Page 1

Harga Eceran Rp 3500,Luar Daerah + Ongkos Kirim


15-22 APRIL 2013| EDISI 355| THN KE-VIII

KANTOR REDAKSI Jl. Flamboyan Raya/Raharja No. 37 Medan Telp (061) 8213786, HP. 081375395392 - 08163134392 Fax (061) 8215552


Kasus korupsi membudaya di negeri ini. Ironinya, 70 persen kasus korupsi didominasi pejabat daerah. Hanya saja, dengan segala trik dan intrik, sang pejabat yang terjerat kasus korupsi masih bisa menghirup udara segar. Intinya, kinerja penegak hukum dipertanyakan. MEDAN, BN Kasus korupsi yang kini jadi perbincangan salah satunya adalah kasus yang mendera Walikota Medan, Rahudman Harahap. Saat ini‘label’yang tersandang di bahu orang nomor satu di Kota Medan meningkat menjadi terdakwa. Namun masih ada cela bagi penegak hukum untuk tidak menahannya. Sebab, sesuai dengan pasal 21 KUHAP, untuk penahanan ada tiga faktor yang dilihat. Pertama, terdakwa berusaha melarikan diri, menghilangkan barang bukti dan mengulangi perbuatan. Dan berkaca dari ketiga hal tersebut membuat Kejari Padangsidempuan belum melakukan penahanan terhadap Rahudman Harahap. Sebelumnya diperoleh informasi, nama Rahudman Harahap terseret kasus perkara dugaan korupsi Tunjangan Penghasilan Aparatur

Pemerintahan Desa (TPAPD) Pemkab Tapanuli Selatan tahun anggaran 2005 sebesar Rp 1,5 miliar lebih. Menyahuti kasus dugaan korupsi TPAPD Rahudman Harahap, Komunitas Peduli Keadilan (KPK) mengatakan, kalau memang cukup bukti, tak salah rasanya sang Walikota Medan dilakukan penahanan. Apalagi, kata Sekretaris KPK Kota Medan, Indrawan Sukma, kasus ini telah berlarut. “Artinya, masyarakat kan ingin tahu kejelasan dan pembuktian kasus tersebut. Yang salah katakan salah, dan yang benar katakana benar. Jangan sampai terjadi opini yang menyesatkan di masyarakat,”paparnya kepada BN, kemarin. BACA RAHUDMAN HAL..2

Walikota Sentil Kekurangan Pejabat Banda Aceh BANDA ACEH, BN Diklat Pim III angkatan I, telah ditutup Senin pekan lalu. Namun, sayangnya tidak satupun dari 30 orang yang mengikuti kegiatan itu mencapai predikat sangat memuaskan, melainkan hanya lima orang yang memperoleh predikat memuaskan dan selebihnya di bawah itu. Diklat tersebut dimulai sejak 9 Februari hingga 8 April lalu. Beruntung, Walikota Banda Aceh, Mawardy Nurdin, tidak memarahi abdi negara MAWARDY NURDIN dilingkup Pemerintah Kota (Pemko) Banda Aceh. Hanya saja, Mawardy, menyentil soal masih dirudungnya kekurangan sejumlah pejabat dan dianggap belum mampu mengajak dan mendistribusikan pekerjaan terhadap bawahannya. Aula Balai Kota Banda Aceh, setidaknya menjadi saksi bisu atas prestasi yang diraih peserta Diklat Pim III angkatan I. Capaian nilai E-Kinerja kepala SKPD Kota Banda Aceh, sangat tinggi, sementara bawahannya justeru berbanding terbalik alias tidak ada. “Hal ini, bisa kita lihat dari capaian nilai E-Kinerjanya sangat tinggi hingga mendapat nilai A, tapi ketika kita lihat bawahannya tidak ada nilai. Oleh karenanya, kedepan saya meminta agar hal itu tidak terjadi lagi. Selain itu, perlu kami himbau kiranya para pejabat dapat memotivasi BACA WALIKOTA HAL..2

Kelompok Tani Ilegal Garap Lahan Warga


183 Konflik Mewarnai Kasus Tanah di Sumut Medan, BN Polda Sumut menilai konflik yang terjadi dimasyarakat adalah persoalan tanah di Pemprovsu sehingga berpotensi mengganggu keamanan didalam negeri. Dan diperoleh informasi bahwa sebanyak 129 kasus tanah

mewarnai 183 peristiwa konflik didaerah ini dan harus segera diselesaikan. “Sisanya permasalahan sumberdaya manusia, ketidakseimbangan kehidupan dan kejahatan atau tindakan criminal,” ungkap Kepala Biro Operasional Poldasu,Kombes Pol

Iwan Hari Sugiarto, di Mapoldasu Jalan Sisingamangaraja Km 10,5 Medan, kemarin. Sehubungan dengan itu,kata dia, Pemprovsu, Poldasu dan Kodam I/BB mengambil BACA 183 KONFLIK HAL..2

Pemko Tebingtinggi Periksa Kenderaan Dinas TEBINGTINGGI, BN Menindaklanjuti instruksi Walikota melalui surat No.900/3972/Keu/2013 tanggal 1 April 2013 tentang Pemeriksaan Atas LKPD Kota Tebingtinggi TA 2013 yang disampaikan Sekdako Tebingtinggi Johan Samose Harahap, SH, MSP melalui surat No.024/3640/BD/2013 tanggal 3 April 2013 perihal Pemeriksaan Fisik

Kenderaan Dinas Operasional, maka dalam waktu dekat akan melakukan pemeriksaan terhadap seluruh kenderaan dinas mulai dari roda 2 hingga roda 6 di jajaran Satuan Kerja Perangkat Daerah (SKPD). Hal ini disampaikan Kabag Adm Humasy &PP,PemkoTebingtinggi,Ahdi Sucipto. dalam siar pers nya kepada wartawan, kemarin, di

ruang kerjanya. “Ini bertujuan untuk mengetahui keberadaan masing-masing kenderaan. Apakah kenderaan itu masih ada di tempat atau sudah berpindah tangan. Banyak terjadi, kenderaan digunakan orang-orang yang tak berkompeten memiliki kenderaan

DUMAI, BN Lahan warga Dusun Mekar Sari, Kelurahan Batu Teritip, Kecamatan Sungai Sembilan Dumai, kembali diduduki oleh sekelompok massa dari Kecamatan Sinaboi, Rohil. Aksi kelompk massa dengan melakukan pembabatan dan pembersihan lahan di Dusun Mekar Sari membawa nama kelompok tani. Tak hanya itu, kelompok tani tersebut mengklaim bahwa lahan tersebut milik mereka. Dengan garangnya pula, sebanyak 70 kelompok tani membawa senjata lengkap sehingga membuat masyarakat RT 9 Dusun Mekar Sari resah. Disinyalir, kelompok tani itu membeli lahan melalui mafia tanah BACA KELOMPOK HAL..2

Cuaca Ekstrim, Petani Karet Merugi TAPSEL, BN Para petani penyadap karet yang mengandalkan sumber penghidupan dari hasil kebun getah ini dirundung gelisah. Pasalnya belakangan ini cuaca di daerah mereka tidak menentu. Imbasnya, para petani karet di Tapanuli Selatan hanya bisa pasrah menghadapi cuaca yang terus ekstrim ini. Salah seorang petani, Ucok mengatakan, bahwa



Operet “Andung Ni Boru Marbagas” Digelar di PRSU Pemerintah Kabupaten Tapanuli Selatan dalam pagelaran seni budaya adat Tapanuli Selatan di Open Stage Pekan Raya Sumatera Utara (PRSU) ke- 42, menampilkan operet“Andung Ni Boru Marbagas” yang berarti “Isak tangis sang gadis meninggalkan kedua orang tua menuju keluarga mempelai laki- laki”.

LIPUTAN: MUHAMMAD SIREGAR SESUAi dengan moment PRSU tahun ini yang mengambil Tema Back to Culture, Dewan Kesenian Daerah Tapanuli Selatan (DKDTS) bekerjasama dengan Forkala dan Dinas Pendidikan Tapanuli Selatan menampilkan operette tentang adat website :

pelamaran dan pernikahan yang dilaksanakan ditempat tinggal mempelai Wanita. Operet yang dipoles oleh tangan dingin sang

sutrada Tantawi Panggabean dengan Asistennya Khatib Lubis, ternyata mampu menggugah para penonton. Drama yang dibarengi tarian dengan

pengantar narasi menggambarkan keseharian dan kebiasan muda- mudi Tapanuli Selatan yang kental BACA OPERET HAL..2 Email:

15-22 APRIL 2013 | EDISI 355| THN KE-VIII

Kajati Aceh Kunker ke kota “Sada Kata” Subulussalam,BNKejaksaan Tinggi Aceh TM. SYAHRIZAL, SH.MH, kunjungan kerja ke kota subulussalam, kamis (11/ 4). Dalam kunjungan kerja beliau, pada malam harinya langsung bertatap muka dengan masyarakat, dan disambut dengan adat kebesaran kota subulussalam, dan hal ini telah lazim dilakukan setiap para pejabat Negara datang kedaerah ini. Pada pertemuan tersebut,yang bertempat di Hermes Hotel, Kota Subulussalam, malam Jum’at yang dihadiri oleh Muspida plus, Badan, Dinas, kantor dan undangan tokoh masyarakat, alim ulamajuga undangan penting lainnya. Walikota dalam sambutannya beliau menyampaikan beberapa hal tentang keadaan kota subulussalam yang baru mekar dari kabupaten induk yakni Aceh singkil. Beliau menjelaskan bahwa darah ini tahap demi tahap telah berbenah diri, dan bergelut

Walikota Subulussalam M. Sakti, SH dalam sambutannya pada kehadiran Kajati Aceh TM. Syahrijal, SH.MH

dalam pembangunan yang diharapkan nantinya, daerah ini dapat bersaing dengan daerah lain di Aceh.

H. OK. Arya Julkarnain SH. MM Lantik Kepala Desa Terpilih SeiBalai,BN Bupati Batu Bara melantik enam kepala desa terpilih di desa Sei Balai Pemekaran seperti Kepala desa durian, Hariadi,Kepala desa perjuangan, Bakti Ginting,Kepala desa Benteng Jaya, Sugiat,Kepala desa Sei Balai, Abdul Rahman,Kepala desa Tanah Timbul, Marmin,Kepala desa Sidomulyo, Rismayanto Dalam sambutannya Bupati Batu Bara mengatakan agar kepala desa yang terpilih hendaknya dapat mengemban tugas ditengah-

tengah masyarakat dan slalu aktif dan proaktif kepada warga setempat. "Wewenang kepala desa harus berfungsi sebaik mungkin untuk menjalankan tugas di roda pemerintahan desa dan bekerja sama dengan pemerintahan Kabupaten Batu ", ujar OK Arya. cara tersebut dihadiri Camat Sei Balai H. Budianto, SSOS,Kapolsek Labuan Ruku, Hamatondang , Danramil 04 Talawi Kapten Inpantri SY, Hasibuan serta hadir Satpol PP, Linmas Kesbang Kabupaten Batu Bara.(SY)

Kejatisu Kunker ke Batubara Batubara,BN Kajatisu ,DR Noor Rachmad SH. MH melakukan kunjungan kerja ke Kabupaten Batubara dalam meningkatkankinerjakejaksaandidaerah. TampakhadirKajariBatubara,RikiSeptaTarigan SH, MHUM ,ketua DPRD Selamat Aripin SE, , sekretaris BPRD Batu Bara Jalaludin Esos, Kadis

pendidikanIr.DarwisMSI,camatKecamatanTalawi AbdulLatifLuthpiPanjaitanSsosKapolsekRabuanRuku ,AKPHamatondangDanRamil04Talawi,KaptenInfantri SY.Hasibuan,KapolresHasahanAKBPYustanAlvianSIK SH.MHUM,Dandim0208Asahan,PolsekMedangDeras AKP MH. Sirait. Acara dilaksanakan di samping kantor kejaksaandanberjalandenganmeriah.(SY)

Yusrizal.Z Pimpin IPELMAJ-MBO Meulaboh,BNMusyawarah Besar Mahasiswa Aceh Jaya (Mubes) ke II di Meulaboh berlansung Minggu(7/4) secara aklamasi yang di lakukan oleh panitia pelaksana (MUBES Ke II) di kantor Sekretariat Ikatan pelajar Mahasiswa Aceh Jaya, bertempat sementara di Desa Penaga Rayeuk Kecamatan Meurebo Kabupaten Aceh Barat. Ketua panitia mubes Nazaruddin kepada Bongkarnews, pelaksanaan Mubes Ke II Ipelmaj Meulaboh berlansung secara aklamasi, karena kandidat No urut 2 Abdul Manaf tidak hadir dalam musyawarah tersebut.sementara yang hadil Cuma calon yang no urut 1 Yusrizal Z katanya. Junaidi selaku pimpinan sidang mengatakan dalam pemilihan tersebut, memutuskan kepada peserta yang mengikuti pelaksanaan Musyawarah besar

mahasiswa Aceh jaya tersebut, di hadiri dari mahasiswa Aceh jaya dari setiap Kecamatan meliputi kecamatanTeunom, Sarah Raya, Panga, Krung Sabee,Setia Bakti dan Sampoinit.untuk melakukan pemilihan pengurus baru IPELMAJ-MBO, “ungkapnya. Dari hasil suara peserta 50 pemilih pada Mubes ke II Ipelmaj memutuskan Yusrizal Z yang menjadi pengurus Ipelmaj 2013-2015 di masa akan datang. Nazar juga berharap kepada ketua terpilih agar benar-benar menjalankan misi dan visi yang telah di sampaikan oleh pengurus yang terpilih, juga kepada mahasiswa, sama-sama mendukung setiap pogram dan membatu pengurus baru dalam menggembangkan organisasi Masiswa Aceh jaya (IPELMAJ-MBO) yang lebih maju kedepan, harapnya.(@rul)

Selanjutnya walikota mengatakan dalam pemerintahan telah mandiri, tapi bagi instansi vertikal seperti kodim, polres, Kajari, Kehakiman,

daerah ini masih tunduk ke kabupaten induk Aceh singkil. Pada kesempatan ini walikota juga memohon kepada kajati, agar dalam kewenangannya kiranya kajari kota subulusaslam segera di bentuk, mengingat jarak tempuh kota subulussalam dan singkil sangat jauh, artinya semua instansi vertical sangat dibutuhkan. Oleh karena itu walikota mengawtkaan bahwa pemko bersedia menyediakan lahan Kajari 1 HA (10000 m2) dmei tercapai nya cita-cita tersebut. Hal ini telah dibuktikan bahwa lahan kodim dan laham mako Polres telah disediakan, malah sebagian pembangunannya telah diplotkan dianggran Pemko dan telah dikerjakan. Bahasa ini dikuatkan oleh tokoh masyarakat, yagn diwakili oleh Syaripudidn Padang Ketua Komisi A DPRK Subulussalam, beliau juga mengatakan bahwa kota subulussalam multi etnis, dan dalam hal ini butuh penanganan pemerintah dan mengayomi.(RB)

Peletakan Batu Pertama Masjid Al-Amin Desa Cepu oleh Walikota Subulussalam SUBULUSSALAM. BN Peletakan batu pertama pembangunan Masjid AlAmin, desa Cepu Kecamatan Penanggalan Kota Subulussalam,dilakukanolehwalikotaSubulussalam(9/ 4).HadirdalamacaratersebutsemuaunsurMuspidaplus, Badan Dinas, dan kantor, pengusaha, tokoh masyarakat, sehinggapadaacaratersebuttampakkomplit. Walikota dalam arahannya menyebutkan, bahwa Masjid adalah salah satu rumah Allah yang patut bagi hambanyauntukmenjaganya,danmemakmurkannya. SeterusnyaWalikotamengajakkepadamasyarakatagar benar-benar menjaga aqidah dan terus belajar sehingga syariat islam dapat terjaga di daerah ini, yang jelas syariat islamharustegaksecarakaffah.

Sesuailaporanpanitia,pembangunanMasjidinihanya bermodalkan swadaya masyarakat, maka dalam hal ini kiranyapemkodapatmembantu,walauberbentukapapun. Padakesempatanitu,spontanitaswalikotamengajak padakepalaSKPK,untukmemberibantuan,selainitupara pengusahapun semangat dalam ajakan untuk sedekah tersebut. Sehingga pada kesempatan itu menyebutkan, sumbanganwalikotapribadi10jutadanatasnamaPemko 40Juta,wakapolres30zaksemen,DENPOM40Zaksemen, dan tidak ketinggalan juga para kepala SKPK sekota subulussalam. PadapeletakanbatupertamaMasjidAl-amin,padahari ituterkumpuldanasebesarRp.l01jutadansemen80zak, ditambahlagisumbanganparadermawanlainnya.(RB)

Walikota Minta Partai Peserta Pemilu Tetap Menjaga Persaudaraan Banda Aceh,BN Walikota Banda Aceh Ir Mawardy Nurdin M Eng Sc memintakepadacalonpesertapemiludarisemuapartai yangbertarungpadapemilulegislatif2014untuktetap menjaga persaudaraan meski berasal dari partai yang berbeda dan warna yang berbeda. Hal ini disampaikan Mawardysesaatsebelummelepasstartgerakjalansehat menuju pemilu legislatif 2014 yang digelar KIP Kota Banda Aceh, Minggu (7/4) di depan Kantor KIP Kota Banda Aceh. "Warna kita boleh beda, tapi kita tetap bersaudara.Bersainglahsecarasehatdengancaramencari simpatimasyarakatsecarasehatjuga"AjakMawardy. Mawardyberharap,dengangerakjalansehatinipara calon anggota legislatif dari 15 yang akan maju dapat berbaurbersamadenganmasyarakatsertasesamacalon. Kepadaparacalon,Mawardyjugamemintamereka menyiapkanmentaldansiapmenerimahasildaripileg nanti."Artinyaparacaloniniharussiapmenangdansiap kalah, kita tidak ingin pileg diakhiri dengan kekisruhan

karenaketidaksiapanparacalonmenerimahasilpemilu" pungkasMawardy.Sementaraitu,PltKetuaKIPKotaBanda AcehAzhariAminS.Agdalamlaporannyamengatakan jalansehatyangdigelarkIPinimerupakanperintahdari KPUPusatdandilakukansecaraserentakdiseluruhIndonesiamulaidariAcehsampaiPapua. Dikatakannya, saat ini KIP Kota sedang melakukan proses pemutakhiran data, merekrut PPK dan PPS dan melakukan Bimbingan Teknis untuk mereka untuk persiapan menuju pileg nanti. Sementaraitu,padatanggal 9s/d22Aprilnantiakan membuka pendaftara calon, selanjutnya KIP akan melakukan uji baca Al-Quran. "Daftar calon sementara akankitaumumkandibulanJunidandaftarcalontetap akan kita umumkan pada bulan Agustus" ujar Azhari. Pantauandilapangan,Jalansantaiinidiiuktioleh600 orang,yaknidariparacalonyangakanmendaftarsebagai calegdari15partaiyangadadiBandaAcehsertaratusan masyarakatkotayangjugaikutberpartisipasi..(Mkk)

Idris Kepala Desa Terpilih Desa Sentang TANJUNG TIRAM BN, PemilihankepaladesayangdilaksanakandikantorDesa Suntang (Rabu,4/4) yang dimulai pukul 07.30 WIB, dimenangkan Idris dengan meraih 402 suara.Menang mutlakdalampemilihansebagaicalonbalonkepaladesa Sentang untuk priode 2013- 2019 kedepan. Acara pemilihan pilkades dihadiri,Camat Tanjung Tiram,BPMPD,KapolsekLabuanRukuAKP,Hamatondang

, Danramil 04Talawi ,Kapten Infantri SY Hasibuan serta hadirSatpolPP/LinmasKabupatenBatuBara. Pilkades telah berjalan dengan sukses ,selanjutnya menunggu dilantik Bupati Batu Bara H. OK. Arya. JulkarnainSH,MM.Kedepanhendaknyabagikepaladesaterpilih bisamengembantugasditengah-tengahmasyarakatjuga harusproaktivdidalammenjalankantugasyangdiembannya danbekerjasamadanPemerintahanKabupatenBatuBara.(sy)

Rahudman ... Memang, lanjut Indrawan, aksi demo kerap terjadi menuntut Rahudman Harahap ditangkap. Tapi, mungkin ada cela yang sulit menangkapnya. Ditambah lagi ada aturan sesuai pasal 21 KUHAP. “Nah, di sinilah dituntut ekstra keras kinerja penegak hukum terutama pihak kejaksaan. Selama ini kan masyarakat menilai bahwa kejaksaan itu seolah tak perduli. Apalagi menyangkut pejabat dan kalangan berduit. Saya minta kejaksaan jangan tebang pilih untuk mengungkap kasus korupsi di bumi pertiwi ini,” tegas Indrawan. Sebelumnya Kepala Kejaksaan Negeri (Kajari) Padangsidempuan Fredi Azhari Siregar, membenarkan pihaknya telah menerima pelimpahan tahap dua barang bukti dan tersangka dalam hal ini Rahudan Harahap, dari jaksa penyidik Kejati Sumut ke Jaksa Penuntut Umum (JPU). Setelah menerima berkas dari penyidik, dirinya sebagai pimpinan Kejari Padangsidempuan, menyatakan akan mempelajari dan meneliti berkas tersebut sebelum

melimpahkannya ke Pengadilan Tipikor Medan. Jika berkas tersebut dinyatakan layak, secepatnya akan disusun dakwaan terhadap Rahudman. Selain itu diakui Fredi, ada jaminan uang sekitar Rp 100 juta, yang nanti akan dititipkan di pengadilan. “Selain itu ada juga surat yang ditandatangani oleh Dedi, anaknya, sebagai pemohon jaminan. Belum terpikirkan saya ke presiden untuk ijin penahanan. Kalau pencekalan akan saya minta secepatnya kepada pihak imigrasi," katanya. Kecewa Di tempat terpisah, kuasa hukum Rahudman Harahap, Hasrul Benny Harahap merasa kecewa atas perkara dugaan korupsi Tunjangan Penghasilan Aparatur Pemerintahan Desa (TPAPD) Pemkab Tapanuli Selatan, yang menyeret namanya kliennya sebagai tersangka akhirnya dinyatakan lengkap atau P21 oleh penyidik kejaksaan. Benny dan Julisman mengakui bahwa kliennya yang resmi

menjadi terdakwa menyampaikan bahwa ini adalah suatu risiko menjadi pemimpin, dan harus siap menghadapi itu semua. "Ada rasa kekecewaan dan menyayangkan penyidik melakukan P21 atas perkara ini. Rahudman bilang, ini suatu risiko menjadi pemimpin dan kita harus siap menghadapi itu semua," ujar Benny menirukan ucapan Rahudman. Namun demikian, lanjutnya, sampai sekarang dia (Rahudman) tidak ada mengaku ke Benny dan Julisman akan meninggalkan kursi Walikota Medan. “Termasuk juga apakah dia (Rahudman) sudah berkoordinasi dengan Kemendagri perihal kasus ini sudah P21 dan tahap dua, tidak ada dibicarakan ke kami. Kami kan hanya menangani masalah hukumnya saja dan bukan politik," ujar Benny. Soal jaminan Rp 100 juta yang ditandatangani Dedi, salah seorang anak Rahudman, Benny sama sekali tak menampik. “Saya berencana menyerahkan uang Rp 100 juta. Sementara surat jaminan bertandatangan Dedi, diberikan bersamaan saat prosesi tahap dua di kantor Kejati Sumut,” sebutnya. (PEN/NET)

tahun 2013 tentang Penanganan Gangguan Keamanan Dalam Negeri, Poldasu melakukan rapat koordinasi dengan Pemprovsu dan Kodam I/BB untuk mengambil langkah ke depan dalam mencegah dan mengantisipasi konflik.”Sudah kita lakukan koordinasi dengan Kodam I/BB dan Pemprovsu dan rapatnya berlangsung di Mapoldasu”,kata Iwan. Juga dikatakannya koordinasi dengan Pemprovsu dan Kodam I/BB mengacu pada Inpres RI No.2 tahun 2013 tentang Penanganan Gangguan Keamanan Dalam Negeri itu dijadikan landasan para pemimpin di daerah dalam mengambil tindakan

mencegah potensi konflik dan untuk itu akan dilakukan koordinasi bersama. Kepolisan dijajaran Poldasu,imbuh Iwan sudah melakukan penanganan gangguan konflik dengan menggelar giat rutin kepolisian berupa razia di setiap wilayah hukum Poldasu.”Kita sudah melakukan penanganan dengan melakukan giat rutin kepolisian,” tegasnya. Iwan mengimbau seluruh masyarakat di Sumut agar bersama sama menjaga ketertiban,jangan mudah terprovokasi hal-hal yang bisa menimbulkan konflik dan bersama sama menjaga keamanan masyarakat. (HZA)

atau pensiunan. Berdasarkan lampiran surat itu, kata Kabag Humasy, ada 32 unit kerja yang akan diperiksa kenderaan dinas masing-masing. Pemeriksaan dilaksanakan8-9Aprildiinstansimasing-masing.Instansiyangakandiperiksa tim LKPD, yakni Akbid, Dinsosnaker, BKPP, Disduk dan Capil, Dis PU, Dihub, Dis Kebersihan dan Pertamanan, Ba. Kesbangpol dan Linmas, Inspektorat dan Dis Pendapatan. Selanjutnya, Dis koperindag UKM, Distan, BPMPK, KP2T, Diskes,

Kecamatan Rambutan, Kan. P2A&KB, BPBD, Kecamatan Bajenis, Kecamatan Tebingtinggi Kota, RSUD, Disporabudpar, Disdik, Kan. Perpus & Arisip, Bappeda, Sekretariat Pemko, Sekt DPRD, Kecamatan Pd. Hulu, Kecamatan Pd. Hilir, Kan. Satpol PP dan Kan. Ketapang. Total kenderaan dinas dimiliki Pemko Tebingtinggi di berbagai instansi, masing kenderaan roda dua, 700 unit, sedangkan kenderaan roda 3, 4 dan 6 mencapai 200 unit, tersebar di berbagai unit. (DER)

183 Konflik ... langkah langkah pencegahan untuk mengantisipasi konflik agar tidak terjadi jatuh korban jiwa. “Makanya harus dilakukan koordinasi antara pemerintah, TNI dan Polri didalamnya untuk mencegah dan mengantisipasi permasalahan ini,” jelas Iwan. Iwan kemudian menegaskan, untuk menyelesaikan masalah tanah rakyat maupun tanah milik negaraseluruh pihak terkait harus dilibatkan, terutama instansi yang membidangi pertanahan yakni Badana Pertanahan Nasional[BPN] Provsu dan BPN Kabupaten/Kota serta Pemkab/Pemko di Sumut. Ditambahkannya, sesuai instruksi pRPresiden[Inpres] RI No.2

Pemko ... dinas,” terang Ahdi Sucipto Surat itu, lanjutnya menginstruksikan agar seluruh SKPD menghadirkan kenderaan dinas operasional di seluruh SKPD di lingkungan Pemko Tebingtinggi, sedangkan khusus bagi Dinas Pekerjaan Umum (PU), termasuk pemeriksaan fisik atas alat berat dan yang sejenis dengannya. Juga diinstruksikan agar beberapa dinas yang punya bawahan segera menindak lanjutinya ke unit bawah masingmasing. Termasuk kenderaan dinas cicilan yang dipergunakan PNS


Walikota.. bawahannya,mengajak,sertabahumembahudalammensukseskankinerja SKPDnya masing-masing,”tegasWalikota Mawardy, seraya meminta. DiamengimbaukepadasetiapPNSdikotaBandaAcehagarterusberusaha meningkatkan kompetensinya baik melalui pelatihan-pelatihan, maupun secara ototidak. “Kita meminta PNS dijajaran Pemerintah Kota Banda Aceh agar terus meningkatkan kompetensinya. Dan, apa yang bapak ibu dapatkan selamamengikutidiklatadalahbagiankompetensimanajerial,dimanadisini diajarkanbanyakteoridanjugaterjalinkebersamaansesamepeserta.Danbisa dinilaiapakahkitatermasukorang-orangterbukaatautertutup,bisamenerima pendapat orang lain atau tidak,”pintanya. Terkait dengan pelaksanaan Diklat itu, Walikota mengatakan, hendaknya segalamateripelatihanyangtelahditerimaselama49haribisaditerapkandalam menjalankantugasselakuabdimasyarakat.Tidakhanyaitu,katanyalagi,sebagai abdi negara, PNS mendapatkan penghasilan dari pajak masyakat.Karena itu, sudahsepantasnyaPNSmengabdikepadamasyarakat. “Saya ingin tegaskan, mari ubah mindset kita sekarang juga dari dilayani menjadi melayani,”katanya. Sebelumnya kepala BKPP Kota Banda Aceh, M. Natsir Ilyas, mengatakan, Diklat Kepemimpinan Tingkat III angkatan I dilingkungan pemerintah Kota BandaAcehdilaksanakanselama49hariyangdimulaipada9Februarisampai 8 April meliputi 360 jam pelajaran. Ke 30 peserta terdiri dari 6 perempuan dan 24 laki laki. sebanyak 15 orang diantaranya menduduki jabatan eselon III dan 15 lainnya menjabat eselon IV yang sudah lulus seleksi Pim tingkat III. Dikatakannyaseluruhpesertatelahmelakukanobservasilapangankekota Surakartaselama6hari.Pesertadibagi3kelompokstudi.KelompokImengkaji topikupayapenguatancalonkepalasekolah,kelompokIImengkajioptimalisasi pembinaan kesenian tradisional jawa pada generasi muda, dan kelompok III mengkaji optimalisasi pengendalian tata ruang. Dijelaskannyasistempenilaianmengacupadaperaturanpemerintahno101 tahun2000tentangpendidikandanpelatihanjabatanPNS.keseluruhanpeserta dinyatakanlulus.Dengankualifikasi5orangpredikatnilaimemuaskan,18orang baik sekali dan 7 orang mendapat predikat nilai baik. (AF)

Kelompok di daerah tersebut. Karena terus dihantui kecemasan, warga pun melaporkannya ke Lurah Batu Teritip, Tanwir Azhar. Akhirnya pihak kepolisian sector sungai Sembilan pun menurunkan pasukan untuk berjaga jaga di lokasi. Konflik di perbatasan Dumai dengan Rohil ini tepatnya di wilayah hukum Batu Teritip, Kecamatan Sungai Sembilan bukan lagi masalah baru, tetapi tindakan brutal dari kelompok massa dari Sinaboi Rohil. Sebelumnya, pada 2012 lalu sempat memukuli dua anggota warga Dusun Mekar Sari dan melakukan aksi teror hingga kini pelakunya belum ditangkap polisi. Diduga kuat penanganan sesuai jalur hukum yang berlaku terhadap aksi yang meresahkan masyarakat mekar sari sejak dulu sepertinya tidak ada keseriusan aparat berkompeten seperti dijelaskan Ketua RT 09 Desa Mekar Sari, Umar kepada BN. Dikatakan, konflik dan ragam persoalan tanah di wilayah Kelurahan Batu Teritip seperti yang terjadi di Dusun Mekar Sari adalah merupakan bukti yang nyata bahwa tindakan hukum tegas tidak berjalan terhadap pelaku mafia tanah yang banyak menjuali lahan garapan yang tidak prosedural. Di mana di wilayah ini lahan hutan Negara sejak tahun 2006 lalu sampai sekarang diserobot kelompok mafia tanah dengan bertamengkan kelompok tani yang kemudian diperjual belikan kepada pembeli dari luar daerah. Terkait kasus yang memasuki wilayah hukum Dumai ini, dari investigasi dan penelusuran awak media ini, bahwa massa dari Sinaboi Rohil tersebut diduga membeli lahan dari mafia tanah. Sepak terjang jualbeli lahan garapan illegal di dearah Sungai Sembilan sejak lama berlangsung. Dan sudah banyak korban pembeli. Sebab lahan yang dijual mafia tanah ini tidak memiliki legalitas resmi, hanya surat blok yang ditandatangani ketua RT, dan ditanda tangani Camat dan Lurah sebagai bentuk formnalitas diduga senjata pemungkas mafia tanah untuk sebagai dasar menggarap lahan hutan Negara dengan cara illegal atau melawan hukum. (RDS)

Cuaca... cuaca belakangan ini tidak bisa diperediksi lagi. Bahkan menurutnya tergolong ekstrim. “Cuaca sekarang tidak bias lagi dibaca bang, tidak menentu sebentar panas sebentar hujan,” sebutnya kepada BN, kemarin. Menurut pria 30 tahun itu, cuaca yang tidak menentu bukanlah satu-satunya masalah yang dialami para petani yang seperofesi dengannya. Harga getah karet yang dinilainya masih rendah bila dibandingkan dengan harga kebutuhan pokok juga ikut mempersempit hidup para petani karenaya ucok berharap pada pemerintah KabupatenTapanuliSelatanagarmaumencarikan solusi bagi mereka. “Mudah-mudahan pemerintah kita bisa membantu kami bang, mencarikanjalanuntukmenaikkanhargagetahkaretataukalau memungkinkanmembukalapangankerjalahbangseluas-luasnya agar kami pun tidak harus jadi pangguris selamanya,”sebut Ucok. (AS)

Operet... dengan adat Dalihan Natolu digambarkan sedemikian rupa sehingga tanpaknya penonton ikut dalam bahagian kisah tersebut. Peran Hj Syaufia Lina selaku Ketua Dewan Penasehat DKDTS cukup besar dalam Oprette tersebut, demikian juga Ketua Panitia besar PRSU Tapsel H M Aswan Hasibuan, SH, dengan saran dan masukan yang disampaikan dapat mempertegas dan memantapkan penampilan para aktor serta menguatkan dukungan atas kerja tim dalam mempersiapkan segala sesuatunya. Seperti disampaikan Bupati Tapanuli Selatan H. Syahrul M. Pasaribu sebelum pementasan kepada semua yang berhadir bahwa sesuai Tema yang diambil “Back to Culture” untuk itu, dalam rangka pelestarian adat budaya di Tapanuli Selatan diharapkan pagelaran seni budaya ini tidak hanya sampai disini, akan tetapi dapat berkesinambungan hingga kemasyarakat. Hadir dalam pada kesempatan tersebut Wakil Ketua DPRD Sumut Ir.Chaidir Ritonga,MM, Ketua PKK Kab. Tapsel, Wakil Ketua Yayasan PRSU, Anggota Wali Amanat USU, H Panusunan Pasaribu, Rektor UGN dan Guru Besar USU Prof. Erwin, Kepala Satuan Perangkat Daerah dari Tapsel, Mahasiswa. Di sela- sela acara, Pemerintah Kabupaten Tapanuli Selatan memberikan piagam penghargaan kepada Hj. Syaufia Lina Syahrul M. Pasaribu, Ketua Forkala Sutan Soripa Mulia dan Ketua DKDTS Fajaruddin Tanjung dalam peran mereka melestarikan dan mengembangkan seni dan budaya di Tapanuli Selatan. (***)

15-22 APRIL 2013 | EDISI 355| THN KE-VIII

Indogreen Forestry Expo 2013 RAPP Gelar Talkshow Kehutanan Bersama Mahasiswa IPB Pelalawan:BN Ratusan mahasiswa Fakultas Kehutanan IPB ikuti Indogreen Forestry Expo 2013 yang digagas PT RAPP. Diketahui Hutan Industri Indonesia tertinggal dibandingkan konversi hutan menjadi kawasan kelapa sawit. Riauterkini-JAKARTA- Hari kedua penyelenggaraan Indogreen Forestry Expo 2013 yang berlangsung di Jakarta Convention Center (JCC) kembali menggelar Talkshow kehutanan. Kegiatan yang digagas PT Riau Andalan Pulp and Paper (RAPP) ini sendiri diikuti ratusan mahasiswa Fakultas Kehutanan Institut Pertanian Bogor (IPB) dan pembicara DR Ir Petrus Gunarso, Director Tropenbos International Indonesia Program. Dalam pemaparannya, Petrus menyebutkan meskipun Indonesia merupakan sebagai negara tropis yang memiliki keunggulan dibidang konservasi hutan alam, ternyata produksi Hutan Tanaman Industri (HTI) Indonesia masih sangat rendah jika dibandingkan beberapa negara lainnya. Bahkan, sejak tahun 2000 lalu, hingga kini luas Hutan Industri Indonesia jauh tertinggal jika dibandingkan konversi hutan menjadi kawasan perkebunan kelapa sawit. Tahun 2000 lalu, kawasan Hutan Industri Indonesia sekitar 959 ribu hektare dan tahun 2005 naik menjadi 1,091 juta hektare, tahun 2012 naik menjadi 1,2 juta hektare. Sementara luas perkebunan sawit di Indonesia mengalami peningkatan yang cukup pesat dalam 10 tahun terakhir. Tercatat tahun 2000 lalu luas perkebunan sawit di Indonesia hanya 958 ribu hektare, dalam 10 tahun terakhir meningkat menjadi 4,7 juta hektare. "Dengan luas area hutan yang kita miliki sekarang ini dan didukung iklim tropis yang ada di Indonesia, seharusnya pertumbuhan hutan industri meningkat juga," ujar Pria yang terlibat dalam penelitian dan kajian nilai konservasi tinggi di Semenanjung Kampar, Riau pada tahun 2010 lalu ini. Dipaparkannya, rendahnya produktifitas hutan industri ini tidak terlepas dari berbagai persoalan regulasi perizinan yang terjadi di indonesia. "Sehingga tidak mengherankan hutan industri kita luasnya tidak bertambah, meskipun ini cukup potensial untuk dikembangkan," pungkasnya. Secara spesifik Petrus menyebut pengaruh ini terasa sangat besar terhadap beberapa perusahaan bubur kertas di Riau, terutama PT RAPP. "Kita lihat sekarang ini produktifitas izin penebangan hutan sangat rendah, sehingga ini berpengaruh langsung terhadap kawasan hutan industri," cetusnya. Oleh sebab itu katanya, harus ada kejelasan dan koordinasi ditingkat Kementerian, terutama kepastian perizinan bagi perusahaan kehutanan ini. "Jadi harus ada koordinasi antar bidang yang ada di Kementerian Kehutanan, agar kajian mengenai satu kawasan hutan industri ini tepat sasaran," ucapnya. Selain itu, perlu ada restorasi kehutanan di Indonesia, sehingga ekologi kehidupan hutan bisa lebih seimbang. Misalnya restorasi hutan yang telah rusak oleh penebangan liar. "Restorasi ini tidak hanya pada hutan saja, tetapi juga menyangkut izin," tukasnya.***(rls)

ULP Pelalawan Beroperasi 2014 PELALAWAN,BN Pemkab Pelalawan pastikan unit layanan pengadaan (ULP) kabupaten beroprasi tahun 2014 mendatang. Dalam waktu dekat Pemkab akan lakukan sosialisasi Meskipun sejumlah daerah telah memiliki unit layanan pengadaan (ULP), namun Pemkab Pelalawan baru memastikan unit ini beroperasional pada 2014 mendatang. "Kita pastikan 2014 mendatang ULP kita sudah beroperasi dan itu sesuai amananat pemerintah. Sementara saat ini, ya dalam waktu dekat ini kita

akan lakukan sosialisasinya," terang Kabag Program Pembangunan Setkab Pelalawan H Hanafie,S.Sos.Msi, Jum'at (5/4/13). Hanafie mengatakan bahwa setelah tahapan sosialisasi yang dilakukan tahun ini maka unit pengadaan barang dan jasa ini dipastikan sudah terbentuk. Pembentukan ULP tetap tahun 2013 ini, namun pelaksanaannya akan dimulai 2014 mendatang. Kedudukan ULP yang akan memberikan pelayanan satu pintu, di dalamnya terdapat beberapa kelompok kerja (pokja) mempunyai posisi yang berimbang dengan para

pengguna anggaran (PA) atau bahkan lebih tinggi dari PPK. "Soalnya, PA dan ULP sama-sama diangkat oleh Kepala Daerah, sehingga pengambilan keputusan (terutama dalam penentuan pemenang pemilihan penyedia) dapat dilakukan secara mandiri tanpa pengaruh dari pihak lain," katanya. Begitu pula dengan bentuk ULP yang mandiri, sambungnya, pokja ULP tidak lagi terikat dengan atasan lain selain ketua atau struktur organisasi pada ULP sendiri. Sehingga dengan begitu, PPK dalam suatu pekerjaanpun tidak dapat ikut campur

Dana Bantuan Kelompok Tani Dilarang Dipotong PELALAWAN,BN Kuranglebihduatahunpenyelidikan mengenaikasus dugaan korupsi dana gapoktan yang di laporkan warga ukui kepada tipikor polda riau terjawab sudah setelah hakim menyidangkan islan tidak mampu berkelit pengadilan negri baru baru ini di Pekanbaru kembali di buka sidang kasus korupsi Gapoktan Ukui, Pelalawan. Saksi nyatakan tidak ada pemotongan dari dana bantuan. Dua Pegawai Negeri Sipil (PNS) Dinas Ketahanan Tanaman dan Pengan, Riau dan Dinas Pertanian (Distan) Kabupaten Pelalawan yang dihadirkan Jaksa Penuntut Umum (JPU) Kejaksaan Negeri (Kejari) Pelalawan. Pada persidangan kasus korupsi Gabungan Kelompok Tani (Gapoktan) Kecamatan Ukui, Kabupaten Pelalawan, menyebutkan tidak dibolehkan adanya pemotongan bagi dana bantuan kelompok tani. Hal tersebut diungkapkan, Ika Purwani, Sekretaris Teknis Pokja, Dinas Tanaman Pangan Riau, saat bersaksi pada sidang lanjutan kasus korupsi Gabungan Kelompok Tani (Gapoktan) Kecamatan Ukui, Kabupaten Pelalawan, dengan terdakwa Islan Bin Naridin, di Pengadilan Tipikor, Pengadilan Negeri (PN) Pekanbaru, Jum'at (12/ 4/13) siang. Ika Purwani yang dihadirkan JPU Rafisme SH dan JPU Cut Wardah SH, kepersidangan bersama saksi Admal, PNS Kasi Kelembagaan Dinas Pertanian (Distan Pelalawan, mengatakan, dana bantuan kelompok tani yang diberikan pemerintah pusat sebesar Rp 1 miliar. Bersih diterima oleh kelompok tani.

"Adanya biaya adminidtrasi yang dikenakan, itupun diambil dari dana simpanan pokok atau sukarela anggota kelompok tani," terang Ika dihadapan majelis hakim yang diketuai Ida Ketut Suarta SH. Dijelaskan saksi, Tahun 2010 lalu ada pengajuan permohonan bantuan tanaman pangan dari kelompok tani dari Kecamatan Ukui, Pelalawan, untuk 14 kelompok tani. Selanjutnya, saksi selaku Sekretaris Teknis Pokja kemudian memverifikasi persyaratan yang diajukan kelompok tani tersebut yang diketuai oleh terdakwa. Dan dikirim kepemerintah pusat untuk ditindak lanjuti. Selanjutnya saksipun tidak tahu lagi bagaimana perkembangan kelanjutan permohonan bantuan tersebut. Apakah dicairkan pemerintah pusat atau tidak. Saksi hanya tahu dari orang lain kalau dana bantuan telah dicairkan pemerintah pusat, yang diserahkan langsung kepada kelompok tani. "Untuk bantuan tersebut, bersih diterima kelompok tani terdakwa tanpa ada pemotongan. Sebab, sebagai biaya administrasi saat pengajuan permohonan. Itu dibayar langsung oleh anggota kelompok taninya, yang diambil dari simpanan pokok koperasi gapoktan yang bersangkutan," terang saksi. Selain itu, selama ini saksi sendiri tidak tahu apa nama kelompok tani yang dipimpin terdakwa. Begitu juga dengan terdakwanya, saksi juga tidak tahu," kata saksi lagi. Setelah mendengarkan keterangan Ika Purwani. Kemudian dilanjutkan dengan keterangan saksi Admal, PNS Kasi Kelembagaan Dinas Pertanian (Distan

Pelalawan. Seperti diketahui, Islan Bin Naridin, Ketua Gabungan Kelompok Tani (Gapoktan) Kecamatan Ukui, Kabupaten Pelalawan. Dihadirkan JPU Rafisme SH danJPUCutWardahSH,kepersidanganatasdugaankorupsi kelompok tani senilai Rp 242 juta, di Kecamatan Ukui, Kabupaten Pelalawan, pada tahun 2010 lalu. Dimana Gapoktan Ukui mendapat anggaran Rp1 miliar, dari pemerintah pusat. Sejumlah Gapoktan yang mendapatkan bantuan adalah, Tunas Harapan, Soga Makmur, Maju Bersama, Lembu Lestari, Sumber Rejeki, Geri Loji 07, Seiya Sekata danBinaSejahtera.Masingkelompoktanimendapatkan jumlah beragam. Paling tinggi sebesar Rp100 juta. Darianggarantersebut,terdakwaIslanmemaksasetiap ketua kelompok tani mengeluarkan uang sebesar Rp 30 juta, sebagai biaya administrasi. Meski ada yang diminta kurang dari Rp30 juta. Dana Rp 30 juta itu digunakan terdakwa untuk kepentingan pribadinya. Berdasarkan audit Badan PengawasanKeuangandanPembangunan(BPKP)Riau, negara telah dirugikan Rp240 juta. Akibatperbuatanterdakwa,JPUmenjeratnyadengan pasal 2 junto pasal 18 Undang-Undang (UU) No.31/1999 tentangpemberantasankorupsisebagimanadiubahdan ditambah dengan UU No.20/2001. Selain itu, terdakwa juga dijerat dengan pasal 8 junto pasal 18 Undang-Undang (UU) No.31/1999 tentang pemberantasankorupsisebagimanadiubahdanditambah dengan UU No.20/2001, dengan ancaman hukuman maksimal 20 tahun penjara dan minimal 4 tahun penjara(TIM)

Pemilik Kenderaan Roda Dua Banyak Korban Curanmor Meningkat , Masyarakat Resah DUMAI,BN Tindakan kejahatan pencurian motor roda dua belakangan ini kembali meresahkan masyarkat Dumai kejahatan ini dalam tahun 2013 sudah beberapa kali terjadi . bila pemilik kendaraan bermotor roda dua tidak ekstra hati hati asal lalai sedikit jika kendaraan diparkir bisa lenyap digondol maling. Hal serupa baru baru ini kembali terjadi menimpa warga bukit batrem (Sri Utami) dimana kendaraan yang dipakainya jenis Supra X 125 yang diparkir dipinggiran taman bukit gelanggang jalan sudirman dumai lesap dilarikan si laknat. Aksi Curanmol yang melarikan Honda merek Supra X 125 yang diparkirkan Sri Utami dengan nomor polisi 6302 HA berwarna hitam diduga telah di intai pelaku sejak diparkirkan . yang mana ketika itu sedang ada kegiatan gelar dongeng cerdas yang pesertanya dari murid murid TK dan Sd kelas I sekota Dumai dan saat itu korban setelah

memakirkan kendaraannya langsung memasuki arena kegiatan Dongeng cerdas karena anaknya ikut serta dalam kegiatan tersebut yang kemudian usai acara kembali menuju tempat parkir dilokasi parkiran taman bukit gelanggang ternyata kendaraan yang merupakan millik temannya yang dipinjamnya sudah raip. Keterangan diperoleh media BN diarena bukit gelanggang bahwa menurut beberapa sumber mengatakan terkait hilangnya kendaraan roda dua dilokasi ini sudah sering terjadi belakangan ini. Lagi pula kendaraan yang hilang adalah yang masih mulus ujar beberapa dan juga beberapa pedagang lokasi parkiran taman bukit gelanggang itu saat bincang bincang dengan wartawan BN. Pelaku Curanmor menjadikan lokasi ini sebagai sasaran empuk karena selalu ramai dipadati pengunjung. Bukan saja pada sore hari malam haripun,Kalau lalai, sebentar saja ditinggal pemiliknya kendaraan roda dua bisa langsung raip.

Dari pantauan media ini kejahatan Curanmor kota Dumai sampai tahun 2012 masih terlihat tidak meresahkan masyarakat karena sebelumnya sejumlah tokoh elemen masyarakat di Dumai meminta kepada aparat kepolisian agar pelaku Curanmor ditembak dan hasilnya menggembirakan dimana kejahatan pencurian bermotor itu langsung reda. Tetapi setelah memasuki tahun 2013 ini maling kendaraan roda dua itu kembali memanas dan sudah banyak warga korban kehilangan kendaraan. Karena itu beberapa pemerhati dan pengamata di Dumai kembali menyikapi aksi Curanmor tersebut karena sudah meresahkan warga, meminta kepada pihak kepolisian agar pelaku ditindak tegas seperti tahun sebelumnya. Bahwa pelaku Curanmor diberangus habis atau dihukum berat saja (Ditembak dan dimasukkan ke penjara agar ada efek jera) ujar beberapa pemerhati kasus Curanmor itu yang minta namanya tidak ditulis (Rds/Tenk)

dalam proses pemilihan. Pada akhirnya dengan pelayanan pengadaan yang kredibel dari ULP maka akan dapat diperoleh proses pelaksanaan pengadaan yang sesuai dengan aturan, prinsip serta kebijakan pengadaan sehingga kebutuhan pengguna akan barang dan jasa dapat dipenuhi sesuai dengan kebutuhannya. "Barang danjasa yang sesuai dengan kebutuhan pengguna akan meningkatkan tingkat pelayanan masyarakat dan dapat memberikan perlindungan hukum untuk meminimalkan resiko bagi organisasi," tandasnya(lingkon)

Oknum PNS Masih Ada yang Tidak Patuh Aturan Pada Jam Kerja Masih Nongrong di Kedai Kopi Dumai ,BN Sejak tahun 2013 ini beberapa oknum yang berstatus PNS di lingkup Pemko Dumai masih saja ada kedapatan dilihat awak media ini pada jam kerja nongkrong dikedai kopi. Diduga prilaku oknum PNS tersebut yang masuk kedai kopi pada jam kerja belum diketahui walikota dumai dan wakil walikota dumai sehingga oknum PNS tersebut yang seharusnya sudah menjalankan tugas kerja dikantor ternyata menyempatkan korupsi waktu menikmati enaknya kopi dan lontong dibeberapa kedai kopi maupun santapan makanan mie goreng dan lain lain. Perilaku oknum PNS yang diduga korupsi waktu itu kadang bisa sampai ada yang satu jam lamanya dikedai kopi pada jam kerja. Karena itu seharusnya sikap yang kurang mematuhi disiplin tersebut tidak dipertontonkan dihadapan orang banyak. Sebab PNS adalah abdi masyarakat dan abdi Negara yang bisa jadi panutan terutama menyangkut disiplin waktu jam kerja. Tidak tercermin memiliki displin , seharusnya, bahwa oknum PNS bisa menjaga citra dimata masyarakat. Kejadian hal yang menemukan oknum oknum PNS pada jam kerja itu hampir ada kedapatan dalam setiap minggunya nongkrong dikedai kopi tidak jelas diketahui BN oknum tersebut apakah mendapat prioritas dari atasannya sehingga bisa mengopi enak enak dikedai kopi pada jam kerja Dari pantauan media ini beberapa oknum PNS tersebut ada dikedai kopi pada jam kerja sekitar jam 09 sampai jam 10 pagi. Seperti dikedai kopi jalan sukajadi, dikedai kopi jalan ombak, dikedai kopi jalan sultan sarif kasim dan dibeberapa kedai kopi dijalan sudirman. Berbagai kalangan dimasyarakat dumai memperhatikan sikap oknum PNS tersebut karena pada jam kerja masih ngopi dikedai kopi seharusnya walikota dumai dan wakil walikota dumai harus menegur tegas agar perilaku yang diduga tidak disiplin tersebut tidak terbawa bawa dari hari ke hari. Bukan tidak mungkin timbul asumsi masyarakat bahwa sudah digaji Negara masih enak enak nongkrong dikedai kopi terkecuali pada jam istirahat makan, kalau waktu istrahat tidak jadi masalah. (Rds/Tenk

Lahan Hutan Negara ei Kawasan Perbatasan Dilego Mafia Tanah

Pemko Dumai Segera Bangun Tugu Tapal Batas Dumai-Rohil DUMAI:BN Pemerintah kota Dumai pada tahun ini segera membangun tapal batas antara Dumai _ Rohil.anggaran untuk membangun tapal batas tersebut telah dianggarkan pada APBD 2013.pembangtunan tapal batas di kecamatan sungai Sembilan ini sejak lama di idam idamkan masyarakat karena aksi penyerobot dai sinaboi rohil terus berupaya menggarap lahan yangt terletak didalam wilayah hukum dumai diperbatasan, bahkan sampai ada berdiri bangunan kantor Kepala Desa di lahan wilayah hukum dumai kelurahan batuteritip . kantor Desa tersebut diduga dibawah pemerintahan kecamatan sinaboi kabupaten Rohil diduga cacat Hukum”. Kesiapan pemko dumai membangun tapal batas pada tahun 2013 ini disampaikan langsung oleh Wakil Walaikota Dumai H.Agus Widayat pada beberapa Wartawan di dumai belum lama ini.biaya anggaran untuk membangun tugu Tapal batas antara Dumai -- Rohil itu sudah dianggarkan pada APBD 2013 ujarnya.dan pembangunan tugu ini, adalah merupakan program Pemko Dumai Demi terciptanya iklim yang kondusif di daerah perbatasan, tentunya mengantisipasi gejolak yang tidak sehat didaerah perbatasan tepatnya di kelurahan batu teritip kecamatan sungai Sembilan artinya untuk mengamankan lahan wilayah hukum Dumai agar tidak diklaim pemerintah Rohil terang wakil Walikota Dumai itu. Lahan yang terletak diKawasan perbatasan Antara Dumai _ Rohil tepatnya di kelurahan batuteritip sejak dulu di usik kelompok mafia tanah. Gejolak ini timbul karena tapal batas yang belum terbangun ada berdiri dengan kokoh. Bahkan sepak terjang mafia tanah sejak lama didaerah ini kerab

beroperasi dengan mengapling lahan hutan Negara dan diperjualbelikan kepada pembeli yang datang dari luar daerah seperti dari kisaran , tanjung balai asahan, daerah labuhan batu, negeri lama, ajamu dan dari tanah karo serta dari daerah simalungun Sumut. Permainan licik mafia tanah irtu cukup bermodalkan tameng kelompok tani saja dengan dasar surat blok yang ditandatangai lurah dan camat .bahkan sesuai impormasi ada yang bermodalkan surat yang diragukan keabsyahannya seperti surat hibah dari Datuk laksamana Raja Dilaut”.sementara lahan tersebut adalah lahan Hutan Negara dan kayu habis dibabati pelaku illegal loging sejak tahun 2006 silam.setelah kayu habis lahan pun dilego pada toke toke berduit. Sejauh itu kejahatan yang merugikan Negara tersebut, namun para pelaku tidak ada yang ditangkap kehutanan Riau apalagi kehutanan Dumai terkesan”sepertinya bungkam saja”.Kok begitu ya ???sehingga ada protes dan asumsi rakyat Dumai Institusi itu diduiga gagal menyelamatkan asset Negara (Lahan Hutan Negara dan lahan kawasan Hutan _red ) Kejahatan memafiakan lahan negara diwilayah ini bisa berjalan aman karena factor tapal batas yang tidak transparan.sehingga mafia tanah ditengarai selama ini mencuri lahan hutan Negara di dearah perbatasan antara Dumai_rohil itu bisa mulus .bahkan lahan HPH PT Diamond Raya Timber pun diduga diserobot.dimana dari pantauan BN lahan dikawasan HPH PT Diasmond Raya Timber diduga diklaim oknum yang bertamengkan lahan kelompok tani da Koperasi sekitar puluhan hektare.. Lahan tersebut diperjualbelikan kepada warga Sumut dengan cara mengandalkan propaganda dan iming iming modal disediakan bapak angkat untuk biaya membangun perkebunan

sawit. Strategi akal busuk mafia tanah inilah terus menerus ditebarkan di beberapa daerah Sumut mengelabui mangsanya . taktik busuknya itu yach dengan cara cara tadilah, menjuali lahan hutan Negara di Desa Mekar sari dan lahan di Sei Sinepis yang diduga lahan tersebut juga masuk HPH PT Diamond Raya Timber.berbagai kalangan di masyarakat Dumai dan beberapa LSM belum lama ini angkat Bicara terkait lemahnya penanganan kasus lahan disungai Sembilan Dumai menuai banyak protes dan Diduga ada pembiaran. Mengenai masalah ragam konflik lahan dan aksi penyerobotan lahan hutan Negara maupun lahan peruntukan Transmigrasi dikelurahan batu teritip Tiangjong diduga banyak dilego mafia tanah tetapi tidak ada tindakan refresifdari aparat pemko dumai. hal itu dusebutkan Ketua LSM DPD KPFI RI Erwan S ,dan Rudy DS Direktur Kemitraan dan Mediasi DPC Clean Governance (C G) Kota Dumai pada BN baru baru ,aktivis ini meminta agar Pihak Kehutanan Riau dan Menteri Kehutanan RI secepatnya turun tangan menyelamatkan asset negara (lahan hutan Negara dan Lahan kawasan Hutan_red )di wilayah kecamatan sungai Sembilan dumai . sebab tercium kabar bahwa kawasan tersebut bakal dijadikan objek oleh pemain Politik dalam mencari perhatiandan menarik sipatik gaya budaya “Penjilat” rakyat dalam upaya meraup suara banyak pada Pileg(pemilihan legislatif ) mendatang ini, ujar aktivis itu pada BN.jikalau tidak sigap menanganinya , mafia tanah yang bertopengkan kelompok tani dan koperasi yang tidak procedural, bakal terus memperjualbelikan lahan hutan Negara dan lahan kawasan hutan Negara di kecamatan sungai Sembilan Kota Dumai nuntuk mengumpulkan uang untuk kepentingan kelompok akhirinya.(RDS)


15 - 22 APRIL 2013 | EDISI 355 | THN KE-VIII

Polisi Bentrok Dengan Pengunjukrasa di Belawan MEDAN, BN Bentrokan antara seratusan massa dari Solidaritas Masyarakat Islam untuk Muslim Tertindas[ Somasi Umat] dengan pihak kepolisian Belawan saat melakukan unjukrasa di depan Mapolres Belawan, Jumat[12/4] sore. Para penghunjukrasa memaksa masuk ke Mako Polres Pelabuhan Belawan melalui pintu gerbang yang sudah diblokade pasukan Polres Pelabuhan Belawan. Aksi

yang semula damai tiba tiba massa memaksa masuk dengan mendorong blockade polisi dan aksi dorong mendorong pun terjadi dan baku hantam terjadi sehingga suasana tidak terkendali. Massa penghunjukrasa pun mulai bertindak anarkis dengan melempari barikade polisi. Dan polisipun merasa terpancing dengan membalas lemparan tersebut. Sejumlah polisi pun terpaksa menghindar dari lemparan massa. Setelah pa-

sukan polisi yang dipimpin langsung Kapolres Pelabuhan Belawan AKBP Endro Kiswanto melakukan tindakan tegas akhirnya massa pun mundur. Setelah itu massa pun melakukan orasi ditengah jalan raya sehingga memacetkan lalulintas sehingga arus keluar masuk barang dari terminal peti kemas terganggu. "Unjukrasa berdampak terhadap keluar masuk barang dari/ke terminal peti kemas BICT", kata Humas BICT [Bela-

wan Internasional Terminal Container] H Suratman SSos. Seorang penghunjukrasa M Dahrul Yusuf meminta agar suku Rohingya yang ditahan tanpa syarat karena kasus pembunuhan 8 warga Negara Myanmar di Rudemin Jalan Selebes Gang Pekong Belawan, Jumat[5/4] lalu adalah membela diri dan membela harga diri umat Islam, karena 3 wanita Rohingya diganggu WN Myanmar di Rudemin Belawan. (HZA)

Supir Ugal-ugalan, Angkot Rajawali Masuk Parit TEBING TINGGI. BN Satu unit Bus angkutan Kota (angkot) merk Rajawali yang membawa belasan penumpang, pelajar SMP dan SMA kejebur kedalam parit sedalam lima meter di Jalinsum Medan-Tebing Tinggi, tepatnya di Desa Paya Bagas Kec. Tebing Tinggi Kabupaten Sergai, Kamis pagi sekira pukul 07.00 wib. Akibat kejadian itu, satu siswa penumpang angkot tersebut mengalami luka berat, dan belasan penumpang lainnya luka-luka memar ditangan dan kepala. Berdasarkan informasi diperoleh dan pantauan wartawan koran ini dilokasi, saat kejadian, bus angkot Rajawali BK 1416 ZF

yang dikemudikan Ronald Sihombing (43) tahun Warga Suka Damai terlalu ugal-ugalan, hendak mengantarkan siswa ke sekolah, dari Desa Suka Damai Sergai keperguruan Yayasan Budi Murni Kota Tebing Tinggi. Dari puluhan siawa SMP dan SMA yang menjadi korban Lakalantas ini dilarikan oleh Warga ke RSU Sri Pamela Kota Tebing Tinggi. Dari belasan siswa yang mengalami luka memar dibagian kepala dan kaki antaranya Erikson (16) tahun Warga Kampung Banjar, Ramauli Tambunan (17) tahun Warga Kampung Pon Sergai, Selvi (13) tahun Warga Kampung Pon, Rido Siagian (18) tahun Warga Kampung Banjar, Veri Siagian (17) tahun Warga Kampung Banjar, Masta Si-

Sopir Angkot Bawa Truk Berisi CPO Ditangkap MEDAN, BN Petugas Subdit III Umum Direktorat Reserse Kriminal Umum[Ditreskrimum] Poldasu menangkap sebuah truk Fuso yang membawa Crude Palm Oil[CPO] bermuatan 15.000 liter CPO dikemudikan oleh seorang sopir angkot, Junaidi[38] warga Tandem, Binjai, Selasa[9/4]. Keterangan yang diperoleh dari Junaidi di Mapoldasu ini, sebenarnya ia hanya sopir angkot kota lin 03 jurusan BinjaiStabat. Untuk mencari tambahan ia bersedia disuruh membawa truk pengangkut CPO tersebut kekawasan Tandem, dengan upah Rp.50 ribu dan lokasi gudag juga tidak jauh hanya 1 km saja . Dan ia bekerja atas perintah Irwansyah yang baru satu bulan dikenalnya. "Dia hanya menyuruh membawa truk bermuatan CPO ini ke gudang. Sehari hanya satu kali saja",tuturnya ketika wartawan menanyakan hal itu kepadanya di Mapoldasu. Diapun tidak tau karena katanya dia langsung dibawa petugas ke Mapoldasu. Kasubdit III Umum Direskrimum Poldasu, AKBP Andry Setiawan, menyebutkan pihaknya dalam Operasi Palm Toba 2013 menahan satu truk Fuso roda 10 dengan plat nomor BD 4717 LA bermuatan 15.000 liter CPO, dua drum penampung CPO dan dua selang. "CPO tersebut diperoleh dari para sopir dari wilayah Aceh yang akan mengirim CPO ke Belawan. Diperjalanan truk tangki singgah diminta menurunkan sekitar satu gelang sampai tiga gelang setiap truk bermuatan CPO",ujarnya. Menurut Andry 15.000 liter CPO itu hasil kejahatan yang dikumpulkan dari para sopir di gudang-gudang illegal..Tersangka yang diamankan masih pekerja[worker] yakni pekerja dan dua sopir yaitu Suyono[55] warga Lubuk Pakam, Pasar Miring Deli Serdang dan Seno[58] warga Lubuk Pakam. "Pelaku dan penadahnya kita amankan. Ini akan dikembangkan siapa orang yang ada diatasnya. Untuk saat ini belum ada oknum TNI atau Polri yang terlibat.Hasi yang ditangkap ini dari seminggu yang dikumpulkan dua gelang hingga empat gelang. Stu gelang harga rata rata Rp.200.000",jelasnya. Sementara itu Direktur Ditreskrimum Poldasu Kombes Pol Marsauli Siregar menambahkan Operasi Palm Toba 2013 yang digelar sejak 1 April hingga 15 April 2013 mendatang, Poldasu sudah berhasil mengungkap 33 kasus dengan 35 tersangka. Barang bukti yang diamankan 3 truk satu unit tangki,dua buag gelangan,satu drum CPO. "Kita telah mengamankan 25 ton CPO. Operasi Palm Toba 2013 mengedepankan enam Polres yakni Polres Labuhanbatu, Deli Serdang, Tebing Tinggi, Simalungun, Asahan, KP3 Belawan dan Sergei, ini yang dikedepankan sedangkan lainnya mendukung dan ini sudah targetnya",jelasnya Operasi ini digelar inisiatif Poldasu karena sudah banyak aksi penggelapan yang sudah meresahkan. "Pengusaha tidak melaporkan karena merasa tidak masalah dengan digelapkannya satu gelang sampai dua gelang. Namun hal ini mengganggu juga, makanya kita melakukan operasi",imbuhnya. [HZA]



manjuntak (39) tahun Warga Kampung Pon, Winda (16) tahun Wartawan Desa Gempolan, Oki Sibarani (18) tahun Warga Kampung Tempel, kini mereka dirawat di RSU Sri Pamela. "Salah satu siswa saat ditemui wartawan di rumah sakit mengatakan, dia (supir angkot) terlalu ugal-ugalan, mulai dari Suka Damai Pak, sepertinya dia tidak memikirkan nyawa penumpang sehingga mobilnya masuk parit, dan kami pun lukaluka begini," ucap David Kristian salah seorang korban kecelakaan itu. Sedangkan angkot mengalami kerusakan parah. Kasus Lakalantas ini sudah ditangani Satlantas Mapolres Tebing Tinggi. (IBNU)

Angkot Rajawali BK 1416 ZF ringsek setelah terjun ke dalam parit PTPN III Kebun Rambutan di KM 72 - 73 Desa Paya Bagas Kec. Tebing Tinggi Kab. Sergai

Polisi Bongkar Penggelapan dan Penipuan Mobil MEDAN, BN Kepolisian Sektor Medan Kota[Polsek Medan Kota] berhasil membongkar jaringan penggelapan dan penipuan kendaraan bermotor [mobil] di Jalan Sisingamangaraja tepatnya didepan pintu tol Amplas, Jumat[5/4] dan polisi berhasil membawa lima unit mobil ke Mapolsek Medan Kota.. Hal ini disampaikan Kapolsek Medan Kota Kompol Paulus Hotman Sinaga ,Senin[8/4] kepada wartawan. Penangkapan ini berawal dari informasi adanya penjualan mobil murah. Petugas mencurigai,dan melakukan undercover buy[transaksi sebagai pembeli]. Setelah dicek, kendaraan tersebut tidak memiliki dokumen kendaraan yang lengkap "Per unitnya Rp.25 juta. Dengan harga tersebut patut dicurigai asal usul kendaraan. Barang bukti yang berhasil kita amankan,yakni Daihatsu Xenia BM 1418 SG, Daihatsu Xenia BK 1335 KI[plat nomor palsu], Daihatsu Xenia BK 1863 KK, Toyota Avanza B 1633 PKU, Suzuki APV BK 1491 JO, 1 lembar surat tilang, 4 lembar kwitansipenerimaan uang,2 lembar kwitansi pembayaran kredit mobil, 2 lembar STNK, 1 lembar surat sewa menyewa", ungkapnya. Kapolsek menghimbau kepada masyarakat berwirausaha menyewakan mobil agar dapat menggunakan alat deteksi dikendaraannya.Hal itu agar mudah melacak kendaraan dimana berada Dalam hal ini petugas berhasil menangkap

tersangka yakni Irwan[34] warga Jalan Dusun III Desa Suka Mandiri Hilir Kecamatan Pagar Merbau ,Wardoyo[39] warga Jalan Pasar V Kebun Kelapa Dusun Bina Karya Kecamatan Beringin Deli Serdang, Dadi Susanto[[26] warga Jalan Meterologi PWI/Tanah Garapan Dusun XVI Deli Serdang/ Jalan Bersama Dusun VII Lau Dendang, dan Hartono[38] warga Jalan Bakaran Batu Gang Antara Lubuk Pakam/Jalan Sidirman No.23 Lubuk Pakam Deli Serdang, "Dari pengakuan mereka barang bukti diperoleh dari P, B dan AL, masih kita buru",tegasnya. Motif pelaku menerima gadai mobil dengan membayar sejumlah uang dengan jumlah bervariasi dan kemudian mobil tersebut digadaikan pula kepada orang lain. "Sesuai laporan pengaduan LP : LP/11/IV/ 2013/Reskrim tanggal 5 April 2013, ini masih dalam pengembangan penyidikan. Menurutnya tersangka yang sudah menguasai kendaraan itu, kemudian menukar nomor platnya dengan plat palsu agar tidak dapat kendala dilapangan. "Tersangka juga membeli satu surat tilang dari personil lalulintas Polres Deli Serdang untuk mengelabui dokumen mobil tersebut. Kita juga akan berkoordinasi dengan Direktorat Lalulintas Poldasu untuk melihat keabsahan dokumen kendaraan tersebut,jelas Kapolsek Medan Kora Kompol Paulus Hotman Sinaga. (HZA)

Dua Kapal Pukat Tarik Diamankan Sat Pol Air Sergai TANJUNG BERINGIN, BN Satuan Polisi Air ( Sat Pol Air ) Polres serdang Bedagai menangkap dua kapal gandeng tanpa nama menggunakan alat tangkap trawl jenis pukat tarik, yang beroperasi sekitar 1,5 mil dari bibir pantai sialang buah, kec. Teluk Mengkudu kemarin sore. Selain mengamankan kapal dan hasil tangkapan Pol Air juga mengamankan dua kapten Kapal (Nakhoda ) IN,27 , warga dusun IV, Desa Pematang Guntung Kec.Teluk Mengkudu dan JH,35 warga dusun V, Desa Pekan Sialangbuah, Keca-

matan yang sama , bersama lima anak buah kapal ( ABK ). Usai menjalani pemeriksaan kelima ABK diperbolehkan pulang. Keterangan dihimpun, sore itu personel SatPol Air Polres Sergai melakukan Patroli rutin dan menerima laporan dari masyarakat nelayan tentang adanya pukat tarik gandeng tengah beroperasi tidak jauh dari bibir pantai sialangbuah. Dibantu nelayan tradisional lainnya Pol Air langsung menuju lokasi, sekaligus mengamankan kedua kapal berikut ABK dan kapten

kapal yang langsung diboyong ke Mako Pol Air Sergai diDusun I, Desa Tebing tinggi Kec.Tanjung Beringin. Usai menjalani pemeriksaan, JH mengaku tidak tahu kapal dan lat tangkap yang digunakannya melanggar hukum dan baru 14 hari menjalankan usaha tersebut. Mereka beranggapan selama ini alat tangkap semacam itu tidak menyalahi. Kapolres Sergai AKBP Arif Budiman,S.Ik,MH melalui Kasat Pol Air Sergai AKP Bahdaruddin membenarkan tertangkapnya kedua kapal pukat tarik tersebut .( IBNU )

Tertidur Usai Tenggak Tuak Sepeda Motor Beat Langsung Lenyap

Pelaku curanmor Kaharuddin dan Ariansyah di dampingi kanit reskrim Ipda Tarmizi Lubis

POLRES Tapanuli Selatan resort Barumun berhasil menagkap dua orang pelaku pencuri sepeda motor pada hari

jum'at (12/4) di desa Bulu Sonik Kecamatan Barumun Padang Lawas(Palas).

Hal tersebut disampaikan oleh Kanit Reskrim Polsek Barumun Ipda Tarmizi Lubis SH,saat di konfirmasi diruangkerjanya mengatakan,berkat laporan dari warga pihaknya telah berhasil menagkap dua orang pelaku curanmor yakni,Kaharuddin (23) dan rekannya Ariansyah (19) penduduk pekan selasa Portibi Kabupaten Paluta ,di desa Bulu Sonik Kecamatan Barumun Palas pada hari Jum'at 12/4 sekitar jam 14 wib dengan barang bukti satu unit sepeda motor Beet plat nopol BB 4076 JB. Menurut Kanit,dari hasil introgasi terhadap kedua pelaku,peristiwa tersebut berawal dari saat kedua pelaku mendatangi salah satu pakter(kedai tuak) di pekan selasa portibi pada hari Kamis sekitar jam 01 wib untuk membeli minuman beralkohol jenis tuak. Setibanya di lokasi kejadian perkara (TKP) keduanya mengurungkan niat untuk membeli tuak karena melihat pengunjung pakter bernama Lumban penduduk desa yang sama sudah dalam keadaan mabuk dan tertidur,sedangkan sepeda motor korban di parkir dengan kunci tidak dilepas di halan pakter.Kesempatan tersebut lansung di

Minyak Oplosan Kembali Makan Korban MEULABOH, BN Sepasang suami istri kamis(11/4) jelang magreb terbakar akibat disambar api yang menjulur dari lampu teplok, akibatnya istri dari pasangan tersebut mengalami luka bakar di sekujur tubuh, sedangkan suaminya mengalami luka bakar di bagian lengan tangan sebelah kanan, di duga korban terbakar akibat menyalakan lampu teplok dengan menggunakan minyak tanah yang telah di oplos. Akibat disambar api dari lampu teplok, M Said(75) dan Zainah(57) sepasang suami istri warga desa Gleng Kecamatan Sungai Mas Aceh Barat, mengalami luka bakar di duga kebakaran tersebut terjadi akibat minyak tanah yang digunakan korban untuk penerangan rumahnya telah di oplos oleh penjual yang tidak bertanggung jawab, pasangan suami istri tersebut terpaksa dilarikan ke rumah Sakit Umum Cut Nyak Dhien Meulaboh guna mendapat perawatan. Ibnu anak korban kepada Bongkarnews, mengatakan saat kejadian tersebut desa mereka dalam keadaan mati listrik, sehingga kedua orang tuanya menyalakan lampu teplok namun lampu itu langsung disambar api dan Zainah ibunya tidak bisa mengelakkan dari kejadian tersebut sekujur tubuhnya langsung dilalap api, sedangkan M Said suami Zainah juga mengalami luka bakar dibagian lengan, saat memberi pertolongan kepada istrinya. Menurut Ibnu, minyak tanah yang digunakan untuk lampu teplok itu dibelinya beberapa waktu lalu pada seorang agen keliling yang menggunakan becak, dia menduga minyak tersebut sebelum dijual telah dioplos terlebih dahulu ia mengharapkan kepada pihak berwajib agar mengusut kasus yang menimpa keluarganya. (@rul)

Petugas Grebek Perjudian yang Ketangkul Shabu-shabu TELUK MENGKUDU, BN Seorang pemakai narkoba jenis shabu berhasil ditangkap dari satuan petugas buser Polres Serdang Bedagai saat pelaku sedang bermain judi kartu leng di rumah salah satu tetangganya, didusun darul aman desa sei buluh kec.teluk mengkudu kab.serdang bedagai tepatnya rabu ( 10/4/2013) sekitar pukul 18.30 Atas informasi dari masyarakat kepada kasat narkoba Polres Sergai AKP.Hendra bahwa tersangka akan melaksanakan pesta shabu dilingkungan tersebut. Kemudian Kasat Narkoba menindak lanjuti informasi yang berharga dari masyarakat, dan Kasat memerintahkan Kaur Bin OPS Narkoba Ipda. A.Haidir Harahap,S.Sos bersama busernya untuk memberantas persedaran narkoba tersebut. Setelah dilakukan penyamaran dan diselidiki bahwa tersangka ditemukan sedang asyik bermain judi leng disebuah rumah milik Bobby ( melarikan diri ) selanjutnya buser Narkoba memeriksa TKP seketika itu ditemukan barang bukti 1 paket shabu shabu yang sudah dikemas plastik tembus pandang, 1 bungkus rokok Djie Sam Soe Premium dan uang Rp. 2.000,- yang mana pada waktu penangkapan para tersangka ada yang melarikan diri, sehingga yang tertangkapan hanya 3 orang, 1 orang tersangka narkoba ( syaiful bahri lubis ), 2 orang tersangka judi, mengingat situasi keamanan masyarakat yang sudah begitu ramai disekitar TKP, kemudian kasat Narkoba beserta anggotanya langsung memboyong kedua tersangka bersama barang bukti ke Sat Narkoba POLRES Sergai. Tersangka syaiful bahri lubis dari tahun 2008 sudah pemakai narkotika sejenis shabu shabu . Kapolres Sergai berpesan bahwa Kepolisian Resort Serdang Bedagai tidak henti hentinya memberantas persedaran Narkoba dan Permainan judi, diharapkan kepada masyarakat agar turut membantu dan memberikan Informasi kepada Polres Sergai tentang peredaran Narkoba maupun perjudian yang merusak kehidupan serta pola pikir bangsa Indonesia. Dan saat ini tersangka masih dilakukan penyidikan untuk membuat terang perkaranya oleh Sat Narkoba Polres Sergai. Tersangka ini dikenakan ancaman hukuman pasal Narkotika, pasal 114 ayat 1 subs pasal 112 ayat 1 UU RI No.35 tahun 2009 tentang Narkotika. Dengan sengaja memiliki, menyimpan dan menyediakan tempat bagi pemakai bahan narkotika tanpa izin dari pihak yang berwajib dengan ancaman hukuman minimal 5 tahun maksimal 9 tahun penjara, " terang Arif Budiman. ( IBNU )

manfaatkan kedua pelaku membawa kabur sepeda motor tersebut ke arah sibuhuan ibu kota Padang Lawas. Lanjut Kanit keesokan harinya Lumban sangat terkejut melihat kenderaan yang di parkirnya sudah tidak ada,merasa khawatir lalu membuat laporan ke polsek di Paluta.Sedangkan kedua pelaku berusaha mencari pembeli sepeda motor hasil curian di Padang Lawas. Sehingga pada hari jum'at (12/4) sekitar jam 14 wib salah seorang warga memberikan informasi bahwa ada dua orang pemuda hendak menjual sepeda motor tanpa surat resmi,mendapat laporan tersebut Kanit Reskrim Tarmizi Lubis SH serta beberapa anggota langsung terjun ke lokasi sembari mencocokkan dengan ciri ciri pelaku sesuai dengan laporan yang sudah kita terima sebelumnya. Selanjutnya usai memastikan ciri dan jenis sepeda motor kedua pelaku beserta barang bukti di boyong ke mapolsek Barumun guna pemeriksaan lebih lanjut,sedangkan keduanya dikenakan KUHP pasal 363 dengan ancaman penjara limatahun. (Ali)

Syaiful Bahri Lubis diapit Kasubag Humas AKP Z Siregar

15 - 22 APRIL 2013 | EDISI 355 | THN KE-VIII

WakilWalikotaTebingtinggi Kunker Jumling Kelurahan Lalang TEBINGTINGGI, BN Wakil Walikota Tebingtinggi H Irham Taufik SH MAP memberikan apresiasi kepada aparat kelurahan Lalang yang telah menjalankan roda pemerintah kelurahan dengan baik terutama dalam memberikan pelayanan terbaik kepada warganya. Sedangkan terkait masih rendahnya tingkat partisipasi kegiatan gotong royong di tengah masyarakat, Irham Taufik mengajak warga untuk kembali menghidupkan semangat kegotong royongan. Ajak Irham , untuk meningkatkan kembali semangat gotong royong dari kita untuk kita bersama, program pembangunan yang belum terealisasi akan menjadi masukan bagi pemerintah kota agar kedepan dapat segera direalisasikan. Inilah pentingnya kegiatan jumling dilakukan, sehingga pemerintah kota dapat mengetahui informasi langsung dari pihak aparat kelurahan dan warga”, katanya Selama tahun 2012, sebanyak 1.091 jiwa warga di Kelurahan Lalang Kecamatan Rambutan Kota Tebingtinggi yang telah masuk ke dalam program jaminan kesehatan daerah (jamkesda) dan 20 kepala keluarga (KK) yang telah mendapatkan fasilitas bantuan aladin (atap lantai dinding) yang merupakan program pengentasan Rumah Tidak Layak Huni (RTLH) dikota itu Dihadapan para pimpinan SKPD jajaran Pemerintah Kota Tebingtinggi dan Camat Rambutan M Wahyudhi serta Ketua LPM, tokoh masyarakat dan pemuka agama di kelurahan tersebut, Asnul Fadli menyampaikan, dalam hal pembuatan E-KTP hingga 31 Desember 2012 mencapai 89,3 persen dari 4.732 jiwa wajib KTP dan E-KTP yang terealisasi 4.227 jiwa. Adapun di bidang pembangunan, di wilayah Kelurahan Lalang telah dibangun jalan setapak di Jalan Gunung Martimbang I lingkungan 4 dengan panjang 77 m dan lebar 2,5 m, normalisasi parit di Jalan Gunung Bakti LKMD sepanjang 150 m dan pelapisan kembali jalan setapak di Lingkungan 03 sepanjang 900 m x 2 m dengan sumber dana APBN 2012.(DER)

Pembukaan MTQ T.Tinggi ke-45 Sukses dan Meriah TEBINGTINGGI, BN Plh Walikota Tebingtinggi H.Irham Taufik mengatakan, bahwa kita berkewajiban untuk memupuk karakter, khlak,danmoral bangsa yang luhur dan mulia agar dapat mengukir sejarah peradaban yang unggul danmaju, khusunya kepada generasi muda kita yang akan datang. Dengan karakter,akhlak , dan moral yang Qur’ani,insya Allah kita dapat memper kokoh persatuan, kebersamaan dan kerukunan, baik diantara sesama warga bangsa, diantara ulama dan umara, ”Dengan karakter Qur’ani yang pula, insya Allah kita dapat mensukseskan seluruh agenda pembangunan bagi peningkatan rakyat di kota Tebingtinggi yang kita cintai ini ” kata IrhamTaufik dalam sambutan nya pada pembukaan Musbaqoh Tialawatil Quran (MTQ) kota Tebingtinggi ke-45 tahun 2013, Selasa (9/4) malam di Lapangan Merdeka Jalan Sutomo Tebingtinggi. Tampak hadir Unsur Muspida plus ,Kapolres Tebingtinggi AKBP.Andi Rian Djajadi,Ketua dan Anggota DPRD, Ketua PN, Kajari, Ketua Pennfgadilan Agama, H.Bisman, Sekretaris Daerah H.Johan Samose, SH,MSP, Ketua dan Pengurus LPTQ , Ketua MUI, Kakan Menag Drs.H.Hasful Huznain,SH,Pim. Cabang Bank se kota Tebingtinggi,Para SKPD jajaran Pemko Tebingtinggi, Tokoh Agama, pimpnan Ormas, Tokoh Masyarakat ,Camat dan Lurah se kota Tebingtinggi, para Kafilah MTQ dan undangan lainnya Melalui kegiatan MTQ,Plh Walikota mengajak warga kotanya untuk meningkatkan kualitas kehidupan beragama .Karena dengan kualitas kehidupan beragama yang baik kita dapat mewujudkan masyarakat berakhlak mulia, bermoral ,beretika,berbudaya dan beradab, sehingga dapat memperkuat jati diri dan karakter bangsa melalui nilai-nilai keagamaan, mematuhi aturan hukum, memelihara kerukunan antar umat beragama , serta menerapkan nilai-nilai budaya bangsa sesuai dengan nilai-nilai universal ajaran islam. Irham juga mengakui, bahwa apa yang diajarkan Alquran kepada kita sudah tidak ada lagi ruh dalam kehiduapan kita.Kemorosotan akhlak, moral dankarakter dari generasi penerus sudah sangat memprihatinkan dan membuat kita menjadi sedih ,”Jika kita lihat kenyataanhar ini,maka apa yang sebenarnya diajarkan Alquran kepada kita sudah tidak ada lagi ruh dalam kehidupan kita” kata Irham Taufik. Oleh karena itu,, pemerintah kota Tebingtinggi akan berupaya sekuat-kuat nya untuk menciptakan generasi muda yang berakhlak mulia,bermoral dan berkarakter Alquran dengan melakukan maneuver baru yakni kegiatan gerakan masyarakat maghrib mengaji (Gemmar) disetiapmesjid danmusholla yang ada dikota Tebingtinggi. Sebelumnya, ketua pelaksana kegiatan MTQ ,Sahbana Hasibuan dalam laporannya menyampaikan, pelaksanan MTQ tingkat kota Tebingtinggi ke-45 tahun 2013 berlangsung mulai 9 hingga 13 April 2013 dan iikuti para kafilah dari 5 (lima) kecamatan yang ada dikota Tebingtinggi yakni,Kecamatan Padang Hilir,Kecamatan Padang Hulu,Kecamatan Tebing Tinggi Kota,Kecamatan Bajenis dan Kecamatan Rambutan. Sedangkan cabang yang diperlombakan yakni,Tartil Putra/ I,Tilawah anak putra/I.tilawah remaja putra/I,tilawah dewasa putra/ imasing-masing jumlah peserta sebanyak 10 orang.Cabang Fahmil Quran 15b group,(DER)

Bupati DS Resmikan Rumah Jaga Bendung Daerah Irigasi Kota Rantang DELISERDANG, BN Bupati Deli Serdang Drs H Amri Tambunan dalam kun jungan kerjanya meresmikan satu unit rumah jaga bendung daerah irigasi Kota rantang Kecamatan Hamparan perak yang ditandai dengan penandatanganan batu prasasti, serta menyerahkan kunci enam unit rumah yang baru selesai dibedah menjadi layak huni berikut SK tanah dan SIMB, kepada keluarga kurang mampu di Kecamatan Hamparan Perak, Senin (8/4) . Dalam kunjungan kerja yang dipusatkan di Desa Kota Rantang , Bupati didampingi anggota DPRD Sofyan Sauri , Unsur Muspida, Kapolres Pelabuhan Belawan AKBP Endro Kiswanto, Asisten I H Syafrullah SSos MAP. Kadis Ciptakarya A Haris MM, Kadis Infokom Drs Neken Ketaren, Kadis Perikanan dan Kelautan Ikhsar Risyad, Kadis Pendidikan Pemuda dan Olahraga Hj Saadah Lubis SPd MAP Wakil Ketua DPD REI Sumut Datuk Selamat Ferry, yang disambut Camat Hamparan Perak H Faisal Arif Nasution MSi beserta Muspika dan Kepala Desa se Kecamatan Hamparan perak. Selain meresmikan rumah jaga bendung dan penyerahan kunci enam rumah yang selesai dibedah juga pengecoran pertama pertanda dimulainya pembangunan perluasan jalan program PNPM Mandiri didukung swadaya masyarakat Desa Kota rantang dengan rabat beton sepanjang 1,715 M, menyerahkan jaring ikan kepada kelompok tani, 1000 batang bibit buah durian, 1000 batang bibit buah kelengkeng dan ratusan bibit kelapa . Kepala Desa Kota Rantang Ngatino menjelaskan bahwa pembangunan rumah jaga bendung ini terlaksana berkat swadaya masyarakat, termasuk tanah pertapakannya adalah melaui hibah dari ibu Aluh Basyariah demikian juga enam unit rumah yang baru selesai dibedah adalah hasil gotong royong berkat dukungan pihak pemerintah,pengusaha dan partisipasi masyarakat, sedangkan sarana transportasi jalan sebahagian sudah diaspal hotmik, masyarakat juga terus melakukan pelebaran jalan tanah dan sudah siap untuk ditingkatkan . Tokoh Masyarakat Sutrisno pada kesempatan itu menyampaikan terimakasih kepada Bapak Bupati Drs H Amri Tambunan, karena selama dua priode menjabat Bupati telah banyak menggagas program maupun gerakan pembangunan melalui visi misi pembangunan Deli Serdang yang mengutamakan sektor pendidikan lewat konsep Cerdasya,demikian juga pembangunan sarana jalan dan lainnya lewat Gerakan Deli Serdang Membangun (GDSM) , tentu apa yang sudah dicapai ini, atas nama masyarakat mengharapkan agar gerakan maupun program pembangunan ini terus dikembangkan. Drs H Amri Tambunan menyatakan rasa haru dan bangga melihat semangat juang dan semangat membangun yang di perlihatkan warga masyarakat, semangat ini tentu menjadi kekuatan besar dalam menghadapi permasalahan yang semakin kompleks ke depan sejalan dengan meningkatnya tuntutan kebutuhan masyarakat di era globalisasi kemajuan zaman ini. (ROMI)

Tak Mampu Jabarkan AD/ART dan PO Ketua KTNA Binjai Terpojok Dicecar Anggota BINJAI, BN Ketidak mampuan Ketua KTNA (Kontak Tani Nelayan Andalan) kota Binjai Saring P dalam menjabarkan AD/ART dan PO membuat dirinya terpojok dan gelagapan saat salah seorang pengurus KTNA mempertanyakan sejumlah masalah tentang rembug paripurna tingkat daerah termasuk pemilihan ketua KTNA kota Binjai yang belakangan ini menjadi sorotan dan gunjingan dikalangan PNS Dinas Pertanian dan Perikanan kota Binjai Kondisi itu terjadi dalam kegiatan mimbar sarasehan KTNA kota Binjai yang dilak-

sanakan baru-baru ini di gedung Ovany Binjai . Pengurus KTNA kecamatan Binjai Utara menilai rembug paripurna pemilihan ketua KTNA Binjai periode 2012 -2017 tidak mengacu kepada peraturan organisasi dan AD/ART. Tata cara pelaksanaan pemilihan Ketua KTNA menyimpang dari amanat organisasi yang tertuang didalam AD (Anggaran Dasar) ART (Anggaran Rumah Tangga) Dikatakannya dalam rembug paripurna daerah pengurus KTNA kota Binjai tidak menjalankan amanat organisasi, buktinya banyak pengurus yang tidak diundang dalam kegiatan rembug paripurna pemilihan ketua

sehingga pengurus KTNA kecamatan banyak yang kecolongan Bahkan Kepala Dinas Pertanian dan Perikanan kota Binjai sebagai penasehat dan Pembina dalam wadah KTNA tidak pernah dilibatkan didalam kegiatan rembug paripurna daerah seharusnya Pembina dilibatkan ," kata salah seorang pengurus kelompok tani pada acara kegiatan mimbar sarasehan Kami melihat rembug paripurna daerah itu penuh dengan rekayasa untuk itu kami sampaikan agar Kadis Pertanian dan Perikanan kota Binjai dan KTNA Provinsi Sumatera Utara meng-evaluasi kinerja

KTNA kota Binjai yang dijabat Saring P Saring P.saat menerima pertanyaan justru tidak mampu menjawab dengan maksimal semua pertanyaan yang ditujukan kepada dirinya " Kami pengurus KTNA kecamatan kok tidak diundang dalam kegiatan rembug paripurna daerah ," tegas Supri Saring P ketika menanggapi pertanyaan dari anggotanya menjawab bahwa banyak pengurus KTNA yang diundang tidak hadir dalam kegiatan rembung paripurna, karenanya kami anggap peserta yang tidak hadir menyetujui semua hasil rapat," Ujar Saring P (MR/MSTP )

Direktur PD Angkutan Binjai Manipulasi Rekom Pengalaman Kerja BINJAI-BN Kalangan masyarakat minta Badan Pengawas (BP) dan Komisi AC DPRD kota Binjai serta aparat penegak hukum agar melakukan pemeriksaan terhadap surat rekomendasi pengalaman kerja Direktur PD Angkutan kota Binjai yang di keluarkan oleh CV.Tunas Baru Kabupaten Deli Serdang,karena diduga kuat terjadi rekayasa dan manipulasi data saat melengkapi persyaratan administrasi menjadi Direktur PD Angkutan kota Binjai Sebelum menduduki jabatan oknum Direktur berinisial AA diduga memanipulasi data rekom pengalaman kerja dalam pengajuan jenjang

jabatan Direktur , BP,Komisi C DPRD kota Binjai serta Aparat Penegak hokum harus melakukan pemeriksaan untuk menghilangkan kesan bahwa upaya melakukan manipulasi data rekom pengalaman kerja tidak dibenarkan dan melanggar peraturan ," Demikian Sumber BN Imforamsi yang diperoleh dari LSM Wanacakra kota Binjai mengungkapkan surat rekomendasi pengalaman kerja Direktur PD.Angkutan yang dikeluarkan CV.Tunas Baru dicurigai kebenarannya,sebab kalangan supir dilingkungan terminal pinang baris - kampong lalang jurusan 006 Penang Baris -Belawan dan Pinang Baris -Binjai pada umumnya tidak

mengenal oknum Direktur sebelumnya diketahui bekerja sebagai karyawan PT.Kedaung dan Biro jasa tenaga kerja Masyarakat berharap agar aparat penegak hukum kota Binjai melakukan pemeriksaan rekom pengalaman kerja oknum Direktur,karena selama ini BP dan Komisi C DPRD kota tidak menjalankan tupoksinya secara benar dan terkesan memakan gaji buta Direktur PD.Angkutan kota Binjai Ali Ahmad saat dikonfirmasi BN Tidak berada diruang kerjanya, melalui konfirmasi surat tertulis yang dilayangkan BN juga tidak dijawab Direktur PD Angkutan kota Binjai (MR/MSTP )

TP PKK Provinsi Sumut Laksanakan Sambutan di Sergai 5 Desa Terpilih Sebagai Desa Percontohan PKK Sergai SEI RAMPAH,BN Dalam era reformasi bangsa Indonesia tidak bisa melepaskan diri dari keharusan untuk ikut serta dalam arus globalisasi, maka PKK (Pemberdayaan dan Kesejahteraan Keluarga) dalam perkembangannya harus memperhatikan kondisi kearifan lokal namun tetap dilandasi pemikiran masa depan dan memperhatikan keluarga, terutama faktor sosial, budaya dan ekonomi. Hal ini dikemukakan Bupati Serdang Bedagai (Sergai) Ir. H. T. Erry Nuradi MSi dalam arahannya pada acara kunjungan kerja Tim Supervisi TP PKK Provinsi Sumatera Utara (Provsu) dalam rangka Supervisi 5 Desa Percontohan PKK Tahun 2013 yang dilaksanakan di aula Sultan Serdang kompleks Kantor Bupati Sergai di Sei Rampah, Kamis (11/4). Turut hadir Ketua PKK Provsu Hj. Sutias Handayani Gatot Pujo Nugroho beserta Tim Supervisi Provsu, Kepala Badan Pemberdayaan Masyarakat dan Pemerintah Desa (Bapemas) Salman Ginting, Ketua TP PKK Sergai Ny. Hj. Evi Diana Erry, Wakil Ketua TP PKK Ny Hj Marliah Soekirman dan Ny. Hj. Imas Haris Fadillah, Kepala SKPD, Ketua TP PKK Kecamatan serta para kader PKK se-Sergai . Lebih lanjut Bupati HT Erry Nuradi mengatakan dengan berlakunya otonomi daerah maka sifat kegiatan PKK adalah lokal tetapi dalam konteks pemikiran bersifat global. Hal ini mengharuskan TP PKK senantiasa meningkatkan mutu kinerja dan profesionalismenya sehingga gerakan PKK dapat berhasil mengembangkan kemampuan dan kepribadian perempuan serta anak pada umumnya. Kepada warga desa binaan, Bupati

Sergai menghimbau agar kegiatan desa percontohan PKK diharapkan dapat meningkatkan kemampuan di bidang pengetahuan ketrampilan, perekonomian dan bidang kesehatan. Hal ini akan terealisasi apabila kegiatan desa percontohan PKK tersebut mendapat dukungan dari berbagai instansi sektoral terkait, ujar Erry Nuradi. Pelaksanaan supervisi yang akan dilaksanakan oleh TP PKK di desa-desa percontohan beserta lintas sektoral dalam rangka melakukan pembinaan dan evaluasi diharapkan dapat meningkatkan kondisi masyarakat melalui 10 Program Pokok PKK sekaligus dapat memberdayakan keluarga dalam menciptakan ketahanan keluarga, harap Bupati Erry Nuradi. Dalam kesempatan yang sama Ketua TP PKK Provsu Ny. Hj. Sutias Hadayani Gatot Pujo Nugroho dalam sambutannya mengemukakan pembinaan desa tersebut diambil lima kegitan prioritas yang dilombakan sampai ke tingkat pusat. Antara lain lomba desa tertib administrasi PKK, Pencegahan Kekerasan Dalam Rumah Tangga (PKDRT), Usaha Peningkatan Pendapatan Keluarga (UP2K), pemanfaatan tanah pekarangan hatinya PKK, pemanfaatan hasil Tanaman Obat Keluarga (Toga) dan Program Terpadu Peningkatan Peranan Wanita menuju Keluarga Sehat Sejahtera (PTP2W-KSS). Lomba-lomba tersebut diadakan dalam rangka kegiatan Hari Kesatuan Gerak (HKG) PKK dan Bulan Bakti Gotong Royong Masyarakat (BBGRM) Nasional pada Mei mendatang, ujar Ny. Hj. Sutias Handayani. Tujuan diadakannya lomba ini agar terlaksananya tertib administrasi PKK, berkurangnya KDRT untuk mendukung ter-

wujudnya keluarga sejahtera dan mengoptimalkan usaha-usaha keluarga dalam upaya peningakatan pendapatan keluarga. Kemudian untuk meningkatkan kesadaran masyarakat untuk memanfaatkan lahan pekarangan dengan memanfaatkan warung hidup dan Toga serta untuk mewujudkan ketahanan keluarga, jelas TP PKK Provsu. Selain lomba di atas, TP PKK Provsu akan mengadakan lomba simulasi tentang pola asuh anak dikarenakan maraknya terjadi kenakalan remaja, penyakit masyarakat serta ketidakharmonisan keluarga. Hal ini menguatkan institusi keluarga dalam rangka pengarusutamaan keluarga dengan tujuan membentuk masyarakat yang lebih baik, pungkas TP PKK Provsu Ny. Hj. Sutias. Sebelumnya Ketua TP PKK Sergai Ny. Hj. Evi Diana Erry dalam sambutannya menyampaikan ucapan terimakasih kepada tim supervisi yang berkenan hadir di Kabupaten Tanah Bertuah Negeri Beradat dan mengharapkan dapat memberikan pembinaan dan pembekalan agar pengurus TP PKK Desa terpilih agar lebih meningkatkan kinerja dan menjalan program PKK secara maksimal. Kelima desa percontohan PKK Kabupaten Sergai yakni desa tertib administrasi PKK Desa Jati Mulyo Kecamatan Pegajahan, desa PKDRT Desa Sei Buluh Kecamatan Perbaungan, desa UP2K Desa Bandar Magodang Kecamatan Bintang Bayu, desa pemanfaatan tanah pekarangan hatinya PKK Desa Dolok Sagala Kecamatan Dolok Masihul, desa pemanfaatan hasil Toga Desa Pulau tagor Kecamatan Serba Jadi dan desa PTP2W-KSS Desa Karang Anyar Kecamatan Pegajahan.(Ibnu)

Bupati Serahkan 8 Kunci Hasil Bedah Rumah Kepada Warga Kurang Mampu KUTALIMBARU ,BN Sebanyak 8 unit rumah tidak layak huni warga kurang mampu yang telah selesai dibedah di Kecamatan Kutalimbaru, Kamis (28/3) diserahkan Bupati Deli Serdang Drs H Amri Tamunan kepada pemiliknya berikut SKT (surat keterangan tanah) dan SIMB gratis dalam rangkaian kunjungan kerjanya di Kutalimbaru yang di pusatkan di Desa Sawit Rejo. Selain menyerahkan kunci rumah, bupati yang didampingi Ketua TP-PKK Ir Hj Anita Amri Tambunan, Ketua GOPTKI Hj Asdiana Zainuddin Mars, Asisten I H Syafrullah S.Sos, Kadis Dikpora Hj Saadah Lubis S.Pd MAP, Kadis Infokom Drs Neken Ketaren, Wakil Ketua DPD REI Sumut Datuk Selamat Fery, Ketua PMI DS H Ismayadi SH juga menyerahkan berbagai bantuan diantaranya 1 unit hand traktor, 22.500 benih ikan lele, 1.000 batang pohon kelapa, 2. 000 batang pohon durian serta bantuan simpan pinjam kelompok perempuan program PNPM Mandiri kepada 28 kelompok yang keseluruhannya berjumlah Rp 295 juta. Pada kesempatan itu, bupati juga meresmikan Puskesmas Kutalimbaru yang kini statusnya telah ditingkatkan menjadi Puskesmas rawat inap, mersmikan SMPN Negeri 3 satu atap Kutalimbaru, mersmikan perpustakaan SD Negeri 101851 Desa Kwala Bicik serta Musholla Al Manah yang keselruhannya ditandai dengan penandatanganan prasasti. Bupati Deli Serdang Drs H Amri Tambunan dihadapan ribuan warga masyarakat Kutalimbaru menagajak seluruh elemen masyarakat untuk tetap memelihara, menjaga bahkan meningkatkan rasa kebersamaan yang selama ini telah terajut dengan baik sebagai modal besar untuk mensukseskan percepatan pembangunan.Pembangunan di Deli Serdang tidak boleh berhenti, pembangunan harus terus dipacu guna memenuhi tuntutan dan kebuthan masyarakat. Karenanya, kebersamaan yang selama ini telah terbangun dengan baik harus terus kita tingkatkan. Hanya dengan kebersamaan kita dapat melakukan apa saja untuk memenuhi kebutuhan dan tuntutan masyarakat. Sebelumnya, Camat Kutalimbaru Taufik Harahap S.Sos dalam laporannya menyebutkan kebersamaan masyarakat dalam membangun di wilayahnya cukup membanggakan. Selain berhasil membedah 8 unit rumah tidak layak huni menjadi rumah sehat dan layak huni melalui semangat GDSM (Gerakan Deli Serdang Membangun) di Desa Sawit Rejo masyarakat telah membuka jalan Pasar II tembus ke Desa Silebolebo sepanjang 1,2 Km dengan lebar 5 M. Begitu juga pembangunan jalan dusun ke Kampung Toba yang dulunya lebar badan jalan hanya 5 M kini mennjadi 9 M yang panjangnya mencap[ai 2,9 Km. Pelebaran dan pembukaan jalan ini merupakan swadaya murni masyarakat dan lahan warga yang terkena untuk pelebaran dan pembukaan jalan itu secara ikhlas diserahkan warga tanpa ganti rugi. Pada kesempatan itu tokoh masyarakat Kutalimbaru J Tarigan dalam sambutannya menyampaikan rasa terima kasih warga masyarakat Kutalimbaru kepada Bupati Drs H Amri Tambunan yang selama kepemimpinannya di Deli Serdang telah banyak memberikan arti pembangunan kepada mereka di Kutalimbaru. Berbagai program besar Pak Amri dalam memacu percepatan pembangunan di Deli Serdang baik melalui konsep “Cerdas” pada sektor pendidikan, GDSM untuk sektor infra struktur, Ceria sektor kesehatan dan Bedah Rumah telah dirasakan masyarakat. Karenanya, kami warga masyarakat Kutalimbaru sangat mengharapkan berbagai program pembangunan yang telah dilaksanakan selama ini terus dilanjutkan di Deli Serdang guna memenuhi tuntutan dan kebuthan masyarakat, kata Tarigan. Pada pertemuan itu, sebagai ungkapan terima kasih warga kepada pemimpinnya yang telah berhasil memberikan arti dan makna pembangunan yang selama ini telah dinikmati warga masyaraklat, sejumlah warga memberikan berbagai hasil pertanian mereka sebagai oleh-oleh kepada bupati seperti pisang, jambu kelutuk, jagung dan berbagai hasil produksi pertanian lainnya. ( ROM I)

Amri Tambunan: Nilai Agama Benteng Kehidupan

Bupati Deliserdang Drs H Amri Tambunan dan Vikjen Keuskupan Agung Medan Pastor Elyas Sembiring OFMCap diulosi panitia Paskah Ramli Barus.

NILAI agama adalah benteng moral kehidupan bermasyarakat. Demikian pesan Bupati Deliserdang Drs H Amri Tambunan saat pembukaan lomba paduan suara pada gelar Paskah umat Katolik Paroki Santo Yosef Delitua, Kabupaten Deliserdang di Gereja Katolik Santo Petrus, Gang Rotan, Jalan Batangkuis, Kecamatan Tanjungmorawa, Minggu (7/4). Kemudian, indahnya semangat persaudaraan telah terlihat saat perayaan hari besar agama. Paskah kali ini seluruh umat katolik guna pendekatan diri

kepada Tuhan. Amri Tambunan berpesan agar seluruh umat katolik saling isi, asih, asuh, bersatu dan bergandeng tangan maka timbul persaudaraan yang kokoh guna mengatasi persaingan global demi pembangunan Deliserdang. Selama ini umat katolik, khususnya Paroki Katolik Delitua ikut berperan penting dalam pembangunan guna mendukung program Pemkab Deliserdang. Hal seperti itu harus tetap dipertahankan demi kemajuan Deliserdang. Acara spiritual seperti yang

dilakukan umat katolik harus lebih ditingkatkan, sebab acara seperti itu membuat umat semakin bersatu dan kompak. Dengan kekompakan umat dan masyarakat, merupakan salah satu pendukung pembangunan di Deliserdang, kata Amri. Pada kesempatan itu, Bupati Deliserdang Drs H Amri Tambunan membuka lomba koor paduan suara dengan cara pemukulan gong yang disaksikan Ketua Panitia Umum Paskah Se Paroki Delitua, Drs Johanes Sembiring, anggota DRPD Deliserdang Ricky Nelson Barus, Ramses Simbolon perwakilan umat Katolik, para pengurus Paroki Katolik Santo Yosep Deli Tua, Sabar Bangun, Masa Bakti Sitepu dan Ramli Barus. Pastor Paroki Delitua Pastor Padiono OFMConv. Camat Tanjungmorawa Drs ZA Hutagalung MAP, Camat STM Hulu B Sitanggang, Kabag Kesra Deliserdang Tahir Siagian SE, Kadis Infokom Deliserdang, Drs Neken Tarigan, Asisten I Pemkab Deliserdang, H Syafrullah S Sos, Kepala Kementerian Agama Deliserdang, Dur Brutu MA, Dalam perayaan paskah itu mengambil Tema dari Joh 19:2031: “karena itu pergilah, jadikanlah semua bangsa muridKu dan baptislah mereka dalam

nama bapa dan putra dan roh kudus,” dan Sub Tema: “Dengan perayaan paskah kita tingkatkan persatuan dan persaudaraan umat.” Sebelumnya, acara diawali kebaktian Missa Kudus yang dipimpin langsung Vikaris Jendral (Vikjen) Keuskupan Agung Medan Pastor Elyas Sembiring OFMCap. Dengan suasana indah dalam ikatan persaudaraan dan kekeluargaan, mencerminkan adanya semangat kebersamaan yang kokoh dan selalu diwujudkan yang merupakan kekuatan besar dalam merayakan paskah, ungkap Vikaris Jendral (Vikjen) Keuskupan Agung Medan Pastor Elyas Sembiring OFMCap dalam khotbahnya dihadapan ribuan umat Katolik. Sebelumnya, Ketua Panitia Paskah Katolik Santo Yosep se Paroki Deli Tua Drs Johannes Sembiring MPd mengatakan, seluruh umat katolik se Paroki Delitua berterimakasih atas program bupati selama ini berjalan dengan baik. Kemudian, atas prakarsa Amri Tambunan terkait program bedah rumah, umat katolik dari Paroki Delitua dapat bantuan juga. Dan Pemkab Deliserdang yang dipimpin Drs Amri Tambunan cukup perhatian kepada umat katolik khususnya Paroki Delitua.

Ditekankan kepada seluruh umat dan kepada seluruh undangan yang ikut berperan serta dalam pembangunan Gereja Katolik Santo Petrus, Johannes Sembiring berterimakasih. Sedangkan Ramses Simbolon dan Pastor Paroki Katolik Delitua menekankan, atas kerjasama seluruh umat, hendaknya pembangunan Gereja Katolik Santo Petrus hendaknya cepat selesai. Dan Vikjen Keuskupan Agung Medan Pastor Elyas Sembiring OFMCap menyampaikan salam dan berkat dari Uskup Agung Medan supaya umat makin kompak, sebab Paskah merupakan moment yang baik dengan hadirnya ribuan umat. Uskup bermohon juga kepada Pemkab Deliserdang supaya izin sekolah katolik di Lubuk Pakam dan izin pendirian gereja dapat dibantu, kata Pastor Elyas Sembiring. Pada acara selanjutnya pihak panitia paskah menyerahkan ulos kepada Bupati Deliserdang Drs H Amri Tambunan dan Vikjen Keuskupan Agung Medan Pastor Elyas Sembiring OFMCap yang disaksikan seluruh panitia paskah local seperti Drs MJ Naibaho, Arifin Nadeak, Harefa, S Sembiring selaku Vorhanger Katolik Santo Petrus. ( ROMI )

15 - 22 APRIL 2013 | EDISI 355 | THN KE-VIII

USM Indonesia Meningkatkan Kualitas Pendidikan MEDAN, BN Universitas Sari Mutiara (USM) Indonesia terns berupaya meningkatkan kualitas pendidikan bagi para mahasiswanya. Selain menggelar kuliah umum dengan menghadirkan tokohtokoh nasional, USM Indonesia juga menjalin komunikasi dengan perwakilan pemerintah negara asing yang ada di Indonesia khususnya Kota Medan. "Membangun komunikasi dengan perwakilan negara asing merupakan hal yang sangat penting. Dengan adanya komunikasi yang baik, diharapkan akan tercapai suatu kesepakatan dan kerjasama di bidang pendidikan," kata Rektor USM Indonesia DR. Dra. Ivan Elisabeth Purba, MKes kepada wartawan, Jumat. Harus diakui bahwa tekad USM Indonesia meningkatkan kualitas pendidikan di perguruan tinggi tersebut memang tidak main-main. Ivan Elisabeth Purba selaku RektorUSM Indonesia, baru-baru ini melakukan pertemuan dengan Konsul Amerika Serikat untuk Sumatera di Medan Kathryn Crockart. Pada pertemuan itu, Ivan mengut-

arakan keinginannya agar Konsul AS bisa menjadi koneksi dan memberikesempatan kepada mahasiswa USM Indonesia untuk magang di berbagai perusahaan swasta dan fasilitas milik pemerintah di Amerika Serikat. "Kita ingin membuktikan bahwa lulusan USM Indonesia merupakan tenaga yang professional. Khusus di bidang ilmu keperawatan, kemampuan mahasiswa USM Indonesia sudah tidak diragukan lagi. Mereka siap ditempatkan di berbagai negara guna menerapkan ilmu keperawatan dan kemampuannya berbahasa Inggris," kata Ivan. Dalam perkembangannya, USM Indonesia yang sebelumnya bernama Sekolah Tinggi Ilmu Kesehatan (STIKes) Mutiara Indonesia ini, telah memiliki tujuh fakultas.Yakni, Fakultas Ilmu Kesehatan dengan program studi Kesehatan Masyarakat (S I), Keperawatan (SI), Ners (Profesi), Keperawatan (D3), Kebidanan (D3), Analis Kesehatan (D3) dan Teknik Elektro Medik (D3). Fakultas Matematika dan IPA dengan program studi Kimia (SI), Farmasi (SI) serta Analisa Farmasi dan Makanan

Walikota Tinjau Pasar Petisah Medan MEDAN, BN Wali Kota Medan Drs Rahudman Harahap MM melakukan peninjauan ke Pasar Petisah Medan, Jumat (12/4) siang. Peninjauan ini dilakukan untuk mengecek harga bawang di pasar tradisional untuk menyahuti keluhan warga menyusul masih tingginya harga bawang di pasaran. Namun dari hasil peninjauan yang dilakukan Wali Kota bersama Sekda Ir Syaiful Bahri Lubis MM, Asisten Pemerintahan Drs Musadat Nasution, Dirut PD Pasar Beni Sihotang, Kadispenda M Husni SE MSi serta sejumlah pimpinan SKPD lainnya, ternyata harga bawanbg masih tinggi berkisar Rp60 ribu per kilogram. Karena itulah Wali Kota mengatakan Pemko Medan akan melakukan operasi pasar kembali sehingga harga bawang bisa mencapai di bawah Rp.30 ribu per kilogram. “Saya kemari untuk mengecek harga bawang di pasar . Ternyata kita lihat di sini harga bawang masih tinggi di kisaran Rp. 60 ribu per kilogram. Padahalah kita sudah melakukan operasi pasar. Kita berharap harga bawang bisa turun di bawah Rp.30 ribu per kilogram,” kata Wali Kota. Dengan masih tingginya harga bawang tersebut, kata Wali Kota, maka Pemko Medan akan kembali melakukan operasi pasar. “Tidak betul ini, kita akan lihat kalau masih ada bawang di importir, maka Senin (15/4) kita harus lakukan operasi pasar kembali. Saya tidak mau membiarkan warga saya seperti di kota lain. Masyarakat Medan harus bisa merasakan perubahan itu,” ungkapnya. Untuk itulah Wali Kota mengatakan dirinya akan mendatangi kembali importir bawang dan kemudian memintanya untuk menyalurkan sebagian besar bawang yang mereka impor untuk dapat dipasarkan untuk masyarakat. “Kita akan datangi kembali importir bawang dan kita minta agar bawang yang dimilikinya agar disalurkan ke masyarakat,” jelasnya. Sementara itu salah seorang pedagang bawang di pasar Petisah Medan, Emilia mengaku harga bawang masih mahal. Untuk bawang Samosir berkisar Rp60 ribu per kilogram, sedangkan harga bawang Bangkok Rp55 ribu per kilogram. “Selain bawang, tomat juga harganya naik hingga Rp12 ribu. Padahal sebelumnya harga tomat hanya Rp10 ribu per kilogram,” terang Emilia. (Ndo)

(D3). Fakultas Ilmu Komputer dengan program studi Sistem Informasi (SI). Fakultas Psikologi dengan program studi Psikologi (SI). Fakultas Ekonomi dengan program studi Akuntansi (SI) dan Manajemen (SI). Kemudian, Fakultas Ilmu Komunikasi dan Perpustakaan dengan program studi ilmu Komunikasi (S1) dan Ilmu Perpustakaan (S1). Fakultas Hukum dengan program studi Ilmu Hukum (SI). USM Indonesia juga memiliki Program Pasca Sarjana dengan program studi Kesehatan Masyarakat (S2). Kini, lanjut Ivan, USM Indonesia terus berbenah dengan melengkapi berbagai fasilitas, sarana dan prasarana kampus sebagai penunjang segala aktivitas para mahasiswa. "Jadi, kita ingin mengundang Konsul AS untuk meninjau berbagai fasilitas yang ada di Kampus USM Indonesia. Kemudian, Konsul AS diharapkan dapat berdialog langsung dengan para mahasiswa yang telah memiliki kemampuan berbahasa Inggris secara aktif," ajar Ivan seraya menambahkan, USM Indonesia sangat memprioritas-

kan kualitas pendidikan sehingga akan melahirkan lulusan yang andal. Menanggapi keinginan RektorUSM Indonesia, Konsul Amerika Serikat untuk Sumatera di Medan Kathryn Crockart mengatakan, pemerintah AS ingin membangun kerjasama dengan Indonesia dalam di segala bidang khususnya pendidikan. AS ingin membantu Indonesia agar sukses don lebih baik lagi," katanya sembari mengutarakan keinginannya berkunjung ke kampus USM Indonesia. Sementara itu, Pembina Yayasan Sari Mutiara yang juga Anggota DPD RI asal Sumut Parlindungan Purba, SH MM mengatakan, pertemuan dengan Konsul AS untuk Sumatera di Medan Kathryn Crockart ini juga membahas beragam isu di Indonesia. "Guna membangun Indonesia lebih baik lagi, maka kita bahas di sini tentang kontribusi di segala bidang," katanya. Parlindungan berharap, DPD RI dan instansi lainnya diundang ke AS jika ada program penting, sehingga bisa menambah pengetahuaan. "Agar pengetalnuan yang kami dapat itu bisa dibagikan kepada masyarkat lndone-

sia," ujarnya Kathryn Crockart Mengemukakan, pemerintah A.S selalu melakukan komunikasi dengan pemimpin di Indonesia guna membahas berbagai permasalahan, termasuk pendidikan. Kenapa? Pemerintah Ameriacan sangat pahan bahwa kunci kesuksesan masa depan adalah pendidikan. "Pada tahun 2010, Presider AS Obama dan Nesiden RI SBY melakukan perjalanan kemitraan di bidang pendidikan dengan melibatkan pelajar Artinya, pelajai Indonesia bisa belajar di AS dan sebaliknya," kata Kathryn Crockart. Dia juga menyinggung tentang pentingnya iniormasi teknologi. Kata Kathryn Crockart, perkembangan internet memiliki peranan pentingdalarn kornunikasi (ini era modern). " Karena itu, internet sangat penting. Kemarin kita mengajak siswa SMA di Medan untuk melankukan diskusi dengan Duta Besar Indonesia untuk AS Dino Pall Djalal dan Duta Besar AS untuk Indonesia Scot Marciel, melalui digital uir vieoo conference," ujarna (AHS)

Kesepakatan Penetapan Kinerja Pemko Medan Ditandatangani MEDAN, BN Untuk mengembangkan manajemen pemerintahan yang semakin melayani, pemerintah melalui Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi RI, telah mengeluarkan Permenpan nomor 29/2010, tentang pedoman penyusunan penetapatan kinerja dan pelaporan akuntabilitas kinerja Instansi pemerintah, melalui ketentuan tersebut pemerintah memfasilitasi pemerintah daerah dengan mengeluarkan pedoman penyusunan pengukuran kinerja yang diharapkan semakin objektif dan menyeluruh sehingga dapat diterapkan secara efektif. Hal ini dikatakan Walikota Medan Drs H Rahudman Harahap MM didampingi Wakil Walikota Medan Drs H Dzulmi Eldin SMSi, Sekda Ir Syaiful Bahri saat Penandatanganan Kesepakatan Penetapan Kinerja Tahun Anggaran 2013 antara para Pimpinan SKPD dan para Camat jajaran Pemerintah Kota Medan dengan Walikota Medan, Kamis (11/4) di balai Kota Medan. Dikatakannya, didalam penyelenggaraan pemerintahan daerah selalau dihadapkan pada tiga isu pokok yakni, Keterbukaan, Partisipasi dan

Akuntabilitas publik, sebagai konsekuensinya kita senanatiasa perlu meningkatkan kualitas manajemen pemerintahan daerah khsusunya melalui sistem perencanaan keuangan dan penganggaran, serta pengendalian keuangan daerah yang semakin efektif, terukur dan tepat sasaran. Walikota Medan mengingatakan beberapa hal yang harus dilaksanakan oleh semua pimpinan SKDP, yakni harus memiliki komitmen kuat untuk menyelenggarakan tupoksi yang sudah ditetapkan secara efektif, komitmen ini hanya bisa diimplementasikan, apabila para pimpinan SKPD dan seluruh jajarannya memiliki integritas dan dedikasi yang dapat diandalkan, selanjutnya, setiap SKPD harus mampu menetapkan sasaran strategis dan prioritas program yang ingin dicapai secara berkelanjutan sebagai bagian dari tupoksi yang dijalankan, dan yang ketiga, SKPD harus bisa menetapkan indikator kinerja utama sebagai instrumen atau media untuk menilai tingkat keberhasilan dan atau kekurangan yang masih ada pada saat dilakukan evaluasi. Menurutnya, dokumen penetapan kinerja merupakan salah satu instrumen pokok dalam evaluasi

penyelenggaraan pemerintahan daerah, oleh karena itu khusus kepada inspektur dan Tim anggaran pemerinmtah daerah secara khusus diminta untuk melakukan evaluasi dan mengendalikan pencapaian kinerja SKPD sebagai mana yang telah ditanda tangani bersama-sama secara priodik. “ Disisi lain kepada seluruh SKPD saya juga meminta agar saudara-saudara melaporkan capaian realisasi kinerja SKPD-nya sesuai dengan tata cara monitoring, evaluasi dan pelaporan yang ditetapkan, “ ujar Rahudman. Diingatkannya, pencapaian kinerja yang semakin optimal harus kita capai sekaligus merupakan komponen utama penilaian keberhasilan SKPD dalam melaksanakan tupoksinya, untuk itu diharapkan instrumen ini bisa semakin memotivasi kita bekerja lebih baik, sekaligus menjadikan penyelenggaraan pemerintahan daerah khususunya ditingkat SKPD semakin berdaya guna dan berhasil guna, terukur sekaligus akuntabel. “ Semoga penetapan kinerja tahun anggaran 2013 ini dapat menjadi pedoman bagi kita semua, untuk mencapai hasil-hasil pembangunan yang semakin optimal, ter-

ukur guna mewujudkan pemerintahan daerah yang semakin melayani masyarakat, “ ungkapnya. Sebelumnya Kepala Inspektorat Kota Medan Drs H Farid Wajedi Msi melaporkan, secara umum penetapan kinerja tahun anggaran 2013 dimaksudkan untuk mendorong penyelenggaraan pemerintahan daerah yuang semakin efektif, bertanggung jawab dan berakuntabiltas, dan penandatanganan penetapan kinerja ini mencakupi seluruh kepala SKPD dan Camat jajaran Pemko Medan. Dilaporkannya, secara subtansi materi pokok penetapan kinerja terdiri dari sasaran strategis, indikator utama dan target kinerja termasuk target PAD dan seluruh jenis pendapatan daerah lainnya berdasarkan sumberdaya yang dialokasikan kepada masing-masing SKPD, dan dokumen penetepan kinerja ini akan disampaikan secara berjenjang kepada pemerintah termasuk kepada Badan Pemeriksa Keuangan (BPK) perwakilan Sumatera Utara. “ Dari sisi manajemen pemerintahan, penetapan kinerja ini akan menjadi instrumen monitoring, evaluasi dan pengendalian capaian kinerja SKPD tahun anggaran 2013,. “ jelas Farid Wajedi. (Ndo)

Peresmian Rumah Imam Masjid Nurul Huda MEDAN, BN Walikota Medan Drs H Rahudman Harahap MM didampingi Wakil Walikota Medan Drs HT Dzulmi Eldin S MSi, Sekda Ir Syaiful Bahri MM bersama sejumlah pimpinan SKPD jajaran Pemko Medan, melakukan sholat Jumat di Masjid Nurul Huda jalan Sei Serayu (12/4), usai sholat Jumat Walikota Medan meresmikan rumah Imam dan rumah Nazir Masjid Nurul Huda yang berada di komplek Masjid Nurul Huda. Ramah Imam dan rumah Nazir Masjid ini dibangun sebagai tempat kediaman mereka didalam rangka agar mepermudah dan melancarkan tugas-tugas mulia mereka didalam mengurus Masjid, baik itu member-

sihkan Masjid maupun tempat wudhuk serta halaman Masjid, agar para jemaah merasa nyaman dan khusuk melaksanakan ibadah. Walikota Medan Drs H Rahudman Harahap MM dalam sambutannya menjelaskan, program pemerintah Kota Medan pada acara safari Magrib mengaji, safari Jumat, dan dalam program ini ada yang ingin dikembangkan lagi, yakni bagai mana Badan Kenaziran Masjid agar mulai memikirkan untuk mendidirkan rumah Imam dan rumah penjaga Masjid atau nazir. Dengan disiapkannya rumah tempat tinggal merka di lokasi Masjid yang pertama adalah agar mereka dapat memelihara Masjid dengan baik, membersihkan

Masjid, mejaga keindahannya agar supaya kondisi Masjid tetap bersih,selain itu juga kamar mandi dan tempat berwuduk bersih, inilah yang paling penting, supaya para jemaah yang melaksanakan ibadah di Masjid bisa khusuk. Selanjutnya dikatakan, kedepannya Masdjid harus mampu mandiri tidak lagi mengandalkan sumbangan tetapi harus ada kopperasi, seperti market kecil, bangunan tempat pesta perkawinan, jadi sakarang harus mulai kita fikirkan bagai mana rumah Ibadah kedepan ini bisa mandiri. “ Coba kita melihat tempat ibadah umat lain, mereka membuat tempat ibadah tetapi ada tempat pertemuannya, “

Dikatakannya, memilahara Masjid ini bukan hal yang murah, bila kita hanya mengandalkan dari sumbangan berapalah yang bisa didapatkan, inilah harapan kita kedepan dan hari ini kita melakukan peresmian pemakaian rumah Imam dan rumah penjaga masjid, semoga ini dapat dimanfaatkan dengan baik. Menurutnya, rumah Masjid dan rumah penjaga Masjid Nurul Huda ini diharapkan bisa menjadi contoh kepada masjid-masjid lainnya di Kota Medan, apa lagi kita melihat di masjid Nurul Huda ini ada pesantren, bila ini dikelola tentunya akan menjadi lebih baik lagi, sehingga nantinya anak-anak pesantren melaksanakan ibadah sholat di Masjid ini. (Ndo)

Tujuh Proposal PKM ITM Diloloskan Dikti SECARA nasional, sebanyak 46.000 proposal Program Kreativitas Mahasiswa (PKM) 5 bidang masuk ke Dirjeu Dikti dari perguruan tinggi negeri dan swasta seIndonesia. Namun yang lolos diterima banya 7.505 proposal. Dari jumlah yang lolos itu, tujuh diantaranya berasal dari proposal diajukan mahasiswa Institut Teknologi Medan Hal itu dikatakan Rektor ITM Prof Dr Ilmi Abdullah MSc didampingi Kepala Lembaga Penelitian dan Pengabdian. Pada Masyarakat (LP2M) ITM Ir Mustafa MT dan Kahumas M Vivahmni SH, Msi kepada wartawan,baru-baru ini. Rektor menjelaskan, PKM merupakan program dari Dirjen Dikti Kemendikbud yang bertujuan agar mahasiswa mampu melakukan kegiatan yang bernuansa kreativitas. Selain itu mahasiswa juga didorong untuk menyampaikan gagasannya dan menerapkannya sesuai kompetensi yang dimiliki mahasiswa. Untuk mencapai prestasi itu, mahasiswa ITM dibekali dengan pelatihan dalam bentuk workshop bekerjasama dengan Dikti. Hasilnya proposal yang diajukan ITM ke Dirjen Dikti Kemendikbud Jakarta, sebanyak tujuh proposal disetujui dan didanai berkisar Rp5 juta - Rp12,5 juta untuk tahun anggaran 2013. Kendati jumlah proposal yang disetujui Dikti untuk tahun ini mengalami penurunan dibanding tahun 2012 lalu, yakni dari 10 menjadi tujuh proposal, ITM tetap mengapresiasi upaya mahasiswanya dalam membuat proposal tersebut sehingga layak

untuk diloloskan Dikti. "Ini tetap merupakan sebuah prestasi, karena seleksi yang dilakukan pusat terhadap proposal yang masuk sangat ketat," kata Kepala LP2M ITM Ir Mustafa MT menambahkan. Atas keberhasilan tujuh mahasiswa tersebut, ITM pun akan terus mengadakan pelatihan berupa workshop perubahan proposal agar lolos disetu.jui dan didanai untuk tahun anggaran 2014. Lebih lanjut Ir Mustafa menyebutkan, Direktorat Penelitian dan pengabdian kepada Masyarakat Ditjen Pendidikan Tinggi telah melakukm seleksi proposal PKM 5 bidang untuk pendanaan tahun anggaran 2014. Hasil evaluasi proposal PKM 5 bidang itu bagi perguruan tinggi yang lolos seleksi dan diterima untuk didanai. Ada 6 jenis PKM yaitu PKM-Penelitian (PKM-P), PKMPenyerapan Teknologi (PKM-PT), PKMKewirausahaan (PKM-K), PKM-Pengabdian Masyarakat (PKM-M), PKM-Gagasan Tertulis (PKM-GT) dan PKM-Penulisan Ilmiah (PKMPI) Mustafa menambahkan, kegiatan PKM tahun 2013 dimulai bulan Februari 2013 dan akan dimonitoring pada bulan Mei 2013. Untuk itu, mahasiswa yang bersangkutan diharuskan melaksanakan kegiatan serta melakukan pemantauan pelaksanaannya. ITM Kerjasama Rajamanggala University Thailand Rajamanggala University of Technology Sriwijaya, Songkhla Thailand melakukan

kerjasama dengan InstitutTeknologi Medan (ITM) untuk penguatan akademik bagi kedua perguruan tinggi tersebut. "Proses penandatanganan kesepahaman/ kerjasama itu dijadwalkan pada Juni 2013," kata Rektor ITM Prof. Dr. Ilmi Abdullah, MSc usai menerima rombongan Rajamanggala University of Technology Srivijaya yang dipimpin Ass Prof . Patcharin Kangkha, Mr. Jackrayuth Munsuri1. Mr. Bucha Nebbua, Mr. Booyarit Omanee dan Mr. Chayada dikampus Jln. Gedung Arca Medan, Selasa kemarin. Hadir pada acara tersebut, Pembantu Rektor I Dr. Suprayetno, Pembantu Rektor II H. Munajat, SE MM, Pembantu Rektor III Ir. Mahyuzar Masri, MT, Pembantu Rektor IV Ir. Awaluddin Thayeb, MSc, Kahumas M. Vivahmi Manafsyah SH, Msi yang juga Kepala BADUM dan Dra. Sri Wahyuni (English Center). Ke depan, Prof Ilmi mengharapkan adanya hubungan kerjasama di kedua negara dalam bidang pendidikan. Karena selama ini kedua perguruan tinggi tersebut merupakan anggota IMT-GT dan telah melakukan kerjasama dibidang olahraga, budaya dan kegiatan seminar. "Ke depan, akan diadakan kerjasama disemua bidang pendidikan, meliputi riset, pertukaran mahasiswa dan dosen (out sourching sharing) dan kegiatan lainnya yang dapat menunjang peningkatan mutu pendidikan dikedua perguruan tinggi itu, jelasnya. Lanjut rektor, kedua perguruan tinggi telah

sepakat akan melakukan penandatanganan Memorandum of Understanding (MoU) pada Juni 2013. "ITM akan berkunjung ke Thailand sekaligus menandatangani MoU dengan Rajamanggala University of Technology Sriwijaya," ujar Ilmi. Menurut Ilmi, kerjasama ini baru pertama kali dilaksanakan. Karenanya, kunjungan dan penjajakan kerjasama ini sangat berarti bagi kedua perguruan tinggi yang memiliki visi meningkatkan kualitas pendidikan keteknikan dan saling bertukar informasi. Sementara itu, Ass Prof. Patcharin Kangkha menjelaskan, tujuan penjajakan kerjasama ini guna mengetahui metode pendidikan teknik di ITM dan mengadopsinya ke Rajamanggala University Artinya, kedua perguruan tinggi akan memperoleh masukan ilmu pengetahuan dalam upaya meningkatkan pemahaman dan wawasan baik dosen maupun mahasiswa Dengan demi dan, kedua perguruan tinggi tersebut akan memiliki kemampuan daya saing dan kualitas akademik yang baik serta bertaraf internasional. "Rencana kerjasama ini diatarbelakangi besarnya jumlah keanggotaan yang tergabung dalam IMT GT Varsity Carnival 2012 bidang olahraga, budaya dan aktivitas seminar. Kemudian, bagaimana merekrut ketiga aktivitas tersebut, kemampuan berbahasa Inggris, persoalan komunikasi, pendapat terhadap aktivitas yang dilakukan IMT GT dalam komunikasi Bahasa lnggris dan berapa bentuk aktivitas IMT-GT, ujarnya. (AHS)

R A Kartini Inspirasi Perempuan Indonesia

Penulis : FAUZIYAH HASANAH Fakultas Ekonomi USU Jurusan Akuntansi Untuk Semua Wanita Indonesia Apa yang terlintas di fikiran kalian ketika mendengar tanggal 21 April ? ya..hari Kartini, begitulan kita memaknainya, hari yang sangat bersejarah dimana kita memperingati kelahiran seorang pahlawan yang telah berhasil mengamansipasi,telah berhasil menyetarakan gender, telah berhasil membuat tidak ada lagi kesenjangan antara laki-laki dan kita perempuan. Tidak ingatkah kalian pada abad 19 lalu, dimana kita perempuan tidak mengenyam pendidikan, tidak bisa merasakan keindahan dan keluasan pengetahuan. Sadarkah bahwa kita bukan hanya sesosok tubuh indah, dengan segenap daya tarik, kita bukan berperan sebagai fungsi reproduksi belaka, bukan pula fungsi penunjang rumah tangga atau sekedar sebagai ikon dapur atau sebagainya. Kita juga mempunyai cita-cita dan mimpi-mimpi dalam hidup kita, seperti halnya kaum lelaki. Memaknai Hari Kartini Jika mengingat kembali pelopor emansipasi wanita ini kita pasti takkan lupa dengan sosok RA Kartini yang cekatan pintar lincah suka belajar dan haus akan pengetahuan. Ketertarikannya pada pola fikir wanita Belanda membuatnya berkeinginan menjadikan kaum wanita indonesia juga sedemikian. Padahal di era tersebut, teknologi informasi belum berkembang seperti saat ini. Akan tetapi, dengan segala keterbatasan, ia mampu mengubah nasib bangsa, nasib wanita Indonesia. Karena buah pemikirannya juga, kini wanita-wanita cerdas terlahir dan memberikan kontribusi yang sangat besar untuk kemajuan bangsa Indonesia. Maka tidak heran jika pada tanggal 21 April mulai dari kalangan ibu, remaja putri hingga anak perempuan sibuk mendandani diri dengan pakaian kebaya kan Kartini untuk ditampilkan dalam berbagai atraksi. Tak heran lagi jika salon kecantikan yang selama ini sepi pengunjung, tiba-tiba kebanjiran orderan walau hanya sekedar pemasangan sanggul. Semua itu merupakan ekspresi kecintaan dan kekaguman masyarakat Indonesia terhadap sosok Kartini. R.A Kartini Inspirasi Wanita Indonesia. "hidup ini akan indah dan berbahagia jika dalam kegelapan kita melihat cahaya terang". Sepotong kalimat ini adalah kalimat yang pernah diucapkan Kartini semasa hidupnya, kalimat ini jualah yang memberikan spirit tersendiri dalam perjuangannya. Dan jika membacanya bukan hanya Kartini saja yang merasa bersemangat kita yang membacanya pun bisa ikut terinspirasi. Raden Ajeng Kartini merupakan tokoh wanita yang akan menjadi inspirasi sepaanjang masa. Perjuangan dan semangat hidupnya takkan pernah lekang oleh waktu. Karena ia lah sekarang wanita Indonesia dapat berbangga diri karena kemampuan untuk dapat mengaktualisasikan dirinnya telah disejajarkan dengan pria. Kini wanita Indonesia dapt memberikan suatu perubahan, wanita kini bukanlah dianggap sebagai pemuas nafsu belaka, wanita bukan kaum yang lemah lagi, ini dapat terbukti dengan banyaknya "Kartini" di jaman modern yang telah berhasil memiliki karir dalam dunia kerja, dan semoga Kartini sekarang bisa lebih baik dari Kartini masa lalu, dan Kartini masa lalu dapat lebih baik dari Kartini sekarang. Wanita Bukan Makhluk Lemah Diskriminasi adalah satu kata yang sangat erat kaitannya dengan wanita, banyak orang yang menganggap wanita adalah makhluk lemah. Tapi kini zaman telah berubah, emansipasi telah ditegakkan dan wanita tidak bisa lagi dilecehkan. Komisi pemberdayaan perempuan adalah salah satu contoh bahwa emansipasi telah menjadi darah daging di negara ini. Bukankah bangsa yang besar adalah bangsa yang mendukung kemajuan perempuannya, memberikan hak-hak yang sama dengan kaum pria. Untunglah bangsa indonesia sekarang telah melakukan banyak perubahan dalam melakukan , memperbaiki , memfasilitasi dan memajukan kaum perempuan. Adanya berbagai macam undang-undang yang dibuat untuk melindungi kaum perempuan dari kekerasan dan penindasan merupakan wujud dari majunya pemikiran bangsa indonesia. Jika tidak, maka sia-sia sajalah perjuangan ibu Kartini. Banyak cerita tentang Raden Ajeng Kartini yang bisa kita wanita indonesia jadikan inspirasi dalam meraih citacita, persamaan genre antara kaum pria dan wanita yang diperjuangkan Raden Ajeng Kartini akan sia sia jika kita para wanita tidak menjadikan ia sebagai contoh. R.A Kartini yang pada saat itu belum ada teknologi canggih saja sudah bisa menjadi pahlawan bangsa dengan perjuangannya,sekarang giliran kita kaum muda yang berjuang, giliran kita yang meraih mimpi kita tanpa harus dibatasi oleh genre. Kita wanita adalah Kartini masa depan , Kartini yang akan menjadi istri untuk suaini suatni hebat masa depan, Kartini yang akan menjadi ibu hebat untuk anak anak kita yang hebat, bahkan kita bisa menjadi seorang yang berguna bagi negara indonesia yang kita cintai ini. Ayo kaum wanita, tunjukkan pada dunia bahwa kita bisa. Bahwa perjuangan raden ajeng Kartini tidak sia-sia. Perempuan Indonesia adalah Generasi Kartini Adalah sebuah proses yang panjang untuk memperbaharui pemikiran sebuah bangsa. Merupakan perjuangan yang tidak mudah untuk keluar dari penjara kebodohan, kekakuan pemikiran dan keterbatasan ilmu. Namun sosok muda yang sederhana dari Kartini mampu nicngubah nasib bangsa, tentunya dengan dukungan banyak pihak. Namun apa yang beliau lakukan sebaiknya dijadikan teladan bagi segenap kaum perempuan Indonesia. Karena pemikiran Kartinilah perempuan Indonesia bisa berkarya. Ayo perempuan Indonesia, kita jadikan semangat kita semangat Kartini. kita jadikan kita perempuan Indonesia generasi Kartini. Generasi penerus bangsa yang bisa membanggakan, generasi yang tak mudah menyerah jangan kita sia-sia kan perjuangan Kartini dengan tidak berbuat apa-apa ayo wanita Indonesia kita pasti bisa !!! Majulah generasi kartini dengan segenap kelembutan dan keindahan kaum wanita bukanlah kaum yang lemah. Kekuatan kita ada pada hati dan perasaan yang halus dan tajamnya pemnikiran perempuan indonesia adalah kaum perempuan yang cerdas yang berbudi luhur dan berprilaku santun yang sanggup berjuang dalam terpaan kehidupan yang akan membangun bangsa besar ini untuk menjadi yang lebih baik lagi. Bangkitlah wahai generasi kartini, karena engkau adalah masa depan bangsa ini.***

15 - 22 APRIL 2013 | EDISI 355 | THN KE-VIII

CV. BONGKAR PERS NEWS Badan Hukum: Akte Notaris Hermaini,SH No.4 Tanggal 10 Agustus 2009 Pengesahan PN Medan No: 1520/CV/PEND/2009 NPWP: 02.996.694.2-121.000 Pembina

: Drs. H. Kasim Siyo MSi Drs. Hendra DS HMK Aldian Pinem, SH, MH Uli Tobing Benny Soetedjo Eben Pegagan Manik

Pemimpin Umum

: Muhammad Ridwan


: Sunardi Bonang

Wakil Pemred I/ Wakil Penjab : ESP Parindoery Wakil Pemred II/ Wakil Penjab : A. Sani Simbolon Wakil Pemimpin Umum I Wakil Pemimpin Umum II

: Johnesly Meliala : Irwansyah B

Pimpinan Perusahaan

: Pendi Hariyono

Redaktur Pelaksana

: Drs. Alfindo Amir Hamzah Siregar, SH

Dewan Redaksi

: Mangatur Silaban Drs. Edward Pakpahan H.Zulkarnain Abidin Rudi Sirait EPP Ringo-ringo, SE Muhammad Siregar

Koordinator Liputan

: Jakfar Margiono

Koordinator Daerah

: Indrawan Sukma Antoni Sagala

Litbang/ SDM

: Sudari,SH (Kabag) Leonard Hutasoit Erviyanto, SE Jamal Thahir


: Jamaluddin Salmahadi


: Supriadi

Penasehat Hukum

: Nurmahadi Darmawan, SH Mardianto Situmeang, SH Rosmawati, SH

Sekretaris Redaksi

: Toni Purwadi, SH


: Rini Alamsyah SPd


Sensus Pertanian 2013 Tingkat Sergai Akan Segera Dilaksanakan SEI RAMPAH,BN Sektor pertanian berperan penting dalam pembangunan ekonomi Indonesia. Untuk mendapatkan data statistik usaha pertanian secara lengkap dan akurat yang dipergunakan sebagai bahan memperbaiki kualitas perencanaan agar memudahkan sistem monitoring maupun evaluasi atas hasil-hasil pembangunan sektor pertanian salah satunya melalui sensus pertanian. Untuk mendukung gerakan sensus pertanian, Pemerintah Kabupaten Serdang Bedagai (Pemkab Sergai) dan Badan Pusat Statistik Provinsi Sumatera Utara (BPS Provsu) mengadakan kegiatan Sosialisasi Sensus Pertanian (ST 2013) tingkat Kabupaten Sergai. Sensus Pertanian akan dilakukan pada tanggal 1 - 30 Mei 2013 secara serentak di seluruh Indonesia mencakup 33 provinsi, 497 Kabupaten/Kota dan 77.114 Desa/Kelurahan dengan mengambil tema "Menyediakan Informasi untuk Masa Depan Petani yang Lebih Baik" dengan metode pendataan melalui kuisioner kepada pelaku usaha pertanian. Sosialisasi yang diselenggarakan di aula Sultan Serdang kompleks Kantor Bupati Sergai di Sei Rampah, Senin (8/4), dibuka secara resmi Wakil Bupati (Wabup) Sergai Ir. H. Soekirman didampingi Sekdakab Drs. H. Haris Fadillah MSi, Anggota DPRD Sergai Rasdiaman Damanik, Asisten Admum H. Rapotan Siregar SH, MAP, Staf Ahli Bupati, Perwakilan BPS Provsu, para Kepala SKPD dan Camat se-Sergai, Kepala BPS Sergai Ir. Ida Suswati M.Si, para Kepala UPTD dan Kelompok Usaha Pertanian seKabupaten Sergai dan undangan. Dalam sambutannya Wabup Soekirman mengatakan sesuai dengan amanat Undang-undang RI No. 16 Tahun 1997 tentang Statistik dan Peraturan Pemerintah RI No. 51 Tahun 1999 tentang penyelenggaraan statistik yang mengatur bahwa sensus pertanian diselenggarakan setiap sepuluh tahun sekali sejak tahun 1963. Dan untuk tahun sensus pertanian merupakan sensus yang keenam kalinya yang dilaksanakan secara nasional. Untuk Kabupaten Sergai jelaskan Wabup Soekirman, merupakan sensus pertanian yang pertama kali dilaksanakan dan cakupan data yang dikumpulkan dalam Sensus Pertanian (ST 2013) berdasarkan sejumlah rekomendasi dari salah satu badan PBB, yaitu Food dan Agriculuture Organization (FAO). Rangkaian pelaksanaan sensus pertanian dimulai dengan pencacahan lengkap (listing) dan data yang diperoleh selama sensus pertanian mencakup pemuktahiran data dari seluruh pelaku usaha pertanian di subsektor pangan, hortikultura (sayuran, buah-buahan, tanaman hias dan tanaman obat), bidang perkebunan, peternakan, perikanan dan kehutanan serta rumah tangga pertanian, ujar Wabup Soekirman. Wabup Soekirman mengutarakan lebih lanjut, karena sensus pertanian merupakan kegiatan besar, sehingga pelaksanaannya harus dilakukan beberapa tahapan baik dari tahapan persiapan sampai pelaksanaannya, karena kesuksesan sensus pertanian akan menentukan arah pembangunan sektor pertanian. Data ini sebagai bahan rekomendasi penting bagi pembangunan sektor pertanian sepuluh tahun kedepan. Untuk itu diminta kepada semua pemangku kepentingan (stakehoders) dan badan terkait untuk berpartisipasi dan mendukungnya serta petani sebagai sumber informasi untuk menyampaikan jawabannya dengan benar. (Ibnu)

Lapangan Benteng akan Jadi Pusat Kegiatan Car Free Day MEDAN,BN Wali Kota Medan Drs H Rahudman Harahap MM mengatakan seluruh kegiatan Car Free Day akan dipusatkan di Lapangan Benteng Medan. Sebab, Lapangan Merdeka Medan yang telah ditetapkan sebagai lokasi awal dinilai kurang mendukung apabila beroperasinya Citu Check in. Pasalnya, kehadiran City Check in di diyakini akan menimbulkan kemacetan di sekitar lapangan bersejarah di ibukota provinsi Sumatera Utara tersebut. “Jadi seluruh kegiatan Car Free Day akan kita pusatkan di Lapangan Benteng Medan. Pangdam I/BB Mayjen TNI Lodewijk F Paulus telah menyetujuinya,” kata Wali Kota ketika menghadiri acara peresmian Lapangan Benteng Medan yang baru selesai renovasi oleh Pangdam I/BB Mayjen TNI Lodewijk F Palulus, Jumat (12/4). Menurut Wali Kota, kegiatan Car Free Day rencananya semula akan dipusatkan di Lapangan Merdeka Medan. Namun berhubungan akan dioperasikannya City Check In, maka rencana tersebut berubah. “Jika City Check in telah beropertasi, maka kawasan Lapangan Merdeka diyakini akan macet. Karena itulah Lapangan Merdeka kita pilih jadi pusat seluruh kegiatan Car Free Day,” jelasnya. Untuk kelancaran pelaksanaan Car Free Day nanti, Wali Kota menjelaskan jalan di seputaran Lapan-

gan Benteng akan ditutup. Dengan demikian seluruh kawasan bisa digunakan menjadi tempat pelaksanaan Car Free Day sampai pukul 11.00 WIB. Untuk itu Wali Kota mengajak seluruh masyarakat untuk datang beramai-ramai jika pelaksanaan Car Free Day digelar di Lapangan Benteng. Selain Car Free Day, Wali Kota juga mengharapkan masyarakat untuk memanfaatkan Lapangan Benteng yang telah selesai direnovasi ini guna berolahraga. Di samping jogging, masyarakat juga dapat menggunakannya untuk main futsal siang dan malam. “Jadi masyarakat sudah dapat menggunakan Lapangan Merdeka untuk kegiatan berolahraga,” ungkapnya. Apalagi, lanjut Wali Kota, apabila Gubernur Sumatera Utara Gatot Pujonugroho setuju, maka gedung Pramuka yang ada di lokasi Lapangan Benteng dipindahkan. Selanjutnya, lokasi bekas gedung Pramuka akan ditata kembali dan dilengkapi dengan peralatan olahraga, lapangan voli dan lain sebagainya Guna mendukung keindahalan seputaran Lapangan Benteng, Wali Kota menyampaikan rencananya untuk menata trotoar di sekitar Lapangan Benteng akan diganti dengan keramik seperti yang telah dibuat di trotoar Jalan Diponegoro. . “Ini kita lakukan supaya Kota Medan lebih indah lagi,” terangnya. Itu sebabnya Wali Kota men-

yampaikan apresiasi setinggi-tingginya kepada Pangdam I/BB Mayjen TNI Lodewijk F Paulus dan Dandim 0201/BS Letkol Inf Hendriayadi karena masih memperkenankan Lapangan benteng yang baru selesai renovasi ini untuk diamnfaatkan dengan berbagai kegiatan pembangunan dan sosial kemasyarakatan. Dengan demikian masyarakat dapat tetap memanfaatkan Lapangan Benteng ini sebagai

Doktor Asal Aceh Timur Puji Langkah Rocky Tarik Investor MEDAN,BN Langkah Bupati Aceh Timur, Hasballah M Thaib [akrap dipanggil Rocky-red] dalam menarik minat investor untuk menanam modalnya di daerah itu mendapat pujian dari sejumlah kalangan, termasuk dari tokoh Aceh Timur di Banda Aceh, DR.Ismail Ansari, MA. Menurut tokoh yang berprofesi sebagai dosen di IAIN Ar-Raniry, Banda Aceh, bila langkah Bupati Hasballah di dukung oleh semua kalangan, bukan tak mungkin, 5 tahun kedepan Aceh Timur akan tumbuh pesat. "Saya yakin, bila semua berada di jalur yang tepat dan konsisten dengan program yang telah dirancang, maka kedepan Aceh Timur akan penuh dengan industri-industri yang dapat memakmurkan seluruh rakyat di daerah bekas kerajaan Islam Pertama di nusantara ini," optimis Putra Asli Aceh Timur asal Lhok Nibong itu saat ditanyakan, Jum`at 05 April 2013 seputar langkah Bupati Rocky dalam menggaet investor ke daerah itu. Doktor lulusan Malaysia ini juga berharap, agar pemerintah setempat segera menyiapkan sumber daya manusia yang memadai guna mendukung investasi nantinya. "Sebaiknya segera dibuat pusatpusat pelatihan kerja dan menjalin kerjasama dengan semua pihak, guna melatih putra-putra daerah se-

tempat dengan berbagai keahlian," saran intelektual lulusan Mc Gill, Kanada itu. Saran tersebut bukan tak beralasan tambahnya, banyak daerahdaerah telah gagal dalam memberikan lapangan kerja kepada rakyatnya saat investasi direalisasikan. Rata-rata kendalanya karena minim SDM para pencari kerja, yang ratarata berasal dari desa. "Jadi siapkan dulu tenaga kerjanya agar nanti tak seperti tamsilan `Buya krueng teudengdeng,buya tameng meuraseuki atau Oen Reudeup bunta-bunta, oen capa reukieh-reukieh, yang jioh meuteumee rasa, yang toe meuliehmeulieh`," tamsilnya terhadap kondisi keterlibatan masyarakat setempat dalam mengisi pembangunan. Katanya, bupati sekarang adalah harapan masyarakat kedepan, bukan tak mungkin, bila visi dan misinya diwujudkan dengan benar maka masyarakat akan memberikan apresiasi yang besar. Dalam hal melayani

investor, bupati dapat mencontohi pemerintah negeri China, dimana investasi disana selalu diberi kemudahan-kemudahan. "Di Provinsi Guangdong, China, pemerintah setempat memberi kesempatan kepada investor dengan catatan merekruet putra daerah 60 persen dan memberi berbagai kemudahan, sehingga disana banjir investasi," saranya sambil memberi apresiasi kepada Bupati Rocky. [TM]

bagian dari fasilitas kota. Sementara itu Pangdam I/BB Mayjen Lodewijk F Paulus mengatakan Lapangan Benteng setelah direnovasi akan ditingkatkan kualitasnya sebagai centre of public community, baik sebagai sarana olahraga, sarana rekreasi ataupun sarana kegiatan lainnya. Dijelaskan Pangdam, anggaran renovasi Lapangan benteng merupakan bantuan Pemko Medan dan pengerjaannya

dilakukan oleh prajurit TNI AD. Menurut Pangdam, pembangunan Lapangan Benteng ini sebagai sarana olahraga bertujuan untuk mengolahragakan masyarakat Kota Medan, sebab dalam tubuh yang sehat terdapat jiwa yang sehat. Sedangkan ide menjadikan Lapangan Benteng menjadi pusat kegiatan masyarakat karena selama ini penggunaannya tidak optimal hanya dipergunakan untuk fungsi tertentu saja. (Ndo)

Perusahaan Agen Property Ray White Buka Kantor Baru di Medan MEDAN, BN Perusahaan agen properti Ray White menargetkan penjualan rumah tahun 2013 sebesar Rp16 triliun, bahkan tahun 2014 naik hingga mencapai Rp 20 triliun. Sedangkan tahun 2012 penjualan Rp12 triliun. Hal itu dikatakan Johann Boyke Nurtanio, Country Director Ray White kepada wartawan di sela acara peresmian kantor Ray White Medan di Ring Road Simpang Sunggal Medan Rabu kemarin siang. Hadir di sana Pimpinan Ray White Medan Ir Alexwi (Alex Wilando) dan General Manager Ray White Ring Road Medan Yendy Yap. Johann menyebut penjualan yang terus meningkat diraih Ray White berkat kerjasama semua pihak, termasuk marketing profesional mereka.Alexwi sendiri menurut dia, berperngalaman dan sukses di Jakarta memasarkan properti sehingga tangan dinginnya diharapkan bisa makin sukses di Medan. Ia menilai pertumbuhan bisnis properti di Indonesia berkembang pesat dalam tiga tahun terakhir. Hal ini seiring dengan pertumbuhan ekonomi yang cukup baik mencapai 6,3% dengan pertumbuhan produk domostik bruto Rp1000 triliun. Bisnis properti yang pesat itu didukung dengan keadaan politik yang stabil selama reformasi sepuluh tahun terakhir ini ditambah dengan BI Rate 5,75%. Dengan adanya kantor Ray White maka ke depan tiap tahun ditargetkan tambah satu kantor di Medan. Sehingga semua orang bisa menjual propertinya melalui Ray White. Untuk penjualan masing-masing ada kelasnya seperti kelas Rp300 juta ke bawah, Rp500 juta hingga Rp3 miliar dan Rp3 miliar lebih hingga Rp10 miliar."Kami

mempunyai sumber daya yang profesional. Para pengembang properti cukup hanya datang ke Ray White dan properti mereka terjual," katanya. Baru-baru ini Ray White memasarkan properti luar negeri seperti properti; apartermen di Australia terjual lebih 12 unit dan apartemen Kuala Lumpur, Malaysia terjual 7 unit di Medan. Pemasaran apartemen di Kuala Lumpur cukup laris mengingat banyak anak Medan yang kuliah di Kuala Lumpur. "Dalam waktu dekat akan memasarkan apartemen di Johor Bahru dan Bali. Kami juga memasarkan produk-produk network yang juga merupakan kekuatan Ray White," jelasnya. Untuk produk di Johor Bahru dikunjungi oleh lebih 7 juta orang. Johor Bahru tempatnya sangat strategis. Di sana, produk yang dijual untuk orang luar negeri ada batasannya yakni 500 ringgit hingga 2,5 juta ringgit."Kami sangat mengharapkan jaringan properti. Makin banyak properti, makin punyajaringan yang luas," terangnya Tahun 1999 pernah memasarkan PluitArea di Jakarta. Ternyata 90% orang Medan kalau pindah ke Jakarta maka akan tinggal di sana. Awalnya memang susah, namun lama kelamaan para pengembang properti tahu manfaat memakai jasa Ray White, terlebih dalam lima tahun terakhir ini. Alex menambahkan kondisi properti Sumut tetap mengikuti nasional. Ray White Medan memberikan kontribusi 3-5% ke penjualan Ray White secara nasional. Untuk Ray White Medan kontribusi ke nasional awalnya dua persen hingga nanti diharapkan mencapai lima persen. "Kami juga targetkan tiap tahun tambah satu kantor Ray White," katanya. (AHS)

Ahass se-Sumut Dapat Melayani Motor Injeksi Authorized Service Stetion) di Grand Liberty Restaurant barubaru ini. Kegiatan yang mengusung tema One Team - One Dream - One Heart" ini bertujuan untuk mengikrarkan bahwa AHASS seSumut sudah seratus persen siap memberikan edukasi dan pelayanan terbaik bagi motor Injeksi Honda. Min Hian, Technical Service Manager CV Indako Trading Co yang turut menghadiri acara tersebut mengungkapkan, dengan Karyawan Honda yang berprofesi sebagai Frontdesk di Bengkel resmi Honda AHASS mengikuti kegiatan AHASS Pople Gethering sekaligus digelarnya AHASS People berikrar siap memberikan dukungan edukasi dan pelayanan terbaik Gathering ini diharapkan semakin menguatkan ikatan kekeluargaan bagi motor injeksi Honda di Grand Liberty Restaurant antar sesama AHASS se-Sumatera Utara, sehingga dapat bekerjasama SELAKU main dealer Honda di digelarnya AHASS People mengupayakan pelayanan terbaik wilayah Sumatera Utara, CV Gathering yang khusus bagi konsumen, terutama mereka Indako Trading Co berkomitmen diperuntukkau bagi karyawan pengguna motor yang siap menghadapi era injeksi untuk Honda yang berprofesi sebagai mengaplikasi sistem injeksi. menciptakan langit biru di Sumut. Frontdesk di Bengkel resmi "Kami berharap apresiasi ini Hal ini dibuktikan dengan Honda AHASS (Astra Honda

dapat memicu semangat para karyawan AHASS untuk terus berupaya meningkatkan kualitas pelayanannya kepada konsumen, karena senyum kepuasan konsumen adalah hal yang paling utama bagi Honda," ajar Min Hian. Kegiatan ramah tamah yang dihadiri oleh 46 orang karyawan AHASS se-Sumut ini diawali dengan Refreshman Injeksi Honda yang pastinya bermanfaat untuk menambah pengetahuan mereka tentang teknologi injeksi. Suasana keakraban juga semakin terlihat jelas ketika semua peserta gathering makan malam bersama, dan semakin meriah ketika memasuki acara - kuis seputar injeksi dan games interaktif. Lisa Marliani, salah satu peserta gathering yang berasal dari AHASS PT Indah Sakti Motorindo mengungkapkan

kebahagiannya dapat mengikuti kegiatan ini. "Senang banget bisa berkesempatan mengikuti AMASS Gathering People ini, karena selain bisa bersilaturahmi sesama AHASS se-Sumut, kami juga diberikan banyak pengetahuan seputar teknologi injeksi Honda yang pastinya sangat bermanfaat bagi kami dalam menjalankan togas memberikan pelayanan terbaik kepada konsumen," ujar Lisa. AHASS People Gathering sendiri merupakan agenda rutin yang digelar CV Indako "grading Co setiap tahunnya sebagai sarana temu kangen keluarga besar MASS se-Sumut. Kegiatan ini juga dimanfaatkan sebagai momen bagi main dealer Honda ini Sumut untuk memberikan apresiasi atas loyalitas karyawan AHASS dalam memberikan pelayanan terbaik bagi konsumen. (AHS)

Perwakilan Jakarta: Suryadi, Lukman Nyak Abas. Medan: Heru Indrabudi, Darta Lubis, Andi Utama Nasution, SE, Wiryanto Hadi, Fernando Meliala, Brav Shandy Meliala, M. Arif Thahar. Biro Belawan: Jakfar Latif, Suriono. Sub Biro Medan Utara: Ahmad Muhajir, M. Saleh, M. Yakup. Sub Biro Amplas : Saulus Panjaitan, SH . Binjai/Langkat: Munir Rangkuti (Ka.Biro), Sabar Gurusinga, Mimpin Sitepu, M. Hayat, Ruslan AG, Hendera Ginting, T. Zulfikardin, Frisca Osela, Jefriyansyah, Syalamuddin, Parida, Grensi Ginting, Dedi Sitepu. Langkat Hilir: Irfan Nasirin ST (Ka.Biro). Langkat Hulu: Teger Bangun (Ka. Biro). Deli Serdang: Romi Heripanti Nasution (Ka. Biro), Indrawan S (Waka Biro), Suhendra. Tanah Karo: Farhan Parinduri (Ka. Biro), Dedy Jasana Barus (Waka Biro), Aman Harahap Sub.Biro Pancur Batu: M Rizal Effendi Bako,SPdi, . Serdang Bedagai: Ibnu As (Ka.Biro), Suherman, Abdul Rahman, Herman. Tebingtinggi: Dirlan Effendi Ritonga (Ka.Biro). P Siantar/ Simalungun: Drs Edward Pakpahan (Ka.Biro), Erikson Pakpahan, Drs. Kaliderman Siregar. Batubara: Suyanto (Ka. Biro), Jamilah (Waka Biro), Eko, S, Sunaryo Wijaya, Feri Saputra. Asahan/Tanjungbalai: Hamdan Samosir (Ka. Biro), Sulijon Hutapea, Wahidun, Dedi Hidayat, Rahmat P Ritonga, Suhendri. Labuhanbatu: -. Kotapinang/Labusel: Syamsul Siregar. Aek Kanopan/Labura: Sriwaty Sinuraya (Ka. Biro), L. Parulian Simarmata, SE. Sumbagut: Mhd Syahrul Hasibuan SH, Sutardi, Supendi. Dairi: - Pakpak Bharat: Yusuf Manik (Ka.Biro). P Sidimpuan/Tapsel/Paluta: Sugiono SP (Koordinator), Safruddin Pulungan (Ka. Biro), Muhammad Srg, Baun Aritonang, Hasanuddin Siregar, Ibnu Saad Harahap, Unggul Fahmi Hasibuan. Kotanopan/Madina: Saharman Nasution (Ka Biro)-. Padang Lawas Selatan: Ali Akbar (Ka. Biro).Humbang Hasundutan: Mangatur Silaban (Koordinator), Rikardo Simamora (Ka. Biro), Chuharto Simamora, Pardomuan Silaban. Biro Taput: Mangatur Silaban (Ka. Biro) Biro Tapteng/Sibolga/Nias: - Perwakilan Riau/Kepri: EPP. Ringo-ringo, SE. Korwil Riau/Kepri: Rudi Sirait. Pekanbaru: Jaraya Garingging, S.Sos. Siak: Jaraya Garingging, S.Sos. Pelalawan/Pkl.Kerinci: EPP. Siringoringo (Ka.Biro), Lingkon S. Dumai: Albekri, Tengku Kamaruddin, Belwiyono, MG, Suhartono, Elias G.S.M Sidabutar. Bengkalis: Mahir Ritonga, Misron Tarihoran, Parulian Manurung, Novalis P. Hutahaen, Irwansyah Nasution, Alwi. Rokan Hilir (Rohil): Juminan (Ka.Biro), Basri M Noer, Supryanti, Julientri. Biro Rokan Hulu: -. Biro Kampar: -.Perwakilan Kepri/Batam: Herman Hendro Manurung (Ka Biro), Nelson Hutapea Perwakilan Aceh: T Muktarruddin US - . Biro Banda Aceh/Aceh Besar: T Muktarruddin US (Ka. Biro), Ibrahim Yusuf, Afrizal. Biro Pidie/Pidie Jaya: Mahdi Aziz, SHi. Biro Langsa/Aceh Timur: Mustafa M. Adami, Syamsudin Arsyad. Aceh Tamiang: Zulherman (Ka Biro), Fori Zalmi Wandi Akbar, Ros Muliana, Bahaki Ahyat, ST.MT, Ir. Fadly,Galuh Cipta Murni, - Biro Aceh Singkil/ Subulussalam: Rahmin Banchin (Ka. Biro), Henri, B,SE. Biro Aceh Jaya: Syarkawi. Aceh Barat: Kairul Aryadi. Biro Kutacane: . Lhokseumawe: - . Aceh Utara: Jamaluddin (Ka. Biro), M Suud, Ramli, Sayed Fauzi, Zulfikar. Biro Blangkejeren/Gayo Lues: Antoni Nasipul. Biro Aceh Tengah/Bener Meriah: Al Muzaini (Ka Biro), Sabri, Pujianto (WARTAWAN BONGKAR NEWS DILENGKAPI IDENTITAS DAN NAMANYA TERCANTUM DALAM BOKS REDAKSI)

15 - 22 APRIL 2013 | EDISI 355 | THN KE-VIII

H Zainuddin Mars Ajak Anggota Rempala Lestarikan Potensi Sumber Daya Alam LUBUK PAKAM, BN Wakil Bupati Deli Serdang H Zainuddin Mars, mengajak pengurus dan anggota REMPALA ( Remaja Mesjid Pencinta Alam ) Indonesia Kabupaten Deli Serdang untuk mempertahankan dan melestarikan sumberdaya alam di tanah air ini, karena permasalahan alam dan lingkungan hidup sekarang ini merupakan masalah bangsa yang harus kita tanggulangi secara bersama-sama. Ajakan itu disampaikan Wabup Deli Serdang H Zainuddin Mars saat membuka Musyawarah Daerah ( Musda ) III Remaja Mesjid Pencinta Alam (Rempala ) Indonesia Kabupaten Deli Serdang, Jum’at (5/4) di Aula Cadika Taman Pramuka , Lubuk Pakam yang dihadiri Unsur Muspida, Kepala Kementerian Agama Deli Serdang Drs H Dur Bruitu MA, Kadis Pendididkan Pemuda dan Olah raga Hj Saadah Lubis Spd MAP, Kasi Pemberdayaan Masyarakat Badan Narkotika Nasional Deli Serdang H Khairil Anwar selaku penasihat Rempala, Plt DPD KNPI Deli Serdang Khairullah Siregar SPdi, perwakilan Rempala Kabupaten Sergai, Kota Tebing Tinggi, Medan dan Binjai serta undangan lainnya. Rempala sebagai Generasi penerus bangsa, Kata Wabup , dituntut untuk memiliki visi misi dan semangat yang sama , menguasai ilmu pengtahuan , teknologi , beriman dan bertaqwa, sehingga mampu menggali potensi sumberdaya alam yang melimpah ruah ini untuk kemaslahatan umat dan kita wariskan kepada generasi mendatang , karenanya kita tidak boleh menggantungkan harapan hanya sebagai pencari kerja , tetapi mampu menciptakan pekerjaan. Untuk mewujudkan harapan ini ,Wabub berharap melaui Musda III Rempala Indonesia Deli Serdang ini dapat member kontribusi yang berarti dengan menyusun program yang realistis, tidak mulukmuluk tetapi dapat menyentuh kepentingan masyarakat. Sedangkan Ketua Umum Rempala In donesia Provinsi Sumatera Utara Said Aldi Al Idrus, berharap agar Program Rempala agar terus meperkuat dukungan secara terkoordinasi baik dari pemerintah maupun Organisasi kemasyarakatan pemuda dibawah naungan KNPI , sehingga kita dapat membina generasi muda untuk terus berkarya sehingga terhindar dari tindakan kekerasan, kejahatan dan memberantas peredaran narkoba yang melanda daerah ini. Dikatakan bahwa Rempala Indonesia Sumut telah melakukan berbagai trobosan diantaranya usaha produktif pembuatan alat-alat praga anak-anak sekolah dengan menjalin kerjasama ke beberapa Kabuaten dan Kota di Sumatera utara , sehingga Rempala di Sumatera Utara merasa percaya diri bahwa kedepan Rempala di daerah ini akan terus eksis dan mampu mandiri. Sementara Ketua Panitia Musda Rempala Indonesia III Deli serdang Rian Sulaiman menjelaskan bahwa Musda ini berrlangsung selama dua hari sekaligus menyusun kepengurusan untuk priode 2013-2016 , dia juga menyebutkan bahwa Rempala adalah Mitra kerja pemerintah yang komit dan peduli terhadap kelestarian alam, termasuk berupaya menggali situs-situs sejarah bangsa yang ada de Kabupaten Deli Serdang diantaranya situs makam Guru Patimpus , juga situs Putri Hijau yang terletak di Kecamatan Deli Tua. Dijelaskan juga bah dirinya selaku ketua panitia secara aklamasi terpilih sebagai Ketua pengurus Rempala Indonesia Kabupaten Deli Serdang priode 2013-216, sedangkan untuk melengkapi kepengurusan ini akan disusun se segera mungkin.( ROMI )

MPI dan LPPM Langkat Bukan Milik Ngogesa LANGKAT, BN Masyarakat Kab.Langkat perlu, di berikan kecerdasan, dan jangan di berikan pembodohan atau pikiran kerdil. Tetapi Rakyat harus pintar,dan di berikan pandangan, demi kemajuan serta di kedepankan kepentinganya. Jika ada masyarakat ingin maju menjadi pemimpin, jangan di halang- halangi, balihonya jangan di rusak dan di kotori karena Kab.Langkat bukan milik Ngogesa. "Siapa saja rakyat lankat yang memiliki SDM, berpikir memajukan daerah dan mensjahtrakan rakyatnya serta bersedia menjadi pelayan rakyatnya,yah mari kita dukung dan jangan di haling- halangi " Hal ini di katakan Ketua Dewan Pimpinan Kabupaten (DPK) Masyarakat Pancasila Indonesia (MPI) Langkat Misno Adi dan Abu Sofian, selaku Koordinator Lembaga pengkajian layanan Masyarakat (LPPM) Langkat kepada Wartawan. Rabu (9/4) Dilakukan mereka lagi, rakyat harus diberikan Kecerdasan bahwa Pembangunan yang telah dilakukan itu merupakan dana Pemerintah seperti PNPM untuk perbaikan jalan, gorong-gorong, dan perekonomian bantuan dana bergulir itu merupakan Dana dari Pemerintah Pusat yang dikeluarkan dari Dana Subsidi BBM, bukan DAU Pemkab Langkat. Bangunan jalan lintas Sumatera dari perbatasan Aceh hingga ke kota Binjai itu juga dari APBN. " Tapi kalau ada Pemimpin yang tujuannya untuk merampas Proyek Biaya APBN, APBD, sebaiknya dia tidak usah lagi mencalonkan diri jadi Pemimpin, tapi kita dukung jadi Ketua Asosiasi Rekanan Perusahaan dan Jasa" tegas mereka (INST)

SIKAF apatis anggota DPRD Langkat dari Fraksi Golkar kini mendapat sorotan masyarakat yang dahulu memilihnya saat pileg.Sosok ini merupakan anggota dewan yang sudah duduk dua periode dan kini menduduki jabatan wakil ketua di Kabupaten Langkat. "Sejak pertama kali menjadi anggota dewan dan kini ke dua kalinya tidak

sekalipun oknum anggota dewan tersebut peduli dengan daerahnya", ujar warga dengan geram.Terbukti seperti parit buangan air di simpang Selesai Desa Padang Brahrang sampai saat ini tidak pernah tersentuh bangunan lening parit. Diungkapkan jika musim kemarau airnya tergenang di parit apalagi musim hujan Simpang Selesai jadi banjir dari gang Buntu

sampai mendekati SPBU di Jln.Binjai-Kuala Simpang Selesai Kec.Selesai Kab.Langkat. "Yang menjadi pertanyaan masyarakat, anggota dewan tersebut tempat tinggalnyapun disitu. Apa dia buta sehingga tidak melihat banjir akibat ketiadaan parit",lanjut warga lagi. Lebih jauh lagi warga menyampaikan walaupun jalan ini jalan Propinsi juga

Pembangunan Kantor Capil e-KTP di Kecamatan Selesai Dipertanyakan LANGKAT BN Proyek pembangunan kantor Capil dan e- KTP, di lokasi kantor Kecamatan Selesai, diduga menyalah, karena bangunan aula dijebol dan pembangunan kantor e KTP itu juga, dibangun persis berdampingan dengan bangunan aula terdahulu. Hasil pantauan BNews, dari lokasi, seharusnya bangunan ini berdiri sendiri, dengan ukuran yang ditetapkan sesuai Jutlak, pembiayaan yang ada proyek ini bersumber dari dana APBD Langkat T/A 2012 sesuai permohonan yang disampaikan ke Pemkab Langkat. Namun dalam pengerjaannya, diduga di mark- up oleh oknum

Kecamata, dalam pembelian bahan bangunan ( meterial ) lainnya, karena oknum Kecamatan, sebagai penguna anggaran tersebut. KUPT Capil Kec.Selesai, ketika dikonfirmasi di ruang kerjanya, Rabu (27/3) lalu, terkait pembangunan kantor Capil tersebut , mengatakan bahwa semula ruangan ini blong, tanpa kamar sehingga ia meminta izin kepada Camat, ntuk menjebol ruangan kamar aula, yang ada untuk tempat barang-barang dan kamar KUPT Saya (KUPT red) rasa kamar tersebut terlalu kecil untuk ditempati , sehingga diminta kepada tukang, agar membuatkan kamar berukuran 3x3 m, semenetara dananya berasal dari dana pribadi, jelas KUPT

Kepsek Penerima Bantuan Rehab Bangunan Sekolah Mengeluh

Disinggung berapa biaya untuk bangunan kantor Capil dan eKTP, KUPT mengatakan, tidak mengetahui persis, berapa jumlah pembelian bahanya, coba tanyakan pada Camat, cetusnya. Camat Kecamatan Selesai, Ikhsan Afriza, MSi, ketika di hubungi melalui telepon selularnya, terkait pembangunan kantor e- KTP, tidak berhasil untuk dikonfirmasi. Demikian juga melalui SMS, Kalangan masyarakat setempat, sehubungan dengan proyek rehabilitasi sekolah yang diduga di mark-up itu, minta pihak Inspectorat Langkat, agar meng-audit dan memeriksa dana penggunaan, kemana aliran dana tersebut dalam pengerjaannya.(UDN)

Target Pajak Mineral Bukan Logam dan Bantuan 2013 di Kec Selesai Diduga Ada Kejanggalan LANGKAT BN Perusahaan galian C di Langkat Hulu, temasuk Kecamatan Selesai, dari dua desa, yakni Desa Bekulap dan Desa Perhiasan, termasuk perusahaan yang berkelas, menghasilkan galian C berupa pasir dan batuan, hal ini terlihat dari ratusan truck perharinya, yang mengangkut bahan material. Sehingga kegiatan dari beberapa perusahaan ini mendapat sorotan tajam, dari kalangan warga Kec.Selesai, karena masyarakat hanya mendapat sebab dan akibat, yang timbul dari perusahaan tersebut (abu) dan jalan berlobang. Konon kabarnya untuk menambah pendpatan daerah (PAD) Kab.Langkat, diperoleh dari pajak mineral bukan logam dan batuan. Dari persoalan ini, wartawan sempat mengonfirmasi KUPT Dinas Pendapatan Kec.Selesai, B Sitepu,

di ruang kerjanya baru-baru ini. KUPT, mengatakan yang di maksud peraturan bupati No 03 Tahun 2011, tentang harga dasar mineral bukan logam dan batuan tarifnya 20 per sen, dari harga dasar sesuai dengan Pasal 2, ketika disinggung masalah mekanisme pengutipan, KUPT, mengalihkanya ke Dinas Pendapatan Kab.Langkat, Kadis pendapatan, Marino, ketika dikonfirmasi kru Koran ini, terkait pajak mineral bukan logam dan batuan, mengatakan target pajak yang ditetapkan tersebut, sah-sah saja karena sudah di setujui oleh DPR, Demikian prihal hasil pengutipan, menyebutkan masalah kelebihan hasil pungutan, juga itu sahsah saja. Kalau kita cermati seakan-akan menjadi keuntungan untuk Dinas Pendapatan beliau juga menambahkan jika ada pen-

paritnya tanggungannya Provinsi sebagai seorang Dewan apalagi dia Wakil Ketua kan bisa mengajukan atau bagaimana caranya agar dapat di lening. "Warga yang sebahagian besar pendukung Golkar sangat kecewa dengan sikaf anggota dewan yang diusungnya.Dan kami berjanji tidak akan memilihnya lagi", ujar wara dengan kesal.(BN 007)

yalahgunaan bagi siapapun yang melakukannya saya siap dilaporkan ke kejaksaan, karena hal di Kecamatan itu, dipercayakan kepada perpanjangan tangan adalah KUPT setempat, dan setiap kejadian atau hal dikecamatan itu adalah tanggung jawab KUPT ungkapnya. Ketika disinggung masalah pengawasan dari Kabupaten MARINO mengatakan sudah ada yang saya tunjuk Dari Kecamatan, jika ada yang mengutip perharinya dari pajak tersebuat silahkan lapor kepada saya.Seputar pemberitaan KUPT Kec.Selesai BS tentang perpajakan mineral bukan logam dan batuan kadis pendapatan langkat Marino S akan segera memanggil KUPT pendapatan Selesai dan akan saya adakan pembinaan jika tidak bisa di bina juga, kita binasakan ujarnya kepada wartawan.(TIM)

LANGKAT BN Sejumlah Kepala Sekolah (Kepsek) SD dan SMP, SMA di Kabupaten Langkat Hulu, keluhkan biaya pembangunan rehab sekolah, saat ini hampir rampung dikerjakan, bahkan ada yang sudah diselesaikan, dengan cara pinjam bahan kepada pemilik panglong. Selain pinjam bahan kepemilik panglong, juga para tukang kayu dan bangunan, dan janji dibayar pada saat pencairan dana termin ke dua sejumlah 7 persen, namun hingga saat ini pencairan dari dari pihak terkait, belum dibayarkan. Demikian disebutkan sejumlah Kasek, kepada BNews, pekan lalu,atas kendala dan keluhan itu, akibatnya tunggakan untuk membayar bahan material kepihak panlong, juga pembayaran honor tukang bangunan, tidak bisa terselesaikan tepat waktu, sementara bangunan sekolah hampir selsai dibangun. " Dengan adanya program perehapan bangunan sekolah, menyambut baik bantuan dimaksud, dan semaksimal mungkin menyelesaikanya tepat waktu, namun dengan lambatnya pembayaran dana pembangunan, akhirnya kita yang semula sepakat pinjam bahan dengan pihak panglong, tidak dapat membayar dana tunggakanya " kata sejumlah Kasek disana. Jumlah dana tunggakan dana pembangunan termin ke dua, senilai Rp 139 Juta, hingga saat ini belum bisa dicairkan, skibatnya saat ditagih pihak panglong juga untuk pembayaran honor, tidak dapat dibayarkan, semenetara sesuai petunjuk teknis (Juknis), Maret 2013 bisa dicairkan, namun hingga April 2013 ini tidak jelas, keluh para Kasek. Hingga saat ini kata para Kasek, belum juga ada kabar berita penyelesaian atas penciran dana dimaksud, untuk itu, diminta agar pihak BPK, segera mengaudit dan memeriksa Dinas Pendidikan dan Keuangan Kab. Langkat, untuk mencari tau dimana keselipan terjadi, karena Dinas Pendidikanlah yang lebih tau tentang hal ini.(UDN)

Gubsu Bersama FKPD Sumut Lepas Konvoi Kampanye keselamatan Berlalulintas

GUBERNUR Sumatera Utara H Gatot Pujo Nugroho ST bersama Forum Komunikasi Pimpinan Daerah (FKPD) Sumut yakni kapolda Sumut Irjen Pol Wisjnu Amat Sastro, Mewakili Ketua DPRD Sumut, Mewakili Pangkosek, Mewakili Danlantamal, Mewakili Pangdam 1/BB, Mewakili

Kakorlantas Mabes Polri Kombes Pol Drs Bambang Sugeng yang merupakan Kabag Operasi Korlantas Mabes Polri dan walikota Medan Rahudman Harahap melepas tiga ribu peserta konvoi kampanye keselamatan berlalu lintas di jalan Pulau Pinang, Lapangan Merdeka Medan, Sabtu (13/4).

Sebelum melepas konvoi peserta kampanye yang terdiri dari para pecinta motor dan juga aparat kepolisisan dan TNI, Gubsu dan FKPD Sumut juga melepas balon ke udara sebagai tanda acara kampanye pelopor keamanan berlalu lintas telah dimulai. Juga dilakukan penandatangan MoU antara Polda Sumut, Pemprovsu, Bank Sumut, dan Jasaraharja serta peresmian Gerai Samsat Tembung, peresmian Gerai Samsat Tanjung Morawa. Kemudian penyematan pin pelopor keselamatan berlalu lintas kepada seluruh jajaran FKPD Sumut. Pada saat yang sama Gubernur Sumut menyerahkan empat buah mobil untuk operasional Polda Sumut yang penyerahan simbolis dilakuakan oleh Gubsu kepada kapolda Sumut. Juga direncanakan, dalam waktu dekat ada 50 unit sepeda motor yang akan diberikan Gubsu kepada Polda Sumut sebagai operasional Polda Sumut. Gubernur Sumatera Utara H Gatot Pujo Nugroho ST mengapresiasi setinggi-tingginya

kepada kepolisian RI dalam hal ini Polda Sumut yang telah menyenggarakan kampanye keselmatan berlalu lintas tahun 2013 di Sumut. karena, pelaksanaan kegiatan ini sebagai bagian dari upaya untuk mensukseskan keselamatan berlalu lintas di jalan. "Harapan itu tak hanya dilandasi semangat untuk melaksanakan beberapa acara seremoni kampanye keselamatan berlalu lintas, tetapi juga menjadi bagian dari upaya dan harapan kita bersama untuk terus menyinambungkan kampanye keselamatan di jalan," harap Gubsu. Kita semua mengakui, lanjut Gubsu bahwa dampak kecelakaan lalu lintas sangat mempengaruhi sendi kehidupan berbangsa. Korban terbesar diderita kelompok usia produktif dimana mereka tidak lain adalah motor kehidupan. Maka, bila tidak melakukan tindakan nyata bisa saja korban meninggal yang pada tahun 2010 berjumlah 1,3 juta akan menjadi 1,9 juta pada tahun 2030. Begitu pula di indonesia jumlahnya telah mencapai

31.234 jiwa yang bearti ada 3 hingga 4 orang meninggal setiap jamnya. "Untuk menanggapi keprihatinan terhadap tingginya korban lalu lintas jalan ini memerlukan sebuah kerja yang harus dilakukan terus menerus, tidak bisa dilakukan secara singkat dengan sekali kerja tetapi harus berkesinambungan karena potensi kecelakaan selalu ada dan terusmenerus," ujarnya. Tanggung jawab untuk mewujudkan keselamatan jalan, kata Gubsu melanjutkan, tidak hanya menjadi beban pemerintah sebagai pemegang kebijakan nasional. karena kecelakan yang terjadi melibatkan banyak unsur dimana tanggungjawabnya tidak bisa difokuskan pada satu unsur saja tetapi setiap orang termasuk hal-hal yang tidak memiliki hubungan langsung dengan transfortasi juga memiliki tanggung jawab yang sama. "Kalau cuma pemerintah yang kerja sendiri tanpa ada partisipasi

elemen masyarakat lain, keselamatan jalan mustahil akan bisa dicapai, karena keselamatan jalan adalah tanggung jawab kita semua kita harus bergotong royong menyelamatkan pengguna jalan. Saya berharap ada sedikit empati yang kita berikan untuk dapat menyelamatkan orang lain," harap Gubsu. Gubsu juga menilai, kadar kesadaran masyarakat akan pentingnya berkendara aman dan selamat juga masih relatif sangat rendah. Ini menjadi bukti bahwa komitmen bersama untuk bertanggung jawab terhadap keselamatan jalan di negara ini masih belum terbangun secara optimal. "Untuk itu saya berharap dan mendorong para pihak yang terlibat dalam kampanye keselamatan agara memaksimalkan peran dan fungsinya oleh karena itu marilah bersam-sama menciptakan keamanan, ketertiban, kenyaman dan keselamatan di jalan raya," harap Gubsu lagi. (Ndo)


BPol Airud Polda Aceh Tahan 9

15-22APRIL 2013| EDISI 355| THN KE-VIII

Harga Eceran Rp 3500,Luar Daerah + Ongkos Kirim

Tunggakan Capai Rp 1,2 M

PLN Pangkalan Kerinci Mulai Putuskan KWH Pelanggan PANGKALANKERINCI,BN Perusahaan Listrik Negara (PLN) PT Persero Ranting Pangkalan Kerinci terpaksa melakukan program pemutusan dan penyambungan (tusbung) bagi pelanggan yang belum membayar tagihan listrik. Hingga awal April PLN mencatat tunggakan pelanggan mencapai Rp 1,2 milyar. "Program tusbung terpaksa terus kita laksanakan mengingat tunggakan saat ini Rp 1,2 milyar," terang Kepala Ranting PLN Pangkalan Kerinci Said Murtazak,Jum'at (5/ 4/13). Namun Said memastikan, pelanggan yang masih menunggak capai milyaran rupiah itu semuanya akumulasi dari tunggakan pelanggan umum. ‘’Pelanggan umum semuanya,’’ujarnya. BACA PLN PANGKALAN

'Singa Laut' dan Pawang


Selain Miliki IMB

Lahan 74 Ha di Desa Helvetia Dibeli dari Masyarakat LABUHANDELI, BN Pihak defelover, selain memiliki surat izin mendirikan bangunan (IMB), lahan eks HGU berlokasi di pasar IV Desa Helvetia Kec. Labuhandeli, Kab. Deliserdang, seluas 74 Ha, bukan dimiliki dengan cara merampok, namun sebaliknya dibeli (ganti rugi) dari masyarakat. Demikian disebutkan P Tambubolon, kepada BNews, pekan lalu, sehubungan adanya tudingan dari sejumlah kelompok tani penggarap lahan eks HGU PTPN2 setempat, saat acara pertemuan dengan DPRD SU dari Komisi A, karena tudingan tersebut adalah bohong semata .Disebutkan P Tampubolon, yang merupakan salah seorang pengacara dari defelover itu lagi,bahwa tudingan atas pembangunan pemilikan oleh defelover dengan cara merampok, oleh kelompok petani penggarap, pimpinan Syaifal, jelas tidak beralasan (bohong) “ Pernyataan Syaifal, disejumlah media masa terbitan Medan, selaku ketua kelompok tani penggarap HPPLKN, disaat pertemuanya dengan pihak DPRD SU, PTPN 2, Polres Belawan, Muspika Kec. Labuhandeli Selasa (4/ 4) lalu, itu bohong “ tegas Tampubolon. Selain hal itu, tudingan sejumlah bangunan di lahan seluas 74 Ha, tidak memiliki izin IMB, juga tidak mengandung kebenaran (bohong), karena kenyataanya ada izin IMB-nya. Hal lainya soal utusan dari pihak PT ACR, yang disebut tidak hadir dalam acara tersebut, kenyataanya ada beberapa orang utusan PT BACA LAHAN HAL..10

Gubsu Buka Sosialisasi Pedoman Pengumpulan Data Statistik Pertanian Tanaman Pangan MEDAN, BN Pembangunan Pertanian di Sumatera Utara salah satu pembangunan prioritas hal ini sesuai dengan potensi daerah pertanian memberikan kontribusi yang signifikan terhadap produk domestik regional bruto (PDRB) pada tahun 2012 sebesar 22,01 % dan penyerapan tenaga kerja

sektor pertanian 47 % serta pertumbuhan sektor pertanian sebesar 5,29 % di Sumatera Utara. Dari angka tersebut dapat dilihat bahwa sektor pertanian memainkan peranan yang penting dalam peningkatan pendapatan daerah sumatera utara maupun peningkatan roda perekonpmian ditingkat desa serta mampu meningkatkan

mobilitas masyarakat desa dalam membangun desa dan kesejahteraannya. Hal tersebut dikatakan Gubernur Sumatera Utara (Gubsu) H Gatot Pujo Nugroho ST diwakili Sekretaris Daerah Provinsi Sumatera Utara BACA GUBSU BUKA


Kasatpol PP/WH Aceh : Oknum PP/ WH Beking Maksiat Akan Dipecat!


Soal Bendera Aceh Diserahkan ke Mendagri

BANDA ACEH|BN Penegakan Syariat Islam di Provinsi Aceh akan menjadi prioritas di tahun 2013, kendati saat ini anggaran eksekusi cambuk bagi pelanggar masih dalam pembahasan elit, namun tidak menyurutkan satpol PP/WH Aceh dalam melakukan penegakan dan penertiban sesuai dengan Qanun Syariat Islam yang telah di keluarkan oleh Pemerintah Aceh. "Kita akan terus melakukan penegakan ini dan bahkan beberapa salon hasil laporan dari Masyarakat yang kita terima, disinyalir menyuguhkan praktek prostitusi akan menjadi incaran kita dalam tahun ini,tercatat sepuluh salon di Banda Aceh akan kita tertibkan," tutur Kasatpol PP dan WH Aceh, Khalidin

"Atas acara ini, Pemko Banda Aceh memberi apresiasi kepada kankemenag kota yang telah berinisiatif menyelenggarakan rakor ini," ucapnya. Diungkapkannya Pemko Banda Aceh selama ini telah berupaya semaksimal mungkin demi tegaknya syariat islam di Kota Banda Aceh. Hal itu bisa dilihat dengan adanya beberapa instrumen yang telah

BANDA ACEH, BN Anggota Dewan Perwakilan Daerah RI asal Aceh, Abdurrahman BTM menyerahkan persoalan Bendera dan lambang Aceh menurut `Selera` Mendagri. Dia tidak akan mendukung dan menolak atas sikap DPR Aceh yang telah mensahkan qanun itu. "Saya bukan dalam mendukung atau menolak, jadi serahkan saja pada Mendagri RI," sarannya ketika dimintai pendapatnya oleh BN, kemarin. Pria yang dulu akrab dengan surban putih, sering dipanggil tengku dan berceramah dari kampung ke kampung itu mengakui, bahwa semua draft qanun itu perlu dikaji dulu sebelum menentukan layak tidaknya bendera dan lambang Aceh."Saya belum lihat draft. Saya perlu lihat dulu sebelum berkomentar," dalih anggota DPD RI yang terpilih di pemilu 2009 dengan suara terbanyak serta mendapat dukungan dari para "pejuang". Pria yang akrab dikalangan kombatan itu tak mau dengan tegas apalagi memberi dukungan terhadap bendera dan lambang daerah Aceh seperti telah disahkan DPR Aceh dan dituangkan dalam lembaran daerah oleh pemerintahan Zaini Abdullah."Saya Sangat




Ormas Islam Diminta Bersatu Demi Terwujudnya Syariat Islam Banda Aceh,BN Asisten Keistimewaan Ekonomi dan Pembangunan Pemerintah Kota Banda Aceh Drs Ramli Rasyid M.Si Ormas Islam Diminta Bersatu demi terwujudnya Syariat Islam Banda Aceh-Asisten II Pemko Banda Aceh Drs. Ramli Rasyid meminta seluruh ormas islam dan instansi pemerintah bersatu untuk menegakkan syariat islam di kota banda aceh. Hal itu

BANDA ACEH, BN Polisi Air dan Udara Polda Aceh mangamankan satu unit boat pukat nelayan Singa Laut dengan kapasitas 29 Gros Ton, milik kelompok nelayan tradisional kota Sabang sepekan lalu. Selain menahan boat tersebut pihak Polisi Air dan Udara juga menahan dua awak kapal pukat itu antaranya Nahkoda dan awak mesin. Agam (50) salah satu kerabat nelayan kepada BN, kemarin, mengatakan penangkapan itu terjadi pada tanggal 2 April 2013 lalu sekira lima kilo meter dari muara Lhok Krueng Aceh oleh pihak Pol Airud dengan memakai speed boat karet. Namun saat penangkapan tersebut di lakukan pihak kepolisian tidak menunjukkan surat tugas sebagaimana lazimnya aparat dalam menjalankan tugas. Saat itu pol Airud meminta kapada awak boat 'Singa Laut' untuk menunjukkan dokumen atau izin operasional dari boat itu, namun saat ditanya itu nahkoda mengatakan kalau izinnya sudah mati namun dalam pengurusan. ?Dua hari lagi sudah dapat di berikan kepada pihak Airud," tiru agam mengutip alasan dari kerabatnya itu. Mendengar penjelasan awak boat ikan tersebut, Airud meminta agar kapal tersebut di sandarkan di Mapol Airud di Lampolu sembari menunggu surat tersebut. Nahkoda dan awak bot yang berjumlah 16 orang, akhirnya mengikuti perintah tersebut, Namun kembali tutur Agam, sesampainya di Mapol Airud Lampolu, aparat bukan saja menahan boat nelayat tersebut, turut juga menahan dua awak bot masingmasing, Karman yang berprofesi sebagai nahkoda dan Bus yang memiliki peran sebagai awak mesin, tanpa ada surat penahanan.

disampaikannya saat memberi arahan pada acara rakor antar instansi dan ormas islam dalam penyelenggaraan syariat islam di aula kankemenag kota banda aceh Kamis (11/4). Acara yang diprakarsai oleh kankemenag Kota Banda Aceh tersebut dianggapnya sebagai bentuk dukungan antar pihak berwenang untuk menegakkan syariat islam serta mewujudkan kota banda aceh sebagai model kota madani.

Tekad Rusmiady Membina Dayah di Aceh, 58 Guru Kitab Kuning Diuji BANDA ACEH | BN Sejak dilantik Gubernur Zaini Abdullah, awal November 2012 lalu sebagai Kepala Badan Pembinaan Pendidikan Dayah (BPPD) Aceh, Ir. Rusmiady, kian bertekad untuk terus-menerus melakukan pembinaan baik fisik, kurikulum dan sistem manajemen dayah di Aceh. “Sehingga, dayah mampu bersaing dan bertanding dengan lembaga pendidikan yang lain sesuai dengan keinginan masyarakat Aceh, apalagi setelah diberlakukannya Syariat Islam di Aceh,” ungkap Ir. Rusmiady, saat menyampaikan sambutannya pada pembukaan pelatihan pembinaan kelembagaan

dan manajemen dayah, belum lama ini di Banda Aceh. Kegiatan tersebut diikuti sebanyak 40 orang peserta yang berasal dari dayah-dayah diseluruh Kabupaten dan Kota, selama tiga hari di Hotel Diana, Kecamatan Kuta Alam, Kota Banda Aceh. Dikatakan dia,perkembangan ilmu pengetahuan dan teknologi telah membawa perubahan dihampir semua aspek kehidupan manusia. Dimana, berbagai permasalahan hanya dapat dipecahkan dengan upaya penguasaan dan peningkatan ilmu pengetahuan dan teknologi. “Selain mamfaat bagi kehidupan manusia disatu sisi perubahan tersebut telah membawa manusia kedalam era persaingan global yang semakin ketat, agar mampu

berperan dalam persaingan global. Maka sebagai bangsa kita perlu terus mengembangkan dan meningkatkan kualitas sumberdaya manusia,”katanya. Oleh karena itu, katanya lagi, peningkatan kualitas sumberdaya manusia merupakan kenyataan yang harus dilakukan secara terencana, terarah, intensuf, efektif dan efisien dalam proses pembangunan, kalau tidak ingin bangsa ini kalah bersaing dalam menjalani era globalisasi tersebut. “Berbicara mengenai kualitas sumber daya manusia, dayah memegang peranan yang sangat penting dalam proses peningkatan sumber daya manusia tersebut. Peningkatan kualitas dayah merupakan suatu proses yang terintegrasi dengan proses peningkatan sumber

daya manusia itu sendiri,” tuturnya. Menyadari pentingnya proses peningkatan kualitas sumber daya manusia, sebut mantan Kabid Pembinaan Sumber Daya Manuasia pada BPPD Aceh, maka Pemerintah Aceh telah membentuk suatu Badan yang mengurus dan membina perkembangan dayah yaitu Badan Pembinaan Pendidikan Dayah sesuai dengan Qanun Nomor 5 Tahun 2007 tentang susunan organisasi dan tata kerja dinas, lembaga teknis daerah dan lembaga daerah provinsi Aceh. “Dalam Qanun Nomor 5 Tahun 2008 pasal 1 ayat 29 “Dayah yang disebut juga Pesantren adalah lembaga BACA TEKAD RUSMIADY HAL..10

KANTOR REDAKSI : Jl. Flamboyan Raya/Raharja No. 37 Medan Telp (061) 8213786, HP. 081375395392 - 08163134392 Fax (061) 8215552 -


15-22 APRIL 2013 | EDISI 355| THN KE-VIII


Kasatpol PP/WH Aceh..

Warga Helvetia Minta Pemkab DS Bangun Drainase LABUHANDELI, BN Sejumlah warga yang bermukim di Jalan Kapten Sumarsono/ Karang Sari, Dusun V, Desa Helvetia, Kecamatan Labuhandeli, Kabupaten Deliserdang (DS), minta Pemkab setempat segera membangun sistem drainase (Parit) disisi jalan dan lingkungan rumah penduduk disana. Hal itu disampaikan Edy Elianto (Ahwa), selaku warga setempat di dampingi Ramlan Tanjung (tokoh organisasi), Iskhak Hasibuan SE alias Iskandar(tokoh organisasi

politik), kepada BNews, pekan lalu, sehubungan permohonan warga tersebut, melalui surat ditujukan ke Kepala Dinas PU DS di Lubuk Pakam. Dijelaskan Ahwa lagi bahwa, Pemkab DS, melalui PU DS, atas permohonan warga, melalui surat Kepala Desa Helvetia, harus proaktif dan segera direalisasikan pekerjaanya, sehingga apa yang menjadi keresahan warga, dengan tidak adanya sistem drainase, guna menanggulangi kebanjiran, dapat

segera teratasi " Kita selaku warga setempat, bersama sejumlah kalangan di Desa Helvetia, saat melakukan peninjauan disejumlah pemukiman penduduk disana, kondisi sistem drainase cukup memprihatinkan (rusak berat), akibatnya terjadi banjir jika musim penhujan " jelas Ahwa. Untuk itu, kita selaku warga setempat, mengharapkan pihak Pemkab DS Cq, Dinas PU DS, dapat segera melaksanakan pembangunan/

perehapan drainase/parit, lebih kurang 300 meter, di sepanjang Jalan Kapten Sumarsono, Dusun V, Desa Helvetia, demi kenyamanan dan kesejahteraan, demikian Ahwa. Seperti diketahui, pihak pemerintahan Desa Helvetia, Kec.Labuhandeli, Kab. Deliserdang, pada 16 Januari 2013 lalu, telah melayangkan surat no 140/0/20/1/2013, ditujukan ke Dinas PU DS, atas pemohonan warga untuk pembuatan drainase, di Jalan Kapten Sumarsono/Karang Sari Dusun V.(San)

Kajari Pelalawan Alergi Terhadap Wartawan Pelalawan,BN UU Nomor 14 tahun 2008 tentang Keterbukaan Informasi Publik (KIP) nampaknya tidak berlaku buat Kajari Pangkalan Kerinci Pelalawan Riau. Ada keenggananKajari,EdyGuswarketikasejumlahwartawan hendak konfirmasi perihal penberitaan, Selasa (9/ 4).NamunmerekaharusgigitjarikarenaditolakolehKajari sehingga tidak bisa memperoleh konfirmasi yang diinginkan. Menurut salah seorang wartawan,Epp Siringo- ringo wartawan dari bongkar news yang sebelumnya telah berulang kali mempertanyakan hal tersebut tapi tetap saja Kajari enggan bertemu dan terkesan alergi dengan wartawan. Baru- baru ini beberapa media yang dibuat kecewaolehKajari,antaralain,JohanesTanjungwartawan HarianTribun Pekan Baru, Basyarudin Kontributor Metro TVuntukKabupatenPelalawan,ArdhiIbrahimwartawan Harian Riau Pesisir, Andi Indrayanto wartawan Harian Metro Riau,termasuk wartawan Febri Sugiono. Walaupun sudah melewati aturan yang dibuat oleh pihakKajarinamunjawabanyangditerima."Bapaktidak mauberjumpa,lainkalisaja,"ujarAminkepadasejumlah awakmediayangsudahterlajurdatangkekantorKajari. Saat dihubungi oleh riauterkini melalui sambungan teleponnya.Dariluarrunganbegitujelasterdengarnada dering telepon genggam Kajari, namun yang bersangkutantidakmengangkat. Kemudian Johanes Tanjung wartawan termasuk riauterkini.commewakiliawakmediayanglain,mengirim pesansingkatkepadatelepongennggamKajari."Ijinpak Kajarikamimemintawaktusebentarsaja,kamisudahlama menunggu didepan ruang pintu kantor bapak, guna megofirmasi, tahanan Kajari yang kabur," tulis pesan singkat ke nomor ponsel Kajari.

Awak media yang kecewa meliat perilaku kajari edi guswar

Sambil menunggu awak media masih bertahan diruang tunggu. Kemudian beberapa saat Kajari membalas pesan singkatnya, "maaf skrg sy sdg bekerja..staff sy juga sdg tugas..saran kesempatan lain saja..tks," tulisa balasan sms Kajari. Dengan perasaan kecewa, awak media balik kanan dan berlalu meninggalkan kantor dikajari. Sebagaimanaditulispemberitaanmediaharianlokal hariini,SeorangjaksayangbertugasdiPengadilanNegeri Pangkalan Kerinci dilaporkan ke Polresta Pekanbaru karenamenculikdanmenganiayaseoranganakdandua kerabat terdakwa kasus kehutanan Berlin Sihombing. Jaksa bernama Banu Laksamana, SH,LLM tersebut juga diadukan ke Jaksa Agung Muda Bidang Pengawasan Kejagung karena bertindak di luar prosedur dan melanggarhukum. TigakorbanpenganiayaandanpenculikanjaksaBanu cs yakni Pirman Mangapul Sihombing, Jakintur Siagian sertaSiholPetrusSihombing.PirmandanJakintursudah kembalikerumahmasing-masingsetelahsempatdibawa secarapaksaolehjaksaDabu,sementaraSiholhinggasaat initidakdiketahuinasibnya.BersamaSihol,sebuahmobil

Suzuki Swift BM 101 SH milik Sihol juga tak diketahui rimbanya.SiholPetrusmerupakananakterdakwaBerlin Sihombing. "Klienkamitelahmengalamipenganiayaan.Mereka juga diculik. Bahkan, hingga saat ini Sihol Petrus dan mobil miliknya tak tahu di mana berada," kata Victor Simamora, SH dan Martua Simanulang, SH, yang kuasa hukum para korban kepada wartawan, Selasa (8/4). "Jaksa Danu sudah kami laporkan ke Polresta Pekanbaru. Sebagai aparat, dia (Danu) juga sudah kami adukan ke Jaksa Agung agar diberi tindakan keras," kata Vicktor. Martua menjelaskan, perbuatan jaksa Danu tersebut kemungkinannekaddilakukanlantaranBerlinSihombing yang mendapat izin pembantaran berobat di RS Santa Maria,Pekanbarumelarikandiripada21Maret2013lalu. Danu merupakan jaksa penuntut umum yang ditunjuk Kejari Pangkalan Kerinci dalam kasus Berlin Sihombing. Berlin didakwa kasus tindak pidana kehutanan karena dituduh mencaplok lahan HTI milik PT Arara Abadi. Martuamenjelaskan,perbuatanjaksaDanudilakukan pada 29 Maret 2013 lalu. Saat itu, Jumat sekitar pukul 9

malam, Pirman pergi dari rumah mengendarai mobil Suzuki Swift milik Sihol Petrus. Di Pasar Pagi Arengka, Jalan Soekarno-Hatta, mobil yang dikendarai Pirman diberhentikan paksa oleh jaksa Danu bersama enam orang rekan Danu. Pirman disuruh pindah ke mobil yang dipakai Danu dan diminta menunjukkan rumah Berlin. Ternyata,ditempatyangdituju,Berlintakada.JaksaDanu cs hanya mendapati Sihol Petrus. "Di rumah itu Pirman dan Sihol Petrus dipukuli mereka. Mereka dibawa ke Polresta Pekanbaru dan kemudiandibawakeKandisuntukmencariBerlin,"terang Martua. DiKandis,jaksaDanucsbersamaPirmandanSiholpergi ke rumah Jakintur Siagian, yang diduga menyembunyikanBerlin.Namun,lagi-lagiBerlintakbisa ditemukan. Jaksa Danu cs akhirnya membawa Pirman danJakinturkePolrestaPekanbaru,sementaraSiholPetrus dibawakeSimalungun,Sumut.PirmandanJakinturbisa kembali ke rumah masing-masing, setelah petugas memberi ongkos Rp 200 ribu ke mereka berdua, pagi harinya. Martua menjelaskan, hingga kini keberadaan Sihol Petrustakdiketahui.TermasukmobilSuzukiSwiftmiliknya yang dirampas tak diketahui di mana rimbanya. "Padahal, Sihol itu mahasiswa Fakultas Hukum UIR. Sekarang sudah pasti dia tak bisa kuliah," kata Martua. Martua menjelaskan, perbuatan oknum jaksa Danu tersebut telah merampas kemerdekaan dan hak milik Sihol. "Itu sebabnya, kami minta agar Kejagung segera memerintahkan Kejari Pangkalan Kerinci untuk menyerahkan Sihol dan mobil miliknya. Dan dia (Danu) jugaditindaksesuaiketentuan,"tegasMartua. Sedangkan soalpenganiayaandanperampasanmobiltersebut,lanjut Martua, pihaknya berharap agar Polresta Pekanbaru memproses laporan kliennya.(li)

Tekad Rusmiady ... pendidikan yang Thullab atau santri atau pelajarnya bertempattinggaldidayahataupesantrentersebut(Balai/ pondok), memfokuskan pada pendidikan Islam dan dipimpin oleh teungku Dayah,”sebutnya. DijelaskanRusmiady,dayahsebagailembagapendidikan tertua di Aceh sudah banyak menghasilkan para ulama, tokoh masyarakat dan orang-orang terkemuka lainnya berkembang seiring dengan zaman. “Walaupun dengan caranyasendiri,kurikulum,ADMsertasistempembelajaran sederhana,sesuaidenganpengetahuanyangdimilikioleh pimpinan. Oleh sebab itu, sebagai sebuah lembaga pendidikan harus mempunyai manajemen yang baik, sehingga perkembangan lembaga dayah dapat menyesuaikan diri dengan perkembangan ilmu pengetahuan dan teknologi,”jelas Rusmiady. Ia juga menerangkan, manajemen adalah alat yang mengantarkan kita kepada kekokohan sebuah lembaga pendidikan dan bertahan serta berkembang kearah yang lebih baik. “Manajemen adalah sebuah tuntutan, dan harus dijalankanolehsemuapengurus(Teungku-Teungku/GuruGuru) di Dayah, baik berkaitan dengan manajemen kelembagaan,pengasuhansantri,pemeliharaanasetdayah,

ketatausahaandayahdansistemadministrasidankeuangan dayah,”terangnya lagi. Berkaitandenganhaltersebut,BPPDAcehmerasaperlu untukmembuatpelatihanberkaitandenganmanajemen dayahdanmanajemenasetdayah,agardayah-dayahdiAceh kedepan dapat bertahan, dan berkembang sekaligus maampu bersaingdalampeningkatan mutupendidikan. “Kamiterus-menerusmelakukanpembinaan,baikfisik, kurikulumdansistemmanajemendayah.Sehingga,dayah mampu bersaing dan bertanding dengan lembaga pendidikanyanglainsesuaidengankeinginanmasyarakat Aceh,apalagisetelahdiberlakukannyaSyariatIslamdiAceh,” paparnya.Melaluipelatihandimaksud,pihaknyaberharap parateungku-teungkudapatmengikutidenganbaikdan tekun,mencatathal-halyangperluagarsekembalidarisini dapat mengembangkan pola manajemen dayah dan manajemenasetdayahyanglebihbaikdidayahnyamasingmasing,harapnya.Ketuapanitiapenyelenggarapelatihan pembinaan kelembagaan dan manajemen dayah Aceh, Arjuna,S.Sos,dalamlaporannyamengatakan,selamaacara dimaksud berlangsung, panitia akan terus memonitor kedisiplinanpeserta. “Apabila ada yang tidak disiplin, maka akan diambil

tindakantegas.Acarainiadalahuntukperkembangandayah kedepan,jadikitamemintapartisipasidalammewujudkan program-program dayah yang bermutu dan konsisten,” imbuhnya. UjiGuruMengajiKitabKuning Sementaraitu,pekanlalu, BadanPembinaanPendidikanDayahAceh,jugamelakukan pengujian terhadap 58 orang dari kuota penerimaan sebanyak 50 orang guru mengaji kitab kuning. Menurut Rusmiady, pengujian guru mengaji kitab kuning tersebut dilakukan pihaknya dalam upaya melaksanakanprogramPemerintahAceh,terkaitDinulIslam,untukdikirimkankelimaKabupatendanKotadiAceh. “Ini program Badan Dayah Aceh, dalam rangka mengajarkankitabkuningkepadaanak-anakkhususnyadi daerah terpencil. Sebagian dari mereka (guru mengaji), yang dikirimkan dari merupakan putra daerah, disana nantinya mereka memberikan pengajian termasuk tentang aqidah yang kesemuanyaberkaitandenganSyariatIslam,”ujarnya. Kabid Pembinaan SDM, Nurbaiti, SE, kepada Bongkarnews,mengatakan,penjaringangurukitabkuning tersebut dalam rangka antisipasi terjadinya pemurtadan disejumlah daerah di bumi syariat.

“Mereka (guru) yang dinyatakan lulus nantinya akan ditempatkan didayah-dayah,TPA maipun Balai Pengajian sejenisnya dilima Kabupaten dan Kota terpencil, untuk memberikanpendidikankitabkuningkepadamasyarakat. Hal ini dilakukan untuk mengantisipasi belakangan ini adanya pemurtadan ditengah-tengah masyarakat Aceh," ujarNurbaiti.Disebutkandia,limaKabupatendanKotayang akanditempatkangurukitabkuningtersebutdiantaranya meliputi,AcehTamiang,AcehTengah,Singkil,Subulussalam danSimeulue. “Penempatan dilima Kabupaten dan Kota ini, dikarenakan belakangan ada terjadinya pemurtadan. Sehinggadiharapkan,denganadanyagurukitabkuningini nantinya mampu mencegah masyarakat untuk tidak tersesat," sebutnya berharap. Menurutnya,parapesertayangmendaftaruntukseleksi guru kitab kuning mencapai 58 orang, sedangkan yang diterimaPemerintahAceh,dalamhalinimelaluiBPPDAceh hanyaberkisar50orang.“Namun,kamitidaksemata-mata menerima calon guru kitab kuning itu dari kuota yang tersedia.Melainkanseberapabanyakkualitassumberdaya manusiayangbenar-benardianggapmampu,”paparnya. (Afrizal)

Pol Airud.... "Kami sangat menyesalkan tindakan yang dilakukan oleh pihak Pol Airud tersebut yang langsung menahan tanpa di lengkapi surat tugas dan surat penahanan seolah mereka pelaku kriminal," sesal Agam. Agam pun tambah heran, apa maunya Satuan Polisi

yang seharusnya melindungi nelayan itu. "Saat ini dokumen izin beroperasi sudah ada di tangan kami namun hingga kini sahabat kami masih ditahan oleh mereka," kata Agam. Agam berharap mereka segera dilepas,

mengingat mereka memilki tanggung jawab anak dan istri yang harus dinafkahi. "Kendati kami belum melaporkan kejadian ini ke Propam Polda Aceh atas tindakan kesewenangan aparat ini, namun dia meminta agar untuk kedepan tidak terjadi

hal serupa dengan tindakan yang profesional," ingatnya. Sementara pihak Pol Airud Polda Aceh, terkait kasus penahanan boat 'Singa Laut' beserta awak hingga kini belum diperoleh keterangan, sebab dari tindakan tersebut. (TM)

indikator keberhasilan pembangunan pertanian dengan partisipasi dari seluruh jajaran perstatistikan terutama kerja keras dari petugas lapangan sangat diharapkan dan koordinasi antara mantri tani dengan seluruh sumber informasi di lapangan seperti aparat desa, PPL, Petugas Pengamat Hama dan Penyakit, Kelompok Tani dan Petani. Selain itu menurut Gubernur Sumatera Utara, dari hasil evaluasi pada Kabupaten/ Kota jumlah mantri tani tidak sesuai dengan kebutuhan di lapangan yang menyebabkan tugas mantri tani tumpang tindih sehingga data yang dihasilkan

tidak konsisten dan tidak akurat serta tidak tepat waktu, apalagi yang dipermasalahkan adalah data luas lahan pertanian yang pada beberapa Kab/ Ko terdapat penambahan luas walaupun diperkirakan ada alih fungsi lahan dan cetak sawah serta rehabilitasi infrastruktur pertanian yang harus dikritisi mantri tani. Gubsu menekankan bahwa mantri tani merupakan ujung tombak pengumpulan dan pengolahan data di lapangan namun belum mengetahui metodologi pengumpulan data statistik pertanian, oleh karena itu diperlukan bimbingan secara kontiniu berupa pelatihan

dan pengawasan terhadap data serta pemenuhan sarana dan prasarana untuk pengumpulan data. Sebelumnya Panitia Pelaksana Kasubbag Program Dinas Pertanian Provsu Ir Lusyantini MM mengatakan bahwa peserta sosialisasi berjumlah 200 orang dengan rincian dari Kabupaten 172 orang dan dari Kota 28 orang dan bertujuan Sosiologi Medologi Statisti Pertanian Tanaman Pangan berdasarkan buku pedoman baru dan meningkatkan kapasitas petugas statistik serta meningkatkan koordinasi mantri tani, Dinas Pertanian Kab/ Ko maupun Provsu. (NDO)

Gubsu Buka... (Sekdaprovsu) H Nurdin Lubis SH MM didampingi Kadis Pertanian Provsu M Roem pada Acara Pembukaan Sosialisasi Pedoman Pengumpulan Data Statistik Pertanian Tanaman Pangan Tahun 2013 di Hotel Grand Kanaya Medan, Selasa (9/4). Menurut Gubsu untuk mengetahui besaran produksi pangan atau swasembada yang dicapai maka diperlukan data statistik pertanian yang akurat, untuk itu peranan data statistik pertanian sangat penting dalam pembangunan pertanian maupun dalam pengambilan kebijakan di Provsu dan data statistik pertanian menunjukkan

Lhong kepada, Senin (8/04)di ruang kerjanya. Kasatpol PP dan WH Aceh berharap kepada seluruh organisasi baik OKP dan Ormas,terutama yang bergerak di bidang agama dapat berkoordinasi dengan pihaknya dalam mengawasi penegakan syariat. Dia mangatkan tak dapat dipungkiri, saat ini di Kota Banda Aceh kendati Satpol PP dan WH Kota Banda Aceh sering menggelar operasi, namun mereka yang melakukan kegiatan yang bertentangan dengan Syari`at masih saja melakukan aktifitasnya. "Kita melihat hal ini di sebabkan kegiatan mereka terorganisir dengan baik,ini dapat kita lihat ketika kita meggelar razia ke beberapa target sering tidak membuahkan hasil,kemungkinan operasi kita tersebut bocor sehingga saat dilapangan tidak membuahkan hasil,kita juga harus mengakui bocornya sejumlah operasi yang kita gelar ini tidak tertutup kemungkinan ada oknum dalam yang bermain,saat ini kita juga sedang melakukan pembenahan internal,bila nanti kita mendapati oknum yang terlibat,akan segera kita pecat," tutp sang kasat dengan tegas.(CM)

PLN Pangkalan.. Kendati tusbung terus berjalan lanjut Said, pelanggan yang terkena dampat pemutusan langsung melakukan pembayarannya. ‘’Kebanyakan pelanggan setelah kita putus langsung bayar, jadi tunggakan terus berkurang. Namun tentunya kami berharap, sebelum petugas kami langsung proses tusbung lebih baik pelanggan melunasinya,’’papar Said. Dia juga menganjurkan untuk mengelakkan tusbung ini, masyarakat beralih ke program pra bayar dengan menggunakan voucher PLN. ‘’Kalau tak mau terkena denda atau pemutusan warga segeralah beralih menjadi pelanggan yang menggunakan voucher," tutupnya(RI)

Ormas Islam.. dibentuk seperti KPA-PAI, TAMAR, dai daiyah, muhtasib gampong dan lainnya. Disamping itu Ramli menilai penegakan syariat islam di Kota Banda Aceh akan lebih cepat akselerasinya jika dibantu oleh instansi dan seluruh ormas islam di kota ini. Untuk itu katanya, perlu adanya kebersamaan dan keseragaman visi dalam benak kita semua. Menurutnya bencana tsunami yang dialami masih kalah dahsyatnya dibandingkan dengan bencana moral saat ini. Saat ini katanya generasi muda kita moralnya dalam tahap mengkhawatirkan. "Siapa sangka pada pagi hingga siang mereka berseragam sekolah terlihat baik dan patuh. Namun usai sekolah mereka justru berbuat maksiat," ujar Ramli. Untuk itu Ramli berharap agar forum rakor tersebut dapat membahas dan mencari solusi terhadap segala persoalan pelanggaran syariat di Kota Banda Aceh. "Saya optimis syariat islam akan tegak jika semua instansi dan ormas islam di Kota Banda Aceh bersatu", pungkasnya. Sementara Kakemenag Kota Banda Aceh Drs. Ramlan mengatakan Rakor tersebut digelar selain terinspirasi dari visi Pemko Banda Aceh juga sebagai amanah moral dimana kementrian agama didalamnya termuat tugas sebagai penyelenggara syariah. Rakor yang berlangsung selama sehari tersebut diikuti oleh 11 instansi dan 11 ormas islam se Kota Banda Aceh. (Trz)

Soal Bendera... capek, kami sedang di hotel, kemarin ada Muzakir manaf disini," alihnya. Dari balik telpon, dia memberitahukan bahwa pada tahun 2014 akan kembali menjadi peserta Pemilu dan maju sebagai salah satu calon anggota DPD RI asal Aceh."Maaf saya sedang sibuk mengurus KTP, saya kembali maju," elaknya berkali-kali saat diminta ketegasannya terhadap bendera Aceh. Pria yang populer di Kabupaten Aceh Timur itu masih ingin menikmati "lezat"nya kursi DPD RI. Meski masyarakat selama ini tidak merasakan peranan anggota DPD RI asal Aceh bagi kemajuan Aceh apalagi untuk daerah Aceh Timur."Maju terus, yang jelas sepak terjangnya sudah diketahui oleh rakyat," utara salah seorang mantan TNA saat dimintai pendapat oleh BN terkait majunya Abdurahman BTM di Pemilu 2014 nanti.(TM)

Lahan .. ACR, jelas Tampubolon. Apa yang ada dalam pernyataan, para kelompok tani penggarap lahan eks HGU PTPN 2, pimpinan Syaifal, dalam pertemuan dengan anggota DPRD SU Komisi A, hingga sampai terbitnya berita dibeberapa media masa, keseluruhanya bohong belaka Dia (Syaifal red) itu membuat pernyataan, dihadapan anggota dewan dari DPRD SU, dan lainya, bahkan diterbitkan dimedia masa, kesemuanya bohong “ udalah banyak bohonya dia (Syaifal) itu, macam cakap-cakap aja layaknya “ aku Tampubolon. Seperti diketahui, Pemerintah Kabupaten Deliserdang, pada pernyataanya disejumlah media masa, di tahun 2011 lalu, membantah, menerbitkan surat izin mendirikan (IMB) bangunan yang ditenggarai palsu, untuk pembangunan tembok sepanjang 740 meter di Dusun IV, Desa Helvetia, Kecamatan Labuhan Deli. "Pembangunan tembok di Dusun IV, Desa Helvetia memang sudah dilengkapi surat IMB," kata Kepala Dinas Informasi dan Komunikasi Pemerintah Kabupaten (Pemkab) Deliserdang, Neken Ketaren, .menegaskan itu berkaitan protes sekelompok warga eks penghuni asrama darurat TNI-AD, Kampung Anggrung, saat berunjuk rasa di gedung DPRD Deliserdang. Neken mengatakan, Pemkab Deli Serdang melalui Dinas Cipta Karya dan Pertambangan setempat tidak mungkin menerbitkan IMB di atas lahan yang belum jelas legalitas kepemilikannya.(San)

30 DES15-22 2011 -APRIL 6 JAN 2013 2012 | |EDISI EDISI355| 296|THN THNKE-VIII KE-VII

Bupati Aceh Timur Sidak Kantor Camat dan Puskesmas ACEH TIMUR,BN Bupati Aceh Timur, Hasballah Bin M, Thaib melakukan inspeksi mendadak (sidak) kekantor CamatdanPuskesmas.Inspeksimendadaktersebut usai menghadiri acara maulid yang digelar jajaran Dinas Pendidikan Aceh Timur, Kamis (11/04). Adapunkantoryangdidatangiorangnomorsatu diAcehTimurituyaknikantorcamatRantoPeureulak dan Kantor Camat Peureulak Barat , Puskesmas Kecamatan Ranto Peureulak, Peureulak Barat dan puskesmasKecamatanPeudawa. Bupatidalamkesempatantersebutmengatakan, inspeksi mendadak (sidak) ini dilakukan untuk mengecek berbagai hal menyangkut upaya peningkatanpelayanankepadamasayarakat. “Dalamsidaktersebut,dirinyamendapatkandua puskesmas yang tingkat kebersihan dan tingkat kehadiran pegawainya kurang. Adapun dua puskesmas tersebut yaitu, Puskesmas Ranto Peureulak dan Puskesmas Peudawa,“ujarnya. Katanya, seperti yang terjadi di Puskesmas kecamatan Ranto Peureulak tingkat kebersihannya kurangditambahlagiditambahlagifasilitasyangada diruangrawatinaptidakdiuruspenuhdengandebu. Sementaraitu,Puskesmaspeudawajugatingkat kebersihannya masih kurang, selain tingkat kebersihanmasihkurangdirinyajugamendapatkan laporandaripegawaipuskesmasbahwadokteryang bertugas jam 12 sudah pulang tidak lagi berada dipuskesmas,“sebutnya. “Terhadap temuan dua puskesmas ini, saya serahkan kepada Dinas Kesehatan untuk menegur bawahannya terhadap kinerja kedua puskesmas tersebut, agar meningkatkan pelayanan dan kebersihansertakedisipilinanpegawaiuntukmasuk kerja,“tegasnya.(@MF)

PNS Harus Miliki Rasa Tanggungjawab Aceh Timur,BN KepalaSekolahdangurudanPNSdijajaranAceh Timur diharapkan untuk memunyai rasa memiliki AcehTimurini,sehinggamelahirkanrasaikhlasdalam bekerja demi kemajuan AcehTimur kedepan. Hal itu dikatakan Bupati Aceh Timur, Hasballah BinM.ThaibdalamceramahnyadiacaraMaulidNabi Muhammad SAW 1434 H jajaran Dinas Pendidikan AcehTimur di Gedung Magnet School DamaTutong Peureulak, Kamis (11/04) pagi. Padakesempatanitu,Bupatijugamengingatkan jangan ada pungutan liar di institusi lainya seperti BKPP saat penerimaan PNS, " kita mengharapkab kepadaseluruhPNSAcehTimuruntukbekerjasecara Ikhlas dalam membangun Aceh Timur saat ini dan kedepan, " ucapnya. Lanjut Bupati, bahwasetiapPNSAcehTimurharus mempunyai sikap rasamemilikiterhadapAcehTimur dan bekerja penuh tanggungjawab, "Karena Aceh Timur ini adalah milik kita bersama. apalagi jajaran Dinas Pendidikan untuk Senantiasa Mendidik genarasi Aceh Timur agar menjadi generasi yang handal. Padakesempatanini sayamengucapkanterima kasih kepada seluruh PNS yang telah bekerja keras untuk kepentingan Aceh Timur, " demikian kata Bupati. Sebelumnya, Kadis Pendidkan Abdul Munir dalam laporanya, mengatakan Dinas Pendidkan AcehTimursiapuntukmenjadikanGedungMagnet School untuk dijadikan SMA Unggul, " untuk merehab Gedung Magnet school butuh anggaran Rp 2Milyar itu hanya untuk pemasangan listrik,"jelasAbdulMunirserayamengatakanbahwa Dinas pendidikan di AcehTimur komit memajukan dunia pendidikan di wilayah AcehTimur.(@MF)

Golkar Abar Salurkan Bantuan Banjir Meulaboh, BN Dewan Pimpinan Daerah II Partai Golkar Aceh Barat (Abar) beserta kadernya melakukan kegiatan bakti sosial dalam bentuk rasa kepeduliannya terhadap masyarakat yang terkena banjir yang mengepung kabupaten Aceh Barat dalam dua hari ini. Kegiatan tersebut merupakan dukungan yang diberikan oleh kader partai Golkar kepada masyarakat yang terkena banjir di beberapa titik pengungsian yakni Kecamatan Meureubo sembilan titik dan Kecamatan Johan Pahlawan dua titik hal tersebut di lakukan guna mengurangi beban penderitaan masyarakat. Rahmad Ojer selaku koordinator lapangan saat dikonfirmasi Bongkarnews, mengatakan kagiatan tersebut merupakan rasa kepedulian terhadap masyarakat yang terkena banjir. “ Ya, kita hanya berpartisipasi saja, dan memberi sedikit bantuan berupa indomi” kepada beberapa titik pengungsian sebut Rahmad kepada bongkarnews. Rahmad juga mengatakan, apa yang dilakukan kader partai tersebut sebagai bukti bahwa partai tersebut bukan hanya lahir dalam situasi kepentingan politik, namun juga hadir dalam membentuk lingkungan sosial yang sesungguhnya. Dalam kegiatan tersebut kata dia, juga ikut di bantu sejumlah kader Ampi binaan partai itu, tutup Rahmad( @rul )


Boat Nelayan Lhok Krueng Aceh Jadi Target Pencuri Wel dan As Milik SUPN Ladong Turut Digondol Banda Aceh|BN Nasib sedih kini menimpa para nelayan tradisional Lhok Krueng Aceh, kota Banda Aceh dalam lima hari terakhir. Bukan hanya mahalnya BBM jenis solar dan sulitnya melaut karena musim purnama pasang atau yang lebih dikenal dengan nama musim barat, mereka saat ini juga dihantui maling mesin pada

malam hari saat perahu merekan merapat di dermaga. Salah satunya Muhammad Nur (50) pria yang keseharian yang berprofesi sebagai nelayan tradisional ini kini terpaksa tidak melaut. Akibat salah satu spare part mesin perahunya di gondol maling, Sabtu pekan lalu. Kini Muhammad Nur terpaksa menjadi buruh angkat ikan di TPILampulo untuk menghidupi enam anaknya. Muhammad Nur merupakan salah satu dari korban maling yang beraksi pada malam hari ini. Kepada

Bongkar di kediamannya, Selasa (09/04) mengatakan, selain dirinya ada tujuh lain yang mengalami nasib serupa dengannya, mereka menderita kerugian rata-rata 20 Juta rupiah yang di akibatkan oleh aksi para pencuri tersebut. Muhammad Nur yang kerap disapa Bang Agam oleh teman se profesinya tiap malam hari harus berpisah dengan anak isterinya untuk menjaga perahu miliknya, kendati belum melaporkan kasus ini ke aparat namun dia berharap agar pihak

keamanan turun tangan terhadap keluhan para nelayan ini. Selain perahu Bang Agam, perahu milik SPP Ladong juga mengalami hal yang sama, kini anak sekolah kejuruan perikanan itu urung melakukan praktek gara-garamenjadikorbanparapencuritersebut,tuturagam. Ditambahkan agam para pelaku ini bekerja dengan profesionaldanterorganisirsebabbarangperahuyanghilang tergolongalatyangsusahdibuka,namundenganwaktuyang cepat bisa hilang.[CM]

Masyarakat Mengeluh Biaya Pengurusan Akte Kelahiran Keliling yang Cukup Mahal ACEH UTARA, BN Masyarakat di Kecamatan Tanah Jambo Aye, Kab. Aceh Utara mengeluh dengan mahalnya pengurusan akte kelahiran yang diprogramkan oleh pemerintah dengan mengelilingibeberapakecamatan–kecamatanyangadadi Aceh Utara. Keteranganyangdihimpunmediaini,banyakmasyarakat yang berada dilokasi pembuatan akte dimana masyarakat sangat mengeluh dengan pengurusan pembuatan akte kelahiran yang mencapai 200 –san ribu. “Kami tak mampu mengurus dengan biaya yang cukup mahal itu, apalagi kami masyarakat miskin yang tiap hari mencari upah di sawah,”ujar salah seorang warga yang tidak ingin disebut identitasnya, Rabu (10/4/2013). MenurutM.YusufSH,S.Sos,MMyangselakukepalabidang pencatatan sipil Kab. Aceh Utara yang dikonfirmasi oleh me-

diaBongkarNewsmengatakanpembuatanaktekelahiran telahditentukanolehpemerintahdalamUndang–Undang Nomor 32 tahun 2006 yang bahwa dalam UU tersebut menyimpulusia60harikebawahhanyadikenaibiayauntuk Pendapatan Asli Daerah (PAD) sebanyak 10 ribu ditambah biaya leges 1000 sehingga menjadi 11000. Diatas usia 21 tahun kebawah dikenai biaya siding pengadilan keliling sebesar137ribudanditambahkanlagi4lembarmateraiper KK, ungkap M.Yusuf SH, S.Sos, MM saat ditemui wartawan diruangan sekcam Tanah Jambo Aye, Rabu (10/4/2013). Dia mengatakan, program tersebut dilakukan untuk memudahkanmasyarakatkarenasaatinisetiapjiwaharus melampirkan akte kelahiran untuk mengurus kerja dan lainnya.“Selamaprograminiditerapkandari27kecamatan yangadadiAcehUtarabaruterlaksanakan13titik,”jelasnya lagi.(021)

TP PKK Kota Banda Aceh Gelar Bimtek bagi Pengelola Taman Bacaan dan Pengelola Kopwan BANDA ACEH,BN Tim Penggerak PKK Kota Banda Aceh, Selas (9/4) menggelarBimbinganTeknis(Bimtek)bagipengelolataman bacaandanpengelolakopersiwanitadiAulaLantaiIV,Gedung A, Balaikota Banda Aceh. Bimtekyangakanberlangsungselamaduahariinidibuka langsungolehKetuaPKKKotaBandaAcehNurshantiAdnan. Dalam sambutannya, Nurshanti mengatakan Bimtek ini digelardalamrangka pengembangansumberdayamanusia pengelola taman bacaan dan pengelola koperasi wanita di Banda Aceh. “Untuk pengelola taman bacaan, mereka nantinya kita harapkan mampu mendorong minat baca anak-anak dan remaja kota sejak dini harus digalakkan membaca, karena melalui membaca seolah-olah kita telah membuka jendela dunia, dengan membaca, kita akan mengetahui banyak hal yangbelumpernahkitaketahuisebelumnya,”ujarNurshanti. Terkait dengan koperasi wanita, Nurshanti berharap kedepan seluruh gampong dalam Kota Banda Aceh akan memiliki koperasi wanita yang akan dikelola oleh PKK gampong. “Dalamrangkapemberdayaanekonomikerakyatan,salah satunyaadalahmelaluikegiatankoperasi,disinikamisangat mengharapkan agar seluruh gampong dalam wilayah Kota BandaAcehakanterbentukKoperasiWanita(KOPWAN)”pinta

Nurshanti. Oleh karenanya, Lanjut Nurshanti, melalui bimbingan teknis (bintek) ini saya harapkan agar para peserta dapat berperan aktif dalam pembentukan taman bacaan/ perpustakaandankoperasiWanitadiseluruhgampongdalam wilayah Kota Banda Aceh. KepadaTPPKKKecamatandanTPPKKTingkatKotaBanda Aceh, Nurshanti meminta agar dapat bekerja keras untuk mempercepatterbentuknyakedualembagatersebut(taman bacaan dan koperasi wanita) di seluruh gampong dalam wilayahKotaBandaAcehdanmelakukanmonitoringsecara terus-menerus terhadap kelangsungan aktivitas kedua Lembaga dimaksud.Sementara itu, Ketua panitia Bimtek, Kamelia Nasri SE melaporkan bahwa tujuan dari kegiatan ini dilakukanadalahuntukmeningkatkankemampuansumber dayamanusiapengelolatamanbacaandanpengelolakoperasi wanita. Katanya lagi, peserta yang ikut ambil bagian terdaftar sebanyak200orangyangdibagidalamduaharipelaksanaan Bimtek,yaknitanggal9April100orangpesertadaripengelola tamanbacaan.Sedangkanuntukpengelolakoperasiwanita, Bimtek di gelar besoknya (Rabu, 10 April) di Aula Lantai II, Gedung C Balaikota. Pada pelaksanaan Bimtek ini, lanjut Kamelia,panitiamenghadirkannarasumberdariBadanArsip Provinsi Aceh. (Mkk)

Pengurus PMI Cabang Meulaboh Dilantik MEULABOH,BN Ketua PMI Propinsi Aceh Ir T Alaiddinsyah Meng, melantik Pengurus Palang Merah Indonesia (PMI) Cabang Meulaboh, Jumat malam (5/4) acara seremonial itu berlangsung di Aula kantor Bupati setempat. Acara yang di meriahkan dengan beberapa tarian dan dilanjutkan dengan pengambilan sumpah bagi pengurus baru PMI cabang Meulaboh masa bakti 2013–2018 yang diketuai Daud Manaf. Hadir dalam acara Bupati Aceh Barat, Wakil Ketua DPRK Aceh Barat, Unsur Muspida Aceh Barat, para Kepala Dinas, Ketua PMI Provinsi berserta rombongan. DalamsambutanketuaPMIPropinsiAcehIrTAlaiddinsyah Meng, mengharapkan kepada pengurus baru agar dapat membinasemuarelawan,baikrelawanpemulatingkatPalang

Merah Remaja, SMP dan SMA. Dikatakan, untuk kedepan PMI Cabang Meulaboh perlu segera membuat peta bencana, baik bulanan maupun tahunan “Jikasewaktubencanadatangdenganadanyapeta tersebut,maka evakuasi korban bisa lebih mudah, untuk mencari titik pengungsian” katanya. Bupati Aceh Barat, H T Alaidinsyah (H Tito) dalam pidatonya, Keberadaan PMI telah diakui sebagai sebuah organisasi yang bergerak di bidang kemanusian, bahkan dalamsejarahtelahtecatatbahwaPMImemilikiperanpenting danstrategisdalammemberikanbantuankemanusian. Menurutnya,PMIAcehBaratharusbenar-benarmemiliki dedikasi yang tinggi dan kesiapan dalam penanggulan bencana, jiwa pengabadian yang tulus dan bersifat netral, melakukankerjasamayangbaik,harapnya.(@rul)

Para Camat yang menghadiri Rakor bersama Sekda Aceh Timur,Rabu (10/04) ,diharapkan untuk berpakaian dinas seecara lengkap dengan atribut mereka dalam berbagai kesempatan rapat dan acara resmi daerah/ nasional .

Camat Diultimatum Kenakan Pakaian Dinas Aceh Timur,BN Para Camat di lingkungan Pemerintah Kabupaten Aceh Timur " diultimatum " untuk menggunakan pakaiandinasresmilengkapdenganatributdanlencana jabatan camat dalam setiap kesempatan menghadiri rapatdanacaraacararesmidaerahdanmaupunnasional. Ultimatumbernadahimbauantersebutdisampaikan Sekretaris Daerah (Sekda) Kabupaten AcehTimur , Drs Bahrumsyah MM yang turut didampingi Asisten I Pemerintahan , Adlinsyah S Sos dan Kasubbag Humas Setdakab ,Eddyanto ,SST , Rabu (10/4) lalu pada Rapat Koordinasi (Rakor) Camat se Aceh Timur di aula Serbaguna Setdakab Idi. KerapihandankelengkapanpakaianCamatiniharus diperhatikan,karenaselainmenambahrasapercayadiri dalam bertugas juga menjadikan penampilan para camat selaku pemimpin kecamatan akan tambah berwibawa ditengah masyarakatnya."Jangan lagi ada ,para Camat yang enggan menggunakan atribut lengkap mereka seperti pangkat dan buk krueng (lencana burung garuda),'tegas Sekda.

Juga mengenai tingkat kedisiplinan PNS dan staf di seluruhkecamatanharusmenjadiperhatianseriuspara camat.Janganjugasampaiberkembangkabarbahwa di kecamatan cukup yang kerja hanya tiga orang saja, Camat, Bendahara dan KTU (Tata Usaha). Sementara itu, dalam waktu dekat ini, para Camat dalam Kabupaten Aceh Timur juga akan menjalani pendidikanataupenataran kepamongprajaandiibukota Jakarta.Setidakanyauntuktahuniniada18Camatnon STPDN,APDN,IIP yang akan ditatar.'terang Sekda.Sementara yang enam lagi sisanya, akan dilaksanakanpadatahapselanjutnya. Yang enam tersisa ini ,basic mereka selaku camat berasal dari STPDN/IPDN/IIP. Sementara itu, menyangkutdengansejumlahjabatanstrukturalyang kosong di kecamatan kecamatan, Sekda Bahrumsyah MM juga berpesan kepada para Camat untuk segera mengusulkannamanamayanglayakuntukmenempati jabatan jabatan lowong tersebut. "Segera usulkan sehinggabisacepatdiprosesuntukposisiposisijabatan yang kosong tersebut,'tegas Sekda.(@MF)

Menyambut HUT Kota Banda Aceh ke-808

KNPI Gelar Serangkaian Kegiatan BANDA ACEH,BN Menyambut Hari Jadi Kota Banda Aceh ke-808, tepatnya pada tanggal 22 April 2013, Komite Nasional Pemuda Indonesia (KNPI) Banda Aceh menggelar serangkaian kegiatan. Setidaknya ada empat kegiatan yang dikemas dalam rangkaian yang diberi nama aksi dan kreasi 808 Kota Banda Aceh ini antara lain lomba essay dengan tema Profil Tgk. Muhammad Dawud Beureueh, lomba mewarnai layanglayang,lombamaddingdanwisatatitiknolGampongPande. KetuapanitiaPelaksana,WirzainiUsmanyangdidampingi Ketua DPD KNPI Kota banda Aceh, Hasnanda Putra mengatakan bahwa hari jadi Banda Aceh menjadi momentum pemuda untuk kembali menunjukkan eksistensinya. Karena saat ini, pemuda adalah pemain, bukan hanya penonton. Dikatakannya, Banda Aceh adalah kota tua yang bersejarah. Sejak berabad-abad lalu, kota ini menjadi salah satu pusat kebudayaan yang menjadi bagian penting dalam perjalanan sejarah manusia. Di kota ini, terbentuk sebuah tatananhidupislamidibawahkesultananbesar,yangmemiliki pengaruhhinggakesejumlahdaerahdiAsiaTenggara.DiBanda Aceh,808tahunlalu,berdirikerajaanyangmemilikihubungan hingga ke Eropa dan AsiaTengah. “Dalamperjalanannya,kotainijugapernahmenjadisejarah bangkitnya umat manusia dari keterpurukan akibat dua bencanabesar,perangdantsunami.Peperangantidakhanya menghancurkan pihak-pihak yang bertikai, namun juga menghancurkan sendi-sendi kehidupan bermasyarakat.

Praktis tak banyak organisasi yang bertahan dalam kondisi pelik seperti itu. Kehancuran semakin sempurna saat gelombang tsunami mengancurkan sejumlah kawasan di pesisir Aceh, dan Banda Aceh menjadi salah satu daerah terparah,”kata alumni Fakultas Syariah IAIN Ar-raniry ini. Ia menambahkan, di bawah pemerintahan Mawardy NurdindanIllizaSa’aduddinDjamal,kotainiterusberbenah. Tidakhanyadarisisifisik,pemerintahkotajugamenjadikan masyarakat sebagai subjek pembangunan. Salah satunya adalah dengan memasukkan peningkatan peran pemuda dalam visi dan misi pemerintah. “Pemuda,saatini,tidakhanyamenjadipelengkaptetapi pemudaadalahujungtombakkekuatandarisebuahNegara, pemudalahyangseharusnyamemulaisebuahlangkahyang dapat memakmurkan kesejahteraan lingkungan masyarakatnya,PemudaBandaAcehdiberikanperanbesar untuk ikut menata kehidupan bermasyarakat Banda Aceh menjadi masyarakat yang Madani,”imbuhnya. KNPI sebagai wadah berkumpulnya para pemuda yang mengembantugasuntukmengisipembangunandisegala bidang, katanya, dalam hal ini juga ikut andil di dalamnya sebagai pelaku-pelaku pembinaan pemuda baik di tingkat gampong, sekolah maupun di tingkat organisasi kepemudaan.Pembinaandanpengembanganinidiarahkan pada peningkatan jasmani, mental, rohani, membentuk watak dan kepribadian, disiplin dan sportivitas tinggi guna meningkatkan prestasi yang dapat membangkitkan rasa kebanggaan pemerintah Kota Banda Aceh. (*)

Siswa UPTD Inkubator Kader Peternakan Dilatih Mitigasi Bencana Saree | BN Puluhan Siswa baru UPTD Inkubator Kader PeternakandibawahinasKesehatanHewandan PeternakanProvinsiAceh,berpusatdiGampong Saree Aceh, belum lama ini dilatih Mitigasi bencana. Pelatihan Mitigasi bencana itu dipandu personil polisi dari Sekolah Polisi Negara (SPN) Seulawah dan disaksikan langsung Kepala beserta instruktur UPTD Inkubator Kader Peternakan.Pelatihaninidigelar,sebagaiupaya untuk meningkatkan kapasitas pelajar disana agar tanggap terhadap bencana. Kepala UPTD Inkubator Kader Peternakan, drh. Zulyazaini Yahya, kepada Bongkarnews,

mengatakan, pelatihan yang dilaksanakan pihaknyabaru-baruini,bertujuanuntukmelatih anakdidiknyadalammengantisipasiterjadinya bencana. “Ini kita lakukan dikarenakan, lokasi UPTD Inkubator Kader Peternakan terletak di kaki gunung Seulawah. Sehingga, dengan adanya pelatihanmitigasibencana,siswamaupinsiswi tidak gegabah dalam menghadapi bencana, minimal Ia mengetahui tempat penyelamatannya,”ujar Dokter Hewan ini. Kata dia, pihaknya juga membekali siswasiswi skill keterampilan menyelamatkan diri ketika bencana, pertolongan pertama bagi korban (first aid), dan simulasi ketika

menghadapibencana. “Kitajugaakanmemberikaninformasiterkait apa yang boleh dan apa yang tidak boleh dilakukan ketika bencana. Metode penyampaiannyadilakukanmelaluipemutaran film, games, dan praktek lapangan,”tukasnya. Dia mengatakan, sebagai salah satu sekolah yang berada di lereng Seulawah, seperti UPTD Inkubator Kader Peternakan, letaknya sangat berdampingan dengan gunung tersebut. Alhasil, sejumlah siswa dan siswi yang duduk dibangkus sekolah tersebut sangat antusias mengikutijalannyapelatihanMitigasibencana tersebut.“Pelatihanmitigasibencana,barupada tahun ini kita lakukan dan diupayakan dapat

dilaksanakan secara berkelanjutan setiap satu bulan sekali dan diharapkan masuk kedalam kurikulum proses belajar mengajar,”paparnya. Dalam menerapkan kurikulum berbasis bencana,lanjutdia,pihaknyamendorongsiswa lebih intens mendapatkan sosialisasi Pengurangan Resiko Bencana (PRB). Pelatihan dan penyusunan kurikulum Pengurangan Resiko Bencana terintegrasi kedalam kurikulum sekolah. “Juga meliputi pelatihan mitigasi bencana bagi guru dan siswa yang bekerjasama dengan berbagaikalanganlainnya,kedepankamiakan melakukan kerjasama denganTDMRC Unsyiah terkait kegiatan ini,”imbuhnya.

Apalagi,sambungZulya,beberapawaktulalu statusgunungSeulawahAgammasihWaspada level II, seperti yang disampaikan oleh Badan PenanggulanganBencanaAceh(BPBA).“Maka dari itu, kami menilai sangatlah penting kita lakukanpelatihandansimulasibencanakepada siswa,” sambung dia. Masuk Kurikulum Pendidikan Di Aceh Sebelumnya, Pemerintah Aceh diminta untuk memasukkan Siaga Bencana dalamkurikulumsekolahdasarkarena provinsiitudianggapberadapadaposisirentan bencana. Program tersebut merupakan upaya kesiapsiagaansekolah,yangdikembangkanuntuk menggugah kesadaran pemangku kepentingan dalamkesiagaanbencana.(AFRIZAL)

15-22 APRIL 2013 | EDISI 355| THN KE-VIII

LINTAS RIAU Diduga Pengawasan di Tengah Laut Lemah Pelabuhan Tikus Pantai Dumai Tetap Sasaran Penyeludup Riau ,BN Tindakan penyeludupan belakangan ini kembali disoroti sejumlah surat kabar dan LSM di Riau karena banyak barang barang bekas ataupun barang elektronik diseludupkan para pebisnis gelap masuk ke daerah Riau. Akhir akhir ini beredar informasi belasan kapal penyeludup yang biasanya masuk lewat pelabuhan tikus dipantai perairan Dumai kini disebut sebut telah memutar haluan yakni beralih ke tembilahan Indragiri hilir. Permainan pebisnis gelap yang diduga berlindung dalam usaha importir sembako beberapa tahun sebelumnya marak masuk lewat pantai dumai. Tetapi karena tragedy terbakarnya kapal penyeludup pada September 2012 lalu dipelabuhan illegal sungai dumai hingga menewaskan belasan buruh bongkar muat diduga kuat kasus ini merupakan penyebab keberanian mafia penyeludup jadi molor sehingga mencari daerah yang aman yang saat ini disoroti sejumlah media bahwa maling maling yang bermain di manifase tersebut beralih ketembilahan. Sementara penanganan kasus yang menewaskan belasan buruh bongkar muat pada paskah terbakarnya kapal penyeludupan dipelabuhan tikus dumai itu belum terdengar ada kabar proses hukumnya sampai dipengadilan. Diduga bahwa oknum yang bertanggung jawab atas peristiwa yang menghilangkan belasan nyawa manusia itu kasusnya diredam” sampai kini belum jelas diketahui apakah mahkamah pelayaran sudah mengambil tindakan refresif atau tidak? Kasus ini menjadi catatan merah bagi para pengamat hukum di dumai. Dari informasi dihimpun media BN aksi pebisnis gelap yang menyeludupkan barang barang bekas ataupun kotak kotak berisikan elektronik dan yang lainnya diseludupkan melalui jalur pelayaran diamana kapal penyeludup itu mengangkut barang dari singapura dilayarkan ke batam dan kemudian dilayarkan ke daerah sasaran di Riau seperti ke tembilahan dan ada juga lewat perairan tikus di dumai. Terhadap aksi ini kalangan masyarakat banyak mengharapkan agar aparat melakukan tindakan agresif terhadap aksi penyeludupan yang merugikan Negara itu. Sebab barang barang bekas dari luar negeri kadang barang elektronik yang diduga tidak memiliki dokumen resmi banyak beredar didaratan Riau. Dari pengamatan bahwa aksi penyeludupan yang selama ini tergolong meraja lela lewat pelabuhan tikus dumai tidak satupun dari pelaku kejahatan tersebut yang ada diproses sampai ke pengadilan. Bahkan pada bulan maret lalu tindakan penyeludupan itu terjadi lewat masuk pelabuhan sungai kemeli kecamatan medang kampai puluhan ton barang tanpa dokumen resmi akhirnya diamankan petugas. Dari kenyataan ini bahwa upaya pebisnis gelap didumai terus mencari celah untuk memuluskan bisnis gelapnya. Hal ini bisa melewati jalur pelayaran masuk perairan dumai diduga kuat karena pengawasan ditengah laut masih lemah. Dan disatu sisi pihak bea cukai harus benar benar menjalankan aturan karena penanganan masuknya barang seludupan adalah merupakan tanggung jawab sepenuhnya ditangan pihak Bea Cukai, artinya kewenangan penindak penyeludupan adalah milik Bea dan Cukai. Untuk itu diminta kepala wilayah Bea dan Cukai Riau-Sumbar agar melakukan tindakan refresip terhadap pebisnis yang melakukan penyeludupan barang barang dari singapura ke Riau. ( Rds)

Lanal Tarempa Deportasi Nelayan Asing BATAM,BN Lanal Tarempa telah memulangkan 93 Anak Buah Kapal (ABK) kapal asing yang tertangkap pada tahun 2012 lalu. Dari 93 abk tersebut 82 diantaranya adalah warga negara Vietnam dan 11 sisanya asal Thailand. Kamis (11/4) Deportasi dilakukan bertahap. Tahapan pertama dilakukan pada 82 ABK dari Vietnam yang telah

dilakukan akir Maret lalu kemudian dilanjutkan dengan 11 ABK dari Thailand yang dipulangkan pada awal April. Palaksa Mayor laut (P) Libra Dian di ruang kerjanya belum lama ini mengatakan, proses deportasi ABK kapal dilaksanakan karena permintaan dari kedutaan besar masing-masing negara.

5.745 e-KTP di Kelurahan Jodoh Dibagikan BATAM,BN Program e-KTP di Kelurahan Jodoh Batuampar berjalan baik. Saat ini sudah ada 5.745 lembar KTP elektronik yang digawangi Mendagri Gamawan Fauzi itu telah didistribusikan ke warga. Lurah Sei Jodoh, Imam Tohari kepada wartawan, Sabtu (13/4) menyebutkan pendistribusian e-KTP di wilayah kerjanya berjalan lancar.

“Kelancaran ini berkat tingginya partisipasi warga yang kooperatif dengan aparat kami di RT / RW yang ada,” kata Imam Tohari. Menurutnya dari sebanyak 7.393 e-KTP yang telah diterima dari Kemendagri, pihaknya sudah mendistribusikan sebanyak 5.745 lembar kepada warga. “Sehingga bila dari total 8.177 warga yang melakukan perekaman, sudah mencapai 80 persen,” sebutnya..

Warga di Kelurahan Sei Jodoh sangat koorperatif sebab mereka datang langsung ke kantor kelurahan untuk mendapatkan informasi, sedangkan perangkat RT / RW juga tak kalah dalam mensosialisasikan ke warga tentang pendistribusian e-KTP. Terkait e-KTP yang salah cetak ataupun rusak, Imam menjelaskan ada sebanyak 289 buah yang salah cetak dan sekarang sudah dikirim ke pusat untuk diperbaiki.(r)

Pemko Batam Wacanakan Peniadaan Juru Parkir BATAM - BN Pemerintah Kota Batam mewacanakan menarik parkir tahunan ketika pajak kendaraan dibayar. Saat ini, Wakil Wali Kota Batam, H Rudi SE MM mengatakan, pihaknya sudah menjumpai koordinator Samsat untuk membahas hal itu. "Zulhendri (Kepala Dinas Perhubungan) sudah menemui kordinator Samsat, dan Kadispenda, supaya saat mendaftarkan pajak kendaraan, parkir tahunan ini bisa dipungut sekalian," ujar Rudi, Kamis (14/3) di sela-sela peninjauan taman wisata kota di Jodoh Boulevard, Jodoh, Batam. Ia berharap dari wacana itu, tidak akan ada lagi juru parkir yang mengutip uang di setiap tepi jalan. Hal itu juga akan mencegah adanya juru parkir (jukir) liar di lapangan. "Kalau bisa jalan rencana ini tak ada lagi jukir yang mengambil uang di jalan," tegasnya sembari menegaskanjikajukirmasihmendapatkanpenghasilan dari para pengelolanya. Untuk penertiban jukir liar sendiri, Rudi mengatakan pihaknya akan melakukan hal itu setelah rencana parkir tahunan berjalan. "Kami masih menunggu rencana ini berjalan dulu," kata Rudi. Budi Bukti Purba, Ketua Umum Serikat Pekerja

Parkir (SPP) Batam sangat setuju jika rencana penertiban jukir liar terlaksana. Pasalnya, jika parkir tahunan diterapkan dengan baik, jukir ilegal otomatis mendapatkan gaji bulanan dari Dinas Perhubungan (Dishub) Kota Batam, sehingga tidak ada lagi jukir yang menarik uang parkir kepada pelanggan. "Kalau sudah jelas dengan pembayaran gaji untuk semua jukir yang tedaftar, kami akan lakukan razia terhadap jukir liar. Nantinya kami

akan bekerja sama dengan pihak Dishub, Satpol PP dan Kepolisian," jelas Budi. Hal itu disebabkan, hingga saat ini antara jukir ilegal dan jukir legal tidak terdapat perbedaan dalam hal atribut yang mereka pakai. "Antara jukir liar dan jukir resmi, tidak memiliki perbedaan. Semua atribut yang dipakai sama. Seperti baju, peluit dan tiketnya. Dan saat ini jukir yang sudah terdaftar sedikitnya berjumlah 350 orang," ujar Budi. (int)

Libra mengatakan, selama ABK tersebut berada di Mako Lanal Tarempa, masalah makan ditanggung oleh Lanal. Sehingga tidak jarang lanal merasa keberatan dan memerlukan bantuan dari instansi lain terutama pemkab Anambas. “Sebelum dipulangkan, kita memberi makan 80 orang setiap hari. Bisa dibayangkan berapa biaya makan mereka per hari,” kata Libra. (int)

Kebakaran di KPLI Batam Tidak Mengganggu Penerbangan BATAM,BN Badan Metereologi Klimatologi dan Geofisika (BMKG) Batam menyebutkan, kebakaran di area Kawasan Pengelolaan Limbah Industri (KPLI) Kabil, Rabu (13/3/ 2013) kecepatan angin sedang. Yakni mencapai 16 knot atau setara dengan 33 km/jam padapukul13.00WIB,sehinggaasaptebalmengikutiarah angin pada saat itu mengarah dari utara menuju selatan. Kepala Stasiun Metereologi Hang Nadim, Batam Philip Mustamu,SSosmelaluiprakirawannyamengatakanadanya kepulan asap tersebut juga tidak menggangu lalu lintas penerbangan pada saat itu. "Bilamelihatadaarahanginnya,diprakirakanmengarah menuju pulau Rempang dan Galang. Tidak sampai menggangu lalu lintas penerbangan juga, karena posisi bandaraberadajauhdarilokasi.Meskipun,sempatterlihat kepulanasapdarisini,"ujarprakirawantersebut,Kamis(14/ 3). Ditemui diruangannya, ia menambahkan mengenai dampakyangditimbulkandariadanyakepulanasapakibat kebakaran ini, pihaknya menjelaskan untuk hal tersebut tidak menggangu perubahan cuaca maupun hal yang berkenaandenganhaltersebut. "Untuk perubahan cuaca seperti terjadi hujan asam, sepertinya tidak terlalu berpengaruh. Hanya mungkin bila kepulan asap mengarah ke bandara pada saat itu, akan menggangu mesin pesawat jet yang sensitif akan hal tersebut," ungkapnya. Untuk ciri-ciri hujan asam sendiri biasa disebabkan oleh adanya uap air yang mengandung sulfur atau belerang di dalamnya. "Mungkin, untuk skalanya bila dalam skala besar dimungkinkanhalituterjadi.Tetapi,haltersebutkanbutuh dilakukanujipHterhadapkandunganair.Yangjelas,untuk hujan asam dapat merusak lingkungan," jelasnya. (int)


Bupati Tinjau Kerajinan Masyarakat Simpang Jernih

ACEH TIMUR,BN. Bupati Aceh Timur, Hasballah Bin M. Thaib ketika meninjau usaha kerajinan kursi rotan masyarakat daerah tepencil, yakni Gampong Rantau Panjang Kecamatan Simpang Jernih Kabupaten Aceh Timur belum lama ini,Bupati mengatakan pembangunan ekonomi Indonesia telah menimbulkan dampak serius, antara lain kesenjangan pembangunan sektor perkotaan dan perdesaan atau sektor modern dengan sektor tradisional (sektor-sektor kerakyatan). Untuk mengatasi masalah ini, harus diprioritaskan upaya-upaya untuk memperkuat sektor-sektor tradisional dan kerakyatan dan pemerintah menjadi fasilitator penggeraknya. Sektor-sektor ini harus terbuka dan tanggap terhadap perubahan-perubahan dan kesempatankesempatan domestik dan global. Lanjut Bupati dalam rangka mencapai sasaran tersebut di atas, maka sektor-sektor kerakyatan

(tradisional dan pedesaan) harus menjadi kuat; dan untuk itu sangatlah dibutuhkan pemerintahan yang kuat. Hal ini berarti pemerintah perlu menyusun rencana yang rasional, dan mempunyai daya gerak fasilitatif yang kuat untuk pelaksanaannya. Dalam hubungan ini sangat diperlukan situasi stabil yang dinamis untuk berlangsungnya pertumbuhan ekonomi yang berkelanjutan. Pada tahap awal campur tangan pemerintah cukup besar sehingga terlihat seperti otoriter. Tetapi sesuai dengan perkembangan sosial ekonomi, negara akan menjadi semakin lebih demokratis. Keadaan semacam ini memang diperlukan karena proses transformasi dalam kondisi proses globalisasi tidak dapat hanya didasarkan pada kebijaksanaan mekanisme pasar saja,. Sektor kerajinan masyarakat ini harus terus mendapat perhatian dan dukungan dari pemerintah guna menunjang hasil usaha masyarakat yang

DSI Gelar TOT untuk 400 Guru TPA dan TPQ Banda Aceh-, BN Dinas Syariat Kota (DSI) Banda Aceh menggelar Training Of Trainer (TOT) bagi 400 guru Taman Pendidikan Al-Quran (TPA) se-Kota Banda Aceh, Kamis (11/4) di Aula Lantai II, Gedung C Komplek Balai Kota Banda Aceh. Training Of Trainer metode iqra’ bagi guru TPA ini dibuka Asisten Administrasi Umum Pemko Banda Aceh Ir T Buchari Budiman M Si. Dalam sambutannya, Buchari Budiman yang mewakili Walikota memberi apresiasi dan penghargaan kepada DSI Kota yang telah menggelar kegiatan pelatihan tersebut. Menurut Buchari, Taman Pendidikan Al-Qur’an (TPA) merupakan satuan pendidikan keagamaan luar sekolah yang menyelenggarakan pendidikan agama Islam dengan menggunakan metode iqra’, baik yang dipusatkan di masjid, meunasah, balee maupun tempat lain yang dianggap memungkinkan. Untuk itu, Lanjutnya, dalam rangka peningkatan mutu pendidikan dan kualitas peserta didik di TPA dan TPQ dalam wilayah Kota Banda Aceh,

Kata Libra, pihak kedutaan Vietnam meminta agar Lanal Tarempa berkoordinasi dengan imigrasi setempat untuk mengurus dokumen deportasi. “Setelah ABK diserahkan ke imigrasi Tanjungpinang, kedutaan Vietnam akan berurusan dengan imigrasi Tanjungpinang. Prosedur ini berlaku juga seperti deportasi ABK dari negara lainnya,” kata Libra.

dibutuhkan pembinaan secara menyeluruh baik bidang administrasi, keuangan, kurikulum maupun operasional sehingga TPA/ TPQ memiliki standar manajemen yang baku. Peningkatan pemahaman dan kapasitas ustadz dan ustadzah dalam membina dan melahirkan generasi qur’ani mutlak dibutuhkan. Untuk itu, perlu adanya suatu usaha gradual dalam peningkatan mutu guru TPA/TPQ terutama yang tersebar di kota Banda Aceh. “Salah satu usaha yang dirasakan cukup penting adalah melakukan training bagi calon-calon trainer metode Iqra’ dari seluruh TPA/TPQ seperti yang dilakukan DSI hari ini” Ujar Buchari. Lebih lanjut, Buchari meminta penyelenggaraan pendidikan TPA/TPQ agar dikelola secara profesional. Karena itu, diperlukan upaya nyata peningkatan kapasitas dan profesionalitas tenaga pengajarnya agar hasil yang dihasilkan benar-benar menghasilkan lulusan yang memiliki kompetensi manusia berilmu dan

berakhlakul karimah. Selain itu, Buchari juga meminta ustadz-ustadzah agar tidak bosan dan putus asa dalam mendidik dan mengajarkan anak-anak kota Banda Aceh agar nantinya menjadi anak-anak yang tangguh dan mempunyai bekal yang cukup dalam menghadapi arus perkembangan dunia. “Ustaz-ustadzah harus mampu menjadi trainer di bidang metode iqra’, sehingga problematika yang berkaitan dengan pembelajaran di TPA, dapat dicarikan solusi dan diselesaikan dengan baik. Pemko membutuhkan dukungan dan bantuan dari Ustdz/Ustadzah dan kami mengajak seluruh Ustadz/ Ustadzah menjadi mitra pemerintah dalam mendidik anak-anak warga kota ini, agar menjadi generasi-generasi qurani, sebagaimana yang dicitacitakan” Pinta Buchari. Sementara itu, Kepala Dinas Syariat Islam Mairul Hazami SE M Si dalam laporannya mengatakan pelatihan metode iqra’ bagi guru TPA dan TPQ ini di ikuti 400 peserta dari 100 TPA/TPQ dalam kota Banda Aceh. Peserta dibagi

dalam 10 angkatan yang masingmasing angkatan akan diberi pelatihan selama Tiga hari. Tujuan dari TOT ini, lanjut Mairul adalah untuk memberikan pengetahuan dan pemahaman tentang metodelogi iqra’, menjelaskan tentang kiat-kiat membangun motivasi untuk menjadi seorang trainer metode iqra’, mengajarkan tentang bagaimana berkomunikasi efektif dan melakukan praktek berkomunikasi, memberikan pengetahuan dan pemahaman tentang manajemen, kurikulum dan administrasi TPA/TPQ serta melatih praktek langsung untuk menjadi trainer metode iqra’ serta motivator dalam peningkatan kualitas sumber daya guru TPA. Untuk memberikan materi kepada peserta, panitia menghadirkan instruktur dari LPPTKA-BKPRMI kota Banda Aceh. Turut hadir pada acara ini, para staf ahli Walikota Banda Aceh, kepala BKPP Kota Banda Aceh M Natsir Ilyas M Hum, para Kepala SKPD, para Camat dan sejumlah undangan lainnya. (Mkk)

bermuara pada peningkatan taraf perekonomian dan pendapatan daerah “jadi hal ini harus benarbenar kita dukung sepenuhnya karena kita lihat sendiri bahwa hasil dari kerajinan masyarakat ini mutu dan kualitasnya sangat baik dan tidak kalah dengan buatan daerah lain” ujar bupati. Sementara itu, Geuchik Gampong Rantau Panjang Kecamatan Simpang Jernih, Zainuddin mengatakan selama ini kendala yang dihadapi oleh pengrajin adalah mengenai pemasaran dan pengangkutan hasil usaha, hal ini dikarenakan lokasi desa yang merupakan daerah terpencil di pedalamanan aceh timur sarana jalan masih sangat tidak mendukung sehingga untuk mengangkut hasil dari produksi menjadi kendala yang sangat besar yang dihadapi saat ini sehingga membuat pengrajin kurang efektif membuat hasil kerajinan ini meskipun bahan baku seperti kayu dan rotan di daerah ini persediaannya sangat melimpah namun

hasil dari pada kerajinan ini sangat sulit dipasarkan ke daerah luar, kalaupun ada pembeli yang datang dari luar daerah itu sangat jarang ada dan itupun dengan harga yang sangat murah”ujarnya. Pada kesempatan ini, kabag humas setdakab Aceh Timur, T. Amran mengatakan kemungkinan besar dalam tahun anggaran ini peningkatan jalan daerah terpencil akan segera dibangun guna mempercepat peningkatan perekonomian masyarakat, bukan hanya perajin, petani dan yang lainnya juga akan berimbas perekonomian mereka apabila akses peningkatan jalan daerah terpencil ini segera dilakukan, namun harus diingat denganpeningkatansaranajalandanjembatanyangakan dibangun nantinya masyarakat harus bisa menjaga dan melestarikan lingkunggan sekitar guna menghindari musibah-musibah bencana alam yang tidak kita inginkan dan demi kelangsungan hidup anak cucu kita kedepan”tegasnya.(@MF).

Calon Jemaah Haji Diminta Selalu Menjaga Kecerdasan Emosional Banda Aceh,BN Asisten Keistimewaan Ekonomi dan Pembangunan Pemerintah Kota Banda Aceh Drs Ramli Rasyid M.Si membuka manasik haji bagi calon Jemah haji asal kota Banda Aceh, minggu (7/4) di Aula Mesjid Raya Baiturrahman Banda Aceh. Dalam sambutannya, Ramli Rasyid yang mewakili Walikota Banda Aceh memberikan apresiasi dan penghargaan kepada Ikatan Persaudaraan Haji Indonesia (IPHI) yang tidak henti-hentinya memberikan pelatihan, pembekalan dan pembinaan kepada calon jemaah haji asal kota Banda Aceh sehingga dalam menjalankan ibadah haji nantinya dapat menjalankan dengan baik dan sempurna. Pada kesempatan tersebut, Ramli meminta kepada calon jemaah agar selalu menjaga kecerdasan emosional karena hal ini adalah modal yang tidak bisa dikesampingkan dalam melakukan ibadah haji. "Menjaga emosi sangat perlu, harus sabar karena kalau hal ini tidak mampu dijaga akan membuat ibadah kita tidak sempurna" pinta Ketua PGRI Aceh yang tahun depan akan maju sebagai salah-satu senator dari daerah pemilihan Aceh. Sementara itu, Amri Arsyad MM Ketua IPHI Banda Aceh pada kesempatan yang sama meminta kepada panitia agar dalam penyajian materi menggunakan sistem belajar orang dewasa metode yang bervariasi

agar tidak menimbulkan kejenuhan bagi peserta manasik. "Disamping itu, saya minta peserta harus dapat memanfaatkan forum manasik ini sebagai ajang silaturrahmi sesama peserta sehingga akan memupuk rasa kebersamaan sampai saat pelaksanaan ibadah di sana nantinya" pinta Amri. Sesuai dengan laporan ketua panitia H Teuku Johan bahwa persiapan dan pelaksanaan manasik haji telah dilakukan pihaknya sejak bulan February lalu dengan menggelar rapat awal untuk membicarakan perencanaan pelaksanaan, penyusunan jadwal dan menunjuk penyaji serta tutor. Dijelaskannya, manasik dimulai hari ini, minggu (7/ 4) dan akan berakhir pada 23 Juni dengan waktu pelaksanaannya dilakukan pada setiap hari minggu di Mesjid Raya Baiturrahman. Adapun materi-materi yang diberikan nantinya adalah Pengetahuan haji dan umrah oleh H Abdullah puteh, Pedoman shalat oleh Ustad Syukri Daud, materi tempat-tempat ziarah, materi Akhlakul Qarimah oleh Azman Ismail MA, materi haji wanita, penyajian visualisasi, dan praktek lapangan lengkap pada akhir pelaksanaan. Peserta diikuti oleh 106 orang yang keseluruhannya berasal dari calon jemaah asal kota Banda Aceh. (Mkk)

15-22 APRIL 2013 | EDISI 355| THN KE-VIII


Bunda PAUD Harus Memberikan Perhatian 30 Persen Anak yang Kurang Mampu Simalungun,BN Bupati Simalungun DR JR Saragih SH MM mengatakan bahwa, seorang bunda PAUD (Pendidikan Anak Usia Dini) harus memberikan perhatian 30 % terhadap orang lain disamping keluargnya, karena masih banyak orang-orang disekitar kita terutama para anak yatim, anak kurang mampu dan anak-anak yang kurang mendapat perhatian membutuhkan sentuhan dari kita. Hal itu dikatakan Bupati dalam bimbingan dan arahannya saat membuka secara resmi rapat kerja (raker) Tim Penggerak PKK Kabupaten Simalungun dalam rangka hari kesatuan gerak PKK ke41 tingkat Kabupaten Simalungun tahun 2013 yang dirangkaikan dengan pengukuhan bunda PAUD Nagori seKabupaten Simalungun, Selasa, 09/04/ 2013 di gedung SMA Plus PMS Pamatang Raya. Dikatakan, bunda PAUD sangat berperan dalam memberikan kemajuan terhadap anak-anak, khusunya bagi para guru-guru PAUD, karena memberikan pendidikan sejak usia dini kepada anakanak akan lebih mudah. “Bunda PAUD

erat kaitannya dengan instansi pemerintah seperti pendidikan maupun kesehatan dan dituntut peran aktifnya untuk menangani anak-anak kurang mampu, anak yatim terutama disekolah sehingga mereka tidak tertinggal oleh pendidikan. Kami (pemerintah) siap memberikan fasilitas”, ujar Bupati. Dalam kesempatan itu, Bupati juga menyampaikan komitmennya bahwa anak-anak di Simalungun harus semua mendapat layanan pendidikan semasa kepeminpinannya. “Komitmen saya semua anak-anak di Simalungun harus sekolah dan minimal tamat SMA”, ungkapnya. Disamping itu, Bupati juga mengharapkan, bunda PAUD juga dituntut pro aktifnya dalam memberikan pelayanan kepada masyarakat dan menciptakan komunikasi dua arah kepada masyarakat, seperti turut serta mensosialisasikan tentang Kartu Tanda Penduduk (KTP), kepengurusan akte lahir maupun akte kawin. “Jadilah garam dan terang ditengah-tengah masyarakat serta bina hubungan komuniskasi yang baik sesama bunda PAUD”, ajaknya.

Pemkab Simalungun dan Rektor IPB Tandatangani MoU Simalungun,BN Pemerintah Kabupaten (Pemkab) Simalungun dan Rektor Institut Pertanian Bogor (IPB) melakukan penandatangan MoU (Memory of Understanding) untuk mewujudkan program pembangunan pertanian di Kabupaten Simalungun antara lain kopi arabika yang sedang dikembangkan saat ini. Penandatanganan MoU tersebut dilakukan dalam suatu pertemuan antara Bupati Simalungun DR JR Saragih SH MM dengan rektor IPB Prof Dr Herry Suhardiyanto MSc, Jum’at, 12/ 04/2013 di gedung rektorat IPB. Dalam MoU itu juga dinyatakan, IPB melakukan pendampingan, penelitian dan kajian mewujudkan program pembangunan pertanian di Kabupaten Simalungun dalam jangka waktu 2 tahun. Dalam pertemuan itu juga dihadiri Kepala Lembaga Penelitian dan pengabdian kepada masyarakat IPB Prof Dr Bambang Pramudia N MSc, Kepala Pusat Jender dan anak Dr Ir Titik Sumantri MS beserta jajarannya, Plt Sekda Simalungun Ir Jhon Sabiden Purba MUM, Asisten Adm dan Umum Rizal AP Saragih Msi, Kadis Perkebunan Ir Amran Sinaga, Kadis Pertanian Ir Jan Posman Purba dan beberapa Pimpinan Satuan Kerja Perangkat Daerah dijajaran Kabupaten Simalungun. Dalam kesempatan tersebut Bupati Simalungun mengharapkan kepada IPB untuk turut berperanan di Kabupaten Simalungun dalam mendukung pengembangan pertanian, khususnya komoditas unggulan kopi arabika. Selain itu, Bupati juga berharap kepada pihak IPB memberikan pencerahan tentang ilmu pertanian bagi seluruh stakeholders pertanian dan aparat pertanian Pemkab Simalungun, melakukan pemetaan tata ruang pertanian unggulan pertanian sesuai dengan spesifikasi komoditas pertanian unggulan kewilayahan kecamatan di Kabupaten Simalungun, sehingga diharapkan adanya up grade manajemen pembangunan pertanian yang berkelanjutan dan meletakkan fondasi Sumber Daya Manusia (SDM), yang dimulai dengan dukungan Pemerintah Kabupaten dalam mengirimputra terbaik simalungun mengikuti pendidikan di IPB. “Kami (Pemkab Simalungun) siap membantu dalam pembangunan asrama mahasiswa Simalungun di Kampus IPB Bogor berikut dengan fasilitasnya melalui alokasi anggaran APBD Kabupaten Simalungun atau dengan pola bapak angkat, dengan demikian diharapkan masyarakat petani di Simalungun dapat terbantu, apalagi dengan peran IPB dalam meningkatkan sistem dan pola pembangunan pertanian yang kompetitif, terutama dalam kualitas produksi, packing, distribusi dan pemasarana”, kata Bupati. Secara khusus, Bupati meminta kepada IPB untuk menciptakan inovasi baru berupa alat penggilingan kopi yang langsung dapat dipergunakan mulai dari pemetikan biji kopi sampai kepenggilingannya menjadi bubuk kopi, sehingga akan sangat efisien. “Untuk pemasarannya seluruh produksi kopi kami siap membantu melalui Perusahaan Daerah (PD), yaitu PD Agro Madear untuk mewujudkan kestabilan harga”, jelasnya. Menyikapi niat dan komitmen Bupati Simalungun untuk memajukan pertanian di Kabupaten Simalungun, Rektor IPB beserta jajarannya memberikan apresiasi yang tinggi karena jarang seorang kepala daerah mau langsung terjun (menggiring) untuk hal seperti ini. “Kami siap untuk membantu”, ujar rektor IPB sembari menyarankan perlu dibuka jenjang pendidikan diploma 3 disektor pertanian, perkebunan dan peternakan yang spesifik. “Hal ini juga terkait dengan posisi strategis Kabupaten Simalungun sebagai lokasi Program Masterplan Percepatan dan Perluasan Pembangunan Ekonomi Indonesia (MP3EI) di Sei Mangke”, kata Rektor IPB yang juga sebagai salah satu anggota dewan nasional percepatan MP3EI. Selanjutnya Rektor IPB menyatakan bahwa pihaknya siap menjadikan Simalungun sebagai pilot project pengembangan pertanian secara komprehensif dari hulu ke hilir secara berkelanjutan seiring dengan penyuksesan MP3EI yang sejalan dengan pengembangan pertanian tradisional lokalitas Simalungun. Dikesempatan itu juga, Bupati meminta/ mengundang rektor IPB untuk bersedia hadir di Kabupaten Simalungun dalam acara seminar pembangunan pertanian yang berdaya saing tinggi dan berkelanjutan yang akan dilaksanakan Pemkab Simalungun dalam waktu dekat. Menanggapi undangan Bupati ini, Rektor IPB menyambut dengan baik dan bersedia untuk menghadirinya. (ps01)

Sementara itu, kepada seluruh peserta Raker PKK, Bupati Simalungun mengaharapkan agar program kerja yang telah dibuat untuk dilaksanakan dengan baik, sehingga out come yang hendak dicapai dari seluruh program kerja dapat

terlaksana. Sebelumnya Bunda PAUD Kabupaten Simalungun Ny Erunita JR Saragih didampingi ketua Himpaudi (Himpunan Pendidik dan Tenaga Kependidikan Anak Usia Dini) Musliah menyematkan

selempang Bunda PAUD secara simbolik kepada 31 orang bunda PAUD Nagori. Usai menyematkan selempang bunda PAUD, selanjutnya Bupati Simalungun bersama Bunda PAUD dan pengurus Himapudi memberikan ucapan selamat

kepada para bunda PAUD Nagori yang baru dikukuhkan. Ny S Paulina Resman Saragih selaku ketua panitia Raker dalam laporannya sebelumnya menyampaikan bahwa, tujuan dilaksanakan Raker TP PKK untuk menyampaikan program TP PKK Kabupaten kepada TP PKK Kecamatan dan nagori, menyamakan langka dalam pelaksanaan program kerja TP PKK Kabupaten, Kecamatan dan Nagori serta meningkatkan hasil kinerja TP PKK Kabupaten Simalungun. Menurut istri Kadis Pendidikan itu, seminar tersebut dilaksanakan selama satu hari penuh diikuti 476 orang peserta terdiri dari TP PKK Kabupaten, Kecamatan dan Nagori se-kabupaten Simalungun. Hal-hal yang dibahas dalam Raker antar lain pendataan dasa wisma nagori/ kelurahan, pendataan siswa kurang mampu, kelompok kerja operasional Posyandu dan 10 program pokok PKK. Tampak hadir dalam kesempatan tersebut, Plt Sekda, para asisten, staf ahli bupati, para pimpinan unit kerja, camat dan pangulu.(ps01)

Bupati Simalungun Sampaikan Jamsostek dan Jasa Raharja Bagi Anggota Satpol PP Korban Lakalantas Simalungun,BN Pemerintah Kabupaten Simalungun sangat mengutamakan keselamatan kerja bagi para pegawainya saat melaksanakan tugas-tugas sehari-harinya terutama bagi pegawai honor dijajarannya. Hal ini dibuktikan, pasca terjadinya Lakalantas (Kecelakaan Lalulintas) yang terjadi pada 27 Maret 2013 yang dialami 26 orang anggota Satuan Polisi Pamong Praja (Satpol PP) di Dolok Masihol Kabupaten Serdang Bedagai mengakibatkan 3 orang anggota Satpol PP dan satu warga masyarakat meninggal saat musibah itu dan selebihnya mengalami luka-luka, diberikan santuan masing-masing sebesar Rp 50 juta ditambah Jamsostek dan Jasa Raharja kepada korban yang meninggal dan bagi yang terluka diberikan perawatan. Dimana pada hari naas itu, ke 26 anggota Satpol hendak mengikuti acara pembukaan Karya Bhakti TNI Kodim 0207 Simalungun di Kecamatan Silou Kahean. Tiga orang korban yang meninggal Anggota Satpol PP saat musibah itu yakni Rapiaman Girsang warga Batu 6, Bernard Batuhara warga Pane, Riko T Butar-Butar warga Sidamanik. Santunan Jamsostek dan Jasa Raharja diterima kepada para korban melalui ahli waris, merupakan hasil kerjasama antara Pemkab Simalungun dengan Cabang PT Jamsostek Persero Pematangsiantar dan Perwakilan Jasa Raharja Pematangsiantar yang terjalin sejak kepemimpinan DR JR Saragih SH MM menjadi Bupati Simalungun. Gagasan Bupati Simalungun ini mendapat apresiasi dari Cabang PT Jamsostek Persero Pematangsiantar. Bupati Simalungun DR JR Saragih SH MM saat menyerahkan santunan dari Jamsostek kepada ahli waris anggota Satpol PP korban lakalantas dan bantuan dari Jasa Raharja, Kamis, 11/04/ 2013 di Kantor Kependudukan dan Catatan Sipil Kabupaten Simalungun, mengucapkan terima kasih kepada PT Jamsostek Persero Cabang Pematangsiantar dan Perwakilan Jasa Raharja Pematangsiantar atas kerjasamanya telah merealisasikan bantuan kepada Anggota Satpol PP korban laka lantas saat akan melaksanakan tugas untuk kepentingan bangsa dan Negara, meskipun baru satu bulan menjadi peserta Jamsostek. “Mereka adalah putra terbaik bangsa”, ujar Bupati sembari meneteskan air matanya.

“Meskipun baru 1 bulan pegawai kita masukkan sebagai peserta Jamsostek, namun dalam kejadian itu, mereka (Jamsostek) langsung ambil bagian dalam memberikan partisipasi, termasuk para korban yang mendapat perawatan di rumah sakit karena luka-luka. Oleh karenanya saya atas nama pemerintah dan masyarakat memberikan apresiasi yang tinggi kepada PT Jamsostek dan Jasa Raharja atas kerjasama ini dan kedepan diharapkan semakin baik”, kata Bupati. Menurut Bupati, pegawai honorer Pemkab Simalungun yang menjadi peserta Jamsostek sekitar 900-an orang dan yang mendorong dirinya untuk memasukkan pegawai honor tersebut sebagai peserta Jamsostek adalah murni karena kemanusiaan. “Memasukkan mereka (pegawai honor) sebagai peserta Jamsostek keprihatinan saya kepada mereka. Dulu gaji mereka Rp. 500-an, dan sekaran kami naikkan menjadi Rp. 1.100.000,-. Dipabrik aja karyawan mereka sudah mendapat UMR (Upah Minimum Regional) dan inilah yang menjadi motivasi saya. Saya juga menginginkan selama menjadi Bupati, saya tidak menginginkan ada pegawai mengalami kecelakaan saat melaksanakan tugas, tetapi dia menderita”, ungkap Bupati dihadapan para wartawan dari berbagai media cetak dan elektronik yang turut meluput acara itu. Selanjutnya Bupati menjelaskan bahwa, dari gaji sebesar Rp. 1,1 juta itu, Rp. 100.000 langsung diserahkan kepada Jamsostek dan Rp.

1 juta diberikan kepada pegawai untuk kebutuhan hidupnya. Ia juga menjelaskan bahwa, kepada para korban yang mendapat perawatan, Pemkab Simalungun siap untuk menanggungjawapi bila dana dari Jamsostek maupun Jasa Raharja tidak mencukupi. Untuk para korban yang mengalami luka-luka. “Kita juga akan mengadakan acara khusus bagi mereka”, ujarnya. Sementara itu, pimpinan Cabang PT Jamsostek Persero Pematangsiantar, Rasidin SH mengatakan, untuk Provinsi Sumatera Utara, Kabupaten/kota yang telah menjalin kerjasama dengan Jamsostek baru Kabupaten Simalungun. “Baru Kabupaten Simalungun satu-satunya daerah yang mendaftarkan pegawai honorernya menjadi peserta Jamsostek dari 33 Kabupaten/Kota di Provovinsi Sumatera Utara meskipun kami telah melakukan sosialisasi. Oleh karena itu kami sangat memberikan apresiasi kepada Bupati Simalungun yang sangat peduli atas keselamatan kerja pegawainya”, kata Rasidin SH selaku pimpian Cabang PT Jamsostek Persero Pematangsiantar. Menurut Rasidin, besarnya santuan yang diberikan kepada masing-masing ahli waris disesuaikan dengan besarnya upah kerja per bulan yang disampaikan Pemkab Simalungun kepada pihaknya. “Anggota Satpol PP Kabupaten Simalungun mengikuti 4 program Jamsostek yaitu jaminan keselamatan kerja, hari tua, kematian, dan pemeliharaan kesehatan

dan besarnya santuan yang diterima disesuaikan upah kerja perbulan yang disampaikan kepada kami”, ujarnya. Rasidin mengatakan bahwa, upah kerja yang disampikan kepada pihaknya per bulan kepada setiap pegawai honorer di Pemkab Simalungun termasuk anggota Satpol PP sebesar Rp. 1.100.000 per bulan.selanjutnya Rasidin merincikan perolehan santunan yang akan diterima oleh para ahli waris. “Mereka mendapatkan untuk jaminan kematian akibat kecelakaan masing-masing Rp. 52.800.000,ditambah biaya pemakaman Rp. 2 juta, kemudian biaya santunan berkala Rp. 200.000,selama 24 bulan = Rp. 4.800.000 dan ini langsung dibayarkan kepada ahli waris termasuk jaminan hari tua selama 1 bulan sebesar Rp. 62.840, karena mereka baru satu bulan menjadi peserta Jamsostek. Maka jumlah keseluruhannya sebesar Rp. 59.662.840, inilah yang diterima oleh ahli waris berdasarkan upah yang dilaporkan kepada kami”, tandasnya. Bagi mereka yang mengalami luka-luka dan mendapatkan perawatan, Rasidin megutarakan bahwa biaya pengobatan mereka untuk satu jenis kecelakaan kerja maksimal Rp. 20 juta. “ Untuk anggota Satpol PP Kabupaten Simalungun yang mendapat perawatan, kami akan tinjau dimana mereka dirawat dalam rangka melihat apakah mereka dirawat dengan baik, jika tidak kita akan merujuk mereka ke RS Horas Insani atau RS Jasamen Saragih Pematangsiantar sebagai rumah sakit rujukan yang dihunjuk, keranahakmerekaada”,imbuhnya.HSyafaruddindari Perwakilan Jasa Raharja Pematangsiantar dikesempatan itu juga menyampaikan bahwa pihaknya dalam memberikan satunan kepada korban Lakalantas berdasarkan peraturan dan perundang-undangan yang berlaku sebesar Rp. 25 juta bagi ahli waris korban meninggal dunia, untuk perawatan kepada korban lukaluka sebesar Rp. 10 juta dan untuk korban cacat tetap sebesar Rp. 25 juta. Tampak hadir dalam kesempatan tersebut DPRD Simalungun diwakili Sulaiman Sinaga, Plt Sekda Ir Jhon Sabiden Purba MUM, Asisten Pemerintahan dan Kesra Eka Hendra SSos, Staf Ahli Bupati Simalungun Drs Oberlin Hutagaol MM, Kadis Kependudukan dan Catatan Sipil Albert Sinaga SPd MPd, Kasatpol PP dan Linmas Drs Marolop Silalahi serta beberapa pejabat dijajaran Pemkab Simalungun.(ps01)

Pemerintah dan TP PKK Simalungun Laksanakan Gotong Royong Bersama Masyarakat Simalungun,BN Dalam rangka Bulan Bhakti Gotong Royong Masyarakat ke 11 dan Hari Kesatuan Gerak PKK ke 41 (BBGRM dan HKG PKK) tahun 2013, Pemerintah dan Tim Penggerak (TP) PKK Kabupaten Simalungun melaksanakan gotong royong bersama masyarakat Kecamatan Jawa Maraja Bah Jambi, Jum’at, 12/04/2013. Kegiatan gotong royong yang juga melibatkan anggotaTNI dan Polri serta organisasi kepemudaan itu membersihkan parit jalan sepanjang 5 KM yang menghubungkan Nagori Jawa Maraja danTanjung Maraja Kecamatan Jawa Maraja Bah Jambi. Kebersamaan dan penuh dengan kekeluargaan dalam melaksanakan gotong rayong itu sangat terlihat diantara masyarakat, aparatur pemerintah maupun anggota TNI dan Polri. Mereka saling bantu satu sama lain untuk membersihkan parit jalan yang sudah tertimbun tanah dengan menggunakan cangkul. Pada pelaksanaan kegiatan gotong royong itu, Ketua TP PKK Kabupaten Simalungun Ny Erunita JR Saragih bersama-sama dengan murid-murid SD Negeri No 091553 Nagojor melakukan

penanaman bibit pohon pucuk merah di pekarang sekolah itu. Saat penanaman tersebut, terlihat Ny Erunita JR Saragih membimbing anak-anak cara melakukan penanaman pohon dengan baik. “Penanaman pohon ini sengaja kami lakukan bersama dengan anak-anak agar mereka kelak dapat melakukan hal yang sama, sekaligus mereka juga mau merawatnya di kemudian hari dalam rangka menjaga kelestarian lingkungan”, kata Erunita yang berpredikat dokter kesehatan itu sebari berharap agar anak-anak juga selalu menjaga kebersihan dan kesehatannya serta lebih giat belajar, apalagi ujian sudah diambang pintu. Terkait dengan pelaksanaan kegiatan gotong royong, Ny Erunita JR Saragih mengatakan bahwa kegiatan itu juga dalam rangka menghidupkan kembali budaya gotong-royong sebagai warisan leluhur. “Kegiatan gotong-royong bersama ini juga sebelumnya telah kita laksanakan bersama Pemkab Simalungun membersihakn beram jalan yang menghubungkan Siantar – Pamatang Raya yang bertujuan untuk menghidupkan kembali budaya gotong royong sebagai warisan leluhur kita kepada masyarakat, karena budaya gotong

royong yang dulunya dilakukan oleh para lehurur sudah mulai hilang, jadi kita coba untuk hidupkannya kembali”, jelasnya. Dikesempat itu, seusai melakukan penanaman pohon, Kadis Kesehatan Kabupaten Simalungun dr Saberina MARS memberikan penyuluhan tentang kesehatan bagi anak-anak. Ia mengatakan bahwa, kesehatan itu sangat penting karena salah satu penunjang keberhasilan dalam meraih citacita dimasa depan. “Kalau kita mau sehat, kita harus makan makanan yang bergizi dan sebelum makan kita juga harus cuci tangan dengan sabun supaya bersih”, kata Saberina dihadapan ana-anak. Sebelum beranjak dari sekolah SD itu, Ketua TP PKK bersama Ny Ruth Gidion Purba memberikan tali asih kepada anak-anak yang berprestasi, sebagai motovasi bagi mereka untuk terus belajar dalam mencari ilmu pengetahuan. Camat Jawa Maraja Bah Jambi Dwi Fithri Siregar Msi mengatakan bahwa, kegiatan gotong royong diwilayahnya dilaksanakan setiap satu minggu sekali. “Kita sudah menyurati para pengulu untuk melaksanakan

gotong-royong setiap hari Jum’at di nagori masing-masing terutama untuk membersihkan pari-parit jalan, sehingga saat hujan air tidak melimpah dijalan”, katanya. Sementara itu, salah seorang warga masyarakat, Sunardi, menyampaikan terima kasih kepada pemerintah dan PKK Kabupaten Simalungun yang menggasi untuk menghidupkan kembali budaya gotongroyong ditengah-tengah masyarakat. “Ini jelas sangat bermanfaat bagi kami untuk menjaga kelestarian lingkungan, sehingga masyarakat juga sadar akan pentingnya lingkungan yang bersih”, ujar pria yang berusia sekitar 30-an tahun itu yang sadar akan pentingnya lingkungan yang bersih. “Jika kebersamaan antara aparatur pemerintah, TNI, Polri dan masyarakat terus seperti ini negara kita pasti akan lebih maju. Seperti dalam membersihkan parit jalan, itu sangat perlu agar air tidak melimpah ke badan jalan saat hujan datang, ini jugakan membantu pemerintah dalam merawat jalan”, tandas Sunardi .(ps01)

15-22 APRIL 2013 | EDISI 355| THN KE-VIII

Kadis Perindagkop & UMKM Palas Komit Tuntaskan Permasalahan KUD Sentosa PALAS BN Permasalahan yang pernah di tudingkan anggota KUD Sentosa Desa Ujung Batu II Kecamatan Hutaraja Tinggi(Huragi) Kabuapten Padang Lawas(Palas) tentang pengumpulan sertifikat lahan I dan Lahan II oleh KUD terhadap seluuh anggotanya yang berjumlah sebanyak 750 KK untuk di lebur menjadi satu sertifikat kini semakin memanas.Apalagi dalam pengumpulan sertifikat ,anggota di wajibkan mencicil

uang sejumlah Rp 2 juta 600 ribu per KK guna biaya peleburan sertifikat. Hal tersebut di sampaikan oleh kepala Dinas Perindustrian Perdagangan Koperasi dan Usaha mikro Kecil dan menegah(Perindagkop &UMKM) Palas Ali Irfan Hasibuan S.Pd,MM saat di konfirmasi di ruang kerjanya mengatakan,Dinas Perindagkop &UMKM Palas berkomitment untuk menjernihkan permasalahan yang terjadi di KUD Sentosa Desa Ujung Batu II

Kecamatan Huragi agar koperasi yang bermasalah dapat berjalan lancar dan menguntungkan bagi seluruh anggotanya . Menurut Kadis terkait dengan pengaduan masyarakat terhadap masalah yang terjadi pada KUD Sentosa tersebut belum lama ini ,maka pada tanggal 02 April 2013 kami sudah melayangkan surat penggilan bernomor : 518/0230/2013 terhadap pengurus dan pen gawas untuk hadir kekantor Discoperindagkop &UMKM Palas pada Hari

Senin Tanggal 08 April 2013. Sedangkan perihal surat pemanggilan tersebut, untuk membicarakan permasalahan yang terjadi di KUD Sentosa Desa Ujung Batu II . Tambah Irfan,hingga hari ini tanggal 09 April 2013 Kabid Koperasi Palas saparuddin belum melaporkan hasil pemanggilan tersebut terhadap saya secara resmi. ucapnya sembari mencoba hubungi ponsel kabid koperasi,namun upaya tersebut gagal

karena selain tidak masuk kantor juga handphonnya non aktip. Dikatakannya lagi,kalau nantinya panggilan pertama tidak mereka gubris,kita kan layangkan panggilan kedua,setelah itu kalau tockh tak ada tanggapan saya selaku kepala Dinas dengan beberapa staf akan turun langsung ke lapangan guna untuk perifikasi permasalahan yang terjadi antara pengurus dengan anggotanya,hal ini sangat penting kare-

na kekuasaan tertinggi di dalam koperasi adalah di tangan para anggota bukan di tangan pengurus. Sedangkan menjadi acuan utama kita nantinya turun ke lapangan guna klarifikasi permasalahan adalah buku naskah anggaran dasar dan anggaran rumah tangga (AD/ART)koperasi itu sendiri,megapa kita memilih hal tersebut karena buku AD/ART adalah pengawas yang paling tinggi di dalam satu koperasi.pungkasnya (Ali)

Dinas Pertanian Palas Salurkan 65 Handtractor Kepada Kelompok Tani Palas BN Sebanyak 65 kelompok tani di Padang Lawas (Palas) menerima bantuan Hand Taraktor (Traktor Tangan) guna untuk meningkatkan hasil pertanian persawahan. Penyerahan alat pertanian itu diserahkan oleh Bupati Palas H. Ali Sutan Harahap (TSO) dan Kepala Balai Pengkajian Teknologi Pertanian (BPTP) Sumut Dr.Ir Ali Jamil MP. Penyerahan itu dilaksanakan dalam rangka penandatangan nota kesepahaman kerjasama penelitian/ pengkajian dan pengembangan teknologi pertanian spesipik lokasi berkelanjutan di daerah setempat, Rabu (10/3). Dalam kesempatan itu, Bupati Palas dalam sambutan dan arahannya mengatakan dahulunya Palas merupakan penyuplai beras ke daerah sekitarnya hingga ke labuhan Batu dan ke Rokan Hulu, namun banyaknya kendala di bidang sarana dan prasarana maka hal itu menjadi berkurang. Untuk itu, dengan adanya nota kesepahaman kerjasama dan bantuan traktor tangan serta sosialisasi penelitian dan pemngembangan teknologi yang didukung oleh lokasi persawahan yang terbentang di sepanjang aliran sungai, sangat dimungkinkan Palas akan kembali menjadi daerah swasembada beras di masa yang akan datang. Pada kesempatan yang sama Kepala BPTP Sumut Dr.Ir Ali Jamil MP dalam kesempatan itu menyerahkan benih padi non hiprida dan buku penyuluhan kepada Bupati palas untuk diserahkan kepada kelompok tani.

Sembari mengatakan bibit yang diserahkan tersebut nantinya akan dijadikan bibit kembali. Sementara Kadis Pertanian Palas Ir Abdullah Nasution mengatakan, pertanian palas akan menggunakan pola pengembangan varietas unggul yang dapat memberikan manfaat teknis dan ekonomis yang banyak bagi perkembangan usaha pertanian. Menurutnya,salah satu yang berpengaruh dalam peningkatan produktivitas dan produksi tanaman pangan adalah penggunaan benih varietas unggul bermutu yang didukung oleh penerapan teknologi. Oleh karena itu, ketersediaan benih bermutu terus diupayakan mengingat tingginya manfaat dari penggunaan benih tersebut. Sedangkan bila dikaitkan dengan 500 lebih jumlah Kelompok Tani di palas yang akan menerapkan pola varietes tersebut maka Palas akan kembali lagi menjadi penghasil padi, karena bertani dengan pola varites menjadikan hasil pertanian padi sawah akan melebihi hasil perkebunan karet maupon sawit. Dengan demikian alih fungsi areal persawahan menjadi perkebunan sawit maupun karet akan dapat diminimalis dan tidak tertutup kemungkinan areal yang telah menjadi perkebunan akan kembali menjadi persawahan.pungkasnya Turut hadir dalam acara tersebut Plt Sekda Palas Drs Irfan Soaduon Hasibuan, Damramil Barmun Kapt. Syafaruddin Hasibuan, Kapolsek Barumun, para camat dan sejumlah kepala SKPD serta utusan seluruh kelompok tani.(Ali)

Kecamatan Padangsidimpuan Juara Umum MTQ ke 12 Tingkat Kota Padangsidimpuan PADANGSIDIMPUAN,BN Kecamatan Padangsidimpuan Utara keluar sebagai juara umum Musabaqoh Tilawatil Quran Nasional (MTQN) Ke -12 Tingkat Kota Padangsidimpuan Tahun 2013 yang berlangsung tiga hari di lapangan Perumnas Pijorkoling Kecamatan Padangsidimpuan Tenggara mulai 6-8 April yang lalu. Penutupan MTQ ke-12, Senin malam ( 8/4). Dihadiri oleh Ketua DPRD Kota Padangsidimpuan , Wakil Walikota Padangsidimpuan , Porum Komunikasi Pemerintah daerah Kota padangsidimpuan , Plt . Sekretaris Daerah Kota padangsidimpuan , Para Stap Ahli, Asisten , Kepala Dinas ,badan, Kantor, Bagian, Camat sekota Padangsidimpuan , Kepala kementerian Agama Kota padangsidimpuan , Ketua MUI Kota Padangsidimpuan , Ketua IPHI Kota Padangsidimpuan , Ketua Tim penggerak PKK Para dewan hakim MTQ ke- 12 Tingkat Kota Padangsidimpuan , Para peserta kontingen Qori Qoriah serta undangan lainnya. Kegiatan MTQ ini di ikuti 159 peserta yang tergabung dari enam utusan kecamatan sekota Pdangsidimpuan adapun cabang – cabang yang di pertandingkan antara lain Hifzu Quran , Tafsir Quran , Khattul Quran , Fahmil Quran , dan Syahril Quran,Andar Amin Harahap SSTP, MSi dalam pidatonya menyampaikan “ alham dulillah selama tiga hari ini dari tanggal 6 sampai dengan tangal

8april 2013 kita telah melaksanakan dan mengikuti seluruh rangkaian kegiatan pelaksanaan Musabakoh Tilawatil Quran (MTQ) ke 12 tingkat kota Padangsidimpuan berjalan lancar dan sukses sesuai dengan harapan kita bersama . Tentunya dari berbagai jenis kegiatan yang di gelar telah menghasilkan keputusan yang terbaik. Turut menyampaikan kata sambutan Kakan Kemenag Psp Drs H Efri Hamdan Harahap, Ketua DPRD Psp Aswar Syamsi Lubis yang diwakili Wakil Ketua Hj Hamidah Batubara, Ketua MUI Syaukani MS. Camat Padangsidimpuan Utara,Armen Dame Harahap,SH,MM mengungkapkan, mengucapkan terimakasih sekali kepada semua Pihak dan juga kafilah Kecamatan Padangsidimpuan Utara,dan mengucapkan syukur kepada Allah SWT atas limpahan rahmat yang diberikan oleh Allah kepada masyarakat Kecamatan Padangsidimpuan Utara yang berhasil meraih juara umum MTQ Tingkat Kota Padangsidimpuan ke 12 kedepannya kepaduan tim ini akan terus kita bina dan lebih kita tingkatkan. Kata Camat berkaitan dengan pelaksanaan ini, tugas kedepan yang terpenting adalah untuk meningkatkan minat para generasi muda gemar dan mampu membaca Al Quran dengan baik dan benar, hal ini sesuai dengan visi misi Walikota Padangsidimpuan Sehat Maju dan sejahtera.(SAAD)

Bupati Palas Hadiri Penghataman Kelas Akhir Ponpes Syekh Mhd Dahlan Sibuhuan PALAS, BN Pondok pesantren Seyekh Mhd Dahlan Aek Hayuara Sibuhuan Kabupaten Padang Lawas(Palas)sudahlamabersinardantelahbanyak mengukirprestasidibidangpendidikandiberbagai penjuru tanah air terlebih pada daerah Palas. Haltersebutdisampaikanolehpimpinanpondok pesantrenSyekhMhdDahlanDrs.KH.H.Syafaruddin Hasibuan MA di dampingi perwakilan kepala MDA,MTS , MA dan Perguruan tinggi StaibrWildan Ansyori Hasibuan S.Ag pada acara penammatan santrisantryahRabu(10/4)dihalanutamapondok posantrenSyekhMhdDahlanAekHayuraSibuhuan. DikatakanWildan,jumlah siswayangmengenyam

pendidikandipondokpesanterenAekHayuarasaat ini sebanyak 2796 siswa,namun yang berkesempatanditammatkanpadakelasakhirsaat ini adalah sebanyak 658 orang. Lanjut Wildan jumlah tersebut meliputi MDA 61orang,MTS 386,MAS 137 dan 74 maha siswa Staibr yang terdiri dari dua fakultas yakni,Awalusyahsiyahdanperbankansyariah. Dalam kesempatan tersebut Bupati Padang Lawas Ali Sutan Harahap (TSO) dalam bimbingan danarahannyamengatakan,Palasdikenalselama ini dengan kebudayaan islam yang kental,hal ini terlihat dari sikap dan cara hidup keseharian masyarakatPalas,sehinggakitamendapatjulukan

serambi mekkahnya propinsi Sumatera utara. TambahBupati,olehsebabitupenammatan seperti ini adalah suatu upaya yang positif dalam mengisi dan tetap mempertahankan buda islami di Ladang Lawas,dengan demikian seluruh oang tua dan masyarakat Palas diharapkan agar tetap mengedepankanniladanajaranislamdalamhidup dan berkehidupan sehari-hari,agar budaya yang sudah di wariskan kepada kita tetap berthan dan terus bertambah maju. Seterusnya Bupati mengingatkankepadaseluruhsantridansantryah supayabentengidiridenganilmuagamasertatetap pada koridor jalan yang benar, hal ini tentunya sangat bermanfaat untuk menghindari diri dari

pengaruh negatif serta kenakalan remaja yang akhir-akhir ini menjadi permasalahan tersendiri bagipemerintah.pungkasnya. Acarapenammatandijugadisidenganberbagi senibudayaislamyangdipertunjukkanolehsantri santriyah yang selama ini berlatih dan belajar di dalam pondok pesantren Aek Hayura Sibuhuan. Turut Hadir dalam acara tersebut,beberapa pinpinan pondok pesantren se Kabupaten Palas,mewakili DPRD Palas,Kepala Dinas PendidikanPadangLawas,sertabeberapapinpinan SKPD lainnya,Tokoh Agama,Danramil 08 Barumun,Tokoh masyarakat,serta ribuan orang santri .(Ali)

Memperihatinkan Banyak Siswa di Tapanuli Selatan Kecanduan Rokok TAPSEL,BN Disaat rokok dan bahayanya menjadi topik pembahasan yang sedang marak di perbincangkan, malah dibeberapa daerah/kota besar diberlakukan aturan tertentu tentang penggunaan rokok, semisallaranganmerokokditempatumum,dibeberapagedung, perkantoransertafasilitasumumlainnya,namunrokoktetapsaja “melenggang” . Ironisnya adalah ketika“fakta”ditemukan bahwa rokok bukan sajadikonsumsiolehorangdewasa,tetapibahkanolehparasiswa yangmasihdudukdibangkusekolah.Sudahbukanmenjadirahasia umum lagi bahwa siswa sekolah menengah atas bahkan siswa

menengah pertama sering kali ditemukan dalam keadaan berpakaian seragam sekolah, merokok ketika hendak berangkat pergidanpulangsekolah,baikketikamengendaraikendaraanroda dua, maupun kendaraan umum. Halinitentubukanlahhalyangwajardanbukanpulakesalahan maupuntanggungjawabsepihak,tetapimenjaditanggungjawab seluruh komponen masyarakat, karenanya diperlukan perhatian yang exstra dari dan oleh seluruh lapisan masyarakat, baik oleh paraorangtua,parapendidikmaupunmasyarakatpadaumumnya. Diharapkan kepada pihak POLRI dalam hal ini polres tapanuli selatan yang dipinpin oleh bapak kapolres AKBP Budi Hariyanto

SikMSIbesertaseluruhjajarannyaagarkembalimengaktifkanrazia kasihsayangsehubungandenganhalini,gunamemberantasatau meminimalisir maraknya para siswa yang merokok di wilayah hukum tapanuli selatan pada saat yang sama masyarakat juga berharap banyak kepada bapak bupati tapanuli selatan melalui seluruh jajaran dinas pendidikan dan dinas kesehatan agar tidak kalahgencarnyamemberikanpenyuluhantentangbahayarokok utamanya bagi mereka yang masih duduk di bangku sekolah. Sehingga nantinnya para siswa di tapanuli selatan bebas rokok, dan pemandangan yang tidak wajar selama ini tidak ditemukan lagi.( ASRUL SIANIPAR )

Peran Humbahas Pada Era Repormasi Otonomi Daerah Humbahas, BN Pada lahirnya Undang-undang Nomor : 22 Tahun1999tentangOtonomiDaerahtidakterlepas dari tuntutan Politik yang telah lama diperjuangkansegenapRakyatIndonesiadengan adanya Undang-undang Otonomi Daerah tersebut,setiapdaerah bisaberjalan sendiritanpa tertumpu ke Pemerintah pusat. Otonomi dalam naskah kesepakatan Forum kerjasama penggunaan kawasan pantai barat SumateraUtaradansekitarnyadisetujui,selasa26 maret 2002 yang lalu, yang ditanda tangani beberapa daerah dua walikota dan lima bupati masing-masingKepalaDaerahDrs.TuaniLumban Tobing (Bupati Tapteng), Drs. HM. Sale Harahap (Bupati Natam), Drs. RE. Nainggolan,MM (Bupati TapanuliUtara)AmrulDaulae,SH(BupatiMadina) Bina Hati Baeha,SH (Bupati Nias) dan Sahat P. Panggabean (Wali Kota Sibolga) Drs. Julkarnail Nasution (Walikota Padang Sidempuan). Dalampenerapankerjasamatersebut,masing-

masingKabupaten/Kotaakanmenjabarkansendiri konsep yang akan dilaksanakan atas dasar itu, KabupatenHumbangHasundutanSumateraUtara membuat harla (Hari lahirnya konsep humbahas yang digagasi oleh Bupati Humbang Hasundutan) Drs.MaddinSihombing,MSisebagaianakputraasli HumbahaskelahiranparulohanKecamatanLintong Nihuta yang sangat berupaya memikirkan kesempatan pembangunan dalam dua periode belakangan ini, sebagai Bupati dibuat gelar Bupati Pembangunterutamadalamrangkameningkatkan taraphidupmasyarakatmenujutingkatkehidupan yang layak dan mandiri agar tidak terlihat asing dengan daerah lain. " Betul-betul birokrat tulen " . KamimasyarakatHumbangHasundutansangat bangga akan kepemimpinan Bupati Dr. Maddin Sihombing, MSi yang sangat dekat dengan masyarakatsertaProgramyangsangatmenyentuh kehidupanmasyarakatpadaberbagaisektor,namun masih ada pimpinan SKPD yang tidak dapat mengikutiPoladanProgrambapakBupati,sebagai

mana anekdot dapat disebut Bupati Humbang Hasundutan berjalan dengan 90 km / Jam , SKPDnyamasihadayanglari50km/Jam Terutama yang dikonsep Bupati Humbang Hasundutan St. Maddin Sihombing,M.Si mengisi pembangunandiberbagaibidang,menatapmata masadepandanmewujudkanmasyarakatsejahtera. Pimpinan sebagai Kepala Daerah (Bupati) apabila jarum jatuh kedaerahnya ia tahu, artinya SKPDsekaranginisudahmulaimemalukankalau kita lihat kinerjanya antara lain pelaksanaan Prasarana Wilayah (Praswil) dan Tata Ruang dan Pemukiman (Tarukim) dan Pendidikan sudah sembrautpelaksanaannyaitumemalukanBupati Membangun, tutur beberapa tokoh masyarakat dan LSM Kabupaten Humbang Hasundutan, Bupati sebagai perpanjangan tangan dari Gubernur secara langsung berhubungan dengan masyarakatharustanggapdanjeliterhadapsegala bentukpermasalahanyangdihadapimasyarakat membangun, terlebih dalam hal peningkatan

mutu segala aspek, konsep Bupati di Humbang Hasundutan. Sebagai mana telah beberapa kali kamibuatpemberitaaninimengenaikepalaDinas diatas. Terciptanya masyarakat yang berpendidikan dan berwewenang jauh kedepan dengan etiket moraldanahlakyangbaik.Pembangunandalam kesehatan Masyarakat perlu ditingkatkan karena tanpaditunjangpemikiranyangsehat,makasegala program pembangunan akan tersendat , Jl. Doloksanggul Saitnihuta tidak dipikirkan, memangtanpadukunganmasyarakatsegalaprogram tersebut akan di siasiakan. Untuk itu di harapkan peran aktif, masyarakat dalam mensukseskanpembangunantersebut. Ditengah Humbang Hasundutan dibawah kepemimpinan Bupati Humbahas St. Maddin Sihombing,M.Si semakin menampakkan hasil yangcukupmenggembirakantetapibupatijangan membiarkan ulah bawahannya membuat buruk nama Kepala Daerah. (Mangatur Silaban)

BP2KP Tapsel Wujudakan Harapan Bupati Melalui Penyuluhan TAPSEL,BN Beberapa minggu yang lalu Bupati Tapsel.H.Syahrul M.Pasaribu bersama SKPD seluruh Tapsel mengadakan Tor ke Desa Terisolir,sehingga membuat suatu terobosan bagaimana untuk peningkatan SDM Penyuluh pertanian agar masyarakat sejahtera dan mampu bercocok tanam yang baik dan sesungguhnya karena keberhasilan petani salah satunya akibat kerja keras dan peran serta Penyuluh dalam memberikan ilmu tepat guna kepada Petani,Plt Kepala Badan Pelaksana Penyuluh Pertanian dan Ketahanan Pangan Kabupaten Tapanuli Selatan (BP2KP).Ir

Bismark MT Siregar yang juga ikut dalam rombongan tersebut mengatakan kepada BN dalam minggu ini. Menurutnya,salah satu skala prioritas yang direncanakan Bupati Tapsel adalah mengenai infrastruktur jalan yang kondisinya sangat memprihatinkan sebahagian ada badan jalan belum tersentuh Aspal,dengan adanya turdes ini keinginan masyarakat bisa dipenuhi meskipun tidak seluruhnya. Termasuk juga peningkatan pelayanan sektor pertanian dan penyuluhan pertanian akan maksimal dilakukan karena dengan adanya peningkatan akses jalan sehingga akan

memudahkan petugas penyuluhan Pertanian dalam melaksanakan tugasnya khususnya ke daerah-daerah terpencilsehingga dengan demikian para personil diharapkan lebih aktif dalam menjalankan tugasnya memberikan penyuluhan pertanian kepada masyarakat yang selama ini tidak terjangkau, dengan pembangunan jalan agar menambah semangat dari petugas”Ucapnya. Tambah Bismark,dengan demikian peningkatan akses jalan sangat perlu dalam rangka untuk mengangkut produk hasil pertanian karena bisa dikatakan luas pertanian di Tapsel sangat luas dengan adanya

pembangunan dan peningkatan infrastruktur jalan sehingga pengangkutan hasil produk pertanian dapat terjual dengan harga yg stabil karena selama ini tidak sebanding harga produk pertanian dengan ongkos produk pertanian “Ucapnya. Harapan untuk kedepan untuk lebih memaksimalkan petugas penyuluh pertanian fasilitas kenderaan roda 2 untuk penyuluh sangat diperlukan,karena memang selama ini kenderaan roda 2 ada namun itu semuanya tidak mencukupi harapan kedepan agar ada penambahan fasilitas kenderaan roda 2 kepada petugas penyuluh pertanian”Ucap Bismark.(SAAD)

15 - 22 APRIL 2013 | EDISI 355 | THN KE-VIII

Sosok Emansipasi Wanita dan Pejuang-pejuang Wanita Indonesia Penulis : TITIN SUHARTINI, Mahasiswa Akuntansi Universitas Sumatera Utara Mengenal Sosok Kartini Siapa yang tidak mengenal sosok Kartini, tokoh wanita yang memperjuangkan emansipasi wanita ini dikenal lewat bukunya yang berjudul “ Habis Gelap Terbitlah Terang “. Kartini yang bernama lengkap Raden Adjeng Kartini lahir di Jepara, Jawa Tengah, 21 April 1879. Raden Adjeng Kartini adalah seseorang dari kalangan priyayi atau kelas bangsawan Jawa, putri Raden Mas Adipati Ario Sosroningrat, seorang Bupati Jepara. Kartini menikah pada tanggal 12 November 1903 dengan bupati Rembang, K.R.M. Adipati Ario Singgih Djojo Adhiningrat, yang sudah pernah memiliki tiga istri sebelumnya. Suaminya mengerti keinginan Kartini, Kartini diberi kebebasan dan didukung untuk mendirikan sekolah wanita di sebelah timur pintu gerbang kompleks kantor kabupaten Rembang, atau di sebuah bangunan yang kini digunakan sebagai Gedung Pramuka. Kartini memiliki seorang anak yang bernama Soesalit Djojoadhiningrat, lahir pada tanggal 13 September 1904. Beberapa hari kemudian, 17 September 1904, Kartini meninggal pada usia 25 tahun. Kartini dimakamkan di Desa Bulu, Kecamatan Bulu, Rembang. Kartini mempunyai pemikiran melalui keinginannya untuk menjadi seperti kaum muda Eropa. Kartini menggambarkan penderitaan perempuan Jawa akibat kungkungan adat, yaitu tidak bisa bebas duduk di bangku sekolah, harus dipingit, dinikahkan dengan laki-laki yang tak dikenal, dan harus bersedia dimadu. Kartini juga sempat mengemukakan pendapatnya mengenai agama, ia mempertanyakan mengapa kitab suci harus dilafalkan dan dihafalkan tanpa diwajibkan untuk dipahami. Kartini mengungkapkan tentang pandangan bahwa dunia akan lebih damai jika tidak ada agama yang sering menjadi alasan manusia untuk berselisih, terpisah, dan saling menyakiti. "...Agama harus menjaga kita daripada berbuat dosa, tetapi berapa banyaknya dosa diperbuat orang atas nama agama itu..." Kartini mempertanyakan tentang agama yang dijadikan pembenaran bagi kaum laki-laki untuk berpoligami. Bagi Kartini, lengkap sudah penderitaan perempuan Jawa yang dunianya hanya sebatas tembok rumah. Mengapa harus Kartini ? Pasti kita semua pernah berpikir, “kenapa harus hari Kartini ?” Padahal kita mengetahui bahwa Kartini bukanlah sosok pejuang yang bekerja keras memegang tombak bambu untuk membela negara Republik Indonesia. Sosok Kartini dikenal hanya karena pemikirinnya mengenai emansipasi wanita. Banyak tokoh pejuang wanita lain yang berasal dari Indonesia. Mengapa sosok mereka tidak memiliki hari khusus seperti hari Kartini. Kita juga pasti pernah mengenal sosok Cut Nyak Dien, yang merupakan salah satu dari perempuan berhati baja yang di usianya yang lanjut masih mencabut rencong dan berusaha melawan pasukan Belanda sebelum ia akhirnya ditangkap; Cut Nyak Meutia, wanita asal Nangroe Aceh Darussalam, yang terus berjuang melawan Belanda hingga tewas diterjang tiga peluru di tubuhnya; Raden Dewi Sartika tokoh perintis pendidikan untuk kaum perempuan, diakui sebagai Pahlawan Nasional oleh Pemerintah Indonesia tahun 1966; Siti Aisyah We Tenriolle, wanita ini bukan hanya dikenal ahli dalam pemerintahan, tetapi juga mahir dalam kesusastraan; Martha Christina Tiahahu, ia selalu mendampingi ayahnya dalam setiap pertempuran bukan saja mengangkat senjata, tetapi juga memberi semangat kepada kaum wanita yang ada pada saat itu agar ikut membantu kaum pria disetiap medan pertempuran; Nyi Ageng Serang, turut serta berperang ketika perang Diponegoro meletus. Nama-nama tokoh diatas hanyalah sebagian kecil tokoh pejuang wanita Indonesia yang saya ketahui. Menurut saya, rasanya sedikit tidak adil kenapa Kartini saja yang memiliki hari khusus, melihat perjuangan wanita-wanita diatas yang jauh lebih gigih untuk membela negara Republik Indonesia. Lalu apa alasan dibalik hari Kartini yang diperingati setiap tanggal 21 April. Menurut referensi yang saya baca, Kartini memang dipilih oleh orang Belanda untuk ditampilkan ke depan sebagai pendekar kemajuan wanita pribumi di Indonesia. Kartini mula-mula bergaul dengan Asisten-Residen Ovink suami istri yaitu Cristiaan Snouck Hurgronje, penasehat pemerintah Hindia Belanda, yang mendorong J.H. Abendanon, Direktur Departemen Pendidikan, Agama dan Kerajinan, agar memberikan perhatian pada Kartini tiga bersaudara. Abendanon mengunjungi mereka dan kemudian menjadi semacam sponsor bagi Kartini. Kartini berkenalan dengan Hilda de Booy-Boissevain, istri ajudan Gubernur Jendral, pada suatu resepsi di Istana Bogor, suatu pertemuan yang sangat mengesankan kedua belah pihak. Ringkasnya, Kartini kemudian berkenalan dengan Estella Zeehandelaar, seorang wanita aktivis gerakan Sociaal Democratische Arbeiderspartij (SDAP). Wanita Belanda ini kemudian mengenalkan Kartini pada berbagai ide dan pemikiran yang modern, terutama mengenai perjuangan wanita dan sosialisme. Tokoh sosialisme H.H. van Kol dan penganjur Haluan Etika C.Th. van Deventer adalah orang-orang yang menampilkan Kartini sebagai pendekar wanita Indonesia. Lebih dari enam tahun setelah Kartini wafat pada umur 25 tahun, pada tahun 1911, Abendanon menerbitkan kumpulan surat-surat Kartini dengan judul Door Duisternis tot Lich, kemudian terbit juga edisi bahasa Inggrisnya dengan judul Letters of a Javaness Princess. Beberapa tahun kemudian, terbit terjemahan dalam bahasa Indonesia dengan judul Habis Gelap Terbitlah Terang: Boeah Pikiran (1922). Buku Kartini diterbitkan setelah dua tahun kejadian, Hilda de BooyBoissevain mengadakan prakarsa pengumpulan dana yang memungkinkan pembiayaan sejumlah sekolah di Jawa Tengah. Pada 27 Juni 1913, didirikan Komite Kartini Fonds, yang diketuai C.Th. van Deventer. Usaha pengumpulan dana ini lebih memperkenalkan nama Kartini, serta ide-idenya pada orang-orang di Belanda. Presiden Soekarno pada akhirnya mengeluarkan Keputusan Presiden Republik Indonesia No.108 Tahun 1964, tanggal 2 Mei 1964, yang menetapkan Kartini sebagai Pahlawan Kemerdekaan Nasional sekaligus menetapkan hari lahir Kartini, tanggal 21 April, untuk diperingati setiap tahun sebagai hari besar yang kemudian dikenal sebagai Hari Kartini. Perayaan Kartini Setiap tahun kita merayakan Hari Kartini khususnya perempuan, tepatnya setiap tanggal 21 April. Banyak kegiatan yang dilakukan kaum wanita, seperti kewajiban memakai pakaian adat dari berbagai daerah pelosok Indonesia. Perayaan Hari Kartini selalu saja diwarnai dengan lomba yang berbau perempuan. Mulai dari lomba memasak, pasang sanggul, merias wajah, peragaan busana dan sebagainya yang memang menunjukkan kekhasan seorang wanita. Hal ini malah bisa membatasi aktivitas dari seorang wanita? Karena hal itu hanya menunjukkan tentang pekerjaan sehari-hari seorang wanita. Hari Kartini seharusnya ditandai dengan aktivitas yang menunjukkan kesetaraan kaum wanita dan pria, bukannya perlombaan yang hanya mencirikan wanita saja. Para aktivis wanita juga sering meneriakkan tentang kesetaraan gender, tapi mereka sendiri belum mengetahui kemampuan dari para wanita sendiri apakah bisa disetarakan dengan kaum pria. Inti masalah dari kesetaraan gender sendiri ada pada diri wanita sendiri. Apa mereka mau berusaha keras agar bias sejajar dengan kaum pria? Para wanita sangat mudah menyerah jika mereka menemui sedikit saja masalah dan mereka juga pesimis atas usahanya sendiri. Sejalan dengan itu, Komnas Perempuan menjadikan hari emansipasi wanita tersebut sebagai momentum penegakan hak-hak perempuan. Hak itu adalah hak atas pendidikan, kemandirian ekonomi, hak untuk tidak disakiti dan sikap protes terhadap budaya atau adat-istiadat yang mendiskriminasi sosok perempuan-perempuan di bangsa Indonesia ini. Cita-cita Kartini akan sulit terwujud sepanjang kartini-kartini Indonesia saat ini masih mengalami berbagai bentuk kekerasan, baik kekerasan fisik, psikis, ekonomi dan kekerasan seksual. Emansipasi Wanita Pemikiran mengenai emansipasi wanita ini, masih memunculkan banyak kontroversi karena banyak wanita yang belum terlalu paham mengenai makna emansipasi wanita sebenarnya tanpa harus meninggalkan kewajibannya sebagai seorang wanita. Emansipasi yang terkadang salah kaprah, ingin mempunyai hak yang sama dengan lelaki disemua bidang sehingga terkadang besar peran seorang ibu menjadi terabaikan. Wanita menjadi telaga kasih sayang, mata air motivasi, kuas yang akan melukis watak dan akhlak sang anak. Wanita sekarang pasti bisa menjadi apa saja yang dicita-citakannya menjadi wanita karir sukses, mempunyai posisi penting, bergelar tinggi, menjalankan semua pekerjaan yang dahulu didominasi laki-laki. Ketika seorang wanita harus mengurangi banyak perannya sebagai ibu dalam pembentukan anaknya dalam pencapaian untuk semua kesuksesan itu, perempuan itu telah menghilangkan sebagian nalurinya, karena naluri perempuan adalah menjadi seorang ibu yang baik bagi anak-anaknya. Wanita tidak salah memiliki pendidikan yang tinggi dan memiliki aktivitas bekerja diluar, namun kaum wanita juga tidak boleh lupa jika kaum wanita memiliki tanggung jawab sebagai ibu rumah tangga yang harus wanita kerjakan. Harapan Kedepan Saya lebih setuju jika kita tidak merayakan hari kartini saja untuk mengenang sosok pahlawan wanita. Saya berpendapat kalau bangsa kita memiliki hari khusus bagi pejuang wanita Indonesia selain hari ibu untuk menghargai sosok wanita. Mengingat banyaknya sosok pejuang-pejuang wanita Indonesia yang telah membela Tanah Air kita. Sosok Kartini dibalik semua itu saya tetap menghargai sosoknya yang telah memperjuangkan sosok wanita di Indonesia melalui pemikirannya mengenai emansipasi wanita. Kartini yang rela memberikan jiwa raganya untuk para wanita, dan kartini yang mampu berpikir cedas ditengah keterpurukan yang dialaminya. Kecerdasannya mampu menguasai seni dan ilmu pengetahuan yang luar biasa bagi wanita Jawa di zaman itu. Semoga Kartini-Kartini pada zaman ini bisa berpikir lebih maju dan lebih cerdas lagi tanpa menyampingkan posisi dan tanggung jawabnya sebagai seorang wanita.

Wabup DS Serahkan SPPT-DHKP PBB TA 2013 Kepada 22 Camat LUBUK PAKAM, -BN Wakil Bupati Deli Serdang H Zainuddin Mars menyerahkan Surat Pemberitahuan Pajak Terhutang dan Daftar Himpunan Ketetapan Pajak (SPPT-DHKP) Pajak Bumi dan Bangunan (PBB) Pedesaan dan Perkotaan Tahun Anggaran (TA) 2013 Kabupaten Deli Serdang sebesar Rp 155 miliar lebih kepada 22 Camat se-Kabupaten Deli Serdang di Balairung Pemkab Deliserdang di Lubuk Pakam, Senin (8/4). Penyerahan SPPT-DHKP PBB TA 2013 dihadiri Kepala Dinas Pengelola Keuangan Daerah (PKD) Drs H Hasbi Budiman, mewakili Kepala BPN Deli Serdang, BRI Cabang Lubuk Pakam, Kantor Pos serta Camat se Deliserdang bersama Kepala Desa dan Lurah serta sejumlah undangan lainnya. Wabup H Zainuddin Mars dalam arahan menekankan agar camat jangan hanya duduk dibelakang meja saja.Tapi lakukan berbagai terobosan bersama pihak terkait untuk menjadikan tugas sebagai bagian terpenting yang harus diselesaikan mengingat penerimaan dari sektor pajak bumi dan bangunan (PBB) sudah menjadi bagian dari pajak daerah yang dimanfaatkan bagi kepentingan masyarakat. Penyampaian SPPT-DHKP

PBB Pedesaan dan Perkotaan merupakan tugas rutin yang harus dilaksanakan setiap tahunnya.Namun pada pelaksanaan tahun ini memiliki makna khusus karena dilakukan bertepatan pada tahun kedua masa peralihan pengelolaannya dari pemerintah pusat ke daerah sebagai upaya menghimpun dana pembangunan yang berasal dari masyarakat yaitu PBB pedesaan dan perkotaan, kata Wabup. Wabup menjelaskan untuk Tahun 2013 penerimaan PBB sektor pedesaan dan perkotaan untuk daerah Kabupaten Deliserdang mengalami kenaikan dari Rp 130 miliar lebih pada tahun 2012 menjadi Rp 155 miliar lebih pada tahun 2013 atau naik lebih kurang 20 persen.Adanya kenaikan ini menuntut kita untuk bekerja keras dan sungguh-sungguh bagi memberhasilan pencapaiannya seiring diberlakukannya UU nomor 28 Tahun 2009 tentang pajak daerah dan retribusi daerah. Karenanya untuk mencapai target Tahun Anggaran 2013, para Camat hendaknya lebih pro aktif dalam menanggulangi berbagai permasalahan yang ditemui di lapangan.Salah satu yang harus dilakukan camat adalah terlaksananya intensifikasi dan eksentifikasi

pemasukan PBB dengan sebaikbaiknya melalui pengaktifan tim intesifikasi kecamatan, sebaut Wabup. Pada kesempatan itu, Wabup kepada seluruh camat mengingatkan bahwa tahun 2013 benar-benar dapat dijadikan sebagai tahun kebangkitan pembangunan di Kabupaten Deliserdang.Karena tahun ini (2013red) merupakan tahun terakhir masa kepemimpinan Bupati-Wakil Bu-

Pemilihan Kepala Desa Berjalan Aman LIMA PULUH, BN Sosok yang satu ini cukup dikenal di kalangan masyarakat. Robinson seorang wiraswasta kecilkecilan merasa terpanggil untuk membangun desanya dengan mencalonkan diri menjadi kepala desa Sumber rejo Sidodadi kec. Lima puluh. Akhirnya niat baik Robinson kesampaian juga dengan mengungguli lawa-lawannya dalam pemilihan kepala desa baru-baru ini.Robinson yang mendapat urutan 3 berhasil mengungguli calon no 1. Jumar , No 2. Muliono, ,No 4. Suprapto, Dan No 5. Isyah. Pertarungan calon kepala desa diraih oleh Robinson no urut 3 mendapat 285 suara, sedangkan ISYAh no urut 5 mendapat 221 suara disusul Muliono no urut 2 dengan

suara 220 suara, no urut 1 Jumar , Raih 95 Suara, Dan Suprapto 73 suara. "Warga merasa bahagia dengan kemenangan Robinson dan berharap kepala desa yang baru ini dapat berpeeran aktif dalam mengemban tugasnya di tengah-tengah masyarakat", ujar salah seorang warga. Selanjutnya kepala desa terpilih akan menunggu pelantikan yang dilakukan Bupati Batubara dalam kurun waktu yang tak lama lagi.. Pilkades Mekar Baru Sementara itu Suwono terpilih menjadi Kepala Desa Mekar Baru periode 2013/2014. Suwono yang memiliki no urut 2 akhirnya mengungguli kadidat calon kepala desa lainnya seperti no 1. Misli 3. Syaripuddin 4. Pitria Ningsih 5. Syawaluddin Talawih.

Dari hasil pantauan awak koran ini Sowono mengungguli kandidat lainnya dengan jumlah suara SUWONO mendapat 437 suara, SYARIPUDDIN ,alias kakek no Urut 3 dengan suara 400, MISLI no urut 1 405 – PITRIA NINGSIH no Urut 4, mendapat 175 suara – SYAWALUDDIN no urut 5 mendapat kan 30 suara jumlah DPR 1954, yang hadir 1452, Sah 1447 – batal 5. Pemilihan calon kepala desa dihadiri camat Talawi, Abdol Latif Luhtfi Panjaitan S.sos, TNI/ POLRI, SATPOL PP / BPMPD, anggota DPR Kabupaten Batu Bara. Sahrial Ganci dari Fraksi Demokrat. Pelaksanaan pemilihan kepala desa di kec Limapuluh,Batubara berjalan dalan kondisi aman sehingga proses demokrasi dapatb terlaksana.(YS)

Anggota DPRD Sumut Kunjungi Kab Batubara BATUBARA, BN Penduduk Desa Sei.Balei yang mayoritas penduduknya bekerja sebagai petani merupakan salah satu desa penghasil lumbung beras yang terbesar di Kab Batu-

bara. Hal itu dikatakan Anggota DPRD Sumut Drs,H.Bustami saat mengadakan kunjungan reses di Dusun VI Desa Sei.Balai Kec Sei Balei,Kabupaten Batubara.

Kec Medang Deras Juara Umum MTQ dan Festival Nasyid BATUBARA, BN Kecamatan Medang Deras Pagurawan keluar sebagai juara umum MTQ 6 Kab. Batubara yang dilaksanakan di Tanjung Tiram dan ditutup sekdakab T.Erwin SE.Juara umum ke II diraih Kecamatan Talawi dan Kecamatan Lima Puluh meraih juara umum ke III. Bupati Batubara OK Arya Zulkrnain SH.MM melalui sekdakab T.Erwin SE mengatakan pelaksanakan MTQ dan Festival nasyid ke 6 telah berjalan dengan baik, saya ucapkan selamat kepada

para pemenang dan kepada para peserta yang belum berhasil meraih predikat pemenang jangan kecil hati. Jadikanlah kegagalan hari ini merupakan keberhasilan yang tertunda dan dijadikan cambuk sebagai motivasi untuk dapat meraih kesuksesan dimasa yang akan datang. Terima kasih kepada bapak/ibu dewan hakim dan juri yang dengan tekun dan teliti telah berhasil menetukan dan memilih para pemenang masing-masing cabang MTQ dan festival nasyid. (fer)

Menurut Bustami desa yang penduduknya hanya mengandalkan hasil pertanian,harus didukung dengan sarana infrastruktur jalan yang baik karena jelas akan mempermudah petani membawa hasil paninnya untuk dijual ke Kota. Ditambakannya dengan infrastruktur jalan yang baik sudah tentu perekomian menjadi lancar serta dapat meningkatkan taraf kesejahteraan kehidupan masyarakat, tandasnya. Sementara itu Sukardi,tokoh pemuda Desa Sei.Balai yang juga sebagai aktifis kepada wartawan diruang kerjanya mengatakan,"sangat mendukung kinerja anggota DPRD Sumut H.Bustami yang meluangkan waktunya untuk terjun langsung ke Desa,"karena indikasinya jarang sekali wakil rakyat yang sudah menduduki jabatan memikirkan keadaan rakyat kecil yang kehidupannya serba kekurangan, jelasnya.(fer)

pati terpilih 2009-2014 dan tahun kedua Pemkab Deliserdang mengelola sendiri penerimaan PBB pedesaan dan perkotaan. Sebelumnya Sekretaris Dinas PKD Drs H Suherman dalam laporan menjelaskan sebagai upaya untuk merealisasikan penerimaan PBB Tahun 2013 dengan target Rp 155 miliar lebih telah dilakukan beberapa kegiatan seperti pemutakhiran

data objek PBB pedesaan dan perkotaan bekerjasama dengan dinas/instansi dan pihak terkait lainnya dalam penilaian objek PBB dan penagihan tunggakan pajak. Memonitor penyampaian SPPT-PBB kepada seluruh wajib pajak.Camat membuat sususnan tim intensifikasi kecamatan dalam penyampaian SPPT-PBB dan merealisasikan sesuai dengan target.(ROMI)

Kab Batubara Tuan Rumah Gladi Posko Tingkat Provinsi Sumut BATUBARA, BN Suatu kepercayaan Kabupaten Batubara dipercaya menjadi tuan rumah gladi Posko Tingkat Provinsi Sumatera Utara Tahun 2013 sekaligus membentuk Forum Penanggulangan Resiko Bencana yang melibatkan dari berbagai unsur terdiri tokoh adat/ masyarakat, pemuda dan pelajar. Hal dikatakan Bupati Kab Batubara H.OK Arya Zulkarnain SH,MM dengan Kepala Badan Penanggulangan Bencana Daerah (BPBD) Provsu, DR Asrin Nasution didampingi Kepala BPBD Batubara Achmadan Chair S.Sos MAP,beserta Kepala Diskanla, Ir Rinaldi dan Staf. OK menambakan agar Badan Penanggulan Bencana Daerah (BPBD) dan Dinas Perikanan dan Kelautan Kab Batubara diharapkan bersinergi dengan baik untuk mensosialisasikan Ranperda mengenaai peraturan masalah tambak apung karena salah satu program Pemkab Batubara adalah mengupayakan meningkatkan pendapatan masyarakat daerah pesisir,jelasnya. Selanjutnya OK mengatakan untuk mewujudkan Kab Batubara yang sejahtera dan Berjaya,harapannya kedepan dengan pelaksanaan Gladi Posko Sumut 2013,nantinya agar Kepala BPBD, DR Asrin Nasution dapat menfasilitasi segala sesuatu yang diperlukan termasuk dana yang dianggarkan melalui APBN untuk dikucurkan di Pemkab Batubara.(fer)

Program Prolegda Merupakan Instrumen Peraturan Daerah BATUBARA, BN Program legislasi daerah (Prolegda) merupakan instrumen perencanaan program pembentukan peraturan daerah yang disusun secara berencana dalam waktu satu tahun berdasarkan skala prioritas. Tujuan dilaksanakannya Prolegda agar PERDA Kab. Batubara dapat di lembar daerahkan tepat waktu, sistematis dan efesien sebagai wujud kinerja Pemerintah daerah Kabupaten Batubara, Hal ini disampaikan Bupati Batubara OK Arya Zulkarnain SH,MM melalui sekdakab T.Erwin SE pada apel gabungan di halaman Kantor Bupati Batubara. Saudara kepala SKPD se- Kab .Batubara yang akan mengajukan Ranperda untuk tahun 2014 agar mengajukannya paling lambat bulan juni 2013 melalui bagian Hukum setdakab Batubara untuk dimasukan ke dalam Prolegda 2014. Ranperda dapat diajukan diluar Prolegda menurut kepetingan dan dalam keadaan tertentu sesuai Undang-Undang 2011 Tentang pembentukan peraturan perundang-undangan,jelasnya.(fer)

Budayakan Musyawarah dan Gotong Royong Dalam Pengelolaan Usaha Tani

Wabup Sergai Ir. H. Soekirman didampingi Ketua DPC GOPTKI Ny. Marliah Soekirman, Kepala BP2KP Sergai Setiyarno SP, Kabag Humas Dra Indah Dwi Kumala dan Camat Perbaungan Drs. Akmal menggunting pita sebagai pertanda diresmikannya Saung Tani dan dimulainya masa turun tanam tahun 2013 Gapoktan Melati Jaya Desa Melati II Kecamatan Perbaungan, Jumat (5/4).

BUDAYA bermusyawarah dan gotong royong harus terus dikembangkan dalam kehidupan masyarakat khususnya dalam merencanakan, mengidentifikasi masalah-masalah pertanian serta mengembangkan usaha-usaha

pengelolaan usaha tani dan sumber daya pendukungnya. Kelompok tani dengan bantuan tenaga penyuluh pertanian secara kreatif dapat menjajaki tanaman budidaya yang memiliki nilai jual tinggi seperti bawang merah dan

bawang putih untuk dapat dikembangkan di daerah ini. Dengan demikian diharapkan akan muncul ide-ide dan kreativitas baru dalam mengembangkan sektor pertanian. Hal ini diungkapkan Wakil Bupati Serdang Bedagai (Wabup Sergai) Ir. H. Soekirman dalam sambutan dan arahannya pada acara peresmian Saung Tani dan masa turun tanam tahun 2013 Gapoktan Melati Jaya di Dusun Tontong II Desa Melati II Kecamatan Perbaungan, Jumat (5/4). Acara peresmian saung tani di Desa Melati II ini ditandai dengan pengguntingan pita oleh Wabup Ir. H. Soekirman didampingi Ketua DPC GOPTKI Ny. Marliah Soekirman, Kepala BP2KP Sergai Setiyarno SP, Kabag Humas Dra Indah Dwi Kumala dan Camat Perbaungan Drs. Akmal. Lebih lanjut Wabup Soekirman minta kepada para anggota Gapoktan Melati Jaya secara khusus agar saung tani yang dibangun dari dana APBD Provinsi Sumut tahun 2012 ini dapat diberdayakan secara optimal. Digunakan sebagai

tempat berkumpul, berembug dan bermusyawarah seluruh anggota kelompok tani dalam merencanakan, menyusun dan membahas permasalahan serta mencari solusi yang tepat guna mencapai tujuan peningkatan pendapatan dan kesejahteraan petani. Selain itu masyarakat diminta agar memelihara bangunan saung tani ini sehingga dapat dimanfaatkan secara maksimal dengan menjaga kebersihannya serta menggunakannya sebagaimana fungsi dan tujuannya, harap Wabup Soekirman. Kepada kepala desa diinstruksikan agar mencari para petani-petani pintar yang sudah berinovasi dan berhasil mengembangkan suatu budidaya agar menjadi penyuluh swadaya sekaligus motivator bagi para petani lainnya. Sebelumnya Ketua Gapoktan Melati Jaya Mustariono mengucapkan terima kasih kepada Pemkab Sergai khususnya pemerintah desa yang mengizinkan pembangunan saung di atas tanah desa. Semoga keberadaan saung ini akan

menunjang kemajuan pertanian di desa ini, harapnya. Kades Melati II Supardi dalam kesempatan ini mengucapkan terimakasih atas pembangunan irigasi yang telah dilaksanakan di tahun 2012 untuk 4 dusun di desa ini. Supardi berharap pada tahun 2013 ini Pemkab Sergai akan terus melanjutkan pembangunan infrastruktur pertanian di desa ini. Jelang Pemilu Legislatif 2014 Menyangkut masalah agenda politik yang sedang berjalan saat ini menjelang pelaksanaan pemilu legislatif tahun 2014, Wabup Ir. H. Soekirman mengingatkan kepada seluruh warga masyarakat di tanah bertuah negeri bahwa akan banyak para calon legislatif baik dari daerah Sergai sendiri maupun dari luar Sergai yang akan berkunjung ke daerah ini. Untuk itu diminta kepada warga desa agar menyambut dengan baik serta mengenali para calon-calon untuk kemudian dapat menentukan para wakil-wakil rakyat yang layak untuk duduk di kursi legislatif pada periode mendatang.(Ibnu)



15 - 22 APRIL 2013 | EDISI 355 | THN KE-VIII

PENGUMUMAN Nomor :04/Peng-300.5/XI/2012 Kepala Kantor Pertanahan Kota Padangsidimpuan memberitahukan kepada khalayak ramai: Nama : RAHMAD SALEH HARAHAP, Tanggal Lahir : 04 Desember 1978, Alamat : Jalan Sisingamangaraja No:140 C, Kota Padangsidimpuan, Sumatera Utara yang mengajukan surat permohonan tanggal 19 Maret 2012. Hak Milik atas sebidang tanah di: Kelurahan Losung Batu, Kec Padangsidimpuan Utara, Luas 600 M2, Kota Padangsidimpuan, Peruntukannya Tapak Bangunan Rumah Tinggal. BATAS-BATASNYA, Utara : dengan Usman Siregar, Timur : Usman Siregar, Selatan : Jalan BPDSU, Barat : Usman Siregar. Kepala Kantor Pertanahan Kota Padangsidimpuan,

Verifikasi Ormas dan LSM Penerima Dana Pemda PANGKALAN KERINCI - BN Badan Kesatuan Bangsa dan Politik (Kesbangpol) Kabupaten Pelalawan, akan mendata ulang Lembaga Swadaya Masyarakat (LSM) dan Organisasi Massa (Ormas). Pendataan dilakukan guna memudahkan pembinaan dan pengawasan. Kepala Badan Kesbangpol Pelalawan, Abdul Karim, kepada wartawan, Kamis (11/4), menjelaskan, telah membentuk tim memvalidasi data Ormas dan LSM. Tim

terdiri dari 13 orang dibagi menjadi dua. Mereka menjalankan tugas dan fungsinya sesuai dengan kesepakatan dalam rapat pembentukan. Dalam pendataan kembali ini, Badan Kesbangpol turut melibatkan instansi vertikal di Pelalawan. "Kemarin kita sudah rapat dan membuat kesepakatan ini. Intelijen Polres dan Kejaksaan turut kita libatkan, agar pekerjaannya lebih mudah. Pembentukan tim ini sesuai dengan Perbub yang baru,"

Abdul Karim. Mantan Kepala Badan Kepegawaian Daerah (BKD) menilai, selama ini tidak ada verifikasi dan pengecekan silang jumlah Ormas dan LSM sebagai penerima bantuan hibah yang dikucurkan dari Pemerintah Kabupaten (Pemkab). Penerimaan dana bantuan hanya dari Sekretariat Pemkab, tanpa memverifikasi kepada Kesbanglinmaspol terkait penertiban administrasi dan persyaratan

lainnya. Abdul Karim mengatakan, besaran dana hibah diterima setiap Ormas maupun LSM berbeda. Selain itu, ada ormas ataupun LSM ngotot soal jumlah bantuan. Sehingga perlu diverifikasi tim dari Kesbangpol bekerja sama dengan Sekretariat Pemkab. Berdasarkan data lama, saat ini ada 68 ormas dan LSM terdaftar di Kesbangpol Pelalawan, sepanjang 2010-2012. Namun separuhnya sudah habis masa berlakunya. (Ringo)


Jangan Sebut Dewan Kalau Tidak Berpengaruh

Fachrul Husin Nasution SH Mkn, NIP: 19711015 199303 1 002.

Dilaporkan ke Polresta Pekanbaru

Oknum Jaksa Pelalawan Diduga Rampas Mobil dan Menculik PANGKALAN KERINCI-BN Seorang tahanan kasus pelanggaran Undang-undang Kehutanan Kejaksaan Negeri Pangkalan Kerinci melarikan diri saat dibantarkan. Tahanan bernama Berlon Sihombing kabur saat dirawat di RS Santa Maria Pekanbaru, belum lama ini Kaburnya Berlin menjadi awal malapetaka bagi keluarganya. Jaksa Banu Laksamana bersama beberapa jaksa dari Kejari Pangkalan Kerinci lantas melakukan pemburuan. Namun, cara yang dilakukan dianggap brutal dan jauh dari prosedur resmi. Ia diduga telah melakukan perampasan mobil dan menculik Sihol Petrus Sihombing, anak Berlin. Atas tindakannya tersebut, Banu Cs telah dilaporkan keluarga korban pada Polresta Pekanbaru pada 2 April lalu. "Laporan sudah kami sampaikan ke Polresta Pekanbaru dan kami berharap dapat segera ditindak-lanjuti," ujar Victor Simamora kuasa hukum korban bersama rekannya Martua Simanulang di Pangkalan Kerinci, Selasa (9/4/13). Kepada wartawan, Victor lantas menuturkan kronologis perampasan dan penculikkan yang diduga dilakukan Jaksa Banu bersama sejumlah rekannya. Pada Kamis, 29 Maret atau setelah Berlin diketahui lari dari RS Santa Maria, Jaksa Banu bersama beberapa temannya menghentikan mobil Suzuki Swift BM 101 SH di Jalan Seokarno Hatta, di depan Pasar Pagi Arengka, sekitar pukul 21.00 WIB. Pirman Mangapul Sihombing, adik Berlin yang tengah mengendarai mobil tersebut dipukuli dan dipaksa keluar dari dalam mobil. Setelah itu, Banu bersama rekannya membawa mobil tersebut, berikut Pirman untuk mencari anak Berlin yang bernama Sihol Petrus Sehombing. Pemuda berusia 22 tahun tersebut ditemukan di salah satu Warnet dekat kampusnya di Universitas Islam Riau (UIR). Jaksa Banu dan rekannya lantas memaksa Pirman dan Sihol untuk ikut mereka ke Kandis. Mencari Berlin ke rumah adik iparnya, Jakintur Siagian. Sampai di sana, ternyata Berlin tidak ditemukan. Jaksa Banu lantas membagi dua kelompok. Satu kelompok kembali ke Pekanbaru dengan membawa serta Pirman dan Jakintur. Keduanya diserahkan ke Polresta Pekanbaru. Sementara satu tim lagi, termasuk Jaksa Banu, bergerak ke arah Sumatera Utara, melanjutkan pencarian Berlin. Sihol turut dibawa serta. "Sejak itu, keluarga kehilangan kontak kepada Sihol. Kami tidak tahu bagaimana nasib Sihol sekarang ini," tutur Victor. Sementara itu Kepala Kejari Pangkalan Kerinci Edy Guswar justru menolak memberikan penjelasan terkait kasus tersebut. Sejumlah wartawan, termasuk riauterkinicom yang mendatangi kantornya tidak diberi waktu bertemu. (Ringo)

Sutias Ajak Maksimalkan Potensi Majelis Taklim MEDAN, BN Sutias Handayani Gatot Pujo Nugroho mengajak seluruh anggota majelis taklim untuk memaksimalkan potensinya. Majelis taklim selain dikenal fleksibel dalam masalah waktu juga fleksibel dalam masalah tempat yaitu bisa dilakukan di Masjid, di Kantor, di Rumah bahkan di Alam terbuka sekalipun. “ Ayo kita maksinalkan potensi yang ada untuk sama memajukan bangsa dan negara yang sama kita cintai ini”, demikian dikatakannya ketika menjadi Nara Sumber Seminar Majelis Ulama Indonesia Kota Medan Jl. Medan Sabtu(13/4). Hadir Sekretaris Daerah Kota Medan Ir.Syaiful Bahri Lubis, Ketua MUI Medan Prof. DR.H.M.Hatta, Dewi Budiati Teruna Jasa Said selaku nara sumber serta puluhan Ibu Ketua Majelis Taklim se Kota Medan lainnya. Lebih Jauh Sutias menjelaskan bahwa Majelis Taklim adalah suatu kelompok masyarakat yang memiliki potensi besar membantu kemajuan bangsa dan negara terutama dalam pendidikan keagamaan. Selain itu majelis ini dikenal sangat fleksibel baik itu waktu pelaksanaan, tempat dan materinya. Dengan kefleksibelan itulah menjadikan majelis Taklim cepat berkembang ditengah masyarakat. Sutias menambahkan bahwa Majelis Taklim itu sendiri unik, di arab sendiri istilah Majelis Taklim itu tidak dikenal namun gerakannya sudah ada sejak Nabi Muhammad menyebarkan Islam dimulai di rumah Arqam bin Abi Arqam. Menyadari potensi yang ada Sutias menghimbau kepada seluruh anggota untuk menjalin rasa persatuan antara kelompok majelis taklim agar memiliki gerakan yang lebih besar lagi.

Kembali dijelaskannya bahwa peran dan fungsi majelis taklim itu sedikitnya ada 9 yaitu Tempat pengajaran nilai Islam, Wahana Kaderisasi, Wahana Konseling, Wahana Skill Jamaah, Media Sosial , Sarana Rekreasi Ruhani, Media Komunikasi , Pengembangan Budaya islam dan sebagai Lembaga Kontrol Sosial. Menutup sambutannya Sutias menghimbau agar kegiatan majelis taklim tidak sebatas pengajian biasa tapi lebih kepada 9 fungsi yang dijelaskannya. Lain lagi Dewi Budiati istri seorang Pemilik Surat Kabar terkenal itu membawakan materi tentang Kepedulian LIngkungan. Dalam paparannya Budiati menjelaskan Potensi majelis taklim perempuan sangat besar dalam kaitannya memelihara kebersihan lingkungan. Dengan alat peraga yang dibawanya dia langsung praktekkan bagaimana mengolah sampah jadi bahan berguna dan bernilai ekonomis. Peserta terlihat antusias mengikuti rangkaian acara dan berharap acara yang sama dapat digelar dimasa yang akan datang. Peserta yang umumnya ketua majelis taklim langsung mengundang Sutias dan Budiati sekaligus Ketua MU*I Medan untuk dapat membuat acara serupa didaerahnya masing masing. Menyahuti permintaan peserta Sutias berjanji akan mengadakan acara serupa dimasing masing daerah Majelis Taklim yang hadir sekaligus langsung mempraktekkan Pengolahan sampah yang diperagakan Budiati lebih jelas lagi. Sebgai rasa terimaksihnya H.M.Hatta menyerahkan Plakat terimakasih kepada dua Nara Sumber Sutias Handayani dan Budiati yang menurut mereka sangat aktif dalam gerakan perempuan dan lingkungan. (Ndo)

PANGKALAN KERINCI -BN Anggota Dewan Perwakilan Rakyat Daerah (DPRD) Pelalawan, meradang dengan tudingan Kepala Badan Penanggulangan Bencana Daerah (BPBD), Raja Alkap, Senin (8/4) lalu. Raja Alkap menjelaskan, jika 20 personel pemadam kebakaran (Damkar) yang baru di BPBD merupakan titipan pejabat dan anggota Dewan. Wakil Ketua Komisi A DPRD Pelalawan, Markarius Anwar, Selasa baru baru ini tersinggung dengan pernyataan Raja Alkap dalam berita di beberapa media yang terbit kemarin. Ia menilai tuduhan itu tanpa dasar, apabila membawa lembaga legislatif secara kolektif. Tidak ada permainan titipmenitip dalam perekrutan tersebut. Makarius mempersilakan untuk mengecek langsung apakah ada di antara 20 anggota Damkar baru itu, memiliki hubungan keluarga ataupun sanak saudara dari anggota DPRD. "Ini pencemaran nama lembaga DPRD, jangan sebut-sebut Dewan. Tapi jika ada oknum Dewan yang menitipkan anaknya atau sanak saudaranya, tolong namanya disebutkan. Siapa oknum anggota Dewan itu, jangan mengambang seperti ini. Kita semua jadi termasuk di dalamnya," kata Markarius dengan nada kesal di ruang kerjanya. Politisi PKS ini menjelaskan, secara logika jika itu titipan Dewan, pastinya ada 30 personel Damkar. Karena, anggota DPRD Pelalawan 30 orang. Raja Alkap, pintanya, agar membeberkan ke media oknum Dewan yang bermain dalam penerimaan tenaga honor BPBD ini. Demikian juga dengan pejabat Pemerintah Kabupatan (Pemkab) Pelalawan dimaksud, harus disampaikan. Sehingga jelas kongkalikong yang terjadi pada perekrutan itu. Ketua Badan Kehormatan (BK) DPRD Pelalawan, Nazarudin Arnazh menyayangkan, adanya aksi titip-menitip perihal penerimaan anggota Damkar di BPBD, apabila tuduhan Raja Alkap ada benarnya. Jika pun betul, tentu yang bermain dalam hal ini oknumoknum membawa lembaga Dewan. Secara etika di DPRD, campur tangan oknum anggota DPRD mengintervensi penerimaan pegawai dilarang. "Mohon disebutkan siapa orang atau oknumnya. Jika betul dan faktanya sahih, kita akan proses di Badan Kehormatan. Itu jelas-jelas tidak benar secara etika," jelas politisi PAN ini. Kepala BPBD, Raja Alkap saat dikonfirmasi, memberikan jawaban terbalik dari sebelumnya. Ia meminta awak media untuk tidak membesar-besarkan berita kongkalikong penerimaan anggota Damkar dikaitkan dengan anggota DPRD. Padahal, sebelumnya ia terang-terangan menyatakan ada titipan pejabat dan anggota Dewan. Bahkan, dari 20 personel Damkar yang baru, dua di antaranya mengundurkan diri saat latihan, karena tidak tahan secara fisik. Satu di antara mundur itu merupakan anak kandung oknum anggota DPRD. Alhasil, digantikan keponakan oknum wakil rakyat tersebut. Raja Alkap menjelaskan, belum ada oknum penyambung lidah rakyat menghubungi dirinya untuk mengkonfirmasi pernyataannya di media. Pasalnya, nomor ponselnya yang lama sudah tidak aktif lagi dan saat ini menggunakan nomor baru. (Ringo)

Zainuddin Mars Resmi Menutup MTQN ke 46 dan FSN ke 35

KECAMATAN Hamparan Perak keluar sebagai juara umum Musabaqoh Tilawatil Quran Nasional (MTQN) Ke -46 dan Festival Seni Nasyid (FSN) ke -35 tingkat Kabupaten Deli Serdang tahun 2013 yang berlangsung empat hari di lapangan SMA Negeri 1 Tanjung Morawa, Sabtu (6/4) Malam. Kecamatan Hamparan Perak berhasil menduduki juara umum dengan nilai 68 disusul Kecamatan Percut Seituan nilai 62, Tanjung Morawa nilai 41,Sunggal nilai 18 dan Kecamatan Lubuk Pakam dengan nilai 15, sedangkan juara FSN Putra Syaf An-Nur Kecamatan Hamparan Perak dan Putri Group AlCMY K

Munawwaroh Kecamatan Tanjung Morawa. Penutupan MTQ ke-46 dan FSN ke 35 Kabupaten Deli Serdang, Sabtu malam ( 6/4) dihadiri puluhan ribu pengunjung ditutup secara resmi Wakil Bupati Deli Serdang H Zainuddin Mars, ditandai dengan pemukulan beduk dan mengumandangkan Ayat Suci Alqur’an, penurunan bendera serta penyerahan hadiah kepada Juara Umum dan pemenang lainnya, dihadiri , Unsur Muspida Plus, Wakil Ketua TP PKK Ny Hj Asdiana Zainuddin, Ka Kemenag DS Drs H Dur Brutu MA,Asisten I H Safrullah S.Sos selaku Ketua Panitia,

Pimpinan SKPD,Pengurus FKUB, pimpinan BUMD, BUMN, Camat/ Ketua TP PKK Kecamatan se Kabupaten Deli Serdang ,Camat Tanjung Morawa Drs Zainal Abidin Hutagalung MAP beserta Muspika dan undangan lainnya. Wabup H Zainudddin Mars menyampaikan terimakasih yang tulus kepada panitia dan semua pihak khusnya Camat Tanjung Morawa, Muspika beserta masyarakatnya sebagai tuan rumah yang telah berpartisipasi mendukung pelaksanaan MTQ dan FSN dengan baik dan lancar, tentu kedepan harus dipertahankan dan dikembang tingkatkan.

Dikatakan kegiatan yang bersifat syiar Agama ini sangat bermanfaat dalam upaya menggali semangat api ke Islaman untuk menghadapi tantangan perubahan dampak dari derasnya arus globalisasi yang penuh tantangan melanda bangsa ini. Berkaitan dengan pelaksanaan ini , tugas kedepan yang terpenting adalah untuk meningkatkan minat para generasi muda gemar dan mampu membaca Al Quran dengan baik dan benar, hal ini sesuai dengan visi misi pembangunan Deli Serdang yaitu membangun bangsa yang religius dan sejahtera bersatu dalam kebhinnekaan , bahu-membahu bergandeng tangan demi kejayaan Kabupaten ini. Karenanya melalui kesemarakan dari pelaksanaan MTQ dan FSN ini, diharapakan akan tumbuh motivasi dan semangat untuk meningkatkan kemampuan umat, khususnya dalam membaca dan memahami isi kandungan Alqur’an melalui Lembaga Pengembangan Tilawatil Qur’an (LPTQ) untuk melahirkan Qori dan Qoriah yang handal. Wabup juga berharap kedepan agar disetiap rumah umat muslim akan berkumandang ayat-ayat suci Al-Quran pada setiap Maghrib secara terus menerus. Adapun pemenang untuk MTQN tingkat Kabupaten Deli Serdang diantaranya adalah Golongan ana-anak putra juara I Adenan Tumanggor ( Kecamatan Sunggal ).Golongan Putri Dewi

Afridayanti (Sunggal). Golongan Remaja Putra juara I Faisal Ridho Siregar (Lubuk Pakam).Remaja Putri Zakiyah Khairani (Hamparan Perak). Golongan Dewasa Putra Zulhaili (Hamparan Perak ) Dewasa Putri Mardiyah (Kematan Beringin), Golongan Tartil Qur’an putra juara I Zulkhairi Amri (Hamparan Perak) Tartil Qur’an Putri juara I Rizkiyatus Sa’adah (Percut Seituan ). Golongan Tunanetra Putra juara I Zainuddin (Tanjung Morawa) Tunanetra Putri Sugianti (tanjung Morawa) Selanjutnya Cabang Hifzil Qur’an 1 juz tilawah Putra juara I M. Fatihul Mubaroq (Hamparan Perak ) 1 juz tilawah putri Misbahul Zannah (Percut Sei Tuan). Hifzil Qur’an 5 Juz tilawah Putra juara I Muflihun Nazah (Percut Seituan) 5 Juz tilawanh Putri Siti Nurfah (Tanjung Morawa) Hifsil Qur’an 10 Juz Putra juara I M. Fadhil (Batang Kuis) 10 juz Putri Siti Maysarah (Hamparan Perak) Hifzil Qur’an 20 Juz Fazar Nirwana (Hamparan Perak) 20 Juz Putri Sri Afriany Eka Putri (Tanjung Morawa). Khusus Hifsil Qur’an 30 Juz Putra Juara I Dicky Subagio (Sunggal) Cabang Fahmil Qur’an juara I Kecamatan Percut Seituan. Syahril Qur’an juara I Kecamatan Tanjung Morawa. Cabang Hottil Qur’an tulisan buku (putra) juara I Abdul Hadi ( Kecamatan Hamparan Perak) putri juara I Nurul Arofah ( Tanjung

Morawa). Cabang Hottil Qur’an hiasan Mushaf Putra juara I Febi Rahmadi (Percut Seituan ) Mushaf Putri juara I Ulfa Lestari (Hamparan Perak). Hottil Qur’an Dekorasi Putra juara I A. Subhan (Hamparan Perak) Dekorasi Putri juara I Thin Fatimah ( Percut Sei Tuan). Untuk Festival Seni Nasyid ke 35 putra juara I Group Syaf An-nur Kecamatan hamparan Perak, Nasyid Putri juara I Group AlMunawwaroh Kecamatan Tanjung Morawa, sedangka Busana terbaik pada FSN ini terbaik Putra Kecamatan Percut Sei Tuan, busana terbaik putri Kecamatan Percut Sei Tuan, Solois terbaik Putra Kecamatan Hamparan Perak dan Solois terbaik putri Kecamatan Tanjung Morawa. Sedangkan untuk perlombaan Pawai ta’arruf juara I Kecamatan Tanjung Morawa menyusul Kecamatan Percut Situan dan Kecamatan Deli Tua diposisi ke tiga. untuk Stand Pameran Juara I Kecamatan Sunggal menyusul Kecamatan Beringin dan Kecamatan Lubuk Pakam. Menurut laporan Ketua Panitaia Asisten I Pemeritahan dan Kesra H Syafrullah SSos MAP menjelaskan pelaksanaan MTQ dan FSN kali ini cukup tertib dan meriah ditandai dengan tingginya minat pengunjung hadir di arena ini untuk menyaksikan berbagai kegiatan seperti mengunjungi pameran pembangunan yang digelar oleh 22 Kecamatan ( ROMI ). CMY K


koran bongkar news edisi 355 beredar di sumatera utara indonesia aceh riau membongkar kasus sampai tuntas media terpaercaya di sumut utara...

Read more
Read more
Similar to
Popular now
Just for you