powerful……. What more could you ask for?

he Hyundai Centennial is an upscale full-size luxury sedan that serves as the flagship model of Hyundai Motor Company worldwide and at the same time it’s said to be the largest and most expensive sedan in the company’s lineup. Even though the luxury sedan doesn’t carry a special badge of its own (if you don’t count the bird-like emblem that recurs throughout its interior and exterior) the 2013 Centennial does look every bit like a luxury car, with a softer, more balanced and traditional look that borrows cues and themes from other prestigious sedans and flagship models. The Centennial may not deliver the prestige or the handling of the best vehicles in its class, but it’s a striking bargain for those who don’t mind a more softly sprung luxury sedan, or a great deal.

110

NOVEMBER / DECEMBER 2013


EXTERIOR

At the front, the grille design we know well from the Hyundai Genesis has been skillfully integrated with the headlight shapes, and carefully beveled front corners allow the light forms to carry around as vivid slashes into the quarter panels. The effect visually shortens the front overhang appreciably, to good effect. It is functional, too, allowing the auto-cornering HID headlights to swivel more effectively as the car turns. Now moving on to the side of the car, well its distinguished by a contour crease that runs across the top of the front fender and then arcs through the doors before kicking up over the rear door handle to meet the rear light, lending the rear fender a muscular outline as it does (Hyundai calls its design – the language Áuidic sculpture). Chrome window surrounds and a bright strip below the doors adds further detail, while large, bright 19-inch wheels cram the wheel housings to emphasize a solid stance. A fast rooÁine reduces the impression of size, so it’s quite a surprise when you hop in to discover just how much interior space the design allows.

INTERIOR

Once you’re all comfy in the driver’s seat, you tend to notice the shape of the dash is far more elegant for the new car, with a larger infotainment screen (9.2 inches, up from 8) that’s integrated into a swathe of nicer wood and metal. The whole center stack is far less plasticky than before, and the new steering wheel boasts controls that look and feel far better integrated than the outgoing items. The all-digital instrument cluster, which changes its background color based on the selected drive mode, is nice to look at, too. At the rear, Centennial offers you with reclining; massaging rear seats with access to a personal refrigerator and on the plus side, both rear passengers have access to the car’s infotainment system via a button-laden central console, and you can even use the system via twin 9.3inch monitors that are nestled nicely into the seatbacks.

GOODIES

The vehicle comes along with an extremely high level of interior equipment, including a heated wood-and-leather steering wheel with power tilt-and-telescopic adjustment, forward-view parking and cornering camera, a power decklid, auto defogging system with rain-sensing wipers, heated and cooled front seats, dual automatic climate control with separate adjustment and rear-seat vent control, power-reclining rear seats with powered headrests, cooled rear seats, rear seat massage and leg support, rear seat refrigerator, power rear

sunshades and a rear seat entertainment system. Harman’s Lexicon stereo system is among the best available in-car sound systems we’ve ever heard, with full 7.1 Discrete Logic Surround Sound for brilliant separation and imaging.

ENGINE

The Centennial comes standard with rear wheel drive, a 5.0L V8 DOHC GDI engine that churns out around 424bhp and it’s mated to an eight speed automatic transmission that helps you in getting from 0-100kph in just 5.7seconds Áat!

SAFETY

Some of the standard safety features include antilock brakes, stability and traction control, a lane-departure warning system, a pre-collision warning and preparation system (using adaptive cruise control sensors), front and rear side airbags, side curtain airbags and a driver knee airbag.

RIDE

Out and about on the highway the Àrst thing you’ll notice about the Centennial is that it’s quiet. Things aren’t much louder once underway, with the engine just a whisper and only a slight tire hum to be heard at freeway speeds. The Centennial isn’t some sleepy-handling limousine, it sure does Áoat around a bit in default suspension mode, but hit the Sport dynamic button and the ride stiffens up over bumps. It doesn’t have the speed or reÁexes of European luxo-sport

sedans, but the vehicle remains stable and predictable when pushed around.

HANDLING

With multi-link suspension all around, the big Hyundai’s chassis handles accurately, abetted by the Continental air-struts and the Sachs electronically controlled damping system. There’s a driver-selectable Sport position, which subdues ride motions quite well without introducing much abruptness into the ride, but this is not really the kind of car one wants to Áing around. Hyundai’s decision to adopt a hybrid electro-hydraulic steering mechanism was a good one. Utilizing an electric motor to drive a powersteering pump, it beneÀts from the energy savings enjoyed when cruising straight ahead with the motor at rest, and from the more natural feel of hydraulic assist once the electric motor has been summoned into action. When compared against some high-end nameplates with fully electric assist systems, the Centennial has a far more organic sense to its steering.

SUMMARY

With its attractive styling, smooth-as-silk handling and an excellent price tag (BD31,000); the Hyundai Centennial is a solid choice in the luxury sedan segment. Although those seeking the prestige of name recognition might turn to more established

brands, the Centennial on the other hand provides admirable performance and features at a fair price. NOVEMBER / DECEMBER 2013

111


THE LINCOLN LAWYER

The ultimate luxury crossover that turns heads like no other! Over the past few years or so, Lincoln has made a tremendous effort in redefining their stance in the luxury segment. The all new 2013 Lincoln MKX is a step in the right direction when it comes to luxury crossover vehicles combining luxury refinement and performance. With the styling of the new MKX remaining the same since its redesign back in 2011, the company continues to embark on a steady path that Lincoln has paved out for its potential consumers of luxury crossover vehicles.

112 112

NOVEMBER NOVEMBER / DECEMBER / DECEMBER 2013 2013


EXTERIOR

The overall shape of the engine hood is as long as it needs to be. The roof is shaped by a functional compromise between interior space and aerodynamic drag, and the shape of the side windows faithfully follows the shape of the roof. The front and rear wheel arches bulge out from the surrounding sheet metal just enough to arc into their adjacent doors, relieving otherwise slab-like sides. A subtle skirt, suggesting a covered running board, connects the wheel openings just above the door sills. If the original had a visual weak spot it was its overly fussy, back-to-the-1960s Continental grille: a handsome piece by itself, but one that needed a lower, wider car behind it. Lincoln Àxed that in 2011 with a substantial cosmetic makeover. Lincoln said it replaced about sixty percent of the MKX’s parts and components, but by far the most conspicuous change was to the split wing grille, which has become the current Lincoln hallmark. It suits the MKX much better and remains unchanged on the 2013 model.

INTERIOR

The MKX is a crossover utility. Utility is seen in features such as the front passenger seat, which folds Áat, and each half of the second seat folds Áat independently to accommodate cargoes of various sizes and lengths. The seats themselves appear rich, comfortable, and luxurious. Not just that, but the

vehicle receives an updated version of the MyLincoln touch interface attempting to add ease of usability and interaction. It also comes with two Àve-way thumb switches (mounted on the steering wheel spokes) that help you to toggle around the two 4.5inch LED display screens that are present on either side of the big speedometer in the instrument cluster.

GOODIES

Whereas the 8inch LED display screen at the top center of the instrument panel comes with a four-zone color-coding system, and a panel of Áat touch buttons below it. With MyLincoln Touch, the thumb switches and the screen combine to control climate, sound system, telephone, navigation and an enormous variety of information functions including turn-by-turn directions, sports scores, fuel prices, movie listings, dining, and even horoscopes, using a list of up to 10,000 voice commands. In short, the all new MKX is a polished derivative (from its Ford Edge sibling) that provides a supple ride, quite cabin and plenty of passenger space.

ENGINE

Lift the hood and you’re greeted by a Ford Mustang-sourced 3.7L Ti-VCT V6 powerplant that produces around305 horsepower and 280pound-feet of torque. Our demo MKX came along with a smooth-shifting 6-speed automatic transmission with standard paddle shifters (that performs shifts quite well without too much hunting).

RIDE

The Pirelli tires wrapping 20” chrome-clad aluminum wheels give the MKX a steady yet smooth ride. The vehicles road mannerism gives you conÀdence in the driver’s seat under most conditions. Even under hard acceleration (out and about on the curvy desert back roads) the front end is planted to the tarmac and you feel quite conÀdent while pulling those high speed maneuvers.

HANDLING

The steering is relatively sharp and communicative, and the combination of front struts and rear trailing arms in the suspension system impart a nice, smooth ride with good cornering behavior. At highway speed the MKX’s cabin remains quite and the suspension does its job of soaking up most of the imperfections on the road.

SUMMARY

The Lincoln MKX is an extremely pleasant vehicle, easy to drive, convenient, possessed of an excellent and comprehensive safety package, and yes it’s deÀnitely nice to look at, especially on the inside. The four-zone color-coded MyLincoln Touch system is fun to use and fun to play with. The MKX’s wide array of onboard electronics and entertainment systems are clearly among the best in the industry in terms of capability and ease of use. All in all, the MKX is by far one of the best lookin’ CUV’s we’ve come across in a very long time!

“Lincoln said it replaced about sixty percent of the MKX’s parts and components, but by far the most conspicuous change was to the split wing grille, which has become the current Lincoln hallmark. It suits the MKX much better and remains unchanged on the 2013 model.”

NOVEMBER NOVEMBER/ /DECEMBER DECEMBER2013 2013

113


FROM CONCEPT

TO THE SHOWROOM FLOOR LINCOLN HITS SUAVE WITH THE ALL-NEW MKC 114

NOVEMBER / DECEMBER 2013

W

e don’t car if this is a concept – put it into production now! If you have been following Lincoln’s recent product revival strategy, they have been hard at work making cars that eschew the “sloppy-luxury” theme for cars and SUV’s that are smarter, more efÀcient and ever more luxurious. What’s even better is that Lincoln’s are becoming proper driver’s cars that would appeal to the luxury-minded motoring enthusiast.

Inspiration in Design

The MKC concept took the recently held Dubai International Motor show by storm last month and created quite the stir among the automotive community. The MKC takes inspiration from the new MKZ and builds on Lincoln’s Design DNA. Clearly Lincoln’s designers have gone the extra mile when it came to sketching the MKC. From the front, the MKC has design lines the echo the sort of styling that came about in the jet-set 60’s, juxtaposed with new-age LED lamps, brushed chrome accents and


pretty cool-looking headlamps. The upper grille, that Lincoln calls the “split-wing grille” is punctuated by the Lincoln logo and the fascia is divided by a crease that Áows down the center of the hood. The lower grille is a proper fusion of form meets function; the entire front end is spotted with air intake vents, slats , chrome accents and tastefully styled lighting elements.

Through the side & towards the rear

The design lines Áow crisply around the side proÀle of the car and the Àrst thing that you will notice about that side proÀle is the fact that there are no door-handles – an extremely cool touch no-doubt inspired by hot rod culture where shaved door handles were (and still are) the deÀnition of cool. The rear end on the MKC deÀnitely goes the extra mile and like the front, has extensive originality in design. The entire rear lift gate is a huge single piece which

incorporates a design element known as the “side-view cutline” that provides increased load capability while elevating the vehicle’s appearance.

Art on the inside

In keeping with Lincoln’s design philosophy of creating artistically designed automobiles, the interior has flowing surfaces, and perhaps most importantly – a gear selector that uses push buttons to select the desired range; an innovation that first saw the light of day in cars from the 50’s – nice touch that. Lincoln says that that design element

also frees up space on the center console area making the interior sleeker and tastier. Elsewhere on the inside, Lincoln has extensively advocated the use of the Ànest materials, so every surface that your hands come in contact with is covered in Alcantara suede and top grade natural wood veneers. Lincoln have not released details on what the engine and powertrain combo would be powering the MKC, but we hope that the stellar 3.7 liter V6 out of the Mustang is standard, as well as the Coyote 5.0 liter V8 (or perhaps that being a bit too optimistic!).

NOVEMBER / DECEMBER 2013

115


WHY YOU SHOULD BUY

A FORD NOW!

A

lmoayyed Motors has launched its Value Deals Campaign that will be running until the end of 2013. The exciting promotion offers customers discounts of up to BD 1,500 on selected SUVs and Sedans.

STATE OF THE ART PERFORMANCE Amongst the sedans available at exclusive prices is the Focus with a 1.6L and 100 HP engine. Crisp and agile, it is a popular choice for young drivers looking for a stylish car with state of the art performance technologies, like Ford’s signature Active Park Assist and SYNC. It is also equipped with an ABS braking system and dual zone automatic ACs. Also available is the Taurus that comes with a newly bold design that matches its roaring 3.5L V6 263 HP engine. It utilizes the signature MyKey, SYNC and MyFord Touch along with BLIS (Blind Spot Information System), a system which warns you of any

cars approaching you, making it the ultimate innovative sedan. Although smaller, the Figo takes pride in its enigmatic kinetic design and intelligent features that make it the smartest choice for your daily use. With a 1.6L 101 HP engine, front and passenger seat air bags and an ABS braking system, the Figo stands for strength and safety.

The Edge offers a bold aerodynamic exterior consisting of Áuid shapes and a smooth roof, giving it a fearless look. But besides its great looks, it comes with a V6, 3.5L engine and 286 HP, making it an impressive performer. The Edge also provides the driver with technology at their Àngertips, including SYNC® with MyFord Touch and MyKey features.

AN ARRAY OF SUVS

ADVENTUROUS & POWERFUL

For those looking for bigger cars that can accommodate more passengers and more cargo, Almoayyed Motors’ campaign is also extended to its wide array of SUVs, including the Escape, Explorer and Edge. The Escape takes capability up to entirely new level with its 2.5L iVCT I-4 engine and 168 HP. It also represents advanced engineering that utilizes a 6-speed SelectShift Automatic® Transmission, along with the latest technologies, including SYNC® system with MyFord Touch® and the iconic MyKey feature.

The biggest in the range of SUVs available at amazing prices is the Ford Explorer. Adventurous and powerful, it has a V6 3.5L, 290 HP engine and is spacious enough to seat up to seven passengers comfortably. It also allows you to select the terrain settings to maximize performance and adapt to your preference, including normal, sand and mud with its Terrain Management System feature. With its MyFord Touch and MyKey systems, the Explorer is the ideal choice for bigger families.

To experience the powers of Ford’s sedans and SUVs, visit Almoayyed Motors in Sitra or call 17 737373 to book your test drive today.

116

NOVEMBER NOVEMBER/ /DECEMBER DECEMBER2013 2013


DO YOU NEED... Oil Change O OBattery Change O OWiper Blade Change O OLight Bulbs Change O OBrake Change O OA/C Foul Odor Cleaning O OA/C Gas Filling O O

SPECIAL INTROD UCTORY RATE

BD15

OIL CHA NG (Includes F Oil & Oil uchs Filter)

Call autoMAX...WE COME TO YOU FOR A CHANGE!

A. P.O. Box 108, Manama, Bahrain T. +973 17 404 131 F. +973 17 405 441 W. www.automaxme.com autoMAX Car Care spc

E


FASHION

THE LAT A EST AND TRENDIEST WAY TO DRESSING UP BIG brings to you the latest fashion from the top brands in the fashion world. vv

Akris Belted Zip-Vent Wool Dress Refined zipper details and a leather belt cinched with a trapezoidal buckle define this chic silhouette. arkis.com

HUGO Adris Blazer A classic blazer handsomely refined in an Italian wool blend. Hugo.com

118

NOVEMBER / DECEMBER 2013


Reed Krakoff Mini Atlantique Tote A structured and modern style in luxurious leather with a colorblocked design. Reedkrakoff.com

Burberry Embossed Check Square Cuff Links Elegant, embossed cuff links with signature check detail lend undeniable style to any dress wardrobe. Burberry.com

Burberry Stainless Steel Watch Polished yet practical design, set in stainless steel with iconic check design on the dial. Burberry.com

Christian Louboutin Trotter Leather & Suede Ankle-Strap Pumps Artfully sculpted cutouts lend sexy style to a towering design made of leather and suede. Christianlouboutin.com

NOVEMBER / DECEMBER 2013

119


LIFESTYLE

STUFF WE LIKE Check out the latest gadgets and a host of other items for executives on a break or having some family time Ă&#x2C6;ITRUE-VIEW â&#x20AC;&#x201C; THE 3D DEVICE FOR YOUR SMARTPHONE

The True-View device basically incorporates a widget that has strategically-positioned mirrors which enable the smartphone lens to be split into two stereoscopic images. The two images are then placed at a certain distance away from the other which is similar to the distance between the two eyes. Hence, with the True-View you can take photos and videos by placing the smartphone inside the device. Viewing the split image by either eyes independent of each other is what enables the spectacular 3D effect.

photocritic.org

Ă&#x2030;iSPY

TANK

Use your iPhone, iPad or iPod to control and send your Spy Tank on a secret spy mission, even in night time! This baby has been supplied with an adjustable camera that takes perfect photos and shoots a live video! You can also hear every sound produced in the investigated location, as the tank has a special built-in microphone. If itâ&#x20AC;&#x2122;s dark you can use the uncatchable infrared night vision, nobody can hide from you!

ispytank.com

Ă&#x2026;SOLAR

RESTORE EXTERNAL BATTERY

The ReVIVE Series Solar ReStore External Battery Pack is better than other products that charge laptops, smartphones, mp3 players etc. Itâ&#x20AC;&#x2122;s because it has augmented functionality when it comes to possibilities of charging. The compact and portable device has a powerful internal battery that can be charged from an AC outlet, USB hub or by solar power! Bring it along to restore â&#x20AC;&#x153;juiceâ&#x20AC;? to other devices when youâ&#x20AC;&#x2122;re on the go!

accessorypower.com

120

NOVEMBER / DECEMBER 2013

Ă&#x2C6;LINKASE

FOR IPHONE 5 AND 5S

The Linkase WiFi-Signal Enhancing Case for iPhone 5 is designed to upgrade the daily mobile device experience of every user! It features a built in antenna that uses a special signal-enhancing technology called â&#x20AC;&#x153;Electromagnetic Waveguideâ&#x20AC;? to increase the Wi-Fi signal power up to 50%! That way you could connect more easily to any wireless internet source and enjoy HCUVGTWRNQCFKPIFQYPNQCFKPICPFYGDUWT²PI

absolute.com


Ă&#x2020;SMART

SUITCASE

The Hop! Is one unique suitcase and a great piece of luggage that will provide the ultimate comfort and usability value to its owner. This compressed air-powered suitcase is equipped with innovative two-track caterpillar track system that can enable it to crawl behind you around the airport. However, the tracks would not be able to work well on stairs. It has the ability to lock onto your mobile phone signal with its three inbuilt receivers and then it triangulates its position KPCOCPPGTVJCVKVHQNNQYU[QWHTQOC²ZGF distance with the help of a micro-controller. In case it does lose its way and gets â&#x20AC;&#x2DC;lostâ&#x20AC;&#x2122; then the suitcase automatically locks itself and your cell phone is vibrated to alert you of the situation.

www.want-that.com

Ă&#x2026;S.T.

DUPONT PHOENIX BLACK LIGHTER

Ă&#x2021;HUMAN

REGENERATOR

The â&#x20AC;&#x2DC;Human regeneratorâ&#x20AC;&#x2122; was developed by System 4 Technologies Gmbh. The German company will only make 50 pieces annually. This anti ageing device has been RTKEGF $&CRRTQZ CPF a huge curiosity has already made way. The version of the human regenerator that you see here is a diamond encrusted version of the regenerator. Human regenerator has been designed using a unique technology by the name of Quantum Cell Code. Bodyâ&#x20AC;&#x2122;s natural frequencies are imitated in quantum cell technology and longitudinal waves get generated. Silicon and aluminum deposits have been used and these help create the anti ageing effect.

Lighters Direct is known as the worldâ&#x20AC;&#x2122;s premier online shopping center for consumers looking for lighters and cigar accessories. The establishment is adding a new treat to its collection, aptly named the S.T. Dupont Black Limited Edition .KIPG.KIJVGTU+VTQWIJN[HQNNQYUVJG design and model of the S.T. Dupont Phoenix Prestige Limited Edition Ligne CNVJQWIJVJGPGYNKPGKUDGVVGTKPVGTOU QHKVUGPJCPEGF²PKUJGU#U[QWECPUGG the Phoenix Black lighter is decorated with Chinese lacquer, white bronze patina CPFGODGFFGFTWDKGU9KVJQPN[.KIPG NKIJVGTUOCFGYKVJVJKUFKUVKPIWKUJGF ²PKUJVJGUGRTQFWEVUCTGTCTGKPFGGF#NN RTQFWEVUCTGCXCKNCDNGGZENWUKXGN[CV Lighters Direct. The Phoenix Black lighter KURTKEGFCV $&CRRTQZ 

lightersdirect.com

human-regenerator.com

Ă&#x2026;ELEMOUNT

Simplicity is key: the eleMount needs only to be mounted with one hand. CNC machined, with an elegant yet minimalist design, the eleMount is made from solid aluminum. Itâ&#x20AC;&#x2122;s designed with two elePads, thus ensuring a solid and safe hold of your object. In CFFKVKQP[QWYKNN²PFCĂ&#x17E;ŠVJTGCFCVVJGDCUGQH the eleMount, allowing you to use your tripod to snap away with professional smartphone phones or videos. An added bonus: the eleMount does not rely on plastic clamps, locks, or even suction cups. Rather, the device uses proprietary sticky pads to ensure that gadgets are secureâ&#x20AC;Ś without any messes to clean up later.

elephantele.com

Ă&#x2020;NIKE+

FUELBAND SE

Nike releases a new and improved version of the FuelBand that has a few interesting perks added to the original QPG6JGPGYOQFGNQHVJG²VPGUUVTCEMGTKUECNNGF0KMG  FuelBand SE. It offers a variety of color details and repreUGPVUVJGURQTVKPIIQQFUOCMGTÂŤU²TUVPQPEQUOGVKEWRFCVG VQKVUCEVKXKV[VTCEMKPIYGCTCDNGFGXKEGUKPEGKVU²TUVKPVTQduction. The second generation of this product has similar FGUKIPVQVJG²TUVXGTUKQPYKVJCTWDDGTYTKUVDCPFCXCKNCDNGKP different sizes. However, it has been developed to encourage people even more when it comes to daily activity and moving, plus itâ&#x20AC;&#x2122;s harder to cheat with, as for example motions NKMG²UVRWPEJKPIVJGCKTYQPÂŤVJGNR[QWWR[QWTUEQTG6JG FuelBand SE also seems to better distinguish different type of activities, such as: rowing, spinning, cycling etc.

nike.com

NOVEMBER / DECEMBER 2013

121


*HWLW¿UVW*HWLWIDVW %X\QRWKLQJXQWLO\RXUHDGARABIAN HOMES

$5$%,$1+20(6LV%DKUDLQ¶VSUHPLHUH5HDO(VWDWHPDJD]LQHFRYHULQJDZLGHUDQJHRI DUHDVUHODWLYHWRWKHKRXVLQJLQGXVWU\LQ%DKUDLQDQGEH\RQGIURPLQGHSWKUHYLHZVRI GHYHORSPHQWVDQGSURSHUW\LQYHVWPHQWWRDUWGHVLJQDQGOLIHVW\OH$UDELDQ+RPHVLV KLJKO\SRSXODUDPRQJVWSURSHUW\GHYHORSHUVDQGLQYHVWRUVKRPHRZQHUVSURVSHFWLYH EX\HUVIXUQLWXUHVKRSVDQGWKRVHORRNLQJWRVHWWOHGRZQ ARABIAN HOMES magazine is sold in supermarkets and bookstores across the GCC.

SUBSCRIBE NOW LVVXHVRQO\%' 9LVLWRXUZHEVLWHZZZPD[PHGLDFRFRP 2UFDOO


&ODVVL¿HGV

Did you know Business In Gulf reader’s are always looking for >> Web Services IT Solutions Lawyers Accounting Firms New Business Opportunities Franchise Opportunities Printing Services Courier and Logistics Office Locations and Much more ....

Advertise Now

Call 17402482 www.maxmediaco.com

Because life isn’t always easy to balance... - Feeling Depressed? - Having Relationship Issues? - Weird Thoughts Bothering you? - 7URXEOHZLWK)DPLO\&RQÀLFWV"

Well worry no more! The answer to your issues is a phone call away. Anne Mostafa,PsyD Clinical Psychologist Tel: +973 36317033, email: doctoranna@psychologistbahrain.com www.bahrainpsychologist.com NOVEMBER / DECEMBER 2013

123


. . the B I G

HOTEL guide YOUR GUIDE TO THE KINGDOM’S HOTEL OUTLETS

DINING       Al Safir Restaurant

ƒ•–”‘‘‹…ƒŽ„—ơ‡–•ˆ‘”„”‡ƒˆƒ•– Ž—…Šƒ††‹‡”ƒ•™‡ŽŽƒ••—’‡”„ž Žƒ…ƒ”–‡‘’–‹‘•Ǥ

Opening Hours: Š—”•†ƒ›Ǧƒ–—”†ƒ› ͕͖ǣ͔͗–‘͗ǣ͔͔ ˜‡”›‹‰Š–‡š…‡’– —†ƒ›ǣ͜ǣ͔͔–‘͕͕ǣ͔͔ ‹ƒƒ‹•…Ž‘•‡†‘—†ƒ›•

Saraya: All Day Dining / International š“—‹•‹–‡„—ơ‡–•™‹–Šƪƒ˜‘”•ˆ”‘ƒ…”‘••–Š‡ ™‘”Ž†Ǥ˜ƒ‹Žƒ„Ž‡‹•„”‡ƒˆƒ•–ǡŽ—…Šƒ††‹‡” ƒ†ƒŽ•‘ƒŽƒ…ƒ”–‡ƒ†Ž‹˜‡…‘‘‹‰•–ƒ–‹‘Ǥ

Soie Chinese Restaurant

Wok: South East Asian Restaurant

Golestan Restaurant ‹•…‘˜‡”›‘ˆ–”ƒ†‹–‹‘ƒŽ ”ƒ‹ƒ †‹•Š‡•™‹–Šˆ”‡•ŠŽ›‘˜‡Ǧ„ƒ‡† „”‡ƒ†••‡”˜‡†ƒ––Š‡–ƒ„Ž‡Ǥ Opening Hours: —†ƒ›–‘Š—”•†ƒ›—…Š͕͖ǣ͔͗ Ȃ͖ǣ͙͘ ‹‡”͛ǣ͔͗’ǤǤȂ͕͕ǣ͔͗ ”‹†ƒ›ǣ—…Š͕͖ǣ͔͗Ȃ͗ǣ͙͘ ‹‡”͛ǣ͔͗Ȃ͕͕ǣ͔͗ Ž‘•‡†‘ƒ–—”†ƒ›•

Espressamente Illy ’‡”ˆ‡…–’Žƒ…‡–‘‡‡–ƒ†‡Œ‘› ƒ…—’‘ˆ‡•’”‡••‘ǡ”‡ˆ”‡•Š‹‰ „‡˜‡”ƒ‰‡•ƒ†Ž‹‰Š–•ƒ…•Ǥ Opening Hours: ƒ‹Ž›ǣ͛ǣ͔͔Ȃ͕͔ǣ͔͔ For Information & Reservations ŽƒƤ”ǣ +973 17533533 ext 259 ‘‹‡Š‹‡•‡‡•–ƒ—”ƒ–ǣ +973 17 533 533 ext. 497

‘Ž‡•–ƒ‡•–ƒ—”ƒ–ǣ +973 17 533 533 ext. 375

NOVEMBER / DECEMBER 2013

‡•‹‰‡†™‹–Šƒ‹†‘‘”ƒ†ƒ‘—–†‘‘” •‡ƒ–‹‰ƒ”‡ƒǡ–Š‹•‘—–Ž‡–™‹ŽŽ•‡”˜‡ƒ—–Š‡–‹…

–ƒŽ‹ƒˆ‘‘†Ǥ

Opening Times: ƒ‹Ž›͚ǣ͔͗–‘͕͔ǣ͔͗ ȋ͕͕‘™‡‡‡†•Ȍ —…Šǣ͕͖ǣ͔͗–‘͗ǣ͔͗ ‹‡”ǣ͛ǣ͔͔–‘͕͔ǣ͔͗

Opening Hours: ƒ‹Ž›ǣ͛ǣ͔͔Ȃ͕͕ǣ͔͗ Ž‘•‡†‘ ”‹†ƒ›•

124

Fiamma: Italian Restaurant

Opening Hours: ”‡ƒˆƒ•–͚ǣ͔͗Ǧ͕͔ǣ͔͗ —…Š͕͖ǣ͔͗Ȃ͗Ǥ͔͗ ‹‡”͛ǣ͔͗Ȃ͕͕ǣ͔͗ ‡Žƒš‹–Š‡†”ƒƒ–‹…ƒ„‹‡…‡ ™‹–Š†ƒ”™‘‘†ƪ‘‘”•ǡ‘”‹‡–ƒŽ ‘”ƒ‡–•ƒ†Žƒ–‡”•Ǥ

Baharat, Kempinski

      Ƭ

•’”‡••ƒ‡–‡ ŽŽ›ǣ +973 17 533 533 ext. 1790

Š‡’‡”ˆ‡…–…‘„‹ƒ–‹‘‘ˆ•–‘‡•ƒ†™‘‘† ‹–Š‡†±…‘”–‘”‡ƪ‡…–ƒ•‹ƒˆ‡‡Ž‹‰‹• †‡Ƥƒ–Ž›–Š‡”‡Ǥ Opening Hours: ‡†‡•†ƒ›–‘‘†ƒ›ǣ ͛ǣ͔͔–‘͕͕ǣ͔͔ ‘‹•…Ž‘•‡†‘—‡•†ƒ›•

Tapas: Restaurant

–•‡”˜‹…‡•ƒ™‹†‡”ƒ‰‡‘ˆ‡š…‹–‹‰–ƒ’ƒ•ǡƒ† –Š‡„‡•–…‘…–ƒ‹Ž•‘–Š‡‹•Žƒ†Ǥƒ’ƒ•„ƒ”Šƒ• ƒ–”—Ž›˜‹„”ƒ–ƒ†Ž‹˜‡Ž›ƒ–‘•’Š‡”‡™‹–Š‹–• —„ƒ„ƒ†Ǥ Opening Hours: ƒ‹Ž›ǣ͕͕ǣ͔͗–‘‹†‹‰Š–

La Mer: Seafood Restaurant

–‹•–Š‡•‹‰ƒ–—”‡”‡•–ƒ—”ƒ–‘ˆ–Š‡Š‘–‡Žǡ‰—‡•–• ™‹ŽŽ‡Œ‘›–Š‡ˆ”‡•Š‡•–•‡ƒˆ‘‘†ƒ†…ƒ–…Š‘ˆ–Š‡ †ƒ›…‘‘‡†ƒ––Š‡Ž‹˜‡…‘‘‹‰•–ƒ–‹‘™‹–Šƒ ”‡…Š•ƒ˜‘‹”Ǧˆƒ‹”‡–‘’Ž‡ƒ•‡ƒŽŽ–ƒ•–‡•Ǥ Opening Hours: ƒ‹Ž›ǣ͛ǣ͔͔–‘͕͕ǣ͔͔

Pashawat: Arabic Restaurant

–‹•‘’‡‹–Š‡‡˜‡‹‰•ƒ†‘ơ‡”•ƒ †‡Ž‹‰Š–ˆ—Ž‡„ƒ‡•‡…—‹•‹‡Ǥ —‡•–•™‹ŽŽ‡Œ‘› Žƒ”‰‡˜ƒ”‹‡–‹‡•‘ˆ‡œœƒŠƒ•™‡ŽŽƒ•†‡Ž‹…‹‘—• …Šƒ”…‘ƒŽ‰”‹ŽŽ‡†•’‡…‹ƒŽ–‹‡•Ǥ Opening Hours: ‘†ƒ›–‘ ”‹†ƒ›ǣ͛ǣ͔͔–‘͕ǣ͔͗ ȋŽ‘•‡†‘ƒ–—”†ƒ›•ƒ†—†ƒ›•Ȍ For Information & Reservations Hotel: +973 1763 6363 Concierge: +973 39349659


La Med, Ritz Carlton

China Garden

Zahle

Š‡”‡•–ƒ—”ƒ–ǡ™Š‹…Š‹•†‡•‹‰‡† ‹ƒ‘†‡”‘”‹‡–ƒŽ•–›Ž‡ǡ ‘ơ‡”•ƒ˜ƒ”‹‡†•‡Ž‡…–‹‘‘ˆˆ‘‘† ‹ƪ—‡…‡†„›†‹•–‹…–Š‹‡•‡”‡‰‹‘• …”‡ƒ–‹‰ƒ–‘‡•‡ǡœ‡…Š—ƒƒ† ‡‹‰•’‡…‹ƒŽ–‹‡•Ǥ

Š‡‡—„‘ƒ•–•ƒ‡š–‡•‹˜‡ •‡Ž‡…–‹‘‘ˆŠ‘–ƒ†…‘Ž†‡œœ‡ǡ‰”‹ŽŽ‡† ‡ƒ–ƒ†”‡‰‹‘ƒŽ‡„ƒ‡•‡ˆƒ”‡ǡ•—…Š ƒ•„‡ƒ—–‹ˆ—ŽŽ›’”‡•‡–‡†•Š‹•Š‡„ƒ„ •‡”˜‡†‹ƒ‰‘Ž†‡„‘šƒ–‘’™ƒ” ”ƒ„‹…„”‡ƒ†ƒ†„—”‹‰…‘ƒŽ•Ǥ

Opening Hours: ‘†ƒ›–‘ƒ–—”†ƒ› —…Š͕͖ǣ͔͔’–‘͗ǣ͔͔’ ‹‡”͛ǣ͔͔’–‘͕͕ǣ͔͔’ Ž‘•‡†‘—†ƒ›

Opening Hours: ‘†ƒ›–‘ ”‹†ƒ› ‡‡†ƒ›•ǣ͛ǣ͔͔’Ȃ͕ǣ͔͔ƒ ‡‡‡†•ǣ͛ǣ͔͔’Ȃ͖ǣ͔͔ƒ Saturday —…Š͕͖ǣ͔͔’Ǧ͗ǣ͔͔’ ‹‡”͛ǣ͔͔’Ȃ͖ǣ͔͔ƒ

Fusions

   Klouds Œ‘›ƒƒ••‘”–‡–‘ˆ…—Ž‹ƒ”›†‡Ž‹‰Š–• ™‹–Š–Š‡‹”•’‡…‹ƒŽŠ‡‡†‹‰Š–• ‡˜‡”›†ƒ›‘ˆ–Š‡™‡‡Ǥ Opening Hours: ƒ‹Ž›ǣ͛–‘͕͕

Friday Brunch ‹•…‘˜‡”Š‡†‹ơ‡”‡…‡‹ ”‹†ƒ›”—…ŠǨ

Plums Š‡•’‡…‹ƒŽ–›„‡‹‰’”‡‹—„‡‡ˆ ƒ†ˆ”‡•Šǡ–‘’“—ƒŽ‹–›•‡ƒˆ‘‘†ǡ‹– ’”‘˜‹†‡•‰—‡•–•™‹–Š–Š‡—Ž–‹ƒ–‡‹ †‹‹‰’Ž‡ƒ•—”‡Ǥ Opening Hours: ‹‡”ǣ͛–‘͕͕ǣ͔͗

Primavera ”‹ƒ˜‡”ƒǡ–Š‡‡˜‡”’‘’—Žƒ” –ƒŽ‹ƒ ”‡•–ƒ—”ƒ–‘ơ‡”•ƒ˜‡”›‡š…‹–‹‰‡—Ǥ

Opening Hours: ”‹†ƒ›ǡ͕͖ǣ͔͗–‘͘ǣ͔͗

Opening Hours: —…Šǣ‘‘–‘͗ ‹‡”ǣ͛–‘‹†‹‰Š–

The K lounge

Nirvana

‘‡‡™†‹•Š‡•‹…Ž—†‡–Š‡™‘”Ž†ˆƒ‘—• ‰—••–‡ƒ•ƒ†‡š…‡’–‹‘ƒŽ†‡••‡”–• ™‹–Š–Šƒ–‡š–”ƒƪƒ˜‘”Ǥ —”‘‰‘‹‰’”‘‘–‹‘•‹…Ž—†‡ǣ ƒ‹Ž› ƒ’’› ‘—”ˆ”‘͙’–‘͛’ ‘‘”•‹‰Š–Ƭ—”‰‡””‡ƒ–• ƒ†‹‡•‹‰Š–ˆ”‘ƒ–—”†ƒ›–‘‡†‡•†ƒ› ƒŽŽ…‘…–ƒ‹Ž•ˆ”‡‡‘ˆ…Šƒ”‰‡ˆ‘”ƒ†‹‡•Ǥ

‹”˜ƒƒ„”‹‰•”‘›ƒŽƪƒ˜‘”•–‘Š‡ ‹–œǦƒ”Ž–‘ˆ‘”ƒ†‹‹‰ƒ†˜‡–—”‡ ”ƒ”‡Ž›‡Œ‘›‡†‘—–•‹†‡‘ˆ †‹ƒǤ

Opening Hours: ƒ‹Ž›ǣ͕͕–‘͖

Š‡‹–œǦƒ”Ž–‘Šƒ•ƒ†‡†‹…ƒ–‡†…‹‰ƒ” Ž‘—‰‡™‹–Šƒ…‡ŽŽƒ”‘ˆ’”‡‹—ƒŽ–•ǡ …‘‰ƒ…•ƒ†˜‹–ƒ‰‡™‹‡•Ǥ

Kenza Lounge

Opening Hours: ƒ‹Ž›ǣ‘‘–‘͖

—–†‘‘”•‡ƒ–‹‰ƒ†”ƒ„‡•“—‡‹–‡”‹‘”•ǡ ‡š’‡”‹‡…‡–Š‡Ƥ‡•–‡„ƒ‡•‡†‹‹‰Ǥ Opening Hours: —‡•†ƒ›–‘—†ƒ›ǣ͛–‘͖

K Hotel: (973) 1736 0000 Klouds: (973) 1736 0000 ext. 4019 K Pool: (973) 1736 0000 or email banquet@thekhotel.com

  ǧǡ    Ƭ Overlook Café Š‡’‡”ˆ‡…–’Žƒ…‡–‘”‡Žƒš„›–Š‡™ƒ–‡” ƒ†‡Œ‘›ƒ˜ƒ”‹‡–›‘ˆŽ‹‰Š–Ž—…Š‹–‡•ǡ ”‡ˆ”‡•Š‡–•ǡ„‡˜‡”ƒ‰‡•ƒ†…‘…–ƒ‹Ž• ™‹–Šƒ–”‘’‹…ƒŽƪƒ‹”Ǥ Opening Hours: ƒ‹Ž›ǣ͕͔–‘͚

La Med ƒ•—ƒŽ†‹‹‰‹‰‡‡”‘—••—””‘—†‹‰•‹• „”‹‰Š–‡‡†™‹–Šƒ–—”ƒŽ•—•Š‹‡ƒ†˜‹‡™• ‘ˆ–Š‡–—”“—‘‹•‡„Ž—‡™ƒ–‡”•‘ˆ–Š‡ —ŽˆǤ Opening Hours: ‘–‹‡–ƒŽƒ†”ƒ„‹…”‡ƒˆƒ•–ǣ ͛–‘͕͔ǣ͔͗ —…Š—ơ‡–ǣ‘‘–‘͗ǣ͔͗ —…Šš’”‡••ǣ‘‘–‘͗ǣ͔͗ ŽŽƒ›‹‹‰‡—ǣ͗ǣ͔͗ ‹‡”ǣ͛–‘͕͕ǣ͔͗ ”‹†ƒ›”—…Šǣ͕͖ǣ͔͗–‘͘

Opening Hours: —…Š‘‘–‘͗ ‹‡”͛–‘͕͕ǣ͔͗

Burlington Club

The Lobby Lounge Š‡–”ƒ†‹–‹‘ƒŽŠ‹‰Š–‡ƒ‹••‡”˜‡† †ƒ‹Ž›‹–Š‡‘„„›‘—‰‡ƒ†„‘ƒ•–• ƒŽŽ–Š‡Ž—š—”‹‘—•†‡Ž‹…ƒ…‹‡•–Šƒ–›‘— ™‘—Ž†‡š’‡…–Ǥ Opening Hours: ƒ‹Ž›ǣ͜–‘‹†‹‰Š–

The Ritz Gourmet Lounge š’‡”‹‡…‡ƒ—–Š‡–‹……Š‹…ƒ„‹‡…‡ Ž‹‡‹ƒƒ”‹•‹ƒƒŽ‘‰™‹–ŠŠ‘‡ƒ†‡ ’ƒ•–”‹‡•ƒ†”‹…ŠŽ›†‡…‘”ƒ–‡††‡••‡”–•Ǥ Opening Hours: ƒ‹Ž›ǣ͛–‘‹†‹‰Š– For Information & Reservations Hotel: +973 1758 0000

   Al Waha ‹‡”•ƒ”‡•’‘‹Ž–ˆ‘”…Š‘‹…‡™‹–Š ƒ‡š–‡•‹˜‡ƒ””ƒ›‘ˆ„—ˆˆ‡–ˆƒ”‡ ˆ‡ƒ–—”‹‰Ž‘…ƒŽƒ†‹–‡”ƒ–‹‘ƒŽ †‹•Š‡•ǡƒ•™‡ŽŽƒ•ƒ‹’”‡••‹˜‡˜ƒ”‹‡–› ‘ˆƒŠ”ƒ‹‹Š——•Ǥ Opening Hours: ”‡ƒˆƒ•–͚ǣ͔͔ƒȂ͕͔ǣ͔͗ƒ —…Š͕͖ǣ͔͔’Ȃ͗ǣ͔͗’ ‹‡”͛ǣ͔͔’Ȃ͕͕ǣ͔͔’ ”‹†ƒ›”—…Šǣ͕͖ǣ͔͗’Ǧ͘ǣ͔͔’

—•‹‘•‹•ƒ…‘–‡’‘”ƒ”›ƒ† •–›Ž‹•Š”‘‘ˆ–‘’”‡•–ƒ—”ƒ–„‘ƒ•–‹‰ —”‹˜ƒŽŽ‡†˜‹‡™•‘˜‡”–Š‡Š‘–‡Žǯ• –”‘’‹…ƒŽ‰ƒ”†‡•ƒ†ƒƒƒ•›Ž‹‡Ǥ Opening Hours: —†ƒ›–‘ ”‹†ƒ›͚’Ȃ͕͖ƒ Ž‘•‡†‘ƒ–—”†ƒ›

La Pergola ‡‘™‡†ˆ‘”„‡‹‰‘‡‘ˆƒŠ”ƒ‹ǯ• ‘Ž†‡•– –ƒŽ‹ƒ‡ƒ–‡”‹‡•ǡ–Š‡‹–‹ƒ–‡ ”‡•–ƒ—”ƒ–‘ơ‡”•ƒˆƒ–ƒ•–‹… ‡†‹–‡””ƒ‡ƒƒ„‹‡…‡™‹–Šƒ ˜ƒ—Ž–‡†”‘‘ˆƒ†•–”‹‹‰™ƒŽŽ—”ƒŽ• †‡’‹…–‹‰•…‡‡•‘ˆƒ…‹‡–‘‡Ǥ Opening Hours: —…Š͕͖ǣ͔͔’Ȃ͗ǣ͔͔’ ‹‡”͛ǣ͔͔’Ȃ͕͕ǣ͔͔’

Al Waha: +973 1774 6425/26 China Garden: +973 1774 6423/24 Fusions: +973 1771 3000 La Pergola: +973 1774 6419/20 Margarita Mexicana: +973 1774 6462 Royal Thai: +973 1774 6421/22 Sato: +973 1774 6429/30 Takht Jamsheed: +973 1774 6431/32 Zahle: +973 1774 6417/18

      

Margarita Mexicana ŽŽ†‹•Š‡•ǡ‹…Ž—†‹‰–‘”–‹ŽŽƒ•ƒ† ‰—ƒ…ƒ‘Ž‡ǡƒ”‡ˆ”‡•ŠŽ›’”‡’ƒ”‡†ƒ– ‰—‡•–•ǯ–ƒ„Ž‡•–‘‰—ƒ”ƒ–‡‡–Šƒ––Š‡ ‡—ƒ†Ƥ‡†‹‹‰‡š’‡”‹‡…‡ƒ”‡ ƒ•ƒ—–Š‡–‹…ƒ•’‘••‹„Ž‡Ǥ Opening Hours: —†ƒ›–‘ ”‹†ƒ›͚ǣ͔͔’Ȃ͕͖ǣ͔͔ƒ Ž‘•‡†‘ƒ–—”†ƒ›•

Txoko ƒ•“—‡•›Ž‘—‰‡•‡”˜‡•Ž‹––Ž‡’Žƒ–‡• ‘ˆ’‹–š‘•ȋ–ƒ’ƒ•ȌǤ Opening Hours: ƒ‹Ž›ǣ͕͚ǣ͔͔Ǧ͖ǣ͔͔

Imari ƒ’ƒ‡•‡”‡•–ƒ—”ƒ–ǡ„ƒ”ǡƒ†Ž‘—‰‡Ǥ

Royal Thai Š‡”‡•–ƒ—”ƒ–‹••‹–—ƒ–‡†‹ƒ ‰”ƒ†’ƒ‰‘†ƒ‹–Š‡‰”‘—†•‘ˆ –Š‡Š‘–‡Žǯ•–”‘’‹…ƒŽ‰ƒ”†‡•ƒ† ’”‘˜‹†‡••…‡‹…˜‹‡™•‘˜‡”Ž‘‘‹‰ –Š‡–—”“—‘‹•‡™ƒ–‡”•‘ˆ–Š‡‘—–†‘‘” •™‹‹‰’‘‘ŽǤ Opening Hours: —‡•†ƒ›–‘—†ƒ› —…Š͕͖ǣ͔͔’Ȃ͗ǣ͔͔’ ‹‡”͛ǣ͔͔’Ȃ͕͕ǣ͔͔’ Ž‘•‡†‘‘†ƒ›•

Opening Hours: ƒ‹Ž›ǣ͕͜ǣ͔͔Ǧ͖ǣ͔͔

Le Sauvage ”‡…Š•–‡ƒŠ‘—•‡ǡ ‘’‡‰”‹ŽŽ”‡•–ƒ—”ƒ–Ǥ Opening Hours: ƒ‹Ž›ǣ͚ǣ͔͗Ǧ͔͔ǣ͔͔

Le Domain [34] ‘—–Š‘ˆ ”ƒ…‡…—‹•‹‡ Opening Hours: ƒ‹Ž›ǣ͚ǣ͔͗Ǧ͔͔ǣ͔͔

Sato

–‹•ˆƒ˜‘”‡†„› ƒ’ƒ‡•‡„ƒ••› •–ƒˆˆ™Š‘ƒ”‡•ƒ‹†–‘Ž‘˜‡‹–• ’‡ƒ…‡ˆ—Ž‡ǦŽ‹‡•—””‘—†‹‰• ƒ†‡š“—‹•‹–‡ˆ‡ƒ–—”‡•ǡ‹…Ž—†‹‰ –‡’’ƒ›ƒ‹”‘‘•ƒ†ƒƒ—–Š‡–‹… ”‘„ƒ–ƒ›ƒ‹‰”‹ŽŽƒ†ƒ—•Š‹„ƒ”™‹–Š ƒ•‘‹‰•‡…–‹‘Ǥ Opening Hours: —…Š͕͖ǣ͔͔’Ȃ͗ǣ͔͔’ ‹‡”͛ǣ͔͔’Ȃ͕͕ǣ͔͔’

Figs & Olives …ƒ•—ƒŽ†—‡–‡ƒ–‡”›‘ˆ„‘–Š…Žƒ••‹…

–ƒŽ‹ƒƒ†‡„ƒ‡•‡…‘ˆ‘”–ˆ‘‘†•Ǥ Opening Hours: ƒ‹Ž›ǣ͕͖ǣ͔͔Ǧ͔͔ǣ͔͔

The Cigar Lounge ‡Ƥ‡†•’ƒ…‡ˆ‘”‡Œ‘›‹‰ƒ “—ƒŽ‹–›…‹‰ƒ”Ǥ Opening Hours: ƒ‹Ž›ǣ͕͜ǣ͔͔Ǧ͔͔ǣ͔͔

Takht Jamsheed ƒ‹‰‹•’‹”ƒ–‹‘ˆ”‘‡”•‹ƒǯ•”‘›ƒŽ ’ƒŽƒ…‡‘ˆƒŠ– ƒ•Š‡‡†ǡ–Š‡ —Žˆ ‘–‡Žǯ•…Š‹…”‡•–ƒ—”ƒ–‘ơ‡”•ƒƤ‡ †‹‹‰‡š’‡”‹‡…‡Ƥ–ˆ‘”ƒ‹‰Ǥ Opening Hours: —‡•†ƒ›–‘—†ƒ› —…Š͕͖ǣ͔͔’Ȃ͗ǣ͔͔’ ‹‡”͛ǣ͔͔’Ȃ͕͕ǣ͔͔’ Ž‘•‡†‘‘†ƒ›•

For Reservations

The Deli ƒˆ±Ǧ–ƒ‡ƒ™ƒ›’Žƒ…‡–‘‰”ƒ„ ƒ“—‹…„‹–‡Ǥ Opening Hours: ƒ‹Ž›ǣ͜ǣ͔͔Ǧ͖͕ǣ͔͔ For Information & Reservations

Hotel: +973 16000 400, 16000 200, 16000 222, 16000 333.

NOVEMBER / DECEMBER 2013

125


Royal suite, living area - The K Hotel

    ĆŹ   

Opening hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x203A;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?ÇŚÍ&#x2022;Í&#x2013;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?

T-spoon

Â&#x2021;Â&#x2020;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;Â&#x201D;Â&#x192;Â?Â&#x2021;Â&#x192;Â? Â&#x201D;Â&#x2039;Â&#x17D;Â&#x17D;Â&#x201E;Â&#x2014;ĆĄÂ&#x2021;Â&#x2013; Â&#x201D;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x192;Â&#x2014;Â&#x201D;Â&#x192;Â?Â&#x2013;Â&#x2022;Â&#x2021;Â&#x201D;Â&#x2DC;Â&#x2039;Â?Â&#x2030;Â&#x192;Â&#x2DC;Â&#x192;Â&#x201D;Â&#x2039;Â&#x2021;Â&#x2013;Â&#x203A; Â&#x2018;Â&#x2C6;Â&#x2021;Â&#x2020;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;Â&#x201D;Â&#x192;Â?Â&#x2021;Â&#x192;Â?Â&#x192;Â?Â&#x2020; Â&#x2039;Â?Â&#x2013;Â&#x2021;Â&#x201D;Â?Â&#x192;Â&#x2013;Â&#x2039;Â&#x2018;Â?Â&#x192;Â&#x17D;Â&#x2C6;Â&#x2018;Â&#x2018;Â&#x2020;Â&#x2022;Ǥ

Â&#x2018;Â?Â&#x2DC;Â&#x2021;Â?Â&#x2039;Â&#x2021;Â?Â&#x2013;Â&#x17D;Â&#x203A;Â&#x17D;Â&#x2018;Â&#x2026;Â&#x192;Â&#x2013;Â&#x2021;Â&#x2020;Â&#x2018;Â?Â&#x2013;Â&#x160;Â&#x2021;Â&#x2030;Â&#x201D;Â&#x2018;Â&#x2014;Â?Â&#x2020; ĆŞÂ&#x2018;Â&#x2018;Â&#x201D;Â&#x2018;Â&#x2C6;Â&#x2021;Â?Â&#x2019;Â&#x2039;Â?Â&#x2022;Â?Â&#x2039; Â&#x201D;Â&#x192;Â?Â&#x2020;ĆŹ Â&#x161;Â&#x2039;Â&#x201D; Â&#x2018;Â&#x2013;Â&#x2021;Â&#x17D; Â&#x192;Â&#x160;Â&#x201D;Â&#x192;Â&#x2039;Â?Â&#x2039;Â&#x2013;Â&#x203A;Â&#x2021;Â?Â&#x2013;Â&#x201D;Â&#x2021;Â&#x2122;Â&#x2039;Â&#x2013;Â&#x160;Â&#x2020;Â&#x2039;Â&#x201D;Â&#x2021;Â&#x2026;Â&#x2013;Â&#x192;Â&#x2026;Â&#x2026;Â&#x2021;Â&#x2022;Â&#x2022; Â&#x2C6;Â&#x201D;Â&#x2018;Â?Â&#x2013;Â&#x160;Â&#x2021;Â?Â&#x192;Â&#x17D;Â&#x17D;ÇĄÂ&#x201E;Â&#x201D;Â&#x2039;Â?Â&#x2030;Â&#x2039;Â?Â&#x2030;ĆŞÂ&#x192;Â&#x2DC;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2022;Â&#x2013;Â&#x160;Â&#x192;Â&#x2013; Â&#x2122;Â&#x2039;Â&#x17D;Â&#x17D;Â&#x2020;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2030;Â&#x160;Â&#x2013;Â&#x203A;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2022;Â&#x2122;Â&#x2021;Â&#x2021;Â&#x2013;Â&#x2013;Â&#x2018;Â&#x2018;Â&#x2013;Â&#x160;Ǥ Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ?ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?Č&#x201A;Í&#x2022;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?

Zytoun

Opening hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x161;ÇŁÍ&#x2014;Í&#x201D;Â&#x192;Â?ÇŚÍ&#x2022;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â? For Reservations

Hotel: +973 1729 8008

Mezzanine Lounge Â&#x160;Â&#x2021;Â&#x2026;Â&#x2018;Â?Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2013;Â&#x192;Â&#x201E;Â&#x17D;Â&#x2021;Â&#x17D;Â&#x2018;Â&#x2014;Â?Â&#x2030;Â&#x2021;Â&#x2022;Â&#x2021;Â&#x2013;Â&#x2013;Â&#x2039;Â?Â&#x2030; Â&#x2C6;Â&#x2021;Â&#x192;Â&#x2013;Â&#x2014;Â&#x201D;Â&#x2021;Â&#x2022;Â&#x192;Â?Â&#x2021;Â&#x2020;Â&#x2039;Â&#x192;Â&#x2122;Â&#x192;Â&#x17D;Â&#x17D;Â&#x2122;Â&#x2039;Â&#x2013;Â&#x160;Í&#x2022;Í&#x2022;Â?Â&#x2018;Â&#x2014;Â?Â&#x2013;Â&#x2021;Â&#x2020; Â&#x2022;Â&#x2026;Â&#x201D;Â&#x2021;Â&#x2021;Â?Â&#x2022;ǢÂ&#x2026;Â&#x2018;Â?Â&#x2019;Â&#x17D;Â&#x2021;Â?Â&#x2021;Â?Â&#x2013;Â&#x2021;Â&#x2020;Â&#x201E;Â&#x203A;Â&#x192;Â&#x2026;Â&#x2018;Â&#x17D;Â&#x17D;Â&#x2021;Â&#x2026;Â&#x2013;Â&#x2039;Â&#x2018;Â? Â&#x2018;Â&#x2C6;Â&#x2039;Â?Â?Â&#x2018;Â&#x2DC;Â&#x192;Â&#x2013;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x2C6;Â&#x2018;Â&#x2018;Â&#x2020;Â&#x2020;Â&#x2021;Â&#x2022;Â&#x2039;Â&#x2030;Â?Â&#x2018;Â&#x2C6;Â&#x2013;Â&#x192;Â&#x2022;Â&#x2013;Â&#x203A; Â&#x2022;Â&#x192;Â&#x17D;Â&#x192;Â&#x2020;Â&#x2022;Â&#x192;Â?Â&#x2020;Â&#x2019;Â&#x17D;Â&#x192;Â&#x2013;Â&#x2013;Â&#x2021;Â&#x201D;Â&#x2022;Ǥ Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2022;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?ÇŚÍ&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?

   Yalla Yalla

Nasmat - Lounge & Restaurant

Â?Â&#x2019;Â&#x17D;Â&#x192;Â&#x2026;Â&#x2021;Â&#x2018;Â&#x2C6;Â&#x192;Â&#x2DC;Â&#x2018;Â&#x203A;Â&#x192;Â&#x2C6;¹ǥÂ&#x192;Â&#x17D;Â&#x17D;Â&#x192;Â&#x192;Â&#x17D;Â&#x17D;Â&#x192; Â&#x2018;ĆĄÂ&#x2021;Â&#x201D;Â&#x2022;Â&#x17D;Â&#x2014;Â?Â&#x2026;Â&#x160;Â&#x192;Â?Â&#x2020;Â&#x2020;Â&#x2039;Â?Â?Â&#x2021;Â&#x201D;Â&#x201E;Â&#x2014;ĆĄÂ&#x2013;Â&#x2021;Â&#x2013;Â&#x2022;Â&#x192;Â&#x2022; Â&#x2122;Â&#x2021;Â&#x17D;Â&#x17D;Â&#x192;Â&#x2022;Â&#x192;Â?Â&#x192;Â&#x17D;Â&#x192;Â&#x2026;Â&#x192;Â&#x201D;Â&#x2013;Â&#x2021;Â?Â&#x2021;Â?Â&#x2014;Ǥ

Â&#x160;Â&#x2021;Â&#x192;Â&#x17D;Â&#x2C6;Â&#x201D;Â&#x2021;Â&#x2022;Â&#x2026;Â&#x2018;Â&#x2019;Â&#x2018;Â&#x2018;Â&#x17D;Â&#x2022;Â&#x2039;Â&#x2020;Â&#x2021;Â&#x2021;Â&#x2020;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;Â&#x201D;Â&#x192;Â?Â&#x2021;Â&#x192;Â? Â&#x192;Â?Â&#x201E;Â&#x2039;Â&#x192;Â?Â&#x2026;Â&#x2021;Â&#x2018;ĆĄÂ&#x2021;Â&#x201D;Â&#x2022;Â&#x192;Â&#x160;Â&#x192;Â&#x2DC;Â&#x2021;Â?Â&#x2039;Â?Â&#x2122;Â&#x160;Â&#x2039;Â&#x2026;Â&#x160;Â&#x2013;Â&#x2018; Â&#x2021;Â&#x2022;Â&#x2026;Â&#x192;Â&#x2019;Â&#x2021;Â&#x192;Â?Â&#x2020;Â&#x2014;Â?Â&#x2122;Â&#x2039;Â?Â&#x2020;Â&#x2C6;Â&#x201D;Â&#x2018;Â?Â&#x192;Â?Â&#x192;Â?Â&#x192;ÇŻÂ&#x2022; Â&#x201E;Â&#x2014;Â&#x153;Â&#x153;Â&#x2013;Â&#x160;Â&#x201D;Â&#x2018;Â&#x2014;Â&#x2030;Â&#x160;Â&#x2018;Â&#x2014;Â&#x2013;Â&#x2013;Â&#x160;Â&#x2021;Â&#x2020;Â&#x192;Â&#x203A;Ǥ

Benniganâ&#x20AC;&#x2122;s

Opening Hours:Í&#x2022;Í&#x201D;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?Č&#x201A;Í&#x203A;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?

Saveur Â&#x2018;Â?Â&#x2013;Â&#x2021;Â?Â&#x2019;Â&#x2018;Â&#x201D;Â&#x192;Â&#x201D;Â&#x203A;Â&#x2039;Â?Â&#x2013;Â&#x2021;Â&#x201D;Â?Â&#x192;Â&#x2013;Â&#x2039;Â&#x2018;Â?Â&#x192;Â&#x17D;Â&#x2026;Â&#x2014;Â&#x2039;Â&#x2022;Â&#x2039;Â?Â&#x2021;Â&#x192;Â?Â&#x2020; Â&#x17D;Â&#x2014;Â&#x161;Â&#x2014;Â&#x201D;Â&#x2039;Â&#x2018;Â&#x2014;Â&#x2022;Â&#x192;Â?Â&#x201E;Â&#x2039;Â&#x2021;Â?Â&#x2026;Â&#x2021;Â&#x2021;Â?Â&#x2022;Â&#x2014;Â&#x201D;Â&#x2021;Â&#x2039;Â&#x2013;Â&#x2022;Â&#x2019;Â&#x17D;Â&#x192;Â&#x2026;Â&#x2021; Â&#x192;Â&#x2022;Â&#x192;Â?Â&#x192;Â?Â&#x192;ÇŻÂ&#x2022;Â&#x201D;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x192;Â&#x2014;Â&#x201D;Â&#x192;Â?Â&#x2013;Â&#x2018;Â&#x2C6;Â&#x2026;Â&#x160;Â&#x2018;Â&#x2039;Â&#x2026;Â&#x2021;Â&#x2C6;Â&#x2018;Â&#x201D; Â&#x2022;Â&#x2019;Â&#x2021;Â&#x2026;Â&#x2039;Â&#x192;Â&#x17D;Â&#x2018;Â&#x2026;Â&#x2026;Â&#x192;Â&#x2022;Â&#x2039;Â&#x2018;Â?Â&#x2022;Ǥ Opening Hours: Â&#x2018;Â?Â&#x2020;Â&#x192;Â&#x203A;Â&#x2013;Â&#x2018;Â&#x2014;Â?Â&#x2020;Â&#x192;Â&#x203A; Â&#x201D;Â&#x2021;Â&#x192;Â?Â&#x2C6;Â&#x192;Â&#x2022;Â&#x2013;Í&#x161;ÇŁÍ&#x2014;Í&#x201D;Â&#x192;Â?ÇŚÍ&#x2022;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â? Â&#x2014;Â?Â&#x2026;Â&#x160;Í&#x2022;Í&#x2013;ÇŁÍ&#x2014;Í&#x201D;Â&#x2019;Â?ÇŚÍ&#x2014;ÇŁÍ&#x2014;Í&#x201D;Â&#x2019;Â? Â&#x2039;Â?Â?Â&#x2021;Â&#x201D;Í&#x203A;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?ÇŚÍ&#x2022;Í&#x201D;ÇŁÍ&#x2014;Í&#x201D;Â&#x2019;Â?

Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x161;ÇŁÍ&#x2014;Í&#x201D;ÇŚÂ&#x2039;Â&#x2020;Â?Â&#x2039;Â&#x2030;Â&#x160;Â&#x2013; Â?Â&#x152;Â&#x2018;Â&#x203A;Â&#x2013;Â&#x192;Â&#x2022;Â&#x2013;Â&#x203A;Â&#x2C6;Â&#x2018;Â&#x2018;Â&#x2020;Â&#x192;Â?Â&#x2020;Â&#x2022;Â&#x2019;Â&#x2039;Â&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x2020; Â&#x2026;Â&#x2018;Â?Â&#x2DC;Â&#x2021;Â&#x201D;Â&#x2022;Â&#x192;Â&#x2013;Â&#x2039;Â&#x2018;Â?Ǥ Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x161;ÇŚÍ&#x2013;

Cucina Italiana Â&#x160;Â&#x2021;Â&#x2019;Â&#x17D;Â&#x192;Â&#x2026;Â&#x2021;Â&#x2122;Â&#x160;Â&#x2021;Â&#x201D;Â&#x2021; Â&#x2013;Â&#x192;Â&#x17D;Â&#x2039;Â&#x192;Â? Â&#x2018;Â&#x2018;Â&#x2020;Â&#x2039;Â&#x2022; Â&#x2022;Â&#x2021;Â&#x201D;Â&#x2DC;Â&#x2021;Â&#x2020;Â&#x2122;Â&#x2039;Â&#x2013;Â&#x160;Â&#x2022;Â&#x2013;Â&#x203A;Â&#x17D;Â&#x2021;Â&#x192;Â?Â&#x2020;Â&#x2019;Â&#x192;Â&#x2022;Â&#x2022;Â&#x2039;Â&#x2018;Â?Ǥ Opening Hours: Â&#x2018;Â?Â&#x2020;Â&#x192;Â&#x203A;Â&#x2013;Â&#x2018;Â&#x2014;Â?Â&#x2020;Â&#x192;Â&#x203A; Í&#x161;ÇŁÍ&#x201D;Í&#x201D;ÇŚÍ&#x2022;ÇŁÍ&#x201D;Í&#x201D;

Baharat Â&#x161;Â&#x2019;Â&#x2021;Â&#x201D;Â&#x2039;Â&#x2021;Â?Â&#x2026;Â&#x2021;Â&#x201D;Â&#x192;Â&#x201E;Â&#x2039;Â&#x192;Â?ƤÂ?Â&#x2021;Â&#x2020;Â&#x2039;Â?Â&#x2039;Â?Â&#x2030;Â&#x2013;Â&#x160;Â&#x192;Â&#x2013; Â&#x2019;Â&#x201D;Â&#x2018;Â?Â&#x2039;Â&#x2022;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x2018;Â&#x2020;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x201D;Â&#x192;Â?Â&#x2021;Â&#x2122;ÇĄÂ&#x2021;Â&#x161;Â&#x2026;Â&#x2021;Â&#x2019;Â&#x2013;Â&#x2039;Â&#x2018;Â?Â&#x192;Â&#x17D; Â&#x2026;Â&#x2014;Â&#x17D;Â&#x2039;Â?Â&#x192;Â&#x201D;Â&#x203A;Â&#x192;Â&#x2020;Â&#x2DC;Â&#x2021;Â?Â&#x2013;Â&#x2014;Â&#x201D;Â&#x2021;Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2013;Â&#x160;Â&#x2021;Â&#x2122;Â&#x160;Â&#x2018;Â&#x17D;Â&#x2021;Â&#x2C6;Â&#x192;Â?Â&#x2039;Â&#x17D;Â&#x203A;Ǥ Opening Hours: Â&#x2021;Â&#x2020;Â?Â&#x2021;Â&#x2022;Â&#x2020;Â&#x192;Â&#x203A;Â&#x2013;Â&#x2018; Â&#x201D;Â&#x2039;Â&#x2020;Â&#x192;Â&#x203A;Í&#x203A;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?ÇŚÍ&#x201D;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â? For Information & Reservations All restaurants: +973 1717 1000

SHOPPING       Alhilal Bookshop

Y     

Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ?Â&#x2013;Â&#x2018;Í?

Alhilal Bookshop: +973 17 531 665

Silkâ&#x20AC;&#x2122;s restaurant Â&#x161;Â&#x2019;Â&#x2021;Â&#x201D;Â&#x2039;Â&#x2021;Â?Â&#x2026;Â&#x2021;ƤÂ?Â&#x2021;Â&#x2020;Â&#x2039;Â?Â&#x2039;Â?Â&#x2030;Â&#x192;Â?Â&#x2020;Â&#x2022;Â&#x192;Â?Â&#x2019;Â&#x17D;Â&#x2021; Â&#x2026;Â&#x201D;Â&#x2021;Â&#x192;Â&#x2013;Â&#x2039;Â&#x2DC;Â&#x2021;Â?Â&#x2021;Â?Â&#x2014;Â&#x2022;Â&#x2019;Â&#x201D;Â&#x2021;Â&#x2019;Â&#x192;Â&#x201D;Â&#x2021;Â&#x2020;Â&#x201E;Â&#x203A;Â&#x2022;Â&#x2021;Â&#x192;Â&#x2022;Â&#x2018;Â?Â&#x2021;Â&#x2020; Â&#x192;Â?Â&#x2020;Â&#x2026;Â&#x2014;Â&#x17D;Â&#x2039;Â?Â&#x192;Â&#x201D;Â&#x203A;Â&#x2021;Â&#x161;Â&#x2019;Â&#x2021;Â&#x201D;Â&#x2013;Â&#x2022;ǤÂ&#x160;Â&#x2021;Â&#x2014;Â?Â&#x2039;Â&#x201C;Â&#x2014;Â&#x2021; Â&#x2022;Â&#x160;Â&#x2018;Â&#x2122;ÇŚÂ?Â&#x2039;Â&#x2013;Â&#x2026;Â&#x160;Â&#x2021;Â?Č&#x20AC;Â&#x17D;Â&#x2039;Â&#x2DC;Â&#x2021;ÇŚÂ&#x2026;Â&#x2018;Â&#x2018;Â?Â&#x2039;Â?Â&#x2030;Â&#x2026;Â&#x2018;Â?Â&#x2026;Â&#x2021;Â&#x2019;Â&#x2013; Â&#x2019;Â&#x201D;Â&#x2018;Â&#x2DC;Â&#x2039;Â&#x2020;Â&#x2021;Â&#x2022;Â&#x192;Â?Â&#x2021;Â&#x161;Â&#x2026;Â&#x2039;Â&#x2013;Â&#x2039;Â?Â&#x2030;Â&#x192;Â?Â&#x2020;Â&#x17D;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x17D;Â&#x203A;Â&#x2022;Â&#x2021;Â&#x2013;Â&#x2013;Â&#x2039;Â?Â&#x2030;Ǥ Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÂ&#x201D;Â&#x2021;Â&#x192;Â?Â&#x2C6;Â&#x192;Â&#x2022;Â&#x2013;Í?ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?ÇŚÍ&#x2022;Í&#x201D;ǤÍ&#x2014;Í&#x201D;Â&#x192;Â? Â&#x2014;Â?Â&#x2026;Â&#x160;Í&#x2022;Í&#x201D;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?Č&#x201A;Í&#x2DC;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â? Â&#x2039;Â?Â?Â&#x2021;Â&#x201D;Í&#x2122;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?Č&#x201A;Í&#x2022;Í&#x2013;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â? For Reservations

Silkâ&#x20AC;&#x2122;s restaurant: +973 17460017

THE  ǧÇĄ     ĆŹ Chopard Boutique Opening hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x203A;Â&#x2013;Â&#x2018;Â&#x2039;Â&#x2020;Â?Â&#x2039;Â&#x2030;Â&#x160;Â&#x2013;

Mohd Sharif Hatam & Sons

 

Opening hours: Â&#x192;Â&#x2013;Â&#x2014;Â&#x201D;Â&#x2020;Â&#x192;Â&#x203A;Â&#x2013;Â&#x2018;Â&#x160;Â&#x2014;Â&#x201D;Â&#x2022;Â&#x2020;Â&#x192;Â&#x203A;ÇŁ Í&#x2022;Í&#x201D;Â&#x2013;Â&#x2018;Í&#x2013;Č&#x201A;Í&#x2DC;Â&#x2013;Â&#x2018;Í&#x153;

La Perle Â?Â&#x152;Â&#x2018;Â&#x203A;Â&#x192;Â&#x2020;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2026;Â&#x2039;Â&#x2018;Â&#x2014;Â&#x2022;Â&#x201D;Â&#x192;Â?Â&#x2030;Â&#x2021;Â&#x2018;Â&#x2C6;Â&#x2026;Â&#x2014;Â&#x17D;Â&#x2039;Â?Â&#x192;Â&#x201D;Â&#x203A; Â&#x2022;Â&#x2019;Â&#x2021;Â&#x2026;Â&#x2039;Â&#x192;Â&#x17D;Â&#x2013;Â&#x2039;Â&#x2021;Â&#x2022;Â&#x2122;Â&#x2039;Â&#x2013;Â&#x160;Â&#x192;Â?Â&#x2021;Â&#x161;Â&#x2013;Â&#x2021;Â?Â&#x2022;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x2022;Â&#x2021;Â&#x17D;Â&#x2021;Â&#x2026;Â&#x2013;Â&#x2039;Â&#x2018;Â? Â&#x2018;Â&#x2C6;Â&#x192;Â&#x2019;Â&#x2019;Â&#x2021;Â&#x2013;Â&#x2039;Â&#x153;Â&#x2021;Â&#x201D;Â&#x2022;ÇĄÂ&#x2022;Â&#x192;Â&#x17D;Â&#x192;Â&#x2020;Â&#x2022;Â&#x192;Â?Â&#x2020;Â&#x2020;Â&#x2021;Â&#x2022;Â&#x2022;Â&#x2021;Â&#x201D;Â&#x2013;Â&#x2022;Â&#x2013;Â&#x2018; Â&#x2026;Â&#x2018;Â?Â&#x2019;Â&#x17D;Â&#x2021;Â?Â&#x2021;Â?Â&#x2013;Â&#x203A;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2026;Â&#x160;Â&#x2018;Â&#x2039;Â&#x2026;Â&#x2021;Â&#x2022;Â&#x2021;Â&#x192;Â&#x2C6;Â&#x2018;Â&#x2018;Â&#x2020; Â&#x192;Â?Â&#x2020;ƤÂ&#x2022;Â&#x160;Â&#x2021;Â&#x2022;Ǥ

126

NOVEMBER / DECEMBER 2013

For Information

Chopard Boutique: +973 17 580 667 Mohd Sharif Hatam & Sons: +973 17 580 889

SPA & SALON      

    ĆŹ    Pure Spa Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2022;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?Â&#x2013;Â&#x2018;Í&#x153;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?

Image Spa & Leisure Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x161;Â?Â&#x2013;Â&#x2018;Í&#x2022;Í&#x201D;

For Information & Reservations +973 1717 1122

Sheraton Health Club Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x203A;Â&#x2013;Â&#x2018;Í&#x2022;Í&#x201D;

Sheraton Fitness Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ?Â&#x2013;Â&#x2018;Í&#x153;ÇŁÍ&#x2014;Í&#x201D; For Information

Image Spa & Leisure: +973 17 524 570 Sheraton Fitness: +973 17 524 570 Sheraton Health Club: +973 17 533 533

      ĆŹ

  ǧÇĄ     ĆŹ Elie & Jean Beauty Center Gents Saloon Opening hours: Â&#x192;Â&#x2013;Â&#x2014;Â&#x201D;Â&#x2020;Â&#x192;Â&#x203A;Â&#x2013;Â&#x2018;Â&#x160;Â&#x2014;Â&#x201D;Â&#x2022;Â&#x2020;Â&#x192;Â&#x203A;ÇŁÍ?ÇŁÍ&#x2014;Í&#x201D;Â&#x2013;Â&#x2018;Í&#x153; Â&#x201D;Â&#x2039;Â&#x2020;Â&#x192;Â&#x203A;ÇŁÍ&#x2022;Í&#x201D;Â&#x2013;Â&#x2018;Í&#x203A;

Sports Club & Spa (Membership only) Opening hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2122;ÇŁÍ&#x201D;Í&#x201D;Â&#x2013;Â&#x2018;Í&#x2022;Í&#x201D;ÇŁÍ&#x2014;Í&#x201D; For Information

Elie & Jean Beauty Center - Gents Saloon: +973 17 580 798

Thalassotherapy Č&#x2039;Â&#x192;Â&#x17D;Â&#x17D;Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2019;Â&#x2019;Â&#x2018;Â&#x2039;Â?Â&#x2013;Â?Â&#x2021;Â?Â&#x2013;Č&#x152; For Information & Reservations Hotel: +973 1763 6363 Concierge: +973 39349659

  ǧÇĄ     ĆŹ Elie & Jean Beauty Center Gents Saloon Opening hours: Â&#x192;Â&#x2013;Â&#x2014;Â&#x201D;Â&#x2020;Â&#x192;Â&#x203A;Â&#x2013;Â&#x2018;Â&#x160;Â&#x2014;Â&#x201D;Â&#x2022;Â&#x2020;Â&#x192;Â&#x203A;ÇŁÍ?ÇŁÍ&#x2014;Í&#x201D;Â&#x2013;Â&#x2018;Í&#x153; Â&#x201D;Â&#x2039;Â&#x2020;Â&#x192;Â&#x203A;ÇŁÍ&#x2022;Í&#x201D;Â&#x2013;Â&#x2018;Í&#x203A;

Sports Club & Spa (Membership only) Opening hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2122;ÇŁÍ&#x201D;Í&#x201D;Â&#x2013;Â&#x2018;Í&#x2022;Í&#x201D;ÇŁÍ&#x2014;Í&#x201D; For Information

Elie & Jean Beauty Center - Gents Saloon: +973 17 580 798

   Ann Beauty Salon Â&#x2018;Â?Â&#x2021;Â&#x2039;Â?Â&#x192;Â?Â&#x2020;Â&#x201D;Â&#x2021;Â&#x17D;Â&#x192;Â&#x161;Â&#x2013;Â&#x2018;Â&#x2022;Â&#x2018;Â&#x2018;Â&#x2013;Â&#x160;Â&#x2039;Â?Â&#x2030; Â?Â&#x2014;Â&#x2022;Â&#x2039;Â&#x2026;Â&#x192;Â&#x2022;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2013;Â&#x160;Â&#x2021;Â&#x201D;Â&#x192;Â&#x2019;Â&#x2039;Â&#x2022;Â&#x2013;Â&#x2022;Â&#x2019;Â&#x201D;Â&#x2018;Â&#x2DC;Â&#x2039;Â&#x2020;Â&#x2021; Â&#x2013;Â&#x160;Â&#x2021;Â&#x2019;Â&#x2021;Â&#x201D;Â&#x2C6;Â&#x2021;Â&#x2026;Â&#x2013;Â&#x2013;Â&#x201D;Â&#x2021;Â&#x192;Â&#x2013;Â?Â&#x2021;Â?Â&#x2013;Ǥ For Information & Reservations Â&#x17D;Â&#x192;ƤÂ&#x201D; Â&#x2018;Â&#x2013;Â&#x2021;Â&#x17D;ĆŹÂ&#x2018;Â&#x2122;Â&#x2021;Â&#x201D;ÇŁ +973 1782 7999 Â?Â&#x192;Â&#x2039;Â&#x17D;ÇŁÂ&#x192;Â&#x17D;Â&#x2022;Â&#x192;ƤÂ&#x201D;Â&#x160;̡Â&#x201E;Â&#x192;Â&#x2013;Â&#x2021;Â&#x17D;Â&#x2026;Â&#x2018;ǤÂ&#x2026;Â&#x2018;Â?ǤÂ&#x201E;Â&#x160; Â&#x2021;Â?Â?Â&#x2039;Â&#x2030;Â&#x192;Â?ÇŻÂ&#x2022;ÇŁ +973 1781 3750 Â&#x2021;Â&#x201E;Â&#x2022;Â&#x2039;Â&#x2013;Â&#x2021;ÇŁÂ&#x201E;Â&#x2021;Â?Â?Â&#x2039;Â&#x2030;Â&#x192;Â?Â&#x2022;ǤÂ&#x2026;Â&#x2018;Â?ǤÂ&#x201E;Â&#x160; Â&#x2014;Â&#x2026;Â&#x2039;Â?Â&#x192; Â&#x2013;Â&#x192;Â&#x17D;Â&#x2039;Â&#x192;Â?Â&#x192;ÇŁ +973 1700 1317 Â&#x2021;Â&#x201E;Â&#x2022;Â&#x2039;Â&#x2013;Â&#x2021;ÇŁÂ&#x2026;Â&#x2014;Â&#x2026;Â&#x2039;Â?Â&#x192;Â&#x2039;Â&#x2013;Â&#x192;Â&#x17D;Â&#x2039;Â&#x192;Â?Â&#x192;ǤÂ&#x2026;Â&#x2018;Â?ǤÂ&#x201E;Â&#x160;


   The K lounge Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2022;Í&#x2022;Â&#x2013;Â&#x2018;Í&#x2013;

Champions Sports Lounge Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2022;Í&#x2022;Â&#x2013;Â&#x2018;Í&#x2013; For Information

K Hotel: (973) 1736 0000

   Sherlock Holmes Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2022;Í&#x2013;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?Č&#x201A;Í&#x2013;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?

Typhoon Bar and Lounge Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2122;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?Č&#x201A;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â? Â&#x192;Â&#x2019;Â&#x2019;Â&#x203A; Â&#x2018;Â&#x2014;Â&#x201D;ÇŁÍ&#x2122;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?Č&#x201A;Í&#x203A;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?

Vintage Wine Bar Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2122;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?Č&#x201A;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?

For Reservations

Royal Suite Bedroom, Kempinski

K Hotel: (973) 1736 0000 Sherlock Holmes: +973 1771 2450 Typhoon Bar and Lounge: +973 17 746 395 Vintage Wine Bar: +973 1774 6461

)LDPPD6RĂ&#x20AC;WHO

NIGHTLIFE

    ĆŹ   

     

Boudoir Opening Hours: Â&#x2018;Â?Â&#x2020;Â&#x192;Â&#x203A;Â&#x2013;Â&#x2018;Â&#x2014;Â?Â&#x2020;Â&#x192;Â&#x203A;ÇŁÍ&#x2122;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?ÇŚÍ&#x2013;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?

An Nada Lounge Opening Hours: Â&#x192;Â&#x2019;Â&#x2019;Â&#x203A; Â&#x2018;Â&#x2014;Â&#x201D;ÇŁÍ&#x2022;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?Â&#x2013;Â&#x2018;Í&#x203A;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â? Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;Č&#x201A;Í&#x2022;ÇŁÍ&#x201D;Í&#x201D;

Bizarre Lounge Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ?ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?ÇŚÍ&#x2013;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?

For Information

An Nada Lounge: +973 17 533 533 ext. 293

For Information & Reservations Hotel: (973) 1717 1000

      ĆŹ

 

Amber Bar

Le Bellevue

Lagoon Pool Bar

Â&#x201D;Â&#x2021;Â&#x17D;Â&#x192;Â&#x161;Â&#x2021;Â&#x2020;Â&#x203A;Â&#x2021;Â&#x2013;Â&#x2021;Â&#x17D;Â&#x2021;Â&#x2030;Â&#x192;Â?Â&#x2013;Â&#x201E;Â&#x192;Â&#x201D;Â&#x2018;ĆĄÂ&#x2021;Â&#x201D;Â&#x2039;Â?Â&#x2030; Â&#x2018;Â?Â&#x2021;Â&#x2018;Â&#x2C6;Â&#x2013;Â&#x160;Â&#x2021;Â?Â&#x2018;Â&#x2022;Â&#x2013;Â&#x2022;Â&#x2013;Â&#x2014;Â?Â?Â&#x2039;Â?Â&#x2030;Â&#x2DC;Â&#x2039;Â&#x2021;Â&#x2122;Â&#x2022;Â&#x2018;Â&#x2C6; Â&#x2013;Â&#x160;Â&#x2021;Â&#x2022;Â&#x2021;Â&#x192;Â&#x192;Â?Â&#x2020;Â&#x2026;Â&#x2039;Â&#x2013;Â&#x203A;Â&#x2022;Â?Â&#x203A;Â&#x17D;Â&#x2039;Â?Â&#x2021;ǤÂ&#x2039;Â&#x2030;Â&#x160;Â&#x2013;Â&#x17D;Â&#x2039;Â&#x2DC;Â&#x2021; Â?Â&#x2014;Â&#x2022;Â&#x2039;Â&#x2026;Â&#x2039;Â?Â&#x2013;Â&#x160;Â&#x2021;Â&#x2021;Â&#x2DC;Â&#x2021;Â?Â&#x2039;Â?Â&#x2030;Â&#x2022;Ǥ

Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x153;Â&#x2013;Â&#x2018;Í&#x153;

Opening hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2DC;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?ÇŚÍ&#x2013;ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?

Lobby Lounge Bar

Pool Bar

Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x153;Â&#x2013;Â&#x2018;Â&#x2039;Â&#x2020;Â?Â&#x2039;Â&#x2030;Â&#x160;Â&#x2013;

Tapas: BAR

Â&#x2018;Â&#x2018;Â&#x17D;Â&#x201E;Â&#x192;Â&#x201D;Â&#x2039;Â&#x2022;Â&#x2018;Â&#x2019;Â&#x2021;Â?Â&#x2018;Â?Â&#x2122;Â&#x2021;Â&#x2021;Â?Â&#x2021;Â?Â&#x2020;Â&#x2022;Â&#x2020;Â&#x2014;Â&#x201D;Â&#x2039;Â?Â&#x2030; Â&#x2021;Â&#x2026;Â&#x2021;Â?Â&#x201E;Â&#x2021;Â&#x201D;ÇŚ Â&#x2021;Â&#x201E;Â&#x201D;Â&#x2014;Â&#x192;Â&#x201D;Â&#x203A;Â&#x192;Â?Â&#x2020;Â&#x2021;Â&#x2DC;Â&#x2021;Â&#x201D;Â&#x203A;Â&#x2020;Â&#x192;Â&#x203A; Â&#x2C6;Â&#x201D;Â&#x2018;Â?Â&#x192;Â&#x201D;Â&#x2026;Â&#x160;Í&#x2022;Â&#x2014;Â?Â&#x2013;Â&#x2039;Â&#x17D;Â&#x2018;Â&#x2DC;Â&#x2021;Â?Â&#x201E;Â&#x2021;Â&#x201D;ǤČ&#x2039;Â&#x17D;Â&#x2018;Â&#x2022;Â&#x2021;Â&#x2020; Â&#x2020;Â&#x2014;Â&#x201D;Â&#x2039;Â?Â&#x2030;Â&#x192;Â?Â&#x192;Â&#x2020;Â&#x192;Â?Č&#x152;Ǥ

Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x2022;Í&#x2022;ÇŁÍ&#x2014;Í&#x201D;Â&#x2013;Â&#x2018;Â&#x2039;Â&#x2020;Â?Â&#x2039;Â&#x2030;Â&#x160;Â&#x2013;

Opening hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ?ÇŁÍ&#x201D;Í&#x201D;Â&#x192;Â?ÇŚÍ&#x153;ÇŁÍ&#x201D;Í&#x201D;Â&#x2019;Â?

Opening Hours: Â&#x192;Â&#x2039;Â&#x17D;Â&#x203A;ÇŁÍ&#x161;Â&#x2013;Â&#x2018;Í&#x2013;

For Information

Hotel: +973 1763 6363 Concierge: +973 39349659

For Reservations

Hotel: +973 1729 8008

NOVEMBER / DECEMBER 2013

127


Quoted “I never worry about diets. The only carrots that interest me are the number of carats in a diamond.” Mae West

“Jewellery, I’m telling you. It’s a thing. And love. And maybe danger.” Kami Garcia

“There is in them a VRIWHU¿UHWKDQWKH ruby, there is the brilliant purple of the amethyst, and the sea green of the emerald - all shining together in incredible union. Some by their splendor rival the colors of the painters, others the ÀDPHRIEXUQLQJ VXOSKXURURI¿UH quickened by oil.” Pliny, about the opal

88 128

FEBRUARY NOVEMBER 2012 / DECEMBER 2013

“All art is autobiographical; the pearl is the oyster’s autobiography.”

“It is better to have old second-hand diamonds than none at all.”

Federico Fellini

Mark Twain

“Jewellery takes people’s minds off your wrinkles.” Sonja Henie

“Women are better prepared for marriage. They’ve experienced pain and bought jewellery.”

“Diamonds are only chunks of coal, that stuck to their jobs, you see.”

Rita Rudner

Minnie Richard Smith, Stick to Your Job


Scan for watch details

0RGD0DOO $O$DOL0DOO 6HHI0DOO 5LW]&DUOWRQ+RWHO &LW\&HQWUH ZZZDVLDMHZHOOHUVFRP

Business in Gulf - November 2013  

Business in Gulf January 2013 Issue. Published by Maxmedia Co. Bahrain

Read more
Read more
Similar to
Popular now
Just for you