Page 1

Harga Eceran Rp 3500,Luar Daerah + Ongkos Kirim

B

8-15 APRIL 2013| EDISI 354| THN KE-VIII

PENYAKIT TAHUNAN

Tak Bekerja Maksimal

MEDAN, BN PLN tak henti-hentinya dirundung musibah. Mulai dari pelanggan, wakil rakyat dan pengusaha ‘mencacimaki’ kinerja perusahaan BUMN itu. Tak pelak lagi, intinya PLN punya penyakit ‘menua’ terutama mesin pembangkit listriknya sendiri. Akhir September 2012 diketahui jumlah pelanggan mencapai 2.775.355 pelanggan. Sayangnya, walau terjadi penambahan pelanggan, PLN terus menerus menyatakan rugi. Belum lama ini, wakil rakyat angkat bicara soal kebobrokan perusahaan setrum ini. Salah satunya adalah H Ajib Shah. Tanpa basa

Bupati Atim Kecewa Kinerja Polhut

BACA BUPATI ATIM HAL..2

PLN KAMBUH LAGI

Sejak pertengahan Maret lalu, penyakit Perusahaan Listrik Negara (PLN) wilayah Sumut kambuh lagi. Anehnya, penyakit tahunan ini tak jua dapat disembuhkan. Tarif Dasar Listrik (TDL) naik, namun pelayanan PLN malah kian merosot.

DIREKTUR Lembaga Advokasi dan Perlindungan Konsumen (LAPK) Farid Wajdi mengatakan secara yuridis keputusan pemerintah menaikkan TDL dimaksudkan untuk menekan subsidi energi yang mencapai Rp300 triliun. Tindakan tersebut boleh dikata bagus untuk menghemat subsidi listrik yang menembus Rp90 triliun. Masalahnya, dari sisi PT PLN (Persero), sebagai perseroan tidak bekerja secara maksimal. “Kalau dievaluasi kinerja PLN tidak kunjung membaik. Bahkan cenderung terus memburuk. TDl harusnya dapat mengelakkan pemadaman listrik (byarpet) di masyarakat,” katanya. BACA TAK BEKERJA HAL..2

Aceh Timur,BN Bupati Aceh Timur, Hasballa Bin M Thaib sangat kecewa terhadap kinerja Polisi Kehutanan (Polhut). Sebab, masih maraknya pembalakan liar di kawasan hutan dalam wilayah Kabupaten Aceh Timur yang dilakukan oleh oknum-oknum yang tidak bertangung jawab. Terbukti, dengan turunnya orang nomor satu di Aceh Timur itu didampingi oleh Asisten I, Adlinsyah, S.sos. M.AP, Asisten II, Ichsan Ahyat, S.STP. M.AP, Kepala Badan Penangulangan Bencana Daerah, Ir Elfiandy, S.Pi, dan jajarannya meninjau langsung lokasi rencana pembangunan jalan di pedalaman Aceh Timur. Lokasi tersebut pembangunan jalan dimulai dari Dusun Bidari, Desa Rantau Panjang, Tampur Bor, Tampur Paloh, Kecamatan Simpang Jernih hingga perbatasan Kecamatan Birem Bayeun yang menggunakan dana percepatan pembangunan daerah tertinggal sepanjang kurang lebih 60 kilometer.

KANTOR REDAKSI Jl. Flamboyan Raya/Raharja No. 37 Medan Telp (061) 8213786, HP. 081375395392 - 08163134392 Fax (061) 8215552 Email:bongkarnews@gmail.com indrabongkarnews@gmail.com

basi lagi, Ketua Fraksi Golkar DPRD Sumut ini mendesak pimpinan DPRD segera membentuk Panitia Khusus (Pansus) listrik. “Saya rasa pembentukan pansus listrik ini sungguh mendesak. Supaya kita dapat mengetahui secara detail persoalan apa yang sebenarnya terjadi. Apalagi sekarang ini warga mengeluh seringnya PLN melakukan pemadaman bergilir,” kata Ajib Shah, kemarin. Dia juga mengingatkan pemerintah pusat maupun PT PLN, untuk tidak memancing kemarahan masyarakat Sumut, atas pelayanan kelistrikan yang begitu buruk dan telah berlangsung cukup lama. “Matinya listrik berim-

Tarif Angkot Medan Naik Rp 1.000 MEDAN, BN Tarif ongkos angkutan Kota Medan dipastikan naik menjadi Rp 3.800 untuk penumpang umum dari tarif yang lama Rp 2.800 dan Rp 2.500 untuk pelajar dan Mahasiswa dari tarif lama Rp 1.800 per estafet (1 estafet = 10 KM). Sebelumnya usulan tarif angkutan yang diajukan dari beberapa kali pertemuan, untuk tarif penumpang umum Rp 5000, sedangkan mahasiswa BACA TARIF ANGKOT HAL..2

bas pada perekonomian di Sumut. Sitem perekonomian di Sumut menjadi terganggu dan hal ini sangat merugikan masyarakat di daerah ini,” ujarnya. Bahkan Ajib Shah pun menyampaikan protes secara ekstrem terhadap PT PLN dengan mengajak seluruh masyarakat, untuk memboikot pembayaran rekening listrik, jika pemadaman dilakukan mendadak tanpa pemberitahuan lebih dahulu kepada masyarakat. "PT PLN telah kita ingatkan, jangan mainBACA PANSUS LISTRIK HAL..2

Bupati Tapsel Blusukan ke Daerah Terisolir TAPSEL,BN Bupati Tapsel H Syahrul M Pasaribu bersama sejumlah jajaran SKPD Tapsel mengunjungi daerah terisolir, seperti di Kecamatan Sipirok,Kecamatan Aek Bilah dan Kecamatan Saipar Dolok Hole. Dikatakan Bupati Tapsel H Syahrul M Pasaribu bahwa tour ke desa ini bukan hanya sebatas jalan-jalan, namun untuk mengevaluasi sekaligus perencanaan kegiatan pembangun 2013 di Tapanuli Selatan.

“Intinya, kita mengajak pimpinan SKPD agar dapat membuka mata hati, pikiran dan perasaan terhadap pakta dan kondisi daerah yang didahului sehingga SKPD dapat berkontribusi berperan serta positif memberikan program kegiatan sesuai tugas fungsi SKPD,” ungkapnya. Menurutnya, salah satu skala prioritas yang direncanakan Bupati Tapsel adalah BACA BUPATI TAPSEL HAL..2

Pemerintah Diminta Peka Nasib Korban Penggusuran PT. Arun LHOKSEUMAWE , BN Aksi penggusuran yang dilakukan PT. Arun NLG pada tahun 1974 silam menimpa 542 Kepala Keluarga (KK) masyarakat Blang Lancang dan Rancong, Kecamatan Blang Mangat, Kota Lhokseumawe. Gubernur Aceh dan Walikota Lhokseumawe kembali dituntut agar segera menyelesaikan permasalahan tersebut. Sebanyak 542 KK yang dimaksud itu, pernah digusur sebelum

pemasangan pipa resiving Gas Belawan – Aceh pada tahun 1974 silam oleh PT. Arun LNG. Masyarakat yang menjadi korban setelah dilakukan aksi penggusuran oleh PT. Arun NGL beberapa tahun silam itu hingga saat ini masih tinggal di kawasan Rancong secara tumpang tindih dan ada juga yang mencari tempat di daerah lain. “Kami meminta upaya pemerintah daerah untuk berpartisipasi membantu pembangunan atau relokasi pemukiman baru bagi

masyarakat Blang Lancang dan Rancong. Adapun usulan dan permintaan masyarakat untuk pemerintah dari sebelumnya tidak pernah dikabul,” kata Zubir, selaku sekretaris Misi Konsultasi Masyarakat Tergusur, kepada BN, kemarin. Dikatakan Pemerintah Aceh hingga saat ini belum juga memberi BACA PEMERINTAH HAL..2

Pengusaha Asal China Lirik Potensi Aceh Timur Kadin Komite China dan Kadin Aceh bersama Zhe Shang Investment Group dari Negeri tirai bambun serta pengusaha sukses kelahiran Aceh Timur T. Anwar Johan dan Abdullah Puteh beserta rombongan lainya melirik potensi Aceh Timur.

terimakasih kepada rombongan yang telah datang ke Aceh Timur. Ia mengatakan, potensi Aceh Timur sangat besar untuk peluang investasi, baik itu sektor pertanian, perikanan, ataupun pertambangan. Bupati juga memberi apresasi kepada pengusaha kelahiran Aceh Timur seperti T. Anwar Johan yang telah membawa rombongan dari Tiongkok ke Aceh Timur. "Untuk Membangun Aceh Timur ini Saya membutuhkan bantuan semua putra- putra Aceh Timur yang telah sukses di luar daerah, " ujar Bupati. Sementara itu kedatanagan rombongan Kadin Komite Tiongkok yang di koordintaor oleh Hasan Kosasih Wakil Sekjen Kadin Komite Tiongkok

LIPUTAN: MUSTAFA KEDATANGAN rombongan investor tersebut disambut langsung oleh Bupati Aceh Timur Hasballah H.M Thaib dan ketua Kadin Aceh H.Firmandes, beserta sejumlah kepala SKPK di Pendopo Bupati Idi Rayeuk, belum lama ini. Bupati dalam kata sambutanya mengucapkan website : www.bongkarnews.com

Bupati Aceh Timur, Hasballah Bin M. Thaib berfoto bersama dengan T. Anwar Djohan (kiri) dan Pengusaha asal China, Wu Jin Bin (kanan) setelah memberikan cinderamata kepada kedua pengusaha tersebut. (ist)

BACA PENGUSAHA ASAL HAL..2 Email: bongkarnews@gmail.com


8-15 APRIL 2013 | EDISI 354| THN KE-VIII

29 Perusahaan ‘Perang’ Tender Bus Kualanamu

MEDAN, BN Pendaftaran tender pengadaan transportasi bus dan taksi Kualanamu akan dimulai pada 8 April hingga 12 April mendatang. Setidaknya sudah 29 perusahaan yang sudah mengambil dokumen dan telah menyatakan minat. "Mereka mulai mengambil draf dokumen lelang baik melalui website maupun datang ke kantor langsung," kata Kabid Angkutan Darat Dishub Sumut Darwin, belum lama ini.

Di antara perusahaan itu ada PT ALS, PT Damri, Puskopau, PT Ekspres Limo Nusantara, Legutrans Ekspres, Kostar, PT Sentosa, Sampri, PT Prima Jasa, PT Bluebird, PT Bintang Utara, PO Karona dan PT Sutra. Sebagian besar perusahaan melayani angkutan umum jenis bus dan beberapa perusahaan jasa angkutan umum taksi. Menurutnya, pelayanan transportasi angkutan pemadu moda Kualanamu yang ditenderkan

pihaknya bertaraf internasional dan Quality Lisence (kualitas). Jadi, meskipun perusahaan angkutan tersebut jasa angkutan nasional dan terkenal namun tidak bisa memenuhi persyaratan, panitia tetap akan mencoret calon peserta. Paket yang ditenderkan itu antara lain izin trayek bus pemadu moda rute Medan Fair -Bandara Kualanamu, izin trayek bus pemadu moda rute Home Centra Ringroad-

Bandara Kualanamu, izin trayek bus pemadu moda rute Amplas-Bandara Kualanamu. Lalu, izin trayek bus pemadu moda rute Kabanjahe-Bandara Kualanamu, izin trayek bus pemadu moda rute Pematang SiantarBandara Kualanamu, izin trayek bus pemadu moda rute Binjai-Kualanamu dan izin operasi taksi pemadu moda Bandara Kualanamu. (MBC/NET)

Akan Pacu Pembangunan Venue

94 Calon Anggota Bawaslu Diuji

Atim Siap Dan Optimis Sukses Gelar PORA XII/2014

MEDAN, BN Sebanyak 94 Calon Anggota Badan Pengawas Pemilihan Umum (Bawaslu) Provinsi Sumatera Utara mengikuti seleksi tertulis yang dilaksanakan di Ruang Sidang FISIP USU, Jalan DR Sofian No 1, Kampus USU Medan, kemarin. Calon Bawaslu Sumut yang ikut dalam seleksi adalah mereka yang telah lulus dari seleksi berkas dari 111 orang yang mendaftar sedangkan materi yang diujikan langsung dari Bawaslu. Ketua Ketua Tim Seleksi Calon Anggota Bawaslu Provinsi Sumatera Utara Prof Subhilhar PhD, saat ditemui disela-sela ujian mengatakan setelah melaksanakan seleksi ujian tertulis maka peserta ini juga hrus menjalani seleksi test kesehatan dan psikologi yang berlangsung pada Senin dan Selasa, (08 dan 09/04/2013) mendatang. Untuk selanjutnya, para peserta akan mengikuti seleksi kesehatan maupun psikologi langsung ditangani oleh Mabes Polri, di Bunda Thamrin Medan. Nanti dari 94 orang yang telah melewati seleksi tertulis maupun test kesehatan dan psikologi semua hasil dikirim ke Jakarta, kemudian dari 94 peserta ini Bawaslu mengirimkan kembali kepada tim seleksi sebanyak 12 nama untuk diseleksi. Dari ke-12 nama tersebut tim seleksi hanya merekomendasi enam nama yang lulus seleksi untuk dikirimkan ke Bawaslu selanjut Bawaslu menetapkan 3 nama peserta yang lulus sebagai Bawaslu Provinsi Sumatra Utara. Lebih lanjut, Subhilhar menyatakan adanya kuota perempuan dalam keanggotaan Bawaslu tentunya mereka harus memiliki kemampuan dan standart yang ditetapkan Bawaslu. (NET)

ACEH TIMUR,BN Ketua Umum KONI Aceh Timur Drs HT Syahril MAP menyatakan sangat bersyukur atas ditunjukknya Kabupaten Aceh Timur selaku tuanrumah penyelenggara Pekan Olahrga Aceh (PORA) ke XII/2014 oleh Gubernur Aceh,dr H Zaini Abdullah dan KONI Aceh,Rabu(3/4). Ini pantas kita syukuri dan kita optimis untuk mampu menjadi tuanrumah yang baik, sukses sebagai penyelenggara maupun

sukses dalam hal prestasi .,"terang Ketua Umum KONI Aceh Timur HT Syahril ,Kamis (4/4) kemarin langsung dari Banda Aceh via telepon selulernya sebagaimana disampaikan kembali oleh Kasubbag Humas Setdakab ,Eddyanto SST. Keberhasilan ditunjuknya Kabupaten Aceh Timur sebagai tuanrumahkan adalah buah kerja keras kita bersama insan olahraga dan seluruh lapisan masyarakat daerah ini serta dukungan luar biasa dari Bupati dan Wakil

Bupati Aceh Timur, Hasballah Bin M Thaib serta Syahrul Bin Syama'un yang terus mendukung hajatan pesta olahraga terbesar dan bergengsi di Aceh ini. Mudah mudahan dengan telah ditetapkannya Aceh Timur sebagai tuan rumah PORA ke XII/2014 mendatang, semua prasarana dan sarana pendukung seperti venue olahraga Idi Sport Centre akan segera kita pacu pembangunannya,'terang HT Syahril yang akrab disapa Ampon Yen tersebut.(@MF)

Total Impor Sumut US$436,27 Juta Medan, BN Februari 2013 dari totl nilai impor Sumatera Utara (Sumut) sebesar US$436,27 juta, jika dihitung berdasarkan asal, US$172,77 juta atau 39,60 persen berasal dari ASEAN, US$147,38 juta atau 33,78 persen berasal dari Asia diluar ASEAN, dan sisanya berasal dari kawasan lainnya. Kepala Bidang Statistik Distribusi, Hajizi menjelaskan berdasarkan negara asal utama barang, impor dari Cina merupakan yang terbesar yaitu sebesar US$91,11 juta, diikuti Singapura sebesar US$83,29 juta, Malaysia

US$70,58 juta, Argentina US$27,18 juta, Amerika Serikat US$22,73 juta, India US$20,82 juta, Korea Selatan, US$20,05 juta, Australia US$17,12 juta, Thailand US$12,16 juta dan Jerman sebesar US$7,78 juta. "Selama Februari 2013, enam negara asal utama mengalami peningkatan nilai impor, dimana peningkatan terbesar adalah impor dari Argnetina yang naik hingga 12 kali lipat, Korea Selatan meningkat 115,65 persen, Cina 33,62 persen, Amerika Serikat 16,44 persen, Singapura 2,99 persen, dan Malaysia 2,13 persen," jelasnya.

Hajizi juga mengatakan, di sisi lain negara asal utama yang mengalami penurunan nilai impor adalah Jerman sebesar 49,35 persen diikuti Australia 35,47 persen, India 16,64 persen dan Tahailand sebesar 0,16 persen. "Secara keseluruhan, selama Februari 2013 kesepuluh negara asal utama diatas memberikan peran sebesar 85,46 persen terhadap total impor melalui Sumut, di sisi lain, impor dari sepuluh negara diatas juga mengalami peningkatan sebesar 13,62 persen dibanding impor Januari 2013," kaatanya. (NET)

Illiza Hibahkan Ruko untuk DPC PPP Banda Aceh Banda Aceh | BNHj Illiza Sa’aduddin Djamal, yang juga wakil Walikota Banda Aceh, Selasa 2 April 2013 kemarin, menghibahkan satu unit ruko kepada DewanPimpinan Cabang-Partai Persatuan Pembangunan (DPC-PPP) Kota Banda Aceh. Kepada Bongkarnews, Illiza menuturkan, ruko tersebut merupakan milik pribadi untuk kepentingan partai berlambang Ka’bah itu. Apalagi selama ini, DPC PPP Kota Banda Aceh belum memiliki kantor secara permanen. “Ruko yang saya hibahkan ini untuk DPCPPP Kota Banda Aceh milik pribadi, bukan atas nama pemerintah. Dan saya harapkan, ruko ini

dapat dipergunakan serta mampu membantu kegiatan partai ini,” ujar Illiza, usai menyerahkan hibah ruko disela-sela peringatan maulid DPW-PPP Aceh. Apalagi, sambung mantan anggota DPRK Banda Aceh ini, partai tersebut merupakan pengusung untuk ia duduk dibirokrasi Pemerintah Kota (Pemko) Banda Aceh, yang berpasangan dengan Mawardy Nurdin (Ketua DPD-Partai Demokrat Aceh). “Selama dua periode, antusias masyarakat di Kota Banda Aceh, masih mempercayakan kami untuk memimpin roda Pemerintahan dipusat Ibukota Provinsi Aceh, Kota Banda

Aceh yang sesaat lagi akan berusia 808 tahun,” sambung dia. Terkait pesta demokrasi Pemilu Legeslatif (Pileg) 2014, pihaknya (DPC-PPP Banda Aceh), telah menargetkan satu Daerah Pemilihan (Dapil) mampu melahirkan satu kursi. Dengan harapan, target tersebut mendapat sambutan dari masyarakat, terutama masyarakat di Kota Banda Aceh. “Kita harapkan, semua target itu dapat terwujud dengan sempurna. Kami juga menempuh strategi politik praktis dengan cara yang profesional,” ucapnya. (Afrizal)

KPU DS Tetapkan Pilkada 23 Oktober DELISERDANG, BN Komisi Pemilihan Umum Daerah (KPUD) Deliserdang mengumumkan jadwal pelaksanan pemilihan kepala daerah kabupaten Deliserdang, digelar pada 23 Oktober mendatang 2013. Demikian disampaikan ketua KPUD Deliserdang Drs Moh Yusri, M.Si didampinggi anggota komisioner lainny,

Zakaria Siregar dan Bazoka Nenggolan, kemarin. Penetapan pelaksanan Pilkada tersebut sesuai dengan surat keputusan KPUD Deliserdang No.01/KPTS/KPU-DS-655895/ 2013 tentang tahapan dan jadwal pemilihan umum Bupati dan wakil Bupati Kabupaten Deliserdang Tahun 2013. Dilanjutkanya, tahapan dan jadwal

pemilihan umum Bupati dan wakil Bupati Kabupaten Deliserdang terdiri dari, pertama, persiapan yang meliputi non tahapan, tahapan pelaksanaan, pelaksanaan regulasi dalam bentuk keputusan. Kedua, pelaksanan, pencalonan partai politik, gabungan partai politik dan calon perseorangan, meliputi, penyerahan dan verifikasi dukungan pasangan calon

perseorangan, pencalonan, pengadaan dan pendistribusikan perlengkapan pemungutan dan penghitungan suara berdasarkan berdasarkan norma, standar, prosedur dan kebutuhan yang ditetapkan oleh KPU. "Jadwal tersebut kita buat dua putaran, itu untuk mengantisipasi apabila Pilkada berlangsung dua putaran,"ucapnya. (NET)

Pansus... main dengan hal ini. Kalau pemadaman listrik terus berlangsung, kita minta masyarakat boikot bayar rekening listrik,” katanya, sembari mengingatkan PT PLN, agar segera mengganti mesin-mesin tua di unit pembangkitan Belawan, sehingga langganan pemadaman arus listrik tidak terus terjadi di Sumut. Menurut Ajib, Komisi D DPRD Sumut telah berulang kali memanggil pimpinan PT PLN untuk mempertanyakan kondisi listrik di Sumut dan permasalahan yang mereka hadapi. Bahkan dalam beberapa kali pertemuan, pihak PLN telah berjanji akan terus meningkatkan kinerja, memberikan pelayanan kepada masyarakat. Namun dalam kenyataannya, pemadaman listrik terus terjadi dan intensitasnya semakin tinggi. Evaluasi Kinerja GM PLN Sumut Dalam berbagai statementnya, kata Ajib Shah, pihaknya telah berulang kali mendesak Meneg BUMN Dahlan Iskan dan Dirut PT PLN Pusat segera mengevaluasi kinerja GM PLN Sumut maupun GM Pembangkit Sumut, yang terkesan kurang maksimal mengelola kelistrikan di daerah ini. Namun, desakan dan dilema kelistrikan yang dihadapi masyarakat Sumut itu sama sekali tidak mendapat tangga-

pan positif, meskipun saat ini Sumut sudah berada dalam kondisi krisis listrik, akibat banyak mesin pembangkit sudah tidak layak pakai. Sementara ada beberapa pembangkit yang sudah dibangun PT PLN seperti di Labuhan Angin, Tapteng tidak mampu menyuplai pasokan listrik, karena gagal dalam pembangunannya, akibat dua mesin turbin tidak mampu beroperasi secara maksimal. “Saat ini pembangkit Labuhan Angin dengan kapasitas terpasang 2 x 115 MW, hanya mampu menyuplai 60 sampai 80 MW, ditambah lagi bahan bakar batubara yang digunakan kualitasnya jauh di bawah standar, sehingga kedua mesin tidak mampu memproduksi secara maksimal,” kata Ajib Shah. Sebenarnya, kata Ajib Shah, sekitar tahun 2000-an, Sumut juga pernah mengalami krisis listrik, sehingga muncul gagasan dari pemerintah untuk membangun pembangkit baru seperti pembangkit di Pangkalan Susu, PLTP Lau Sidebuk-debuk dengan kapasitas terpasang 2 x 5,6 MW, dan PLTP Sarulla serta Asahan I. Tetapi, kenyataannya beberapa pembangkit tersebut tidak mampu memenuhi pasokan listrik untuk kebutuhan masyarakat dan kalangan industri di daerah ini. Disebutkan

kebutuhan energi listrik di Sumut saat beban puncak berkisar 1.500 MW. Namun, pasokan listrik yang tersedia saat ini hanya sekitar 1.600 MW, itupun kalau semua pambangkit berjalan normal. Sampai saat ini PLN masih tetap mengandalkan PLTU dan PLTGU Sicanang Belawan sebagai pasokan utama, yang kondisinya saat ini sudah sangat darurat karena kondisi mesin yang sudah tua. Dari berbagai persoalan ini, diharapkan melalui pansus listrik nanti, dapat menguak permasalahan sebenarnya, sehingga kita bisa mencari solusi penyelesaian dan mencari titik lemah yang mengakibatkan Sumut berada dalam kondisi krisis listrik. Di sisi lain, triliunan rupiah uang masyarakat Sumut diserap pemerintah pusat setiap bulan melalui tagihan rekening listrik. Melalui Pansus akan mendesak Meneg BUMN bersama jajaran Direksi PT PLN Pusat segera turun tangan memantau hasil kerja GM PT PLN Sumut bersama GM PT PLN Pembangkitan. "Jika benar-benar kurang mampu mengatasi pemadaman listrik, sudah saatnya dievaluasi dan dilakukan penyegaran di instansi yang menangani kelistrikan tersebut,” akhirinya. (NDO)

akan terus hidup,” sebutnya. Johan Brien, Wakil Ketua Apindo Sumut menambahkan kenaikan TDL ini akan menambah cost perusahaan dan ini nantinya otomatis akan berimbas pada kenaikan harga produksi. Kenaikan TDL ini juga akan melukai industri yang berperan sebagai penggerak ekonomi negara. Dengan kata lain, kebijakan ini secara tidak langsung akan berdampak kepada masyarakat secara keseluruhan. Diberlakukanya kebijakan ini

akan membuat biaya produksi naik sekitar 3-5 persen. Sejauh ini daya mampu pembangkit listrik yang minim adalah penyebab utama pemadaman listrik di Sumatera Utara (Sumut). Daya mampu pembangkit listrik yang dimiliki Sumut sebesar 1.523,2 MW (MegaWatt), sedang total beban puncak yang harus dipenuhi sebesar 1.546,3 MW. Oleh karena itu, harus diadakan pemadaman listrik secara berkala di 32 Kabupaten se Sumut. Masalahnya, Sumut tidak punya cadangan daya. (NET/NDO)

Tak Bekerja... Farid Wajdi menambahkan, fakta perbaikan pelayanan yang sangat diharapkan justru sebaliknya. Pasca-TDL dinaikkan, pelayanan PLN cuma isapan jempol belaka. Pelayanan terus digerogoti dengan pemadaman listrik. Sedang Ketua Asosiasi Pengusaha Indonesia (Apindo) Sumut, Parlindungan Purba menilai bahwa kenaikan TDL per April sebesar 4,3 persen, sangat memberatkan pengusaha. “Kenaikan TDL pasti memberatkan pengusaha, apalagi tidak ada kepastian lampu

2

Tarif Angkot ... Rp 3000, per estafet, namun didalam pertemuan terakhir ini, tarif angkutran yang diusulkan berubah setelah mendapat masukan dari para peserta pertemuan dengan berbagai alasan dan pertimbangan. Akhirnya disepakati bersama menjadi Rp 3.800 untuk penumpang umum dan Rp 2.500 untuk pelajar dan mahasiswa per estafet. “Saya minta agar pembahasan penyesuaian tarif angkutan ini agar betul-betul dibahas, cari solusi terbaik sehingga tidak memberatkan elemen masyarakat juga kita berharap dengan penyesuaian tarif ini nantinya tidak menjadi permasalahan dan menimbulkan gejelok , “ harap Walikota Medan diwakili Asisten Ekbang Ir Qamarul Fatah, kemarin. Kepala Dinas Perhubungan Kota Medan Redward Parapat mengatakan, ada beberapa hal latar belakang penyesuaian tarif angkutan ini. Diantaranya, sejak tyahun 2008 belum dilakukan perubahan. Sementara perkembangan social dan prekonomian Kota medan mengalami perubahan yang yang sangat pesat, selain itu juga usulan dari DPC Organda Medan bahwa tarif saat ini tidak mampu lagi untuk menutupi biaya operasional dan perawatan kenderaan serta biaya hidup operator angkutan kota. “Rapat ini merupakan rapat lanjutan dari rapat pertama pada 18 Februari 2013 dengan Forum LLAJ, selain itu juga Dishub Medan telah melakukan kajian dan survey lapangan serta perhitunghan pasar,” ujar Renward Parapat. (NDO)

Bupati Atim Pantauan di lapangan, memasuki wilayah Kecamatan Simpang Jernih terlihat ratusan batang kayu glondongan maupun balok tim yang berserakan di pinggir jalan. Bahkan terlihat sebuah mobil kombat yang digunakan untuk menarik kayu balok yang berada di lokasi pengumpulan kayu tersebut yang telah ditinggal lari oleh pemiliknya. Menurut Kepala Desa Rantau Panjang, Kecamatan Simpang Jernih, Zainuddin, belum lama ini, dalam hal pembalakan liar ini masyarakat bertindak hanya sebagai pekerja semata sementara cukong pemilik kayu atau yang membiayai pembalakan liar tersebut berasal dari luar wilayah Simpang Jernih ini. Bupati Aceh Timur sendiri sangat menyayangkan kerusakan hutan yang ditimbulkan oleh aksi pembalakan liar ini, oleh sebab itu dalam waktu dekat ini ia berencana untuk memisahkan Dinas Kehutanan dan Perkebunan yang selama ini menjadi satu. “Jadi dalam waktu dekat ini saya berencana akan memisahkan Dinas Kehutanan dan Perkebunan menjadi Dinas Kehutanan dan Dinas Perkebunan dimana kedua dinas ini nantinya akan berdiri secara sendiri-sendiri dan ini kita lakukan untuk mempertegas mana tugas atau wewenang perkebunan dan mana tugas atau wewenang kehutanan dan ini akan kita lakukan secepat mungkin sesuai dengan aturan yang berlaku. Jadi jangan hanya membuat laporan asal bapak senang saja” tegasnya. (@MF)

Bupati Tapsel.. mengenai infrastruktur jalan yang kondisinya sangat memprihatinkan sebahagian ada badan jalan belum tersentuh aspal dengan adanya turdes ini keinginan masyarakat bisa dipenuhi meskipun tidak seluruhnya, karena pembangunan ini tidak terlepas dengan anggaran. Ada pun termasuk desa terisolir yang dilalui Desa Pargarutan Luat Harangan, Kecamatan Sipirok, Desa Turunan Desa Sitabo-Tabo Kecamatan SDH, dan Kecamatan Aek Bilah Perbatasan dengan Kabupaten Padang Lawas Utara. (SAAD)

Pemerintah.... tanggapannya atau solusi yang baik kepada masyarakat korban, padahal pembahasan mengenai persoalan tersebut sudah pernah dibicarakan oleh pemerintah Lhokseumawe dengan Komisi II Dewan Perwakilan Rakyat Republik Indonesia (DPR- RI) pada 26 September 2012 lalu. “Dalam pembahasan itu, antara DPR-RI dengan Pemkot Lhokseumawe di Jakarta sudah sepakat menganggarkan dana dari APBN pada tahun 2013 ini untuk relokasi tempat huni para korban, tapi belum ada juga upload anggaran,” katanya lagi. Tuntutan masyarakat itu muncul kembali setelah mencium penjelasan Gubernur Aceh, Zaini Abdullah, sebagaimana penyampaiannya yang pernah dimuat di media Serambi pada tanggal 30 Maret 2013 kemarin. Dengan demikian, mereka mendesak Gubernur Zaini dan Walikota Lhokseumawe Suaidi Yahya memperioritaskan secara serius perkara relokasi pemukiman warga itu. “Terkait hal ini, baru berapa hari saya sudah menyurati Gubernur Aceh,” ungkap Zubir. Dalam surat itu, katanya, menyebutkan para korban yang diwakili oleh Zubir, meminta Pemerintah Aceh, PT. Pertamina, dan PT. Arun LNG segera mengadakan acara rapat pendapat secara terbuka yang dihadiri oleh masyarakat korban. “Saya berharap agar segera memberi tanggapan oleh dalam ,” ujarnya lagi, seraya mengatakan jika dalam bulan April ini tidak diselesaikan, maka masyarakat korban akan menggelar aksi unjuk rasa atau demo besar -besaran. (O21)

Pengusaha Asal ... bersama Wu Jin Bing Wakil Ketua Pengusahaa Zhei Jiang Indonesia atau Zhe Shang Invetement Group dan rombongan meninjau beberapa lokasi potensi Aceh Timur seperti pelabuhan perikanan pantai kuala Idi. Bahkan ikut meninjau rumah ibadah Tepeikong yang terletak di kota Idi. Menurut Wu Jin Bing dari Zhe Sang Investment Group, dirinya melihat Aceh Timur Sepanjang jalan merupakan daerah yang subur dan disini banyak peluang investasi. Katanya pesisir jalan terlihat banyak tambak ikan, udang masih alami dan bagus dengan kekayaan alam yang subur."Alam yang alami ini dapat dimanfaatkan oleh insvetor dengan teknologi canggih baik teknolgi pertanian, perikanandan lainya,” kata Wu Jin Bing. Sementara Kadin Komite Tiongkok akan melaukan fasilitasi dengan pengusaha tiongkok kata Hasan Kosasih. "Kita akan menjembatani investor dari tiongkok ke Aceh Timur. Kita harapkan masyarat Aceh Timur dapat membuka diri untuk menyambut investasi, ini merupkan modal utama," kata Hasan Kosasih, Sekjen Kadin Komite Tiongkok. (***)


8-15 APRIL 2013 | EDISI 354| THN KE-VIII

Betor Belum Ditertibkan

Abang Becak Dayung Mengeluh Kades Helmi (Kiri) bersama Aktivis LSM FIPPR

Program Percepatan Pembangunan Perekonomian Masyarakat Desa Bengkalis,BN Upaya dalam meningkatkan pembangunan yang merata serta meningkatkan tarap hidup kesejahteraan warga , kepala Desa Dompas prioritas membangun infrastruktur jalan . pembangunan infrastruktur memajukan Desa sesuai INBUP . beberapa proyek jalan pengerjaan nya telah selesai ujar Helmi kepala Desa Dompas . seperti pembuatan jalan baru berukuran panjang 9 km dan lebar 10 m sesuai program penguatan infrastruktrur Pedesaan (PPIP) . Program Pemerintah Kabupaten Bengkalis ini sangat nyata menyentuh kehidupan masyarakat Desa ujar kepala Desa Dompas menjelasakan pada Wartawan BN bersama LSM FIPPR Riau baru baru ini. Lebih lanjut kepala Desa Dompas , pembangunan bodi jalan baru tersebut adalah merupakan akses warga masyarakat. Alham dulillah pengerjaannya sudah selesai ujarnya. Kini jalan tersebut sudah dapat dilalui warga yang hendak menuju masuk ke area Lahan kawasan Pertanian dan perkebunan milik warga kata nya. Memang selama ini akses warga belum memadai , tetapi dengan dikucurkan program pro rakyat yang membangun infrstruktur di Desa tersebut adalah merupakan wujud nyata keseriusan dari pemerintah kabupaten Bengkalis dalam meningkatkan kesejahteraan masayarakat Desa papar Helmi .untuk diketahui, masyarakat desa Dompas sumber mata pencarian dari warga adalah mayoritas bertani.karena itu PPIP(program penguatan infrastruktur pedesaan) tersebut disambut baik warga masyarakat karena pembangunan infrastruktur tersebut langsung dirasakan dan menyentuh pada keperluan hidup warga desa kata kepala Desa Dompas itu . Pembangunan yang dilaksanakan berdasarkan IMBUP sangat menyentuh bagi keperluan kehidupan warga masyarakat Desa . sehingga akses mobilisasi perekonomian warga menjadi lancar ujar Helmi saat bincang bincang diruangan kerjanya menjelaskan pada TIM Koran ini bersama Bid Investigasi & observasi LSM FIPPR (Forum Impormasi Pemantau Pembangunan Riau). Menurut kades ini, lokasi proyek pembangunan bodi jalan baru tersebut terletak di jalan Ibrahim satu,dan jalan Ibrahim dua.kemudian di jalan karet terang nya.jalan ini adalah sarana untuk akses. Sudah lama di idam idamkan masyarakat dan barulah pada tahun 2012 pembangunannya terwujud. Kini jalan menuju lahan pertanian nya sudah terbuka Terkait lahan perkebunan dan pertanian masyarakat Dompas, . sesuai data bahwa lahan milik warga sebagai lahan pertanian ada seluas 377 HA. Konon sebahagian besar lahan ini diduga di serobot pihak Perusahaan yang bergerak dalam bidang perkebunan Sawit . tetapi apapun katanya ,walaupun tantangan berat demi memajukan masrarakat Dompas sebut kepala Desa itu, kita tetap berusaha semaksimal mungkin dalam upaya memperjuangkan hak warga . sekarang saya sebagai kepala Desa Dompas harus memajukan pembangunan untuk meningkatkan kesejahteraan tarap hidup warga Dompas, dan terus ditingkatkan ujarnya.masyarakat sangat kecewa berat atas ulah Perusahaan PT Surya Dumai yang bergerak dibidang perkebunan sawit itu.waraga menilai Banyak kejanggalan, seakan akan Perusahaan itu yang lebih dulu ada mengusahai lahan tersebut ketimbang dari warga penduduk Desa Dompas ini tegas KaDes Helmi . Pemerintah Bengkalis sepertinya diduga kuat kurang serius menindak kejahatan perusahaan tersebut yang terus berupaya menyerobot lahan milik Warga.tetapi sampai kapanpun, bahwa yang hak atau lahan miliki Warga Dompas , yang diserobot perusahaan akan terus kita pertahankan. Karena itu hak masyarakat tegas Helmi.terkait lahan warga yang diduga di serobot perusahaan yang berkantor pusat di Pekan baru itu,sampai berita ini diekspos CAMAT Bukit batu dan Bupati Bengkalis belum dapat dikonfirmasi,(RDS)

DUMAI,BN Beberapa warga yang sehariannya mencarai kebutuhan nafkah hidupnya mengayuh becak belakangan ini banyak mengeluh karena penumpangnya drastis menurun. pasalnya , karena penumpang yang biasanya menumpangi becak kayuh ,tetapi kini penumpang itu banyak naik betor ( becak motor) membuat sumber pencarian abang becak kayuh banyak menurun. Bahkan akibat maraknya betor itu bukan saja dirasakan abang becak kayuh , tetapi sangat berpengaruh juga terhadap oplet atau mobil Angkot, karena penumpangnya berkurang . sementara saejumlah betor diduga belum mengantongi izin hingga kini belum ada penertibannya. Seperti di ungkapkan Yatim 63 tahun salah satu pengayuh becak pada BN mengatakan , sekarang ini sulit mendapatkan penumpang. Hal itu cukup terasa bangat beberapa bulan terakhir ini ujar abang becak yang sejak tahun 1985 sudah menarik becak kayuh di Dumai itu. rezeki kami menjadi

menurun drastis katanya, karena biasanya selama ini sebelum munculnya Betor kami bisa dapat penumpang agak lumayan . biasanya satu hari bisa mendapat hasil Rp 50 ribu. Tetapi sekarang jangan diharap , karena penumpang banyak di angkut Betor ujar Yatim menjelaskan . bukan dirasakan abanag becak kayuh saja, kini penumpang untuk oplet sudah diserobot Betor ,karena itu sangat berpengaruh besar bagi angkot (oplet)kata harahap dan yari yang sehariaannya sebagai sopir oplet didumai juga mengungkapkan keluhannya pada Koran ini kemarin lalu. Lanjut harahap didampingi rekannya menyebutkan, soal masalah Betor ini, sudah lama dilaporkan kepada Dishub Dumai agar ada solusi. Namun sampai saat ini pemerintah dumai tampaknya masih berpangku tangan. Diduga keluhan kami selaku sebagai pendayung becak di kota Dumai ini dianggap angin lalu saja ujar dua orang pendayung becak yang berhasil diwawancarai media BN di jalan sukajadi kemarin

Pemkab Gencarkan Promosi Wisata Pelalawan,BN Pemkab Pelalawan gencar mempromosikan objek andalan yang menjadi aset wisata di Kabupaten Pelalawan, yakni objek wisata gelombang Bono dan Taman Nasional Tesso Nilo (TNTN). Pasalnya, tidak hanya mempromosikan kedua objek tersebut di dalam negeri, tetapi objek tersebut juga dipromosikan hingga ke mancanegara. Demikian disampaikan Kadis Pariwisata Pemuda dan Olahraga Kabupaten Pelalawan H Zulkifli SAg MSi, kepada pers kemarin.Dikatakannya, saat ini pihaknya tengah berada di Jakarta untuk terus mempromosikan kedua objek tersebut kepada masyarakat penjuru dunia khususnya masyarakat Indonesia. ‘’Belum lama ini kita telah melakukan promosi ke Belanda dan negara besar lainnya. Dan saat ini, kami kembali dan mempromosikan objek wisata Bono dan TNTN pada masyarakat Indonesia dan dunia di Jakarta,’’ terangnya. Diungkapkan Zulkifli, sejak, Kamis (4/4) hingga, Ahad (7/4) mendatang pihaknya melakukan Deep Extrem Indonesia di JCC Jakarta. Kegiatan tersebut ditaja langsung oleh Kemenparekraf RI. ‘Even ini menjadi lebih menarik dengan kehadiran Seven Ghost (video Bono, red) yang menjadi ikon wisata Kabupaten Pelalawan dan sudah sangat terkenal seantreo dunia dengan gelombang 7 raksasanya menggulung menjadi arena surfer terbaik dunia khusus di aliran sungai,’’ bebernya. Dijelaskannya, setelah selesai acar pembukaan,

Dirjen Pariwisata Ekonomi Kreatif langsung membawa para undangan ke stand Pelalawan. ‘’Lagi-lagi Bono mendapat pujian ketika itu juga saya dipertemukan dengan para pengusaha perjalanan wisata dan pihak Garuda untuk Eropa,’’ paparnya. Tidak hanya di stand Kabupaten Pelalawan ada promosi Bono, sebut mantan Kabag Kesra Setkab Pelalawan ini, namun di stand Kemenparekraf sendiri juga menampilkan objek yang sama. ‘’Nampaknya Bono semakin menyapa Indonesia dan dunia. Dan selain kehebatan Bono di Teluk Meranti yang menjadi surganya bagi surfer profesional, turut ditawarkan juga objek wisata eksotik TNTN. TNTN tak hanya terkenal dengan lebatnya hutan alam, tapi juga menyimpan pesona beragam satwa yang luar biasa,’’ ujarnya. Dengan kegiatan tersebut, sambung Zulkifli, dirinya mengharapkan melalui kegiatan ini, Kabupaten Pelalawan makin dikenal dan menjadi tujuan wisata masyarakat Indonesia dan dunia. ‘’Namun, dengan keterbatasan Pemkab, tentu kita berharap dukungan dari Pemprov juga pusat serta investor luar dan dalam negeri ikut campur tangan dalam mengembangkannya, terutama peningkatan fasilitas penunjang. Kita pun patut acungkan dua jempol untuk Bupati dalam memberikan dukungannya, tak hanya untuk pariwisata tapi hampir seluruh aspek pembangunan lainnya,’’ tutupnya. (r/ringo)

Tata Batas Siak-Pelalawan Diteken PANGKALAN KERINCI,BN Setelah menunggu cukup lama akhirnya tata batas administrasipemerintahanSiak-Pelalawanmenemuititik temudandisepakatilewatpenandatangananberitaacara kesepakatanyangdilakukanolehkeduakepaladaerahSiak dan Pelalawan, Rabu (3/4) Auditoriun Kantor Bupati Pelalawan, Pengkalan Kerinci. “Alhamdulillah,kesepakataninisudahdisepakati,”kata Bupati Siak Drs H Syamsuar MSi didampingi Bupati Pelalawan HM Harris kepada wartawan usai penandatanganan berita acara. Hadir dalam penandatangan itu, Ketua DPRD Siak Zulfi Murshal SH, AsistenISetdakabSiakDrsHFauziAsniMSi,KapolresSiak AKBP Sugeng Putut Wicaksono SIK, Ketua Pengadilan Negeri Irfanuddin SH MH, Dandim 303 Bengkalis Letkol Inf Sukirman Sulaiman, kepala dinas dan badan di lingkungan Pemkab Siak. Sementara dari Pemkab Pelalawan dihadiri oleh Wakil Bupati Marwan Ibrahim, kepala dinas, badan dan kantor di lingkungan Pemkab Pelalawan. Menurut dia, persoalan tata batas ini sudah lama dibicarakan,bahkansejakdirinyajadicamatdiSiak,namun baru kali ini selesai. PenyelesaiantatabatasinisebutdiabagiPemkabsendiri takadapersoalannamunditingkatmasyarakat.Pemkab sendirisenantiasamengusahakanagartatabatasinidapat diselesaikan. “Ini langkah maju, dan jadi acuan untuk penyelesaian tata batas Siak lainnya yaitu Pekanbaru, Bengkalis dan Rokan Hulu,” sebut orang nomor satu di Siak ini . Diakuidia,meskikesepatanwalaubelumkeseluruhan, namunsebagailangkahawalsudahterjalinkatasepakat. Bahkan hal-hal lain yang diluar ini juga akan disepakati menyusulpembahasanintensifyangterusdilakukan.

HasilkesepakataninikatadiadisampaikanpadaGubri, dan diperkuat sekaligus menindaklanjuti berkenaan denganasetdimasamendatang. Pasca-penandatanganseepakataninidimaklumkan, telah lakukan jalinan kerjasama lintas kabupaten/kota, diantaranyapariwisata,kesehatandanjugapendidikan. Masyarakat di dua kabupaten dapat memanfaatkan pelayanan-pelayanan,terutamamasalahkesehatan. Bahkan setelah kesepakatan ini terjalin kedua daerah melakukan sosialisasi pada masyarakat agar tak terjadi keragu-raguan.Sementaramenyangkutasetbegitujuga tindaklanjuti. “Kesepakatan yang dicapai tak mengganggu aset,”ujar dia. Dalam hal ini, diakui tak ada yang sulit, sebab kedua daerah memiliki jalinan erat komunikasi dan rasa persaudaraan. Mereka terutama pegawai, maupun masyarakat diberi pilihan. Mau mengabdi di Siak atau Pelalawansilahkan,begitujugadenganmasyarakatmau menyekolahkan anaknya di Siak atau Pelalawan tak ada problem. Bupati Pelalawan HM Harris menambahkan sebenarnyakesepataniniawalnyasudahadakatamufakat. Sejak dirinya jadi ketua DPRD hal ini sudah didudukkan, namun terjadi kendala, yaitu, Pemkab berbicara, tibatiba ada bicara yg lain, dan dibawa pada forum formal lain. “Ini yang jadi biangnya dulu, namun sekarang tak lagi,”sebut dia. Diakui dia, sebenarnya administrasi pemerintahan sebenarnya tak ada maslaah, yang khawatir adalah masyarakat. “Saya minta dijaga ketertiban ini yg kita utamakan.Dudukbersama,adapersoalandiselesaikan,” katadia,serayamenambahkanuntukmasalahasettinggal pelimpahan saja oleh Pemkab masing-masing.(int/ ringo)

Tingkatkan PAD, Dishub Gelar Razia Pelalawan Jika tidak ada aral melintang, dalam waktu dekat ini, Dinas Perhubungan (Dishub) Kabupaten Pelalawan, akan menggelar razia kelengkapan dokumen kendaraan. Selain sebagai upaya penertiban, razia tersebut untuk meningkatkan PAD. Demikian ungkap Kadishub Pelalawan Drs Tengku Ridwan Mustafa MH, melalui Sekretaris Dishub Pelalawan Suhardi SH, Kamis (4/4) di Pangkalankerinci. Hanya saja, Suhardi tidak menyebutkan waktu pasti pelaksanaan razia tersebut. Menurut Suhardi, ada beberapa titik yang akan dilaksanakan razia terhadap dokumen kendaraan penumpang dan barang. ‘’Berdasarkan surat tugas yang sudah ditandatanganiKadishub untuk kegiatan ini, akan digelar di Pangkalankerinci dan Kecamatan Pangkalan Kuras,’’ jelasnya.

Diungkapkannya, kelengkapan kendaraan tersebut termasuk surat, keur serta kalayakan lainnya. ‘’Apalagi disinyalir banyak kendaraan keur sudah mati, namun tidak segera mengurusnya kembali,’’ ujar Suhardi. Tidak hanya menggugah kesadaran masyarakat, jelas Sekretaris Dishub ini, tapi razia yang digelar sebagai upaya meningkatkan PAD Kabupaten Pelalawan. “Kita akan melakukan berbagai langkah yang nantinya bisa menggenjot pencapaian PAD, salah satu cara yang akan dilakukan dengan menggelar razia surat-surat kendaraan. Misalkan kalau kendaraan sudah mati keur, otomatis pemiliknya harus menghidupkan atau mengurus perpanjangannya kembali dan biaya yang telah ditetapkan itu menjadi salah satu sumber pendapatan daerah yang menunjang pembangunan daerah,’’ tutupnya.(int/ringo)

kamis (5/4 )disekitar depan kantor pelayanan pasar.bahkan keluhan serupa juga dilontarkan beberapa orang pwengayuh becak yang mangkal di depan pasar senggol jalan sudirman Dumai, Kini kami banyak termenung , karena penumpang semakin hari kian memprihatinkan akibat betor berkeliaran bebas dalam kota. Seharusnya Dishub bisa mengatur rute Betor ke daerah yang tak terjangkau becak kayuh terang abang becak itru. Pengamatan Koran ini, para supir angkot maupun abang becak kayuh , sepertinya bagai menelan pil pahit karena diduga belum diperhatikan Pemko Dumai . aktivitas Betor dalam kota Dumai hingga kini tampak berkeliaran dengan dengan seenaknya keleleran mengambil sewa (penumpang ) disemua jalur jalan raya dalam kota dumai. Bahkan penumpang yang turun dari bus pun habis disikat. Padahal penumpang itu biasanya menaiki oplet tetapi sudah diserobot Betor.kita dan keluarga mau makan apa ?sebut abang becak kayuh yang mangkal menunggu

penumpang dekat simpang bumi ayu baru baru ini menceritakan pahitnya cari rezeki untuk membutuhi keluarganya . sumber pencarian dalam enam bulan terakhir inii sangat merosot total sebutnya pada BN. Berdasarkan Keterangan dan Informasi diperoleh BN , operasional becak motor ( Betor ) di dumai belum pernah ada diberikan izin oleh Dishub kota Dumai .sehingga keberadannya dipertanyakan berbagai pihak di Dumai. Sampai berita ini diekpos , aktivitas Betor tersebut diduga tidak pernahadapenertibannya.sehinggaBetordikota dumai terus kian bertambah banyak dan diduga ada yang surat suratnyatidaklengkap.karenaituDishubDumsaidiminta segera mengatur rute Betor agar tidak menimbulkan dampakfatalbuatbecakkayuh.“diduga adaunsursengaja membudayakan betordalam kota Dumai ,tanpa memikirkannasibwarga pendayungbecak.hinggaberita ini ndiewkspos KA Dishub kota Dumai yang baru belum dapat dikonfirmasi BN, Ikuti berita berikutnya (RDS/ Tengk))

Ikatan Keluarga Masyarakat Batak Dumai Akan Lakukan Mubes Dumai ,BN. Gonjang janjing terkait tudingan miring terhadap kepengurusanIKMBD(ikatankeluargamasyarakatbatak Dumai ) dalam dua bulan belakangan ini menjadi perbincangan seriusbagisebahagian masyarakatbatak dikotaDumai.Kononmenurutsejumlahimpormasi dan keterangan dirangkum Koran ini, diduga kuat ada oknum tertentu yang ingin merebut jadi pucuk pimpinan (untuk jadi ketua IKMBD—red). Indikasi itu terungkapsetelahberedarkabardanisuyang dinilaitidak relevan disebarkandilingkupkeluargamasyarakatbatak Dumai , ada kesan dari statemen yang digembor gemborkanolehoknumokunumtertentukonotasinya berbau propokasi, yang bertujuan memojokkan pengurus IKMBD. Sesuaiinvestigasimediaini,beberapaanggotawarga yang tergabung sebagai anggota IKMBD juga menyesalkanTudinganterhadapPengurusIKMBDkarena dinilaiberlebihan.Masihmenurutwargaitu,pemimpin organisasiini sejakterpilihnyaJapatarSilabanSHSebagai KetuaUmumdanjajaran pengurusIKMBDyangdilantik padatanggal17april2010sampaisekarangtetapeksis danberupayamaksimaluntukberbuatyangterbaiksesuai ketentuan dan aturan yang ada di IKMBD.bahkan dari kelompokparsahutaaon(wargabatakyangtergabung di antar domisili -red)yang bergabung di IKMBD tidak terdengar ada yang cekcek atau meributkan soal kepengurusan IKMBD ujar beberapa warga anggota IKMBD yangbertemudenganWartawanBNpadarabu (3/4) yang mohon tidak ditulis namanya. Pengamatan ,serta beberapa impormasi diperoleh awak media ini , Gejolak yang timbul bermula dari tentang penggunaan mobil ambulance. Mobil Ini merupakan yangdiberikansalahseorang kepadaIKMBD guna dapat dimamfaatkan mengangkut orang meninggaldilingkupkeluargabesarIKMBD.dandiduga mobil Ambulancetersebutmasihkreditsebutsalahsatu sumbermediaBNyanglayakdipercayapadakamis(4/4) ketika bertemu di Jln Sukajadi Dumai. Sangat disayangkanadanyatudinganmiringyangdilontarkan beberapa oknum tertentu, mengolah masalah ini dan dikemasjadibahanpropokasitidaksehat,menyudutkan pengurus IKMBD . hal ini , dijadikan berupa alasan dan dianggap mungkin bisa sebagai dasarataujalanmasuk ,untukmenudingpengurusIKMBDtidakbecus.strategi darioknumoknum tersebutbiladicermatiadaindikasi berbau kepentingan. Sebab masalah itu seharusnya dibawa dalam musyawarah di dalam IKMBD untuk mengetahuidudukpermasalahanyangterjadi.Lagipula pengurus IKMBD selama ini menjalankan tugasnya berjalandenganbaikjelasbeberapa sumberitupadaBN. anehnyalagi,BahkanmasalahSKtentangKepengurusan IKMBD pun sempat dipersoalkan oknum tertentu ujar beberapa anggota masyarakat batak saat bincang bincangdenganBN dijalanairbersih,dijalantegalega, dan disimpang bumi ayu serta di jalan Sudirman pada kemarinlalu. Masalah ini diduga sengaja di kemas dan di jadikan bahanpemberitaanhangatdibeberapaKoran.sehingga menimbulkan pendapat yang pro dan kontra serta menelorkan opini dan prediksi miring terhadap pengurus IKMBD. Kemudian dibesar besarkan atau di komporiolehoknumyangadakepentinganujarsumber BNkamis kemarin(4/4)disimpangjalanairbersihdandi dekatsimpang jalansidomulioDumaibarat yangminta tidakperlunamanyaditulis.haltudinganitudinilaiwarga tadisangatberlebihanbahkan berujung sampaiterjadi pelaporankepadaKepolisiankatasumberitu.Masalah pelaporanitukini disikapiolehsebahagianmasyarakat BatakDumai,sebagaialasanataudasarsipelaporyang melaporkankepolisiitubelumtentuterjaminsemuanya dipastikanbenar , banyak berpendapatseharusnyatidak perluterjadi,karenaadaetikayangbaik, kanbisa dibawa dalammusyawarah dengancaraDudukbersamadalam IKMBD,sebagai Organisasi kemasyarakatan yang legal dan berbadan Hukum ujar beberapa Pemerhati dan yang peduli kedamaian didalam Tubuh IKMBD menjawabWartawanBN. Masih lanjut sumber itu lagi,diduga kuat ada pihak yangberkepentinganuntukmerebutPucukPimpinan kepengurusan IKMBD , indikasi kearah itu kian terkuak dipermukaan ,setelah tersiar kabar bahwa pengurus IKMBDdisorotidiberitasuratkabar,sertaberedarisudan impormasi tentang penggunaan mobil Ambulance.masalah ini jadi pembicaraan warga di beberapa tempat ,dan dijadikan untuk bahan propaganda.Masalahini didugadipelintirolehoknumoknum

tertentu ,danoknum yangdidugapunyakepentingan .sehingga menimbulkan beragam pendapat dan berasumsi “kalau karena gara gara mobil Ambulance yang diberikan kepada IKMBD tersebut, jadi penyebab timbulnya perseteruan di dalam tubuh IKMBD ,lebih baiksecepatnyakembalikansajamobilambulancenya itu kepada pemiliknya” ungkap dari beberapa warga anggota IKMBD belum lama ini saat bincang bincang dengan Tim jelajah Koran ini kemarin lalu dijalan Sudirman,dijalanmerdekabaru,dijalanSSKasim dandi jalan sukajadi Dumai baru baru . Terpisah,KetuaIKMBDDumaiJapatarSilabanSHketika dihubungi Wartawan media ini pada rabu lalu menjelaskan,kami sebagai pengurus IKMBD tetap terbuka dalam menerima kritik yang membangun . kantor IKMBD siap menerima masukan secara lisan maupun tertulis dari segenap anggota IKMBD ujar Silaban. pengurus tetap menjalankan Amanah sesuai ketentuan AD/ART IKMBD.karena itu dalam rangka persiapan seiring pelaksanaan Mubes IKMBD dalam waktu tidak lama lagi, pengurus sudah mengadakan rapatkordinasibersamaDewanpenasehatdanPembina katanya. Ketika dikonfirmasi ,terkait kepengurusan IKMBD masa periode 2009 – 2012 , bahwa Pengukuhannya pada tanggal 17 April 2010.ketika itu dihadiri olehWalikota Dumai Drs Zulkifli AS dan unsur Muspida Kota Dumai ,tokoh Masyarakat,Agama, dan Pengurus Lembaga Kerukunan Keluarga Masyarakat Dumai (LKKMD) terang ketua Umum IKMBD itu, didampingiolehSekretarisUmumM.SimanungkalitSE menjawabWartawanmediaBN. LanjutKetuaUmumIKMBDitu, kitasebagaipengurus yang dipilih cara demokratis , penuh tanggung jawab dengan hati yang tulus ikhlasmenjalankan amanah selama Periode, dan komit berbuat yang terbaik demi majunya IKMBD , sebagai Wadah masyarakat bangso batak di kota Dumai ujar silaban. Dan untuk diketahui bahwa masa periode akan berakhir pada bulan April 2013 ini,dan selama ini kita sudah menjalankan tanggung jawab sebagai Pimpinan kepengurusan IKMBDsesuai Amanah.dankitaberharapsesuaidengan akandilangsungkan MUBESIKMBDnantinya.acara Helat IKMBDtersebutkitaharapkan dapatberjalansukses.dan tentunyabertujuanagar kedepaninibisamaju danlebih baik lagi jelas ketua Umum IKMBD itu. akan halnya , Sekretaris Umum IKMBD (M.Simanungkalit.SE) ketika dihubungi Koran ini mengatakan, harapan kita IKMBD harus Bisa Maju lebih baik lagi . kita berharap seluruh masyarakatbangso batakyangtergabungdalamIKMBD dapattetapbersatu,sehinggakitaweargaIKMBDdapat beradadalamkedamaian,rukundanharmonis.jangan mudah terpengaruh akan riak riak yang tidak membangundan isu yangtidaksehat ujarnya. Sementara itu, Ketua Dewan Penasehat IKMBD SW.Simanungkalit ,Juga didampingi oleh Pembina IKMBD,TT.Sitanggang kepada Wartawandalamtemu Pers(padakamis7/3lalu-red)mengatakan,pengurus IKMBD melakukan rapat Kordinasi. Hal itu dilakukan untuk mematangkanlangkahdankesiapanpengurus IKMBD seiringdenganrencanapelaksanaan MubesUjar SW Simanungkalit.kita berharap agar MUBES IKMBD dapatberjalandenganbaik.Karenaitumarikitasemua masyarakat batak yang tergabung didalam IKMBD memberikan perhatian dan dapat mendukung pelaksanaan MUBES nanti berdasarkan semangat kebersamaan penuh rasa damai demi kelangsungan kemajuan IKMBD kedepan untuk lebih baik lagi sebut Penasehat IKMBD tersebut, yang juga anggota DPRD Dumai itu . Lanjut nya , IKMBD berdiri adalah bertujuan untuk memajukan dan meningkatkan tarap hidup kesejahteraan anggota dalam bidang social, ekonomi dan meningkatkan rasa kekeluargaan yang harmonis, bermasyarakat, serta menjalin kerjasama yang baik dengan pemerintah. Jadi IKMBD tetap berupaya maksimaluntuk membangun kesejahteraan anggota denganpenuhtanggungjawabkatanya.menurutnya kedepan ini IKMBD sebagai wadah suku bangso batak anggota LKKMD (Lembaga Kerukunan Keluarga Masayarakat Dumai ) , senantiasa diharapkan harus bisa maju dan lebih baik lagi ujarnya.dan IKMBD adalah merupakan Asset Pemko Dumai, bisa dapat berperan aktif dan positif ,serta berkontribusi mendukung Program Pemko Dumai dalam mendorong laju pembangunan Kota Dumai dapat lebih baik kedepan tegas anggota DPRD Dumai itu mengakhirinya ( RDS).


8 - 15 APRIL 2013 | EDISI 354 | THN KE-VIII

Kompolnas : Polisi Jangan Dendam Terhadap Tersangka MEDAN, BN Anggota Komisi Kepolisian Nasional[Kompolnas] Edi Sahputra Hasibuan mengatakan bahwa kompolnas akan memantau terus penanganan tersangka penganiaya Kapolsek Dolok Pardamean agar penyidikan berjalan sesuai prosudur. Kompolnas minta penyidik tidak emosi dalam menagani perkara ini. Hal ini disampaikannya kepada wartawan ketika mengunjungi 17 tersangka di Mapoldasu, Senin[1/4]. Lebih lanjut katanya Kompolnas akan mengawasi proses penyidikan dan pengembangan perkara agar tidak ada warga yang tidak terlibat jadi tersangka, mengingat kasus penganiayaan berujung dengan kematian Andar Siahaan termasuk kasus besar.."Semua warga kami minta agar mengawasi juga kasus ini.Kami prihatin atas kasus ini, kami berharap tidak ada lagi kasus seperti

ini dimasa mendatang",ujar Edi. Edi menambahkan Kompolnas merekomendasi seluruh Polsek diseluruh Indonesia menyimpan gas air mata dan peluru karet. Perangkat itu diperlukan untuk mengendalikan massa agar penembakan warga seperti yangterjadi di Mapolsek Barumun Tengah Padang Lawas[Palas] 23 Maret 2013 tidak terulang."Polisi harus lebih baik dan lebih profesionel menangani unjukrasa dan aksi anarkis.Seandainya Polsek Barumun Tengah ada memeiliki gas air mata dan peluru karet, peristiwa penembakan warga dengan peluru tajam tidak perlu terjadi. Seperti diketahui bahwa tragedi yang menewaskan Kapolsek Dolok Pardamean Simalungun Kompol[Anumerta] Andar Siahaan,dianiaya massa di TKP saat melakukan penggerebekan judi kim[sejenis togel] ,Rabu[27/3] malam. Andar tewas dianiaya

Ada Oknum Polisi Hambat Pembangunan Tol Kualanamu MEDAN, BN Proyek pembangunan jalan tol Kualanamu Kabupaten Deli Serdang terpaksa terhenti karena ulah oknum polisi.dimana liam orang pekerjanya ditangkap tanpa sebab yang jelas. Menurut manager proyek, Wami, mereka bekerja sesuai dengan kontrak kerjasama dengan PT Andalas Logamindo Sukses[PT ALS] sesuai dengan perjanjian kerja No.006/ALS/BB/III/2013. Hal ini dikatakannya kepada wartawan, Rabu[3/4]. Adapun kelima orang yang ditangkap oknum polisi yakni Panoto[51] warga Tanjung Morawa dan Jumadi, serta tiga orang masig masing sopir truk dua orang dan satu kernet.. Pranoto, kesal atas tindakan oknum polisi tersebut yang katanya marga Sitorus dari Provost Polres Deli Serdang. Semalam dibawa ke Polres dan dimintai keterangan.Oknum petugas itu menangkap dan merampas kunci eskavator.Surat penangkapan tanggal 1 April 2013 tapi diperlihatkan 1 Maret 2013.",ungkapnya. Pekerja,jelas Pranoto diatngkap dengan tuduhan melakukan pencurian tanah timbun. "Dalam kontrak kerja jelas dikatakan tanah/sampah proyek,material/ bahan yang harus dikeluarkan dari proyek diberi kewenangan kepada penanggung jawab proyek karena tanah itu harus dibuang. Kami satu hari tidak kerja,kata penyidiknya tunggu pimpinan mereka datang",katanya. Sedangkan Kapolres Deli Serang AKBP Dicky Patria Negara, merasa terkejut saat dikonfirmasi prihal penangkapan kelima pekerja proyek sehingga sempat terhambat. Kapn? Dan Dimana?,kata Dicky melalui pesan singkatnya melalui SMS nya kepada wartawan. Ketika dijelaskan wartawan peristiwa itu terjadi,Selasa[2/4] malam dilokasi penegrukan tanah pembangunan proyek tol Kualanamu Internasional Airprt, Dicky kembali bertanya Anggota Polres atau Polsek? Tanyanya lagi melalui SMS nya. Wartawan kembali menjawab anggota Provost Polres Deli Serdang, bermarga Sitorus. Ahkrnya Dicky tidak lagi bertanya dan ketika wartawan bertanya apa tindakan yang akan diterapkan jika penangkapan itu tidak sesuai prosudur dia hanya mengatakan akan melakukan pemeriksaan dan member tindakan. [HZA]

Ardo Sandoksen Pada kesempatan itu Kompolnas juga memaparkan kasus peristiwa kekerasan dan penembakan terhadap warga di Barumun Tangah Desa Aek Buaton Kecamatan Barumun Tengah Padang Lawas yang menyebabkan 11 warga diantaranya dua wanita kena tembakan peluru tajam serta 26 warga lainnya dan tiga polisi terluka. Dan berdasrkan investigasi memang terjadi serangan besar massa ke Mapolsek Barumun Tengah,namun dia menegaskan polisi harus tetap melakukan langkah langkah sesuai prosudur hokum. Selain itu,imbuh Edi, Kompolnas mendapatkan fakta bahwa dua ibu rumah tangga turut jadi korban penembakan oleh polisi. "Kami prihatin dengan kejadian ini. Kami meminta Kapolri dan Kapoldasu agar menagguhkan penahanan terhadap kedua ibu ini",tegas Edi. (HZA)

warga Dusun Rajanihuta Naga Buttu Bayu Paneraja Kecamatan Dolok Pardamean sekitar pukul21.30 WIB. Pada saat kejadian itu,Andar bersama tiga anggotanya menggerebek TKP dan menangkap pelaku judi kim Kosdim, namum karena ada orang yang meneriakkan maling, maka masa datang dengan beringas menghajar Andar Sebagai barang buktinya berhasil disita barang bukti berupa sebuah HP berisi nomor judi kim atas nama Yeni Sumbayak, namun Tamaria boru Aruan yang disebut sebut Bandar judi kim adalah isteri tersangka Kosdim. Terkait kasus ini, kepolisian telah menetapkan 17 orang tersangka yang kini ditahan di Mapoldasu diantaranya Dedi Girsang,Rudi Sidabutar, Fernandus Turnip, Boru Aruan, Mangaratua Purba,Bonar Saragih, Kosdim Saragih, Justan Purba, Juki

Mark-Up Alkes Labusel Rugikan Negara Rp.10 Miliar MEDAN, BN Kasus dugaan mark-up yang terjadi pada pengadaan alat kesehatan[Alkes] kedokteran dan keluarga berencana [KB] di Dinas Kesehatan Labuhanbatu Selatan[Labusel] yang oleh penyedia diserahkan dalm keadaan rekondisi berupa tiga unit refrigerator centrifuge dan dua unit ikkubator transport senilai Rp.3 miliar berpotensi merugikan Negara Rp.10 miliar dari total pagu anggaran Rp.23 miliar. Hal ini disampaikan Kasubbid Pengelola Informasi dan Dokumentasi[PID] Humas Poldasu AKBP MP Nainggolan kepada wartawan, Selasa[2/4] diruang kerjanya dan dijelaskannya besar kerugian Negara akibat korupsi pada kegiatan pengadaan alkes dan KB tahun 2012 yang dananya berasal dari APBDTB dengan DIPA No.3230/024-04.4.01/ 02/2012 tanggal 22 Mai 2012 sebesar Rp.23 miliar itu hingga kini masih menunggu hasil audit Badan Pemeriksa Keuangan dan Pembangunan[BPKP]

Provinsi Sumut. "Penyidik Subdit III/Tipikor Direktorat Reserse Kriminal Khusus [Ditreskrimsus] Poldasu masih menunggu hasil audit dari BPKP Sumut, namun penyidik menaksir kerugian Negara sebesar Rp.10 miliar",kata MP Nainggolan. Dijelaskannya dalam menangani kasus ini Ditreskrimsus Poldasu telah mengambil langkah langkah yakni melakukan penyitaan dokumen serta surat surat yang berhubungan dengan perkara tersebut. Selain itu, telah melakukan penggeledahan sebuah rumah atau took milik JW[salah satu rekanan yang memenagkan pengadaan] di kompleks Millenium Indah Blko B -22 Jalan Setia Luhur Medan,Rabu 28 Februari 2013 dan telah lima orang saksi diperiksa. Ditreskrimsus Poldasu telah memblokir terhadap empat nomor rekening dari perusahaan rekanan Dinas Kesehatan Labusel. Dan keempat rekening itu milik JW,JT,TA dan HR. Dan juga pe-

Eksekusi Rumah Ricuh, Wartawan dan Polisi Terluka MEDAN, BN Eksekusi sebuah rumah di Jalan Bromo No.67 Medan, Rabu[3/4] oleh Pengadilan Agama [PA] Medan berlangsung ricuh dikarenakan anak penghuni rumah yang dieksekusi marah dengan menabrakkan mobilnya ke pagar rumah yang saat itu dipenuhi wartawan dan polsi yang mengawal eksekusi. Eksekusi yang dilakukan PA itu diatasnya terletak sebuah rumah dengan lahan seluas 20 x 40 meter, berdasarkan amar putusan No.447/Pdt.G/2008/ P.Mdn. Perintah eksekusi itu terkait permohonan Agusman yang ditetapkan Kantor Pelayanan Kekayaan Negara &

Lelang[KPKNL] Medan. "Eksekusi ini memang harus kami lakukan karena merupakan perintah pngadilan. Ini memang wewenang Pengadilan Agama Medan",kata M Faudi Can Nasution juru sita PA. Kericuhan terjadi setelah membaca surat perintah eksekusi. Petugas kepolisianpun bergerak maju. Sejumlah pria yang berdiri didepan pagar rumah langsung diamankan. Namun pintu pagar masih digembok. Namun tiba tiba seorang anggota keluarga tergugat masuk kedalam mobil Kijang Inova yang ada dhalaman rumah. Pria itu memundurkan kendaraan dan kemudian maju dengan kencang. Ken-

Kasat Narkoba Polres Sergai AKP Hendra Nyatakan Perang Terhadap Narkoba SERGAI,BN Orangnya berpenampilan tenang, sederhana dan harmonis, namun tegas dank komit terhadap pemberantasan, peredaran narkoba di wilayah Serdang Bedagai. Tak ada kompromi dan tawar menawar, siapa saja yang terlibat pasti di berangus. Itu sikap yang ditempuh AKP Hendra Kasat narkoba Sergai, menyikapi dan menangani peredaran narkoba yang kian memprihatinkan dan merasuki banyak elemen di bumi ini. Diakui atau tidak, narkoba jenis shabu dan ganja merupakan masalah yang paling dominan ditangani aparat penegak hukum mulai dari Kepolisian, Kejaksaan dan Hakim Pengadilan Negeri. Wajar saja demikian, kata AKP Hendra, masalahnya yang terlibat sebagai pengedar dan pemakai narkoba jenis ganja dan shabu di Tanah Bertuah Negeri Beradat Sergai, bukan hanya

kalangan tertentu saja. Namun, peredaran narkoba itu telah merambah dan merasuki keberbagai elemen masyarakat. Mulai dari Mahasiswa, Pelajar, Pegawai Negeri Sipil, Petani, Wiraswasta, bahkan Oknum TNI dan Polri dari luarpun ikut terlibat mengkonsumsi dan pengedaran narkoba. Menurut Kasat, yang dipercaya sebagai Kasat narkoba Polres Sergai, dirinya sudah banyak mendapat masukan tentang peredaran narkoba yang kian memprihatinkan dan perlu penanganan serius. Bahkan, ada rumor yang beredar bila transaksi narkoba sudah seperti jualan kacang goreng saja. Sebab itu dirinya bersama Kanit dan seluruh jajaran Kapolsek di wilayah Serdang Bedagai sepakat dan langsung memasang target menekan dan meminimalisir peredaran narkoba. Kita akan berperang melawan pelaku narkoba, ini merupakan kejahatan besar bagi generasi penerus bangsa. "Tegasnya saat ditemui wartawan Bongkar di ruang kerjanya baru-baru ini. Sebelum

&

TRAGIS

nyidik telah menyita alkes dari tiga Puskesmas di Labusel. Diungkapkannya, Ditreskrimsus Poldasu juga telah menggeledah rumah JT salah seorang rekanan di Dinas Kesehatan tersebut dan sudah meminta keterangan enam orang saksi dari Dinkes Labuhanbatu,serta sedang melakukan ekpose di BPKP untuk meminta audit perhitungan kerugian keuangan Negara. Menurut MP Nainggolan rencana tindak lanjut untuk menuntaskan kasus ini adalah melakukan pemeriksaan ahli le Lembaga Kebijakan Pengadaan Barang Jasa Pemerintah[LKPP].Pihaknya juga melakukan penyitaan tiga unit refrigerator centrifuge dan dua unit baby transport, serta melakukan pemeriksaan dari pihak bank terkait aliran dana. Dan informasi Kadinkes Labusel dr.RL sudah beberapa kali diperiksa terkait kasus ini dan juga S selaku pejabat pembuat komitmen pengadaan alat kedokteran kesehatan tersebut. [HZA]

mengakhiri pembicaraannya, Hendra berpesan kepada masyarakat, khusunya bagi masyarakat yang berdomisili di Serdang Bedagai, selain upaya Kepolisian untuk menekan dan meminimalisir peredaran narkoba dibutuhkan bantuan dan partisipasi pihak lain. Karena tanpa bantuan dari berbagai pihak, komitmen menghilangkan narkoba dari bumi ini, mustahil akan berhasil seperti yang diharapkan. Polisi sudah berbuat dan bergerak menyambangi markas narkoba. Dan hasilnya pun telah terlihat, puluhan kasus yang melibatkan banyak tersangka sudah di cekok, namun masih ada yang melakukan transaksi terselubung, bahkan sel Mapolres sudah over kapasitas, Lantas, mampukah Polisi menekan dan meminimalisir peredaran narkoba sampai ketitik terendah, dengan segenap hanya mengandalkan personil sendiri. Rasanya sangat mustahil. Sebab itu dibutuhkan bantuan dan aksinya dari pihak terkait lainnya. "Tegas Kasat Hendra . (Ibnu)

daraan itu kemudian menghantam pagar besi yang berada didepan rumah. Pagarpun peot. Lalu mobil kembli mundur. Sejumlah polisi pun bereaksi. Kerusuhan berlanjut, mobil Kijang Inova itu kembali melaju dan menabrak gerbang pagar.Setelah pagar rubuh,sebelah lagi terbuka kearah luar. Pagar besi menghantam petugas dan wartawan yang berdiri disisi pagar. Pengemudi kemudian melarikan mobilnya. Sedikitnya tiga oaring terjatuh dua diantaranya wartawan yakni Ismail Siregar[TV Nasional], Al Amin[media cetak] dan Kabag Ops Polresta Medan Kompol Sugeng Riyadi. Ismail mengalami luka patah kaki dan dibawa kedukun patah untu diobati, Polisi mengalami luka siku tangan kanan. Setelah pagar terbuka petugas langsung mengosongkan rumah.Pihak penggugat langsung memasang plank yang menyatakan asset itu milik mereka. Ahkirnya sipengemudi yang diketahu bernama Andre Zulhamid[27[ diringkus di Pasar Merah, dan pada saat melarikan mobil itu dia menabrak kotak infak dijalan. Warga sangat marah melihat tingkah Andre tapi sudah diserahkan ke Polresta Medan. Ternyata keterangan yang diperoleh mobil tersebut adalah mobil rental. Informasi terahkir yang diperoleh,Kamis;[4/4] bahwa pihak yang tereksekusi dan yang menabrak wartawan dan petugas itu sudah mengadakan perdamaian. Hal itu dikatakan Wakasat Reserse Kriminal Polresta Medan AKP Hendra . Dari pihak wartawan diwakili oleh teman Ismail, Yono Syahputra "Intinya mereka mau berdamai dan menunjukkan itikat baiknya dengan mendatangi Ismail dan kantor dimana Ismail kerja",kata Yono. [HZA]

Centeng PT Betami Ditemukan Tewas di Perkebunan

WARGA Kampung Sukajadi Watiman 50 th yang bekerja sebagai centeng dan

penjaga bibitan sawit di salah satu perusahaan perkebunan PT Betami

kecamatan Rantau di Kabupaten Aceh Tamiang di temukan tewas menggenaskan di perkebunan kelapa sawit Kamis 8.00. Wib { 4/4 ). Menurut impormasi , keterangan yang di kutip dari abang kandung korban Sumarin 53 th menjelaskan pada wartawan sekitar pukul 5.30 Wib watimin keluar dari rumah seperti biasanya setiap hari . korban bertugas untuk menghidupi lampu gudang pembibitan sawit PT Betami yang terletak sekitar satu kilo meter dari tempat tinggalnya. Hingga lepas magrib , korban belum juga kembali kerumah ,menaruh curiga ,istri korban menyuruh anaknya Irpan 16 th guna mencari keberadaan korban lalu anak korban bersama masyarakat mencari di mana keberadaan Watimin . Ternyata setelah di cari , anak kandung korban bersama masyarakat setempat menemukan Watimin dalam

keadaan terlungkup sudah tidakbernyawa lagi . Korban mengalami pipi memar di bahagian kepala sebelah kiri diatas plipis mata, serta mengeluarkan darah dari hidung , dan kaki sebelah kiri patah ,serta tumpukan kayu yang di bawa korban berantakan . Setelah ditangani oleh petugas kepolisian Polres Aceh Tamiang serta Babinsa Koramil Kodim 0104 Aceh Timur , sosok mayat korban di angkut dengan menggunakan Ambulance ke Rumah sakit umum Daerah Tamiang ( RSUD ) guna untuk di otopsi serta Visum untuk penyelidikan lebih lanjut . Kapolres Aceh Tamiang melalui Kasat reskrim Akp. Imamam Asapali ketika di kompirmasi waratawan terkait penemuan sosok mayat ini mengatakan , hingga saat ini "kami masih menunggu hasil Visum dari dokter Rumah sakit umum Tamiang ( RSUD ) (zul)

Kasat Reskrim Polres Sergai, AKP Donny Boy Pangabean mengintrogasi tersangka SC di Mapolres Sergai, .Negara Desa Firdaus Kec.Sai Rampah.

Saat Akan Ditangkap Petugas Pria DPO Ini Melawan SEI RAMPAH,BN Pria yang masuk Daftar Pencaria Orang (DPO) kasus pencurian, SC. (45) tahun warga Dusun I Desa Sai Buluh, Kec.Perbaungan ini berusaha untuk melawan petugas saat akan ditangkap personil Satreskrim Polres Serdang Bedagai yang dipimpin KBO Satreskrim Iptu.E.Panjaitan Senin.(1/4-13) sekira pukul 23.00 Wib di Dusun I Desa Lubuk Rotan. Kec.Perbaungan. Informasi diperoleh Bongkar News, selain DPO kasus pencurian keramik dikompleks penyandang tunanetra Dinas Sosial di Sai Buluh tahun 2011, pria yang kesehariannya sebagai tukang ojek, aksinya ini kerap meresahkan masyarakat sekitar. Berkat informasi dari masyarakat, akhirnya pelaku dapat ditangkap saat asyik beraktifitas main judi kopyok di lokasi hiburan keyboard acara hajatan warga. Dan saat akan ditangkap, pelaku melawan dan berusaha mencabut sebilah rencong dari pinggang. Berkat kesigapan dari personil Satreskrim Polres Sergai, akhirnya pelaku dapat diringkus, bersama barang bukti sebilah rencong di boyong ke Mapolres Sergai, jl.Negara Desa Firdaus Kec.Sai Rampah. Kepada wartawan SC usai pemeriksaan mengatakan, dirinya bukan bermaksud melawan, tetapi hanya bermaksud mengambil pisau dan akan membuangnya, ujar residivis kasus narkoba tahun 2000 dan divonis 18 bulan. Kasat Reskrim Polres Sergai, AKP Donny Boy Pangabean membenarkan penangkapan DPO kasus pencurian dan berusaha melawan saat ditangkap, selain itu aksi pelaku ini acap kali meresahkan masyarakat. "Tersangka berikut barang bukti sebilah rencong, kini telah diamankan guna proses lebih lanjut,"Ucap Kasat Reskrim Pangabean.(Ibnu)

Pemkab Belum Maksimal Sosialisasikan Pencegahan Narkoba MEDAN, BN Instruksi Presiden Nomor 12 Tahun 2011,yang memerintahkan Gubernur, Bupari/Walikota melaksanakan pencegahan,penanggulangan dan pemberantasan penyalahgunaan narkoba belum disosialisaikan dan dipahami oleh daerah . Hal ini dikatakan Kepala Badan Narkotika Nasional[BNN] Provinsi Sumut Kombes Pol Rudi Tranggono yang didampingi Direktur Ditresnarkoba Poldasu Kombes Pol Toga Habinsaran Panjaitan dan Kabid Humas Poldasu Kombes Pol Raden Heru Prakoso kepada wartawan, Rabu[4/4], sesusai pemusnahan narkoba senilai Rp.4.620.336,015 dihalaman kantor Ditresnarkoba Poldasu Jalan Sisingamangaraja Km 10,5 Meda,. "Gubernur sudah mengeluarkan instruksi,namun bupati dan walikota belum melaksnakan instruksi presiden. Ini akan kita dorong.BNN Sumut akan ke beberapa kabupaten supaya bupati ikut berperan aktif dalam pencegahan dan rehablitasi"ujarnya. Dan mulaibulan depan pihaknya akan melakukan evaluasi,lantas memanggil para bupati dan walikota untuk disampaikan mana yang sudah melaksankan instruksi presiden dan mana yang belum. Mengenai daerah yang paling tinggi penggunaan dan pemakaian narkoba, adalah Medan tingkat pertama disusul Langkat, Binjai,Tanjung Balai dan Asahan. "Market nya orang kota, pemasok hanya distribusi. Marketnya yang paling penting sehingga orang orang kota yang banyak jadi Bandar besarnya dan ini perlu kita dalami",imbuh Rudi Juga dikatakannya,narkoba sudah ada sejak zaman nabi Adam dan terus meningkat tajam seiring perkembangan teknologi dengan metode bermacam macam. "Angka pecandu narkoba di Indonesia 2,8% dari jumlah penduduk.Penduduk Indonesia 250 juta, berarti lima juta orang pencandu narkoba. Kebijakan pemerintah,sebanyak 245 juta orang yang belum pecandu harus diberi pemahaman. Untuk 2,8% yang sudah terkena direhablitasi gratis oleh BNN",paparnya. Target BNN kata dia pada tahun 2015 merehblitasi lima juta orang, dilakukan tidak hanya dipusat pusat BNN. Bagi yang mampu bisa merehbilatasi swasta dan sebagainya. "Upaya lainnya dilakukan penindakan hokum secara maksimal oleh Polda dan BNN. Jika kita bertahan di 2,8% ,Indonesia akan sukses dalam penaggulangan narkoba itingkat internasional. Jika sampai mencapai 3% kita gagal"tandasnya. Masih menurut Kepala BNN Sumut Kombes Pol Rudi Tranggono, Kamis[4/4] dimana salah satu penyebab Bandar narkoba di Indonesia tidak jera,karena hukum dinegeri ini bisa dibeli. Karena hukuman tidak bisa dijadikan patokan untuk membuat takut dan jera Bandar narkoba. Dicontohkannya. Malaysia saja peredaran narkoba tetap berlangsung meskipun hukuman gantung diterapkan kepada pelaku narkoba."Malaysia yang hanya lima gram saja dihukum gantung tapi tidak membuat jera. Berdasarkan data yang diperoleh salah satu terpidana mati atas nama Deni,vonisnya dikuatkan melalui putusan MahkamahAgung pada 18April 2011. Namun hukuman mati itu tidak lagi berlaku setelah Presiden Susilo Bambang Yudhoyono memberikan grasi melalui Keppres No.7/G/2012 yyang ditandatangani 25 Januari 2012. Makanya kita pesimis meskipun tetap memotifasi masyarakat. Sehebat apapun BNN , sehebat apapun polisi, tidak akan mampu tanpa peran masyarakat. [HZA]

Istri Brigadir Musliadi Tewas Lakalantas SEI RAMPAH.BN Salah seorang anggota Bhayangkari, Winarni (33) tahun istri dari Brigadir Musliadi yang selama ini bertugas di Brimob Pematang Siantar dan tinggal di Asrama Brimob, Jln. Ahmad Yani Kecamatan Siantar Timur, Kota Pematang Siantar, tewas mengenaskan korban kecelakaan lalu lintas, Senin (01-04-13) sekitar pukul 10.30 WIB tepatnya di jalan Medan Tebing Tinggi KM 57-58 Sergai. Informasi diperoleh ditempat kejadian, siang itu sepeda motor honda BK 2729 WAB yang dikendarain korban melaju kearah Medan menuju Siantar. Namun tiba dilokasi kejadian, korban yang mencoba untuk mendahului truk kontainer BK 9423 TN yang di kemudikan Sarimun (39) tahun Warga Sinaksak, Kec. Bringin Pematang Siantar. Korban terjatuh kearah truk sehingga korban tertabrak. Petugas Satlantas POLRES Serdang Bedagai yang dipimpin Kasat AKP Hasan Basri dibantu Warga, untuk mengevakuasi jenazah korban ke RSUD Sultan Sulaiman Sergai di Jln. Negara Desa Firdaus. Sedangkan truk kontainer yang mengangkut peti kemas dan sepeda motor berikut supir truk, diamankan di Mapolantas POLRES Sergai. Supir truk Satimun di Mapolantas POLRES Sergai membenarkan, mengetahui korban, coba mendahului truknya. "Tapi saya tidak tahu kalau korban jatuh kearah kiri dibawah truk, sehingga tertabrak roda belakang. Kasat Lantas AKP Hasan Basri, membenarkan kejadian itu. Sebelum korban diberangkatkan ke rumah duka di Kota Binjai, Kapolres Serdang Bedagai AKBP Arif Budiman. Sik. MH bersama Wakil Bupati Ir. H. Soekirman menjenguk jenazah ibu dua anak tersebut ke RSUD Sultan Sulaiman. Keduanya berpesan agar pihak keluarga bersabar dan ikhlas untuk menerima cobaan ini. Walaupun sebenarnya terasa berat. "Ambil hikmah yang terkandung di balik peristiwa tersebut. (ibnu)


8 - 15 APRIL 2013 | EDISI 354 | THN KE-VIII

Wabup Ir. H. Soekirman didampingi Kepala BPMPD H. Ifdal S.Sos, M.AP tengah menyerahkan cenderamata kepada perwakilan ILO Sumut usai beraudensi di ruang kerjanya Kompleks kantor Bupati Sergai di Sei Rampah, Kamis (4/4)

Sergai Sasaran Pilot Project ILO MAMPU SEI RAMPAH,BN Sebagai upaya meningkatkan akses dan penghidupan bagi kaum Perempuan miskin Indonesia, International Labour Organitation (ILO) Sumatera Utara (Sumut) memperkenalkan proyek ILO MAMPU kepada Pemerintah Kabupaten Serdang Bedagai (Pemkab Sergai) dalam pertemuan audensi yang diterima langsung oleh Wakil Bupati (Wabup) Sergai Ir. H. Soekirman didampingi Kaban Pemberdayaan Masyarakat Pemerintahan Desa (BPMPD) H. Ifdal S.Sos, M.AP di ruang kerjanya kompleks Kantor Bupati Sergai di Sei Rampah, Kamis (4/4). Dalam kunjungannya tersebut Mr. Gumono dari ILO Sumut yang didampingi rekannya Budi dan Ana mengatakan bahwa Organisasinya memulai sebuah kegiatan dan dinamakan proyek ILO MAMPU yang merupakan akses ketenagakerjaan dan pekerjaan yang layak bagi Perempuan. Lokasi sasaran kegiatan proyek ini adalah wilayah Jawa Timur dan Sumut dengan Kabupaten Sergai sebagai pilot projectnya. Gumono menjelaskan tujuan program ini adalah untuk meningkatkan akses dan mata pencaharian kaum perempuan miskin di Indonesia serta mempromosikan pemberdayaan ekonomi dan sosial perempuan. Proyek ILO yang didanai oleh Australian Aid dan telah didaftarkan di Bappenas ini dalam pelaksanaannya di tingkat Provinsi akan bekerja sama dengan Dinas Tenaga Kerja dan Transmigrasi, PNPM, Biro Pemberdayaan Perempuan, APINDO Sumut, Serikat Pekerja (SPSI dam KSBI) serta lembaga sosial masyarakat dengan kelompok sasaran perempuan miskin, rentan dan terpinggirkan. Untuk Program MAMPU di Kabupaten Sergai, ILO akan menargetkan pada proyek PNPM dan secara spesifik akan diaplikasikan pada program Simpan Pinjam Perempuan (SPP), ungkapnya. Strategi proyek ILO MAMPU diantaranya dalam memperkuat dan mendukung kemampuan dan keterwakilan organisasi dari para perempuan pekerja, pengembangan kelembagaan organisasi masyarakat sipil untuk memberikan pelayanan dan fasilitas bagi perempuan yang menjadi sasaran dalam mengurangi hambatan mendapatkan pekerjaan yang layak, transisi perempuan dari pekerjaan informal ke formal serta sektor swasta melalui pelaksanaan kondisi kerja yang lebih baik dan respon pekerjaan inovatif bagi perempuan, jelas Mr. Gumono. Menanggapi pemaparan Mr. Gumono dari ILO, Wabup Sergai Ir. H. Soekirman menyambut baik serta mendukung program ILO MAMPU tersebut untuk diaplikasikan di daerah ini. Dijelaskan H. Soekirman, bahwa Kabupaten Sergai yang baru berusia 9 tahun merupakan hasil pemekaran dari Kabupaten Induk yaitu Deli Serdang terdiri dari 17 Kecamatan dan 243 Desa/Kelurahan serta kemajemukan suku dan budaya masyarakatnya namun tetap hidup rukun dan damai. Soekirman berterimakasih karena Kabupaten Sergai telah dijadikan sasaran projek ILO MAMPU. Diharapkan dengan adanya program ini akan mampu bersinergi dengan program pengentasan kemiskinan yang ada sehingga mampu mengurangi angka kemiskinan khususnya bagi kaum perempuan yang termarjinalkan serta dapat membantu memperbaiki taraf ekonomi keluarga.(Ibnu)

Kota Tebingtinggi Sebagai Daerah Replikasi Program SAPA TEBINGTINGGI, BN Kota Tebingtinggi dan Kabupaten Batu Bara sebagai lokasi replikasi program sasaran program SAPA ( Strategic Aliance for Poverty Allecviation) di propinsi Sumatera Utara .Sedangkan lokasi inti daerah sasaran program SAPA adalah Kabupaten Serdang Bedagai, demikian dikatakan Wali Kota Tebingtinggi Ir.H.Umar Zunaidi Hasibuan,MM dalam sambutannya pada pembukaan acara review implementasi program Sapa dan perumusan model integrasi para pelaku penanggulangan kemiskinan,Kamis (27/3) do RM Pondok Bagelen Jalan Deblot Sundoro Tebingtinggi. Walikota mengatakan bahwa pemerintah pusat mendukung pemerintah daerah dalam berinovasi untukpercepTn danperluasan penanggulangan kemiskinan melalui program Sapa untukdapat menjadi sebuah model kemitraan seluruh pemangku kepentingan dalampenanggulangan kemiskinan berbasiskan kapasitas dankaraktersitik kemiskinan di daerah. Pada kesempatan itu,wali kota TebingtinggiIr.H.Umar Zunaidi turut berterima kasih kepada Kementrian Koordinator Kesejahteraan Rakyatyang telah mempercayakan kota Tebingtinggi sebagai tuan rumah penyelenggaran kegiatan review. ”Kota Tebingtinggi patut bersukur dan berterima kasih kepada ementrian Koordinator Kesejahteraan RakyatRI.Karena Tebingtinggi telah dipercayakan sebagai tuan rumah penyelenggaraan kegiatan review ini,dan kami berharap padapertemuanini akan tercapai semua tujuan yang kita harapkan danbermanfaat untuksemuapihak” kata Umar Zunaidi dalam pertemuan itu. Dijelaskannya,inovasi yang dilakukan pemerintah kota Tebingtinggi dalam penanggulangan kemiskinan antara lain adalah pemberian beasiswa bagi siswa kurang mampu,rehabilitasi rumah tidak layak huni (RTLH),penempatan keluarga tidak mampu di Rusunawa dan pemberian jamkesda kepada 90.000 jiwa warga kotaTebingtinggi pada tahun 2013. Koordinator daerah (Korda) SAPA kawasann SUMUT,Kominta SariPurba dalam sambutannya menjelaskan,program Sapa Indonesia dijalankan oleh multipihakyang tediri dari pemerintah pusat (Kemenkokesra),pemerintah daerah(TKPKD) dan Organisasi Masyarakat Sipil.Sedangkan daerah Sapa di Indonesia ada 9 (Sembilan)propinsi yakitu,Propinsi Aceh,Sumut,Jawa Barat, JawaTengah, DIY,Bali, NTBm,NTT dan Sulawesi Selatan. Dijelaskannya,Kabupaten Serdang Bedagai merupakan daerah pertama yang menjadi daerah SAPA di Sumatera Utara,dan telaj menjalin kerjasama (MoU)pada tahun 2009.Sedangkan daerah replikasinya adalah daerah kota Tebingtinggidan Kabupaten Batu Bara. Kominta juga memaparkan tentang 5 (lima)isu pokok program SAPA yakni,(1) Memperkuat perencanaan dan pengangguran yang berpihak pada masyarakatmiskin dan perempuan,(2) memberdayakan dan memperkuat kapasitas masyarakat miskin dan perempuan,(3) Mengintegrasikan data daninformasi kemiskinan,(4) Mempekuat kapasitas kelembagaan pemangku lepentingan dalam penanggulangan kemiskinan dan (5) Melakukan advokasi kebijakan dan program penanggulangan kemiskinan. Tturut hadir pada pembukaan kegiatan review implementasi programSAPA, Tim SAPA dari Kemenkokesra-RI,utusan TKPKD Kabupaten Sergaidan Kabupaten Batu Bara serta TKPK Tebingtinggi ,Kepala SKPD,Camat dan Lurah se kota Tebingtinggi serta undangan lainnya.(DER)

Walikota Tebingtinggi: Pimpinan Harus Kuasai Manajemen TEBINGTINGGI, BN Walikota Tebingtinggi Ir H Umar Zunaidi Hasibuan MM menekankan kepada para pimpinan Pegawai Negeri Sipil (PNS) di Lingkungan Pemko Tebingtinggi agar menguasai manajemen modern yang mempunyai visi misi yang jelas demi kemajuan Kota Tebingtinggi ke depan. “Untuk menjawab tantangan tugas di tengah-tengah masyarakat, para pimpinan di SKPD Pemko Tebingtinggi harus mampu menguasai manajemen modern serta mampu berkomunikasi dengan baik, baik vertikal ke atasan maupun horizontal ke masyarakat”,

kata Walikota Tebingtinggi dalam sambutan tertulis yang dibacakan Sekdako H Johan Samose Harahap saat membuka Diklat Kepemimpinan (PIM IV) Pemko Tebingtinggi, Selasa (2/4) di gedung TC Sosial Jalan Rumah Sakit Umum Kota Tebingtinggi. Saat ini, lanjut Walikota, para pemimpin birokrasi memerlukan ide dan gagasan yang baru dan cemerlang dari orang-orang muda agar dapat di implementasikan di instansi masing-masing. Jadi bekerja tidak hanya sekedar rutinitas. “Saya juga meminta kepada pimpinan SKPD untuk mengeksplorasi ide dan gagasan dari bawahan. Jangan per-

nah merasa lebih rendah jika gagasan bawahan lebih baik”, imbuhnya. Dihadapan Asisten II Ir H Zainul Halim dan puluhan peserta Diklat, Walikota juga berpesan bahwa dipundak seorang pimpinan ada tanggung jawab untuk pembinaan kebawah, yakni kemajuan staf di bagian instansi-nya masing-masing. Untuk itu, seorang pimpinan harus mau belajar untuk menambah kemampuan birokrasi ke depan, “Pelayanan masyarakat yang utama dan taat azas dan peraturan adalah menerima keluhan dari masyarakat dan secara responsip menanggapinya”, katanya.

Sementara itu, Kepala Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Erwin Suheri Damanik memaparkan, peserta Diklat PIM IV yang memegang jabatan eselon IV di sejumlah insatansi SKPD Pemko Tebingtinggi itu diikuti oleh 40 peserta dan berlangsung selama satu bulan. “Dengan kegiatan Diklat PIM IV ini diharapkan para PNS pemegang jabatan eselon mampu melaksanakan tugas-tugas dibidang pemerintahan, pembangunan dan kemasyarakatan secara efektif, efisien, berdaya guna dan berhasil guna,” tandasnya. (DER)

Komite SMP Negeri 1 Selesai Akui Pembangunan Pagar Sekolah Atas Musyawarah Kasek Bantah Pengutipan Uang Pagar Dilakukan Kepala Sekolah

LANGKAT, BN Komite SMP Negeri 1 Selesai Percayakan Usmayadi sebagai pelaksana pembangunan pagar sekolah yang ditunjuk oleh Komite sekolah. Kepala sekolah SMP negeri 1 Selesai Masa, S.Pd ketika di konfirmasi di ruang kerjanya, 5/4 mengatakan bahwa pengerjaan ini langsung di tangani oleh komite sekolah dengan wali murid yang pengutipannya sebesar Rp.122.000,per orang tidak termasuk 50 orang siswa yang mendapat BSM serta jika ada dua orang dalam satu keluarga yang bersekolah di sekolah ini maka hanya dikenakan satu orang saja yang membayar, hal senada juga disampaikan oleh ketua komite SMP Negeri 1 Selesai (Mislan) lewat telepon selularnya

pada wartwan, ia mengatakan kami tergugah untuk memajukan sekolah SMP Negeri 1 Selesai ini karena saya juga adalah alumni sekolah SMP Negeri 1 Selesai ini. Sehingga hal ini saya sampaikan juga kepada anggota komite yang lainnya melalui musyawarah komite, hal ini kami sampaikan kepada Kepala Sekolah dan Kepala Sekolah menyambut dengan baik mendukung sehingga kepala sekolah tidak terlibat dalam pengutipan ini, untuk pengutipan ini kami komite mempercayakan kepada 3 orang guru SMP Negeri 1 Selesai yaitu Suriani, Mahyuni, dan Zulhamdih. Tutur mislan kepada wartawan. Kalau kita lihat dari kemajuan sekolah SMP negeri 1 selesai ini memang kita akui, kata mislan. Semenjak

di pimpin oleh ibu Masa,S.pd ini sebagai Kepala Sekolah yang bertugas dari tahun 2010 sampai dengan sat ini sudah banyak perubahan yang sudah dilakukannya. Diantaranya penimbunan rawa-rawa yang saat ini dibuat sebagai tempat parker kendaraan, dan pembuatan pos penjagaan, pembuatan gapura, dan sebagainya. Kalau di tinjau dari prestasi yang sudah diperoleh dari sekolah ini telah mengirimkan siswa dalam olimpiade dan tekspram yang mendapat juara 1 melukis tentang lingkungan hidup dan penghijauan yang dilaksanakan di bukit lawang. Disisi lain Kasek juga menempahkan pakaian siswa yang kurang mampu sebagai 30 stel dari biaya pribadinya. Usmayadi sebagai pelaksana bangunan yang dipercayakan untuk membangun pagar sekolah ketika ditanyakan wartawan mengatakan bahwa ia telah mendapat kepercayaan dari kepala sekolah maupun komite untuk melaksanakan penambahan bangunan pagar yang sudah ada sehingga bertambah tinggi untuk menjaga ketertiban siswa dalam kegiatan proses belajar mengajar di sekolah itu. (UDN)

Peran KTNA Binjai Sangat Lemah Binjai-BN : Peranan dan fungsi Kelompok KTNA (Kontak Tani Nelayan Andalan ) kota Binjai saat ini sangat lemah dalam mendukung dan menyalurkan aspirasi masyarakat petani kepada Lembaga Eksekutif, Legislatif dan Yudikatif serta pihak lainnya untuk kemajuan dibidang pertanian, peternakan,perikanan dan dibidang kehutanan Demikian terungkap dalam mimbar sarasehan KTNA kota Binjai yang diadakan di gedung Ovany Binjai barubaru ini. Hadir dalam mimbar sarasehan Ketua KTNA kota Binjai Saring P,Sekretaris Janiman dan Wakil Ketua Selamat Oetoyo serta 30 orang peserta dari kelompok tani dan PNS Dinas Pertanian dan Perikanan kota Binja Banyak hal yang menyangkut persoalan petani, peternak, perikanan tidak terselesaikan melalui forum-forum yang diprakarsai oleh KTNA kota

Binjai.Padahal kata salah seorang peserta tujuan dibentuk KTNA berdasarkan AD/ART untuk mengelola sumber-sumber daya secara bertanggung jawab dan mewujudkan cita-cita mencerdaskan dan mensejahterakan kehidupan bangsa khususnya para petani dan nelayan sekaligus bersama yang jujur ,adil,rukun,damai dan sejahtera Lebih kurang 15 tahun KTNA kota Binjai dipimpin Saring P,namun selama itu pula KTNA tidak mampu membahas masalah yang dihadapi para petani, peternak dan perikanan (Nelayan), selain tidak mampu membahas dan menyalurkan aspirasi masyarakat petani, kondisi anggota kelompok KTNA yang menjadi peserta mimbar sarasehan dari tahun ke tahun hanya anggota tertentu saja,diperkirakan hanya 20 s/d 30 anggota Kelompok KTNA Padahal berdasarkan data -data dari

pihak Dinas Pertanian dan Perikanan kota Binjai kelompok tani, ternak, perikanan yang terbentuk dan telah dikukuhkan sudah mencapai ratusan kelompok, berarti kondisi KTNA semakin lemah dan memprihatinkan ,kata peserta yang diaminkan PNS Dinas Pertanian yang hadir mengikuti kegiatan tersebut Kelemahan yang paling ironis menurut PPL (Petugas Penyuluh Lapangan ) KTNA kota Binjai kurang merespon kehadiran kelompok -kelompok yang ada di kelurahan di kota Binjai,hal ini menyebabkan peran dan fungsi KTNA tidak optimal dan signifikan Sementara itu Ketua KTNA kota Binjai Saring P usai menerima kritikan dari peserta berjanji akan melakukan pembinaan terhadap kelompok tani,ternak , perikanan yang ada dikelurahan (MR/MSTP )

Kabid Perikanan kota Binjai Junaidi Tarihoran saat meninjau lokasi Penetasan dan Pembesaran bibit ikan Lele Sangkuriang di Pokdakan Pertina Mandiri kelurahan Payaroba kecamatan Binjai Barat

Dipokdakan Pertina Mandiri Berhasil Tetaskan Belasan Induk Lele Sangkuriang BINJAI-BN Kelompok Budidaya Perikanan (Pokdakan) Pertina Mandiri kelurahan Payaroba kecamatan Binjai Barat berhasil menetaskan telur belasan induk ikan lele jenis sangkuriang," Telur induk ikan lele sangkuriang yang berasal dari bantuan Dinas Pertanian dan Perikanan kota Binjai sudah menetas 2 kali ,syukur dari 30 induk lele yang terdiri dari jantan dan betina 15 diantaranya berhasil menetas ," Kata Ketua Pokdakan Pertina Mandiri Praja yang didampingi ketua Gapokdakan Mandiri Jaya kecamatan Binjai Barat Boga Arfiansyah di Lokasi Pokdakan Sabtu (30/3) Menurut Boga Arfiansyah Pokdakan Pertina Mandiri dan masyarakat setempat telah melaksanakan pemijahan /penangkaran telur dengan swadaya dan bantuan modal dari Koperasi KSU Pertina Mandiri kota Binjai ,Alhamdulillah investasi pembangunan bak pemijahannya sudah rampung sebanyak 5 kopel,ujar Boga Boga juga mengatakan aktivitas pemijahan bibit ikan lele ini merupakan tindak lanjut dari salah satu visi dan misi Walikota dan Wakil Walikota Binjai di sector budidaya perikanan,karena itu kami mengajak seluruh komponen masyarakat kota Binjai untuk mengkomsumsi ikan lele sehari-hari Petugas Penyuluh Lapangan (PPL) Perikanan kelurahan Payaroba Jamalus SPi,yang didampingi Kordinator PPL kecamatan Binjai Barat Pangihutan Lubis memberikan apresiasi terhadap aktivitas Pokdakan Pertina Mandiri yang telah memanfatkan bantuan induk ikan lele dari pihak Dinas " Ini salah satu bukti bahwa Pokdakan di kelurahan Payaroba telah mendaya gunakan bantuan dari pihak Dinas diharapkan Kadis Pertanian dan Perikanan kota Binjai Ir.Edi Gunawan memberikan dukungan kepada Pokdakan yang telah berhasil mendukung visi dan misi Walikota Binjai ," kata Jamalus SPi (Munir Rangkuti)

Bupati : Budayakan Keselamatan dan Kesehatan Kerja

UPACARA Peringatan Hari Keselamatan dan Kesehatan Kerja (K3) sekaligus pernyataan dimulainya bulan K3 Nasional diselenggarakan serentak secara Nasional, pada tingkat Propinsi Sumatera Utara dipusatkan di Langkat yang penyelenggaraannya dihadiri oleh seluruh perwakilan karyawan dan pekerja pada perusahaan seKabupaten Langkat dan sekitarnya, bertindak selaku perwira upacara Kadisnakertrans Langkat H. Syaiful Abdi, SE, M.Pd, Pemimpin upacara M. Nawawi, S.STP yang berlangsung di Alun-alun T.Amir Hamzah Stabat, Kamis ( 4/4 ). Selaku Inspektur Upacara, Sekdapropsu H.Nurdin Lubis, SH. MM membacakan sambutan Menakertrans Muhaimin

Iskandar yang dalam amanatnya menyampaikan tahun ini merupakan tahun keempat bangsa Indonesia untuk berjuang, berperan aktif dan bekerja secara kolektif dalam mendukung citacita besar Indonesia Berbudaya K3 tahun 2015 yang telah ditetapkan melalui Keputusan Menteri Nomor Kep.372/Men/ XI/2009.. Berdasarkan UU no 1 tahun 1970 tentang keselamatan kerja Menteri Muhaimin menghimbau dan menyerukan kepada semua pihak untuk lebih meningkatkan K3 di semua kegiatan mulai dari perencanaan, pembuatan/pemasangan, pengoperasian/pemakaian dan pemeliharaan terhadap seluruh peralatan produksi dalam upaya menjamin keselamatan dan kesehatan kerja bagi pekerja

maupun masyarakat sebagai konsumen barang atau jasa hasil produksi atau sebagai pengguna sarana fasilitas umum. Dijelaskan berdasarkan laporan ILO bahwa setiap hari di seluruh dunia terjadi kecelakaan kerja yang mengakibatkan korban fatal ± 6000 kasus, sementara Indonesia setiap 100.000 tenaga kerja terdapat 20 orang fatal, maka tingkat keparahan kecelakaan kerja diseluruh dunia pada umumnya masih cukup tinggi. Ini merupakan angka yang cukup besar, oleh karenanya pelaksanaan K3 ditempat kerja harus mendapat perhatian serius oleh pihak-pihak terkait dalam proses produksi. Menteri mengajak seluruh stakeholder dan masyarakat bergerak dan bertindak menjadikan program "Saya Pilih Selamat" menjadi salah satu upaya dalam mewujudkan K3, "Icon tersebut hendaknya kita suarakan, dengungkan setiap hari agar memotivasi dalam berprilaku sehat" kata Menteri Muhaimin seperti yang dibacakan Nurdin. Sementara Bupati Langkat H. Ngogesa Sitepu, SH menyampaikan terima kasih atas amanah yang diberikan sebagai penyelenggara kegiatan tersebut, ucapan terima kasih juga disampaikannya kepada para pimpinan perusahaan baik BUMN maupun BUMD dan swasta serta seluruh serikat

pekerja, organisasi karyawan dan buruh yang memberikan andil besar menghantarkan Langkat memperoleh penghargaan Nasional K3 dari Kemenakertrans. "Mari kita tetap jaga kebersamaan, kenyamanan dan iklim kondusif di wilayah kerja masing-masing" sebut Bupati Haji Ngogesa seraya mengatakan bahwa semuanya saling membutuhkan, untuk itu berprinsiplah semua untuk satu dan satu untuk semua demi kebaikan bersama, Bupati Langkat itu juga menyampaikan rasa terima kasih atas program CSR perusahaan yang mampu membantu oeningkatan perekonomian masyarakat Langkat Sebelumnya Ketua Panitia Drs. Musa Rajekshah, M.Hum melaporkan terpilihnya Langkat sebagai tuan rumah Upacara bulan K3 tingkat Sumut tahun 2013 karena prestasi Bupati Haji Ngogesa yang telah berhasil membina K3 sehingga mendapat penghargaan sebagai Pembina K3 Terbaik se-Indonesia pada 2012 lalu, rangkaian kegiatan tersebut juga diselenggarakan kegiatan sosial sperti pemeriksaan dan pengobatan geratis operasi katarak, donor darah dan penanaman pohon mendukung program 1 Miliar pohon. Lebih lanjut dikatan Ijeck panggilan akrabnya yang juga Ketua IMI sumut itu satu diantara maksud dan tujuan diselenggarakan

kegiatan tersebut untuk meningkatkan partisipasi semua pihak untuk optimalisasi pelaksanaan budaya K3 disetiap kegiatan usaha. Dalam kesempatan itu juga diserahkan piagam penghargaan "Zero Accident" kecelakaan nihil pada 10 perusahaan yakni PT. Perusahaan Gas Negara, Tbk distr wil III, PT. Anugerah Langkat Makmur, PTPN II Pabrik gula Kw. Madu Langkat, PT.PP Lonsum, Tbk Perk Bungara Estate Langkat, PTPN II Rs Tg. Selamat Langkat, PT. Indofood CBP sukses makmur, PT. Lafarge Cement Medan, PT. Musim mas Kim II Deli Serdang, PT. PD Paya Pinang Kbn Mandaris Sergei, PT. PP Lonsum Indonesia , Tbk Kbn Sei Bulan Sergei. Diserahkan juga beasiswa Jamsostek kepada 6 orang pelajar dan 2 mahasiswa yakni Irene Vikalen Karolina dan Andre Ginting tingkat SD sebesar Rp. 1.800.000, Farid Yoanda dan Evira Sandra SMP Rp. 1.800.000, Yayang Novitasari dan Siti Ulina SMA Rp. 2.400.000 serta Boda Sari Handayani dan Asmaul Husna Mahasiswi Rp. 2.400.000. Diakhir acara Sekdapropsu, Bupati Langkat dan para pimpinan perusahaan meninjau pelaksanaan donor darah dan pengobatan operasi katarak yang dilaksanakan pada stand-stand di seputaran Alun-alun T. Amir Hamzah. (Munir Rangkuti)


8 - 15 APRIL 2013 | EDISI 354 | THN KE-VIII

KTLMLI Hadir untuk Salurkan Aspirasi Petani DELISERDANG, BN Kelompok Tani Maju Lestari Indonesia (KTMLI) SU, hadir untuk membantu dan menyalurkan aspirasi masyarakat petani, dalam upaya meningkatkan ekonomi keluarga, dengan cara bercocok tanam palawija dan usaha lainya, diareal lahan dianggap layak dan kosong. E Hasibuan, SE, kepada BNews, pekan lalu, menyebutkan hal itu, dis-

ela-sela kesibukanya bersama pengurus KTMLI, memperjuangkan aspirasi seribuan petani, di lahan eks HGU PTPN2, berlokasi dipasar IX/X, Desa Manunggal. Kec.Labuhandeli. Kab.Deliserdang. Disebutkanya lagi bahwa, KTMLI atas aspirasi rakyat petani, tidak berjalan sendiri, melainkan didukung oleh Orpol (PDI-P), Ormas (PP), BPRPI, juga para kelompok tani lain-

Wartawan Unit Pemko Medan Bantu Panti Asuhan dan Kaum Dhuafa MEDAN, BN Koordinator Wartawan Unit Pemko Medan memberikan santunan kepada dua panti Asuhan dan bantuan pake t sembako di tiga kecamatan yakni Medan Kota, Medan Helvetia dan Medan Marelan, Jumat (5/4). Bantuan bagi 100 orang anak panti asuhan dan 50 orang kaum dhuafa tersebut diserahkan langsung Ketua Koordinator Wartawan Unit Pemko Medan, Lilik Riadi didampingi Sekretaris Koordinator Bernard Situmorang, Ketua Panitia Malam Perkenalan dan Pengukuhan Wartawan Unit Pemko Medan Dipo Sumarno dan Sekretaris Panitia Dicky Sihotang serta Yurmal Hasibuan Kasubag Informasi dan Komunikasi Humas Pemko Medan. Di Panti Asuhan Claretta, jalan Gaperta Ujung Medan, bantuan diterima Ketuan Yayasan Hermon Ginting. Dalam sambutannya, Hermon menyampaikan rasa terima kasih dan merasa terharu menerima bantuan dari Pengurus Koordinator Wartawan Unit Pemko Medan. “Atas nama yayasan saya sampaikan terima kasih dan bantuan ini akan diberikan langsung kepada anak-anak yang berhak menerimanya,”kata Hermon Ginting terharu. Dikatakan Ginting, bantuan ini sungguh sangat berharga dan bermanfaat bagi yayasan, karena sampai saat ini pihaknya masih menyewa gedung dan tanah yang setiap tahunnya terus naik. “ Dengan adanya bantuan ini diharapkan bermanfaat dan bergunan bagi anak asuh di yayasan ini,”ujarnya. Sedangkan di Aula Kantor Camat Medan Marelan, bantuan diterima Camat Medan Marelan Dedy Djaminsah Putra Harahap SSTP MAP diwakili Sekretaris Kecamatan Medan Marelan Sar’an didampingi Lurah Labuhan Deli Hamdani S.Sos,Lurah Rengas Pulau H Irwan Daniel Nasution Lurah Terjun. Dalam sambutannnya Sekcam Medan Marelan Sar,an mengatakan, 50 orang kaum dhuafa diambil masing 20 orang dari Kelurahan Medan Deli, 15 orang dari Kelurahan Rengas Pulau dan 15 orang dari Kelurahan Terjun. “Atas nama Kecamat Medan Marelan kami mengucapkan terima kasih atas sumbangan yang diberikan kepada warga kami. Mudah-mudahan bantuan sembako ini dapat dimanfaatkan para orang tua kita yang sudah dhuafa.Semoga

Allah meridhoi setiap langkah yang dilakukan rekan-rekan wartawan unit Pemko Medan,”ucapnya. Watinah salah seorang penerima bantuan paket sembako dengan rasa haru menyampaikan terima kasih dan rasa syukur kepada wartawan Unit Pemko Medan yang peduli dengan keberadaan mereka.”Semoga bantuan ini menjadi berkah dan mendapat balasan dari Allah SWT,”ungkap Watinah usai menerima paket sembako. Di Panti Asuhan AlWsashliyah Jalan Ismaliyah Medan, bantuan diterima Ketua Yayasan Bendahara Panti Ujung Ulung Batubara. Dia menyampaikan terima kasih tidak terhingga atas prakarsa koordinator Wartawan Unit Pemko Medan memberikan santunan kepada anak-anak asuh yang ada di Yayayan Panti Asuhan Al Washliyah.”Kami betul-betul sangat terharu menerima bantuan ini. Kita akans alurkan kepada mereka secara langsung kepada merfeka yang berhak. Kami mendoakan apa yang menjadi harapan agar anak-anak panti maju, kreatif dan terus berkembang menjadi kenyataan. Semoga bantuan ini bermanfaat bagi anak panti. Kami tidak bisa membalas atas kebaikan rekan-rekan wartawan. Kepada Allah kami serahkan semuanya,”kata Ujung Ulung Batubara ketika menerima bantuan santunan tersebut. Sementara itu, Koordinator Warwatawan Unit Pemko Medan Lilik Riadi mengatakan, pemberian santuan ke panti asuhan dan bantuan paket sembako bagi kaum dhuafa merupakan serangkaian kegiatan bakti sosial menjelang Malam Perkenalan sekaligus Pengukuhan Pengurus Wartawan Unit Pemko Medan yang akan digelar pada Jumat (12/5) di Gelora Hall, Hotel Madani yang akan dilakukan Walikota Medan Drs Rahudman Harahap MM selaku Dewan Pembina. Diungkapkannya, bantuan ini janganlah dilihat dari nilainya tapi diberikan dengan hati yang tulus dan ikhlas sebagai sikap kepedulian kepada mereka yang memang membutuhkan. “Bantuan ini memang tidak seberapa dan janganlah dinilai dari jumlahnya. Tapi paling tidak, bantuan ini dapat membantu orang-orang yang memang membutuhkan,”ujar Lilik. (Ndo)

Walikota Medan Terima Audensi MEDAN, BN Walikota Medan Drs H Rahudman Harahap MM didampingi Asisten Kesmasy Erwin Lubis SH, Kepala Dinas Kesehatan Kota Medan drg Usma Polita, Kabag Humas Budi hariono SSTP MAP, berturut-turut menerima audensi Kesatuan Perempuan Partai Golkar Sumut, Harian Tribun, dan Pimpinan Hotel Aryaduta, Jumat (4/4) di Balai Kota Medan. Ketua Kesatuan Perempuan Partai Golkar Sumut Ifrma Julita Ginting menjelaskan bahwa dalam rangka menyambut hari kartini yang jatuh pada 21 April 2013, Kesatuan Perempuan Golkar Sumut akan menggelar bhakti social yakni pelayanan berobat gratis kepada masyarakat Medan Sunggal, dan daur ulang sampah di Medan Marelan, kegiatan ini akan digelar pada 20 dan 21 April 2013. “ Kami akan menggelar bhakti social pengobatan gratis di Medan Sunggal dan gerakan daur ulang sampah di Medan Marelan, dalam kegiatan ini kami berharap dukungan dari pemerintah Kota Medan, agar kegiatan ini dapat terlaksana dengan baik, “ ujar Irma Julita Ginting.

Walikota Medan Drs H Rahudman Harahap MM mengatakan, pemerintah Kota Medan mendukung keghiatan tersebut, untuk itulah dimintakan agar panitia bhakti social melakukan koordinasi dengan Dinas Kesehatan Kota Medan, agar pihak Puskesmas Medan Sunggal dapat dilibatkan dalam bahakti social ini. Sementara itu wakil pimpinan perusahaan harian Tribun Setiawan menjelaskan, bahwa Harian Tribun akan menggelar acara Melangkah Bersama Tribun, yakni kegiatn jalan sehat yang digelar pada 15 Mei di lapngan Benteng, dengan peserta sebanyakk 10.000 orang yang melibatkan masyarakat, instansi, dan pelajar, kegiatan ini nantinya akan memecahkan rekor Muri dengan peserta terbanyak. Walikota Mesdan Drs H Rahudman Harahap MM dalam kesempatan tersebut meminta kepada panitia agar acara ini dipersiapkan dengan matang, dan nantinya acara dibuat dengan bagus dan kgiatan ini harus sukses, nantionya kegiatan ini juga dikaitkan dalam rangfka menyongsong hari jadi kota Medan dan hari Pertemua KTT APEC. (Ndo)

ya, mempunyai tujuan yang sama, yakni meningkatkan kesejahteraan petani. Disinggung tentang adanya hambatan, dari pihak PTPN2 Kebun Kelambir, atas penguasaan lahan dimaksud, Hasibuan, yang saat itu didampingi beberapa pengurus, berharap agar pihak PTPN2, tidak menghalanginya, seperti menurunkan sejumlah ratusan massa.

“ PTPN itu memiliki badan hukum, sehingga bersikap dan bertindak, sesuai dengan jalur yang telah diterapkan pemerintah, jangan sebaliknya bersikap seperti primanisme, berakibat jatuhnya korban dalam penyelesaianya “ tegas Hasibuan. Lebih dari 1500 KK yang mendaftar, untuk mendapatkan areal lahan bercocok tanam, kesemuanya dapat kita salurkan, dan peluang men-

ingkatkan tarap hidup dari para petani, akan terbuka lebar, sesuai wujud nyata UUD RI 1945, kata Hasibuan. “ Peluang membantu masyarakat petani ini, hendaknya mendapat apresiasi pihak pemerintah, dalam penyelesaian hak administratifnya, sehingga cita-cita bangsa dan negara atas kehidupan layak dibumi NKRI ini benar-benar terwujud “ tegas Edison.(San)

USM Indonesia Bantu Pemerintah Capai APK MEDAN, BN Kehadiran Universitas Sari Mutiara (USM) Indonesia di Kota Medan membuka peluang bagi masyarakat untuk mendapatkan pendidikan berkualitas. USM Indonesia juga membantu Pemerintah dalam mencapai Angka Partisipasi Kasar (APK) nasional dalam dunia perguruan tinggi. "Kami berupaya memberikan pilihan kepada masyarakat untuk kuliah di perguruan tinggi. Sebab, kami berjanji akan menciptakan USM Indonesia menjadi tempat pendidikan yang nyaman dan bermutu," kataRektor Universitas Sari Mutiara Indonesia DR. Dra. Ivan Elisabeth Purba, MKes di Medan, baru-baru ini Menurut Ivan, APK nasional masih sangat jauh dari harapan yaitu hanya 18,7 persen dengan jumlah mahasiswa di seluruh Indonesia berkisar 4,6 juta orang. Sementara, jumlah anakanak yang selayaknya kuliah di perguruan tinggi mencapai 25 juta orang. "Jika dibanding dengan angka partisipasi kasar negara maju yang mencapai 40 persen, maka Indonesia harus bekerja keras untuk mencapai target tersebut," ucapnya. Dengan rendahnya tingkat angka partisipasi kasar masyarakat Indonesia, lanjut Ivan, maka peluang perguruan tinggi yang bernaung di bawahYayasan Sari Mutiara ini, diyakini masih terbuka luas. Sebab, masih banyak anak usia kuliah yang belum terlayani dengan baik Kita yakin, USM Indonesia akan mendapat dukungan pemerintah karena tugas peningkatan APK hingga 27 persen pada tahun 2020 tidak mungkin dicapai kalau hanya mengandal-

kan Perguruan Tinggi Negeri (PTN) saja. Kami yakin peran universitas ini akan mempercepat tercapainya APK ideal bagi Indonesia,'" ujarnya. Ivan menambahkan, USM Indonesia akan mendorong tingkat kesadaran kelompok usia kuliah dengan memberi peluang yang seluas-luasnya kepada masyarakat ekonomi kurang mampu. Dengan cara memberi tawaran biaya yang terjangkau dan pemberian beasiswa baik dari pemerintah maupun dari yayasan serta dari berbagai mitra kerja selama ini. Sementara itu, Pembina Yayasan Sari Mutiara Parlindungan Purba, SH, MM mengatakan selama 30 tahun mengabdi dan berkarya di bidang pendidikan, Yayasan Sari Mutiara memandang perlu melakukan pengembangan Sekolah Tinggi IlmuKesehatan (STIKes) Mutiara Indonesia. Karenanya, pada awal tahun 2013, STIKes Mutiara Indonesia dikembangkan menjadi Universitas Sari Mutiara Indonesia. Universitas ini didirikan berdasarkan surat keputusan Kemen-dikbud nomor 10/E/O/ 2013 tangga110 Januari 2013. Universitas ini berdiri atas semangat dan cita-cita pendiri Yayasan Sari Mutiara, Bidan Sauria Sitanggang dan suaminya Drs. Washington Purba. "Pengembangan STIKes Mutiara Indonesia menjadi USM Indonesia merupakan wujud peran serta Yayasan Sari Mutiara membantu pemerintah dalam mencapai Angka Partisipasi Kasar (APK) nasional disektor perguruan tinggi," ujarnya. Tidak hanya sekadar membantu pemerintah mencapai APK nasional,

lanjut Parlindungan, USM Indonesia bertekad melahirkan lulusan yang profesional melalui pendidikan berkualitas. "Jadi, kita akan menyiapkan program pendidikan berkualitas dengan upaya peningkatan disiplin para mahasiswa. Dengan demikian kelak para lulusan USM Indonesia menjadi tenaga yang siap pakai dan profesional," kata Parlindungan. Hasil dari pengembangan STIKes Mutiara Indonesia, lanjut Parlindungan, saat ini Universitas Sari Mutiara Indonesia memiliki tujuh fakultas terdiri dari Fakultas Ilmu Kesehatan dengan program studi Kesehatan Masyarakat (SI), Keperawatan (Si), Ners (Profesi), Keperawatan (D3), Kebidanan (D3), Analis Kesehatan (D3) dan Teknik Elektro Medik (D3). Fakultas Matematika dan IPA dengan program studi Kimia (S1), Farmasi(S1) serta Analisa Farmasi dan Makanan (D3). Fakultas Ilmu Komputer dengan program studi Sistem Informasi (Sl). Fakultas Psikologi dengan program studi Psikologi (Si). FakultasEkonomi dengan program studi Akuntansi (Sl) danManajemen (Sl). Kemudian, Fakultas Ilmu Komunikasi dan Perpustakaan dengan program studi Ilmu Komunikasi (S1) dan Ilmu Perpustakaan (Si). Fakultas Hukum dengan program studi IlmuHukum (Si). USM Indonesia juga memihldProgram PascaSarjana dengan program studi Kesehatan Masyarakat (S2). Kini, Universitas Sari Mutiara Indonesia terus berbenah dengan melengkapi berbagai fasilitas, sarana dan prasarana kampus sebagai penunjang segala aktivitas para mahasiswa. (AHS)

Bupati Sergai Tutup MTQ IX dan FSN X Tahun 2013 PEGAJAHAN,BN Musabaqah Tilawatil Qur'an (MTQ) keIX dan Festival Seni Nasyid (FSN) ke-X tahun 2013 tingkat Kabupaten Serdang Bedagai (Sergai) yang berlangsung sejak 25 Maret 2013 lalu di alun-alun eks MTQ tingkat Provinsi Kelurahan Melati Kebun Kecamatan Pegajahan telah berakhir dan ditutup secara resmi oleh Bupati Sergai Ir. H. T. Erry Nuradi MSi, Kamis malam (28/3). Perhelatan akbar yang digelar selama empat hari tersebut berjalan sangat meriah dan penuh semangat dengan keberhasilan dari Kecamatan Perbaungan yang merebut predikat juara umum MTQ sekaligus FSN golongan putra. Sedangkan juara umum untuk FSN golongan putri diraih Kecamatan Tebing Syahbandar. Bagi Kecamatan yang meraih juara umum berhak memboyong piala bergilir MTQ dan FSN Bupati Sergai ke kecamatan masing-masing serta memperoleh voucher uang tunai yang diserahkan langsung oleh Bupati Sergai H. T. Erry Nuradi yang didampingi Wakil Bupati (Wabup) Ir. H. Soekirman dan Sekdakab Drs. H. Haris Fadillah MSi selaku Ketua Panitia Penyelenggara disaksikan. unsur Forum Komunikasi Pimpinan Daerah (FKPD) Sergai. Sedangkan untuk FSN juara milik bersama, karena dimenangkan oleh dua Kecamatan yaitu Kecamatan Perbaungan dan Tebing Syahbandar.

Beberapa pemenang MTQ yang diumumkan Ketua Dewan Hakim H. M. Nasir diantaranya, untuk cabang Musabaqah Tilawatil Quran (MTQ) golongan Tilawah dewasa putra terbaik I diraih oleh Sarwedi Harahap (Tanjung Beringin), terbaik I putri Khairiah (Perbaungan). Sedangkan Tilawah remaja putra Hadi Gunawan Tanjung (Tanjung Beringin) dan putri Irma Albani (Kotarih). Untuk cabang Musabaqah Hifzil Qur'an (MHQ) golongan Tahfiz I Juz terbaik putra diraih oleh Muhammad Irsandi Haikal Tanjung (Kotarih) dan putri Bai'ah (Tebing Syahbandar), Tahfiz 5 Juz terbaik I putra Ahmad Syafii (Teluk Mengkudu) dan putri Ramona (Tebing Syahbandar) serta golongan Tahfiz 10 Juz terbaik I putra Muhammad Fauzi (Tebing Syahbandar) dan putri Inayati Syafunda (Sei Rampah). Selanjutnya untuk cabang Musabaqah Syarhil Qur'an (MSQ), pembaca terbaik I diraih Kecamatan Perbaungan, terbaik II Serba Jadi dan terbaik III Kecamatan Sei Rampah. Untuk cabang Musabaqah Fahmil Qur'an (MFQ) terbaik I diraih Kecamatan Sei Rampah, terbaik II Serba Jadi dan yang ke-III Kecamatan Perbaungan. Sedangkan untuk peringkat Kafilah terbaik juara umum I diraih Kecamatan Perbaungan, juara umum II Kecamatan Sei Rampah dan juara umum III Kecamatan Tebing Syahbandar. Untuk peserta Pawai

Ta'aruf terbaik I diraih Kecamatan Sei Rampah, terbaik II Dolok Masihul dan III Kecamatan Perbaungan. Khusus stand pameran pembangunan, terbaik I diraih stand Badan Pemberdayaan Perempuan, Anak dan KB (BP2KB), disusul dengan Kantor Kementrian Agama (Kemenag), dan stand Dewan Kerajinan Nasional Daerah (Dekranasda) Kabupaten Sergai. Sedangkan harapan I diraih stand Badan Pemberdayaan Masyarakat Desa (BPMD) dan stand terfavorit diraih Dinas Kesehatan. Selain Bupati Sergai H. T. Erry Nuradi, hadir juga pada acara tersebut Ketua TP PKK Sergai Ny. Hj. Evy Diana Erry, Ketua GOPTKI Ny. Hj. Marliah Soekirman, Ketua DWP Ny. Hj. Imas Haris Fadillah, para Asisten dan Staf Ahli Bupati, Kepala SKPD dan Camat se-Sergai, Kakan Kemenag, Ketua MUI dan Ketua LPTQ Sergai, para Ketua TP PKK Kecamatan, alim ulama dan tokoh masyarakat serta ribuan undangan lainnya. Bupati Erry Nuradi yang didampingi Wabup Soekirman pada kesempatan itu mengatakan kegiatan MTQ dan FSN merupakan agenda rutin Pemkab Sergai setiap tahunnya bertujuan untuk mengembangkan nilai-nilai ajaran islam di tanah bertuah negeri beradat ini dan juga dalam rangka mendukung program Nasional dalam bidang keagamaan..(Ibnu)

Pemko Medan Prihatin Atas Tewasnya 8 Warga Myanmar WALI KOTA Medan Drs H Rahudman Harahap MM merasa prihatin atas tewasnya 8 warga Myanmar akibat bentrokan yang terjadi di Rumah Detensi Imigrasi (Rudenim) Belawan Jalan Selebes, Kelurahan Belawan II, Kecamatan Medan Belawan, Jumat (5/4) dinihari. Apalagi para korban yang tewas itu masih berusia muda, paling tua diketahui berusia 49 tahun. Untuk itu Wali Kota berharap segera dilakukan langkah-langkah penanganan yang serius dalam menyikapi masalah pengungsi sehingga kasus seperti ini tidak terulang kembali. Rasa keprihatinan ini disampaikan Wali Kota ketika melihat kedelapan jenazah warga Myanmar yang tengah dalam proses outopsi di RSUP Pirngadi Medan, Jumat (5/4). Kedelapann jenazah yang umumnya tersangkut kasus illegal fishing ini tampak terbujur kaku dengan wajah dan tubuh berlumuran darah yang sudah mengering. Pakaian yang mereka kenakan pun masih melekat di tubuhnya masing-masing. “Kita sangat prihatin sekali dengan insiden yang terjadi sehingga merenggut 8 jiwa ini,” kata Wali Kota dengan suara sedikit bergetar ketika melihat kondisi kedelapan

jenazah sangat mengenaskan didampingi Sekda Ir Syaiful Bahri Lubis MM didampingi sejumlah pimpinan SKPD dilingkungan Pemko Medan, termasuk Kabag Humasy Budi Hariono SSTP MAP. Untuk mencegah bentrok susulan terjadi kembali, Wali Kota minta pengamanan di Rudenim Belawan ditingkatkan lagi. Selain itu dia juga berencana bulan ini atau bulan depan akan menggelar seminar yang terkait dengan penanganan pengungsi di Medan, termasuk dengan United Nations High Comissioner for Refugees (UNHCR) yakni organisasi PBB yang memberikan perlindungan dan bantuan kepada para pengungsi. “Selanjutnya saya akan berkoordinasi dengan pihak Imigrasi. Sebab, korban yang tewas ini bukan penduduk kita. Tadi malam saya dapat laporan dari Bapak Kapolres bahwa penanganan pengamanan telah dilakukan secara maksimal . Saya kira penjelasan terkait dengan masalah bentrokan ini akan dijelaskan pihak kepolisian. Saya hanya melihat jenazah para korban. Kita belum tahu apakah jenazah mereka akan dipulangkan ke Myanmar atau bagaimana. Jenazah yang paling tua berusia 49 tahun,” ungkapnya.

Usai melihat jenazah kedelapan korban, Wali Kota selanjutnya melihat tempat kejadian perkara (TKP) di Rudenim Belawan. Di tempat itu Wali Kota disambut Kapolresta Pelabuhan Belawan AKBP Endro Kiswanto yang telah tiba lebih dahulu. Begitu memasuki ruangan, tampak puluhan wartawan baik cetak dan elektronik tengah melakukan peliputan. Selain itu terlihat belasan aparat kepolisian bersenjata lengkap siaga di tempat terswebut. Kemudian, Kapolresta membawa Wali Kota menuju TKP yang berada di lantai dua. Petugas Rudenim juga melakukan penjagaan ketat, tidak semua diperbolehkan masuk untuk melihat TKP. Saat berjalan menuju tangga menuju lantai dua, puluhan pengungsi dari beberapa negara berkumpul menjadi satu di tempat tersebut. Ada yang duduk, tidur-tiduran dan berjalan hilir mudik tanpa mempedulikan lokasi sekitar. Di samping itu ada juga terlihat pengungsi yang berada dalam ruangan mengintip dari balik pintu besi. Usai melihat TKP, Wali Kota kepada wartawan mengaku sangat prihatin dengan kondisi seluruh pengungsi yang ditampung di tempat tersebut. Jumlah pengungsi yang ada melebihi kapasitas ruangan sehingga para

pengungsi harus berdesakan. “Tempat ini sangat tidak mendukung sehingga terjadinya over capacity. Untuk itu saya berharap kepada pemerintah pusat agar memperhatikan ini, minimal harus ada perluasan dan pengamanan yang lebih ketat lagi,” harapnya. Sementara itu Kapolresta Pelabuhan Belawan AKBP Endro Kiswanto menjelaskan, kronologis kejadian sekitar pukul 01.30 WIB. Begitu bentrok terjadi, petugas Rudenim langsung menghubungi Polresta Pelabuhan Belawan untuk minta bantuan pengamanan. Sampai di lokasi, aparat kepolisian yang datang tidak memungkinkan melakukan pengamanan karena jumlahnya cukup banyak. “Untuk itu dikirimkan lagi 30 petugas Dalmas yang datang bersama-sama dengan saya. Setelah tiba di lokasi dan melakukan pengamanan, kita cek di lantai dua ditemukan 8 mayat korban dari Myanmar. Apa motif bentrokan, masih kita dalami dan kembangkan, termasuk pasal-pasal yang akan dikenakan nanti. Selain itu kita amankan juga yang luka-luka sebanyak 15 orang. Kemudian yang kita mintai keterangannya lebih kurang 25 orang,” jelas Kapolresta. (Ndo)

Pemko Medan Segera Bangun Jembatan di Sari Rejo MEDAN, BN Pemko Medan telah menyipakan anggaran sebesar Rp.2,9 miliar untuk membangun jembatan di Jalan Cinta Raya Kelurahan Sari Rejo, Kecamatan Medan Polonia. Pembangunan akan dilakukan secepatnya, sebab pembangunan jembatan ini telah ditenderkan dan pemenangnya sudah ada. Kehadiran jembatan permanen ini sangat penting sekali, sebab merupakan akses penting. Diharapkan kehadiran jembatan yang akan dibangun nanti semakin memperlancar akses warga yang bermukim di Kelurahan Sari Rejo dan Kelurahan Beringin, Kecamatan Medan Selayang. Hal ini terungkap ketika Wali Kota Medan Drs H Rahudman Harahap MM bersama Wakil Wali Kota Drs H Dzulmi Eldin MSi didampingi Sekda Ir Syaiful Bahri Lubis serta sejumlah pimpinan SKPD di lingkungan Pemko Medan melakukan peninjauan, Kamis (4/4). Saat ini warga menggunakan jembatan bailey bantuan Kodam I/BB sebagai sarana penghubung kedua kelurahan tersebut. Menurut Wali Kota, jembatan bailey ini dibangun setelah jembatan gantung yang dibangun sekitar tahun 1970-an rusak parah akibat diterjang banjir pada April 2011. “Jadi kita sudah menyiapkan anggaran sekitar Rp.2,9 miliar untuk membangun jembatan permanen menggantikan jembatan bailey. Kita sudah tenderkan dan pemenangnya sudah ada, jadi pembangunan jembatan akan dilakukan secepatnya,” kata Wali Kota. Menurut Wali Kota, jika pembangunan dimulai, maka jembatan bailey akan dikembalikan karena merupakan aset Kodam I/BB. Dia berharap kehadiran jembatan baru nantinya akan member rasa aman dan nyaman bagi warga sekitar ketika melintasinya. Selama ini setiap kali melintas, warga sedikit was-was karena lantai jembatan terbuat dari kayu. “Selain itu kita berharap kehadiran jembatan baru nanti akan memperlancar akses warga, sekaligus membantu mengurai kemacetan yang terjadi di sekitar kawasan tersebut. Sudah lama sekali warga disini sangat mengharapkan kehadiran jembatan permanen. Untuk itulah kita melakukan peninjauan siang ini guna menyahuti keinginan warga tersebut,” ungkapnya. Ketika tiba di lokasi, Wali Kota langsung mengecek kondisi jembatan bailey. Warga sekitar yang mengetahui kehadiran Wali Kota langsung datang menghampiri. Mereka selanjutnya bermohon kepada Wali Kota agar dibangun jembatan permanen. Setelah dijelaskan Wali Kota kedatangannya meninjau untuk persiapan pembangunan jembatan permanen, warga langsung menyambut dengan gembira dan penuh suka cita. Selanjutnya Wali Kota menyampaikan permintaan maaf kepada warga, sebab pembangunan jembatan yang akan dilakukan nanti dipastikan akan mengganggu kelancaran askes warga. Untuk itu atas nama pribadi dan Pemko Medan, Wali Kota menyampaikan permintaan maafnya kepada warga, terutama yang bermukim di sekitar jembatan tersebut. “Namanya juga membangun, kelancaran arus lalu lintas di sekitar kawasan ini dipastikan terganggu selama pembangunan jembatan berlangsung. Jadi saya berharap kepada warga agar dapat menerimanya dengan hati yang ikhlas. Semoga jembatan yang baru dibangun ini nantinya dapat menjadi salah satu solusi mengatasi kemacetan yang ada di kota ini,” harapnya. (Ndo)

Wali Kota Tinjau Pembangunan Fly Over Simpang Pos MEDAN, BN Wali Kota Medan Drs H Rahudman Harahap MM meninjau pembangunan jembatan fly over Simpang Pos Jalan Jamin Ginting Medan, Kamis (4/4) petang. Selain untuk mengetahui sejauh mana proses pembangunan yang sudah dilakukan, Wali Kota juga ingin mengetahui apa yang menjadi kendala sehingga mengganggu kelancaran pembangunan jembatan layang kedua di ibukota provinsi Sumatera Utara ini setelah fly over Pulo Brayan tersebut. Dari hasil peninjauan yang dilakukan bersama Kepala Satuan Kerja Pelaksanaan Jalan Nasional Metropilitan Medan Mula Tua Sinaga, Sekda Ir Syaiful Bahri Lubis MM serta sejumlah pimpinan SKPD dilingkungan Pemko Medan, Wali Kota menilai proses pengerjaan jembatan fly over Simpang Pos yang dilakukan saat ini termasuk cepat. “Rencananya, bulan ini kiri kanan jalan sudah bisa dipergunakan supaya full pembuatan tiang tengah. Sebab, titik fokus pembangunan fly over adalah tiang tengah ini. Karena itu saya berharap jangan ada lagi kendala-kendala sehingga mengganggu kelancaran pembangunan fly over ini,” kata Wali Kota. Berdasarkan informasi yang diperoleh Wali Kota di lapangan, salah satu kendala yang mengganggu kelancaran pembangunan fly over terkait terjadinya kemacetan arus lalu lintas. Ternyata yang menjadi penyebabnya adalah kehadiran sejumlah stasiun-stasiun liar. Untuk itu saya minta Satlantas Polresta Medan dan Dinas Perhubungan Kota Medan berkoordinasi untuk mengatasinya. Untuk itu saya minta mulai besok harus ditertibkan agar pengerjaan fly over dapat berjalan dengan baik dan lancar!” tegasnya. Selain fly over Simpang Pos, jelas Wali Kota, Kepala Satker Pelaksanaan Jalan Nasional Metropilitan Medan Mula Tua Sinaga tengah memperjuangkan kemungkinan dibangunnya jembatan fly over di Jalan Gatot Subroto Medan, persisnya persimpangan Jalan Asrama dan Jallan Ring Road (Gagak Hitam). Kemudian pembangunan fly over Pinang Baris dan underpass Titi Kuning. Pembangunan itu tinggakl menunggu persetujuan dari pusat. “Untuk lokasi pembangunan sudah tidak ada masalah lagi,” jelasnya. Karena itulah sebelum melakukan peninjauan pembangunan fly over Simpang Pos, Wali Kota beserta rombongan terlebih dahulu meninjau Jalan Gatot Subroto, persisnya persimpangan Jalan Asrama dan Jalan Ring Road. Di tempat itu Wali Kota memberikan gambaran terkait dengan pembangunan fly over yang akan dilakukan kepada Mula Tua. Kehadiran fly over diyakini Wali Kota mampu mengatasi kemacetan yang acap kali terjadi di kawasan tersebut. Itu sebabnya Wali Kota sangat berharap upaya yang dilakukan Mula Tua membuahkan hasil. “Saya yakin dengan kehadiran fly over dan underpass yang baru nanti, mampu mengurai titik-titik kemacetan yang ada di Kota Medan. Dengan demikian masyarakat pengguna jalan bisa lebih merasa aman dan nyaman lagi,” ungkapnya. Kepala Satker Pelaksanaan Jalan Nasional Metropilitan Medan Mula Tua Sinaga mengatakan, pembangunan yang dilakukan pihaknya saat ini adalah fly over Simpang Pos. Setelah itu akan fokus dua fly over lagi yakni fly over Pinang Baris, fly over Jalan Gatot Subroto serta underpass Titi Kuning di Jalan Brigjen Katamso. “Untuk pembangunan underpass Titi Kuni kini dalam tahap studi, pemabngunan fly over Pinang Baris sudah dalam tahap desain. Sedangkan satu lagi kita sekarang sedang berjuang untuk membangun fly over Jalan Gatot Subroto sehingga dapat menjadi bagian fly over yang ada di Kota Medan,” papar Mula. (Ndo)


8 - 15 APRIL 2013 | EDISI 354 | THN KE-VIII

CV. BONGKAR PERS NEWS Badan Hukum: Akte Notaris Hermaini,SH No.4 Tanggal 10 Agustus 2009 Pengesahan PN Medan No: 1520/CV/PEND/2009 NPWP: 02.996.694.2-121.000 Pembina

: Drs. H. Kasim Siyo MSi Drs. Hendra DS HMK Aldian Pinem, SH, MH Uli Tobing Benny Soetedjo Eben Pegagan Manik

Pemimpin Umum

: Muhammad Ridwan

Pemred/Penjab

: Sunardi Bonang

Wakil Pemred I/ Wakil Penjab : ESP Parindoery Wakil Pemred II/ Wakil Penjab : A. Sani Simbolon Wakil Pemimpin Umum I Wakil Pemimpin Umum II

: Johnesly Meliala : Irwansyah B

Pimpinan Perusahaan

: Pendi Hariyono

Redaktur Pelaksana

: Drs. Alfindo Amir Hamzah Siregar, SH

Dewan Redaksi

: Mangatur Silaban Drs. Edward Pakpahan H.Zulkarnain Abidin Rudi Sirait EPP Ringo-ringo, SE Muhammad Siregar

Koordinator Liputan

: Jakfar Margiono

Koordinator Daerah

: Indrawan Sukma Antoni Sagala

Litbang/ SDM

: Sudari,SH (Kabag) Leonard Hutasoit Erviyanto, SE Jamal Thahir

Pemasaran/Iklan

: Jamaluddin Salmahadi

Fotografer/Teknisi

: Supriadi

Penasehat Hukum

: Nurmahadi Darmawan, SH Mardianto Situmeang, SH Rosmawati, SH

Sekretaris Redaksi

: Toni Purwadi, SH

Keuangan

: Rini Alamsyah SPd

BI Usulkan Pentingnya Percepatan Pembangunan Infrastruktur di Sumut MEDAN,BN Bank Indonesia (BI) Kantor Perwakilan Wilayah IX Sumut-Aceh mengusulkan pentingnya percepatan pembangunan infrastruktur di berbagai proyek besar Sumatera Utara pada tahun 2013 ini seperti Bandara Kualanamu, pengembangan pelabuhan Belawan dan kawasan industri Sei Mangke. Pemimpin Kantor Perwakilan Bank Indonesia (BI) Wilayah IX Sumut-Aceh Hari Utomo mengatakan hal itu pada Musyawarah Perencanaan Pembangunan (Musrenbang) Sumut tahun 2013 di Hotel Santika baru-baru ini. Acara yang bertema "Peningkatan Daya Saing untuk Menetapkan Perekonomian Daerah dan Kesejahteraan Rakyat" itu berlangsung hingga 5 April. Pada hari pertama selain BI, juga ada pengurus Kadin Sumut, Kepala Badan Pusat Statistik (BPS) Suharno dan Kepala Bappeda Sumut Riadir Akhir Lubis memaparkan makalahnya, termasuk mengusulkan sejumlah masukan pada Musrenbang tersebut. Dia menilai infrastruktur yang ada sekarang belum memadai dalam mendukung pertumbuhan Sumut yang berkesinambungan. Hal ini

mengakibatkan jalur distribusi komoditas utama yang relatif panjang dan kurang transparannya informasi biaya perijinan dan lain-lain berpotensi menimbulkan ekonomi biaya tinggi. "Untuk infrastruktur, perbaikan kualitas jalan utama terutama yang menjadi jalur distribusi komoditas utama Sumut sangat penting sekali diperhatikan," katanya. Selain infrastruktur Hari juga menekankan akses pengusaha Usaha Mikro Kecil dan Menengah (UMKM) terhadap pembiayaan masih perlu ditingkatkan. Menurutnya, peningkatan akses perkreditan terhadap pengusaha UMKM yakni percepatan pembentukan Perusahaan Penjamin Kredit Daerah (PPKD), pengaktifan sistem resi gudang sebagai jaminan pembiayaan dan perluasan program sertifikasi tanah masyarakat sebagai jaminan pembiayaan."Juga perlu penciptaan iklim investasi yang kondusif melalui kepastian hukum," katanya. Ia juga mengungkapkan ekonomi Sumut memiliki prospek untuk tumbuh sedikit lebih tinggi di tahun 2013 jika dibandingkan dengan tahun sebelumnya dan diperkirakan

akan semakin membaik di tahun 2014. BI menargetkan pertumbuhan ekonomi Sumut tahun 2013 sebesar 6,3-6,5.0%, sedangkan tahun 2014 sebesar 6,4-6,6%. Lanjutnya, target pertumbuhan ekonomi Sumut itu didukung oleh prospek peningkatan konsumsi domestik, adanya potensi berkembangnya indsutri hilir CPO yang memiliki nilai tambah lebih besar. Juga potensi investasi baru dengan masuknya rating Indonesia ke invesment grade."Ekonomi Sumut didorong oleh prospek pertumbuhan investasi di industri hilir kelapa sawit," katanya. Hari menyebut perkembangan luas perkebunan kelapa sawit akan terus meningkat. Pertumbuhan industri hilir juga akan meningkat seiring dengan kebijakan pemerintah yang mendorong industri hilir untuk berkembang antara lain dengan pengenaan bea keluar progresif CPO. Kluster industri hilir Kelapa Sawit (IHKS) Sei Mangkei akan memproduksi unilever oleochemical, procter & gamble dan ferrostal."Industri kelapa sawit di Sumatera Utara akan membutuhkan banyak dana investasi dan merupakan kesempatan bagi dunia perban-

kan untuk mendanainya," jelas Hari. Mengenai inflasi, ia menyebut padsa tahun 2013 ditargetkan sebesar 4,5%Âą1% dan tahun 2014 juga sama 4,5%Âą1%."Ke depan, inflasi Sumut diperkirakan meningkat namun cukup terkendali dan diperkirakan sesuai target yang ditetapkan," katanya. Saat ini, untuk pengendalian inflasi dilakukan oleh Tim Pengendalian Inflasi Daerah (TPID) Provinsi Sumut dan TPID Kota Medan, Pematangsiantar, Padangsidempuan dan Sibolga. "Nanti ke depan masing-masing kabupaten kota sudah terbentuk TPID," katanya. Pameran Usai memaparkan makalahnya, Hari bersama nara sumber lainnya seperti Kepala BPS Sumut Suharno, Kepala Bappeda Sumut Riadir Lubis dan pengurus Kadin Sumut meninjau stan pameran industri kecil yang dibina oleh BI di lokasi Musrenbang tersebut. Hari didampingi Kabid Ekonomi dan Moneter BI Wilayah IX SumutAceh Mikael Budisatrio dan Humas Samsir Alam mengatakan pada pameran ini BI menampilkan tiga kel-

Perusahaan Agen Property Ray White Buka Kantor Baru di Medan

KONTAK PERSON IKLAN/SIRKULASI HP. 0816 3134 392/0813 7539 5392 IKLAN DISPLAY/UMUM RP 6.000/MM FULL COLOUR RP 21.000/MM KANTOR REDAKSI JL. FLAMBOYAN RAYA/RAHARJA NO. 37 MEDAN TELP (061) 8213786, FAX (061) 8215552 NO. REKENING: 5310 - 01 - 004167 - 53 - 5 AN. SUNARDI, BANK BRI UNIT TANJUNG SARI MEDAN PERCETAKAN/PRA CETAK : PT MEDAN GRAINDO (Isi Diluar Tanggung Jawab Pra Cetak/Percetakan)

Dukung Program Ketahanan Pangan

Panen Kedelai Perdana 1,5 Ton/ Ha di Kebun Gunung Para MEDAN, BN PT Perkebunan Nusantara III ikut serta dalam program ketahanan pangan nasional yang dicanangkan oleh Kementerian BUMN melalui berbagai program di luar core business perusahaan. Salah satu diantaranya adalah menanam kedelai di sela-sela (di gawangan) tanaman karet yang berukuran 20 kali 20 sentimeter yang terletak di wilayah kebun PTPN III. Penanaman kedelai dilakukan di sembilan kebun yaitu kebun Tanah Raja 25 ha, kebun Rambutan 25 hektar, kebun Gunung Para 25 ha, kebun Sarang Gitting 25 ha, kebun Silau Dunia 20 ha, kebun bandar Betsy 40 ha, kebun Sei Silau 25 ha, kebun Rambutan 16 ha dan kebun Pulo Mandi 15 ha. Total areal untuk tanaman kedelai difasilitasi perusahaan mencapai 216 ha. Menurut keterangan Distrik Manajer Deli Serdang I, Herbet T Panjaitan bahwa produktivitas tanaman kedelai yang ditanam di puncak musim hujan pada pertengahan bulan Desember 2012 dan dipanen pada musim kemarau di bulan Maret 2013 ini mencapai rata-rata 1,1-1,5 ton/ha. Sedangkan khusus di kebun Gunung Para rata-rata panen yang dapat dihasilkan dari 25 hektar lahan yang diperuntukkan untuk tanaman kedelai mencapai 1,5 ton/ha. Program ketahanan pangan yang dilakukan saat ini adalah bagian dari sinergi BUMN antara PTPN III selaku perusahaan penyedia lahan dan modal saprodi, sementara PT Sang Hyang Seri berperan sebagai konsultan penanaman dan perawatan kedelai. Untuk dukungan sarana produksi diantaranya penyediaan jenis bibit unggul seperti anjasmoro, pupuk dan bahan kimia untuk mengatasi hama penyakit. Sedangkan tenaga kerja sekaligus penerima keuntungan dari program ini adalah masyarakat sekitar unit kebun yang terdiri dari kelompok-kelompok tani di antaranya untuk wilayah kebun Gunung Para yaitu kelompok tani Karya Jaya, Karya Bakti, Bina Makmur dan Karya Makmur. Megananda Daryono, Dirut PTPN III mengungkapkan kegembiraannya karena keberhasilan program penananam kedelai di kebun-kebun PTPN III sehingga bisa panen pada tanggal 27 Maret 2013 dengan tingkat produksi 1,5 ton/ha. "Ini sungguh luar biasa dan menggembirakan bagi kita semua, dan berharap ke depan program ini akan kita teruskan," katanya dengan bangga. Ia juga menambahkan bahwa ke depannya PTPN III akan menambah jumlah tanaman buah tropis untuk mendorong peningkatan kesejahteraan ekonomi rakyat di lingkungan perkebunan sambil tetap fokus dengan core business perusahaan yaitu karet dan sawit. Program ketahanan yang dilaksanakan PTPN III ternyata memberikan dampak secara langsung bagi petani dan masyarakat sekitar. Sekretaris Daerah Sergei, Harris Fadhillah, mengucapkan terima kasih kepada kedua BUMN khususnya kepada PTPN III yang telah berperan n yata bagi kesejahteraan masyarakat melalui program ketahanan pangan di Sergei. Ia berharap semoga ke depan program dapat dilanjutkan. Panen perdana ini dihadiri oleh Balaman Tarigan, Direktur Produksi, Kapolres Deli Serdang, PT Sang Hyang Seri, Distrik Manager dan Manajer serta para kepala bagian PTPN III, kelompok tani dan undangan lainnya. (AHS)

MEDAN, BN Telkomsel memberikan apresiasi khusus kepada pelanggan yang sering melakukan isi ulang pulsa bagi pengguna kartu simPATI, kartu As, dan Facebook, melalui program Rezeki Isi ulang Tahap 2. Head of Sales and CustomerCare Division Telkomsel FilinYulia, mengatakan, pemberian apresiasi ini mengingat wilayah Sumatera jumlah pelanggannya terus meningkat. Adalah wajar bila kami terus memperhatikan mereka yang tetap setia menggunakan produk kami, ujarnya. Mekanisme pemberian apresiasi ini caranya hanya dengan melakukan isi ulang pulsa minimal Rp10 ribu berkesempatan mendapatkan hadiah Grand Prize Mobil Ford Fiest M/T, dan hadiah menarik lainnya. Menurutnya, program ini berlaku bagi pelanggan Sumatera kecuali NAD, P.Siantar dan Padang Sidempuan yang

memang wilayah tersebut memiliki apresiasi tersendiri kepada pelanggannya mulai 20 Maret 2013 sampai dengan 30 Juni 2013. Disebutkannya, pelanggan melakukan isi ulang pulsa Rp20.000 akan mendapatkan dua bintang, isi Wang Rp50 ribu mendapat lima bintang, dan bagi pelanggan melakukan isi ulang Rp.l00 ribu langsung mendapatkan 10 bintang. Jumlah minimum bintang harus dimiliki pelanggan agar berkesempatan diundi dalam program ini adalah 10 bintang. Artinya semakin sering mengisi pulsa sesuai nominal ditentukan, maka bintang yang terkumpul semakin banyak dan kesempatan menjadi pemenang semakin besar. "Program ini merupakan bentuk apresiasi Telkomsel bagi pelanggan yang rutin melakukan isi ulang pulsa dan memang sengaja kami lakukan kembali

mengingat antusisme pelanggan yang sangat tinggi pada program Rezeki Isi Ulang Tahap 1 yang kami lakukan dipertengahan tahun 2012 lalu", katanya menambahkan. Selain tiga unit Mobil Ford Fiesta M/ T, hadiah lainnya diantaranya Sembilan unit Motor Yamaha Mio Type J, 45 unit Tablet Speed Up Pad 8, 270 unit HP3G, dan 5000 voucher pulsa masing-masing senilai Rp50.000. Pengundian pemenang akan dilakukan pada bulan Juli 2013 serta seluruh pajak hadiah ditanggung Telkomsel. Filin berharap melalui program ini pengguna kartu prabayar Telkomsel akan semakin merasakan manfaat saat mengisi pulsa, karena selain dapat menikmati tarif murah dengan kualitas terbaik dari Telkomsel, pelanggan berkesempatan mendapatkan hadiah yang sudah disiapkan. (AHS)

ompok yakni industri kreatif daur ulang tergabung dalam Komunitas Green Teacher Indonesia. Kelompok ini mendaur ulang limbah seperti plastik, koran, uang kertas lama yang tidak laku lagi dan sebagainya. Untuk limbah uang kertas, perajin meracik uang tersebut hingga menjadi potongan kecil dan dibuat menjadi beragam barang seperti tas, ransel dan sebagainya. Tas ransel yang unik tersebut dijual Rp100.000 per buah. Kelompok lainnya industri daur ulang kelompok wanita di Belawan. Kaum ibu ini juga memproduksi barang-barang berbahan dasr limbah seperti kertas, koran, plastik, botol dan sebagainya. BI memberikan peralatan penunjang seperti mesin compressor untuk mengecat, mesin pemotong kertas, gergaji mesin dan sebagainya. Kemudian kelompok (klaster) budidaya ikan lele di Desa Tebing Tinggi, Sergai. Klaster beranggotakan delapan kelompok (tiap kelompok 15 orang) ini memmbudidayakan ikan lele. Dua kelompok lagi memproduksi produk turunannya seperti abon lele, bakso lele, nugget lele dan kerupuk lele. (AHS)

Pembangunan Butuh Dukungan Dari Perbankan MEDAN, BN Pembangunan membutuhkan dukungan dari semua pihak, terutama perbankan, karena pemerintah tidak bisa berjalan sendirian, Pembangunan harus dilakukan tidak secara parsial, tetapi harus dilakukan secara konprehensif dengan melibatkan setiap potensi yang ada. "lembaga perbankan memiliki posisi sangat strategis dalam pembangunan. Hal ini bisa dilihat dari relevansi kegiatan perbankan disuatu daerah. Apabila kegiatan perbankannya baik, maka kondisi pembangunannya akan baik. Begitu juga, apabila kegiatan ekonomi suatu daerah baik, maka kegiatan perbankan akan baik pula. Hal ini sesuai dengan fungsi perbankan sebagai lembaga intermediasi," kata Sekretaris Daerah Provinsi Sumatera Utara (Sekda Provsu) Nurdin Lubis, dalam peresmian kantor layanan cabang BNI di Medan, baru-baru ini. Nurdin mengatakan, dalam perspektif pembangunan ekonomi, perbankan harus berfungsi sebagai lembaga intermediasi static invesment menjadi dynamic invesment, dimana masyarakat menyimpan tabungan atau depositonya sebagai investasi pasif dengan mengharapkan return atau bunga dari pihak perbankan sebagai lembaga intermediasi yang menyalurkan kredit kepada pihak lain atau masyarakat untuk kegiatan produktif. "Berdasarkan kerangka ini kita bisa melihat bagaimana kontribusi lembaga perbankan dalam pembangunan perekonomian di Sumut. Apakah kehadiran lembaga perbankan memberikan nilai positif bagi masyarakat di sekitarnya atau sebaliknya. Oleh karena itu, saya mengharapkan BNI mampu menjadi salah satu katalisator peningkatan ekonomi masyarakat, khususnya bagi pertumbuhan Usaha Mikro Kecil dan Menengah (UMKM) di Sumut," ujarnya. Menurutnya, proses pembangunan ekonomi bukan hanya bergantung pada kinerja perbankan saja, tetapi juga akibat kinerja bersama, karena lembaga perbankan juga tergantung dari kinerja pemerintah dan kinerja sektor swasta lainnya. Perbaikan kinerja perbankan harus sejalan dengan peningkatan kinerja pemerintah seperti halnya pada pembinaan UMKM. "Kita pahami, peningkatan kemampuan ekonomi pengusaha khususnya UMKM harus ditunjang dengan pembangunan infrastruktur," kata Nurdin Lubis. (AHS)

Honda CBR 250 Pemenang Seri I Kejurnas Disentul 250 cc seri pertama para pebalap Astra Racing Team (ART) langsung unjuk gigi, dan seolah mengulang hasil seri pertama ajang yang sama pada 2012 Silam, dua CBR250 milik ART kembali mencatat hasil mencengangkan dengan sukses mengamankan barisan depan seolah tanpa perlawanan berarti, dimana wawan Hermawan memimpin di urutan`pertama dengan catatan waktu 1 merit 47 detik, sementara Iswandi Muis rekan Satu timnya menyusul tepat di belakangnya. Meski harus kalah dari 2 pembalap tim ART, namun Dwi Satria yang merupakan pembalap Pebalap Honda yang tergabung di Astra Racing Team kembali tim Wahana Dunia Motor. NHK mendulang hasil gemilang di ajang Kejurnas IRS di Sentul juga tidak kalah hebatnya. International Circuit(SIC), Bogor, Jawa Barat. Namun tepat di Race kedua, Wawan tidak bisa berbuat banyak dan harus puas dengan posisi HONDA CBR250 sukses menjadi berlangsung akhir Minggu ini ketiga. Meski mampu terus primadona di Kejurnas Indoo dibagi menjadi dua sesi, dimana mempertahankan posisinya Speed Race Series (IRS) 2013 250 Race pertama diadakan pada diurutan terdepan di awal balapan, cc seri pertama yang berlangsung Sabtu, 30 Maret 2013, sementara namun persaingan ketat dengan di Sentul International Circuit race kedua diadakan pada hari Iswandi Muis dan Dwi Satria (SIC), Bogor, Jawa Barat. Ajang Minggu, 31 Maret 2013. Pada justru tidak bisa dihindari. balapan bergengsi yang Race pertama Kejurnas IRS 2013

Iswandi yang lihai memanfaatkan celah kosong di pertengahan balapan langsung melesat meraih juara. Perebutan posisi finish di urutan kedua pun tidak kalah serunya, meski nyaris sama dengan perebutan podium utama, namun kali ini Dwi Satria justru mampu memperlihatkan agresifitasnya hingga berhasil menempati urutan kedua. Beruntung semua pembalap bermain dengan cukup sportif, sehingga balapan tetap berlangsung seru untuk ditonton. Leo Wijaya, Marketing Manager CV Indako Trading Co, selaku main dealer. Honda di wilayah Sumatera Utara, mengungkapkan, pihaknya sangat berbangga dengan hasil gemilang yang diukir oleh pebalappebalap Honda pada ajang Kejurnas IRS ini. "Prestasi ini pastinya semakin membuktikan bahwa produk Aport Honda memang tangguh, berkelas dan teruji,"ungkap Leo Wijaya, di ruang kerjanya jalan

Pemuda Medan. Sementara itu, Gunarko Hartoyo, Corporate and Marketing Communication Manager CV Indako Trading Co mengungkapkan ajang ini diharapkan dapat memicu semangat pebalap-pebalap Honda untuk terus mengasah kemampuan dan berprestasi hingga akhirnya dapat mengibarkan sang Merah Putih di puncak arena balap dunia. Dwi Satria sendiri merupakan salah satu dari 4 pembalap yang tahun ini akan diboyong Honda ke ajang balap tingkat Asia dan balap Dunia, dimana la akan mengikuti ajang Suzuka 4 Hours Endurance race, kelas Supersport 600 cc dan Asia Dream CUP 250 cc. Selain itu, Denny Tiyugo juga akan mengikuti ajang Wild Card Motor 3 2013" dan GP3 All Japan Championship, dan lswandi Muis yang akan bertarung di ajang Suzuka 4 Hours Endurance Race, kelas Supersport. 600 cc, serta Gerry Laurens yang akan mengikuti Asia Dream Cup 250 cc. (AHS)

Perwakilan Jakarta: Suryadi, Lukman Nyak Abas. Medan: Heru Indrabudi, Darta Lubis, Andi Utama Nasution, SE, Wiryanto Hadi, Fernando Meliala, Brav Shandy Meliala, M. Arif Thahar. Biro Belawan: Jakfar Latif, Suriono. Sub Biro Medan Utara: Ahmad Muhajir, M. Saleh, M. Yakup. Sub Biro Amplas : Saulus Panjaitan, SH . Binjai/Langkat: Munir Rangkuti (Ka.Biro), Sabar Gurusinga, Mimpin Sitepu, M. Hayat, Ruslan AG, Hendera Ginting, T. Zulfikardin, Frisca Osela, Jefriyansyah, Syalamuddin, Parida, Grensi Ginting, Dedi Sitepu. Langkat Hilir: Irfan Nasirin ST (Ka.Biro). Langkat Hulu: Teger Bangun (Ka. Biro). Deli Serdang: Romi Heripanti Nasution (Ka. Biro), Indrawan S (Waka Biro), Suhendra. Tanah Karo: Farhan Parinduri (Ka. Biro), Dedy Jasana Barus (Waka Biro), Aman Harahap Sub.Biro Pancur Batu: M Rizal Effendi Bako,SPdi, . Serdang Bedagai: Ibnu As (Ka.Biro), Hendra Gunawan (Waka Biro), Suherman, Abdul Rahman, Herman. Tebingtinggi: Dirlan Effendi Ritonga (Ka.Biro). P Siantar/Simalungun: Drs Edward Pakpahan (Ka.Biro), Erikson Pakpahan, Drs. Kaliderman Siregar. Batubara: Suyanto (Ka. Biro), Jamilah (Waka Biro), Eko, S, Sunaryo Wijaya, Feri Saputra. Asahan/Tanjungbalai: Hamdan Samosir (Ka. Biro), Sulijon Hutapea, Wahidun, Dedi Hidayat, Rahmat P Ritonga, Suhendri. Labuhanbatu: -. Kotapinang/Labusel: Syamsul Siregar. Aek Kanopan/Labura: Sriwaty Sinuraya (Ka. Biro), L. Parulian Simarmata, SE. Sumbagut: Mhd Syahrul Hasibuan SH, Sutardi, Supendi. Dairi: - Pakpak Bharat: Yusuf Manik (Ka.Biro). P Sidimpuan/Tapsel/Paluta: Sugiono SP (Koordinator), Safruddin Pulungan (Ka. Biro), Muhammad Srg, Baun Aritonang, Hasanuddin Siregar, Ibnu Saad Harahap, Unggul Fahmi Hasibuan. Kotanopan/Madina: Saharman Nasution (Ka Biro)-. Padang Lawas Selatan: Ali Akbar (Ka. Biro).Humbang Hasundutan: Mangatur Silaban (Koordinator), Rikardo Simamora (Ka. Biro), Chuharto Simamora, Pardomuan Silaban. Biro Taput: Mangatur Silaban (Ka. Biro) Biro Tapteng/Sibolga/Nias: - Perwakilan Riau/Kepri: EPP. Ringo-ringo, SE. Korwil Riau/Kepri: Rudi Sirait. Pekanbaru: Jaraya Garingging, S.Sos. Siak: Jaraya Garingging, S.Sos. Pelalawan/Pkl.Kerinci: EPP. Siringoringo (Ka.Biro), Lingkon S. Dumai: Albekri, Tengku Kamaruddin, Belwiyono, MG, Suhartono, Elias G.S.M Sidabutar. Bengkalis: Mahir Ritonga, Misron Tarihoran, Parulian Manurung, Novalis P. Hutahaen, Irwansyah Nasution, Alwi. Rokan Hilir (Rohil): Juminan (Ka.Biro), Basri M Noer, Supryanti, Julientri. Biro Rokan Hulu: -. Biro Kampar: -.Perwakilan Kepri/Batam: Herman Hendro Manurung (Ka Biro), Nelson Hutapea Perwakilan Aceh: T Muktarruddin US - . Biro Banda Aceh/Aceh Besar: T Muktarruddin US (Ka. Biro), Ibrahim Yusuf, Afrizal. Biro Pidie/Pidie Jaya: Mahdi Aziz, SHi. Biro Langsa/Aceh Timur: Mustafa M. Adami, Syamsudin Arsyad. Aceh Tamiang: Zulherman (Ka Biro), Fori Zalmi Wandi Akbar, Ros Muliana, Bahaki Ahyat, ST.MT, Ir. Fadly,Galuh Cipta Murni, - Biro Aceh Singkil/ Subulussalam: Rahmin Banchin (Ka. Biro), Henri, B,SE. Biro Aceh Jaya: Syarkawi. Aceh Barat: Kairul Aryadi. Biro Kutacane: . Lhokseumawe: - . Aceh Utara: Jamaluddin (Ka. Biro), M Suud, Ramli, Sayed Fauzi, Zulfikar. Biro Blangkejeren/Gayo Lues: Antoni Nasipul. Biro Aceh Tengah/ Bener Meriah: Al Muzaini (Ka Biro), Sabri, Pujianto (WARTAWAN BONGKAR NEWS DILENGKAPI IDENTITAS DAN NAMANYA TERCANTUM DALAM BOKS REDAKSI)


8 - 15 APRIL 2013 | EDISI 354 | THN KE-VIII

Musrenbang Harus Memberi Kontribusi Bagi Percepatan Pembangunan

LUBUK PAKAM, BN Wakil Bupati Deli Serdang H Zainuddin Mars mengharapkan pelaksanaan Musrenbang (Musyawarah Rencana Pembangunan ) tidak sekedar serimonial tetapi harus mampu memberi kontribusi bagi percepatan pembangunan daerah, apalagi Kabupaten Deli Serdang saat ini perkembangnnya cukup luarbiasa , tentu perencanaan pembangunanya harus tepat serta disukung SDM yang benar-benar tepat. Karenanya kepada pimpinan Satuan Kerja Perangkat Daerah (SKPD) dapat memberi pemikiran yang maksimal dan terbaik untuk membangun daerah. Dikatakan Wabup Potensi besar yang dimiliki daerah Kabupaten Deliserdang seperti kehadiran bandara Kuala Namu diharapkan dapat membawa kesejahteraaan bagi masyarakat khususnya bagi masa depan generasi muda. Karenanya di daerah ini perlu dibangun sekolah menengah kejuruan dibidang penerbangan bahkan setingkat perguruan tinggi sehingga SDM para generasi muda di daerah ini bisa diandalkan untuk mengelola Bandara Kualanamu yang bertarap internasional itu. Dikatakan Wabup Hal itu sejalan dengandi tetapkannya Visi Misi Pembangunan Deli Ser-

dang yang memang memprioritaskan sektor pendidikan yang selama ini digerakkan lewat Konsep Cerdas yang saat ini saat ini sudah memasuki tahap apresiasi terhadap sekolah yaitu peningkatan kwalitas murid dan tenaga pendidik. Wabup juga mengatakan selain pendidikan menjadi prioritas pembangunan di Deli Serdang juga disektor kesehatan dan infrastruktur. Meski APBD Deli Serdang sudah mencapai 2,3 triliun tetapi masih terasa kurang untuk menyahuti semua tuntutan masyarakat yang semakin berkembang kata Zainuddin Mars dihadapan peserta Musyawarah Perencanaan Pembangunan (Musrenbang) tahun 2013 tingkat Kabupaten Deliserdang di Balairung Pemkab Deliserdang di Lubuk Pakam, Rabu (27/3). Musrenbang Kabupaten Deli Serdang juga dihadiri Kepala Bappeda Sumut Ir H Riadil Akhir Lubis MSi, Anggota DPRD Deliserdang Chairul Anwar Unsur Muspida sejumlah anggota DPRD Sumut Dapil Deliserdang diantaranya Guntur Manurung, Kepala Bappeda Deliserdang Ir H Irman Dj Oemar MSi, TP PKK DS , para pimpinan SKPD, Camat se jajaran Pemkab Deliserdang serta sejumlah tokoh pemuka masyarakat,

Kepala Bappeda Sumut Ir H Riadil Akhir Lubis MSi dalam paparannya menjelaskan program prioritas Provinsi Sumatera Utara tahun 2014 diantaranya peningkatan kehidupan beragama,penegakan hukum, penguatan tata kelola pemerintahan yang baik, peningkatan aksebilitas dan kualitas pendidikan ( program wajib belajar 12 tahun ) peningkatan aksebilitas dan pelayanan kesehatan terutama penurunan angka kematian bayi dan ibu melahirkan, meningkatkan infrastruktur dan pengembangan wilayah, mendukung daya saing perekonomian, pengermbangan perdesaan dan perkotaan, serta wilayah kepulauan dan perbatasan/wilayah luar. Juga memprioritaskan Peningkatan penguasaan ilmu pengetahuan dan penerapan teknologi serta perluasan kesempatan kerja dan peningkatan kesejahteraan rakyat miskin, melalui dorongan penciptaan lapangan kerja bagi pengusaha pemula dan PNPM Mandiri. Sedangkan arahan kebijaksanaan kawasan Mebidangro ( Medan Binjai Deli Serdang Karo) melakukan rencana peningkatan jalan outerouter ring road (TR 16 dan TR 17) Helvetia. Pembangunan outer-outer ring road Mebidangro Mulai Cemara-Batang kuis-Bandara Kualanamu-Simpang Kayu besar Tanjung morawa-jembatan rivera/batas kota Medan. Pembangunan bendungan lau simeme Deli Serdang, jalan tol Medan Binjai, Medan Kualanamu Tebing Tinggi. Kepala Bappeda Kabupaten Deli Serdang Ir H Irman DJ Oemar Msi Menjelaskan pelaksanaan Musrenbang ini berlangsung selama dua hari sedangkan paparan pada Musrenbang Kabupaten Deli Serdang ini juga disampaikan Kadis Pendidikan Provinsi Sumatera Utara M Zein Msi,Kadis Binamarga Sumut, Institusi USU Medan Ir Dwi Lindarto, Pimpinan SKPD Deli Serdang yaitu Kabappeda Deli Serdang Ir H Irman DJ Oemar Msi,Kadis Cipta karya,Kadis Pendidikan Pemuda dan Olah raga,Kadis PU,Kadis Kesehatan, Kadis Perindag dan Kadis Pertanian. (Romi)

Sekretariat Kabinet RI Pantau Persiapan Pilbup Kabupaten Deli Serdang

LUBUK PAKAM , BNBupati Deli Serdang Drs H Amri Tambunan melalui Plt Sekdakab Drs Agus Ginting MSI menerima Tim dari Sekretariat Kabinet Republik Indonesia masing-masing Kasubbid Otda sekretarriat Kabinet RI Syahrion Teridel Ssos Msi dan Kabid Fasilitasi operasional bidang Polhukam Aston Sidauruk SAP melakukan

pemantauan terhadap rencana penyelenggaraan Pemilihan Umum Bupati dan Wakil Bupati Deli Serdang priode 2014-2019 , Rabu (20/3) di ruang rapat lantai II Kantor Bupati Deli Serdang, Lubuk Pakam Tim pemantau rencana pelaksanaan Pemilihan Bupati dan Wakil Bupati dari Sekretariat Kementerian RI , menjelaskan bahwa menu-

Biaya Pengamanan Pilkadasu Habiskan Dana Rp 31 M MEDAN, BNUntuk pengamanan biaya Pilkada Sumut 2013 Poldasu menghabiskan dana sebesar Rp.31.568.405.170 dari anggaran yang dialokasikan sebesar Rp.87 miliar. Ini belum termasuk biaya pengamanan pelantikan Gubenur terpilih. "Dana tersebut untuk satu putaran hingga pelantiakn saja. Putaran kedua dana tidak terpakai. Dana dianggarkan untuk pengamanan Pilgubsu putaran pertama Rp.58.145.482.000 dan putaran kedua Rp.28.854.572.000. Namun dana pengamanan putaran kedua tidak digunakan.Pasalanya Pilkada Sumut hanya satu putaran saja yang dimenangkan oleh pasangan Gatot Puju Nugroho dan HT Erry Nuradi[Ganteng]",jelas Karo Ops Poldasu Kombes Pol Iwan Hari Sugiarto, Kamis[4/4] kepada wartawan di Mapoldasu Jalan Sisingamangaraja Km 10,5 Medan.

"Jadi dari Rp.58.145.482.000 anggaran pengamanan Pilkadasu putaran pertama, yang dipakai hanya Rp.31.568.405.170. Sisanya Rp.26.577.022.830. Itu dana yang digunakaan sampai rekapitulasi belum termasuk dana pengamanan pelantikan Gubernur terpilih",urai Iwan. Iwan juga menybutkan, dalam baya pengamanan sesuai Keputusan Kapolri Nomor 606 tahun 2012 tentang pengamanan Pilkada di Indonesia, dan setiap personil mendapatkan uang dari dana pengamanan sebesar Rp.77.000 per harinya. "Sama semua biaya pengamanan setiap personil sesuai Keputusan Kapolri ini",katanya . Ia mengatakan setiap personil sesuai pangkatnya, uang pengaman diberikan langsung dipotong pajak dengan rician untuk perwita pertama[pama] dipotong pajak 5%. Sedangkan untuk perwira menengah[pamen] dipotong 15%.[HZA]

rut catatan Kementeria Dalam Negeri di sejumlah daerah termasuk Kabupaten Deli Serdang akan memajukan penyelenggaraan pemilihan Kepala Daerah yang seharusnya dilaksanakan pada tahun 2014 menjadi tahun 2013 hal ini berdasarkan usulan DPR RI agar pemerintah daerah dan KPU dapat melaksamakannya. Plt Sekdakab Drs Agus Ginting MSi didampingi anggota DPRD Chairul Anwar Kapolres Deli Serdang AKBP Dicky Patria Negara, Asisten I H Syafrullah Ssos MAP, Kadis Infokom Drs Neken Ketaren , Ketua KPU Deli Serdang diwakili Zakaria Sinaga dan Bazoka Nainggolan Staf Kesbang serta sejumlah pejabat terkait Pemkab Deli Serdang ,menguraikan tentang peran Pemerintah Kabupaten Deli Serdang bersama KPU terhadap kesiapan Pemilihan Umum Bupati dan Wakil Bupati Deli Serdang Tahun 2013. Agus Ginting Menjelaskan tentang rencana pelaksanaan Pemilihan Bupati Dan Wakil Bupati Deli Serdang telah melakukan berbagai kegiatan diantaranya sudah menetapkan dukungan Pemkab berupa penguatan dan pengayaan nilai-nilai demokratisasi bagi generasi muda dengan pagu Rp 115.060.000 dengan 400 peserta generasi muda dan pemilih pemula , pembentukan Desk Pemilu Bupati dan Wakil Bupati dengan pagu Rp 300.361.500,- untuk dua putaran dan pengamanan dengan pagu Rp 5.113.980.000 juga untuk dua putaran. Sedangkan untuk pemutahiran data dan daftar pemilih akan dilakukan oleh KPU pada April -Mei 2013 ,sesuai rencana tahapan,program dan jadwal waktu penyelenggaraan Pemilu Bupati dan Wakil Bupati yang ditetapkan KPU Deli Serdang. Dijelaskan juga bahwa bahwa partisipasi politik masyarakat dalam menggunakan hak pilih dikabupaten Deli serdang berdasarkan pengalaman pada Pilgubsu tahun 2013 yang baru lalu bahwa jumlah pemilih 1.426.603 dengan jumlah suara 608.051, jumlah suara tidak sah 18.871 dan jumlah suara sah dan suara tidak sah 626.922 atau S43,94 %.(ROMI/INDRA)

H Baharuddin Siagiaan sedang memberikan kata sambutan didepan tokoh agama dan masyarakat Batubara

Tokoh Agama dan Masyarakat Minta

H.Baharuddin Siagian Pemimpin Batubara Ke Depan MEDAN,BNRatusan tokoh masyarakat, pemuka Agama dan pemuda meminta kesediaan Haji Baharuddin Siagian SH MSP (kini Kepala Biro Keuangan Pemprovsu) menjadi bakal calon (Balon) Bupati Batubara masa bakti 2013-2018. Aspirasi tersebut mereka sampaikan langsung kepada Baharuddin Siagian pada acara Silaturrahmi di Pantai Bunga Kabupaten Batubara, belum lama ini yang diawali makan bersama, dialog dan doa. Ratusan masyarakat berkumpul di lokasi wisata pantai mandiri yang belum pernah disentuh anggaran APBD kabupaten tersebut sehingga suasana benar-benar semarak namun tetap tertib dan penuh kekeluargaan. Pada acara yang diprakarsai sejumlah tokoh masyarakat Batubara antara lain H Adly selaku Penggagas Acara dan H Aladin yakni sejumlah tokoh dan pemuka Agama diantaranya Al Ustadz H Muhammad Nasir Lc, Al Ustadz Tauhid Assidiqi (Ketua FKUB Batubara) dan Al Ustadz M Yus. Haji Baharuddin Siagian merasa terharu campur gembira diundang pada acara silaturrahim yang penuh akrab dan kekeluargaan ini. Selaku putra daerah asli Batubara beliau mengaku bangga terhadap kampung halamannya, apalagi ternyata para tokoh dan Ulama tidak melupakannya meski sudah mengabdi di ibukota Propinsi Sumut, Medan. Tentang aspirasi para tokoh dan Ulama yang mengharapkannya menjadi balon Bupati Batubara pada Pemilihan Kepala Daerah (Pilkada) Batubara yang dijadwalkan September 2013 mendatang, Haji Baharuddin Siagian belum bisa berkomentar banyak. "Hakekatnya saya benar-benar berterima kasih dan berbesar hati atas harapan masyarakat ini namun untuk menentukan sikap apakah maju atau bagaimana pada Pilkada nanti, masih banyak yang

harus dipertimbangkan, dirembukkan dan difikirkan secara matang, termasuk perlunya izin atasan," ujarnya. Meskipun desakan sudah cukup kuat mengemuka malam itu namun Baharuddin Siagian yang mantan Kepala Samsat Medan Utara ini masih hanya tersenyum dan bermohon agar memikirkannya secara matang, arif dan bijaksana. Penggagas acara H Adly mengemukakan mereka berharap sangat agar aspirasi ini dipenuhi Haji Baharuddin karena mereka menilai kepiawaian, kemampuan dan pengalaman Bahar di Pemprovsu membuat mereka optimis Bahar dapat lebih memajukan Kabupaten Batubara. Sementara H Aladin yang mengklaim masyarakat yang hadir malam itu representasi dari 7 kecamatan di Batubara juga mengemukakan keyakinan mereka terhadap Baharuddin selaku salah seorang putra terbaik Batubara yang kini berkiprah di jajaran Pemerintah Provinsi Sumatera Utara bersedia pulang kampung memimpin Kabupaten Batubara. Al Ustadz M Yus yang juga selaku salah seorang pejuang pemekaran Batubara juga menyatakan posisi Baharuddin yang kini diberi kepercayaan oleh Gubsu H Gatot Pujo Nugropho selaku Kepala Biro Keuangan Pemprovsu merupakan bukti kemampuan Bahar dalam pemerintahan, manajemen dan sistem anggaran. Hal yang sama juga disampaikan Al Ustadz Tauhid Assidiqi yang juga Ketua FKUB Batubara mengemukakan Pilkada setempat sudah dekat dan dia berpesan agar masyarakat tetap dewasa dan cerdas dalam menyikapi pesta demokrasi ini sebagaimana pada Pilgubsu 7 Maret 2013 lalu. Sementara itu ,Al Ustadz H Muhammad Nasir Lc antara lain mengemukakan asyarakat Batubara menginginkan pemimpin yang merakyat. Jatidiri pemimpin merakyat adalah menjadi pelayan masyarakat.(r.ndo)

Warga Karang Sari Minta Pemkab DS Perbaiki Jalan Rusak LABUHANDELI, BN Warga Jalan Kapten Sumarsono/ Karang Sari, Dusun II, III s/d V, Desa Helvetia, Kec. Labuahndeli. Kab.Deliserdang (DS), minta Pemerintahan kabupaten (Pemkab) setempat, segera memperbaiki jalan alternatif, berlokasi dilingkungan padat penduduk, yang sejak beberapa tahun terakhir ini rusak (berlobang). Edy Elianto, menyebutkan hal tersebut pada BNews pekan lalu, atas kondisi jalan alternatif, yang menghubungkan Jalan Kapten Sumarsono/ Karang Sari, menuju Jalan Veteran Raya, sudah selayaknya dilakukan perbaikan oleh dinas terkait, karena aspal jalan pada pecah diberbagai sisi jalan. Disebutkan Edy Elianto alias Ahwa, yang juga pengurus LSM Aliansi Indonesia SU, lagi bahwa, permohonan warganya, atas kondisi jalan itu, sudah selayaknya disahuti dan segera dilaksanakan oleh pihak Pemlab DS, karena selain padat penduduk, jalan juga dipakai sebagai sarana perdagangan. “ Kita khawatir jika kondisi aspal jalan pecah, tidak segera mendapat perbaikan, akan menjadi pemicu

keresahan warga, berakibat banjir pada saat musim penghujan, juga mengundang terjadinya kecelakaan lalu lintas “ kata Ahwa, diamini Awaluddin SH dan Ramlan (Humas LSM Aliansi SU). Hal senada juga disebutkan Iskhak Hasibuan SE, selaku pengurus DPC PDI-Perjuangan DS, pihaknya juga mendesak Pemkab DS, segera memperbaiki pasilitas jalan alternatif disana, agar pengguna jalan dapat beraktifitas dan berlalu lintas dengan nyaman. Sehubungan dengan permintaan warga disana, pihak pemerintahan Desa dan Kecamatan setempat, ketika dikonfirmasi BNews, menyebutkan bahwa persolan jalan alternaif, baik itu jalan aspal Karang Sari dan jalan cor beton untuk jalan Gang Jaya, sudah secara terus menerus diusulkan dalam Musrembang. “Untuk jalan alternatif yang menghubungkan Jalan Kapten Sumarsono/ Karang Sari menuju Jalan Veteran Raya, sudah diusulkan dan menunggu rekomendasi, sementara jalan di Gang Jaya,yang berasal dari dana swakelola, dalam waktu dekat akan turun tim survey” kata pihak pemerintahan setempat. (San)

Bupati Erry Nuradi Hadiri Family Gathering Keluarga Besar Kosek Hanudnas III

Bupati Sergai Ir. H.T. Erry Nuradi, M.Si didampingi Asisten Ekbangsos Drs. Amirullah Damanik, Asisten Admum H. Rapotan Siregar SH, MAP dan Kabag Humas Dra. Indah Dwi Kumala photo bersama dengan Panglima Kosek Hanudnas III Marsekal Pertama TNI Sungkono SE, M.Si dan keluarga besar Kosek Hanudnas III pada acara Family Gathering Kosek Hanudnas III bertempat di Open Stage Lokasi Wisata Theme Park Pantai Cermin, Sabtu (30/03).

PANTAI CERMIN,BN Dalam rangka mempererat tali silaturahmi antara masyarakat Serdang Bedagai (Sergai) dengan keluarga besar Komando Sektor Pertahanan Udara Nasional (Kosek Hanudnas) III, Kosek Hanudnas III mengadakan acara Family Gathering diikuti seluruh Keluarga Besar Kosek Hanudnas III sebanyak enam ratus orang yang diselenggarakan di Open Stage Lokasi Wisata Theme Park Pantai Cermin, Sabtu (30/3). Turut hadir dalam acara tersebut Bupati Sergai Ir. H. T. Erry Nuradi MSi, Asisten Ekbangsos Drs. Amirullah Damanik, Asisten Admum H. Rapotan Siregar SH MAP, Staf Ahli bidang Pembangunan Drs. Rachmad Karo-Karo, Kadishutbun Muhammad Aliuddin SP, Kabag Humas Dra. Indah Dwi Kumala, Camat Pantai Cermin A. Yasir Arafat Nasution, SSos, Panglima Kosek Hanudnas III Marsekal Pertama TNI Sungkono SE MSi, Asisten Komunikasi dan Elektronika (Askomlek) Kolonel Lek Bambang Tetuko, Asisten Logistik (Aslog) Kolonel Tek M. Yani Rudiansyah, Asisten Intelijen (Asintel) Kolonel

Pnb Riva Yanto ST, Msc, Asisten Personil (Aspers) Kolonel Pnb Nana Resmana dan Asisten Operasi (Asop) Kosek Hanudnas III Kolonel Pnb Umar Fathurrohman S.IP. Dalam sambutannya Bupati HT Erry Nuradi mewakili masyarakat Sergai sebagai tuan rumah menyambut hangat dan memberikan apresiasi kepada keluarga besar Kosek Hanudnas III yang menyelenggarakan event ini. Lebih lanjut Bupati Erry mengatakan bahwa kegiatan family gathering merupakan sebuah kegiatan yang positif karena berupa kegiatan kebersamaan untuk lebih mempererat kerjasama antar personal di dalam suatu organisasi perusahaan/instansi, dengan menggunakan sebuah aktivitas permainan low impact. Aktivitas permainan menekankan pada team building, komunikasi, motivasi serta memberikan fokus akan pentingnya inovasi dan kompetisi individu, dengan serangkaian simulasi yang menantang namun tetap bersifat menyenangkan (fresh and fun). Untuk itu Bupati Erry Nuradi menghimbau kepada keluarga besar Kosek Hanudnas III agar selalu

mengadakan acara ini sebagai ajang silaturrahmi setiap tahunnya untuk mempererat persatuan dan kesatuan. Dan diharapkan kepada keluarga besar jajaran Kosek Hanudnas III dapat terus membangun keakraban, semangat kekeluargaan serta mendorong rasa solidaritas dalam tanggung jawab dan kerjasama, ujar Erry Nuradi. Pada kesempatan yang sama, Panglima Kosek Hanudnas III Marsma TNI Sungkono melalui sambutannya menyampaikan rasa terima kasih kepada Bupati Erry Nuradi yang telah menyediakan waktu dan tempat dengan keindahan objek wisata alamnya sehingga terlaksananya acara Family Gathering ini. Tujuan dilaksanakannya event untuk menjalin kebersamaan antara pimpinan dan bawahan yang selama bertugas ada pembatasan waktu serta sebagai "syukuran" atas kenaikan pangkat beberapa Perwira di jajaran Kosek Hanudnas III. Untuk itu diharapkan kepada keluarga besar Kosek Hanudnas III dan masyarakat tanah bertuah negeri beradat agar hubungan persaudaraan ini tetap terjalin pada masa-masa mendatang, pungkas Sungkono.(Ibnu)


CMYK

Harga Eceran Rp 3500,Luar Daerah + Ongkos Kirim

Miliaran Rupiah Anggaran Proyek PSAB Sibande, Hingga Kini Tidak Bermanfaat

B

PAKPAK BHARAT, BN Pembangunan PSAB di Sibande yang telah dikerjakan mulai tahun anggaran 2008 sampai dengan tahun 2012 yang menghabiskan dana miliaran rupiah namun hingga kini belum ada manfaat yang dapat dirasakan masyarakat. Hasil pantauan BN beberapa waktu lalu di lapangan, fisik PSAB (Pembangunan Sarana Air Bersih) yang ada di Sibande dan sukarame tidak dapat dimanfaatkan, padahal ini pekerjaan Anggaran 2012 sementara saat ini masih terbilang awal tahun 2013. Boangmanalu salah satu tokoh masyarakat Sibande mengatakan, agar proyek PSAB ini jangan dikerjakan asal jadi seperti tahuntahun yang lalu, karena masyarakat sangat membutuhkan air bersih, namun sampai sekarang hasilnya nihil. Ditambahkannya, ini akibat dari pihak pekerja yang tidak tahu bidangnya, sementara dana sudah cukup besar, dana yang sudah masuk selama ini jadi sia-sia dan terkesan hanya menghamburhamburkan uang Negara, jelasnya. Dinas Pekerjaan Umum Pakpak Bharat juga dinilai tidak becus dalam membuat anggaran dan perencanaan serta pengelolaannya, apalagi realisasi pelaksanaanya dikerjakan oleh rekanan yang tidak mengerti kebutuhan masyarakat. Diminta kepada instansi terkait agar mengevaluasi kembali proyek tersebut dan segera memperbaiki agar berfungsi dengan baik, ketusnya. (pb.007)

Ratusan GMMB Mengelar Aksi Penolakan Qanun Di Depan Gedung DPRK Aceh Barat

DPR Aceh Sambut Positif Keseriusan SBY PEMERINTAH Aceh melalui Dewan Perwakilan Rakyat Aceh (DPRA) menyambut positif terhadap keseriusan Presiden Susilo Bambang Yudhoyono (SBY). Yaitu dalam menyelesaikan polemik terhadap qanun Bendera dan Lambang Aceh. "Kita DPR Aceh sambut positif terhadap keseriusan SBY untuk turun

tangan langsung menyelesaikan masalah polimik Bendera Aceh dengan memanggil Gubernur Aceh," kata Baleg DPR Aceh, Abdullah Saleh saat dimintai tanggapan, Sabtu (6/4). Menurutnya, keseriusan SBY itu dapat menyelesaikan masalah Bendera Aceh secara bijaksana sehingga tidak BACA DPR ACEH HAL..10

MEULABOH,BNRatusan Masyarakat dan Mahasiswa yang tergabung dalam gerakan masyarakat Barat selatan(GMMB) kamis(4/4) melakukan aksi di Bundaran simpang pelor sekira pukul 11:00 wib di Kabupaten Aceh Barat, aksi tersebut meminta pemerintah pusat agar tidak menerima Qanun Lambang dan bendera yang sudah disahkan BACA RATUSAN

BACA GELOMBANG HAL..10

HAL..10

Puluhan Warga Konvoi Merah Putih Meulaboh,BN Di pantai Barat Aceh sekitar 150 lembar bendera merah putih berkibar di sepanjang jalan Nasianal, pengibaran itu dilakukan sebagai bentuk penolakan qanun dan BACA PULUHAN

HAL..10

Masa ‘SOMASI’ Menolak

Gelombang Mutasi Kembali Bergulir Aceh Timur,BN mutasi kembali bergulir dilingkup Pemerintah Kabupaten Aceh Timur, Senin (1/ 04) di Aula Serbaguna Setdakab Idi. Sebanyak 48 pejabat struktural eselon III dan IV kembali diberi kepercayaan untuk mengemban amanah dalam upaya memberikan pelayanan publik yang prima kepada masyarakat selaku abdi negara dan pemerintahan. Namun ada juga pejabat yang diperbantukan atau dibangkupanjangkan. Bupati Aceh Timur diwakili Sekretaris Daerah (Sekda), Drs Bahrumsyah MM dalam sambutannya mengatakan bahwa mutasi ini adalah hal yang lumrah sebagai kebutuhan organisasi pemerintahan dan jangan ditafsirkan macam macam. Kepada pejabat yang diberi amanah ini diharapkan mampu bekerja dan bergerak cepat dalam memberikan pelayanan kepada publik secara prima seiring dinamika dan tuntutan masyarakat yang semakin dinamis dan memang ingin cepat. “Karenanya, dibutuhkan pejabat pejabat yang peka, kreatif dan inovatif terhadap segala situasi sehingga mampu bekerja dengan maksimal dan bertanggungjawab. Jadikan tanggungjawab dan amanah ini untuk pengbdian kepada masyarakat sehingga jalannya roda pemerintahan dan pembangunan yang sedang kita galakkan di Kabupaten Aceh Timur ini berhasil terwujud kearah lebih baik lagi,’tegas Sekda.

9

8-15 APRIL 2013| EDISI 354| THN KE-VIII

ACEH TAMIANG,BN Dua ratusan masa dari Solidaritas Masyarakat Sipil Aceh Tamiang (SOMASI) menolak dan menentang sikap politik anggota DPRK dan DPRA Aceh dari Partai Nasional (Parnas) yang mengesahkan Qanun Nomor 3 Tahun 2013 tentang symbol Aceh. Kamis (4/4/) sekira pukul 10.55 wib, dua ratusan warga yang berkumpul di markas SOMASI desa bundar, bergerak BACA MASA

‘Bom’ Waktu di Pemkab Atam ACEH TAMIANG,BN Tiga bulan berlalu sudah Kabinet Pemerintahan Aceh Tamiang (Atam) digenggaman police— kekuasaan—HamdanSatidanIskandarZulkarnain,belum menampakkan restorasi internal terhadap Satuan Kerja Perangkat Daerah (SKPD) yang memiliki raport nol bagi peningkatan Pendapatan Asli Daerah (PAD) Atam. AgaknyaseorangIskandarZulkarnainnotabenenyaWakil Bupati,takmampuberbuatbanyakuntukperubahanAtam, dirinya disibukkan dan berkutat pada penandatanganan surat-surat yang menyangkut dengan administrasi pemerintahan. Bekerja dibawah tekanan memang tak mengenakkan, sebab remote kendalinya ada ditangan Hamdan Sati, sang BupatidefinitivepadaPilkadalalu.Tidakmemberikantupoksi pada wakil bupatinya untuk melaksanakan tugas-tugas penyelesaianinterenyangmenjadiborokditengahtataran pemerintah Atam. Hamdan Sati memelihara bom waktu, yang sesaat bisa

Kebijakan Anggaran Tidak Adil

meledaklalumemuntahkanborokkorupsidanSKPDpemilik raport nol terhadap kontribusi PAD Atam. Haruskah bom waktuinidiledakansendiriolehrakyatAtam?,atausebaliknya Hamdan Sati sendiri yang menyulut sumbunya hingga meledak. Tiga bulan sudah berlalu, masyarakat Atam hanya bisa duduk manis menonton lakon dan scenario tayangan kebobrokanpemerintahAtamsambilmengurutdada,yang disutradarai Hamdan Sati itu bergeming, hanya berkedok menutupi borok korupsi pejabat berdasi. Ini cara lama meraup pundi rupiah. Akar Masalah Maraknya indikasi ketua panitia tender proyek tahun 2013 ini tanpa mengantongi sertifikasi resmi yang dikeluarkan oleh Negara melalui Lembaga Kebijakan Pengadaan Barang Jasa Pemerintah (LKPP)—sebagai satu syarat mutlak untuk menjadi BACA ‘BOM’ WAKTU HAL..10

HAL..10

Banggar DPR RI Jadi Tumpahan Kekesalan Pemprovsu

Hamdan Sati

MEDAN,BN Kunjungan Badan Anggaran DPR RI ke Sumut menjadi tumpuan keluh kesah pemerintah provinsi dan pemkab/pemko se Sumatera Utara terhadap kebijakan anggaran pemerintah pusat yang terkesan tidak adil. Keluhan utama yang diungkapkan adalah Dana Bagi Hasil Perkebunan dan minimnya alokasi dana pembangunan infrastruktur di Sumut. Keluhan tersebut terungkap dalam Kunjungan Kerja Badan Anggaran DPR RI di Kantor Gubsu, Kamis (4/4). Pertemuan yang berlangsung BACA BANGGAR DPR RI HAL..10

21 Srikandi Jajal Banda Aceh-Padang Bersepeda Banda Aceh,BN Tepat pukul 07.30 WIB Jumat (5/4) pagi tadi 21 srikandi Indonesia dilepas Wakil Walikota Banda Aceh menuju Padang. Pelepasan srikandi tersebut berlangsung di halaman kantor Balaikota Banda Aceh. Selanjutnya kilo demi kilo akan ditempuh sampai nantinya akan mengakhiri gowes pada tanggal 20 April 2013 di kota Padang dan selanjutnya akan merayakan hari Kartini tanggal 21 April 2013 di kota Padang. Jamuan Makan Malam Sebelumnya pada Kamis (4/4) malam, rombongan srikandi Indonesia berkesempatan hadir di aula Balaikota untuk acara welcome dinner dengan Wakil Walikota Banda Aceh. Acara tersebut dimeriahkan dengan penampilan beberapa tarian tradisonal aceh

dari beberapa sanggar tari Kota Banda Aceh Dalam keterangannya kepada humas pemko Lucy Iskandar anggota srikandi asal Sragen mengatakan tujuan mereka naik sepeda ke Padang adalah dalam rangka memperingati Hari Kartini, 21 April. 21 srikandi yang mengikuti touring sepeda ini berasal dari berbagai kota seperti Jepara, Sragen, Bandung, Surabaya dan Jakarta. Dikatakannya anggota srikandi bukan dari pebalap sepeda, melainkan beberapa ibu yang berprofesi sebagai ibu rumah tangga, wanita karier, freelance, dan sebagainya. Sementara Wakil Walikota Banda Aceh Hj. Illiza Sa’aduddin Djamal, SE mengatakan kegiatan yang dilakukan para srikandi Indonesia BACA 21 SRIKANDI HAL..10 INTERNET

KANTOR REDAKSI : Jl. Flamboyan Raya/Raharja No. 37 Medan Telp (061) 8213786, HP. 081375395392 - 08163134392 Fax (061) 8215552 Email:bongkarnews@gmail.com - indrabongkarnews@gmail.com

CMYK


8-15 APRIL 2013 | EDISI 354| THN KE-VIII

Pemkab Simalungun Gelar Malam Pesona Seni dan Budaya di PRSU ke-42 Tahun 2013

Teater Tuan Rondahaim Saragih Garingging Tarik Perhatian Pengunjung PADAPekanRayaSumateraUtara(PRSU)yangdigelar setiap tahun oleh Pemerintah Provinsi Sumatera, Pemerintah Kabupaten (Pemkab) Simalungun selalu ambilbagiandalammemeriahkannya.UntukPRSUyang ke-42 tahun 2013, Pemkab Simalungun menggelar kesenian dan kebudayaan daerah itu melalui kegiatan malam pesona seni dan budaya Simalungun, di Open Stage PRSU, Jum’at malam, 05/04. Malam pesona seni dan budaya Simalungun digelar dalam rangka untuk melestarikan kesenian dan kebudayaankepadamasyarakatkhusunyagenerasimuda, sehinggakedepandiharapkanwarisanyangditanggalkan oleh leluhur itu dapat terus ada ditengah-tengah kehidupanmasyarakatseiringdengankemajuanzaman dan tekhnologi. Kesenian dan kebudayaan yang ditampilkan oleh KabupatenSimalungunantaralaintor-torsumbasebagai mengawali kegiatan itu yang dilanjutkan dengan penampilanparapenyanyiasalKabupatenSimalungun yangsudahterkenaldiduniamusicIndonesiaantaralain seperti Jhon Eliaman Saragih, Yance Sinaga, Damma Silalahi dan Yesica Saragih menyajikan lagu-lagu Simalungun. Selain itu, pada kegiatan ini Kabupaten Simalungun juga menggelar teater Tuan Rondahaim Saragih Garingging. Teater ini di perankan oleh putra putri Simalungun yang tergabung di dalam Sanggar Seni HIMAPSI (Himpunan Mahasiswa dan Pemuda Simalungun), sebagai wujud penghormatan kepada pimpinan(rajasaatitu)atasjasanyayangtelahmembela tanahairtercintaini,terutamaTanohHabonaronDoBona.

Teater tuan Rondahaim Saragih Garingging ini menceritakan sosok pimpinan Kabupaten Simalungun masa lampau, mulai dari kelahirannya, masa kepemimpinannya dan masa perlawannya terhadap Bangsa Belanda yang menjajah negeri ini. Saat teater ini digelar, terlihat sangat menarik perhatian dari ribuan pengunjung untuk menyaksikanny, termasuk Bupati SimalungunDRJRSaragihSHMM,NyErunitaJRSaragih, Ketua DPRD, Dan Rindam I BB, Kapolres, Dan Dim 0207 Simalungun, Ketua PN Simalungun, Anggota DPRD, perwakilan yayasan PRSU, Sekda dan Plt Sekda sangat seriusmenyaksikanpagelaranbersejarahitu. Pagelaran Teater Tuan Rondahaim tersebut yang disajikandandikemassedemikianrupaituolehHIMAPSI sebgaibentukdukunganmasyarakatSimalungununtuk dijadikanTuan Rondahaim Saragih Garingging menjadi pahlawannasional. Bupati Simalungun DR JR Saragih SH MM dalam sambutannya mengatakan, pegelaran seni dan budaya Simalungun di PRSU bertujuan untuk melestarikan keseniandankebudayaandaerahSImalungunyangtelah dilakukanolehparaleluhurterutamaparagenerasimuda, sehingga dapatteruseksisseiringdengankemajuantekhnologi. “Dulu para leluhur kita menciptakan budaya untuk diberikan kepada anak cucunya dan bagi semua masyarakatyangadadisekitarnyadenganmenggunakan alat-alat musik tradisional seperti Sarunai (suling), panggual(pemaingendang),gitardansebagainyayang adapada zamannya,tetapikalaukitalihatsaatiniketikasenidan

budayaituditampilkantidaklagidiringidenganperalatan tradisional tetapi sudah menggunakan alat modern sehinggatidakadakesanbudayadisana. Oleh karena itu kita mencoba pada PRSU tahun 2013 ini penampilan kesenian dan kebudayaan Simalungun diiringi dengan peralatan musik tradisional, sehingga diharapkananak-anakkitakedepantidakmengalamikrisis budaya ditengah-tengah kehidupannya”,ujarnya Bupati. Bercerita tentang budaya, Bupati mengajak seluruh elemen masyarakat untuk bersama-sama menggali budaya itu dan melestarikannya sehingga kebudayaan ini dapat ditampilkan oleh semua masyarakat. Karena kebudayaan merupakan salah satu sarana untuk mendukung kemajuan daerah itu sendiri. Untuk memajukan kesenian dan kebudayaan, Bupati Simalungun berharap kepada DPRD untuk memberikan dukungannya dengan menaikkan anggaran dari tahun sebelumnya. Menyinggung tentang dukungan masyarakat untuk menjadi Tuan Rondahaim Saragih menjadi pahlawan Nasional, Bupati mengucapkan terima kasih kepadamasyarakatyangtelahpeduliterhadapbeliau.“Ini murni usulan masyarakat untuk mendukung Tuan Rondahaim menjadi pahlawan nasional”, uangkapnya. Sementara itu, Ketua DPRD Simalungun Binton Tindaon SPd dalam sambutannya mengharapkan agar kegiatan kesenian dan kebudayaan seperti ini dilaksanakandenganbaik,karenamelaluikegiataninikita akan lebih banyak mengetahui tentang kesenian dan kebudayaanSimalungun.“Kerenadisiniakanditampilkan

berbagai kesenian maupun kebudayaan seperti tor-tor, tari-tarian, certa-cerita rakyat. Kalau tidak kita buat seperti ini kapan lagi kita akan melestarikannya dan kami (DPRD Simalungun) siap untuk mendukung keseniandankebudayaanSimalungun”,tandasnya. Sebelumnya Kadis Kebudayaan dan Pariwisata Drs Karshell Sitanggang menyampaikan bahwa, selain menampilkan kesenian dan kebudayaan Simalungun, padakegiataninijugadilaksanakanGrandFinalPemilihan garamapakonanakboruSimalungun.Darigrandfinalini pesertadibagidalamkategoridutawisatadanlingkungan hidup Simalungun. SelanjutnyaKarshellmengatakanbahwa,dalamPRSU tahun 2013 tersebut Kabupaten Simalungun juga menampilkan produk-produk unggulan di Vapiliun Simalungun yang ada di kompleks PRSU. Produkproduk unggulan tersebut disajikan oleh Dinas Kebudayaan dan Periwisata, Pertanian, Perkebunan, Perikanan dan Peternakan, Perindustrian dan Perdagangan, Kehutanan, Koperasi dan UKM serta dari Badan Pelayanan Izin Terpadu dan Pelayanan Modal sebagai bukti bahwa pelayanan pemberian perizinan sangat efektif bagi para investor. Tampak hadir dalam kesempatan tersebut, para asisten, staf ahli Bupati, para pimpinan SKPD, camat dan para pejabat structural dijajaran Pemkab Simalungun, dekan UNIFA dan dosen dari USI dan masyarakat.Acaratersebutdiakhiridenganpenyerahan hadiahkepadapemenanggrandfinalgaramapakonanak boru Simalungun. (rel/ps01)

membahas tentang masalah hukum,tetapi masalah seperti kehidupan sosial masyarakat, dan kesejahteraan bagi rakyat Aceh. "Mudah mudahan kita berdoa pertemuan itu dapat membawa manfaat besar dan mampu menyelesaikan beda pendapat antara pemerintah

pusat dan Pemerintah Aceh," imbuhnya. Sebelumnya Kementrian Dalam Negeri melalui Dirjen Otda, Dhohermansyah Djohan pada selasa (2-4/2) telah menemui Pemerintah Aceh untuk memberi sinyal agar Qanun Nomor 3/2013 tentang Bendera dan Lambang Aceh qanun

Bendera dapat direvisi. Setelah Direjen Otda menemui Gubernur Aceh, kemudian pada kamis (4/4) Mendagri Gamawan menjumpai Pemerintah Aceh untuk membahas dan sekaligus menyerahkan berkas hasil klarifikasi Kemendagri terhadap qanun tersebut. (dtc/int)

Dalam tutntunya masyarkat dan mahasiswa juga meminta kepada para elit politik aceh agar tidak membangun indetitas politik baru yang bertentangan dengan kesatuan republik indonesia sehingga tidak menimbulkan komplik baru Aceh. Pengesahan qanun lambangdanbenderatersebutmasyarakat mengangap DPRA telah meng khianati rakyat Aceh.sebabyangrakyatinginkanadalahkesejahtraan dan kemakmuaran,bukan bendera, “tegasnya.

DikatakanTaufik, kami juga mengutuk DPR Aceh yang terbuai dalam kepentingan golongan dan kelompok sehingga kodisi dan situasi Aceh kembali memanas. Yang terakhir ujarTaufik, Kami juga mengecam mendagri kalau di paksakan juga qanun lambang dan bendera bulan bintang berlaku di Aceh,maka kami dari MasyarakatdanMahasiswaBaratSelatan,dipisahkan dari Provinsi Aceh.

Setelah melakukan orasi sekitar 20 menit di depan kantor DPRK Aceh Barat namun salah satu Anggota DPRK Aceh Barat Herman yang menjabat sebagaiWakil DPRK tersebut mendatangi Massa untuk menanggapi aspirasi tuntutan Masyarakat tersebut. Dalam pidatonyaHermanmengatakantuntutanmasyarakat danmahasiswaBaratSelataninijuga akankami sampaikan ke DPR Aceh sebagaiWakil kami di Daerah Dalam waktu dekat ini, “tuturnya(@rul)

Asahan sepanjang 1.654 km hancur semua gara-gara perkebunan, sementara daerah tidak memperoleh pendapatan dari hasil perkebunan,” ujar Taufan. Menurutnya, apabila Kabuaten Asahan sebagai daerah perkebunanmendapatkandanabagihasilperkebunan,maka danatersebutdapatdigunakanmembanguninfrastruktur yangrusakkarenakerapdilaluitrukpengangkuthasilkebun. “Kalau kami dapat dana DBH perkebunan, tambahan pemasukan bisa mencapai Rp 2 T. Sehingga bila kami tak mendapat DAU atau DAK tidak masalah. Saat ini Asahan mendapatkan DAU hanya Rp 660 milyar yang diantaranya termasuk gaji pegawai, tapi jalan hancur semua,”ujarnya di hadapananggotaBanggarDPRRI. Halsenadajugadiungkapkanolehsalahseorangpejabat PemkabLabuhanBatuSelatanyangmenyebutkanbahwa sektor utama Perkebunan di sana ternyata belum memberikan kesejahteraan bagi masyarakat. “PDRB Labuhan Batu Selatan Nomor tiga tertinggi dari 33 kabupaten/kota yang ada, namun kabupaten ini juga termasuk 8 besar termiskin di Sumut dengan angka kemiskinan di atas rata-rata nasional sebesar 14,5%,” ujarnya. Ironiosnya, lanjut dia, 5 kecamatan termiskin

beradadikawasanperkebunan.Untukitu,diajugameminta keseriusanbanggarDPRRIuntukdapatmembantuSumut dan provinsi lainnya memperoleh dana bagi hasil perkebunantersebut. Turut mendukung pernyataan tersebut, Assisten Ekbang yang juga meminta dukungan Banggar DPR RI untuk mempertimbangkan perolehan DBH cukai tembakauyangdiusulkanJatimsekarangsudahterealisasi. “KalauTembakau saja boleh, kenapa tidak dengan sawit danhasilkebunlainnya?Kitasudahlamausulkanini,bahkan Provsu bersama 18 provinsi lainnya sudah tandatangani kesepakatanpengusulanDBHperkebunan,”ujarSabrina. SabrinajugamengungkapkanbagaimanaPDPerkebunan sebagaisalahsatuBUMDmilikProvsumembayarpajakke pusat mencapai Rp 96 m per tahun, sementara setoran untuk PAD hanya 26 m per tahun saja. Selain DBH perkebunan, alokasi dana pembangunan infrastruktur mendapat perhatian juga dari para kepala daerah. Wakil Walikota Tebing Tinggi Irham Taufik yang menyinggung belum jelasnya pembangunan jalan tol Medan-TebingTinggisementaratingkatkemacetansudah sangat parah.“Jalan Medan-Tebing Tinggi adalah bagan

DPR Aceh.... berlarut larut. "Saya harap SBY juga bukan hanya memanggil gubernur, namun DPRA, ulama serta tokoh masyarakat Aceh juga ikut dipanggil. Sehingga bisa memberi penjelasan penjelasan aspirasi masyarakat," ujarnya. Ia berharap pertemuan itu nantinya bukan

Ratusan.... oleh DPR Aceh beberapa pekan lalu, menurut mereka itu kepentingan golongan,“bukan Kepentingan Rakyat Aceh. Taufik coordinator aksi kepada wartawan, tututan aksiyangdilakukanolehmasyarkatdanmahasiswa yangpertama,Kamidarigerakanmasyarakatdan mahasiswabaratselatanmeminta kepadamendagri agar megantikan seluruh anggota Parnas di DPR Aceh yang sudah tidak Nasionalisme,“katanya.

Banggar DPR RI.... selamahampirtigajamtersebutdihadiriWakilKetua Banggar DPR RI Ir Djoko Udjianto, Dr Capt. Anthon Sihombing, Drs Marzuki Daud, Dolfie OFP, Sayed muhammad Muliady, Ir Sunartoyo, Drs H Hasrul Azwar MM, Rindoko Dahono Winggit SH MHum, dan H HeriyantoSEMMdidampingisekretarisbadananggaran DPRRISitiAtikadanBenysertastaffahlibadananggaran DPR RI Dr Handi Risza. Sementara dari SUmut hadiri bupati/walikota se Sumut dan kepala SKPD Provsu. Gubernur Sumatera Utara H Gatot Pujo Nugroho dalam sambutan yang dibacakan Assisten Ekbang DR Sabrinamenyinggungdanabagihasilperkebunanmasih yang hingga kini masih menjadi perjuangan beberapa provinsipenghasilperkebunantermasukSumut.Gubsu kembali meminta dukungan anggota Banggar untuk ikut meperjuangkan daerah memperoleh DBH perkebunanuntukkemajuandaerah. BupatiAsahanDrsHTaufanGamaSimatupangbahkan mengungkapkanrasakecewanyakarenatuntutanDana Bagi Hasil dari sektor perkebunan yang sudah mulai diwacanakansejaktahun2000,namunhinggakinitidak juga mendapatkan tanggapan. “Jalan kabupaten di

lintasSumaterayangsaatinisudahpadatsekali,termasuk ke dua terpadat setelah lintas Pantura. Akibantnya perjalanan Medan-Tebing Tinggi sepanjang 80 km tidak bisa lagi diprediksi dari yang hanya berjarak tempuh 1,5 jam perjalanan, sekarang bisa mencapai 3-4 jam. Belum lagi tingkat kecelakaan lalulintas yang sangat tinggi,”ujar Irham.Untukitudiamengusulkanadanyacrashprogram pelebaran jalan sambil menunggu pembangunan jalan tolselesai. Menanggapi para kepala daerah,Wakil Ketua Badan AngaranDprRIIrDjokoUdjiantomenyampaikanpihaknya akanmengiventarisirberbagaiusulandanharapandaerah untukkemudiankembalidibahasdiTimBadanAnggran. Sementara itu Anggota Banggar DPR RI Anthon Sihombing yang berasal dari daerah pemilihan Sumut berjanji akan ikut meperjuangkan tuntutan DBH perkebunan. “Saat ini kami di Komisi IV juga sedang membahas RUU Perkebunan, sehingga usulan saudara akanmenjadicatatantersendiribagikami,”katanya.Anton juga mengakui bahwa SUmut relatif tertinggal pembangunannya dibanding provinsi lain di luar Jawa yangsangatpesat.(ndo)

‘Bom’ Waktu... ketuapanitiatenderpengadaanproyekdipemerintah kabupaten—salah satu penuyulut bom waktu di tubuh PemkabAtam.Iniperludipertanyakan.Konfliktanahadalah hal krusial yang harus segera diselesaikan, mengingat ini menyangkutlangsungkepadakepentingangrasroth— masyarakat bawah—yang menyentuh akar permasalahan.MasalahinigetoldisuarakanolehLembaga AdvokasiHutanLestari(LembAHtari)sebagaiLSMAvokasi yang berkutat tentang masalah hulu-hilir di Atam. Kehutanan,konfliktanah,advokasidanlingkungan. DinasKehutanandanPerkebunanAtamterlalubanyak bermainuntukmengumpulkanpundi-pundirupiahdemi kepentingan kelompok dan pribadi. Ada lahan yang di ajukan oleh Koperasi Bina Lestari (Kopibali) seluas 3.000 lebihsebagaiHutanTanamanRakyat(HTR),tumpangtindih olehyangdiajukanolehduakoperasilain.Selanjutnyaada koperasilainjuga mengajukanpermohonanHTRdengan lahanyangsamajugaditandatanganiolehbupatiHamdan Sati.BentukpemicukonfliklahandipertontonkanHamdan Sati pada rakyatnya. Dia minim penelaah pemberian ijin dankecolongan. KonfliklahanTanjungBinjaidanTanjung KeramatantaramasyarakatdenganPTRapalayangdijual kepadaPTParasawitajugapemicubomwaktu.Masyarkat di dua wilayah itu telah membangun kekuatan untuk melawan dan mengambil alih hak-hak mereka yang terampas. Ini konflik lama yang menjadi catatan hitam perjalanankabupatenAtam. PTMestikaPrimaLestariIndah(MPLI),telahmelakukan pelanggaran dokumen lingkungan, penggelapan pajak Negaradenganmenciutkanpemanenansawittidaksesuai dengan Hak Guna Usaha (HGU) yang sebenarnya. Memindah kan patok BPN hingga 100 meter, sepanjang hampir 5 kilometer. Membelahhutan,denganmembuatalur-alursebagai canalpembuanganairselebar4-5meterdengankedalaman 3 meter. Ini tidak tercantum dalam dokumen Unit Kelola Lingkungan (UKL) dan Unit Pemantauan Lingkungan

(UPL),merupakankejahatanNegara. Tidakhanyaitu,hasilinvestigasiLembAHtari;luasareal yangdiklaimPTMPLItidaksesuaidenganluasyangtersebut dalam HGU, melainkan kelebihan mencapai 500 hektar. IjinLeanclearingtapiPTMPLIsudahmelakukanpenebangan tegakkan yang ada diwilayah itu, walau Ijin Pemanfatan Kayu (IPK) telah di kantongi PT MPLI. Tapi penebangan dilakukandiluararealyangtelahdiklaimtersebut. Selanjutnya PT MPLI, membangun kilang—sawmill—tanpamemilikiijinresmidariPemkabAtam.Banyak kejanggalan-kejanggalan yang dilakukan perusahaan perkebunan besar milik Joni Rusli. Namun Pemkab Atam tetaptutupmata.KitatidaktahuadaapaantaraDishutbun Atam dengan Pemerintah. TatananadministrasiPemkabAtamdinilaimasyarakat banyak mengundang empati terhadap kecurangan. Kasbon 2006 yang mencapai Rp. 8 miliaran lebih, hingga hariinitaksatupunyangmenjadipesakitan.Penyelesaian jalanduajalur,jelas-jelasmilikHGUPTPN,seharusnyakan hanyapelepasanpembebasandariklaimHGU.Tapiinitidak, dibayarkeluarnama-namapemiliknya.Anehini,HGUada pemilikpersonnyahaha!!!… MasyarakatAtammenantijanjireshufflekabinetlama kekabinetbaruHamdanSati–IskandarZulkarnain,banyak SKPD yang memiliki raport nol besar. Apakah ini harus dipertahankan?...atau mereka sudah memberikan ‘lampiran’sebagaitandatetapdipertahankan. Jika ini terjadi, Kabinet Hamdan Sati Cs, siap-siap bom waktu diledakan sendiri oleh masyarakat Atam, hingga percikkannya membuncah memunculkan borok-borok lamakembalimengangamengalirkanbaubusukkorupsi yangtelahmengakarmenggerogotiPemkabAtam.Masya Allah. Mereka BicaraTentang Kabinet Hamdan Sati MantanKetuaHimpunanMahasiswadanPelajarAceh Tamiang (HIMPERATA), Ramli menuding, Kabinet PemerintahanHamdanSati–IskandarZulkarnainsebagai

BupatiAcehTamiang(Atam)tidakmemilikiArahKebijakan Umum (AKU) dalam membangun kabupaten diujung Timur Aceh itu. Dirinya menilai Pemerintahan Kabinent Hamdan Sati Cs mandul—diam ditempat—tidak seperti dikatakan saat sebelum dirinya menjadi bupati definitif, pernyataan HamdanSatidimediacetak;akanmembawaperubahandi segala bidang sector untuk memajukan Atam secara umum.“Sayakira,HamdanSatiharusbisaintrospeksidiri, apakah pemerintahannya sudah benar atau masih bergeming,tidakmampumembawaperubahankearah yanglebihbaik,dalammembangunAtamkedepan.Saya kiraomongkosongitu”.Tegasnyadalamsebuahwawancara. MenurutRamli,tugasseorangbupatimampumembawa perubahan yang mendasar di tatanan sebuah pemerintahan, bukan malah diam dan terkesan hanya berpangkutangan.Lebihjauhdikatakan;janganmembeo, JokowimemimpinJakartadenganAnggaranBelanjadan Pembangunan Provinsi (APBP) yang triliunan jumlah. “Kita jangan selalu membeo, melihat orang lain maju dengan cara turun ke desa-desa, atau setiap harus jumpa denganmasyarakatlayaknyaseorangartis.Sayakiratidak demikian. Kita minim APBK, gunakan sebaik mungkin, janganterlenadenganasyikturunkelapangantanpahasil. Maafkalausayamengkritik,tapiinidemikemajuanAtam”. Katanya. MasihRamli;selayaknyabupatisudahmerestrukturisasi kabinet—SKPD—lama yang tidak berpotensial dalam mengawangiAtamuntukmeningkatkanPendapatanAsli Daerah(PAD),kalaupuntersangkutdengankebijakanAPBK tahun2012,kansudahhabismasanya. “Ini sudah bulan Maret 2013, saya piker Bupati sudah sewajarnya menggantikan para Kepala SKPD yang tidak mampubekerjadenganbaik.TugaskepalaSKPDkanharus sesuai tupoksi, mempu membawa perubahan dan meningkatkan PAD, malah terkesan memelihara para koruptor berdasi”.

Selain Ramli, Andy Nur Muhammad (aktifis mitigasi) Acehberpendapat,HamdanSatibelumdapatmembawa perubahandiKabupatenAtam,“Sudahlebih100hari,tapi tidakadagebrakan-gebrakanyangdapatmembawaAtam kea rah perubahan mendasar, lihat saja, apa yang sudah diberikan untuk Atam”. Katanya. Andy sependapat dengan pernyataan Ramli, kalau restrukturisasihanyaomongkosong,kalaumasihmemakai cabinetlama(AbdulLatief),samasajasepertimemasukan garamsejumputkelaut,takberbekasdantidakmemberikan efekapapun. Sektorpendidikan,kehutanan,konfliktanah,HGUdan Kelautansemuabermasalah,malahLSMLembAHtariyang getolmenyuarakankebijakanmasalaluyangsalahpuntak ditanggapi,padahalitubisadijadikansebagaiacuandalam tahapanpembenahandikabupatenAtamini. “Hari ini saya kecewa dengan sikap Pemerintah yang hanyabisadiam,tidakmampuberbuat.Kalautakmampu memimpin kenapa harus mau menjadi Bupati. Jangan ngeles“sayaterpaksaataudipaksa”ituhanyakamuflasedan retorikaketidakmampuan,tunjukanpadarakyatTamiang kalauandamampu,bisatidak!!!”.TegasAndymengakhiri. SayaLagiDijalan Hingga berita ini dilansir, belum ada pejabat pemkab Atam yang bisa memberikan konfirmasi, tak tau apakah ada pesan seponsor dari Bupati Hamdan Sati pulang dari Lemhanas, baru mendapat jawaban pasti. Jika benar, ini menjadidilematissebuahpemerintahan. Wakil Bupati Atam, Iskandar Zulkarnain yang coba di konfirmasi visa seluler mengatakan, kalau dirinya dalam perjalananmenujuBandaAceh,adakeperluandinas.Dan menerimaSTCpadahariseninmendatang. “Maaf,sayadalamperjalananmenujuBandaAceh,apa yangbisasayabantu.Kalaumasalahyangterkaitdengan pemerintahan, hari senin saja kita bertemu, bukan saya menolak, tapi lebih enak wawancara langsung saja, hari senin nanti”. Kata wabup menutup pembicaraan. (zul)

10

Masa ... menuju Gedung Dewan DPRK Aceh Tamiang (Atam) yang hanya berjarak 2 kilometer, sebagai objek tujuan pergerakan masa. Selain meneriakan yel-yel dan menyanyikan lagu Indonesia Raya, mereka melakukan orasi yang diakhiri dengan membacakan pernyataan sikap. Coordinator Aksi; Sayed Zainal, MSH meminta anggota dewan dari Parnas untuk keluar dan mendengarkan pernyataan sikap yang dibacakan tersebut. Hadir di kerumunan masa dari anggota dewan antara lain; Jafar Ketong (Demokrat), Usman (PAN) dan Juanda (PAN), mereka mendengarkan orasi dan pembacaan pernyataan sikap yang dibacakan langsung oleh Sayed Zainal. Dalam orasi itu, Sayed menentang dan menolak sikap politik anggota DPRK dan DPRA dari Partai Politik Nasional yang hanya diam, takut dan tidak memberikan pendapat, saran terhadap lahirnya qanun nomor 3 tahun 2013 tentang lambing dan Bendera Aceh yang dapat dan berpotensi kerawanan social pasca perjanjian damai Agustus 2005 di Helsinky. “Kami menyesalkan sikap politik anggota DPRK dan DPRA yang hanya memikirkan jabatan, kedudukan dan perut tanpa memperhatikan potensi konflik baru di Aceh. Ini yang kita sesalkan, kenapa tidak dipikirkan secara jernih dan bijaksana, ini bicara perdamaian, bukan bicara konflik. Anda-anda harus pikirkan itu”. Tegas Sayed. Masih Sayed, dia meminta secara sadar kepada anggota DPRK dan DPRA segera mengundurkan diri dari lesgislatif dan dari keanggotaan ataupun pengurus Partai Nasional karena tidak memiliki tanggung jawab sebagai bangsa dan anggota masyarakat di NKRI ini. Masa yang terkendali itu meneriakan yel-yel ‘hidup Indonesia’, ‘NKRI harga mati’, ‘Turun anggota dewan yang hanya memikirkan kepentingan pribadi dan jabatan’, ‘Kami cinta Indonesia’ lalu mereka menyanyikan lagu Padamu Negeri. Masa yang menentang tersebut berasal dari Paguyuban Gayo Meusara, FKPPI, PETA, Laskar Merah Putih, Mapala, IPK, LembAHtari dan warga Sungai Yu, Seruway, Harum Sari dan Wonosari. Aksi itu dilakukan secara sepontan tanpa direncanakan. “Kita memang tidak merencanakan aksi ini, kita lakukan secara sepontan saja. Atas desakan masyarakat yang cinta terhadap NKRI, agar SOMASI melakukan aksi penentangan terhadap Qanun nomor 3 tahun 2013 tersebut. Dasar itu, kita secara sepontan melakukan aksi hari ini”. Katanya. Setelah melakukan orasi dan membacakan pernyataan sikap, masa berkonvoi dengan menggunakan sepeda motor dan truk. Longmarch mengambil route, Karang Baru – Kota Kualasimpang – Sungai Liput dan kembali ke markas SOMASI di desa Bundar.(ZUL)

Puluhan Warga ... lembang aceh oleh puluhan masyarakat Aceh Barat Selasa(2/4). Taufiq selaku Koordinator aksi pengibar bendera mengatakan,jika hampir sebagian besar di wilayah Bumi Teuku Umar, telah berkibar Merah Putih. Kegiatan pemasangan tersebut dilakukan, demi kecintaannya terhadap Negara kesatuan Republik Indonesia (NK-RI). ”Masih, sama dengan kegiatan Minggu (31/3) lalu, pengibaran 80 bendera merah putih sebagai sikap menolak bendera bulan bintang sebagai lambang bendera Aceh,” ungkapnya. Taufik, mengaku kelompok pengibar bendera se-pantai barat Selatan Aceh, telah memasang bendera sebanyak 1500 lembar, yang berkibar di seluruh lintas jalan nasional dan simpang-simpang strategis. “Masyarakat yang cinta dengan Merah Putih, juga ikut berpartisipasi dengan mengibarkan bendera di halaman rumah mereka, masing-masing,” jelasnya. “Kami masyarakat tidak ingin di Aceh ini berkibar selain bendera merah putih, jika bendera aceh berkibar itu berarti mengundung konflik baru di Aceh,” ujarnya. Taufik berharap elit-elit politik yang ada di Aceh, jangan mengambil kesempatan dengan menjual nama Aceh, untuk kepentingan kekuasaan semata.(@rul)

21 Srikandi... tersebut akan memberikan inspirasi terhadap kaum wanita lainnya, bahwa wanita bisa melakukan semua hal di luar pakem. Ia juga menambahkan bahwa kaum wanita sekarang tidak bisa dianggap lemah, buktinya ada wanita yang mampu bersepeda dari Banda Aceh menuju Padang. Menurutnya kegiatan gowes ini juga dapat dijadikan sebagai ajang kampanye bahwa bersepeda itu sehat, alternatif transportasi, dan menjaga lingkungan dari polusi. Ia juga berharap para srikandi tersebut dapat mempromosikan kota banda aceh sebagai kota ramah lingkungan dan bersyariat islam seraya berdoa agar rombongan srikandi diberi kekuatan dan kesehatan sampai tiba di Padang nantinya. (T.reza)

Gelombang... Kepada seluruh pemangku jabatan di Aceh Timur dan PNS daerah ini juga diingatkan untuk mewujudkan pemerintahan yang bersih dan bebas korupsi, kolusi dan nepotisme. Adapun pejabat eselon III.a dan III.b yang dilantik diantaranya Amir Syarifuddin SKM sebagai Pj Sekretaris Dinas Kesehatan Kabupaten Aceh Timur, M Amin SE sebagai Kabag Pemerintahan Umum Setdakab, Drs Armia M MPd sebagai Sekretaris Dinas Pendidikan Aceh Timur. Ir Syukri MP sebagai Inspektur Pembantu Bidang Pemerintahan Mukim Gampong dan Kemasyarakatan pada Inspektorat Aceh Timur, Adnan SH sebagai Kabid Keluarga Sejahtera pada BPMKS Aceh Timur, Furqan BA sebagai Sekretaris Korpri, Mukhlan SE MM sebagai Kabag Kesra Setdakab dan lainnya. Sedangkan pejabat eselon IV diantaranya Mulyawardi SH sebagai Kasubbag Usaha, Bantuan Hukum dan Sosial pada Sekretariat Korpri, Iskandar Skom sebagai Kasubbag Umum dan Kerjasama Korpri, Harlida sebagai Kasubbag olahraga,Seni Budaya,Mental dan Rohani pada Sekretariat Korpri Kabpaten Aceh Timur. Selanjutnya Diana Andrawina SE sebagai Kasubbag Tata Usaha pada Bagian Umum Setdakab dan sejumlah nama lainnya.Hadir dalam pelantikan ini para Kepala SKPK,Asisten, Kabag dijajaran Setdakab, Camat dan undangan lainnya.(@MF)


8-15 -APRIL 30 DES 2011 6 JAN 2013 2012 | |EDISI EDISI354| 296|THN THNKE-VIII KE-VII

HUT Kecamatan Longkip Ke 10 Diperingati Subulussalam, BN Hari Ulang Tahun ( HUT ) lahirnya kecamatan longkip ke 10 berjalan sukses aman dan terkendali tanggal 01/04-2013 yang bertempat di kecamatan longkip kota subulussalam. Hadir dalam acara tersebut Muspida Kota Subulussalam seperti walikota, wakil walikota,sekda dan seluruh SKPK, camat dan tokoh masyarakat juga undangan penting lainnya. Pada kesempatan ini Walikota subulussalam Merah Sakti Kombih, SH dalam arahanya mengatakan bahwa kota subulussalam baru berumur 6 tahun dan dibawah pemerintahan defenitif, 4 tahun lebih tapi kita selalu berupaya untuk memacu pembangunan di segala sektor dengan tujuan agar masyarakat Kota Subulussalam dapat mengecap kemajuan zaman yang hakiki sesuai dengan visi/misi kita untuk itu kedepan sakti mengarahkan dukungan masyarakat agar pembangunan yang di programkan dapat terwujud karena tanpa dukungan masyarakat pembangunan mustahil dapat terlaksana. Sedangkan Mukim salah satu tokoh masyarakat dalam sambutanya mengatakan bahwa HUT Kecamatan longkip memiliki satu sejarah panjang dalam memperjuangkan pemekaran yang pada saat itu masih tunduk ke kabupaten Aceh Singkil.Lika Liku yang dihadapi dan namun akhinya kecamatan longkip di mekarkan sepuluh tahun yang lalu oleh Bupati Aceh Singkil dan sejarah ini tak boleh dilupakan sejarah panjang telah mencatat dan kini kecamatan longkip telah menjadi bagian dari Pemko Subulussalam , maka kesempatan ini atas nama masyarakat longkip mengucapkan terima kasih yang sebesar- besarnya kepada Walikota Subulussalam yang telah menyulap daerah hampir semua jalan – jalan dilongkip berwarna kuning dan lumpur, akan tetapi berkat kepedulian beliau sehingga kini semua jalan di daerah ini telah berwarna hitam alias hotmix. Kemajuan longkip tak terlepas dari satu sistem pemerintahan yang peduli akan keluhan masyarakatnya dan saat ini telah mencapai kenyataan, daerah ini maju dari segala sektor, seperti perkebunan sawit masyarakat, pertanian yang selalu mendapat perhatian dari pemerintah. Pemko subulussalam berkeinginan kemajuan pembanguan harus di kejar masyarakat harus sejahtera, sehingga cita – cita dapat terwujud agar kota subulussalam dapat bersaing dengan daerah – daerah yang lain.( RB )

26 Tim Ikuti Futsal Piala Bupati ACEH TIMUR, BN 26 Tim dipastikan mengikuti Turnamen Futsal tingkat SLTA Se-Kabupaten Aceh Timur guna memperebutkan Piala Bupati Aceh Timur yang baru pertama kali digelar, turnamen futsal ini dibuka oleh Asisten Pemerintahan Setdakab Aceh Timur, Adlinsyah, S.Sos, M.Ap mewakili Bupati Aceh Timur bertempat dilapangan JS Futsal Kota Idi, senin (1/4) pagi. Dalam kesempatannya Bupati dalam amanatnya yang dibacakan Adlinsyah mengatakan kegiatan ini merupakan ajang untuk menunjukkan kemampuan dan skill dalam mengolah si kulit bundar, “ajang seperti ini merupakan kegiatan positif yang dapat mencegah para pelajar untuk tidak terjerumus dengan narkoba dan obat-obatan terlarang yang saat ini marak terjadi di seluruh pelosok negeri ini”, ungkapnya. Sementara itu Ketua Panitia Turnamen ini, Luki Zulkarnaini, ST mengatakan maksud dari kegiatan ini adalah, memperkenalkan olahraga futsal, mencari bakat, sebagai salah satu mengembangkan sumber daya manusia. Sementara tujuannya adalah sebagai wadah penyalur minat, membentuk karakter sportifitas, mengajak generasi muda untu lebih berperan positif, realisasi pemerintah mendukung kreatifitas pemuda. Lebih lanjut Luki juga mengatakan pada Turnamen Futsal memperebutkan piala Bupati Aceh Timur ini diikuti 26 tim yang akan bertanding dari tanggal 1 s/d 6 mendatang guna memperebutkan piala bergilir Bupati Aceh Timur serta juara I mendapatkan uang pembinaan sebesar Rp. 1,5 juta dan juara II mendapatkan uang pembinaan Rp. 1 juta serta diberikan trophy juara, medali dan sertifikat kepada masing-masing juara. “Turnamen ini dapat terselenggara atas partisipasi dan kami ucapkan terima kasih kepada sponsor yang sudah membantu seperti XL, LP2R Al Fatih dan LP3I,” papar luki. Pihak panitia juga meminta maaf kepada tim-tim yang belum bisa ambil bagian dalam ajang kali ini dikarenakan pendaftaran sendiri telah ditutup pada 27/, “kami mohon maaf kepada tim yang belum bisa ikut bertanding pada turnamen ini semoga turnamen seperti ini dapat terus bergulir pada tahun-tahun mendatang,” harap luki. (ariel)

11

Pengadilan Negeri Ukur Tanah Sengketa SUBULUSSALAM, BN Tim dari pengadian Negeri Aceh Singkil / subulussalam dipimpin oleh Toni, SH turun ke lokasi tanah disengketakan di kampong Suka Makmur kecamatan simpang kiri kota subulussalam untuk mengukur tanah sengketa pada hari senin ( 01/04 ). Tanah berlokasi di jalan umum kampong suka makmur di gugat oleh keluarga Mahadi bancin seluas 2 Ha ( Ukuran tanah 200 M x 200 M ) didalanya lapangan bola kaki, kantor / kebun karet milik Disbun dan Rumah masyarakat, bahwa tanah tersebut adalah hak miliknya sesuai dengan fakta dan surat yang dimiliki. Pada saat pengukuran berlangsung terjadi ketegangan antara masyarakat yang akan diukur tanahnya mereka menghalangi karena tanah tersebut sudah dimiliki puluhan tahun dan mempunyai surat berbadan hukum seperti akta/ sertifikat, sehingga pengukur pun memilih mundur tidak berani takut ancaman dari pihak masyarakat. Alamuddin Bancin abang penggugat mengatakan tanah di areal kampong suka makmur, dulunya saat H.Yasin Bancin ( Orang tuanya ) sebagai kepala

Tim dari pengadilan negeri aceh singkil subulussalam bersama pengacara penggugat dan tergugat berbincang – bincang saat sebelum di adakan pengukuran lahan

kampong sekaligus membuka hutan diberikan kepada penduduk pendatang hanya sebagai pinjaman bukan jadi hak milik karena setelah H.Yasin Bancin meninggal dunia kepala kampong saya sendiri, jadi saya mengetahui semuanya surat – surat tanah tersebut ada sama saya semua kata alam. Sementara itu kepala kampong suka makmur H.Abdul Hamid Padang mengatakan masalah tanah diareal kampong suka makmur seperti lapangan bola kaki, kantor / kebun Disbun sudah mulai dibangun tahun 1997 , dan kenapa baru sekarang digugat kenapa tidak dari dulu kata padang. Hal senada juga disampaikan masyarakat setempat apalagi mereka sipenggugat pun selama ini tinggal di suka makmur sudah barang tentu mereka tau bahwa tanah yang klaim miliknya ditanam / diolah pihak lain, kenapa didiami pungkas mereka, sekaligus mengharapkan kepada penegak hukum untuk memutuskan perkara harus berbuat benar – benar adil. Sidang lanjutan keputusan perkara sengketa lahan tersebut akan dilanjutkan pada hari senin ( 08 / 04) di pengadilan negeri singkil. ( RB )

WH Aceh Barat Gelar Razia Busana MEULABOH,BN Sebanyak 49 wanita yang memakai celana ketat terjaring dalam razia gabungan polisi syariat, Polri dan TNI di jalan Nasional kota Meulaboh Aceh Barat, razia tersebut dilakukan berdasarkan qanun nomor 11 tahun 2002 tentang ibadah, aqidah dan syiar di aceh. Para pelanggar yang terjaring dalam razia itu akan dilakukan pembinaan serta diminta untuk tidak mengulangi memakai busana ketat, dengan membuat perjanjian secara tertulis. Kepala satuan polisi wilayatul hisbah, Khairuzzadi kepada Bongkarnews, razia busana muslim tersebut dilakukan berdasarkan peraturan daerah atau qanun nomor 11 tahun 2002, tentang ibadah dan aqidah. Khairulzadi mengharapkan kepada masyarakat

Kepala Sekolah SDN Dasan Raja kecamatan penanggalan Adi Suryo, S.Pd

khususnya wanita yang ada di Aceh Barat, agar mengenakan pakaian yang menutup aurat dan tidak berbentuk lekuk tubuh, demi menegakkan syariat

islam di kabupaten Aceh Barat, kedepan razia seperti ini terus kita lakukan guna menekan angka pelanggar syariat, tutupnya.(@rul)

Illiza Minta Pemilik Usaha Lindungi Pekerja Perempuan Banda Aceh, BN Wakil Walikota Banda Aceh Hj. Illiza Sa’aduddin Djamal, SE meminta setiap perusahaan yang mempekerjakan perempuan dapat melindungi dan memperhatikan hak-hak kaum perempuan. Hal itu disampaikannya saat memberi arahan pada acara sosialisasi undang-undang perlindungan tenaga kerja perempuan di aula Balaikota Pemko Banda Aceh Kamis (4/4). Disamping melindungi lanjutnya, perusahaan juga diharap memperhatikan hak-hak karyawan perempuan yang bekerja ditempatnya. Hak-hak perempuan yang dimaksud seperti memberikan izin 2 hari masa haid dan cuti melahirkan selama tiga bulan dengan tidak memotong sepeserpun gaji mereka. Illiza berharap dengan adanya sosialisasi tersebut para pekerja, pemilik usaha, kafe, apotek, hotel dapat memahami aturan aturan yang ditetapkan Pemko Banda Aceh. Namun apabila mereka tidak mematuhi, mereka akan kita

panggil, kata Illiza. Illiza juga mengimbau para pekerja perempuan agar dapat memakai pakaian sesuai syariat islam. Jangan malah perempuan diekploitasi dan dijadikan komoditi pendongkrak penjualan suatu produk, tegas Illiza. Disebutkannya Hak-hak yang harus dipenuhi sebuah perusahaan seperti memberikan gaji sesuai UMR Aceh sebesar Rp. 1.550.000, menyediakan transportasi antar jemput karyawan, menyediakan fasilitas penginapan yang terpisah laki laki dengan perempuan dan fasilitas lainnya. Ditegaskannya dalam waktu dekat aturan-aturan tersebut akan diatur dalam peraturan walikota banda aceh Aturan-aturan tersebut katanya akan diatur dalam peraturan walikota Banda Aceh, sehingga akan mempunyai kekuatan hukum yang kuat. Memang diakuinya aturan-aturan itu belum semua dipatuhi dan dengan sosialisasi ini diharapkan

mereka baik pemilik usaha dan pekerja perempuan akan mengetahui dan melaksanakan aturan tersebut. Illiza juga menghimbau jika terjadi pelanggaranpelanggaran terhadap pekerja wanita, agar mau melaporkan ke pemerintah Kota Banda Aceh melalui sms gateway, atau juga bisa langsung ke Dinsosnaker/ WDC atau Kantor PP KB Kota Banda Aceh. "Dengan adanya pengaduan kita berupaya memprotek dan memberikan advokasi hukum kepada perempuan tersebut," katanya. Sosialisasi yang berlangsung selama satu hari penuh diikuti 300 peserta dari unsur pemilik usaha, pekerja hotel, kafe, apotek, lembaga formal maupun informal lainnya. Beberapa narasumber penting seperti Kadis Syariat Islam Aceh Prof. Dr. Syahrizal Abbas, Kepala Dinsosnaker Kota, dan Dinas Syariat Kota Banda Aceh dihadirkan untuk memberi pemahaman dan informasi terkait perempuan dan hak-haknya. (*)

Kabinet Hamdan Sati ‘Mandul’ ACEH TAMIANG,BN Mantan Ketua Himpunan Mahasiswa dan Pelajar Aceh Tamiang (HIMPERATA), Ramli menuding, Kabinet Pemerintahan Hamdan Sati – Iskandar ZulkarnainsebagaiBupatiAcehTamiang(Atam)tidakmemiliki ArahKebijakanUmum(AKU)dalammembangunkabupaten diujung Timur Aceh itu. Dirinya menilai Pemerintahan Kabinent Hamdan Sati Cs mandul—diam ditempat—tidak seperti dikatakan saat sebelumdirinyamenjadibupatidefinitif,pernyataanHamdan Sati di media cetak; akan membawa perubahan di segala bidang sector untuk memajukan Atam secara umum. “Sayakira,HamdanSatiharusbisaintrospeksidiri,apakah pemerintahannyasudahbenarataumasihbergeming,tidak mampumembawaperubahankearahyanglebihbaik,dalam membangun Atam ke depan. Saya kira omong kosong itu”. TegasnyadalamsebuahwawancarasoreinikepadaSTC. MenurutRamli,tugasseorangbupatimampumembawa perubahanyangmendasarditatanansebuahpemerintahan, bukan malah diam dan terkesan hanya berpangku tangan. Lebih jauh dikatakan; jangan membeo, Jokowi memimpin JakartadenganAnggaranBelanjadanPembangunanProvinsi

(APBP) yang triliunan jumlah. “Kita jangan selalu membeo, melihat orang lain maju dengan cara turun ke desa-desa, atau setiap harus jumpa denganmasyarakat layaknya seorang artis. Saya kira tidak demikian. Kita minim APBK, gunakan sebaik mungkin, jangan terlena dengan asyik turun kelapangan tanpa hasil. Maaf kalau saya mengkritik, tapi ini demi kemajuan Atam”. Katanya. Masih Ramli; selayaknya bupati sudah merestrukturisasi kabinet—SKPD—lama yang tidak berpotensial dalam mengawangi Atam untuk meningkatkan Pendapatan Asli Daerah (PAD), kalaupun tersangkut dengan kebijakan APBK tahun 2012, kan sudah habis masanya. “Ini sudah bulan Maret 2013, saya piker Bupati sudah sewajarnya menggantikan para Kepala SKPD yang tidak mampu bekerja dengan baik. Tugas kepala SKPD kan harus sesuai tupoksi, mempu membawa perubahan dan meningkatkan PAD, malah terkesan memelihara para koruptor berdasi”. Selain Ramli, Andy Nur Muhammad (aktifis mitigasi) Aceh berpendapat, Hamdan Sati belum dapat

membawa perubahan di Kabupaten Atam,“Sudah lebih 100 hari, tapi tidak ada gebrakan-gebrakan yang dapat membawa Atam kea rah perubahan mendasar, lihat saja, apa yang sudah diberikan untuk Atam”. Katanya. Andy sependapat dengan pernyataan Ramli, kalau restrukturisasi hanya omong kosong, kalau masih memakai cabinet lama (Abdul Latief), sama saja seperti memasukan garam sejumput ke laut, tak berbekas dan tidak memberikan efek apapun. Sektor pendidikan, kehutanan, konflik tanah, HGU dan Kelautan semua bermasalah, malah LSM LembAHtari yang getol menyuarakan kebijakan masa lalu yang salahpun tak ditanggapi, padahal itu bisa dijadikan sebagai acuan dalam tahapan pembenahan di kabupaten Atam ini. “HariinisayakecewadengansikapPemerintahyanghanya bisa diam, tidak mampu berbuat. Kalau tak mampu memimpin kenapa harus mau menjadi Bupati. Jangan ngeles “saya terpaksa atau dipaksa” itu hanya kamuflase dan retorika ketidakmampuan, tunjukan pada rakyat Tamiang kalau anda mampu, bisa tidak!!!”. Tegas Andy mengakhiri.(ZUL)

Jalan dan Jembatan ‘Kupak-kapik’, Balita Diserang Ispa ACEH TAMIANG,BN jalur utama lintasan Karang Baru menuju Babo, Ibukota Kecamatan Bandar Pusaka kupak kapik, selain itu juga ada beberapa jembatan maut butuh perhatian serius dari Pemkab Aceh Tamiang (Atam) segera dibangun. Bagaimana tidak, jembatan dilintasan tersebut banyak memakan korban yang digunakan masyarakat sebagai lintasan dan sarana pital lalu lalang masyarakat dari wilayah hulu untuk membawa hasil bumi ke ibukota Kabupaten. STC melansir, banyak masyarakat saat melintasi jembatan sudah tak layak itu, malah terjerambat masuk ke dalam alur—anak sungai—yang sudah terlihat rangka besi jembatan. “beberapa waktu lalu saya, istri dan anak, masuk kedalam alur, untungnya alur tersebut ada airnya, tidak langsung terhempas”. Kata Meno (37) warga Bukit Karim saat dikonfirmasi. Memang jembatan tak layak itu, bukan hanya satu ini saja, melainkan salah satu sampel dari beberapa jembatan pital maut; yang sangat butuh perhatian serius dari Pemkab. Ada 5 unit jembatan ukuran

sedang—plat beton—yang butuh untuk segera dibangun, mengingat lintasan Karang Baru – Hulu adalah jalur pital menuju ibukota Kabupaten. Sumber di dipemerintahan menyebutkan, untuk jembatan menuju hulu di wilayah Atam untuk Tahun Anggaran 2013 ini sudah mulai di bangun. Benarkah?...kita lihat benar atau tidaknya. Janganjangan itu hanya ucapan klise menyenangkan hati masyarakat. Namun hingga berita ini di lansir, belum ada pejabat pemerintah Atam yang buka mulut. Kita tidak tahu apa memang harus tutup mulut atau takut jabatannya copot, akibat tekanan dari elit politik. Sayang jika ini terus belanjut di Atam, lalu sampai kapan masyarakat menerima imbas ketidakmampuan pemerintah?...tak tau lah, hanya mereka yang bisa jawab. “Selain jalan dan jembatan, kami butuh perhatian untuk bidang kesehatan. Coba saja bapak bayangkan, kalau musim kemarau kami harus menghirup debu setiap harinya, kalau hujan ya kayak kubangan. Selayaknya jalan utama ini bukan lintasan pital,

melainkan lintasan kampung menuju sawah atau ladang”. Tegas Herlina (40) warga alur Jambu. Terserang Sesak Nafas Data dari beberapa Puskesmas menyatakan, dalam satu bulan ada 4 sampai 6 orang usia balita yang terserang sesak nafas—isfa, akibat debu jalan, sudah melewati abang batas. Hal itu sudah menjadi aktifitas biasa yang dirasakan oleh masyarakat hulu wilayah Atam. Dari data di peroleh; dalam satu bulan disatu Kecamatan ada 20 orang usia balita terserang saluran pernafasan dan butuh perhatian lebih serius. Dari data lapangan yang dihimpun, setiap puskesmas masih kekurangan tenaga medis dan obat-obatan. “Benar pak, kita sangat kekurangan tenaga medis dan obat-obatan, dimana saat masyarakat berobat, mereka harus mencari obat yang dibutuhkan ke Ibukota Kabupaten. Dan itu jarak yang harus ditempuh puluhan kilometer, kami sendiri mengeluh, sebab tidak bisa berbuat banyak untuk membantu masyarakat”. Sebut sumber disalah satu Puskesmas. (zul)

SD Penentu Generasi Muda Kedepan SUBULUSSALAM, BN Bagi anak didik menjadi yang baik, bermartabat menjunjung tinggi norma – norma kemanusiaan untuk menjadi harapan bangsa kedepan sekolah Dasar ( SD ) adalah kunci utama, hal tersebut dikatakan kepala SDN Dasan Raja Kecamatan Penanggalan Adi Suryo, S.Pd kepada BN di ruang sekolah pada hari kamis ( 04/04). Lebihlanjutdikatakankarenaanak–anakpadasaat memasukiSDSelama6tahunadalahanak yangmasihlugu belummengertikejahatanmakaolehsebabituselama berada di SD peran guru sangat dibutuhkan untuk mendidik anak – anak tersebut dari SD tersebut lah modal untuk dibawah melanjutkan studynya ditingkat lebih tinggi ( SMP ) tutur Adi Suryo. Makasayasebagaikepalasekolahkatasuryoberusaha semaksimalmungkinuntukmemberikan arahankepada para guru agar benar – benar menanamkan etika yang luhur / baik kepada para murid sewaktu mengajar jelasnya. SDN Dasan Raja memiliki 139 orang anak didik, 21 orang kelasVI dan guru mengajar 10 orang, nilai kelulusannya pada tahun 2012 100% dan untuk tahun ini akan diupayakan sama dengan tahun lalu 100% tegas kepalasekolah. Pantauan BN pada saat itu jam belajar di masing – masing kelas sangat tertib para murid sangat serius mengikuti serta pada saat istirahat pun semua anak – anakaberadadalamlingkungansekolahtidakadayang keluar dari pagar seperti sekolah lain. Sedangkan sabtu ( 06/04 ) kata Adi Suryo di SDN Dasan raja akan diadakan pertemuan ( Rapat ) kelompok kerja guru ( KKG )Tingkat Kecamatan penanggalan untuk membahas peningkatan mutu pendidikan dan penyuluhan kegiatan olimpiade olahraga oleh kelompok kerja kepala sekolah ( KKS ) Satgas IV – X juga wilayah kecamatan penanggalan kota subulussalam.( RB )

Diuji Publik : 1457 Tenaga Honorer Aceh Timur Masuk K2 Aceh Timur,BN Sebanyak 1457 tenaga honorer Tahun 2005 Kategori 2 (K2) yang bertugas di lingkup Pemerintah Kabupaten Aceh Timur dinyatakan valid dan namanya diumumkan dalam pengumuman tenaga honorer K2 yang dikeluarkan Badan Kepegawaia Nasional (BKN) sebagaimana disampaikan kembali oleh Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Kabupaten Aceh Timur. Nama nama yang dinyatakan valid tersebut diumumkan dalam uji publik secara luas kepada masyarakat untuk dikros cek kembali apakah memang nama nama yang masuk dalam K2 tersebut benar benar layak untuk nantinya diikutkan dalam testing penerimaan CPNS formasi honorer. Jika ada sanggahan, bantahan dari publik terkait keabsahan nama nama dimaksud agar dapat segera disampaikan kepada Bupati Aceh Timur melalui Kepala BKPP untuk segera ditindaklanjuti dengan memberikan data autentik yang dapat dipertanggungjawabkan. Demikian disampaikan Plt Kabag Humas dan Protokol Setdakab Aceh Timur T Amran SE melalui Kasubbag Humas,Eddyanto SST, Rabu (3/4). Untuk pengumuman nama nama yang masuk dalam nominasi K2 ini bisa dilihat langsung ke Kantor BKPP Aceh Timur dan juga Setdakab serta dinas lainnya. Pengumuman tersebut telah ditempelkan secara terbuka agar mudah di akses publik,'tutupnya.(@MF)


8-15 APRIL 2013 | EDISI 354| THN KE-VIII

LINTAS RIAU

Jalan Perwira Rusak Berat Dumai,BN Kondisi jalan perwira sejak lama sudah memprihatinkan, hal itu dikarenakan belum adanya perbaikan. Selain itu jalan yang satu satunya dilalui warga menuju kantor DPRD dan kantor Walikota Dumai itu selalu dilintasi armada truk yang bertonase tinggi membuat kondisi jalan yang rusak kian bertambah parah Seperti pantauan media ini beberapa hari lalu dilokasi jalanrusaktampakpenggunajalandengansusahpayah melintasi jalan yang berlumpur pas turun hujan. Sehingga ada yang tergelincir seperti pengendera motor roda dua akibat lubang lubang yang terdapat dibadan jalan yang rusak parah. Untuk perawatan jalan ini Pemko telah melakukan penimbunan beberapa kali tetapi toh tidak membawa arti karena jalan yang ditimbun selalu dilalui banyak kendaraan yang bertonase tinggi penyebab kondisi jalan perwira merupakan salah satu jalan yang terjelek dalam kota Dumai. Berbagaiprotesyangdisampaikanwargakarena kondisi jalan perwira selama ini belum ada perbaikan. Pada hal jalan ini merupakan akses satu satunya untuk menuju Kantor DPRD dan Kantor Walikota Dumai maupun kantor instansi lainnya yang berada dijalan perwira.Yang seharusnyajalaninikondisinyamenggembirakan.Sebagai catatan di masyarakat sudah tiga walikota dumai berganti sampai tahun 2013 ini jalan perwira kondisinya masih seperti yang dulu juga (kondisinya rusak) apalagi pas musim iklim hujan yach memprihatinkanlah ujar beberapawargayangbertemuwartawanmediaini dilokasi jalan rusak tersebut pada selasa lalu (2/4) Keterangan yang dirangkum media ini dari beberapa anggota warga disekitar jalan perwira mengatakan kondisi jalan tersebut mengalami kerusakan juga akibat dari leluasanya armada bertonase tinggi melalui jalan perwira tersebut karena itu Pemko Dumai harus bertindak tegas danberanimengambillangkahrefresifterhadaparmada yang melebihi tonase bila melalui jalan perwira ini kata beberapawargadisanayangtidakbersedianamanya ditulis. Dumai sebagai salah satu kota transit dan pintu gerbangmasuknyamancaNegarakeIndonesiabahwa seharusnya infrastruktur jalan dikota ini kondisinya sudah memadai kata warga itu lagi. Dari pengamatan media ini bahwa infrastruktur jalan dibeberapa wilayah kecamatan dikota Dumai belum memadaisepertidiwilayahkecamatanmedangkampai dansungaisembilan.sarana jalan merupakanakses masyarakat tidakdapatditawartawardansudahsaatnya terpenuhi untuk kebutuhan masyarkat di daerah Medang kampai danSeiSembilan. Sementara jalanyangadasaat ini sebahagian kondisinya banyak yang rusak parah. Hal tersebut sangat berpengaruh pada perekonomian masyarakatmedangkampaikhususnyabagiwargayang berada di pelosok. Sedangkan jalan aspal yang telah terbangun kini sebahagian sudah kopak kapik. Karena itu diharapkan ada kebijakan pemerintah kota Dumai untuk perbaikan jalan yang kian hari bertambah parah. Infrastruktur jalan yang banyak rusak di daerah Medangkampai menjadi perhatian prioritas buat Camat Medangkampai WanKamarudinyangbarumemasuki tiga bulan menjabat Camat Daerah ini, menurutnya kondisijalanyangmerupakanaksesmasyarakat saatini kondisinya sangat memprihatinkan. Karena itu pengajuan infrastruktur dalam musrenbang belum lama ini,khususnya untuk pembangunan jalan diharapkan dapat terwujud. Karena jalan adalah saranaVital untuk aksesperekonomianmasyarakatujarCamatMedang kampai itu mengahirinya padaWartawan. (Rds/Tenk)

Truk Masuk Kota Harus Patuhi Rambu Lalulintas Dumai ,BN Peraturan dan kecepatan kendaraan yang masuk jalan kota harus ditertibkan karena jalan lintasan yang dilalui kendaraan truk truk juga merupakan lintasan yangdigunakanmasyarakat.Sementarasebahagianbesar truk truk yang memasuki jalan kota dipacu dengan kecepatan tinggi oleh oknum supir yang merasa hebat dan patentengan hal itu sangat berbahaya bagi warga pengguna jalan. Untuk menekan hal hal yang dapat menimbulkan bahaya bagi pengguna jalan dalam kota, Pemko Dumai melalui dinas perhubungan kota dumai sudah memasang rambu rambu tentang ketentuan laju kendaraan truk yang memasuki jalan kota.Truk truk yang melintas disejumlah ruas jalan di dalam kota harus mengurangi kecepatannya ujar Kepala Dinas perhubungan kota DumaiTaufik Ibrahim menjelaskan padawartawanbelumlamaini. Dinas perhubungan kota Dumai tidak akan segan mengejar dan menyetop truk truk yang melaju kecepatan tinggi apabila melanggar rambu rambu kecepatan kendaraanyangditetapkankarenaDinasPerhubungan Kota Dumai sudah menetapkan untuk kecepatan maksimal 40 Km/Jam yang harus ditempuh truk dilintas jalandalamkota,bahkanuntukmelakukanpengawasan terhadap laju kendaraan di lintas jalan kota dinas perhubungan menyediakan alat pengukur yang bisa memantaulangsungkendaraanyangsedanglewat. Sesuai keterangan diperoleh media ini, bahwa beberapa oknum sopir pengemudi truk yang masuk dalamkotaterkesanmembandeldanadayangsok anggar jago seenaknya melaju masuk rute dalam kota. Bahkan truk truk tersebut bukan hanya mengabaikan larangankecepatankendaraannyatetapisering melanggar rambu rambu aturan memasuki jalan yang tidak selayaknya dilalui dengan bobot kendaraan yang berlebihan. Kondisi ini membuat berbagai pihak dimasyarakatmendukungsepenuhnyaketegasanDishub Dumai untuk menertibakn truk yang masuk jalan kota dan yang melebihi tonase. Sebab inilah sebagai biang keroksumberpenyebabrusaknyajalandan semberautnya jalan lintas dalam kota Dumai.(Sirait/ Tenk)

DPD RI Nilai Aparat Lalai Awasi Narkoba di Kepri KEPRI,BN Maraknya penyelundupan narkotika di wilayah Kepri khususnyaBatammembuatberangsenatorasalKepriHardi SHood.Iamenudingpenegakhukumlalaimengawasilalu lalangbarangharam Jika dahulu jalur penyelundupan narkotika di Asean terkenal dengan jalukan segi tiga emas (Thailand,Vietnam dan Malaysia), namun saat ini sudah beralih menjadiVietnam, Indonesia dan Malaysia. Khusus Indonesia kata Hardi ada di Batam, Jakarta dan Bali. Hal ini sebut Ketua Komite III DPD RI, tidak terlepas dari pangsapasarnarkotikayangmakinsuburdinegeriini.Kabar terbaru yang dia peroleh ditemukannya lagi penyelundup sabu-sabuseberat1,59kgdiHangNadimBatam,Jumat(5/ 4) lalu.

“Aneh, para penyelundup ini yang tetangkap rata-rata mengaku sudah beraksi 2 sampai 4 kali. Artinya kan pengawasan penegak hukum sangat lalai dan lemah,” sindirnya. Terlebih lagi barang haram itu masih banyak yang tak terdeteksisepertiyangdiselundupkanlewatjalurtikusyang banyak ditemui di wilayah Batam dan Kepri. Narkoba ini kata Hardi kebanyakan berasal dari wilayah segi tiga emas narkoba yakni Malaysia. “Kami prihatin dengan kinerja aparat penegak hukum. Bayangkan sampai saat ini sudah ada BNN dan sebagainya puntetapimasalahnarkobatakjugabisatuntas.Kalauaparat mau jujur, jangan pernah ada pilih kasih dalam menumpas peredaran narkoba,”sebutnya. Dari catatan pihaknya sudah ada 5 juta jiwa penduduk

Indonesiayangtelahkencanduannorkobaaktif.Diperparah denganmaraknyaperederannarkobaakhir-akhirini,tentu saja jumlah pecandu akan meningkat dua kali lipat dari sekarang. “Khsusu wilayah Batam dan Tanjungpinang, kami mendesakpolisidanpenegakhukumlainnyasepertiBCagar lebih waspada dalam mengawasi lalu lalang barang dan orangyangtiba.Bilaperluseluruhpelabuhantikusdikawal ketat,karenakuatdugaanjalurinidigunakanolehparamafia narkoba untuk beraksi,”tegasnya. Di tempat terpisah LSM Anti Narkoba Granat Kepri, yang diketuaiSamsulPalohmensinyalirhampir80persentindak kejahatannarkobadiBatamdilakukanmelaluijalurlautdan sisinya dari udara. “Aktivitas kapal di pelabuhan tikus saat ini bukan

Enam SD Dapat Penghargaan Sekolah Terbaik dari Dewan Pendidikan Batam,BN Dalam rangka merumuskan program kerja pada tahun 2013 ini, Dewan Pendidikan kota Batam menggelar Rapat Kerja (Raker) Dewan Pendidikan Kota Batam yang di buka secara resmi oleh Wakil Walikota Batam, Rudi, Sabtu (6/4) di Vista Hotel. Selain menyusun program tahun 2013, acara yang diikuti oleh 32 komite sekolah mulai dari sekolah dasar hingga sekolah menengah atas baik negeri maupun swasta di Kota Batam ini juga bertujuan untuk melakukan evaluasi terhadap prestasi dan kualitas pendidikan di Kota Batam. Ketua Dewan Pendidikan Kota Batam, Said Indra Abdullah dalam laporannya mengatakan selain melakukan koordinasi dan merumuskan program setahun kedepan, Dewan Pendidikan Kota Batam dalam kesempatan ini juga memberikan anugerah tokoh pendidikan Kota Batam sebagai bentuk penghargaan kepada tokoh yang dianggap telah memberikan dedikasi, sumbangsih dan upaya dalam memajukan dan memperhatikan pendidikan di Kota Batam. “Tahun 2013 ini kami atas nama dewan pendidikan kota batam memberikan anugerah tokoh

pendidikan kepada mantanWali Kota Batam yang saat ini menjabat sebagai Ketua Lembaga Adat Melayu Kota Batam, bapak Nyat Kadir atas perhatian dan dedikasinya kepada dunia pendidikan di kota batam”, ujar Said Indra. Selain Nyat Kadir, Dewan Pendidikan Kota Batam juga memberikan penghargaan khusus kepada Hardi Selamat Hood, mantan ketua dewan pendidikan kota Batam selama 2 periode rentang waktu 2002-2006 dan 2006-2011. Dalam kesempatan tersebut juga diberikan piagam penghargaan kepada sekolah dasar yang berprestasi dibidang mata pelajaran, kesenian maupun olah raga di tingkat nasional. Penghargaan ini diberikan kepada SDN 002 Batu Aji, SDN 003 Batu Aji dan SDN 004 Batu Ampar untuk kategori sekolah dasar negeri, sedangkan untuk kategori sekolah dasar swasta penghargaan diberikan kepada SD Permata Nusantara, SD Theodore dan SD Tabita. Wakil Wali Kota Batam, Rudi, dalam sambutannya sebelum membuka Raker ini menyampaikan hubungan antara pemerintah kota Batam dengan dewan pendidikan saat ini telah terjalin dengan baik. Banyak sekali masukan dan saling bertukar pikiran adalah

sebagai upaya yang dilakukan untuk memajukan pendidikan di Batam. Rudi menambahkan, ada 2 sektor yang akan diperkuat oleh pemerintah kota Batam dalam hal peningkatan mutu pelayanan kepada masyarakat yaitu dibidang pendidikan dan kesehatan. Saat ini banyak yang mengenal Batam hanya sebagai kota industri, perdagangan dan pariwisata, sedangkan dari sektor pendidikan kurang terdengar gaungnya. Untuk itu perlunya suatu perubahan yang harus dilaksanakan bersama oleh seluruh insan pendidikan dalam hal memajukan dan meningkatkan mutu pendidikan di Batam. Wawako menambahkan Dewan Pendidikan dan Komite Sekolah hendaknya terus berupaya menguatkan komitmen demi terselenggaranya layanan pendidikan yang berkualitas disemua jenjang sekolah. “Para pengurus Dewan Pendidikan dan Komite Sekolah hendaknya terus berupaya memasyarakatkan berbagai ketentuan yuridis di bidang pendidikan serta mendorong setiap sekolah untuk berinovasi dan terus mengembangakan sistem pembelajaran yang efektif,”pungkasnya. (int)

saja melayani kapal-kapal antar pulau tetapi juga diguanakan untuk menyelundukan narkoba dari luar negeri. Jadi aparat jangan bermain-mainlah di sini, ini demi anak bangsa. Jika memang aparat punya hati nurani, ya tolong dong pelabuhan tikus di Batam dijaga,” kecamnya.(int)

Ditlantas Polda Kepri Gagas Samsat Online Kepri,BN DirektoratLalulintas(Ditlantas)PoldaKeprimenggagas pembayaran pajak kendaraan secara online. Ini untuk mempermudah pemilik kendaraan di Provinsi Kepri, sehinggadapatmembayarpajakdimanasaja. “Gagasan ini sudah kami sampaikan kepada Dinas Pendapatan Daerah (Dispenda) Kepri, tanggapannya positif. Namun pelaksanannya kapan, kami tidak tahu, karena hal itu gaweanya pemerintah,”ujar Direktur Lalulintas (Dirlantas) Polda Kepri, Kombes Rusdi Hartono, Jumat (5/4) . Mantan Kapolres Garut ini mengatakan samsat online adalah tantangan pemerintah untuk mempermudah pembayaranpajakkendaraan.”Karenaidealnyapembayar pajak harus dimudahkan,”katanya. Pengguna kendaraan yang berada di kabupaten dan kota di Kepri bisa membayar pajak dimana saja tanpa terbatas ruang. “Dari Karimun, Natuna, dan Tanjungpinang bisa membayar pajak di Batam, begitupun sebaliknya,”ungkap perwira tiga mawar di pundaknya ini. Dengan adanya kemudahan itu, pembayaran pajak kendaraan terus meningkat, seperti yang telah diterapkan di wilyah DKI Jakarta serta Jawa Barat. Gagasan itu menurutnya berawal dari keberhasilan sistem BPKB online di seluruh Indonesia. Masyarakat yang kehilangan BPKB, bisa mencetak ulang, karena datanya masih tersimpan. “Sehingga mempermudah pelayananterhadapmasyarakat,”pungkasnya.(int)

DELI SERDANG - DELI SERDANG - DELI SERDANG - DELI SERDANG - DELI SERDANG - DELI SERDANG Rasa Haru dan Isak Tangis Warnai Kunjungan Kerja Bupati Amri Tambunan di Pagar Merbau

41 Kunci Rumah yang Telah Selesai Dibangun Diserahkan L.PAKAM -BN RasaharudanisaktangiswarnaikunjungankerjaBupati Deli Serdang Drs H AmriTambunan dan Ketua TP-PKK Ir Hj Anita AmriTambunan di Kecamatan Pagar Merbau, Selasa (26/3). Ketika bupati menyerahkan 41 kunci rumah yang telahselesaidibangunbesertasurattanahdanIMB,sejumlah wargapenerimabantuanbedahrumah takkuasamenahan rasaharunyasehinggameneteskanairmata. DalamkunjungankerjanyakeKecamatanPagarMerbau, Bupati Drs H Amri Tambunan yang didampingi Dandim 0204 DS Letkol Arh Syaepul, Kadis PU Ir Faisal, Asisten I H SyafrullahS.Sos,KadisPertanianIrEkaSriRejekiDanil,Kadis DikporaHjSaadahLubis,KadisInfokomDrsNekenKetaren, Wakil Ketua DPD REI Sumut Datuk Selamat Fery selain menyerahkan41kuncirumahjugamenyerahkansejumlah bantuandiantaranya22.500ekorbenihikanlele,1000ekor itik, 1 unit mesih pengolah kompos, 3000 batang pohon penghijauan serta bantuan kepada sejumlah siswa SD berprestasi bidang IPA dan matematika. Bupati Deli Serdang Drs H Amri Tambunan pada kesempatanitumengatakanbahwadengankebersamaan kitadapatmelakukanapasajamembangunkemaslahatan masyarakat sejalan denganlajunyaperkembanganzaman diiringi tuntutan kebutuhan masyarakat yang semakin berkembang. Karenanya mari kita kobarkan dan pertahankan jati diri kita sebagai bangsa yang bersatu dan salingmenyayangi.

Kitajugamengetahui bahwaSemua Negaramengagumi tanahairkita yang memang dikaruniai sumberdayaalam yang melimpah untuk dikelola dengan baik. Tetapi kesemuanyaitu mustahil bisatercapaibilakitatidak memiliki kekompakan dan kebersamaan, karenanya kita harus mempertahankan jati diri kita sebagai bangsa yang saling menyayangiantarsesame.

Deli Serdang , Terbaik I Lomba Penanaman Satu Milyar Pohon Medan ,BNBupati Deli Serdang Drs H Amri Tambunan mendapat predikatterbaikIpadalombapenanaman satumilyar pohon (onebillionIndonesianTrees)tingkatprovinsiSumateraUtara tahun 2012, sebagaimana Surat Keputusan Plt Gubernur Sumatera Utara H Gatot Pujonugroho ST Nomor 188.44/739/KPTS/ 212 . pada acara peringatan Hari Bakti Rimbawan tahun 20013 tingkat Provinsi Sumatera Utara , Senin ( 18/3) di reservoar / kanal jalan Eka Sama Pangkalan Mansyur Kotamadya Medan. yang dihadiri Unsur FKPD Sumut, dan pimpinan SKPD Pemprovsu dan undangan lainnya.. BupatiDeliSerdangDrsHAmriTambunan penerima Surat Keputasan Gubsu sebagai terbaikI lomba penanaman satu milyar pohon diwakili Kadis Kehutanan Deli Serdang Ir Arli Msi,diserahkan Gubernur Sumatera Utara diwakili Staf Ahli bidang ekonomi DRDrsArsyadLubis MM, menyusulterbaikIIBupati Gunung Sitoli Martinus Lase,MSp dan selanjutnya Bupati SimalungunDRJRSaragih,SHMMdiwakiliKadisKehutanan KabupatenSimalungun SudahmanSaragih.

StafahlibidangEkonomiPemprovsu DRDrsArsyadLubis MM selaku irup pada upacara peringatan Hari Bakti Rimbawan tahun 2013 tingkat Provinsi Sumatera Utara membacakan pidatosambutanMenteriKehutananRI Zulkifli Hasanantaralainmenjelaskanbahwaprogramyanglangsung terkait dengan kontrak kinerja Kementerian Kehutanan adalahpenanamandalamrangkarehabilisasihutandanlahan yang sampai tahun2012telahtercapai 1.148.289,14hektar daritarget2,5jutahektar padatahun2014. Olehkarenaitu padatahun2013iniakanditanam748.285 hektardanpada tahun 2014 sekitar 603.426 hektar Upacara HariBaktiRimbawantahun2013tingkatProvinsi SumateraUtara diawalidengan pengibaranbenderamerah putih diiringi lagu Indonesia raya Pembacaan Pembukaan UUD 1945, teks Pancasilaselanjutnyamenyanyikanlagu BagimuNegeri serta penanamanpohon olehpesertaupacara berupapohon nyamplung,kuini,kepuhtualangdanbinjai,yangsebelumnya juga dirangkai dengan kegiatan bhakti sosial,pemeliharaan pohon,donor darah,pertandingan olahraga dan malam keagrabanRimbawan. (ROMI/INDRA)

Pada kesempatan itu, Bupati Drs H Amri Tambunman yang tinggal 1 tahun lagi akan mengakhiri masa tugasnya juga menyampaikan terima kasih kepada seluruh warga masyarakat yang selama ini telah memberikan dukungan untukkemajuanpembangunanDeliSerdang.Keberhasilan kita membangun daerah tercinta ini pada dasarnya karena terciptanya kebersamaan yang indah antara masyarakat,

pemerintahdandukunganswasta/pengusaha. Sebelumnya Camat Pagar Merbau Drs Teddy Bachtari dalamlaporannyamenyebutkansejakgerakankemanusiaan bedah rumah dicanangkan Bupati Drs H Amri Tambunan pada Maret 2011 kini di Kecamatan Pagar Merbau telah dibangun 91 rumah tidak layak huni menjadi rumah sehat dan layak huni. Keberhasilan pelaksanaan gerakan kemanusiaan bedah rumah di Kecamatan Pagar Merbau tidak terlepas dari bersatunya tiga pilar pembangunan (pemerintah,masyarakatdandukunganswasta). Disebutkannya pada tahap pertama, gerakan bedah rumah di Pagar Merbau berhasil membangun 50 rumah tidak layak huni menjadi layak huni dan pada tahap kedua berhasil membangun 41 rumah. Sejak gerakan bedah rumah dilaksanakan, para pengusaha batu bata di Pagar Merbau ikut berperan aktif dan tercatat sebanyak 500.000 batu bata merupakan sumbangan para pengusaha batu bata. Dari 41 rumah warga kurang mampu yang berhasil dibangunpadatahapkedua,sebanyakduaunitmerupakan sumbanganKepalaDesaPasarMiringdanstaf. Usaimenyerahkankuncidansejumlahbantuanlainnya, Bupati Drs H Amri Tambunan bersama Ketua TP-PKK Ir Hj Anita Amri Tambunan meninjau rumah Tugisih di Dusun Makmur Desa Pasar Miring yang telah selesai dibangun. Selanjutnya meninjau MCK yang dibangun melalui PNPM dengananggaranRp139jutadiDesaPagarMerbauPondok Batu.( ROMI / INDRA )

Bupati Resmikan Kantor Kades Tg Rejo Percut dan MCK Plus Bernilai Rp 500 Juta PERCUT SEI TUAN -BN Bupati Deli Serdang Drs Haji Amri Tambunan, Kamis (21/3) meresmikan pemakaian kantor Kepala Desa Tanjung Rejo Kecamatan Percut Sei Tuan. Selain meresmikan kantor desa yang dibangun dengan dana Rp 150 juta yang bersumber dari ADD dan swadaya masyarakat bupati yang didampingi Ketua TP PKK Deli Serdang Ir Hj Anita Amri Tambunan, Kadis PU Ir Faisal, Aasisten I Drs H Syafrullah S.Sos, Kadis Infokom Drs Neken Ketaren, Wakil Ketua DPD REI Sumut Datuk Selamat Fery, Ketua PMI Deli Serdang H Ismayadi SH juga meresmikan pemakaian MCK Plus di Dusun I Desa Tg Rejp yang merupakan program sanitasi lingkungan berbasis masyarakat (SLBM). Sebelum menandatangani prasasti kantor Kepala Desa Tg Rejo. Bupati Drs H Amri Tambunan mengajak seluruh warga masyarakat untuk tetap menumbuh kembangkan rasa kebersamaan yang selama ini telah terbukti mampu menjadi modal besar untuk memberhasilkan berbagai program pembangunan di Deli Serdang. Apapun dapat kita lakukan untuk

memacu pembangunan di Deli Serdang kalau kebersamaan yang indah seperti ini terus dapat terjalin dengan baik. Sekretaris Desa Tg Rejo Riski Apianto menjawab pertanyaan wartawan menyebutkan pembangunan kantor desa yang menelan biaya Rp 150 juta bersumber dari ADD TA 2011 dan 2012 yang besarnya Rp 60 juta. Sedangkan sisanya merupakan swadaya masyarakat yang besarnya mencapai Rp 90 juta. Sementara MCK Plus yang merupakan program sanitasi lingkungan berbasis masyarakat (SLBM) di Dusun I yang pengelolaannya ditangani KSM Karya Mandiri dibangun melalui dana APBD Deli Serdang melalui Dinas Cipta Karya dengan menelan dana Rp 350 juta. Usai menandatangani prasasti di lokasi MCK Plus, Bupati Drs Haji Amri Tambunan meninjau MCK yang masing-masing untuk pria dan wanita ada 4 ruangan. Bahkan pada kesempatan itu bupati sempat bertanya sumber air besrih yang digunakan di MCK Plus dan dijawab Sekretaris Dinas Cipta Karya Deli Serdang Ir Agus Mulyono bersumber dari sumur bor. ( ROMI / INDRA )


8-15 APRIL 2013 | EDISI 354| THN KE-VIII

13

Pompa Air Rusak di Simantin, Warga Antre Dapatkan Air SIDAMANIK, BN Pompa air penyedia pasokan air untuk warga Simantin, Kecamatan Sidamanik rusak. Akibatnya, warga harus rela antrean panjang untuk mendapatkan pasokan air bersih dari salah satu sumur bor milik seorang warga. Walau gerimis tidak menyurutkan semangat warga untuk mendapatkan pasokan air bersih untuk keluarga. Puluhan warga yang membawa jeregen dan ember terlihat bersabar antre. Warga yang membawa jeregen didominasi kaum laki-laki sedangkan ember umumnya dibawa ibu-ibu. Pemilik sumur bor A br Limbong mengatakan, kerusakan pompa air yang disediakan pemerintah membuat warga kesulitan mendapatkan air bersih. Kerusakan pompa air sudah berlangsung sejak 3 hari lalu. “Jika sudah sore, maka warga akan antre untuk mendapatkan air. Satu jeregen harga air bersih sebesar Rp250,” ujar wanita paruh baya tersebut sambil mengisi jeregen warga. Seorang wrga Simantin Rinto Sitio (34) yang menunggu antrean agar jeregennya diisi mengatakan, di daerah mereka air bersih dari PDAM Tirtalihou belum masuk ke dalam rumah warga. Yang ada hanya sumur bor yang disediakan pemerintah. “Warga sangat berharap agar pemerintah segera dapat mamasang pipa PDAM Tirtaulihou ke rumah-rumah warga. Jika pipa rusak seperti ini, maka warga harus rela antre mendapatkan air. Di samping antre, warga juga harus membayar Rp250 per jeregen,” ujarnya. Sedangkan salah seorang ibu S Situmorang (36) mengatakan petugas sudah berjanji akan memperbaiki segera pompa air tersebut namun hingga saat ini belum juga diperbaiki. “Untuk ke depan, pemerintah sudah dapat memasukkan PDAM Tirtalihou ke rumahrumah warga. Air adalah salahsatu kebutuhan pokok masnuaia yang tidak bisa tergantikan. Jika beras tidak ada, mungkin masih bisa memakan ubi atau yang lain. Tapi kalau tidak ada air bersih maka manusia tidak bisa hidup,” ujar wanita paruh baya itu. (ps-01/int)

Pemkab Bangun Rumah Janda Miskin SIMALUNGUN,BN Pemkab Simalungun memberikan bantuan uang sejumlah Rp70 juta untuk membangun rumah warga tidak mampu di Huta Dolok Saribu, Nagori Dolok Saribu, Kecamatan Dolok Pardamean. Selama ini Tiar br Girsang (63 tahun) bersama seorang anaknya, yang menerima bantuan, tinggal menumpang di rumah tetangganya dengan luas kamar 2×1,5 meter lantai tanah dinding tepas (gedek). “Saya prihatin melihat kondisi kesehatan dan rumah ibu ini, untuk itu kami akan memberikan bantuan buat membangun rumah ini,” kata Bupati Simalungun DR JR Saragih SH MM didampingi Kadis Kesehatan dr Saberina MARS, Plt Sekda Ir Jhon Sabiden Purba MUM, Pangulu Nagori Dolok Saribu Jalmen Saragih ketika berkunjung ke Nagori Dolok Saribu, Senin (1/4). Mendengar bantuan yang akan diberikan Pemkab Simalungun, Tiar merasa terharu sambil menitikkan air mata. Selanjutnya bupati memberikan kata-kata penghiburan buat Tiar agar tidak larut dalam kesedihan. “Jangan menangis Bu, ini adalah tugas kami sebagai pemerintah memberikan pelayanan dan membantu masyarakat yang membutuhkan, jadi tidak usah bersedih,” ujar bupati. Selain akan membangun rumahnya, dalam kesempatan tersebut bupati juga memberikan bantuan berupa uang sebesar Rp4 juta kepada Tiar br Girsang untuk bekal hidup mereka dalam memenuhi kebutuhan sehari-hari. Pangulu Nagori Dolok Saribu Jalmen Saragih menceritakan bahwa kondisi kesehatan Tiar Girsang yang mengalami kebutaan dialaminya sudah 4 tahun terakhir. “Sejak suaminya almarhun B Saragih meninggal dunia beberapa waktu lalu kondisi kesehatannya menurun. Sementara ketika berumah tangga, mereka dikaruniai seorang anak perempuan,” ungkapnya. Jalmen menambahkan, Tiar mengalami kebutaan setelah sebelumnya menderita sakit, dan lama-kelamaan kedua matanya tidak bisa melihat lagi. Untuk memenuhi kebutuhan hidupnya bersama seorang anaknya, Tiar berharap belas kasihan dari warga. Para tentangga mengungkapkan, untuk kebutuhan sehari-hari Tiar mereka memberikan bantuan makanan. ”Kami memang prihatin melihat kondisinya. Mudah-mudahan dengan adanya perhatian dari Pemerintah Kabupaten Simalungun sedikit meringankan beban Tiar,” ujar Br Purba salah seorang tetangga Tiar. (ps-01/int)

Banyak Sarana Umum di Siantar Belum Dibenahi SIANTAR,BN Meski sudah sudah sering diberitakan, bahwa beberapa kondisi papan informasi sampai sekarang ini belum mendapat perawatan. Padahal hari jadi Siantar tinggal menghitung hari belum menggugah Pemko Siantar untuk memperbaikinya. Tampaknya dari jauh memang kelihatan megah, namun setelah didekati, kondisi sudah tidak layak pajang. Warna dan tulisan sudah tidak terbaca. Bahkan sudah ditutupi dengan ranting pohon yang tumbuh di sebelahnya. Lokasinya di pusat kota simpang tiga depan Polres Siantar atau tak juah dari Kantor Pos. Selain di tempat itu, kondisi sama juga dijumpai di gerbang masuk lokasi parkir bus Pariwisata. Setelah beberapa kali dijadikan tempat pemasangan spanduk, warna dan kondisi gerbang sudah memprihatikan. Sekarang ini yang terlihat jelas hanya tali berwarnawarni bekas pengikat baliho atau spanduk. Sejumlah prasarana lainnya pun terlihat tidak mendapat perawatan. Masih di pusat kota, Jalan Merdeka. Tugu atau patung pejuang di atas Gedung juang 1945 Simpang Jalan Diponegoro sudah ditumbuhi rerumputan. Bahkan coran pondasi tugu tersebut sudah sangat pudar. Padahal sejumlah lokasi yang disebutkan di atas kerab di lintasi para pejabat tinggi Siantar. Namun tampaknya belum ada mendapat respon baik untuk melakukan perawatan. Masyarakat menilai pejabat Pemko sepertinya tutup mata soal kondisi tersebut. “Tak heran bagi kita warga Siantar jika melihat kondisi ini, tapi sangat disayangkan kedatangan pengunjung dari luar daerah melihat kota Siantar seperti kota kumuh,” sebut Putra (24) warga jalan Ade Irma. Putra menambahkan, kalau warga Siantar sudah bosan melihat kondisi buruk yang tak kunjung di rawat, bahkan plang petunjuk arah jalan saja yang berada di Jalan Merdeka atau sekitar trafick light menuju Jalan Ahmad Yani sudah sangat buruk belum juga disentuh. “Untuk meraih aipura, bukan hanya kebersihan kota yang dilakukan, melainkan perawatan sarana yang sudah ada,” katanya. (ps-01/int)

Bupati Buka MTQ Ke-42 “Agama Diciptakan Sebagai Wadah Untuk Merangkul Umat Dalam Menjalin Silahturrahmi” SIMALUNGUN, BN Guna untuk menumbuhkembangkan pemahaman dan pengamalan isi kandungan AlQur’an kepada masyarakat, Pemerintah Kabupaten(Pemkab) Simalungun melaksanakan Mushabaqoh Tilawatil Qur’an Nasional (MTQN) ke-42 Tingkat Kabupaten Simalungun tahun 2013. Kegiatan MTQ itu dipusatkan di Lapangan Dobana Serbalwan Kecamatan Dolok Batu Nanggar dan berlangsung selama tiga hari mulai tanggal 4 s/d 6 April 2013. Kegiatan MTQ tersebut dibuka secara langsung oleh Bupati Simalungun DR JR Saragih SH MM yang ditandai dengan penekanan tombol sirene membuka selubung Al-Qur’an yang ada di arena MTQ, Kamis, 04/04/2013. Mengawali kegiatan MTQ yang bertemakan “Dengan MTQ ke-42 Kabupaten Simalungun tahun 2013, kita jadikan sebagai sarana untuk mewujudkan masyarkat yang beriman, bertaqwa dan berakhlak mulia”dan Sub Tema “MTQ Ke-42 Kabupaten Simalungun sebagai sarana peningkatan kebersamaan ummat dan bangsa” tersebut pembacaan ayat suci Al-Qur’an oleh Mahyudin SAg dan saritilawah disampaikan oleh Teti Harani Lubis SPdI, pelantikan dewan hakim oleh Bupati Simalungun ditandai dengan pemakaian toga kepada ketua Dewan Hakim H Abdul Halim Lubis LC SHI.

“Saya menyambut baik kegiatan MTQ ini, karena ini kegiatan seperti ini sebagai upaya dalam pembinaan mental kepada masyarakat, sekaligus sebagai sarana untuk meningkatkan silahturrahmi antara umat beragama”, ujar Bupati dalam penyampaikan bimbingan dan arahannya ketika membuka MTQ tersebut. Dikatakan, agama diciptakan sebagai wadah untuk merangkul umat dalam menjalin silahturrahmi. “Kita ingin memperkokoh nilai-nilai keagamaan sebagai landasan dalam mewujudkan semangat toleransi dikalangan umat beragama di Kabupaten Simalungun”, ungkap Bupati. Selanjutnya Bupati menyampaikan bahwa, pada pelaksanan MTQ tahun2012 yang lalu ada kontingen Kabupaten Simalungun diberangkat ke Ambon mengikuti MTQ tingkat Nasional. Oleh karena itu kepada qori’ dan qori’ah untuk lebih meningkatkan latihan-latihan secara rutin sehingga kedepan kegiatan seperti ini tidak hanya menjadi serimonial saja, tetapi dapat lebih berprestasi pada event selanjutnya. Kepada para qori’ dan qori’ah Bupati juga berharap dapat menjadi garam dan terang ditengah-tengah masyarakat serta dapat bersama-sama dengan pemerintah membangunan Kabupaten Simalungun. “Saya mengharapkan agar pelaksanaan MTQ ke 42 ini dapat lebih baik dari tahun sebelumnya dan saya mengajak seluruh masyarakat untuk kembali kepada Al-Qur’an bagi yang beragama Islam dan kepada Al-kitab bagi yang beragama Kristen agar kelak kedepan meraka memiliki moral yang baik dan menjadi garam dan terang ditengah-tengah masyarakat” ,pungkas Bupati Dari MTQ ke-42, Bupati juga berharap untuk dapat dijadikan sarana mengenang kembali apa yang dilakukan oleh para

terdahulu yang untuk dilestarikan bersamasama termasuk Al-qur’an didalamnya agar dipahami bersama-sama. “Kehadiran saya di Kabupaten Simalungun tidak untuk membedakan agama melainkan untuk memajukan daerah ini baik dibidang mental, moral dan pembangunan termasuk kesejahteraan sekaligus pelayanan kepada masyarakat”, tandas Bupati. Melalui MTQ ini juga, Bupati kembali mengajak seluruh elemen masyarakat di Kabupaten Simalungun untuk bersama dan bergandengantangan membangun moral dan mental dalam rangka membangun Simalungun dan Republik Indonesia yang tercinta untuk kita wariskan kepada generasi yang akan datang. Dalam kesempatan tersebut, Bupati juga menyampaikan siap untuk memberikan dukunganya kepada peserta yang berprestasi sampaikan ketingkat nasional. “Mengingat anggaran di APBD sangat minin, namun bagi peserta apabila ada yang sampai ke Provinsi maun ke Jakarta, kami siap mendukung dan kita tidak pilih kasih”, kata Bupati. Sementara, Ketua DPRD Simalungun Binton Tindaon SPd dalam sambutannya antara lain mengajak kepada seluruh masyarakat untuk menjadikan MTQ sebagai perekat antar sesame umat beragama sehingga suasana harmoni kehidupan yang telah terjalin dengan baik dan kondusif dapat terus dilestarikan dan lebih ditingkatkan legi sesuai dengan dinamika kehidupan kita masyarakat di dalam koridor kekeluargaan yang penuh religious. “Bahwa generasi yang cinta Al-Qur’an akan menjadi teladan bagi setiap umat, kerana akhlak dan budi pekertinya santun penuh dengan keimanan dan ketaqwaan kepada Tuhan Yang Maha Esa”, katanya. Sebelumnya, Ketua Panitia Eka Hendra SSos

dalam laporannya mengatakan bahwa tujuan dilaksanakannya MTQ tersebut adalah sebagai tahapan seleksi ditingkat Kabupaten Simalungun guna mengikuti MTQ tingkat Provinsi Sumatera Utara. Dalam MTQ ini cabang yang diperlombakan yaitu cabang mujawwad, tartil, tahfiz, fahmil, syarhil dan khottil. Peserta yang mengikuti MTQ ini berasal dari 31 Kecamatan se-Kabupaten Simalungun yang berjumlah sekitar 8.000-an orang. Pembukaan MTQ tingkat Kabupaten Simalungun diakhiri dengan pengibaran bendera Lembaga Pengembangan Tilawatil Qur’an (LPTQ) oleh pasukan pengibar bendera yang berasal dari siswa/siswa SMAN 1 Dolok Batu Naggar dan SMA Muhammadyah Serbalawan yang diiringin dengan mars MTQ dibawakan oleh siswa/I SMAN 1 Dolok Batu Nanggar. Dalam memeriahkan MTQ tersebut juga digelar tarian Tor-tor sombah, tarian kolosal dari lima etnis yaitu Simalungun, Karo, Jawa, Melayu dan Toba, pagelaran marsing band dan ada juga Stand dari UKM (usaha Kecil Menengah dan SKPD Kabupaten SImalungun, layanan internet dan perpustakaan. Diacara pembukaan MTQ tersebut juga dimeriahkan dengan pemberikan hadiah lucky drow kepada 27 pemenang hadiah berupa sepeda sumbangan dari Bupari 25 unit, Kapolres 2 unit (1 untuk hadiah lucky drow dan 1 untuk hadiah juara MTQ) dan Dandim 0207 SImalungun. dalam MTQ ini, panitia menyediahkan hadiah 3 unit sepeda motor. Tampak hadir dalam kesempatan trersebut diantaranya, Forum Komunikasi Pimpinan Daerah (FKPD), Anggota DPRD Simalungun, Plt Sekda, staf ahli Bupati, para asisten dan pimpinan SKPD, para camat, tokoh agama, tokoh masyarakat dan tokoh adat. (ps-01)

LINTAS SUMATERA - LINTAS SUMATERA - LINTAS SUMATERA - LINTAS SUMATERA

Sosialisasi Indonesia Mengajar ACEH UTARA, BN Ratusan guru dari 16 sekolah dasar (SD) se – UPTD-PK Seunuddon, Aceh Utara mengikuti acara sosialisasi Indonesia Mengajar. Acara tersebut digelar oleh dua tutor yaitu Elvira Saufiani Rosanti dan Ratih Dwi Astuti dari Jakarta. Menurut panitia pelaksana acara itu, Usman Malik S.pdmengatakanacarayangdilaksanakanselama dua hari mulai hari Jum’at sampai hari Sabtu (6/4/ 2013) dengan tujuan agar menambah wawasan dan

ilmu bagi para guru sekaligus kepala sekolah. Dalam acara tersebut dibahas beberapa item diantaralain, teknik mengajar, sumber mengajar, metode belajar dan pendekatan konsep. “Dalam satu sekolah dihadiri 3 orang guru dan kepsek. Dengan tujuan agar meningkatkan mutu pendidikan,” kata Usman, sambisaat ditemui BN, Sabtu (6/4/2013). Setidaknya, lanjut Usman, dengan adanya kegiatan swadaya itu mampu menjadikan

wawasan dan ilmu tentang pendidikan, apalagi guru-guru di daerah. Acara yang diutuskan oleh salah satu Lembaga Swadaya Masyarakat (LSM) dari Jakarta itu dilakukannya dengan biaya swaday dan dilaksanakan di SD Negeri 5 Seunuddon selaku sekolah K3S dikecamatan tersebut.“Mereka tidak harap uang, bahkan kita ikut gelar dengan swadaya,”katanya lag, seraya mengatakan kalau acara ini diawali dari KecamatanLangkahan.(o21)

Pemkab Atam Diminta Buka Akses Darat ke ‘Pelosok Sekrak’ Aceh Tamiang,BN Sejumlahdatokpenghuluataukepaladesa(Kades) dipelosokKecamatanSekrak, KabupatenAcehTamiang yang terdiri dari Kades Pematang Durian, Burhanuddin,KadesSikumur,BuyungSelamat,Kades Sulum,SaparuddindanKadesSukaMakmur,Hariyadi memohon kepada Bupati Aceh Tamiang melalui dinstansiterkaituntukmembukaaksesdaratdariDesa Tanjung Glumpang menuju Desa Baling Karang serta membangun jembatan terletak di bukit neraka. Sejumlah pejabat desa yang ditemui Wartawan, Senin(1/4)diKarangBarumelaluijurubicaranyaKades Suka Makmur, Hariyadi mengatakan Lintasan jalan yang melintasi jalan Tanjung Glumpang— Sikumur—Pematang Durian—Juar—Sulum— SukaMakmurmenujuDesaBalingKarangsudahtidak layaklagidigunakanolehpejalankaki. “di sebabkan batunya sangat besar, serta terdapat bukit yang sangat tinggi, oleh warga areal tersebut dinamai ‘Bukit Neraka’ yang terletak diantara

perbatasan Desa Sikumur dengan Desa Pematang Durian. Di areal tersebut sebaiknya di bangun jembatan, dikarenakan areal tersebut berupa alur”, sebut Hariyadi. Diamelanjutkandenganmengatakanjalanlintasan tersebuthanyabisadilaluikendaraanrodadua,lintasan tersebut masih berupa jalan tikus dan bentuk tracknya berbukit tinggi sehingga tidak bisa dilalui oleh kendaraanrodaempat. "Lintasan itu jika dibuka berjarak total 24 kilometer dengan rincian jalan Tanjung Glumpang menuju Sikumur berjarak 4 kilometer, dari Desa Sikumur menuju Desa Pematang Durian berjarak 3 kilometer, dariDesaPematangDurianmenujuDesaSukaMakmur berjarak 4 kilometer dan dari Desa Suka Makmur menuju Desa Baling Karang berjarak 13 kilometer", paparnya. Menurut Hariyadi lintasan tersebut harus dibuka dan bukitnya harus dibelah, serta areal yang dekat dengan Bukit Neraka tersebut seharusnya di bangun

jembatan, sehingga jalan tersebut bisa dilalui oleh kendaraan roda empat sehingga memudahkan masyarakatyangberadadiempatdesatersebut,ketika ingin mengeluarkan hasil panennya. SementaraituKadesPematangDurianBurhanuddin mengemukakan, jika akses jalan dari Baling Karang menuju Tanjung Glumpang dibuka dan diperbaiki maka dapat menghemat waktu 1,5 jam jika dibadingkan dengan jarak tempuh yang biasa dilalui masyarakat empat desa tersebut. Kemudian lintasan jalandariBalingKarangkejembatanlubuksidupharus mengunakan alat transportasi getek dari Desa Pematang Durian menuju Desa Rantau Bintang KecamatanBandarPusaka. "Selama ini masyarakat harus menggunakan alat transportasi air yaitu getek dari Pematang Durian menuju Desa Rantau Bintang Kecamatan Bandar Pusakadenganmenggunakankendaraanrodaempat untuk mengeluarkan hasil bumi berupa kelapa sawit dan karet", ungkap Burhanuddin. (zul)

Tiga Petinggi Gerindra Aceh Utara Diganti ACEH UTARA , BN Di tubuh Dewan Pimpinan Cabang Aceh Utara Partai GerakanIndonesiaRaya(Gerindra)mulaimenimbulkan polemik baru setelah adanya isu pergantian ketua DPC setempat yang ditindak langsung oleh Ketua Umu Gerindra di Jakarta. Ketua DPC Gerindra Aceh Utara, Syahril Baysah mengatakan,polemiknegatiftersebutmulaitimbulsejak sepekanterakhirsetelahmenerimainformasidariKetua Umum Gerindra Pusat Jakarta, Prabowo Subianto yang menyebutkan bahwa ketua DPC Gerindra Aceh Utara harusdiganti.“Selainsaya,SekretarisdanBendarahjuga akan diganti,” kata Syahril Basyah saat ditemui usai

menggelar rapat koordinator daerah pemilihan (Kordapil).RapatKordapiltersebutdigelardiGedungCenter Gerindra Aceh Utara, di Lhoksukon, hari ini, Jum`at. Syahril Basyah menegaskan, pihaknya tidak akan menuntut keras atas tindakan Ketua Umum partai tersebut yang akan menggantikan 3 orang di tubuh Gerindra DPC Aceh Utara itu. Namun para anggota dan ketua DPC Gerindra Aceh Utara tetap meminta kejelasan serta alasan yang dapat diterimanya.“Sayamemintakalaumaudigantisemuanya saja.Jangantigaorang,nantianggotapartaiinitidakakan sinkron lagi dengan ketua DPC baru,” ungkap Syahril Basyah.

AtastindakanKetuaUmum,KetuaDPCGerindraAceh Utara itu mengaku sangat kecewa. Menurut informasi yangdiketahui,SyahrilBasyahakandigantidenganketua DPC baru, yaitu T. Moni Alwi. Moni itu dipilih langsung olehKetuaUmumGerindradalamrapatinterendiJakarta pada awal April lalu. “Setahu saya tidak ada konflik intern yang terjadi ditubuhGerindraAcehUtaraselamaini,bahkantidakada kendala lain yang bisa mengakibatkan polemik ini,” terangnyalagi.Menurutdia,semakinjauhharipermainan politikditubuhpartaiGerindrasemakinberbedadantidak adakesosialanyangmampumendukungkerjasamaantara DPC dan DPW termasuk ketua umum Gerindra. (021)

Harga Material Bangunan Beda Dengan Jakarta, Kepsek di Aceh Utara Tanggung Rugi ACEH UTARA, BN - Proyek pembangunan gedungperpustakaanyangdikuncurkanolehAPBN -Perubahan(APBN-P)melaluiBantuanSosial(Bansos) tahun 2012 untuk sekolah - sekolah di Aceh menjadi sorotanbagiparaKepalaSekolah.Pasalnya,daftarharga alatmaterialdiAcehlebihmahal dibandingkan daftar harga yang ditentukan di Jakarta. Hal itu dikeluhkan oleh sejumlah kepala SD di Aceh Utara yang telah menerima bantuan bangunan Perpustakaantahun2012yangbersumberdariBansos tersebut. Dari tingginya harga peralatan material di Aceh,merekamengakuterpaksaharusmenanggung rugi.“Daftar harga pembelanjaan alat material untuk bangunanPerpustakaanitudibuatdiJakartasesuaiharga disana. Kami yang belanja alat material disini cukup mahal,bahkanlebihdaridaftarhargayangtelahsudah ditentukanitu,”kataYusmadi,KepalaSekolahDasarNegeri 2Langkahan,AcehUtara. Ia mengaku pada tahun 2012 kemarin, telah menerima proyek pembangunan satu gedung perpustakaandisekolahnyayangkinibelumrampung dikerjakan. Alokasi anggaran untuk proyek yang dikelolanya itu berjumlah Rp112 Juta. Dari harga material di Aceh yang cukup tinggi itu membuat mereka terpaksa harus menanggu rugi. “Jangankanlaba,sayaharusmenyumbanguangpribadi untuk pembangunan itu sebanyak 12 juta. Kalau tidak,bangunan itu tidak akan siap,” ujarnya, yang dibenarkanolehbeberapakepalasekolahlainnya.Mereka mengatakan, selain harga alat material bangunan itu mahal,biayaongkoskerjaparatukangbangunanpun cukupmahaldanjauhbedadibandingkanharga-harga ditempatpenenderanproyekdiJakarta. “DiAceh,ongkoskerjabangunanajasudah80ribu perhari.KalaudiJakarta40atau50ribu,disinitidakada orangkerjakalauditawarmurah-murah.Begitujuga hargatriplet,pelafon,dansemen,”paparnyalagi.(021)


8-15 APRIL 2013 | EDISI 354| THN KE-VIII

Puskesmas Saitnihuta Prioritas Pelayanan Prima Humbang Hasundutan, BN Puskesmas Saitnihuta Kecamatan Dolokanggul Kabupaten Humbang Hasundutan merupakan salah satu sarana pelayanan Kesehatan Masyarakat yang berada di bawah naungan Dinas Kesehatan Kabupaten Humbang Hasundutan (KHH). Puskesmas yang membawahi 9 Wilayah Desa masing-masing Posko Sileang, Posko Pampean, posko Lumban Tobing, Posko Purba Manalu, Posko Pakkat Dolok, Posko Aeklung, Posko Lumban Purba, Posko Saitnihuta, Posko Simarigung, ditambah 1 Pustu Pakkat dan luas wilayah 8230 Ha ini sangat berperan dalam mewujudkan masyarakat sehat dan cerdas. Kepala Puskesmas Saitnihuta Dr. Tiar Lusiana Sihombing mengatakan dikantornya baru-baru ini kepada wartawan BN mengatakan dirinya bangga atas kepercayaan masyarakat di saitnihuta ini apalagi Lansia yang terus berjalan baik untuk Olahraga 2 kali 1 Minggu dan yang dipercayakan oleh Bapak Kepala Dinas Kesehatan Humbahas Drs. Budiman Simanjuntak untuk memimpin Puskesmas Saitnihuta ini, dimana dirinya sudah 2 Tahun memangku jabatan sebagai Kepala Puskesmas dan dia mengajak anggotanya kalau melayani pasien yang berobat biarpun tamu harus berpakaian rapi dan ramah tamah sesuai dengan adat batak di wilayah ini. Dr. Tiar Lusiana Sihombing mengungkapkan ia akan terus berupaya untuk membawa kawankawan yang bertugas di Puskesmas ini, melayani masyarakat untuk berobat demi kesehatan yang cerdas dan membawa puskesmas ini lebih baik dalam bidang pelayanan, maupun dalam bidang yang terkait kesehatan masyarakat dalam waktu dekat ini. Beliau akan menata kembali baik internal maupun eksternal puskesmas demi menciptakan suasana yang lebih harmonis dalam mewujudkan pelayanan yang prima, dan akan berisaha agar pasien yang berobat di puskesmas senantiasa merasakan kepuasan tersendiri serta menciptakan masyarakat yang sehat khususnya di wilayah saitnihuta, karena berupaya Pemerintah setempat dan masyarakat disini bisa kerjasama menuju kesehatan yang prima. Saat ini jumlah tenaga medis di Puskesmas saitnihuta 50 orang dokter umum 1 orang Tiar Lusiana Sihombing, 8 orang Bidan Puskesmas, 17 Orang Bidan Desa, 10 Perawat Puskes, 14 Perawat Desa . Dalam waktu dekat ini rencananya Puskesmas ini sesuai dengan usul untuk mau dipagar demi menjaga kebersihandankesehatanbersama.(PardomuanS).

Pemko Launching Layanan Pengadaan Secara Elektronik PADANGSIDIMPUAN,BN Pemerintah Kota Padangsidimpuan menggelar Launching Pengadaan Secara Elektronik (LPSE) di Aula MAN 2 Padangsidimpuan Kamis (4/4). Pengadaan barang/jasa dengan menggunakan sistem elektronik atau LPSE menurut Plt Sekda Kota Psp,Drs.Khairul Alamsyah di laksanakan demi terciptanya Good Governance serta Clean Goverment, khususnya di lingkungan Kota Padangsidimpuan. Sesuai dengan ketentuan peraturan perundang-undangan, maka wajib bagi pemerintah untuk menggunakan LPSE untuk pengadaan barang/jasa.Diharapkan dengan dibentuknya LPSE Kota Padangsidimpuan,setiap proses pelelangan yang akan di laksanakan di Kota Padangsidimpuan,sehingga dapat tercipta tertip administrasi,serta memudahkan dalam proses monitoring,evaluasi dan pelaporan. Bahwa segenap jajaran SKPD harus menjalankan sistem dengan baik. Dengan menggunakan LPSE, maka Pengadaan barang/ Jasa di lingkungan Pemerintah Kota Padangsidimpuan akan berlangsung sevara cepat, efisien dan berkualitas. Disamping itu, akan menumbuhkan rasa nyaman dan tentram dalam bekerja. Hal ini dinilai penting untuk mewujudkan masyarakat Kota Padangsidimpuan yang Sehat, maju, sejahtera dan berdayasaing tinggi. LPSE akan menjalankan fungsi antara lain adalah; mengelola system pengadaan secara elektronik (SPSE),menyediakan pelatihan kepada PPK/Panitia dan penyedia barang,menyediakan sarana akses internetbagi PPK/Panitia dan penyedia barang,menyediakan bantuan teknis untuk mengoperasikan SPSE kepada PPK/Panitia penyedia barang/ jasa,melakukan pendaptaran dan Verifikasi terhadap PPK/Panitia dan penyedia barang/ jasa. Ketua panitia Ir.Husni Thamrin Nst menyampaikan bahwa dengan menggunakan LPSE, maka akan menciptakan transparansi, efisiensi, serta efektivitas dalam proses Pengadaan Barang/Jasa. Selain itu penggunaan LPSE juga akan menghilangkan praktek KKN, karena dengan LPSE, pihak ketiga atau rekanan dalam proses Pengadaan Barang/Jasa tidak bertatap muka secara langsung dengan Panitia Pengadaan, sehingga penyimpangan dalam proses Pengadaan akan terhindar. Hal yang tak kalah pentingnya adalah, dengan penggunaan LPSE maka akan mempermudah dalam melakukan monitoring serta evaluasi.(Saad)

Oknum Dokter Terima Gaji Buta Humbang Hasundutan, BN Ekspresi syair lagu Iwan Fals “ Tikus-tikus Kantor” secara dimologi kota artikan sebagai kiasan orang-orang kantor di Pemerintahan yang tidak jujur, berikut sankaj Chairil Anwar berjudul“DeriCampurDebu”yangdapatdiimplementasikan kondisi yang sedang memanas diadopsi berbagai hal yang kotor.Tentumasyarakatakanrame-ramemenyanyikan“Lain dibibirlaindihati”buatpemimpinyangsuka-sukaberenang di air kotor. Kenapa tidak, pak SBY begitu gentarnya memberantasKKNdenganpayungHukumUndang-undang No. 20/2002 sebagai perubahan UU No. 23Tahun 2001. KKN dimaksud bukan hanya masalah materi saja maksudnya korupsi uang. Akan tetapi juga korupsi waktu gaji buta. Di Puskesmas Pollung Kecamatan Pollung Kabupaten HumbangHasundutanadaseorangOknumDr.DAsudahlebih kurang7bulantidakpernahbertugasdiPuskesmastersebut

dia hanya tinggal di medan. Menurut informasi bahwa sang dokter tersebut hanya mengurusin suaminya karena sakit. Wartawan BN, rabu, 03 April 2013 jam. 19.00 Wib dia menghubungi Dokter melalui selulernya mengenai kehadiran Dokter tersebut. Dokter langsung menjawab “Kalauadamasyarakatyangkeberatansayatidakpedulikarena alasanadayangpalingtepatbuatsayakarenasuamisayasakit. Kalau wartawan dan LSM keberatan laporkan saja keatasan saya. Pantauan wartawan baru-baru ini di Kecamatan Pollung wargasangatkecewadengankeberadaanDokterDAnamun tidak dapat hadir lebih kurang 7 bulan melayani pasiennya, yang butuh bantuan dokter akhirnya di bawa ke RSU doloksanggulresikonyatelahada beberapayangmeninggal di jalan ketiga hendak rujukan, seandainya mendapat pertolongan dokter kemungkinan hal itu tidak terjadi

demikian keluhan warga masyarakat Pollung. Kami sangat kecewa kondisi Puskesmas didaftar ada dokternya selama 7 bulan ini sebelum datang dokter Sihombing akan tetapi makangajiButa.Halinimendorongkamiharustetapberobat ke dukun yang belum tau pasti suatu penyakit dapat disembuhkan lagi pula harus membawa peralatan semedi seperti ayam hitam, jeruk puruk, rokok dan lain-lain, jadi kembaligayadulu.Kamimasyarakatsangatmengharapkan kebijakanPemkabHumbahasmasalahini. Keberadaan masatugasoknumDokterDAtelahdilaporkan kepadaBKDL.Sibarani02April diruangkerjanya diamenjawab wartawan BN,“Masalah sang Dokter BA belum ada laporan dariatasannya,kalauadalaporansamakamimasalahinidokter DAyangmeninggalkantugaslebihkurangdari7bulanharus di tuntaskan, sesuai dengan aturan tanpa kecuali. Bila memangkeberadaandoktertersebuttidakdapatlagiditoliler,

Jelang UN Ka UPTD Pendidikan Kecamatan Sosa Ingatkan Kepala Sekolah Palas ,BN Ingin mengulang sukses besar tahun lalu dengan kelulusan seratus persen Ka UPTD Pendidikan Kecamatan Sosa Kabupaten Padang Lawas H.Bahron Harahap S.Pd I ingatkan seluruh kepala sekolah dan masyarakat supaya memanfaatkan waktu yang tersisa dengan lebih fokus dalam mempersiapkan siswa dalam menghadapi UN tahun 2013 yang akan di laksaakan bulan Mei 2013 mendatang. Menurut Bahron saat dikonfirmasi diruang kerjanya mengatakan,pihaknnya sangat berharap agar seluruh kepala sekolah yang bertugas supaya

lebih jeli memanfaatkan sisa waktu jelang pelaksanaan UN dengan lebih giat lagi dalam program pembelajaran terhadap siswa yang sudah terdaftar dalam DNT,misalkan pelaksanaan try out lokal dan belajar tambahan sore hari. Lanjut Ka UPTD Sosa,sesuai dengan data yang di terima jumlah DNT tahun 2013 untuk Kecamatan Sosa Berjumlah 841 siswa yakni terdiri dari,siswa SD dan MIN. Dikatakan,selain dari itu dia juga mengharapkan supaya para kepala sekolah lebih tanggap nantinnya tentang tknis pelaksanaan UN agar selain dari sukses dengan kelulusan seratus

persen juga terlaksana dengan baik serta sukses dalam penangananya. Seterusnya kata Bahron,mengingat pilar pendidikan ada tiga yakni,sekolah,orangtua dan lingkungan atau masyrakat,maka kita sangat berharap peran serta kedua pilar tersebut supaya turut memaksimalkan para siswa yang berada di tengah masyarakat dan para orang tua. Kalau ketiga pilar tersebut dapat bekerja sesuai dengan proposinya masing-masing kita sangat yakin kalau keberhasilan tahun lalu dengan gool target seratus persen kelulusan dapat tercapai.pungkasnya.(Ali)

Pembangunan Kolam Ikan Diharapkan Meningkatkan Ekonomi P.SIDIMPUAN,BN Rencananya Tahun 2013 ini Dinas Pertanian dan Kehutanan Kota Padangsidimpuan akan membangun sejumlah Kolam ikan milik warga yang selama ini hanya mengandalkan tempat pembesaran ikan dengan plastic tenda biru.Hal ini dikatakan Kadis Pertanian Perikanan dan Kehutanan Kota Padangsidimpuan,Soleh Siregar melalui Kabid Perikanan dan Peternakan,Bambang Supriono,SP kepada BN diruang kerjanya Selasa (2/4). Katanya,melalui Pembangunan Kolam ikan ini dapat menambah nilai pendapatan Ekonomi masyarakat,menurut Bambang rata-rata masyarakat banyak budi daya ikan lele ketimbang ikan Mas.Disamping itu juga akan nada pembangunan Tempat Penampungan Ikan yang

dikelola pengusaha,karena Tahun depan akan diberlakukan Perda salah satu sumber PAD untuk usaha pengolahan pengumpulan pengangkutan dan pemasaran hasil perikanan sebesar Rp.200.000,-/Tahun yang tersebar diwilayah Kota Padangsidimpuan,karena selama ini belum adanya ketetapan retribusi dikenakan. Selain itu juga Lanjutnya,berdasarkan Perda nomor 6 Pasal 21 yang telah ditetapkan bahwa target Kolam Ikan pembenihan UPR 25/M2/ Tahun,kolam air tenang/pembesaran 25/M2/ Tahun,kolam air deras Rp.100.000,-00 (seratus ribu) /unit/Tahun,keramba jarring apung Rp.50.000,-00(Lima puluh ribu)/unit/Tahun dan Lubuk larangan Rp.150.000 (Seratus lima puluh ribu)/Tahun. Katanya lagi,Dia merinci UPR (Unit

pembenihan rakyat) yang ada di Kota Padangsidimpuan ada 10,di Sipabangun,Joring Lombang,Hutapadang,Pijorkoling,Kelurahan Timbangan Simatohir,Aek Tuhul,Baruas,Singali Mompang dan Siharang-karang.Sedang untuk BBI ada di Kecamatan Hutaimbaru dan Kecamatan Padangsidimpuan Tenggara. Dengan demikian semaksimal mungkin kita akan terus berjuang bagaimana kita dapat memproduksi Ikan lebih banyak sebagai mana target yang telah ditetapkan dengan memanfaatkan BBI yang ada”Ungkapnya.Diakui memang selama ini kita masih disuplay dari Panti Sumatera Barat dalam pengadaan pasokan kebutuhan Ikan di Kota Padangsidimpuan”Ujarnya.(Saad)

4 Pejabat Eselon II Akan Didefenitifkan PALAS,BN Seluruh pejabat eselon II (14 orang, red) yang masih berstatus pelaksana tugas (Plt), maka dalam waktu dekat ini akan didefenitifkan. Karena hal itu sudah menjadi agenda BKD Palas dalam waktu dekat. Demikian disebutkan Kabid Mutasi BKD Palas, Fakhruddin Panggabean kepada METRO, Rabu (3/4). Dijelaskannya, ada sekitar 7 pejabat eselon setingkat kepala badan dan lembaga yang masih Plt, sedangkan ada 7 orang lagi Plt Pejabat eselon II seperti Jabatan Asisten, Sekda, dan Kadis di Pemkab Palas. “Dalam waktu dekat ini akan kita defenitifkan, namun waktu pastinya kapan, belum bisa kita pastikan saat ini,” ucapnya. Ditanya mengenai

jabatan Kadis Perhubungan yang sudah kosong selama satu bulan, karena pejabat sebelumnya sudah pensiun? Kabid Mutasi menjawab, kalau penggantinya sudah ada ditunjuk Plt Amirhan Pasaribu. “Sudah ada pejabat penggantinya beberapa hari lalu ditunjuk. Memang ada sebulan lebih jabatan itu kosong,” terangnya. Disinggung alasan kenapa banyak pejabat eselon II yang masih Plt? Lagi-lagi Fakhruddin mengatakan, kalau hal itu yang lebih berwenang menjawab Kepala BKD Palas dan Bupati Palas. “Kalau saya kan cuma Kabid Mutasinya, kapan diperintahkan mutasi, saya akan bekerja dalam adminsitrasinya, itu sajanya,” ucapnya. Mengenai

Sekda Palas, Irfan Soaduon Hasibuan yang sudah lama menjabat sebagai Plt, Fakhruddin belum bisa memberikan jawaban pasti, kapan akan didefenitifkan. “Kalau itu saya belum bisa memberikan jawabannya,” tukasnya. Penggiat Kebijakan Politik Pemerintah Palas Firdaus Hasibuan, jarang terjadi dalam suatu pemerintahan, banyak pejabatnya Plt, karena hal itu akan menimbulkan kegaduhan birokrasi, meskipun itu wewenang Bupati. “Tapi pasti akan merembet dalam hal loyalitas dan etos kerjaya, termasuk dalam hal kewenangan dan kebijakannya yang penuh, sehingga harus dilakukan pendefenitifan, apalagi saat ini menjelang Pemilukada,” tukasnya. (int)

Pendaftaran Balon Bupati Palas Adem Ayem PALAS,BN Pendaftar balon bupati yang dibuka DPD Golkar Palas beberapa waktu lalu, hingga Jumat (5/4) sore masih kosong atau belum ada kandidat yang mendaftarkan diri. Hal yang sama juga terjadi di Partai PKS. Namun telah banyak yang telah menghubungi panitia. Panitia penjaringan DPD Golkar Palas Miftah Harahap, Jumat (5/4) mengatakan, hingga saat ini belum ada yang mendaftar secara resmi, mengambil formulir pendaftaran untuk diusung Golkar dalam pemilukada Palas.

“Hanya saja, kalau untuk mengenai persyaratan dan informasi mekanisme pendaftaran sudah ada tim H Syahrin Daulay datang kemarin,” jelasnya. Ditanya,apakah para kandidat balon Bupati Palas lainnya tidak percaya diri mendaftar ke Partai Golkar, karena Ketua DPD Partai Golkar Palas H Ali Sutan Harahap (TSO) juga berniat maju dalam Pemilukada Palas mendatang, Miftah tidak berani memastikannya. “Namun bisa saja ada factor feeling itu dari balon Bupati Palas lainnya, tidak berani mendaftar ke Golkar. Padahal, kita membuka

seluas-luasnya, karena Partai Golkar akan mengusung figur yang dicintai rakyat, sesuai semboyan ‘Suara Golkar Suara Golkar,” tukasnya. Sedangkan Ketua DPD PKS Palas Puli Farisan Lubis LC mengatakan, saat ini sudah banyak balon Bupati Palas yang berminat mendaftar untuk menghubunginya, termasuk komunikasi melalui telepon seluler H Syahrin Daulae, Sarmadan Hasibuan, Sende Tua Hasibuan dan Rahmat P Hasibuan.“Namun sesuai hasil komunikasi dengan Tondi Roni Tua, Jumat (5/4) sore mungkin beliau akan mendaftar ke PKS,” tukasnya.(int)

Akseptor KB Vasektomi Meningkat TAPSEL,BN Akseptor Keluarga Berencana (KB) pengguna tubektomi dan vasektomi di wilayah Kabupaten Tapsel mengalami peningkatan dari yang ditargetkan. Peningkatan yang cukup signifikan adalah peserta KB pria atau vasektomi. Pasalnya dari 5 peserta yang ditargetkan di 2013, ternyata mencapai 35 peserta. Sedangkan untuk KB wanita atau tubektomi, dari 100 yang ditargetkan, juga mengalami peningkatan menjadi 108. Kenaikan angka tersebut tak lepas dari peran kader KB vasektomi yang memberikan penjelasan pada masyarakat, bahwa dengan mengikuti program KB tersebut, tidak mendatangkan efek apapun. Bahkan manfaatnya sangat besar dalam menjaga program KB menuju keluarga sejahtera. Demikian dikatakan Kepala Kantor (Kakan) Pemberdayaan Perempuan Perlindungan Anak dan Keluarga Berencana (PPA-KB) Kabupaten Tapsel Hj Emsi Ermida Hasibuan SE, kepada METRO, Kamis (4/4) di sela pelaksanaan kegiatan operasi KB tubektomi dan vaektomi di RSUD Tapsel Sipirok. “Tingkat kesadaran masyarakat semakin

tinggi akan manfaat mengikuti program KB. Ini juga tak lepas dari peran PPL KB yang terus memberikan penyuluhan pada masyarakat,” ucapnya. Didampingi Ketua Pantia Kegiatan Kontrasepsi Mantap (Kontap) Drs Zupri Hasmi Hasibuan, Emsi menjelaskan, suksesnya kegiatan Kontap yang berlangsung sehari penuh itu, tak lepas dari peran serta BKKBN Provinsi Sumut, Tim medis, tim dokter, baik dari provinsi maupun lokal, serta RSUD Tapsel. “Kita semakin yakin program ini akan berkembang di wilayah kita. Untuk itu kita harapkan, semua peserta, terutama vasektomi, bersedia menjadi kader yang nantinya dapat memberikan penjelasan dan pemahaman pada masyarakat kita,” terangnya. Salah seorang peserta KB vasektomi Anwar Turpin Rambe, warga Desa Hapesong Baru, Kecamatan Batangtoru, kepada METRO mengatakan, alasan dirinya memilih mengikuti KB adalah untuk membatasi jumlah anak. Pasalnya istri keduanya masih muda, namun tidak cocok mengikuti program KB. “Istri saya yang pertama meninggal, istri saya yang kedua masih muda. Padahal saya sudah dikarunia dua putrid. Alasan saya

menikah kedua kalinya, juga ingin punya putri. Dulunya istri saya telah mencoba KB, namun tak cocok. Kalau mengkonsumdi pil KB, istri saya sering pusing. Pakai suntik sering pendarahan, pake spiral mengalami gatal. Jadi saya kasihan, makanya memilih ikut vasektomi ini,” kata ayah lima anak yang juga suami dari Masdani Siregar (35) ini. Sementara Kabudi Hermanto (40), kader lain yang berperan memberikan pemahaman tentang manfaat yang dialami sebagai peserta vasektomi mengatakan, selama mengikuti KB vasektomi, ia tidak pernah merada ada efek samping apapun. Malah dirinya merasa nyaman dalam menjalankan program KB menuju keluarga sejahtera. “Tidak ada efek samping, memang awalnya saya sudah berniat ikut vasektomi karena istri saya tak cocok ber-KB,” ucap ayah 2 anak tersebut. Untuk diketahui, vasektomi atau biasa di sebut dengan KB pria, adalah upaya untuk menghentikan fertilitas. Yaitu dengan melakukan operasi kecil di bagian kemaluan pria. Sedangkan manfaat vasektomi adalah bisa merencanakan keluarga dengan mengontrol jumlah anak yang diinginkan.

makaakankitabuat tindakantegassesuaiadministrasiposisi Oknum Dokter DA. Melalui pemberitaan palapa Nusantara ini, masyarakat mengharapkan kepada DPRD Humbahas agar dapat bersinerjis dengan Pemkab mewujudkan Humbang HasundutansehatjasmanidanrohaniseiringdenganMotto “Mensano Inconforesano” (Mangatur Silaban)

BKD Paluta Sosialisasikan Jabatan Fungsional Tertentu PALUTA, BN Acara Sosialisasi Peningkatan Kinerja Organisasi Melalui jabatan Fungsional Tertentu oleh Badan Kepegawaian KabupatenPadangLawasUtara(Paluta)yangdilaksanakan di Ruang Rapat Hotel Mitra, Kamis (04/04) berjalan baik. SosialisasitersebutmenghadirkannarasumberdariKantor BKN Medan RegionalVI Ojak Murdani, S.Sos danWesterling Siregar , SH , dengan diikuti perwakilan dari seluruh Badan, Dinas dan Kantor yang ada di Kabupaten Paluta. Dalam sambutan Kepala BKD Paluta Mora Harahap, SH menyampaikan, bila kita melihat falsafah aparatur negara maka sebetulnya setiap orang yang bekerja dalam birokrasi harus memiliki jabatan. Jabatan ini tentu kita definisikan sebagai suatu kewajiban atau tugas-tugasnya yang harus dikerjakandalammendapatkantugastersebut. Untuk itu, diharapkan kepada seluruh peserta agar dapat mengikutipaparanyangakandisampaikannarasumberdan menyerapnyayangkemudiannantinyadapatdisampaikan kepadarekan-rekanPNSyanglain. NaraSumbermenyatakansebabperlunyabanyakjabatan fungsional tertentu, karena agar setiap orang itu memiliki spesifik khas dari tugas-tugas tertentu yang harus diangkat. Jadikedepankompetensinyaakanmenjadispesifikdantidak umum lagi. Sekarang ini kita masih memiliki banyak permasalahan dalam birokrasi untuk kepegawaian, kita masih mengalami ketidaktepatandalampendistribusianPNSbaiksecarakualitas maupun kuantitas, baik nasional maupun instansi. Misalnya guru yang jumlahnya berlebihan tapi dari distribusinya ada tempat-tempat yang sangat kekurangan guru, namun ada juga tempat yang berlebihan ini ditinjau darisegikuantitas,sedangkandarisegikualitasadatempattempatyanggurunyatidakmemilikikualitasyangmemadai, sedangkan ditempat lain sangat berlebihan. Selanjutnya ketidaktepatan kompetensi. Kompetensi yangdiharapkankepadamasing-masingPNSitutidakselalu tersedia sehingga pekerjaan itu dilakukan oleh orang yang bukan kompetensinya. Ketidaktepatan selanjutnya adalah ketidaktepatan prestasi, kinerja dan sekarang kita ingin mencobasedikitmemahamikesenjangandidalambirokrasi itu sendiri, dan tentunya yang pertama kita ingin lakukan adalahsuatupembinaanprofesi,jadikitainginmeningkatkan kompetensi seseorang sesuai apa yang dibutuhkan. Kalaukompetensinyameningkat,kitaharapkankinerjanya juga harus meningkat, tapi itu juga memerlukan suatu pembinaan budaya kerja agar supaya bila seseorang mempunyaikompetensidiajugamemilikikinerjayangbaik, dan mudah-mudahan karakternya, perilakunya juga akan menjadi lebih baik dalam hal pelayanan dan akan menjadi lebih ramah, jelas nara sumber. Dalam manajemen kepegawaian telah diatur didalam Peraturan Perundang-Undangan baik dalam bentuk Undang-Undang, Peraturan Pemerintah, Peraturan Presiden, dan juga Peraturan Kepala BKN yang perlu dipedomani.(KS.03/02)

37 Pejabat Tobasa Diganti TOBASA ,BN Sebanyak 37 pejabat di Pemkab Tobasa Samosir diganti. Meski beberapa camat mendapat jabatan strategis, namun adajugapejabatyangjustrunonjobataumenjadistaf.Kepala SMKNegeri1BaligeLaloHartonoSimanjuntak,salahsatudari sekian pejabat struktural eselon II, III dan IV yang dimutasi melalui SK Bupati No 061Tahun 2013. DiadiberijabatanbarumenjadiKepalabidangPendidikan Luar Sekolah, Pemuda, Olahraga, Seni dan Budaya di Dinas PendidikanTobaSamosir.BegitujugauntukposisiKepalaDinas KesehatandipercayakankepadadrRajaipanOmpaTuaSinurat. Pejabat baru itu dilantik langsung Bupati Pandapotan Kasmin Simanjuntak. Pelantikan yang dilaksanakan di Aula SMKN 1 Balige itu, beberapa camat mendapat jabatan strategis, namun ada juga pejabat yang justru non job atau menjadi staf. Meskipun dilakukan pengangkatan jabatan, beberapa posisi jabatan pemerintahan yang sebelumnya dijabat orang lama justru lowong. Di jajaran camat, Augus Sitorus misalnya, sebelumnya menjabatsebagaiCamatPorseakinimendudukiposisisebagai KepalaDinasPasar,KebersihandanPertamanan.Begitujuga Sabam Pardosi sebelumnya menjabat Camat Habinsaran dipromosikan menjadi Kepala Dinas Kependudukan dan Catatan Sipil. Taruli Siagian, Camat Laguboti kini menjadi Kabag OrganisasiSekdakab.Sementarauntukmengisijabatancamat yang ditinggalkan, Robert Gono menjadi Camat Laguboti, memimpin Kecamatan Porsea dipercaya kepada mantan camat Uluan, Elister Manurung. Untuk sementara jabatan camat Uluan, lowong. Bupatimengatakan,pelantikaniniadalahmerupakanhasil evaluasikinerjaPNSdibeberapaSatuanKerjaPerangkatDaerah (SKPD). Pelantikan juga dimaksudkan dalam rangka peningkatanpelayanankepadamasyarakatsertakepercayaan publik atas kinerja birokrasi. “Untuk itu dibutuhkan aparatur yang cakap dan mampu menduduki jabatan sesuai dengan kapasitasnya,” sebut Pandapotan,Jumat(5/4)diAulaSMKNegeri1Balige.Bupati mengatakan, mutasi jabatan merupakan hal biasa yang memang harus dilakukan sebagai bagian dinamisasi dari proses penyegaran dan penyesuaian kebutuhan personel dalamorganisasi.Diajugamenganggapmutasidanpromosi hendaknyaditanggapisecarawajardansebagaihalyangbiasa. “Mutasijabatansepertiiniakanselaluadaselamakebutuhan dan situasi organisasi menghendakinya,”tambahnya.(int)


8 - 15 APRIL 2013 | EDISI 354 | THN KE-VIII

Wabup Sergai Terima Audensi Himpera SEI RAMPAH,BN Dalam upaya penyelesaian masalah yang menimpa sekelompok masyarakat yang tergabung dalam Himpunan Pedagang Pasar Sei Rampah (Himpera) yang diwakili Syahrul Nasution selaku ketua, Drs. Eddy Warman Saragih, Suhardi dan Johansyah Putra melakukan kunjungan audensi ke Kantor Bupati Serdang Bedagai (Sergai) dan diterima oleh Wabup Ir. H Soekirman di ruang kerjanya Kompleks Kantor Bupati Sei Rampah Seni pagi (1/4). Drs. Eddy Warman Saragih selaku sekretaris Himpera mengemukakan masalah terkait empat orang pedagang di Pasar Sei Rampah Jalan Negara Kecamatan Firdaus yang dijadikan terdakwa atas pengerusakan patok yang dibuat oleh yang mengklaim pemilik tanah Tengku Hari. Sebelumnya, keempat terdakwa telah diadukan ke Polres Sergai, tertanggal 25 Oktober 2011 lalu. Saat ini kasus keempat pedagang Pasar Sei Rampah yakni Syahrul Nasution (62), Masmi Merwati (31), Sunita (28) dan Romahadi (43), warga Desa Sei Rampah Kabupaten Sergai yang dituduh merusak patok sudah sampai ketingkat persidangan di PN Tebing Tinggi. Eddy Warman menjelaskan, kasus ini bermula adanya pihak lain yang mengklaim kepemilikan tanah di Pasar Sei Rampah . Padahal dari puluhan tahun lalu, memang sudah ada Pasar Sei Rampah dan para pedagang selama ini sudah berjualan turun temurun, tetapi mengapa baru sekarang ada yang mengklaim bahwa tanah tersebut ada pemiliknya, serta mempertanyakan mengapa temantemanya dijadikan terdakwa hingga ke tingkat pengadilan, ungkap Eddy Warman. Dari semua permasalahan ini, kami mengharapkan kepada Pemerintah Kabupaten (Pemkab) Sergai agar memberikan perhatian serius dan bantuan hukum kepada Himpera, sehingga dapat menyelesaikan masalah tersebut, harap Eddy Warman. Menanggapi permasalahan tersebut, Wabup Sergai Ir. H. Soekirman yang didampingi Sekdakab Drs. H. Haris Fadillah, M.Si, Kadis Perindagsar Drs. Indra Syahrin, M.Si, Kabag Humas Dra. Indah Dwi Kumala dan Kabag Perekonomian Drs H. Mariyono, SP, mengungkapkan didalam Undang-Undang (UU) Nomor 25 tahun 2009 tentang pelayanan publik, disana dijelaskan bahwa Negara berkewajiban melayani setiap warga negara dan penduduk untuk memenuhi hak dan kebutuhan dasarnya dalam kerangka pelayanan publik yang merupakan amanat Undang-Undang Dasar Negara Republik Indonesia Tahun 1945, membangun kepercayaan masyarakat atas pelayanan publik yang dilakukan penyelenggara pelayanan publik merupakan kegiatan yang harus dilakukan seiring dengan harapan dan tuntutan seluruh warga negara dan penduduk tentang peningkatan pelayanan publik. Sehubungan dengan UU di atas, Pemkab Sergai akan berupaya semaksimal mungkin dalam membantu menyelesaikan masalah ini serta mengkoordinasikannya ke Bagian Hukum untuk memberikan advokasi dalam mendampingi para terdakwa di persidangan nanti. Soekirman mengharapkan sebagai pedagang yang taat membayar retribusi, hendaknya jangan berbuat anarkis sehingga dapat meresahkan warga sekitarnya dan selalu tetap menjaga kekompakkan dalam melaksanakan pekerjaanya. Pemkab Sergai akan membawa permasalahan ini dalam rapat koordinasi bersama unsur SKPD dan FKPD untuk penyelesaiannya, ujar Wabup Soekirman.(Ibnu)

Walikota Hadiri Malam Pesona Tebingtinggi di PRSU TEBINGTINGGI, BN Walikota Tebingtinggi Ir.H.Umar Zunaidi Hasibuan bersama keluarga,wakil wali kota H.Irham Taufik,SH,MAP dan Sekdako H.Johan Samose Harahap,SH,MSP berbaur bersama ribuan penonton menyaksikan malam pesona Tebingtinggi pada Pekan Raya Sumatera Utara (PRSU) ke -42 Tahun 2013 turut juga hadir para SKPD,Camat dan Lurah se kota Tebingtinggi serta ditandai dengan penarikan berbagai hadiah lucky draw diantaranya DVD,kipas angin dan hadiah lainnya., kemarin lalu di Oven Stage komplek Tapian Daya,Medan Malam pesona Tebingtinggi yang tampil di oven stage PRSU itu menampilkan kisah legenda tentang kerajaan “Bandar Kajum” yang dimainkan sanggar seni dan tari Dispora Tebingtinggi.Meskipun cerita nya sedikit agak menoton,namun para pengunjung yang hadir tetap antusias untuk menyaksikannya kisah legenda tersebut. Sebelumnya,walikota Tebingtinggi Ir.H.Umar Zunaidi dalam sambutannya mengucapkan terima kasih kepada Yayasan PSRU yang telah memberikan kesempatan buat kota Tebingtinggi untuk menampilkan seni dan budayanya di pentas oven stage PRSU.Dia juga memberikan apresiasi kepada para penonton yang hadir terutama warga kotanya yang khusus datang untuk menyaksikan malam pesona Tebingtinggi. Pada kesempatan itu,Umar Zunaidi juga menyampaikan bahwa kota Tebingtinggi di undang oleh Malaysia untuk mengikuti Penang Fair yang akan digelar Desember 2013 mendatang ,” Kota Tebingtinggi di undang negeri Malaysia untuk menampilkan hasil produk lokal dan seni budayanya di Penang fair pada Desember 2013 mendatang’kata Umar Zunaidi.(DER)

Anggota DPRD Sumut Desak Polisi Ungkap Kasus Mawar PANTAI CERMIN,BN Anggota Komisi E DPRD Sumatera Utara asal daerah pemilihan (Dapil) III Kab.Sergai dan Kota Tebing Tinggi, Hj.Evi Diana mendesak Polisi dalam hal ini Polres Serdang Bedagai mengungkap kasus penculikan dan pembunuhan terhadap Mawar (19) tahun warga Kab.Sergai. Pernyataan itu disampaikan Hj,Evi Diana kepada Wartawan, Senin (1/4), saat menjenguk keluarga korban di Dusun I Desa Besar II Terjun, Kec.Pantai Cermin usai reses perorangan di Desa tersebut. "Saya yang juga seorang ibu sangat merasakan betapa sedihnya kedua orang tua dan keluarga saat ini atas peristiwa yang menimpa putri mereka, terlebih perlakuan tersangka yang sadis dan tak berprikemanusiaan, "kata Evi Diana, sedih. Menurut Evi Diana, dia juga paham pihak Kepolisian bekerja maksimal dan patut dihargai. Tapi sebaliknya kita juga sangat berharap Polisi segera menangkap pelaku. Kedatangan Hj.Evi Diana di dampingi Camat Pantai Cermin, M.Yasir Arafat, Ketua TP PKK

Pantai Cermin, Kepala Desa Besar II Terjun, Sulaiman di sambut kedua orang tua Mawar, Sadirin (43) dan Sugiatik (42) yang tengah menyiapkan acara kenduri malam ketujuh Almarhum. "Saya berharap keluarga Mawar tabah, sabar serta tawakal menerima cobaan ini. Jangan terus larut dengan kesedihan, walau memang terasa sangat berat, ihklaskanlah kepergian Mawar," harap istri Bupati sergai tersebut. Hj.Evi Diana juga berpesan kepada keluarga dan tetangga Mawar untuk senantiasa menjaga dan mengawasi anak-anaknya, khususnya anak perempuan yang kerap menjadi sasaran berbagai tindakan kriminal. Sementara kedua orang tua Mawar hanya mampu mengucapkan beberapa patah kata ucapan terima kasih atas simpati dan kepedulian Hj.Evi Diana. Bahkan Sugiatik masih tampak shock dan terus menangis, terlebih saat Hj.Evi Diana melihat album foto semasa hidup Mawar, hingga sampai Hj.Evi Diana beranjak pulang dengan menyerahkan tali asih sejumlah uang kepada Ibu Mawar, Sugiatik.

Anggota DPRD Sumut, Hj.Evi Diana disambut kedua orang tua korban penculikan dan pembunuhan Mawar (Alm), Sadirin dan Sugiatik di rumah duka Dusun I, Desa Besar II Terjun. Kec.Pantai Cermin.

Ditangkap. Sepulang Anggota DPRD Sumut, Hj.Evi Diana, ayah almarhumah Mawar, Sadirin yang masih tampak sedih kepada Wartawan mengharapkan pihak Kepolisian

LSM Wanacakra Binjai Nilai RSU Artha Medica Kebal Hukum

BINJAI,BN Dalam pemberitaan sebelumnya LSM WANACAKRA meminta Dinas Kesehatan Binjai,untuk menyikapi dugaan kecelakaan medis di RSU ARTHA MEDICA Jln. Samanhudi Binjai,yang menimpa pasien PrayetnoO penduduk Desa Mancang Kec. Selesai Kab. Langkat yang terjadi 19 Desember 2012. Dalam suratnya No.182/WCR/ KBPK/10/2013 pada tanggal 24 Februari 2013 LSM WANACAKRA Binjai menyampaikan hal klarifikasi dan tembusannya kepada Dinas kesehatan Kota Binjai. Seperti pernyataan anak kandung korban (Maja) mengisahkan tragedi yang menimpa ayah kandungnya ber-

mula keluhan yang dirasakan sakit dibawah bagian perutnya sehingga pada tgl 17 Desembr 2012 dibawa berobat ke RSU Artha Medica . Dari hasil diagnosa yang di tetapkan oleh Dr. Gunawan, pasien Prayetno menderita penyakit Hernia (Usus turun). Pada tgl 18 Desember 2012 pasien Prayetno menjalani operasi yang dipimpin langsung Dr Gunawan untuk dipasang alat penyanggah agar usus tidak turun lagi,setelah 4 hari pasien diperbolehkan pulang. Selanjutnya dengan cek up rutin di RSU ARTHA MEDICA Binjai pada layanan cek up yang tidak maksimal membuat kondisi korban pasien Prayetno semakin memburuk terus

terus mengejar para pelaku. "Kita berupaya sesegera mungkin menangkap pelaku perampokan, penculikan disertai pembunuhan tersebut,"imbuh Arif Budiman.(Ibnu)

Pramuka Motor Kemandirian, Karya dan Prestasi

menerus mengeluh sakit. Menurut Dr. Gunawan ada terdapat kebocoran pada usus yang lengket pada dinding sehingga mengeluarkan cairan kuning seperti kotoran manusia kemudian disarankan agar pasien mengkonsumsi telur 15 butir dalam per hari agar cepat sembuh. Namun kondisi pasien semakin memburuk dan keluarga menyimpulkan untuk membawa berobat ke RS Al Fuadi, 01 Januari 2013 ditangani oleh Dr. David . Dari laporan asisten, Dr. David semula tidak percaya kalau dari bekas operasi itu mengeluarkan cairan seperti kotoran manusia (tinja). Kemudian disarankan pasien untuk di operasi kembali, keluarga menyetujui Karena sudah tau kondisi pasien Prayetno. Pihak keluarga menyaksikan operasi yang dilakukan Dr David dimana terlihat koyakan besar bekas operasi yang menimbulkan luka yang cukup besar sehingga perlu 3 kali operasi. Sampai saat ini pihak keluaraga melalui LSM Wanacakra Binjai telah mengirim surat dengan No.177/WCR/ KB/V/10/2013 Tgl 14 Januari 2013 meminta RSU Artha Medica bertanggung jawab dan pihak Dinas Kesehatan sepertinya tutup mata dengan masalah ini. (TIM)

DOLOK MASIHUL,BN Wakil Bupati Serdang Bedagai (Wabup Sergai) Ir. H. Soekirman mengingatkan kepada anggota pramuka di Kabupaten Sergai agar dapat mandiri, berkarya dan berprestasi. Dengan begitu, diharapkan para generasi muda khususnya pelajar yang tergabung dalam Pramuka mampu menjadi motor pembangunan daerahnya. Komitmen ini sesuai dengan janji pramuka yang tercantum dalam Tri Satya dan Dasa Dharma Pramuka. Hal ini diungkapkan Wabup Soekirman saat membuka kegiatan Lomba Karya Seni dan Prestasi (Lokanisi) ke-II Gerakan Kwartir Cabang (Kwarcab) Pramuka Kabupaten Sergai bertempat di lapangan bola kaki Erry-Soekirman, Desa Pekan Dolok Masihul, Kecamatan Dolok Masihul, Kamis sore, (28/3). Turut hadir dalam acara tersebut Camat Dolok Masihul Drs. Dimas Kurnianto selaku Kepala Kwartir Ranting (Ka. Kwaran), Pengurus Kwarcab Pramuka Dolok Masihul dan peserta lomba. Dalam kegiatan Lokanisi ini, salah seorang anak Pramuka membacakan puisi Trembesi. Bait-bait ini merupakan buah pikir Wabup Soekirman yang miris karena krisisnya pepohonan besar sekarang ini, khususnya Trembesi. Menyambung puisi itu, Soekirman di hadapan ratusan Pramuka memaparkan bahwa pohon Trembesi saat ini tinggal hitungan jari saja. Karenanya, Gerakan Pramuka khususnya Sergai diharapkan untuk turut aktif menjaga lingkungan. Oleh karena itu kepada seluruh masyarakat dihimbau agar ikut serta menanam bibit-bibit pohon tersebut di lingkungan sekitar kita, ujar Wabup Sergai. Untuk mendukung program itu, Soekirman menyakinkan bahwa anak Pramuka diperbolehkan meminta langsung kepada para camat di Sergai karena saat ini setiap Kantor Kecamatan menjadi sentral penyaluran bibit-bibit pohon yang merupakan bantuan dari program Pemkab Sergai. Sementara itu, Camat Dolok Masihul Dimas Kurnianto mengatakan Lokanisi ke- II ini merupakan ajang tahunan yang digelar untuk meningkatkan kreativitas, kecakapan, ketangkasan dan ketrampilan para pramuka. Selain itu, sebagai ajang silaturrahmi regu-regu pramuka seSergai untuk memupuk rasa persaudaraan dan persatuan. Lokanisi ini mempertandingkan seni puisi dan pidato dalam Bahasa Inggris, sedangkan keterampilan yang dipertandingkan yakni jenis keterampilan dibidang kepramukaan.(Ibnu)

Pesona Budaya Kabupaten Sergai Pukau Ribuan Pengunjung PRSU

Kades Pulau Gambar Tanam 100 Pohon Kelapa PULAU GAMBAR, BN Kades Pulau Gambar Supardi bersama perangkat Desa dan warga Pulau Gambar sedang melaksanakan kegiatan tanam 1000 pohon kelapa makan di semananjung daerah DAS Sungai Ular. Kegiatan ini hasil musyawarah Desa bersama tokoh masyarakat Pulau Gambar dan dilaksanakan hari selasa (2/4) oleh Kades bersama warga. Saat dikonfirmasi Kades Pulau Gambar, Pak Kardi menjelaskan kalau kegiatan ini bertujuan melaksanakan penghijauan sekaligus mengantisipasi erosi di Daerah Aliran Sungai yang semakin lama kian erosi. Program Desa ini sangat didukung oleh warga Pulau Gambar. Saat dikonfirmasi beberapa warga menjelaskan mendukung program Pak Kardi karena menjaga terjadinya erosi atau pengikisan tanah yang kian lama mengikis tanah masyarakat. Sehingga Sungai Ular semakin melebar, sehingga semakin lama tanah masyarakat semakin berkurang. Keputusan musyawarah Desa yang melaksanakan 1000 pohon kelapa itu cukup bijaksana. Masyarakat yang bersama-sama bergotong - royong dengan Kepala Desa cukup semangat dan bersinergi. Salah satu keistimewaan dan ciri khas Desa Pulau Gambar yang patut dicontoh adalah tingginya rasa persaudaraan dan kebersamaan serta mengutamakan azas gotong royong dan mufakat untuk mencapai suatu tujuan. (Abr)

segera menangkap pelaku dan dihukum seberat-beratnya. Sementara Kapolres Sergai AKBP Arif Budiman, S.Ik.MH yang dihubungi Wartawan via telepon selular mengatakan pihaknya

Bertempat di Open Stage PRSU Jl. Gatot Subroto Medan, Rabu malam (3/4) Bupati Sergai Ir. H.T. Erry Nuradi M.Si didampingi Wabup Ir. H. Soekirman, dan Sekdakab Dr. H. Haris Fadillah, MSi menyerahkan penghargan Anugerah Seni kepada Pencipta Tari Serampang XII Almarhum Sauti yang diterima oleh ahli warisnya Akhiruddin Sauti di sela-sela acara Malam Pesona Budaya Kabupaten Sergai dalam rangka memeriahkan Pekan Raya Sumatera utara (PRSU) ke-42 tahun 2013.

MALAM pesona Budaya dan Kesenian Kabupaten Serdang Bedagai (Sergai) Rabu (3/4) yang diisi berbagai pertunjukan seni, sukses memukau ribuan pengunjung Pekan Raya Sumatera Utara (PRSU) ke-42 yang digelar di open stage PRSU Kompleks Tapian Daya Jalan Gatot Subroto Medan. Pertunjukan akbar ini turut dihadiri Bupati Sergai Ir. H.T. Erry Nuradi MSi, Wabup Ir. H. Soekirman, Sekdakab Drs. H. Haris Fadillah MSi, Ketua DPC GOPTKI Ny. Hj. Marliah Soekirman, Ketua DWP Ny. Hj.

Imas Haris Fadillah, para Asisten dan Staf Ahli Bupati dan para kepala SKPD Sergai, Camat Kades/Lurah se-Sergai serta Ketua Yayasan PRSU Medan. Tari tradisional dari berbagai etnis di Sergai dipertontonkan lewat gerakan lentik dan enerjik para penari dari Sanggar Safira binaan Ketua TP PKK Ny. Hj. Evi Diana Erry yang telah mengukir prestasi sampai tingkat internasional. Beberapa tarian yang dibawakan antara lain tari Jawa berjudul lirak lirik, tari Tolu Sahundulan dari etnis simalungun

dan tari Melayu Rentak Pusaka. Selain itu para pelajar Sergai turut menampilkan beberapa tari daerah seperti tarian Melayu Serampang XII yang sudah sangat terkenal sampai ke mancanegara dan tari hitam manis dibawakan dengan lincahnya oleh siswa-siswi dari SMP Negeri 1 Pantai Cermin. Turut memeriahkan pagelaran seni budaya malam itu atraksi sulap dan akrobat dari kelompok Payung Hijau yang menampilkan beberapa pertunjukan sulap serta adegan berjalan maupun mengendarai sepeda di atas seutas

tali. Sebagai puncak acara, Bupati Sergai Ir. H.T. Erry Nuradi MSi menyerahkan anugerah seni kepada Almarhum Sauti sebagai pencipta tari Serampang XII sekaligus sebagai tokoh seni yang konsisten dalam memperkenalkan tari Melayu ini sampai ke dunia internasional. Penghargaan ini diterima oleh ahli waris yakni Akhiruddin Sauti yang merupakan putra ke-6 dari Almarhum Sauti. Bupati Sergai Ir. H.T. Erry Nuradi MSi dalam sambutannya mengemukakan bahwa penghargaan anugerah seni yang diberikan kepada Almarhum Sauti yang adalah putra Sergai dari Kecamatan Pantai Cermin merupakan bentuk apresiasi Pemkab Sergai atas tokoh seni budaya dari daerah ini yang telah memperkaya khasanah kebudayaan di negeri ini. Diharapkan di masa kini dan masa yang akan datang akan terus muncul tokoh seni budaya lainnya dari daerah tanah bertuah negeri beradat ini yang akan menciptakan kreasi maupun kreativitas baru dalam dunia seni, ungkap Bupati. Melalui acara ini menurut Bupati Erry Nuradi dapat mengenalkan kepada masyarakat Sumatera Utara potensi yang ada di Kabupaten Sergai khususnya potensi budaya dan kesenian. Dimana masyarakat Sergai yang sangat heterogen namun hubungan antara satu etnis dan lainnya dapat terbina dengan baik serta penuh semangat persatuan dalam kebersamaan. Semangat persatuan dan kebersamaan inilah yang merupakan aset andalan dalam membangun daerah ini, tegas Bupati.

Bupati Erry Nuradi mengajak masyarakat khususnya bagi generasi muda agar lebih menanamkan serta melestarikan budaya daerah sebagai aset yang perlu dipertahankan untuk mencegah terjadinya krisis budaya dan menangkis pengaruh negatif dari globalisasi. Jangan sampai budaya asli daerah yang sangat berharga ini diakui oleh negara lain karena tidak dilestarikan oleh masyarakat kita, tegas Bupati. Paviliun Sergai Ramai Pengunjung Paviliun Pemkab Sergai yang turut memeriahkan PRSU ke-42 tahun 2013 ini terlihat selalu ramai dengan pengunjung karena konsep dekorasi yang menarik untuk dijadikan objek photo oleh para pengunjung. Konsep dekorasi yang dipilih tahun ini berbeda dengan konsep tahun lalu yang mengusung tema wisata bahari. Tahun ini dekorasi paviliun dengan thema pertanian yang mencerminkan bahwa sektor pertanian merupakan sektor utama dalam kehidupan perekonomian masyarakat di daerah ini. Di dalam paviliun ini dipamerkan produk-produk usaha kecil menengah (UKM) dari Sergai seperti makanan ringan, hasil pertanian dan perkebunan, hasil kerajinan tas dan pernakpernik lainnya yang merupakan produk khas daerah ini. Hal ini senada dengan keinginan pemerintah daerah ini yang ingin mewujudkan One Village One Product (OVOP) dengan mengembangkan UKM yang menghasilkan produk-produk unggulan yang diharapkan dapat diterima oleh masyarakat Sumut.(Ibnu)


CMY K

CMY K

8 - 15 APRIL 2013 | EDISI 354 | THN KE-VIII

Meteran Diputus "Modus Perintah Manager PLN" MEDAN, BN Sebut saja Tinonggo Hutauruk (55) salah seorang Warga Patumbak , Deli Serdang yang merasa telah ditipu oknum mengaku PLN rayon Medan Selatan , Kota Medan. Dengan modus tugas resmi dari pimpinanya si petugas tersebut datang kerumah Tinonggo beberapa waktu lalu tepatnya di akhir bulan Maret tahun 2013, untuk memutuskan meteran yang telat bayar selama 4 bulan. Oknum petugas PLN yang mengaku bernama Rusnan dari PLN Rayon Medan Selatan itu meminta sejumlah uang kepada Tinonggo yang didampingi sang istri dan anaknya guna pelunasan tunggakan rekening listrik dirumah keluarga Tinonggo. Tinonggo yang pada saat itu merasa takut dengan ancaman pembongkaran meteran listriknya yang telah telat bayar tanpa basa basi langsung mencarikan uang sebesar jumlah tagihan sesuai surat pemutusan bila tidak dibayar, yang ditanda tangani oleh Manager PLN Medan Selatan atas nama Hiro P Pardede , tertanggal (7/3/2013) dengan nominal 151.656 Rupiah. Setelah mendapat uang yang diminta oleh oknum petugas itu ditambah beban denda dengan total 170 Ribu Rupiah dari pinjaman tetangga agar tidak dilaksanakan pembongkaran meter lampu "emang pada saat itu kami lagi banyak permasalahan ekonomi ditambah lagi kondisi sang suami saya (Tinonggo:Red) yang lagi sakit dan perlu uang untuk berobat sehingga terpaksalah pinjam-pinjam" Ungkap istri

Rumah Tinonggo Hutauruk warga Patumbak yang telah dibongkar meteran listriknya beberapa waktu lalu.(Tim)

Tinonggo pada awak BN dikediamanya belum lama ini yang didampingi Tinoggo

Tinonggo beserta istri memperlihatkan meteran yang sudah dibongkar(Tim)

duduk lemas dalam keadaan sakit Stroke. Tapi sayang uang yang diminta sudah diberikan tetapi tetap saja Oknum tersebut melakukan pembongkaran dan mengatakan "tunggu prosesnya " sambil berlalu membawa meteran . Lemas bercampur pitam Tinonggo hanya bisa pasrah menerima kenyataan yang terjadi.Setelah kejadian tersebut berselang 5 bulan berlalu si Petugas PLN datang kembali kekediaman Tinonggo member uang yang pernah dimintanya dan mengatakan kalau meteran tidak bisa dipasang lagi kecuali diganti dengan pemasangan meter baru dengan tarif sebesar 870 Ribu Rupiah, kemudian mengembalikan uang tunggakan kepada Tinonggo yang pernah diterimanya. Sontak saja Tinonggo keberatan karena hal itu sangat bertentangan dengan atruran yang wajar " Masa sudah dibayar tidak disetor itukan penipuan namanya." Dan hingga detik ini kami masih berharap agar pihak PLN berlaku adil kepada pelanggan namun hampir berjalan setahun si oknum petugas belum juga memasang kembali meteran yang dijanjikanya "entah sampai kapan lagi kami menunggu" ungkapnya penuh harap.(TIM)

PARLEMENTARIA DPRK BANDA ACEH

DPRK Banda Aceh Minta Aktifkan Balee Inong BANDA ACEH, BN Dewan Perwakilan Rakyat Kota (DPRK) Banda Aceh, meminta agar Balee Inong untuk dapat diaktifkan kembali. Hal itu dalam upaya meningkatkan peran perempuan dalam perencanaan pembangunan yang berkeadilan gender. Permintaan itu diungkapkan Wakil Ketua DPRK Banda Aceh, Razali, S.Ag, belum lama ini usai melaksanakan Reses di kecamatan Baiturrahman. Razali, S.Ag, merupakan wakil rakyat yang duduk diparlemen asal Daerah Pemilihan (Dapil) IV, yaitu meliputi wilayah Kecamatan Baiturrahman dan Lueng Bata. Dikatakan Razali, dalam musrembang yang berlangsung sebelumnya, ia mengambil segmen tentang remaja putri. Pasalnya, menurut dia, selama ini banyak keluhan-keluhan dari remaja tersebut. "Dalam hal ini, mereka (remaja putri) mengeluhkan pola orang tua dalam mendidik generasi bangsa tidak lagi menggunakan cara-cara pendidikannya seperti anak yang masih sekolah di Taman Kanak-Kanak (TK)," ujar Razali, yang akrab disapa Ustad. Masih kata dia, remaja putri juga menginginkan agar orang tua mempunyai pendidikan dalam menjaga remaja dalam keluarga. Tentunya, masih tetap dalam nilai-nilai Syariat Islam. "Artinya, mereka menginkan komunikasi antara orang tua dengan anak (remaja putri) dapat terjalin dengan cara-cara kedewasaan. Dan, tidak lagi menerapkan pola didik seperti terhadap anak kecil yang masih mengenyam pendidikan di TK dan dapat menimbulkan tekanan," katanya lagi. Dalam reses yang diikuti sebanyak 120 orang remaja putri itu, ia juga menuturkan penting adanya sekolah pendidikan kepada kalangan orang tua untuk mendidik anaknya. "Sebenarnya, kita juga sudah mengakomodir persoalan ini melalui Badan Pemberdayaan Perempuan dan Perlindungan Anak. Dimana disana juga sudah ada Balee Inong, untuk memberikan pendidikan dan membina remaja secara produktif," tuturnya. Karenanya, lanjut Razali, Balee Inong yang ada di Kota Banda Aceh dapat difungsikan kembali dan kreatif dalam mendekatkan diri untuk menggelar kegiatan yang dapat menyentuh

masyarakat. Jangan hanya menggelar rapat saja. "Persoalan yang dihadapi oleh Balee Inong yaitu belum ada qanun yang mengatur tentang legalitas sebuah organisasi atau yayasan tersebut. Mereka (pihak Balee Inong), sangat menginginkan keberadaannya dilegalkan," lanjut Razali, yang juga politisi Partai Keadilan Sejahtera (PKS) Kota Banda Aceh. Menurutnya, permintaan adanya Qanun terhadap Balee Inong, bertujuan untuk mengatur tata kelola maupun mekanisme kerja Balee tersebut. Sehingga, keberadaannyapun diakui. "Saat ini kita belum dapat memastikan kapan akan dibahas Qanun tersebut, karena, saat ini juga masih banyak Qanun yang lainnya sudah menumpuk. Dan, apabila sisa Qanun tersebut sudah selesai, kami mengupayakan Qanun tentang Balee Inong dapat dibahas," imbuhnya. (ADV)

Menakertrans Himbau Semua Pihak Tingkatkan K3 di Semua Kegiatan LANGKAT, BN Menteri Tenaga Kerja dan Transmigrasi RI Muhaimin Iskandar berdasarkan UU Nomor 1 tahun 1970 menghimbau dan menyerukan kepada semua pihak harus lebih meningkatkan K3 di semua kegiatan mulai dari perencanaan, pembuatan/pemasangan, pengoperasian/pemakaian, dan pemeliharaan terhadap seluruh peralatan produksi dalam upaya menjamin keselamatan dan kesehatan kerja bagi pekerja maupun masyarakat sebagai konsumen barang atau jasa hasil produksi atau sebagai pengguna sarana dan fasilitas umum. Hal ini dikatakan Menteri Tenaga Kerja dan Transmigrasi RI Muhaimin Iskandar dalam sambutannya yang dibacakan Sekdaprovsu H Nurdin Lubis, SH MM pada Upacara Peringatan Hari Keselamatan dan Kesehatan Kerja (K3) Nasional Tahun 2013 Tingkat Provsu, Kamis (4/4) di Alun-alun Amir Hamzah Kabupaten Langkat. Kejadian runtuhnya jembatan Kutai Kartanegara Kalimantan Timur yang telah terjadi 26 Nopember 2011 dan memakan korban jiwa lebih dari 20 orang dan harta benda lanjut Menteri, salah satu penyebabnya pelaksanaan K3 pada perkerjaan peralatan ini kurang memadai. "Kejadian ini harus kita jadikan pelajaran yang berharga untuk mencegah terulangnya kejadian yang serupa," ujar Menteri. Berdasarkan laporan ILO bahwa setiap hari terjadi kecelakaan kerja yang mengakibatkan korban fatal kurang lebih 6000 kasus sementara di Indonesia tiap 100 ribu tenaga kerja terdapat 20 orang korban fatal akibat kecelakaan kerja. “Untuk itu kepada para pengusaha dan tenaga kerja diharapkan untuk lebih

banyak mengambil inisiatif dalam meningkatkan kinerja K3 di tempatnya masing-masing,” ujar Menteri lagi seraya mengharapkan agar K3 diintegrasikan pada tiap jenjang manajemen perusahaan melalui pendekatan prinsip-prinsip manajemen sehingga dapat mengurangi kecelakaan kerja, menekan tingkat keparahan untuk pencapaian kecelakaan nihil yang kita dambakan. Pada kesempatan itu Menteri juga mengajak kepada seluruh stake holder dan masyarakat untuk melaksanakan program yang diluncurkan tanggal tanggal 16 Oktober 2012 yaitu program “Saya Pilih Selamat” sebagai ajakan untuk meningkatkan kesadaran bahwa pentingnya keselamatan dan pentingnya berperilaku aman. “Mari kita suarakan dan dengungkan “Saya pilih selamat” setiap hari untuk memotivasi kita berperilaku selamat,” ajak Menteri. Diawal sambutannya Menteri juga mengatakan pada Upacara Hari K3 ini sekaligus merupakan pernyataan sebagai awal dimulainya Bulan Keselamatan dan Kesehatan Kerja Nasional Tahun 2013 yang diselenggarakan secara serentak diseluruh tanah air. Peringatan Hari Bulan Keselamatan dan Kesehatan Kerja Tahun 2013. Peringatan Hari K3 Tahun 2013 ini merupakan tahun keempat sebagai upaya Bangsa Indonesia untuk berjuang berperan aktif dan bekerja secara kolektif dalam mendukung cita-cita besar kita yaitu Indonesia Berbudaya K3 Tahun 2015. Sementara itu Bupati Langkat Ngongesa Sitepu SH mengatakan bahwa capaian prestasi yang telah diraih berupa anugerah penghargaan nasional K3 yang telah diterima Kabupaten Langkat dari Menteri Tenaga

Kerja dan Transmigrasi RI adalah berkat berkat dukungan dan kerjasama kita seluruhnya antara pemerintah, perusahaan maupun pekerja dan juga atas bimbingan pemimpin kita Gubernur Sumatera Utara Bapak H Gatot Pujo Nugroho. Mari kita jaga kebersamaan, kenyamanan dan iklim kondusifitas di wilayah kerja kita masing-masing lanjut Ngongesa, karena adalah satu dan saling membutuhkan. “Mari kita berprinsip semua untuk satu dan satu untuk semua demi kebaikan kita bersama,” ujar Ngongesa seraya berterima kasih kepada seluruh pihak yang telah membantu meningkatkan perekonomian masyarakat kabupaten langkat melalui program Corporate Social Responsibility (CSR) sebelum menutup sambutannya dengan pantun. Panitia Penyelenggara Drs Musa Rajeksha, MHum mengatakan terpilihnya Kabupaten Langkat sebagai tuan rumah Bulan K3 Tingkat Provsu Tahun 2013 adalah karena perestasi Bupati Langkat yang telah mendapatkan penghargaan sebagai Pembina K3 terbaik se Indonesia tahun 2012. Tujuan dari kegiatan bulan K3 tahun 2013 yang bertemakan “Bulan K3 Nasional adalah Budayakan K3 disetiap kegiatan usaha menuju masyarakat industry yang selamat, sehat dan Produktif”, kata Rajeksha, adalah meningkatkan kesadaran dan ketaatan pemenuhan norma K3, meningkatkan partisipasi semua pihak untuk optimalisasi pelaksanaan budaya K3 setiap kegiatan usaha, terwujudnya budaya K3 masyarakat Indonesia, “Sasaran kegiatan ini untuk tingginya tingkat pemenuhan norma K3, meningkatkan jumlah perusahaan mendapatkan kecelakaan nihil dan terwujudnya masyarakat yang berperilaku K3,” ujarnya. (Munir)

Lanjutan Sidang Kasus Pencurian Ikan

Terdakwa Tanda Tangani Berita Acara Karena Dijanjikan Pulang MEDAN, BN Lanjutan sidang kasus pencurian ikan lele, dengan terdakwa M Ali, ditempat usaha, milik korban Herianto, di Pasar VII, Desa Manunggal, Kec.Labuhandeli, Deliserdang, untuk ke dua kalinya, digelar oleh Pengadilan Negeri (PN) Lubuk Pakam, yang bersidang di Labuhandeli, Kamis (4/4) lalu. Keterangan diperoleh BNews dipersidangan, saat terdakwa dimintai keteranganya oleh majelis hakim, atas dakwaan JPU dan keterangan para saksi, membantah melakukan pencurian, termasuk penanda tanganan berita acara di Kepolisian. " Benar, saya ada menanda tangani berita acara, usai dimintai keterangan oleh petugas juru periksa di Polsekta Medan Labuhan, dan CMY K

hal itu saya lakukan, karena petugas kepolisian menjanjikan kepada sy (terdakwa), setelah tanda tangan bisa pulang " kata terdakwa menyakinkan majelis hakim dan JPU. Dalam hal keterangan saksi Paino, yang disebut terdakwa, saksi tersebut dari kesatuan TNI-AD, terpaksa mengaku melakukan pencurian atas apa yang dituduhkan, karena dirinya dianiaya dalam satu tempat di Medan Marelan, setelah sebelumnya dijemput, pada dini hari dan dipaksa ikut menaiki mobil. sebut terdakwa. Ketua majelis hakim, atas keterangan terdakwa, dalam hal merasa dikelabui, oleh petugas juru periksa di Kepolisian, minta kepada JPU, untuk menghadirkan petugas tersebut, dalam lanjutan sidang pada Kamis

mendatang. Sementara atas keterangan saksi Paino, terhadap terdakwa, ketua majelis hakim, menyatakan bahwa hal tersebut, dipersilahkan kepada terdakwa, untuk melaporkanya kepada instansi yang berwenang menanganinya. Dan sidang dilanjutkan pada Kamis mendatang. Seperti diketahui, pada sidak Kamis terdahulu, Jaksa penuntut umum (JPU) Robert SH, dalam dakwaanya antara lain menyebutkan bahwa terdakwa, pada Desember 2012 lalu, ada melakukan pencurian ikan lele, secara berulang, dikolam milik korban dan menjualkanya kepada Syaipul (DPO). Akibat perbuatan terdakwa korban mengalami kerugian dengan nilai nominal Rp 12 Juta (San)

Wali Kota Ingin AMPI Jadi Organisasi Berkarakter MEDAN, BN Wali Kota Medan Drs H Rahudman Harahap MM berharap Angkatan Muda Pembaharuan Indonesia (AMPI) agar menjadi organisasi yang berkarakter. Selain itu dalam menjalankan roda organisasi, AMPI juga harus lebih mengutamakan kepentingan masyarakat. Dengan demikian organisasi ini akan semakin dicintai oleh seluruh lapsian msyarakat. Harapan ini disampaikan Wali Kota ketika menerima audiensi Ketua DPD AMPI Kota Medan H Iswanda Nanda Ramli beserta sejumlah kepengurusan lainnya di Balai Kota Medan, Kamis (4/4). Kedatangan mereka untuk melaporkan sekaligus mengundang Wali Kota terkait dengan pelantikan Lembaga Konsultasi Hukum AMPI Kota Medan, Brigade Kartini AMPI Kota Medan dan Satuan pelajar AMPI Kota Medan di Hotel Danau Toba, Jumat (5/4). “Saya berharap agar ketiga lembaga yang akan dilantik ini akan menjadi corong AMPI di lapangan. Selama ini AMPI tidak kenal kekuasaan, tidak kenal fitnah dan selalu bergerak untuk kepentingan masyarakat. Dengan demikian AMPI di Kota Medan akan selalu dicintai oleh seluruh lapisan masyarakat,” kata Wali Kota. Dijelaskan Wali Kota, saat ini yang perlu perlu disuguhkan kepada masyarakat adalah komitmen dan bukti nyata bukan hanya janji-janji. Untuk itu dia berharap agar AMPI Kota Medan harus selalu pro kepada masyarakat, sehingga organisasi ini selalu diterima dengan baik oleh masyarakat. Di samping itu AMPI harus menjadi wadah yang memiliki karakter. “Jadi gunakanlah organisasi ini sebagai wadah untuk berkomunikasi dengan baik dengan masyarakat. Jangan pernah sekalipun menggunakan organisasi ini untuk kepentingan pribadi,” pesannya mengingatkan. Selanjutnya Wali Kota mengajak AMPI untuk ikut mendukung seluruh program Pemko Medan dalam rangka membangun ibukota provinsi Sumatera Utara ini. Kunci keberhasilan membanguna kota ini apabila mendapat dukungan penuh dari seluruh lapisan masyarakat. Artinya, masyarakat harus punya rasa memiliki terhadap kota ini, punya tanggung jawab dan berpartisipasi mendukung seluruh program pembangunan.

“Membangun kota ini tidak seperti membalikkan telapak tangan tetapi harus melalui perencanaan yang baik dan matang. Di samping itu harus mengetahui apa yang menjadi keinginan masyarakat. Untuk itu saya setiapo hari harus turun ke lapangan untuk menyerap aspirasi langsung dari masyarakat,” ungkapnya. Ketua DPD AMPI Kota Medan H Iswanda Nanda Ramli menjelaskan, tujuan kedatangan mereka untuk melaporkan sekaligus mengundang kehadiran Wali kota terkai dengan pelantikan bersama yang akan dilakukan terhadap 3 lembaga yang baru dibntuk kepengurusannya. Adapun keliga lembaga itu yakni Lembaga Konsultasi Hukum AMPI Kota Medan, Brigade Kartini AMPI Kota Medan dan Satuan Pelajar AMPI Kota Medan. “Pelantikan ketiga lembaga ini kita lakukan bersamaan di Hotel Danau Toba Medan besok malam. Untuk itu kami minta kehadiran Bapak Wali Kota,” jelas Nanda. Selanjutnya, Nanda mengungkapkan organisasi yang dipimpinnya akan melaksanakan serangkaian kegiatan lainnya sepertti Msuyawarah Daerah , diklat kader untuk pemahaman organisasi serta mengadakan pembacaan ayhat-ayat pendek di setiap kelurahan. Untuk mendukung kel;ancara kegiatan tersebut, Nanda minta dukungan penuh Wali Kota. Setelah itu Wali Kota menerima Kepala Badan Penaggulangan bencana Daerah (BPDB) Sumatera Utara A Nasution bersama beberapa stafnya. Selain silaturahmi, kedatangan ini untuk menjalin sinergitas. Sebab, BPDB Sumatera Utara berada di wilayah Kota Medan. “Untuk itu Kami harus bersinergi dengan Kota Medan,” kata A Nasution. Dalam pertemuan dengan Wali kota, Nasution juga mengatakan pihaknya siap memberikan bantuan jika bencana melanda Kota Medan seperti banjir, putting beliung, gempa bumi maupunm bencana lainnya. Untuk itu BPDB Sumut siap mengerahkan seluruh personel dan peralatan yang dimilikinya. Selanjutnya, Wali Kota menerima pengurus Ikatan paskibra Medan (IPM). Mereka minta persetujuan Wali Kota untuk menggelar perlombaan parkibra untuk tingkat pelajar se-Kota Medan memperebutkan Piala Wali Kota medan. Perlombaan yang akan diikuti sekitar 50 sampai 60 paskibra itu akan dilaksanakan di Universitas Medan Area (UMA) pada 26 s/d 28 April mendatang. (Ndo) CMY K


BONGKARNEWS EDISI 354  

koran bongkar news edisi 354 beredar di sumatera utara indonesia aceh riau membongkar kasus sampai tuntas media terpaercaya di sumut utara m...

Advertisement
Read more
Read more
Similar to
Popular now
Just for you