Page 1

Harga Eceran Rp 3500,Luar Daerah + Ongkos Kirim


21-28 JANUARI 2013| EDISI 343| THN KE-VIII

KANTOR REDAKSI Jl. Flamboyan Raya/Raharja No. 37 Medan Telp (061) 8213786, HP. 081375395392 - 08163134392 Fax (061) 8215552

Kinerja Kejari Binjai Dipertanyakan BINJAI, BN Kurangnya kepercayaan masyarakat, khususnya di Kota Binjai dalam menagani kasus tindak pidana korupsi di Kejari Binjai mengundang polemik dan penuh tanda tanya. Apakah pemberantasan Korupsi Kolusi dan Nepotisme (KKN) di Kota Binjai bisa diatasi dalam upaya pemberantasan atau dijadikan ajang manfaat bagi oknum tertentu bagi pihak penegak hukum itu tersendiri dalam kepentingan pribadi.

Pasalnya, segudang kasus-kasus dugaan korupsi di Kota Binjai dari sejumlah instansi Pemko Binjai yang telah diterbitkan di sejumlah media cetak sebagai laporan cepat dan juga laporan dari Lembaga Swadaya Masyarakat bahkan terlewati begitu saja. Sementara itu dalam penaganan kasus perkara tindak pidana Korupsi pengunaan anggaran proyek Swakelola Cipta Karya dan BACA KINERJA KEJARI HAL..2

BPK Janji Pelajari Ulang ‘Rapor Merah’ Busra CS Badan Pemeriksa Keuangan Republik Indonesia (BPK-RI) Perwakilan Aceh, berjanji akan mempelajari ulang soal sejumlah rapor merah PT Bank Aceh di Tahun 2009 dan 2010 lalu, yang saat itu termasuk Busra Abdullah, menjabat selaku Direktur Pemasaran pada Bank Aceh. BANDA ACEH, BN Saat ini, jabatan Busra, justeru mendapat kursi empuk. Ia ditunjuk Gubernur Aceh, selaku pemegang saham pada perbankan berplat merah itu sebagai Plt Direktur Umum, menggantikan Islamuddin. Pergantian tersebut muncul setelah sejumlah karyawan Bank Aeh, melancarkan aksi mosi tak percaya. “Kami tidak akan melupakan temuan yang telah dilakukan pemeriksaan pada Tahun Buku 2009 dan 2010. Karena, yang kita tuju pemeriksaannya bukan keperorangannya, melainkan terhadap lembaga perbankan itu,”ujar Kepala BPK-RI Perwakilan Aceh, Maman BACA BPK JANJI PELAJARI HAL..2

GAM-GB: Banyak Kepsek Diangkat Tak Sesuai Kinerja

Tradisi Pungli di Rutan Kelas II A Batam

Diduga Tahanan Masih ‘Bebas’ Pakai Narkoba BATAM, BN Tradisi Pungutan Liar (Pungli) memang sangat sulit diberantas hingga saat ini. Apalagi di Rumah Tahanan (Rutan) Kelas II A Batam yang hingga saat ini belum dapat dituntaskan secara tegas oleh pemerintah maupun penegak hukum. Selain sulitnya ditegakkan hukum di rutan, disinyalir oknum pegawai di rutan tersebut mempunyai kepentingan-kepentingan untuk memperoleh keuntungan tertentu dari kegiatan pungli tersebut. Berdasarkan informasi yang dihimpun, selain pungutan kepada tahanan pembesuk juga kerap kena pungli apabila BACA DIDUGA TAHANAN HAL..2

Rutan Cabang Lhoksukon Over Kapasitas ACEH UTARA, BN Rumah Tahanan (Rutan) Cabang Lhoksukon over kapasitas. Informasi diperoleh Rutan berkapasitas 95 orang dan ternyata dihuni 220 orang. Kasubsi Pelayanan dan Pengelolaan Ridwan, SH tak pelak lagi membenarkan jumlah penghuni rutan yang melebihi kapasitas, “Sekarang sudah mencapai 220 orang, sedangkan kapasitas hanya untuk 95 orang tahanan. Pihak BACA RUTAN CABANG HAL..2

Celotehan Pak de Kumis

Patut diacungi jempol kepada BPK RI yang mau mengupas ulang rapor merah pejabat..... Semoga bukan hanya isapan jempol belaka,yaaa.............

FK-P4 KBK Tuding Terjadi Mark Up Tunjangan Perumahan DPRD Palas PALAS, BN Lembaga Forum Komonikasi Pusat Peduli Pemerhati Pendidikan Kesehatan Seni Budaya dan Keagamaan (FK-P4 KBK) Sumatera Utara cabang Tabagsel menuding adanya dugaan mark up tunjangan perumahan anggota DPRD Padang Lawas(Palas) tahun anggaran 2012 yang menelan biaya sebesar Rp 1,5 milliar. Hal tersebut disampaikan Ketua FK-P4 KBK Sahat Gamayel Lubis kepada wartawan baru-baru ini mengatakan,sehubungan dengan pelaksanaan PP Nomor 71 tahun 2000 tentang peran serta masyarakat

dalam upaya pencegahan dan pemberantasan tindak pidana korupsi di wujudkan dalam bentuk antara lain mencari, memperoleh, memberikan data atau informasi tentang tindak pidana korupsi dan hak menyampaikan saran dan pendapat secara bertanggung jawab terhadap pencegahan dan pemberantasan tindak pidana korupsi. “Sehingga berdasarkan pasal tersebut di atas kami melihat dalam APBD Kabupaten Padang Lawas tahun anggaran 2012 kemi temukan pos anggaran DPRD Kabupaten Padang Lawas adanya tunjangan peruma BACA FK-P4 KBK TUDING HAL..2

BANDA ACEH, BN Gerakan Aktivis Muda-Guru Bersatu (GAM-GB) Provinsi Aceh menilai, selama ini dilema pendidikan, terutama dalam pengangkatan Kepala Sekolah banyak yang tidak sesuai kinerja. Bahkan, hanya diambil dari teman dekat, timses Pilkada atau yang bisa bekerjasama dalam pemberian fulus. “Pengangkatan Kepsek bukan sesuai kinerja, melainkan banyak yang diambil berdasarkan pendekatan, timses pilkada. Kondisi ini juga banyak kita lihat ditingkat Sekolah Dasar dan Menengah/Madrasah,” ujar Ketua GAM-GB Aceh, Tarmizi, SPd, kepada BN, kemarin. Imbasnya, kata Tarmizi, banyak Kepala Sekolah yang tidak memahami kinerjanya untuk dapat dilakukan. Padahal, katanya lagi, menurut para praktisi, kemajuan pendidikan semestinya diawali dari pucuk pimpinan tingkat sekolah. “Seperti Pemerintahan yang baik, diawali dari Kepala Desa yang baik, cerdas, bijak, terbuka dan profesional. Bahkan, banyak pengangkatan Kepsek selama ini sampai menjelang pensiun,” selorohnya penuh curiga. Bahkan, lanjut Tarmizi, yang TARMIZI, SPD Ketua GAM-GB Aceh BACA GAM-GB HAL..2

Hanya Ada di Riau, Orang Mati Hidup Kembali Inilah kasus yang unik di Provinsi Riau. Seorang buronan kasus korupsi Polda Riau yang telah dinyatakan meninggal tahun 2010, ternyata masih hidup, dan berkeliaran di Kota Pekanbaru. Liputan: Lingkon DIA adalah Bustarizal, seorang stad di Lembaga Penjaminan Mutu Pendidikan (LPMP) Riau. Tahun 2010, Polda Riau menetapkan Bustarizal sebagai tersangka pemalsuan

Penetapan Angka Kredit (PAK) 1.820 guru tahun 2010. Namun setelah dinyatakan tersangka, Bustarizal melarikan diri dari Riau. Polda Riau kemudian menetapkan DPO kepada tersangka. Pada tahun 2010 itu juga kemudian, dia dinyatakan meninggal saat Umroh di Mekah. Surat kematian kemudian dikeluarkan Polda Riau. Pasca keluar surat kematian, kasusnya ditutup. Namun, awal Januari 2013, berembus kabar, tersangka yang sudah dimatikan itu masih berkeliaran di Pekanbaru. Ini kemudian dibuktikan oleh salah seorang wartawan Antara

Pekanbaru, saat mengintai orang yang dikatakan mirip Bustarizal berada di Kantor Bank Riau Kepri. Setelah sempat di foto, kemudian di konfirmasi foto itu memang benar adalah Bustarizal yang dikatakan meninggal di Mekah tahun 2010. Pasca penemuan itu, kantor LPMP Riau jadi heboh. Banyak pejabat yang kemudian mengelak ditanyakan soal hidupnya kembali Bustarizal. Dari penelusuran kemudian diketahui, sejak dikatakan meninggal tahun 2010, ternyata gaji Bustarizal masih dikeluarkan oleh pihak LPMP Riau. Selain itu di data PT Taspen

menyebutkan Bustarizal merupakan peserta aktif di LPMP dengan golongan pegawai III C. Dari data PT Askes, Bustarizal tercatat sebagai peserta aktif. Askes juga mencatat yang bersangkutan sempat menggunakan kartu Askesnya di salah satu rumah sakit di Pekanbaru. Yang jadi pertanyaan adalah apakah proses dimatikannya Bustarizal, untuk melindungi kebusukan yang ada di LPMP Riau soal Penetapan Angka Kredit bodong para guru di Riau. Polda Riau sendiri, pasca hidupnya Bustarizal ini berjanji akan membuka kembali kasus. (*)

21-28 JANUARI 2013 | EDISI 343| THN KE-VIII

Senam Sehat di Desa Manunggal Dihadiri Ratusan Massa DELISERDANG, BN Kagiatan Senam Pagi Sehat, diselenggarakan oleh Tim Kampanye Merah Putih, dan digelar di lapangan sepak bola kaki pasar VII, Desa Manunggal, Kec. Labuhandeli, Kab.Deliserdang, Minggu kemarin, dihadiri sejumlah ratusan massa. Menurut panitia penyelenggara, Tri Pratiko didampingi Rudi Handoko, pada kru BNews,

kegiatan senam pagi sehat, atas kerja sama Tim Kampanye Merah Putih dengan DPC PDIPerjuangan Kab, Deliserdang, selain dalam rangka mengolah ragakan masyarakat dan memasyarakatkan olah raga, juga sosialisasi Cagub-Cawagub. “ Kegiatan Senam Pagi Sehat, Kerja sama Tim Kampanye Merah Putih dengan DPD PDIPerjuangan ini, selain menyahuti program

Kutipan Dana Swadaya Demi Kelancaran Transportasi Tjg Tiram,BN Kutipandanaswadayamasyarakat,yangdilakukan olehperangkatdesaBagan-BarabersamajajaranBPD danLPM,adalahdalamrangkamembangunsarana dan prasarana jalan, demi kelancaran alat transportasi masyarakat. Demikian antara lain disebutkan Agus Salim SE, selakuKepalaDesa(Kades)Bagan-Bara,kepadakru BNews,sehubungandenganpelaksanaankutipan danaswadaya,yangdiperuntukanbagi pembangunan/pemeliharaanjalandidesatersebut. Disebutkanyalagibahwa,kebijakankutipandana

swadaya,sesaihasilrapatbersamapihakpedessaan bersamaunsurepedesaansetempat,pengutipanbagi pengguna jalan transportasi adalah berfariasi, untuk mobil roda 6 sejumlah Rp 30 ribu.-, mobil roda 4 Rp 15 ribu.-. Demi kelancaran usaha tersebut, Agus, mengharapkan semua pihak, terutama para pengguna jalan yang melintas disana, untuk bekerja sama mendukung program itu, demi terwujudnya kebersamaan, keselamatan dan kenyamanan berlalu lintas disana.(tim )

pemerintah memasyarakatkan olah raga dan mengolah ragakan masyarakat, juga sosialisasi serta pemantapan program CagubsuCawagubsu ES-JA (no 2)” kata Tri. Serangkaian kegiatan senam pagi sehat dan sosialisasi pemantapan program CagubsuCawagubsu ES-JA, yang dihadiri sejumlah ratusan massa, yang berasal dari berbagai kalangan etnis di Deliserdang ini,juga

diramaikan dengan penarikan hadiah luckydraw. Tampak hadir pasangan Cagubsu-Cawagubsu ES-JA, berbaur bersama sejumlah pengurus DPC PDI-Perjuangan Kab.Deliserdang,dintaranya Iskandar SE, para pengurus Tim Kampanye Merah Putih, pengurus PAC PDI-Perjuangan Kec. Labuhandeli, beserta jajaran simpatisanya.(San)

Pembagian e-KTP di Desa Dolok Berjalan Lancar Dolok, BN Pembagian kartu tanda penduduk elektronik (eKTP), yang dilaksanakan di Desa Perkebunan Dolok, oleh petugas perangkat desa setempat, tampak berjalan tertib dan lancer. Hasil pantauan kru BNews, pembagian eKTP, oleh perangkat Desa Perkebunan Dolok, yang berasal dari Kecamatan Lima Puluh, tampak berjalan sesuai aturan persyaratan yang ada, yakni dengan membawa KTP ( manual) yang lama dan foto copy kartu rumah tangga.

Kepala Desa Perkebunan Dolok, M Nasir, ketika dimintai tanggapan atas hal tersebut, oleh BNews, beberapa hari lalu, menyebutkan kelancaran pembagian e-KTP itu, berkat kesadaran dan kerja sama yang baik dari perangkat desa. Disebutkan M Nasir lagi bahwa, penyerahan e-KTP, yang merupakan perpanjangan tangan dari pihak kecamatan, tidak dipunguit bayaran alias geratis, dan semoga warga penerima e-KTP, dapat memanpaatkan sesuai dengan fungsinya, demi kemajuan bangsa.(tim )

Kinerja Kejari Pengairan di Dinas PU Binjai bersumber APBD Tahun 2010 yang mengakibatkan Negara mengalami kerugian mencapai Miliaran rupiah, hingga kini Kejari Binjai belum mampu menuntaskan perkara tersebut denganmaksimal. Akhirnyahanyamengkaittiganamasebagaitersangka yakni Hj Mansiari,ST selaku Kepala Dinas PU Binjai dan juga dua Orang BendaharapelaksanaproyekZulfanyahdanAlfanBatubara. Dari catatan BN selama pejalanan penyidikan dalam kasus Korupsi pengunaananggaranproyekSwakelolaCiptaKaryadanPengairandiDinas PU Binjai bersumber APBD Tahun 2010 oleh pihak Kejaksaan Negri Binjai, hnggadipersidanganbahwaTimJaksaPenuntutUmum(JPU)yangmenagani perkara tersebut sama sekali tidak pernah menghadirkan tersangka Hj Masniari,STselakutersangkautamadalamperkaraitu. Bahkan pihak Tim JPU dari Kejari Binjai terindikasi kuat memberikan peluang untuk Hj Masniari,ST dapat melarikan diri agar terhindar dari jerat hukum.Terbukti, selama tersangka tersebut bersetatus sebagai tersangka tidak ada upaya dilakukan penahanan, yang akhirnya tersangka terbukti melarikan diri hingga kini belum ditemukan. Sementara itu dalam kasus perkara tindak pidana korupsi pelaksanaan pengunaananggaranproyekSwakelolaCiptaKaryadanPengairandiDinas PU Binjai bersumber APBD Tahun 2010 pada hasil putusan majelis Hakim PengadilanTinggi Medan terlihat cenderung putusan tersebut kontropersi danbahkanmerugikanhakazasisalahsatuterdakwa.

Sebab darihasilputusanPengadilanTinggiMedandenganNo:30/Pid.Sus. K/2012/PT-Mdn tertanggal 07 Agustus 2012 Jo dan juga sesuai dengan No:03/Pid.Sus.K/2012/PT-Mdn tertanggal 15 Agustus 2012 dalam kasus perkara tindak pidana korupsi pelaksanaan pengunaan anggaran proyek Swakelola Cipta Karya dan Pengairan di Dinas PU Binjai bersumber APBD Tahun2010dalamputusantersebutdinilaiadanyakekeliruandankesalahan serta ketidaksempurnaan (Onvoeldoende Gemotiveere) Judex Faite dalam penegakanSupermasiHukumyangbenar. DalamkekeliruanpenegakanHukumtersebutbahkanterindikasiadanya rekayasa yang dilakukan secara sengaja oleh Jaksa Penuntut Umum Kejari BinjaidalampengajuanbandingperkarayangtelahdiputuskanPengadilan Negri Medan sesuai Register No: 03/PID-SUS.K/2012/PN.Mdn tanggal 15 Mei2012kePengadilanTinggiMedanterhadapZulfansyahselakubendahara proyek Swakelola PU Binjai Tahun 2010 yang juga merupakan pengajuan banding sepihak yang dinilai mempunyai kepentingan untuk merugikan Hakazazsi terdakwa. Jaksa Penuntut Umum Kejaksaaan Negri Binjai Mh,Iqbal,SH telah mengajukan banding sepihak terhadap putusan Pengadilan Negri Medan yangtelahmemvonisZulfansyahdengankurunganbadanselama1Tahun3 Bulan dengan denda Rp 50 juta dan selanjutnya dari hasil vonis Pengadilan TinggiMedanyangmengambilputusanprimerakhirnyaZulfansyahdivonis selama 4Tahun kurungan dan denda Rp 200 juta.

PadahaldarituntutanJPUKejaksaanNegriBinjaisebelumnyamenuntut Zulfansyah 1 Tahun 6 Bulan dan denda Rp 100 juta, selanjutnya putusan Pengadilan Negri Medan mengambil putusan Subsider dan mevonis terdakwaZulfansyahdengankurunganbadanselama1Tahun3Bulandengan dendaRpjutasudahmemenuhipersyaratandari2/3penguranganhukuman. Namunlagi-lagiJaksaPenuntutUmumKejaksaaanNegriBinjaiMIqbal,SH malah melakukan banding ke PT Medan yang bersifat menyalahi kewewenanganjabatannya. Sedangkandalamperkaratindakpidanakorupsipelaksanaan pengunaan anggaran proyek Swakelola Cipta Karya dan Pengairan di Dinas PU Binjai bersumber APBD Tahun 2010 putusan Pengadilan Negri Medan bersifat Dakwaan Subsider sedangkan putusan Pengadilan Tinggi Medan telah menjatuhkanhukumandalamdakwaanPrimer.Haltersebutadanyadugaan kesewenang-wenanganJPUdalampengajuanbandingtampamemenuhi prosudur yang benar hingga putusan PT Medan terkesan Kontroversi yang telah mencedrai rasa keadilan. Abd Hafiz,SMHK selaku aktifis Hukum Kota Binjai meminta kepada KejaksaanTinggi Medan atau pun Kejagung segera melakukan peninjauan terhadap kinerja di Kejaksaan Negri Binjai atas bobroknyapenaganankasustindakpidanakorupsiyangselamainiditangani oleh pihak penyidik. “Dan jangan sampai kepercayaan masyarakat hilang pada pihak Kejaksaan hanya karena oknum nakal yang bekerja dalam kepentingan pribadi,” akhiri Abd Hafiz.(MR/M.Stp).

Menurutnya, dari pemeriksaan yang dilakukan Badan Pemeriksaan Keuangan-RepublikIndonesia(BPK-RI)PerwakilanAceh,ataspelaksanaan Rencana Kerja Anggaran Perusahaan (RKAP) PT Bank Aceh, tahun 2010 lalu, BPK juga mengungkapkan sederet kelemahan sistem pengendalian intern Bank berplat merah itu. Beberapapermasalahanyangdikelompokkanmenjadikelemahansistem pengendalian intern, permasalahan dalam pengelolaan pendapatan dan non operasional, pengelolaan biaya operasional dan non operasional serta permasalahandalampengelolaankredit. “Di sini ada tiga kelemaahan sistem pengendalian intern, yaitu sistem pengendalianinternataspenempatandanapadaDivisiTreasury,yang kurang memadai,sehinggakeputusanDireksiyangmenyangkutpenempatandana antar bank berpotensi kurang menguntungkan,”ucapnya. Tidak hanya itu, BPK juga mengungkapkan bahwa pengawasan dan pengendalian terhadap pengelolaan sistem teknologi informasi pada PT Bank Aceh lemah sehingga berpotensi terjadi penyalahgunaan wewenang.bahkan,Sistempengendalianinternataspelaksanaanpemberian kredit komersial pada Divisi Kredit dan beberapa Kantor Cabang kurang memadaisehinggarawanterjadipenyimpangan. “Permasalahan lainnya, yaitu terkait permasalahan dalam pengelolaan pendapatanoperasionaldannonoperasional.Disini,katanya,PTBankAceh tidak mengenakan sanksi denda keterlambatan sebesar Rp Rp4.923.509.958,03 atas tunggakan angsuran kredit”, lanjutnya. Sebutnya lagi, PT Bank Aceh, memiliki sejumlah permasalahan. Dalam hal ini terkait pengelolaan pendapatan operasional dan non operasional, mulai pengenaan sanksi oleh Kementerian Agama atas keterlambatan pelimpahansetoranawalBPIHsebesarRp119.850.000,00,hinggasoalPPh terhadap penghasilan tidak teratur diratur direksi dan dewan komisaris kurang dihitung sebesar Rp 769.999.999,87. “Tahun itu juga, PT Bank Aceh sempat dikenakan sanksi denda oleh Kementerian Agama atas keterlambatan pelimpahan setoran awal BPIH sebesarRp119.850.000,00.Bahkan,dalamprosespembayaraninsentifbiaya penagihankreditkonsumtifkepadabendaharadinas/instansi/badan,terjadi kelebihan, sehingga memboroskan keuangan PT Bank Aceh sebesar Rp720.576.158,00,” sebutnya lagi. Selanjutnya, pembayaran atas penyalahgunaan cek milik Bendahara Umum Daerah Kabupaten Aceh Utara oleh pihak ketiga sebesar Rp1.500.000.000,00, berpotensi merugikan keuangan PT Bank Aceh Cabang Lhokseumawe minimal sebesar Rp900.000.000,00. “Pembayaran tunjangan pensiun kepada mantan Direksi dan Dewan Komisaris belum sepenuhnya sesuai ketentuan sebesar Rp23.132.924.900,00, sehingga perlu dikaji kembali. Serta, pembayaran tunjanganoperasionaldantunjangantransportasikepadaDireksidanDewan KomisarisPTBankAcehtumpangtindihdenganfasilitasdarikantorsehingga berindikasi merugikan keuangan PT Bank Aceh sebesar Rp2.625.000.000,00,” paparnya. BankAceh,saatitu,jugaterjadikelebihanpembayaranpenghasilandewan komisaristahun2009dan2010sehinggaberindikasimerugikankeuangan PT Bank Aceh sebesar Rp 1.965.971.833,58. Disusul pembayaran insentif kepadapemegangsaham,DireksidanDewanKomisarisPTBankAcehtidak sesuaiketentuansehinggamemboroskankeuanganPTBankAcehsebesar Rp665.000.000,00. “Dalam pemeriksaan yang kami lakukan, juga adanya bantuan dana Corporate Social Responsibility sebesar Rp450.000.000,00, yang dapat disimpulkan tidaktepatsasaran.Pelaksanaansewakendaraanrodaempat untuk operasional Direksi dan Dewan Komisaris tidak melalui pelelangan, sehingga berindikasi merugikan keuangan PT Bank Aceh sebesar Rp1.150.000.000,00,” ungkapnya. Ditambahkan dia, dalam LHP tersebut juga adanya pekerjaan pembangunan pintu gerbang masuk Kota Jantho berlogo PT Bank Aceh belum selesai dikerjakan dan dikenakan sanksi denda sebesar Rp34.090.931,00, dan penggunaan uang panjar pada Cabang LhokseumawesebesarRp250.000.000,00tidaksesuaiketentuan,sehingga

berindikasi merugikan keuangan PT Bank Aceh, tambahnya.

BPK Janji Abdulracman,melaluiKasubbagHukumdanHumasBPK-RIPerwakilan Aceh, Rizaldy Arfah, belum lama ini, kepada BN. Bahkandiajugaberjanjiakanmempelajarisoalsejumlahtemuanditahun tersebut.“Dan jika masih ada item yang belum ditindaklanjuti oleh PT Bank Aceh, kita akan menyerahkan dan meminta aparat penegak hukum untuk memproses sesuai aturan yang berlaku,”tegas. Dikatakan pada Tahun Buku 2009 dan 2010, pihaknya menemukan sebanyak 29 temuan pemeriksaan atas pelaksanaan Rencana Kerja dan Anggaran Perusahaan (RKAP) PT Bank Aceh. “Saat itu, penanggung jawab pemeriksaan BPK-RI Perwakilan Aceh, dipimpin oleh pak Abdul Rifa’i Sholeh. Berdasarkan pemeriksaan yang dilakukan menunjukkan bahwa masih terdapat sejuumlah kelemahan leembaga perrbankan berplat merah itu,”katanya. DarigambaranumumdantemuanpemeriksaanatasPTBankAceh,dapat diketahuibeberapaapersoalan.Seperti,dalamTahunBuku(TB)2009,realisasi peendapatan adalaah sebesar Rp1.329.331.3378.308, atau 81,94 persen dari anggaran pendapatan sebesar Rp1.622.330.293.244. “Sedangkan realisasi biaya adalah sebbesar Rp945.636..274.482, atau sebesar75,84perseenndarianggaranbiayasebesarRp1.246.876.300.293, dan realisasi kredit yang diberikan sebesar Rp6.390.851.053.297, atau 119,16 % dari anggaran kredit yang diberikan sebesar Rp5.363.201.210.152,”sebutnya. Audit Coverage Dijelaskanpuladarirealisasipendapatan,biayadankredityangdiberikan tersebut,telahdilakukanpemeriksaanatasTahunBuku2009,dengancakupan pemeriksaan (audit coverage) sebesar Rp2.350.744.937.483,85. “Cakupan pemeriksaan pendapatannya sebesar Rp50.122.617.615,00 atau3,77%darirealisasipendapatan,biayasebesarRp431.304.704.791,24 atau 45,61% dari realisasi biaya, dan kredit yang diberikan sebesar Rp1.869.317.615.077,61 atau 29,24% dari realisasi kredit yang diberikan,” terangnya. Secara rinci dari pemeriksaan tersebut menghasilkan 18 temuan senilai Rp74.520.285.704,58 atau 3,17% dari cakupan pemeriksaan yang terdiri dari satu temuan pendapatan sebesar Rp2.572.837.961,76 atau 5,13% daricakupanpemeriksaanPendapatan. “SembilantemuanlainnyayaitubiayasebesarRp8.998.447.742,82atau 2,09% dari cakupan pemeriksaan Biaya, dan delapan temuan kredit yang diberikan sebesar Rp62.949.000.000,00 atau 3,37% dari cakupan pemeriksaan kredit yang diberikan,”rinci Rizaldy Arfah. Namun, lanjut dia, berbeda dengan Tahun Buku 2010 (sd. 30 November), realisasi pendapatan adalah sebesar Rp1.511.546.863.235,00 atau 75,85% dari anggaran pendapatan sebesar Rp1.992.931.342.234,00 realisasi biaya adalah sebesar Rp1.154.326.275.955,00 atau 71,79% dari anggaran biaya sebesar Rp1.630.671.129.340,00. “Realisasi kredit yang diberikan tahun 2010 sebesar Rp7.831.407.480.930,00 atau 111,22% dari anggaran kredit yang diberikansebesarRp7.041.524.009.678,00.Darirealisasipendapatan,biaya dan kredit yang diberikan tersebut, telah dilakukan pemeriksaan dengan cakupan pemeriksaan (audit coverage) sebesar Rp2.099.403.084.169,48,” lanjutnya. Cakupan pemeriksaan pendapatannya, kata dia mencapai sebesar Rp68.509.620.545,00 atau 4,53% dari realisasi pendapatan. Selanjutnya, pemeriksaan biaya sebesar Rp445.108.212.008,25 atau 38,56% dari realisasi biaya, dan pemeriksaan kredit yang diberikan sebesar Rp1.585.785.251.616,23 atau 20,25% dari realisasi kredit yang diberikan. “Dari pemeriksaan tersebut menghasilkan 14 temuan senila Rp48.969.426.342,40 atau 2,33% dari cakupan pemeriksaan yang terdiri dari satu temuan pendapatan sebesar Rp2.350.671.996,27 atau 3,43% dari cakupan pemeriksaan pendapatan, sembilan temuan biaya sebesar Rp30.443.344.935,13 atau 6,84% dari cakupan pemeriksaan biaya dan empat temuan kredit yang diberikan sebesar Rp16.175.409.411,00 atau 1,02% dari cakupan pemeriksaan kredit yang diberikan,”paparnya LemahSistemPengendalian

Lalai Bank Aceh Banda Aceh (Kantor Pusat Operasional) dan Cabang Lhokseumawe, disinyalir tidak memperhatikan prinsip kehati-hatian perbankan alias lalai dalam memberikan KMK. Akibatnya, kredit tersebut direklasifikasi menjadi macet. Pemeriksaan ini bertujuan untuk menilai apakah Sistem Pengendalian Internyangterkaitdenganprogram/kegiatanyangdiperiksatelahdirancang dan dilaksanakan secara memadai, pengelolaan pendapatan operasional dan non operasional, serta biaya operasional dan non operasional telah mengacukepadaketentuan/kriteriayangtelahditetapkandan pengelolaan kredit telah menerapkan prinsip ekonomis, efisien dan efektif. “Pemeriksaankamilaksanakansesuaidenganstandarpemeriksaanyang ditetapkanolehBPK,yangmeliputiprosedur-proseduryangkamipandang perlusesuaidengankeadaan,”kata. Dikatakan, berdasarkan pemeriksaan yang dilakukan pihaknya atas pelaksanaan RKAP PT Bank Aceh seperti yang telah disebutkan itu, menunjukkanbahwamasihterdapatberbagaikelemahan. “Sebagaidampakkelemahantersebut,BPKmengungkapkansejumlah temuanpemeriksaansebagaimanatercantumdalamlaporaniniyangbelum sepenuhnyasesuaidenganketentuanperbankandanketentuaninternalPT Bank Aceh,”katanya. Pertama,katanya,terkait pemberianKMKsebesarRp3.000.000.000,00 dan Line Letter of Credit (LC) sebesar USD878.553,75 oleh KPO Banda Aceh kepada PT Kuta Malaka Leumona (PT KML) tidak memperhatikan prinsip kehati-hatianperbankansehinggakreditnyadireklasifikasimenjadimacet. “PemberiankreditinvestasidanmodalkerjasebesarRp7.000.000.000,00 olehKPOBandaAcehkepadatigadebiturjugatidakmemperhatikanprinsip kehatihatian perbankan, sehingga kreditnya direklasifikasi menjadi diragukan alias macet,”ujarnya menyebutkan. Sedangkan untuk Bank Aceh Cabang Lhokseumawe, katanya ditahun yangsamaitu,pemberianKMKsebesarRp13.600.000.000,00olehCabang Lhokseumawe kepada tiga debitur menyalahi prosedur dan melampaui kewenanganPemimpinCabang. “Pemberian KMK oleh Cabang Lhokseumawe kepada seorang debitur sebesar Rp3.000.000.000,00 saat itu juga melampaui batas kewenangan pemimpin cabang dan tidak digolongkan kedalam Non Performing Loan NPL),” ungkapnya. Menurut Penanggung Jawab Pemeriksaan BPK RI Perwakilan Aceh ini, pemberianKMKolehCabangLhokseumawedanLangsakepadaPTRanub Lampuan Sejati (PT RLS) dengan tingkat kolektibilitas yang berbeda. “Selain itu, pemberian KMK dan Kredit Investasi oleh Cabang Lhokseumawe kepada dua debitur dalam satu grup sebesar Rp,00 menyalahi prosedur dan tidak memperhatikan prinsip kehati-hatian perbankan,”tukasnya. Celakanya lagi, ungkap dia, adanya proses pemberian Kredit Investasi oleh Cabang Lhokseumawe kepada seorang debitur sebesar Rp1.200.000.000,00, yang menurut pihaknya tidak sesuai ketentuan. “Lain halnya pemberian Kredit Komersial oleh Cabang Lhokseumawe kepada11debiturdalamsatugrupsebesarRp21.950.000.000,00,iniakibat Bank Aceh Cabang Lhokseumawe tidak memperhatikan prinsip kehatihatian perbankan,”ungkapnya lagi. Pihaknya juga menemukan adanya pemberian Kredit Komersial oleh Cabang Lhokseumawe kepada lima debitur dalam satu grup sebesar Rp13.950.000.000,00 tidak memperhatikan prinsip kehati-hatian perbankan. “Bahkan, pengelolaan dan pemantauan Kredit Konsumtif sebesar Rp1.485.000.000,00 dilaksanakan tidak sesuai prosedur, serta kebijakan penghapusan KMK kepada Pemerintah Aceh sebesar Rp3.167.000.000,00 tidak sesuai ketentuan,” tandasnya. Ditambahkan, penyelesaian kredit bermasalah atas nama PT Uber Daya Indah Lestari (PT UDI) sebesar Rp2.000.000.000,00berindikasimerugikankeuanganPTBankAcehsebesar Rp1.550.409.411,00. (TIM)


GAM-GB.... paling menyedihkan lagi, masih sangat minimnya peran Pengawas Sekolah dalam pengawasan yang hanya waktu datang, lihat, duduk lalu pulang. “Masalahlainnya,jugamenerpaprosespengrekrutanPengawasSekolah, banyak para mantan Kepsek menjelang pensiun. Sehingga, tidak produktif lagidalammelakukantugasnya,inijugaberakibatmasihminimnyatenaga pengawas,” lanjutnya. Pemerintah Pusat, sebut Tarmizi, sudah mencoba mengatasidenganmenerbitkanPermendiknasNo.28Tahun2010,tentang penugasanGurusebagaiKepalaSekolahdanPemerintahAceh,mengesahkan Qanun Nomor 5 Tahun 2008. Menurutnya,PendidikanAcehmemangharusadadasar-dasaryangkuat, melalui penegakan aturan yang benar, tepat, cepat, tegas dan adil. Juga, sambung dia, melalui pembinaan pendidikan karakter maupun akhlak. “Tugas Pemerintah harus segera merealisasi dan mengawasi, juga pembinaan yang berkesinambungan melalui guru-guru kepada anak bangsa. Karena, pendidikan yang kuat adalah akhlak yang baik,”paparnya. GelarSeminar Dalam seminar yang bertajuk “peran guru dan kepala sekolah dalam memajukanpendidikanAcehyangberkualitas,danberkarakterIslami,”diikuti sekitar 250 tenaga pendidik dari kalangan guru dan Kepala Sekolah di Kota Banda Aceh dan Kabupaten Aceh Besar. Acara tersebut menghadirkan PemateridariDinasPendidikanAceh,yaituKabidDikmen,Drs.Laisani,M.Pd. “Selama ini banyak kita lihat guru-guru yang tidak peduli terhadap kualitas mata pelajaran atau pendidikan begitu juga kepala sekolah hal ini disebab oleh banyak faktor. Dan dengan seminar ini kita coba menggali dan mengkaji apa solusi yang bisa kita berikan,”ujar Tarmizi , yang juga ketua panitia seminar. Ia menilai dilema pendidikan selama ini dalam pengangkatan kepala sekolah banyak yang berdasarkan pendekatan, tim sukses Pilkada atau pemilu yang bekerjasama dengan pemberian uang, bukan berdasarkan kinerja. (AFRIZAL)

Diduga Tahanan.. ingin membesuk tahanan disana.“Tapi mau bagaimana lagi bang, kalau tidakditurutitingkahoknumyangmelakukanpunglinantikamipastidipersulit untukbisajumpasamatahananyangkamibesuk.Padahal,kamisudahdatang jauh-jauh hanya untuk menjumpai keluarga yang menjadi tahanan disana. Yah,lebihbaikkasihuangrokokmerekaajalahdaripadaribetnantinya.’ Papar salahsatuwargayangtidakmaudisebutkannamanyakarenatakutnantinya keluarganya yang menjadi tahanan rutan kelas II A Batam tersebut dipersulit. Ketikaditanya,apakahkeluarganyayangmenjaditahanandisanapernah mengatakan tentang peredaran narkoba di ruang tahanan ataupun tindak pidanalainnya.’Memangsudahmenjadirahasiasepertitradisidisetiap-setiap rutandanlapasdiNegarakitainikaliyah.Orangkayakalaudipenjaraberbeda dengan orang tidak mampu. Seperti sudah menjadi rahasia seperti tradisi di setiap-setiaprutandanlapasdiNegarakitainikaliyah,orangkayakalaudipenjara berbeda dengan orang tidak mampu. Kemana lagi uang para tahanan habis dibelanjakanyaagarbisabetahmenjalanihukumanyangmerekahadapikalau bukannarkobadanjudi.Pokoknyaadasemuadecasaladauang,keluargayang tidak mampu seperti kami ini yang kasian. Kalau tidak sering membesuknya, diatidaktahanmakanjatahyangadadisana,kalaudibesukbanyakberkorban uang juga, bang,”jelasnya lagi. Kepada wartawan, Kepala Rutan Kelas II A, Baloi, Batam, Anak Agung Gde Krisna mengakui adanya penyeludupan narkoba di rumah tahanan tersebut. Karena itu, jajaranya gencar melakukan razia rutin. Usaha kami untuk memberantas Pungli sekaligus meningkatkan pelayanan professional kini menyiagakan call centre atau nomor telpon pengaduan.’Call centre tersebut lewat nomor 0878 84544460, jadi jika pembesuk ada yang merasa menjadi korban praktek pungli langsung saja kirimkan sms atau menghubungi ke call centertersebut.Selainmenyediakancallcentrepihaknyajugaterusmelakukan pengawasanterhadappenyeludupnarkobadanhendphonekerutan.Dalam seminggu2kalikamimelakukanrazianarkobadanhendphone,bahkanditahun 2012 lalu, kami berhasil mengungkap empat kasus narkoba dan 40 kasus pemakaianhendphonediRutanKelasIIABatamini,”pungkasnya.(RO/RLS)

FK-P4 KBK Tuding... han dengan kode pos rekening ( sejumlah Rp 1,546.068,000,yakni untuk Ketua 12 OB X 5.264.000 = 63,168,000,Wakil ketua 24OB X4.750.000= 114.000.000.Anggota 324OB X 4.225.000 = 1.368,900.000.Berarti setiap tahunnya anggota DPRD Palas menerima dana tunjangan perumahan 12 OB X 4.225.000 atau sebesar Rp 50.700.000./tahun,” bebernya. Sedangkan menurut penilaian FK-P4 KBK dalam penganggaran hal tersebut di atas jelas melanggar peraturan pemerintah RI nomor 37 tahun 2005 tentang perubahan atas PP nomor 24 tahun 2004 tentang kedudukan protokoler dan keuangan pimpinan dan anggota dewan perwakilan rakyat yaitu pasal 20 yang berbunyi“Dalam hal pemerintah daerah belum dapat menyediakan rumah jabatan pimpinan atau rumah dinas anggota DPRD, kepada yang bersangkutan diberikan tunjangan perumahan”. Kemudian, “Tunjangan perumahan sebagaimana dimaksud pada ayat (1) diberikan dalam bentuk uang dan dibayarkan setiap bulan terhitung mulai tanggal pengucapan sumpah/janji”. Selanjutnya“Pemberian tunjangan perumahan sebagaimana dimaksud ayat (2) harus memperhatikan asas kepatutan,kewajaran,dan rasionalitas serta standar harga setempat yang berlaku. Ketentuan lebih lanjut mengenai besarnya tunjangan perumahan sebagai mana dimaksud pada ayat (2) ditetapkan dengan peraturan kepala daerah. “Berdasarkan PP di atas dugaan mark up semakin kuat apalagi kalau kita banding degan harga sewa rumah/kantor beberapa SKPD yang ada di Palas yang baru mencapai Rp 35 juta /tahun,dan bahkan mnasih ada yang diwah harga tersebut.sehingga kalau di banding dengan tunjangan perumahan DPRD yang mencapai Rp 50,7 juta /tahun. Berarti ada selisih sekitar Rp 20,7 juta /tahun untuk satu anggota dewan.Sementara di ketahui jumlah anggota DPRD Palas saat ini sebanyak 30 orang,sehingga dugaan mark-up anggaran tunjangan perumahan tahuan 2012 mencapai 621 juta,” rincinya. Tambah Sahat, hal ini sudah pernah dipertanyakan kepada kasubbag hukum sekretariat Bupati Palas Agus Daulay,tentang peraturan tunjangan perumahan DPRD. Namun menurutnya peraturannya belum ada. (ALI)

Rutan Cabang .. kalapas terpaksa menempatkan narapidana dan tahanan dalam satu ruangan 15-25 orang. Idealnya dalam satu ruangan hanya 5 orang saja,” ujarnya, kemarin. Ridwan, SH juga menambahkan, jika dikaji dari sisi hukum, ini sudah melanggar hak asasi manusia (HAM), karena semua warga negara indonesia sama dimata hukum. Sebagaimana yang dituangkan dalam pasal 28 (d), setiap orang berhak atas pengakuan, jaminan, perlindungan dan kepastian hukum yang adil serta perlakuan yang sama di hadapan hukum. Dirinya juga sangat prihatin atas keadaan narapidana dan tahanan yang berdesak-desakan. Walaupun begitu, pihak Kalapas akan selalu memberikan hal yang terbaik untuk mereka baik dari sisi pelayanan dan sebagainya. “Kiat akui serba kekurangan, dan kita setiap minggu memberikan bimbingan agama dan nasehat,” akhirinya. (RAM)

21-28 JANUARI 2013 | EDISI 343| THN KE-VIII

Jalan Lintas Desa Bakti Makmur Rusak Parah BaganSinembah,BN SejumlahbadanjalanyangberadadisepanjangJalan LintasDesaBaktiMakmur,KecamatanBaganSinembah, Kabupaten Rokan Hilir (Rohil), kondisinya saat ini rusak parah,dancukupmenggangguaktifitaswargamelintas disana. HasilpantauandanketeranganyangdihimpunBNews dari lokasi, Jalan Lintas Desa Bakti Makmur, yang menghabiskandanamilliaranrupiah,berasaldariAPBD Kab. Rohil tahun anggaran 2011, selain mengganggu aktifitaskenderaanwargasetiapkalimelintasdisana,juga menjadisalahsatupenyebabterjadinyakecelakaan. Salah seorang perangkat Desa disana, ketika dikonfirmasi BN, beberapa waktu lalu, menyebutkan bahwaJalanLintasDesaBaktiMakmur,sepanjang4Km, yangmenelandana5,4Milliartersebut,yangdibangun tahun 2011, beberapa bulan terakhir kondisinya rusak parah.Disebutkanyalagibahwa,jikakondisijalantersebut tidaksegereadiperbaiki,selaindapatmenggangguaktifitas danberpengaruhpadatingkatekonomiwarga,jugadapat menjadi penyebab bertambahnya jumlah angka kecelakaanlalulintasdisana. Untukitudiharapkankepadainstansipemerintahan kabupatenRohil,agarpro-aktifdansegeramungkinuntuk memperbaiki badan jalan yang rusak dan berlobang, sehingga aktifitas warga yang melintas, menjalankan aktifitasdapatmerasaaman,harapkalanganwargajuga perangkatdesadisana.(Juminan)

Penerimaan Bea Keluar dari Batam Tak Capai Target Batam, BN. RealisasipenerimaanBeaKeluardiBatamselamatahun 2012 sebesar Rp803 miliar, lebih rendah dari target yang ditetapkan sebesar Rp860 miliar. Hal tersebut dikatakan KepalaKantorBeaDanCukaiTipeBBatamUntungBasuki mengatakanpenurunanHargaPatokanEkspor(HPE)rataratabulanandanJenisCrudePalmOil(CPO)produkyang diekspordengantarifPersetujuanEkspor(PE)yanglebih kecil atau bahkan 0% menyebabkan penerimaan Bea Keluar lebih rendah dari target. “Realisasi penerimaan Bea Keluar sebesar 93,38%. PenyebabpenerimaanBeaKeluartidakmencapaitarget dipengaruhiolehHPErata-ratayangcenderungturunserta tarifeksporyangturunbahkanmenjadi0%untukbeberapa produk mulai bulan Juni,” katanya kepada wartawan beberapawaktulalu. Untung menjelaskan realisasi penerimaan bulanan sebenarnyasangatfluktuatifdimanapenerimaanbeakeluar tertinggitercatatterjadipadabulanMaretsebesarRp147 miliar,sedangkanyangterendahpadabulanJunisebesar Rp27 miliar. Adapun sejak bulan September hingga Desember 2012 cenderung menurun. Pada bulan Maret saat penerimaan tertinggi jumlah netto produk penyumbang bea keluar juga mengalami kenaikan dibanding bulan sebelumnya. Selain itu, pada MaretHPErata-ratajugaberadapadaposisicukuptinggi yaitu US$1.105,7 /MT. SelamaJuni-September,lanjutUntung,terjadihalyang berbeda dilihat dari jumlah netto produk ekspor yang cenderung mengalami kenaikan tetapi kontribusi terhadap penerimaan mengalami mulai bulan September.“PadahalpadaOktoberdanNovemberrealisasi ekspor produk penyumbang bea keluar lebih tinggi dibandingpadabulanMaret,”tuturnya.Selainitu,Untung menambahkanrealisasipenerimaanBeaMasukselama 2012 sebesar Rp122 miliar, lebih tinggi dari target yang ditetapkansebesarRp81miliar. Ia menyebutkan komoditi Bea Masuk bayar terbesar disumbangkanolehpembuluh,pipadanprofilberongga, tanpakampuh,daribes(selainbesituang)ataubajadengan HS code 7304.“Angka realisasi penerimaan Bea Masuk selama 2012 149,74%.”Ujarnya lagi. (Ro/Rls)

Pengerjaan Proyek PPIP Sesuai Inbup Bengkalis,BN IntruksiBupatikebupatenbengkalis(INBUP)tahun2012 yang menggulirkan program penguatan infrastruktur pedesaan (PPIP) seperti yang sudah terealisasi di desa tenggayun tahun 2012 cukup menggembirakan. INBUP dalam tahun 2012 pelaksanaan pengerjaan proyek PPIP olehpemerintahdesabersamaperangkatdesatanggayun berjalandengantepatsasaran,pengerjaansejumlahproyek didesainiterealisasirampung dancukupmenyentuhdan melancarkan akses mobilisasi nadi perekonomian masyarakatdesatenggayunkecamatanbukitbatu. KepaladesatenggayunHj.AisyahsaatdikonfirmasiKoran ini selasa (08/01) dikantornya menjelaskan pelaksaan pengerjaan pembangunan sesuai INBUP 2012 sudah rampung100%.Dimanaada7semenisasijalan,11jembatan yangmerupakansaranamenghubungkankepemukiman wargadankekawasanpertanianmasyarakat.Pengerjaannya semuatuntasjelasHj.Aisyah.LebihlanjutKadesini,bahwa pemerintah desa tetap komit mengambil langkah yang terbaik untuk membangun kemajuan kesejahtraan masyarakat desa tenggayun, dan kedepannya bahwa pembangunan yang berpihak kepada kepentingan masyarakatterusditingkatkanterangnya. Dijelaskan, bahwa INBUP tahun 2012 yang mengucurkanPPIP(programpenguataninfrastrukturdesa )yangmanatahuninididesatanggayunInsyahAllahdapat berjalandenganbaikdanterealisasisesuaiyangdiharapkan . itu semua adalah karena berkat keseriusan dan tingkat kebersamaan masyarakat serta perangkat desa dan pemerintah Desa .juga didukung kesadaran yang tinggi dan semangat membangun untuk memajukan Desa tenggayun lebih baik kedepan dalam mensejahterakan masyarakatkataHj.Aisyah menjawabpertanyaanaktivis LSM FIPPR (Forum Informasi Pemantau Pembangunan Riau) dan menjawab wartawan Koran ini yang turun lapanganinvestigasipenelusuranpembangunandidaerah kabupatenbengkalisduapekanlalu.(SIRAIT)

Kepala UPT Jembatan Timbang Dishub Riau Aleksander SH didampingi Kasi Operasional jembatan timbang dishub Riau Hadi sasmito, didapn truk RAPP yang tengah dibingkar.

Dua Unit Mobil Trinton Tertangkap Tangan Saat Dirazia di Jembatan Timbang Trantang Manuk

Humas PT RAPP Membantah

PELALAWAN.BN Sepandai pandai tupai melompat tiba saatnya akan terjatuh jua,hal ini Terkait truk muatan kayu di duga milik perusahaan kertas terbesar di Asia Tenggara, milik sukamto tanoto riau palp and paper mau tak mau, terpaksa di bongkar dan diturunkan muatannya belum lama ini dis hub riau lakukan razia di jembatan timbang Terantang Manuk senin lalu,mobil apapunnjenisnya termasuk milik siapapun dishub tidak segan segan tindak tilang dari hasil razia kayu yang di anggkut di dalam get pase dishu secara terang terangan sang sopir juga menyampaikan bahwah dirinya hanya sopir biasa layaknya yang makan gaji dan muatan di angkutnya dari lirik menuju pabrik RAPP Ironisnya ungkapkan selama ini baik lewat sms kepada sejumlah wartawan ternyata adanya dugan kebohongan seperti hal nya Humas RAPP Budi Firmansyah meneruskan pernyataan dari Corporate Comunikation Manager RAPP, Pamungkas Trishadiatmoko mengatakan bahwa bahwa truk truk yang bermuatan kayu milik RAPP tidak melintas di jalan Lintas Timur. Truk RAPP yang mengangkut kayu dari wilayah HTI RAPP menuju Pangkalan Kerinci, khususnya dari arah Ukui selama ini melalui jalan akses

perusahaan” tulis Budi,Kemudian Budi menambahkan release dari CCM RAPP, Moko yang mengatakan bahwa RAPP mentaati undang undang yang berlaku.,RAPP selalu menghargai dan berusaha mengikuti perundang undangan yang berlaku” tambahnya Namun apa yang dinyatakan oleh Humas RAPP Budi Firmansyah melalui release yang dikeluarkan oleh Corporate Communication Manager RAPP, Moko bertolak belakang dengan fakta yang terjadi di lapangan sesuai hasil razia, humas RAPP menyanggah bahwa truk mereka tidak melintas di Lintas Timur namun dari razia yang dilakukan oleh Dinas Perhubungan Propinsi Riau tepatnya di jembatan timbang Terantang Manuk berhasil menahan dan membongkar paksa dua truk pembawa kayu bertonase lebih,Sebuah truk pembawa kayu syarat muatan dengan nomor polisi BM 8310 ZU, yang dikemudikan oleh Ganda Simbolon dari Lirik menuju pabrik kertas RAPP di Pangkalan kerinci.“dari Lirik untuk dibawa ke RAPP” ujar Ganda singkat Kepala Unit Pelaksana Teknis Jembatan Timbang Dishub Riau, Aleksander SH, Senin (14/1) kemarin mengatakan kendaraan apapun yang melintas di jembatan timbangan terantang Manuk yang melebihi muatan akan ditindak dan ditilang,

seperti saat ini truk yang melebihi muatan tetap ditilang. “Truk truk tinton itu kelebihan muatan, dan kita bongkar paksa, jika surat suratnya tidak lengkap akan kita tilang” ujar Eleksander didampingi Kasi Operasional Timbangan Kendaraan bermotor Dishub Riau Hadi Sasmito S.I.Kom. Dari fakta di lapangan terlihat selain truk dari Lirik, ada juga truk pembawa kayu untuk RAPP dari Ukui yang dibongkar paksa. Truk bernomor BK 9483 CH itu akhirnya dibongkar oleh petugas jembatan timbang Terantang Manuk. Sementara itu, Ketua Aliansi Masyarakat Lintas Timur (AMAL), Ison mengatakan tidak masalah jika pihak RAPP membantah bahwa truk mereka tidak melintas di jalan lintas timur, namun fakta di lapangan yang mengatakan apakah mereka benar apa berbohong. Misalkan mobil itu milik kontraktor namum kayu jelas milik PT rapp apakah itu tidak serupa sebutnya ketika Razia dishub di jembatan timbang, Terantang Manuk, banyak truk truk yang melintas dan di tahan disana” anehnya di temukan dalam gete pas bertuliskan kayu milik PT RAPP.jika itu bukan kayu perusahaan itu,apakah mungkin dari surat jalan para kontaktor maupun supir berani menunjukkkannya.kita tau rapp selalu

berdalih.tegasnya. Humas RAPP Budi firmansyah ketika dikonfirmasi BN,sabtu (18/01) terkait masih ada lagi truk truk yang di bongkar di jembatan timbang Terantang Manuk. Dan komentar Humas RAPP mobil trinton yang bermuatan kayu tersebut bukanlah milik PT RAPP,bahkan budi firmansyah mencontohkan jikalau ada misalkan kita membangun rumah lalu kita memesan pasir apakah itu dan mobil yang membawa pasir tersebut milik kiata,sementara jelas pasir pesanan dan mobil itu bukan milik kita ,artinya apakah milik kita sebutnya jadi sama halnya dengan kejadian mobil trinton yang mengangkut kayu tersebut,kayu itu adalah kita beli jadi urusannya dijalan tentu urusan pihak pemilik mobil.hal ini yang trjadi nah kenapa disebut milik PT rapp,bantahnya “Terkait informasi penahan truk angkutan kayu oleh petugas UPT Dishub Riau di terantang Manuk, sampai saat ini kami belum mendapat informasi dari instansi terkait maupun perusahaan kontraktor” tulis Budi dengan mencantumkan nama Moko.di kemudian hari nanti ada hal serupa mengenai kontraktor yang mengangkut kayu lalu mencantumkan nam RAPP ungkap budi,kiranya dengan penjelasan agar dapat saling di pahami pungkasnya(RI)

Bandar Togel di Riau Diduga Tak Tersentuh Hukum

Faisal Aswan Segera Diganti Gumpita di DPRD Riau Pekanbaru, BN Komisi Pemilihan Umum Daerah Riau akhirnya menetapkan Gumpita, sebagai pengganti antar waktu (PAW) Faisal Aswan yang telah di vonis karena kasus korupsi. Faisal Aswan adalah anggota DPRD Riau dari fraksi Golkar. Menurut Ketua KPU Riau, Tengku Edi Sabli, Jumat (18/1) penetapan Gumpita sebagai PAW Faisal Aswan sudah sesuai dengan undangundang. Dalam pemilu kemarin, Gumpita mendapat suara terbanyak setelah Faisal untuk

Dapil I Riau, yakni dengan 4.827 suara. Di Dapil I Riau, perolehan suara Golkar terbanyak diraih oleh Iwa Sirwani Bibra dengan 11.350 suara. Urutan berikutnya, Faisal Aswan dengan perolehan 6.492 suara sah. Perolehan suara Gumpita, berada di urutan setelah Faisal Aswan. Menurut Edi Sabli, KPUD Riau sudah menyerahkan nama calon pengganti antar waktu sesuai dengan permintaan dari Sekretariat DPRD Riau(lingkon)

Panen Perdana Sayuran Berdaun Lebar DUMAI,BN Gubernur Riau, Rusli Zainal, melakukan panen perdana sayuran berdaun lebar, dilahan seluas 4 hektar di kecamatan Dumai Selatan, Kota DUmai. Penanaman sayuran berdaun lebar, merupakan kerjasama dengan kementrian Singapura, dimana nantinya hasil produksi sayuran berdaun lebar ini akan diekspor ke Singapura dan Malaysia. Rusli zainal, Guberbur Riau memberikan apresiasi atas kerjasama yg dilakukan pemko dumai dengan swasta yang dapat memproduksi sayur dengan memperkerjakan beberapa kelompok tani. dengan

kerjasama ini akan meningkatkan pendapatan dan daya beli masyarakat kita. dengan kedekatan Riau dengan negara Malaysia dan Singapura ini harus dapat dimanfaatkan agar bisa saling menguntungkan. Rusli zainal menambahkan kedepannnya bukan hanya Dumai, diharapkan hampir semua wilayah Riau bisa juga mencontoh dan melakukan kerjasama ini. Sehingga semua petani di Riau bisa ambil bagian dengan proyek ekspor sayur ini. Selain itu, Rusli Zainal juga memberikan bantuan kepada kelompok tani tiga unit Hand Traktor.(lingkon)

Riau,BN Bisnis judi merupakan Usaha menggiurkan yang cepat mendapat untung besar. judi Toto Gelap (Togel) diDumai diduga sudah betahuntahunlamanyamerajalela ditengah kehidupan masyarakat. Bahkan perjudian jenis Togel terselubung tersebut di sinyalir di beberapa Daerah di Riau kinisemakinsubur,sepertidIpekanbaru,Bengkalis,Rohildan Pelalawan,dandiInhusertaKampar,Inhil danSiak.Pantauan media ini seperti di Kota Dumai Bisnis togel sepertinya kian membudaya , meskipun penyakit masyarakat ini telah menjamur(togelterselubungitu_red)tetapi yangnamanya “bandarJudiTogelyangada dikotaDumai sepertinyasemakin berani karena tidakTersentuh Hukum . Dari pantauan dan penelusuran investigasi Wartawan Media ini di dumai Riau, gerak langkah pengusaha judi ( perjudianjenisTogel) kianmodernseiringdengancanggihnya sarana komonikasi lewat Handphon dan internet. Untuk mencari nomor jitu tidak perlu susah susah, cukup dengan pola sederhana , caranya klik saja“WWW.Togel jitu. com dan situs ini memberi impormasi togel yang keluar dan rumus untuk caramencarinomorjitu“sudahlengkapujarpengamat dan pemerhati judi togel di dumai baru baru ini saat bincang bincang dengan BN,. jadi perjudian ini sudah mendunia karena bigbos judi togel adalah di singapore. para pemain yanggemarmenghayaluntukjadi kayamendadaktidaksusah cari rumus. dengan cara online tersebut semakin elegan mempermudah pemain judi togel apalagi untuk memprediksi nomor yang dianggap jitu terang sumber itu yang minta tidak perlu ditulis namanya.. Dari kenyataan dan sudah ada Bandar togel disikat pihak berwajibbelumlamainidiRohil,ternyataBandaryangbenitial Akang setelah dei proses danpihak kepolisian melakukan pengembangan , terungkap bahwa Bandar Besarnya ada bewrada di Jakarta. Dan hasil penjualan yang dihimpun bandar Di Rohil juga disetor ke Bandar Besarnya di Jakarta sebut sumber BN.bukan tidak mungkin Bandar togel di beberapakabupatendankotadiRiaupunyajaringansindikat samaBandarBesardiJakarta.daripengalamanyangtelahlalu lalu, untuk Bandar togel yang kelas kakap tidak pernah terdengar ada lagi yang berhasil ditangkap.yang selalu terdengar dan masuk dalam berita media yang banyak ditangkap adalah Kurir kurir Togel saja ,yang memadati isi Lapas. Makanya para pebisnis judi atau bandar bandar togel terselubung semakin berkembang biak dibeberapa daerah di negeri ini. pertanyaan muncul dari kalangan publik bagai mana sikap serius pihak berawajib untuk memberangus kejahatan togel tersebut ??? kejahatan perjudian ini ,modusnya cukup lewat SMS dari sipembeli nomor togel , diakseskeHPkurirKuriryangdiberdayakanbandar.sehingga cara Permainannyacukuprapidanterakomodirdilingkungan masyarakatujarsumberKoraniniyangjugaselakupengamat dan pemerhati terhadap kejahatan judi togel itu pada BN. Pasukan atau kurir Bandar judi togel ini belum lama ini di dumai , ada yang berhasil di sergap Polisi, dua orang kurir togel iTerselubung itu dijebloskan kebalik trali besi .tetapi Bandar togel bisa saja lolos . di peroleh informasi dua orang kurir togel berinisial RP dan RS berhasil di tangkap di bukit bateremsatu kecamatanDumaitimur,keduanyaditemukan PetugassedangmenghitungUanghasilpenjualanTogelyang akan segera di setor kepada bandarnya yang berinisial PANG.sayangnya Bandar togel yang satu ini berhasil lolos darikejaranpolisi.sementaraRSdanRPsudah diamankandi polsekDumaitimurterangsumberituyangmintatidakditulis

namanya. Diperolehketerangan,diduga BandarJudiTogel ( PANG _red )yang merupakan Bos dari kedua orang kurir JudiTogel tersebut dan tidak dapat diketahui Siapa ? Bandar besarnya diatas Bandar PANG . dari penjelasan dikutip BN , PANG saat mau di tangkap petugas berwajib tepatnya pada awal januari lalu Bandar Togel ini berhasil lolos lari lintang Pukang ketika Hendak di sergap pihak berwajib. Menurut beberapainformasidisebutsebutmasyarakatBukitBantrem pada Media ini, sang Bandar Togel ini,diduga kuat ada kaitannyadenganBandarTogelyangberadadijalanMerdeka Baru . terkait penangkapan kurir judi ini, di duga karena dilaporkanbeberapa anggotawarga diBukitBatremkepada PihakPolisi.pelapordariwargatersebutbenarbenarkesatria dan taat hukum.jikalau tidak dilaporkan , mungkin saja kurir_kurir judi tersebut terus semangkin meraja lela. Menyikapi soal penangkapan terhadap kurir togel tersebut ,timbulAsumsidariwarga sebahagianbesarmenilai “ bahwa oknum warga selaku pihak pelapor pada polisi memang tergolong“Dewa Suci”mungkin juga disinyalir karena tidak senang melihat Pembisnis Togel tersebut mendapat uang banyak diraup dari masyarakat” sementara hanya sebagai penonton saja.ahirnya pebisnis judi togel di lapor ke Polisi.banyak Bandar togel disebut sebut oleh warga belakanganinijumlahnyameningkatdikota Dumai.bandar judi itu disinyalir berada di jalan merdeka baru danBandar Togel yang tergolong bonafit ada katanya tinggal di bagan besar,”tetapi tidak ada warga yang mau dan berani untuk melaporkannya kepolisi ,yach tidak ditangkaplah” Sebut sumber Koran ini yang namanya minta tidak di tulis. DiberbagaipelosokkotaDumaidisinyalirusahajuditogel tumbuh subur. dan tersebar kabar di Dumai , bahwa Bandar Togelyangtergolongomsetnyabesardansudahmulai terkenal ,adaberdomisilididaerahbaganBesarkecamatanbukitkapur Dumai, ada juga beberapa orang Bandar togel itu di jalan Merdeka Baru , di Jaya Mukti , Di Jalan Datuk Laksamana , di DaerahPulauPayungSukajadi,DiBukitBatremDua,diBukit Timah di Jln Sudirman dumai dan juga di gang Sentul jalan PulauPayungsertadijalanDockDumaidandekatEkslokalisasi WTSbaganbesar.yanghinggasaatinibelumterjeratHukum yangberlakukarenabelumadayangberanimelaporkannya secarajentlemenkepadaPolisi.karenaitu Berbagaikalangan di Dumai belakangan ini semakin kawatir bahwa daerah Dumai kian hari bisa jadi Kota Judi“ karena Bandar JudiTogel terselubung terus bertambah tidak tersentuh Hukum.. “apakah kasus ini terus di biarka?, kapankah ? ada tindakan refresif dari pihak berkompeten ? Kurirtugeldibukitbatremduayangditangkappolisiawal januari lalu , kini kedua nya sudah meringkuk di sel Polsek DumaitimurberhadapandenganprosesHukum.sementara Bandar judi yang berinisial PANG, tidak diketahui dimana rimbanya. Menurut impormasi terbaru diperoleh BN , ketika Saat Bandar judi tersebut hendak disergap petugas diduga sudah ada gerak dan firasat tanda tanda bakal ada sesuatu . Sebabdisaatpetugasdatang,PANGdenganreflekgerak kilat terusberembuslintangpukang,petugasberwajibpunhanya berhasil menangkap dua orang kurirnya RP dan RS.besrta barangbuktiuangtunaidanHPbeberapaunit.Disebutsebut warga setempat Dompet dan KTP sang Bandar judi togel itu karenatinggalterletakdiatasmejasehinggamerupakanjadi barangbukti.sampaiberitainidieksposKAPOLRESTADumai belum berhasil dikonfirmasi BN. Persoalannya banyak kalangan bertanyaTanya”kapanwaktunyaBandarjuditogel dikotaDumai bisadapatdiberangus”?kitatunggusaja!(RDS)

21 - 28 JANUARI 2013 | EDISI 343 | THN KE-VIII

Ditresnarkoba Polda Sumut Musnahkan Narkotika Rp1,5 M Medan, BN Direktorat Reserse Narkoba [Ditresnarkoba] Polda Sumut memusnahkan barang bukti narkotika hasil tangkapan Desember 2012 hingga Januari 2013 senilai Rp.1,5 miliar yakni shabu sabu, ganja,pil ekstasi, Jumat[18/1].. Bukti narkoba yang dimusnahkan pihak kepolisian bersama perwakilan Kejatisu tersebut,adalah hasil tangkapan Ditresnarkoba Poldasu yang berhasil mengangkap 14 tersangka yang terlibat 11 kasus.. Barang bukti yang dimusnahkan berupa 1.384,78 gram shabu secara keseluruhan yang kemudian disishkan 147,58 gram untuk kepentingan penyelidikan Labfor dan Pengadilan Negeri. Kemudian ganja sebanyak 2.080 gram dan dari jumlah itu dikirim ke Labfor dan Pengadilan Negeri 81 gram. Untuk jenis pil ekstasi dimusnahkan sebanyak 189 butir dari jumlah tersebut 18 butir dikirimkan ke Labfor dan Pengadilan Negeri. Menurut Direktur Reserse Narkoba Poldasu Kombes Pol Toga Habiansaran Panjaitan kepada wartawan bahwa dalam pemusnahan barang bukti tersebut petugas kepolisian bersama perwakilan Kejatisu, Pengadilan Negeri, Balai POM,LSM, melakukan pemusnahan dengan cara membelender sha-

bu dan ekstasi serta pembakaran ganja yang diperkirakan senilai Rp.1,5 miliar. Ringannya hukuman yang dijatuhkan kepada pengedar dan Bandar oleh putusan pengadilan terkesan tidak ada memberikan efek jera untuk mengulangi perbuatannya. Bahkan hukumna ada yang lebih ringan dari orang yang pemakai. "Keputusan hukuman itu ada pertimbangan dan ketentuan dari surat edaran Jampidum terhadap terdakwa.Makanya pertimbangan itu melihat dari banyaknya barang bukti yang ditangkap dari terdakwa.Maksimal hukumannya seumur hidup,kalau barang buktinya 0,5 hukumannya minimal 4,5 sampai 6 tahun kurungan penjara", ujar perwakilan Kejatisu. Sementara itu Toga mengatakan juga bahwa keterbatasan anggaran menjadi kendala dalam memutuskan mata rantai sindikat jaringan narkoba. Dalam suatu pengungkapan, anggaran hanya diberikan Rp.13 juta sedangkan dana yang dikeluarkan melebihi anggaran yang ada. "Satu kasus kita hanya diberikan Rp.13 juta. Saya rasa ini sangat minim,Rp.13 juta mau dibawa kemana? Bayar informan saja Rp.1 juta sampai Rp.2 juta. Itupun tangkapannya kecil",kata Toga dalam sambutannya saat pemus-

Sembilan Tersangka Curanmar Ditangkap Medan, BN Pencurian kendaraan bermotor [curanmor] yang selama ini meresahkan masyarakat di kota Medan, telah berhasil dibongkar polisi dan , polisi berhasil menangkap Sembilan tersangkanya dan tujuh lainnya masih diburon. Sebagai barang buktinya disita empat unit sepeda motor, 19 lembar STNK, 19 keping plat BK, sejumlah sparepart hasil curian, kunci T, delapan HP,dan dua buku BPKB. Menurut Wakil Direktur Reserse Kriminal Umum[Ditreskrimum] Poldasu AKBP Wawan Munawar didampingi Kasubdit I AKBP Yusuf Saprudin,dan Kasubdit III Umum AKBP Andry Setiawan kepada wartawan, Selasa[15/1] bahwa kesembilan orang itu ditangkap berdasarkan 3 LP pencurian sepeda motor dalam sepekan terahkir dan kasus ini sudah dilakukan penyelidikan selama sebulan dan bekerjasama dengan Subdit I Keamanan Negara[Kamneg] dan Subdit III Umum Jahtanras Poldasu. Menurut Wawan dalam aksi pencurian sepeda motor para tersangka memiliki peran masing masing.Ada yang bertugas sebagai eksekusi, pengintai, penadah dan pengorder. "Tersangka Kar dan AD otak pelaku. AD juga yang mengorder dan membawa sepeda motor curian ke Kutacane Aceh. Sebagian besar sepeda motor tersebut dibawa kesana, tapi ada juga yang dicincang atau disate[jual terpisah]",jelas Wawan. Dari pemeriksaan sementara mereka sudah beroperasi selama tujuh bulan, sebagian diantaranya diketahui sebagai geng motor. "Dari hasil penyelidikan ,kita menyimpulkan aksi anarki geng motor sudah menjurus kepencurian kendaraan bermotor.Ini akan terus dikembangkan dan club geng mana yang terlibat kasus yang sama. Bahkan sindikat ini sudah pemalsu surat surat kendaraan dan plat nomor kendaraan",ujarnya. Juga disebutkan Wawan bahwa sindikat curanmor ini juga melakukan kejahatan dengan mengawinkan STNK asli dengan kenderaan curian lainnya."Artinya nomor fisik kendaraan diketok dan disamakan dengan nomor yang di STNK agar harga jual lebih tinggi. STNK yang kita sita asli. Ini diduga hasil kejahatan penipuan dan Disebutkannya,pihaknya juga mencurigai adanya kejahatan penadah sparepart hasil kejahatan disepanjang jalan ring road dan beberapa titik penjualan sparepart bekas bekas di kota Medan. "Kita akan selidiki , jika terbukti kita tindak",ujarnya seraya mengatakan masyarakat yang menjadi korban diharapkan untuk berkoordinasi dengan untuk mencari barang bukti nomor plat kendaraan yang tidak menutup kemungkinan ada terungkap. Adapun kesembilan yang tertangkap adalah Ajudan Deski[41], Kariadi[21], Abdul Muis alias Andi[24], Chefri Hamonangan[24], Ridwan Suganda[26], Verri Antoni[37], Perijal[35], Ahmad Fauzi[35], Zulfen Rivai[47]. Sementara itu, tujuh yang belum tertangkap Ahong, Deli, Temen, Black, Roby Juanda, Togu, Mr X. [HZA]



Direktur Reserse Narkoba Polda Sumut, Kombes Pol Toga Habinsaran Panjaitan (ketiga kanan) didampingi pihak Pengadilan dan Kejaksaan menyulutkan api ketumpukan ganja kering ketika memusnahkan barang bukti, di Mapolda Sumut, Medan, Jumat (18/1). Pihak kepolisian memusnahkan 1,2 kg sabu-sabu, 1,99 kg ganja kering dan 171 butir ekstasi dari 14 tersangka.

nahan narkoba dihalaman Ditresnarkoba Poldasu Medan. Bahkan anggaran minim itu menjadi kecemburuan miris dirasakan Toga bila membandingkan dengan anggaran Badan Narkotika

Nasional[BNN] yang mencapai Rp.68 juta per kasus. Dan Toga berharap agar pemerintah karena tidak hanya menyangkut biaya operasinal melainkan keperluan lain untuk menambah kekuatan di

lini perlengkapan seperti sarana transportasi dan alat sadap. Naumu demikian Toga tetap mengakui hal itu tidak menegcilakn semangat dari para personil Ditresnarkoba Poldasu. [HZA]

Satpam SPBU Katamso Krisis Dibacok Medan, BN Petugas jaga malam [Satpam] di sebuah SPBU Jalan Brigjen Katamso Medan, Saut Muliya Lumbantobing[27] warga Jalan Pelajar Gang Keliling Medan, yang dipekerjakan PT Wira Pradana Mukti[WPM] di SPBU Jalan Brigjen Katamso Medan, kritis dibacok perampok di SPBU itu, Senin[14/1] sekitar pukul 02.45 WIB. Informasi yang diperoleh menyebutkan, dihari kejadian korban tugas jaga malam bersama rekannya Rudi[30] di SPBU Brigjen Katamso. Sewaktu Rdi tidur di pos jaga dan korban patrol disekitar lokasi. Tiba tiba lima pemuda berkendaraan tiga unit sepeda motor dating ke SPBU itu dengan maksud melakukan perampokan. Melihat itu, Saut yang baru tiga bulan bekerja disitu berusaha menangkap pelaku dan terjadi perkelahian kata SK Gultom Pengawas Securiry PT WPM. Menurutnya pelaku membawa kelewang, dan gunting dan menikamkannya kepada korban dibagian perut kanan kiri, tangan kanan, bahu dan kepala persisnya dijidat. Setelah korban bersimah darah dan

tak berdaya, kelima pelaku batal melakukan perampokan dan meninggalkan lokasi."Setelah ditikam,korban memanggil temannya Rudi yang tidak jauh dari tempat kejadian dan Rudi dating langsung memberitahukan warga sekitarnya. Menurut SK Gultom, korban dibawa dikerumah sakit Esthomihi dengan mobil pick up dan tubuh korban terdapat luka tusukan sebanyak lima liang, tapi kemudian dibawa ke RSU Dr Pirngadi Medan dan ditangani tim dokter dan menjalani operasi diruang instalasi gawat darurat. "Korban belum lagi bias dijenguk kerabatnya karena baru saja dioperasi",kata Kabag Humas RSU Dr Pirngadi Medan, Edison Perangin angin. Kapolsekta Medan Kota Kompol Sandy Sinurat mengatakan pihaknya masih melakukan pengejaran terhadap pelaku. Informasi terahkir yang diterima, Kamis[16/1] sekitar pukul 02.30 WIB dinihari, tiga dari lima orang yang mau merampok SPBU 11.201.103 di Jalan Brigjen Katamso Medan, menyerah-

kan diri ke Polsekta Medan Kota, mereka membawa bukti gunting pagar. Mereka adalah Budiman[20] warga Jalan Bakti Gang Damai Kecamatan Pancurbatu, Feri Irawan[26] warga daerah yang sama, Abdul Karim[20] warga Desa Baru Kecamatan Tuntungan. Menurut Budiman mereka sudah 4 kali berencana untuk merampok SPBU itu bersama oknum yang kena Bacok Saut Mulya Lumban Tobing.Rencana itu dibuat Budiman dan mengajak Rudi menyusun rencana dan juga rekan lainnya Karim bersama Roy dan Putra yang masih buron. Dikatakannya Saut sendiri minta jangan ada pengurusakan ATM dan minta bermain cantik,namun tidak diikuti Budiman. Dia ingin merusak ATM menggunakan linggis dan gunting pagar serta martil. Dan kemudian terjadilah adu mulut antara Budiman dengan pelaku dan berahkir dengan pembacokan terhadap korban. Budiman menuturkan saat menganiaya korban dia memukul dan menikannya dengan linggis. Dia juga pernah bekerja sebagai security selama lima bulan. [HZA]

Ditnarkoba Poldasu Razia Tempat Hiburan Malam Medan, BN Direktorat Narkoba Polda Sumut [Dirnarkoba] yang dipimpin langsung Direktur Narkoba Polda Sumut Kombes Pol Drs Togi H Panjaitan dibantu Kasat Narkoba Polsekta Medan Kompol Donny Alexander SIK ,Minggu[13/1] melakukan razia ditempat hiburan malam yakni M3, X-Tree dan Barcelona. Sebelum melakukan razia tersebut, gabungan dari personil Ditnarkoba Poldasu, Sat Narkoba Polsekta Medan, Provost Poldasu dan Provost Polsekta Medan, menggelar apel terlebih dahulu dilapangan Merdeka Medan. Kemudian mereka melakukan razia ditempat hiburan M3 dan X-Tree dan Barcelona. Dari razia itu,puluhan personil tidak menemui narkoba, namun saat di Barcelona mereka menemukan seorang pengunjung yang mem-

bawa senjata air soft gun diruang KTV 8 lantai III. Pemiliknya Abdul Razak Lubis[20]. Keterangan diperoleh bahwa Abdul Razak Lubis diamankan oleh Bripka Kely dari satuan narkoba Polsekta Medan dari ruang KTV 8 lantai III. Abdul Razak Lubis mengatakan bahwa izin memakai air soft gun itu ada izinnya saat dia digiring petugas keluar dari Barcelona, dan dibawa ke Mapolsekta Medan guna dimintai keterangan lebih lanjut. Menurut Razak , dia membawa air soft gun itu hanya untuk menjaga diri saja. Sementara itu Kombes Pol Drs Togi H Panjaitan mengatakan kepada wartawan bahwa hal ini dilakukan untuk mempersempit ruang gerak peredaran narkotika dan obat obat terlarang. Sementara itu ditempat terpisah bersama personil Polri dan Babinsa Kodam I/

BB, puluhan warga Jalan Bahagia Kelurahan Titi Rante Kecamatan Medan Baru membakar sebuah lapak yang kerap dijadikan tempat penggunaan narkoba, Senin[14/1] dan satu orang yang memakai narkoba ditangkap dan dua lagi kabur dengan melompat ke sungai dekat lokasi tersebut. Menurut Kepala Lingkungan 7 Titi Rante, Bahtera Sitepu, selama ini warga resah dan khawatir anak anak disekitar itu terpengaruh perbuatan orang orang yang memakai narkoba dilokasi tersebut. Setelah berembuk warga bersama seorang polisi yang tinggal disekitar itu dan bintara Kodam I/BB melakukan penggerebekan dan sejumlah pemuda disekitar lokasi berhamburan dan hanya satu orang yang ditangkap dan kemudian diserahkan ke Mapolsekta Medan Baru. [HZA]

Wanita Cacat Fisik Ditangkap Polisi Saat Pesta Sabu Bersama Mantan Pacar

AYEN alias Yeni (29) warga Dusun Banjaran, Pasar II, Desa Balai Kasih bersama Edi Tuah Sitepu alias Tuah (44) warga Dusun Mentengger, Desa Lau Mulgap Kecamatan Selesei, Kabupaten Langkat ini harus mempertanggung jawabkan pebuatanya kepada pihak berwajib yang tertangkap tangan dan terbukti melanggar melawan Hukum yang kedapatan mengkonsumsi Narkoba jenis Sabu-sabu. Kedua Orang tersangka yang terduga pasangan selingkuh ini di tangkap Polisi saat asik mengkonsumsi Sabu-sabu Kamis (17/1) sekira pukul 14.00 WIB di salah satu kamar rumah milik Warga di Pasar II Padang Cermin, Kecamatan Selsei, Kabupaten Langkat, sedangkan petugas mendapatkan Ayen alias Yeni bersama Edi Tuah Sitepu alias Tuah bersama barang bukti yang sedang di gunakan. Dari keterangan diperoleh BN di

kepolisian menyebutkan ,�bahwa Edi Tuah Sitepu merupakan kaki tangan bandar sabu di wilaya Tanjung Kriahan kab Langkat, danTuah merupakan target pihak kepolisian terkait peredaran sabusabu yang selama ini cukup di kenal sangat licin dari kejaran petugas Kepolisian. Tertangkap nya kedua tersangka berdasarkan Informasi yang di bantu masyarakat sekitar, yang mana Saat itu Tuah menelepon Yeni untuk mengkonsumsi sabu-sabu, dan ajakan tuah ternyata di turuti Yeni hingga akirnya Tuah menjemput mantan pacar nya itu ke salah satu warung bakso dengan mengendarain sepeda motor. Selanjutnya Tuah pun meminta uang Yeni sebesar 350 ribu rupiah untuk membeli paket Sabu-sabu dari salah seorang bandar berinisial M yang berada di Tanjung keriahan kab Langkat, setelah barang haram tersebut di

belinya, maka Tuah pun mengajak Yeni di suatu tempat unu menikmati sabusabu di salah satu rumah temannya. Namun ketika kedua pasangan tersebut tengah menikmati sabu-sabu di atas ranjang, petugas Sat-Narkoba Polres Binjai yang mendapatkan informasi langsung menuju ke lokasi rumah yang di jadikan tempat pesta sabu, sesampai nya di lokasi Polisi pun langsung mendobrak pintu kamar tersebut hingga menemukan Ayen alias Yeni bersama Edi Tuah Sitepu alias Tuah lagi asik menikmati Sabu-sabu di atas ranjang tempat tidur. Didalam kamar di atas ranjang Polisi juga menemukan alat hisap berupa bong yang mereka gunakan untuk mneikmati Sabu-sabu, dan selanjutnya membawa Kedua tersangka ke Komando Sat-Narkoba Polres Binjai untuk di lakukan pemeriksaan secara intensif yang selanjutnya di lakuka

pengembangan. Kepada Kru koran ini, Kasat Narkoba Polres Binjai AKP Achiruddin mengakui ,�bahwa saat di lakkan pengerebekan keduanya memang berada di atas tempat tidur dan sedang menikmati sabu-sabu sambil bersandar, dan kedua tersangka di tangkap tidak melakukan perlawanan, dan kita terus melakukan pengembangan dan mengejar Bandar nya, terang AKP Achiruddin Sedangkan Yeni saat berada di Ruang pemeriksaan Sat-Narkoba Polres Binjai terlihat terus menangis sambil menutupi wajahnnya dan mengatakan ,� Aku menyesal sekali, saat itu aku hilaf dan baru sekali ini mau pakai sabu-sabu, dan tolong jangan bawa-bawa perbuataku ini dengan rumah tanggaku, kasihan dengan suamiku sebab dia tidak tahu apa-apa tentang ini semua,katanya yang terlihat terus menangis. (Fris/007)

Kapoldasu: Berkas Pidana Pemilu Siap Dalam Sebulan Medan, BN Kapolda Sumut[Kapoldasu] Irjen Pol Wisjnu Amat Sastro mengatakan kepada wartawan,Selasa[15/1] usai memeriksa kesiapan personil Polri menjelang Pilgubsu yang akan berlangsung pada 7 Maret 2013, bahwa kesiapan polisi mengawal seluruh tahapan Pilgubsu bukan hanya dalam hal pengamanan tapi juga menindaklanjuti laporan temuan pidananya. "Kalau nanti pidana serahkan ke kita. Paling lama berkasnya satu bulan jadi",katanya. Menurutnya Poldasu beserta jajarannya siap mengawal seluruh tahapan pilgubsu, dan kalau dihitung mundur tinggal 47 hari lagi,jelasnya. Untuk itu semua kesiapan jajarannya dicek dan alhamdullilah Polresta Medan sudah siap, dan juga ditegaskannya seluruh tahapan pilgubsu harus diwaspadai dan karenanya Wisjnu akan dating kesetiap Polres untuk melihat kesiapannya. Hal ini dilakukan karena pihaknya tidak ingin nanti pontang panting menangani keamanan selama tahapan pilgubsu. "Siapapun nanti yang terpilih menjadi pemimpin Sumut,dialah yang terbaik memimpin Sumut selama lima tahun kedepan",,katanya. Dan juga.Wisjnu mohon kepada tokoh masyarakat dan insane pers turut membantu dalam pengamanan pesta demokrasi . Sementara itu Pangdam I/BB Mayjen Lodewijk F Paulus mengatakan bahwa pengamanan Pilgubsu nantinya diambil dari berbagai satuan baik TNI-AD, TNI-AU, TNI-AL yang ada di Sumut,dan 20 persen dari personil yang dimiliki untuk pengamanan Pemilukada. "Sifatnya hanya membantu personil kepolisian saja"kata Lodewijk saat usai peresmian masjid Al-Ihklas di Jalan Timor Medan,Selasa[15/1] Khusus untuk Kodam I/BB ada 8 batalyon di Sumut. Prajurit prajurit dari situlah yang kita libatkan untuk membantu kepolisian. Sebagai langkah persiapan Kodam I/BB akan melaksanakan operasi yustisi atau penegakan hukum di internal mereka,agar seluruh personil tidak menemui kendala dalam pengamanan tersebut. "Kita berharap tidak ada masalah, tapi kita siap diminta atau tidak diminta polisi. Seperti kemarin, kita juga sudah bersinergi dengan kepolisian dalam menangani demo BBM", kata Lodewijk. [HZA]

Polisi Bingung Cari Mantan Bupati Palas Basyrah Lubis Medan, BN Direktorat Reserse Kriminal Khusus[Ditreskrisus] Poldasu kebingungan mencari keberadaan mantan Bupati Padang Lawas Basyrah Lubis .Alasannya karena tersangka korupsi itu kabur dari pengawasan kepolisian.Bahkan Basyrah dituding berhasil membodohi polisi dengan mengirimkan surat sakit pada saat jadwal pemeriksaan lanjutan, Kamis[3/1]. Juga pengacara tersangka kasus dugaan korupsi penyalahgunaan Dana Alokasi Khusu[DAK] dan Dana Alokasi Umum[DAU].untuk pembangunan prasarana perkantoran [proyek multi years] yang merugikan Negara Rp. 6.048.827.227,73 itu ikut mencari keberadaan Basyrah Lubis. Menurut Direktur Direktorat Reserse Kriminal Khusus[Direskrimsus] Poldasu Kombes Sadono Budi Nugroho, bahwa pengacara tersangka selaku penjamin pada waktu itu memberikan surat sakit ke Poldasu juga ikut mencarinya dengan jalur mereka. Disinggung apakah ada diberikan tenggang waktu agar tersangka menyerahkan diri, Sadono menjelaskan tidak ada batas waktu,jika ketemu langsung ditangkap. "Nggak perlu tenggang waktu. Sekarangpun sedang dicari, ketemu langsung ditangkap",tegasnya. Sebelumnya Sadono menyatakan pihaknya tidak mau buru buru menahan Basyrah,karena pemeriksaan dinilai belum selesai."Gampang itu soal menahan.Lihat saja Andi Malaranggeng. Meskipun dia sudah tersangka namun belum ditahan kan. Yang pasti jika nanti Basyrah Lubis dating untuk diperiksa dan jika kita rasa sudah kuat untuk dilakukan penahanan,kita akan langsung menahannya",jelas Sadono. Sadono sangat yakin dan percaya diri dengan tegas langsung menahan Basyrah Lubis apabila memenuhi panggilan penyidik. Saat itu Sadono mengungkap alas an menahan tersangka yakni dikhawatirkan melarikan diri dan menghilangkan barang bukti. Namun usai diperiksa pada 26 Desember 2012, Basyrah batal ditahan dengan alas an pemeriksaan yang dilakukan penyidik belum selesai. Dalam kasus ini polisi telah menetapkan 5 tersangka yakni mantan Bupat Palasi Basyrah Lubis, mantan Kadis PU Palas, Chairul Windu, Pejabat Pembuat Komitmen Abdul Hamid Nasution, Bendahara Umum Daerah Paruhum Daulay dan Ketua DPRD Palas HM Ridho.[HZA]

Perampokan Terjadi di PT Kimia Farma Medan, BN Perampokan terjadi pada Senin[14/1] sekitar pukul 02.00 WIB dikantor PT Kimia Farma Jalan Sisingamangaraja Km 6,8 Medan, dengan terlebih dulu mengikat penjaga malamnya atau Satpam dikantor tersebut. Dan menurut satpam perampok sekitar lima orang bersenjata api dan berhasil menggasak uang dibrankas Rp.141 juta. Satpam yang bertugas malam tersebut yakni Joko dan Mawardi, kelima orang perampok itu tiba tiba masuk dan menodongkan senjata api guna menunjukkan dimana brankas berada. "Awalnya dari lantai bawah namun brankas tidak ditemukan, kemudian perampok naik kelantai II dan setelah menemukannya mereka mengikat satpam dengan lakban di pos",kata Mawardi dan Joko setelah diperiksa di Mapolsek Patumbak, Senin[14/1] siang. Dikatakannya , isi uang didalam brankas diketahui jumlahnya setelah karyawan dating pagi harinya. "Jumlahnya sebanyak Rp.141 juta. Pelaku diperkirakan memakai mobil.Kami dengar suara statenya",ungkapnya. Setelah pelaku kabur, Mawardi dan Joko berusaha melepaskan ikatannya dan mereka segera melaporkannya kepada atasannya. "Kami jaga sengaja mematikan lampu dan gerbang ditutp.Hanya TV yang hidup. Tiba tiba pelaku muncul dan menodongkan senjata api. Kami perkirakan pelaku masuk dari pintu belakang,karena dari pintu depan tidak ada kedengaran suara orang melompat pagar karena pintu pagar dikunci",jelasnya. Menurut Kanit Reskrim Polsek Patumbak AKP Atopan Silitonga ,pihaknya sudah memeriksa dua saksi korban dan empat karyawan. Dan dijelaskannya pihaknya bersma Polresta Medan sudah membentuk tim untuk mengungkap kasus ini. [HZA]

21 - 28 JANUARI 2013 | EDISI 343 | THN KE-VIII

Bupati Sergai Buka Kejuaraan Seni Gerak Junior Antar Satlat dan Eksebisi Tarung Drajat 2013 Perbaungan, BN Bupati Serdang Bedagai (Sergai) Ir.H.T. Erry Nuradi, MSi diwakili Sekdakab Drs. H. Haris Fadillah, MSi secara resmi membuka kejuaraan seni gerak junior antar satuan latihan (satlat) yang memperebutkan piala Bupati Sergai dan eksibisi tarung derajat tahun 2013 di Wisma Juang 45 Kelurahan Simpang Tiga Pekan Kecamatan Perbaungan, Minggu (13/1). Turut hadir dalam acara tersebut Ketua DWP Sergai Ny. Hj. Imas Haris Fadillah, mewakili unsur FKPD Sergai, Kepala Dinas Pariwisata Kebudayaan, Pemuda dan Olahraga, Pengurus Keluarga Olah Raga Tarung Derajat (KODRAT) Sumut, Camat Perbaungan dan Bintang Bayu, Pengurus KODRAT Sergai binaan Ketua TP PKK Ny. Hj. Evi Diana Erry, Muspika Perbaungan, Ketua Padepokan Siliwangi Kapten Asma Putra, Ketua Pengkot dan Pengkab KODRAT peserta kejuaraan, para juri dan para petarung serta tamu undangan lainnya. Kejuaraan Seni Gerak Junior antar satlat ini diikuti oleh 18 tim putra putri yang masing-masing regu terdiri dari 4 orang. Keempat belas tim yakni 4 tim dari KODRAT Sergai, 4 tim dari KODRAT Pematang Siantar, 1 tim dari KODRAT Tebing Tinggi, 6 tim dari KODRAT Medan, 1 tim dari KODRAT Karo dan 2 tim dari Universitas Negeri Medan. Sementara untuk eksebisi diikuti oleh 3 kelas putra dan 1 kelas putri dari tingkatan kurata IV s/d kurata VI. Bupati Erry Nuradi dalam sambutan tertulisnya yang dibacakan Sekdakab Drs. H. Haris Fadillah, MSi mengemukakan bahwa melalui olahraga dapat menangkis bahkan menyingkirkan hal-hal negatif yang dapat merusak mental generasi muda seperti narkoba, perkelahian, dan kasus genk motor yang sedang hangat dibicarakan saat ini. Oleh karenanya, dengan memasyarakatkan olahraga di kalangan muda diharapkan mampu mewujudkan generasi muda yang berkualitas di tengah-tengah banyaknya tantangan dan pengaruh negatif yang dihadapi. Salah satunya adalah olahraga seni ilmu bela diri tarung derajat ini yang merupakan perpaduan sinergis antara aspek olah raga, seni dan ilmu bela diri yang mengutakamakan 5K yakni kekuatan, kecepatan, ketepatan, keberanian dan keuletan. Kepada para atlet dan petarung yang akan mengikuti kejuaraan diucapkan selamat bertanding dan Bupati mengharap agar para atlet yang keluar sebagai juara dapat meneruskan perjuangan menjadi juara pada kejuaraan di tingkat provinsi maupun nasional. Ketua Panitia penyelenggara kejuaraan Deni R. Suganda sebelumnya melaporkan bahwa tujuan utama diadakannya kegiatan ini adalah demi memperkenalkan cabang olahraga tarung derajat kepada masyarakat Kabupaten Sergai sebagai olahraga asli Indonesia. Kemudian untuk mempererat tali silaturahmi sesama pengurus KODRAT Sumut, memberikan pengalaman teknik-teknik petarungan, dan mempersiapkan sedini mungkin atlit petarung Kabupaten Sergai untuk menyongsong Porkab, Porda dan PON. Keluar sebagai juara I dalam kejuaraan yang berlangsung selama sehari penuh yakni untuk seni gerak beregu putra dari Satlat Universitas Negeri Medan, juara II Satlat Ulil Albab Pematang Siantar dan juara III dari Satlat MAN 2 Model Medan. Kemudian untuk seni gerak beregu putri juga dimenangkan oleh Satlat Unimed Medan sebagai Juara I, satlat SMP Negeri 10 Pematang Siantar sebagai Juara II dan juara III dari Satlat SMK Negeri Pantai Cermin Kabupaten Sergai. Untuk tim favorit dimenangkan oleh tim putri Ulil Albab dari Pematang Siantar. Masing-masing tim juara terbaik I mendapatkan piala tetap Bupati Sergai dan medali serta uang pembinaan, sedangkan juara II dan III mendapatkan medali serta uang pembinaan.(Ibnu)

Warga PTP2WKSS Tebing Tinggi Dapatkan Binaan Tebing Tinggi, BN Warga Binaan Program Terpadu Peningkatan Peranan Wanita Menuju Keluarga Sehat Sejahtera (PTP2WKSS) yang terdiri dari Pengurus dan seluruh kader PKK kelurahan Pasar Baru, Kecamatan Tebing Tinggi Kota, Sumatera Utara, hadiri acara Pembinaan Warga PTP2WKSS diaula Kelurahan Pasar Baru, dijalan RSU Kumpulan Pane, Jum'at/11/1/2013 sekira pukul 10.00 WIB siang. Acara diawali dengan membaca doa yang dibacakan oleh ustad Abdul Khalil dan dilanjutkan dengan menyanyikan lagu Mars PKK yang dipimpin oleh dirijen, Lindawati Koto. Henni Efrida mewakili dari BPMK dalam kata sambutannya mengatakan,"masih banyak lagi pelatihan pelatihan yang akan nantinya akan diberikan kepada warga kader PKK Kelurahan Pasar Baru,berupa pelatihan Kristik (sulam menyulam),pembuatan Tudung saji,masakmemasak,salon (kecantikan dan tata rias )serta jahit menjahit. Gabena Marapusuk mewakili PKK Kota Tebing Tinggi mengatakan dalam kata sambutannya,"Agar seluruh kader PKK Kelurahan Pasar Baru khususnya agar benar benar memanfaatkan kesempatan yang sangat positif ini,agar nantinya ilmu yang sudah didapatkan dari pelatihan menjahit ini,dapat terus dikembangkan sehingga dapat menambah Penghasilan pendapatan keluarga. "Kegiatan pelatihan menjahit pakaian yang dilaksanakan diaula kelurahan Pasar Baru, baru saja selesai terlaksana.Dimulai dari 3 bulan yang lalu.Acara ini sekaligus acara penutupan pelatihan menjahit bagi warga binaan PTP2WKSS yang juga kader kader PKK kelurahan Pasar Baru yang mengikuti pelatihan sebanyak 10 orang. Mereka diberikan pelatihan secara gratis dan juga berupa mesin jahit ,alat-alat dan bahan perlengkapan menjahit dan kain.Hasilnya mereka sudah dapat menjahit baju sepasang seragam PKK nya masing-masing dan sepasang baju busana muslim serta celana dan baju kelelawar." Lebih lanjut dikatakannya," Ini semua berkat perhatian pemerintah kota yang sangat serius dalam merealisasikan visi dan misi kota Tebing Tinggi,salah satunya memberikan pengetahuan melalui pelatihan kerja untuk meningkatkan sumber daya manusia (SDM) warganya demi terwujudnya program "one village,one product" sehingga warga menjadi berdaya dan selanjutnya diharapkan warga belajar dapat mengembangkan pengetahuannya sehingga jadi mandiri. Mengingat kota Tebing Tinggi merupakan kota Transit dan jasa.Yang penting warga belajar serius dan yakin dalam mengikuti pelatihan,mudah-mudahan pasti bisa dan mendapat manfaatnya."papar Lurah Pasar Baru,Maya Soraya S.SOS,MSP dengan ramah kepada Dikonews diruang kerjanya. Salah seorang peserta pelatihan,Pipit (30) mengatakan kepada wartawan" ianya merasa senang dapat mengikuti pelatihan menjahit.karena baru kali ini mendapat kesempatan mengikuti pelatihan yang diselenggarakan diaula kelurahan. Awalnya ia tidak yakin bisa menjahit,tapi setelah mengikuti pelatihan ini,"saya bersyukur sekarang sudah menyelesaikan beberapa pasang pakaian. Kebetulan instruktur yang melatih kami juga warga disini yang dikenal warga sudah Profesional dibidangnya. Sehingga dengan waktu yang singkat ini kami sekarang sudah pandai menjahit baju kami sendiri masing-masing." Turut hadir dalam acara itu,Ketua PKK Kota Tebing Tinggi yang diwakili Bagena Marapusuk beserta rombongan,Ketua PKK Kecamatan Tebing Tinggi Kota,Lurah Pasar Baru,Maya Soraya S.SOS,MSP dan seluruh Kader PKK ,Instruktur/Pelatih,Lindawati Koto dan warga binaan PTP2WKSS kelurahan Pasar Baru. (Der).

Jelang Pilgubsu 7 Maret 2013

Bupati Sergai Minta PNS Tetap Bersikap Profesional dan Proporsional

Bupati Sergai Ir. H.T. Erry Nuradi, MSi menyampaikan arahan dan bimbingan kepada jajaran PNS Pemkab Sergai pada upacara hari Kesadaran Nasional bertempat di halaman apel Kantor Bupati Sergai di Sei Rampah, Kamis (17/1).

Sei Rampah, BN Menyambut pemilihan umum Gubernur Sumatera Utara (Pilgubsu) yang akan dilaksanakan pada 7 Maret mendatang, Bupati Serdang Bedagai Ir. H.T. Erry Nuradi, MSi minta kepada seluruh jajaran PNS Pemkab Sergai untuk tetap bersikap profesional dan tidak berpihak kepada golongan manapun dengan

tetap mengutamakan kepentingan masyarakat. Oleh karenanya, PNS sebagai pelayan masyarakat harus dapat menempatkan diri pada posisi yang terbaik dalam memberikan teladan sekaligus pembelajaran politik di tengah-tengah masyarakat. Hal itu ditegaskan Bupati Sergai H.T. Erry Nuradi di hadapan

ratusan PNS Pemkab Sergai pada upacara hari kesadaran nasional pertama tahun 2013 yang dilaksanakan di halaman kantor Bupati di Sei Rampah, Kamis (17/1). Lebih lanjut dikemukakan Bupati Erry Nuradi bahwa PNS tidak boleh berlaku diskriminatif di tengah-tengah realitas politik yang berbeda karena keberagaman dan per-

Bupati Langkat Ajak Masyarakat Lestarikan Seni Budaya Bangsa Langkat, BN Kamis (17/1), seluruh jajaran Pemkab Langkat bersama dengan seluruh lapisan masyarakat merayakan Hari Jadi Kabupaten Langkat ke- 263. berbagai macam kegiatan dilaksanakan untuk memeriahkan perayaan tersebut, diantaraanya melaksanakan kegiatan bakti sosial, pagelan seni dan budaya, pameran pembangunan, lomba karya tulis untuk para wartawan, mahasiswa, pelajar, PNS dan masyarakat umum, perlombaan olahraga seperti gerak jalan dan bola volley serta festival kuda kepang dan festival lagu- lagu pop Karo, Melayu dan Batak. Yang menarik, perayaan tahun ini begitu sangat meriah. Hal ini tentu tidak terlepas dari positifnya penilaian masyarakat terhadap kepemimpinan Bupati dan Wakil Bupati H. Ngogesa Sitepu- Budiono. Buktinya, pembangunan yang merata terus dilaksanakan dan dilanjutkan, lehidupan masyarakat yang religius terus dijaga, seni budaya terus dilestarikan, pendidikan dan kesehatan masyarakat tetap diutamakan serta pembinaan generasi muda juga terus diperhatikan. Selain itu, ketertiban dan keamanan tetap dijaga dan diprioritaskan. Hal itu tentu tidak dilaksanakan sendiri, tapi dengan menggandeng pihak- pihak terkait. Yang tidak kalah menariknya, perayaan hari jadi itu juga diwarnai dengan

festival lagu- lagu Melayu, Batak dan Karo. Festival seperti itu memang penting untuk dilakukan guna melestarikan khasanah seni budaya bangsa. Apalagi, warga Kabupaten Langkat memang dikenal majemuk, karena terdiri dari beragam suku dan etnis. Festival lagu pop Melayu dilaksanakan di Gedung MABMI Langkat (9-10 Januari 2013). Uniknya, para pesertanya tidak hanya berasal dari putra- putri Melayu, tapi juga dari putra- putri dari suku dan etnis yang lain.Begitu juga dengan festival lagu pop Karo yang dilaksanakan di Jambur Persaan Merga Silima Langkat, tidak hanya diikuti oleh putra- putri dari suku dan etnis Karo, tapi juga diikuti oleh putra- putri dari suku dan etnis Jawa, Melayu dan lain- lain. Apalagi, para dewan jurinya tidak hanya memberikan penilaian, tapi juga ikut memberikan kritik dan saran. Pada intinya, kegiatan festival itu benar- benar positif dan patut untuk dilestarikan.Begitu juga dengan festival lagu pop Batak yang dilaksanakan di Aula kantor BKD (Badan Kepegawaian Daerah) Kabupaten Langkat, sangat menarik perhatian. Apalagi, karena asyiknya di sela- sela lomba mantan Kadis Perdagangan dan Perindustrian Langkat Hj. dra Diana Sari dan Kadis Pertanian Langkat H. Basrah Daulay, SP tanpa malu turun ke gelanggang dan ikut

berjoget.Ya, bisa juga rupanya Basrah berjoget. Apalagi dengaan gaya yang kocak, tidak kalah dengan para penari pada umumnya. Melihat hal itu, Bupati Langkat H. Ngogesa Sitepu di sela- sela menyaksikan final festival lagu pop batak mengaku bangga, karena banyak potensi yang muncul. Katanya, kegiatan seperti itu memang penting untuk dilakukan untuk melestarikan seni dan budaya bangsa agar tidak terkikis oleh kemajuan zaman.Selamat Hari Jadi Kabupaten Langkat ke- 263. Semoga Kabupaten Langkat bisa semakin jaya dan maju di tengah persaingan global. Adapun para juara dari Festival Lagu Karo, Juara I Syah Afandi Murdani Meliala dari Kecamatan Binjai, Juara II Tripdayanti br Ginting (Sei Bingei), Juara III Idawati br Tarigan (Sei Lepan), Juara IV Valentine br Situmeang, Juara V Indriansyah (Pkl. Susu) dan Juara VI Agus Rudianto (Bahorok). Sementara itu, para juara dari Lomba Lagu Melayu, Juara I Putra Dandi Al Hajmi (Wampu), Juara II Widi Tambusai (Stabat), Juara III M. Idiansyah (Hinai), Juara IV Suherman (Brandan Barat) dan Juara V Muammar (Padang Tualang). Sedangkan di kelompok putri, Juara I Siti Jubaidah (Batang Serangan), Juara II Dinda Azurra (Binjai), Juara III Aini (Secanggang), Juara IV Supina (Padang Tualang) dan Juara V Nuzura (Tg. Pura). (MR)

bedaan akan memberikan nuansa tersendiri dalam tatanan kehidupan demokrasi di tengah masyarakat. Bekerjalah demi kepentingan masyarakat, berikan pelayanan secara adil tanpa diskriminasi dan jangan sampai ada masyarakat yang dirugikan. Karena PNS harus berada pada seluruh kepentingan masyarakat, tidak membeda-bedakan masyarakat yang satu dengan lainnya, itulah profesionalisme PNS, kata Bupati Erry Nuradi. Dihimbau kepada para PNS untuk tetap konsisten dalam melaksanakan tugas pokok dan fungsi yang diemban sebagai amanah dari masyarakat sesuai proporsinya masing-masing. Jangan mengurangi ataupun melampaui batas kewenangan yang telah dipercayakan kepadanya. Dengan mengerjakan tupoksi secara profesional, amanah dan proporsional akan menciptakan keseimbangan dan sinergi positif serta harmonis dalam mewujudkan 5 butir visi Kabupaten Sergai yakni menjadi Kabupaten terbaik di Indonesia dengan masyarakatnya yang pancasilais, religius, modern,

kompetitif dan berwawasan lingkungan, tegas Bupati. Dinilai berhasil dalam memimpin tanah bertuah negeri beradat dalam kondisi yang kompak dan kondusif selama dua periode, Bupati dan Wabup Sergai masingmasing menerima kepercayaan untuk ikut dalam kancah Pilgubsu 2013. Namun hal ini diharapkan tidak menimbulkan riak-riak perbedaan yang memicu konflik di tengah-tangah masyarakat. Karena kepercayaan yang diberikan bagi kepala daerah Sergai ini merupakan salah satu bukti kekompakan dan kebersamaan yang harus terus dibangun dan dijunjung tinggi sebagai modal pembangunan yang berkesinambungan, tegas Erry Nuradi. Untuk itu Bupati Sergai H.T. Erry Nuradi minta kepada seluruh jajaran PNS di semua tingkatan mulai dari desa sampai kabupaten secara bersama-sama saling bahu membahu menyukseskan pelaksanaan Pilgubsu 2013 dengan mempertahankan harmonisasi dan suasana kondusif di tengah-tengah masyarakat.(Ibnu)

Pemko Tebing Tinggi Gelar Upacara Hari Kesadaran Nasional

Tebingtinggi, BN Pemerintah Kota (Pemko) Tebing Tinggi, Sumatera Utara, Kamis 17/1/ 2013 pagi, menggelar upacara peringatan Hari Kesadaran Nasional di Lapangan Merdeka Kota tersebut. Apel gabungan ini diikuti oleh seluruh jajaran PNS, TNI dan Polri. Acara diawali dengan pengibaran bendera sang merah putih dan pembacaan UUD 1945, Sapta Marga, Tri Brata dan Panca Prasetya Korpri. Turut hadir dalam upacara, ketua DPRD, Kapolres, Dandim 0204, Ketua Pengadilan Agama, Kepala Kejaksaan dan Ketua Pengadilan Negeri, Ketua FKUB, Sekdako, Kepala SKPD, Camat dan Lurah, se Kota Tebing Tinggi. Dalam sambutan tertulis Walikota Tebing Tinggi, Ir H Umar Zunaidi MM, yang dibacakan oleh Wakil Walikota, H Irham Taufik SH MAP, mengingatkan kepada semua jajaran Pemerintah Kota untuk menjunjung tinggi komitmen netralitas dari segala bentuk kegiatan politik praktis khususnya menyongsong pelaksanaan pemilihan Gubernur dan Wakil Gubernur Sumatera Utara pada 7 maret 2013 mendatang. Umar Zunaidi berpesan, pelihara kebersamaaan, dan tingkatkan soliditas sesama kita, pesannya. Walikota menambahkan, ada empat hal yang perlu di perhatian oleh kita bersama, terutama berkaitan dengan kinerja Aparatur Pemerintah Kota Tebing Tinggi pada tahun 2013, yang pertama masalah displin PNS, kedua kualitas kerja, ketiga Reformasi Birokrasi TNI dan POLRI dan yang keempat Netralitas dalam proses politik yang berkembang di Masyarakat, Tegasnya. (Der)

Tim Evaluasi UP2K Provsu Kunjungi PKK Kelurahan Durian

Bupati Langkat beserta peserta Festival Seni Budaya dalam acara HUT Langkat ke-263

Tebingtinggi, BN Tim Evaluasi UP2K Propinsi Sumatera Utara, mengunjungi Kelurahan Durian Kecamatan Bajenis, Kota Tebing Tinggi, (14/1). Rombongan di terima Camat Bajenis, Syahdama S STP dan Lurah Durian, Hasyim di Kantor Kelurahan Durian Kecamatan Bajenis Kota Tebing Tinggi. Kedatangan Tim evaluasi ini di damping Wakil Ketua PKK Kota Tebing Tinggi Ny Hj Elyuna Irham taufik, serta para pengurus PKK Kota Tebing Tinggi, mengadakan penilaian dan evaluasi kegiatan PKK di Kelurahan tersebut. Ketua PKK Kelurahan Durian dan Ketua PKK Kecamatan Bajenis menjelaskan tentang kegiatan PKK yang ada diwilayahnya. Tim UP2K Propinsi Sumatera Utara, sangat terkesan dengan apa yang telah dilaksanakan para Kader PKK di Kelurahan Durian. Setelah itu, Tim didampingi Wakil Ketua PKK Kota Tebing Tinggi, Ny Hj Elyuna Irham Taufik, mengunjungi kerajinan PKK yaitu usaha Gordyn dan usaha pembuatan Kue Gipang serta Roti. Tim juga sangat terkesan atas usaha PKK Kelurahan Durian dan diharapkan kegiatan ini lebih di tingkatkan lagi pemasarannya sampai ke pelosok Sumatera Utara. (Der)

Disinyalir Ada Unsur Dendam, Preman Kampung Meregang Nyawa Dibantai OTK BUDIMAN Tarigan alias Puso (270 yang di ketahui sebagai warga Dusun Kuta Belkih, Desa Adin Tengah, Kecamatan Salapian, Kabupaten Langkat kemarin Jumat (18/1) sekira pukul 11.30 WIB di temukan warga terbujur kaku bersimbah darah dan tidak bernyawa lagi di bantai oleh kawanan sekelompok pemuda tak di kenal. Korban di bantai hingga tewas di temukan di Dusun Telaga, Kecamatan Sei Bingai, Kabupaten Langkat dengan sejumlah luka di bahagian tangan dan lengan kirinnya ditemukan luka tikam sabitan senjata tajam, sedangkan

di bahgian pelipis kanan korban juga mengalami luka lembam akibat pukulan benda tumpul yang konon hidung korban mengeluarkan darah segar yang cukup serius. Informasi yang di peroleh BN dari Warga setempat mengatakan ,"Korban di temukan dalam keadaan terbujur kaku dengan kondisi luka tikam dan lembam bersama mengeluarkan darah segar dari hidungnnya, dan kemukinan korban tewas kehabisan darah hingga di temukan tidak bernyawa lagi.terang warga. Dari penemuan mayat tersebut Warga melaporkan peristiwa

tersebut, sehingga Polisi langsung turun lokasi kejadian dan langsung melakukan olah TKP hingga membawa jasad korban ke Puskesmas pembantu yang berada di Desa Namukur untuk di lakukan Visum atau juga guna di lakukan lidik dan penyidikan, terang nya. Dalam kasus kejadian pembunhan tersebut, hingga kini Polisi saat melakukan penyelidikan di TKP mendapatkan kendala, sebab warga setempat tidak ada yang dapat memberikan keterangan apa pun dan terkesan tutup mulut dalam upaya mengungkap siapa pelaku pembunuhan tersebut.

Namun informasi isyu yang berkembang, bahwa korban di kampung tersebut selama ini selalu membuat resah warga dan kerab membuat masalah yang di kenal dalam berkelakuan sehariharinya bandal yang konon dalam catatan Kepolisian pernah masuk bui Lembaga Pemasyarakatan. Kapolsek Sei Bingai AKP M Sihombing ketika di konfirmasi BN melalui telepon seluler nya membenarkan adanya peristiwa pembunuhan di Wilayah hukum nya, namun sampai saat ini belum di ketahui motif pembunuhan dan masih dalam penyelidikan, sedangkan dalam melakukan olah

TKP dan penyelidikan kita masih mendapat kendala di karnakan masyarakat sekitar tidak ada yang memberikan penjelasan sebagai saksi untuk dimintai keterangan untuk mengungkap siapa pelakunya. Dugaan sementara, koban sengaja dibunuh oleh seseorang, tapi, kita kesulitan untuk meminta keterangan dari warga sekitar, mereka gak ada yang bersedia untuk di jadikan saksi dan dan warga terlihat tertutup, hal ini lah membuat kita mengalami kesulitan untuk mengungkap siapa pelaku dalam peristiwa pembunuhan ini, jelas AKP M Sihombing.(Fris/007).

21 - 28 JANUARI 2013 | EDISI 343 | THN KE-VIII

Pengguna Jamkesnas Dikutip Biaya, Laporkan ke Polisi

Medan, BN Jamkesmas adalah program bantuan sosial untuk pelayanan kesehatan bagi masyarakat miskin dan tidak mampu.Program ini diselenggarakan secara nasional agar terjadi subsidi

silang dalam rangkamewujudkan pelayanan kesehatan yang menyeluruh bagi masyarakat miskin. Pada hakekatnya pelayanan kesehatan terhadap masyarakat miskin menjadi tanggung jawab dan dilaksanakan bersamaoleh Pemerintah Pusat dan Pemerintah Daerah. Pemerintah Propinsi/Kabupaten/Kota berkewajibanmemberikan kontribusi sehingga menghasilkan pelayanan yang optimal Lebih jauh ditegaskan bahwa pihak rumah sakit provider tidak boleh memungut biaya tambahan terhadap pasien pemegang Jaminan Kesehatan Masyarakat baik itu untuk biaya mabulance maupun tambah darah. Pernyataan di atas disampaikan Ketua Lembaga Pemerhati Kinerja Pemerintah Sumatera Utara (LPKP Sumut),Fajar Trihatya SE (foto), di kantornya, Jumat (18/1) menyikapi kutipan yang dilakukan pihak RSU Delima, Martubung terhadap pasien pemegang kartu Jamkesmas "Semua masyarakat pemegang

Setiap Unit Kerja Harus Punya Target dan Terukur Medan, BN Walikota Medan Drs H Rahudman Harahap MM menekankan dari hasil rapat kerja pelaksanaan program pembangunan Kota Medan tahun 2013 baru-baru ini diminta agar setiap unit kerja di jajaran Pemerintah Kota Medan dalam menjalankan kegiatan dan programprogram kerjanya harus punya target dan terukur, harus ada yang menjadi pilihan sehingga ada tolok ukur apa yang menjadi keberhasilan dan apa yang telah dilakukan untuk menyahuti aspirasi masyarakat. Hal ini disampaikannya pada saat memimpin upacara bendera peningkatan kesadaran nasional, Kamis (17/1) di halaman depan balai Kota Medan, dihadiri Wakil Walikota Medan Drs HT Dzulmi Eldin S MSi, Sekda Ir Syaiful Bahri, para setaf ahli, asisten dan pimpinan SKPD sera staf jajaran Pemko Medan. Dikatakannya, rapat kerja tersebut merupakan langkah strategis untuk lebih mendorong pembangunan kota yang semakin optimal, berkelanjutan, serta singkron dengan kondisi dan kebutuhan masyarakat kita yang semakin dinamis, berbagai rencana program, kegiatan serta anggaran pembangunan kota tahun 2013 telah disusun dan ditetapkan, untuk itu diminta agar semua memahami arah, alur serta sasaran pembangunan kota yang dilaksanakan pada tahun ini. “ Pahami apa tugas pokok kita, apa yang menjadi tanggung jawab yang harus dilaksanakan, khususnya fungsi kita masing-masing dalam SKPD, saya ingatkan, tantyangan yang akan dihadapi cendrung semakin kompleks, marei tingkatkan sinergi dan kerja sama baik, “ ujar Rahudman. Menurutnya, pada 2012 kita tidak pernah berhenti membangun, hasilnya kita semakin mampu mewujudkan system dan kinerja pemerintahan yangsemakin baik, demikian juga pada 2013 ini kinerja pembangunan harus lebih baik lagi, manfaatkan semua keberhasilan pembangunan sebelumnya sebagai pengalaman sekaligus katalisator pembangunan kota , jangan cepat merasa puas diri, sebab masih banyak lagi yang harus kita lakukan dalam rangka mwencapai visi Kota medan 2015, meningkatkan kesejahteraan masyarakat yang semakin baik. Ditambahkannya, selain aspek pembangunan kota bidang fisik, sosial budaya serta ekonomi, pembangunan pariwisata tahun ini juga tetap menjadi salah satu fokus untuk menjadikan Medan sebagai kota yang semakin menarik untuk dikunjungi oleh wisatawan, jangan sampai image yang sudah baik ini luntur disebabkan kita kurang peduli terhadap citra kota yang sedang kita bangun. “Seluruh program kerja pembangunan kota yang telah disusun harus dipahami sebagai kewajiban bersama dan didasari dengan niat yan tulus dan ikhlas untuk membangun kota ini, jangan jdikan kewajiban sebagai beban, justru anggap sebagai sarana dan kesempatan untuk mengabdi dan mendedikasikan diri secara nyata kepada masyrakat, “ imbuhnya. Lebih lanjut dimintakannya, sebagai aparatur negara jadilah contoh yang baik kepada seluruh masyarakat, kita sedmua harus menjadi tuan rumah yang baik terhadap siapapun, baik kepada warga masyarakat kita sendiri, maupun kepada tamu yang datang berkunjung ke kota ini, semua itu harus kita wujudkan dalam bentuk pelayanan umum yang semakin baik dan berkualitas. Walikota Medan berharap, melalui momentum ini diharapkan agar semua dapat tersu meningkatkan kapasitas serta kapabilitas kita sebagai aparatur negara, kita semua harsu meningkatkan disiplin, kerja keras, kreatifitas serta motivasi kerja yang besar untuk mewujudkan cita-cita pembangunan yang kita harapkan. (Ndo)

Jaminan Kesehatan Masyarakat (Jamkesmas) gratis berobat karena semua biayanya sudah ditanggung pemerintah.Jadi kalau ada rumah sakit yang tetap mengenakan biaya pada pasien Jamkesmas berarti sudah menyalahi ketentuan dan itu bisa ditindak," kata Fajar Ditegaskan Jamkesmas merupakan program yang sangat penting dan diharapkan terus berjalan. Dengan adanya program Jamkesmas, maka tidak ada lagi orang miskin yang terlantar. " Beberapa waktu lalu Dinas Kesehatan Provsu telah menegeluarkan surat edaran yang ditembuskan kepada Menteri Kesehatan, Gubernur Sumatera Utara, DPRD Sumatera Utara, Wali kota/Bupati di Sumatera Utara dengan Nomor 440.800/ 20070/X/2011, perihal penyelenggaraan Jamkesmas/Jampersal, tertanggal 11 Oktober 2011 ",tuturnya. Dalam surat tesebut, Dinkes Sumut menegaskan, bahwa sesuai dengan pedoman pelaksanaan

Jamkesmas dan Juknis Jampersal bahwa fasilitas kesehatan penyelenggara Jamkesmas/Jampersal tidak diperbolehkan untuk mengenakan tambahan biaya kepada penerima manfaat Jamkesmas/Jampersal dengan alasan apa pun. " Surat Edaran menyatakan setiap rumah sakit provider Jamkesmas agar dapat melayani pasien dengan ketentuan yang berlaku yakni semua pasien Jamkesmas digratiskan dari seluruh pelayanan dan perawatan.Tidak ada lagi kutipan biaya terhadap pasien yang terkover oleh Jamkesmas.Ini semua sudah jelas tertera dalam petunjuk teknis (Juknis)," katanya. Sementara disinggung masalah pengutipan biaya yang dilakukan petugas RSU Delima,Martubung terhadap salah seorang pasien Jamkesmas, Fajar sangat terkejut dan berharap dana tersebut dapat dikembalikan." Tidak ada dipungut bayaran apa pun. Kalau ada seperti itu dan ada buktinya, laporkan saja ke polisi,

pungutan yang dilakukan oleh petugas RSU Delima merupakan tindak pidana dan korban dapat melaporkanya kepada pihak kepolisian", ujarnya. Kita mengecam dan sangat menyayangkan insiden kutipan terhadap pasien miskin di wilayah itu yang menggunakan kartu Jaminan Kesehatan Masyarakat (Jamkesmas) sebesar Rp 1 Juta, dengan alasan tertentu bila perlu Dinas Kesehatan Pemko Medan dan Dinas Kesehatan Provsu turun tangan menenggarai kasus tersebut. "Jangan ada lagi pasien Jamkesmas yang nota bene orang miskin di Indonesia terlantar di rumah sakit. Sebab, biaya pelayanan kesehatan mereka sudah ditanggung oleh pemerintah pusat melalui program Jaminan Kesehatan Masyarakat (Jamkesmas). Jika masih ada orang miskin yang belum tertampung dalam program Jamkesmas, maka akan menjadi tanggungjawab pemerintah daerah ",tegasnya.(Ndo)

Plt. Gubsu, H. Gatot Pujonugroho, ST. Resmikan PT. BPR Syariah Gebu Prima Medan, BN PT. BPR syariah "Gebu Prima" sejak 16 tahun yang lalu sudahlah berdiri dan dulunya berada di jalan Utama No. 2 A. motivasi dengan berpindahnya kantor yang baru adalah guna mengembangkan BPR Syariah ini seperti yang lalu bagaimana ceritanya BPR Syariah ini dalam pengelolaannya dan ternyata dapat berkembang. PT. BPR Syariah ini sudah ada sejak 16 tahun yang lalu, yakni berada di jalan Utama No. 2A dan sekarang motivasinya kita pindah kantor adalah guna untuk mengembangkannya seperti yang lalu lalu, bagaimana ceritanya kita dalam pengelolaan "Gebu Prima" ini ternyata kita mampu, lalu kita kembangkan usaha BPR Syariah "Gebu Prima" untuk meningkatkan mutu kita dalam hal pelayanan yang lebih baik lagi kepada masyarakat "jelas Djanius Jamin selaku Komisaris / pemilik PT. BPR Syariah "Gebu Prima" dalam sambutannya pada acara pembukaan kantor Gebu Prima, Rabu lalu. Prof. Djanius Jamin mengatakan bahwa dengan adanya kantor yang baru ini kiranya para nasabah daripada PT. BPR Syariah "Gebu Prima" semakin bertambah dan PT. BPR Syariah akan mencoba merangkul masyarakat usaha mikro kecil menengah seperti yang dikatakan, Plt. Gubsu H.

Gatot Pujonugroho dalam sambutannya". "Dengan adanya kantor yang baru ini, kita harapkan nasabah "Gebu Prima" semakin bertambah dan kita akan mencoba untuk merangkul para UMKM yang ada seperti apa yang dikatakan Plt. Gubsu dalam sambutannya" jelas Prof. Djanius Jamin. Sementara itu, Plt. Gubsu H. Gatot Pujonugroho, ST sangat mengapresiasikan dengan adanya PT. BPR Syariah "Gebu Prima" serta dengan adanya kantor BPR Syariah "Gebu Prima" ini lebih semangat baru lagi dalam hal mengajak para nasabah untuk berperan khususnya seperti yang telah disampaikan yakni sebagai pendamping kepada para UMKM. "Ini bukanlah kantor yang baru lagi, sebenarnya bila dilihat lagi BPR Syariah ini cukuplah lama yang tentunya harapan kami juga, bahwa BPR Syariah yang dengan kantor baru ini lebih semangat baru dalam mengajak nasabah untuk berperan khususnya seperti yang telah saya sampaikan, yakni : sebagai pendamping bagi pelaku usaha UMKM, dan bila itu dilakukan sebenarnya kita yakin bahwa produk - produk keluaran UMKM cukup inovatif cukup memiliki kualitas yang sangat membanggakan hanya sekarang ini diantara mereka belum mengerti serta belum memiliki pendamping dan dengan

adanya BPR Syariah ini kami sangat mengharapkan dapat memberikan pendamping bagi pelaku UMKM" jelas H. Gatot Pujonugroho, ST. PLT. Gubsu, H. Gatot Pujonugroho, ST lebih lanjut mengatakan bahwa dengan usianya yang telah ke 16 tahun ini, maka semakin dewasalah atau semakin bahwa ini amanah dan tanggung jawab yang semakin terjaga dan hal ini kiranya dapat disosialisasikan. PT. BPR Syariah "Gebu Prima" menawarkan produk yang halal, murni, adil, aman dan menguntungkan bagi nasabah serta motto PT. BPR Syariah "Berkembang bersama umat" adapun produk - produk daripada PT. BPR Syariah antara lain: Tabungan Gema, Tabungan Tholib, Tabungan Wahyu, Tabungan Jabal Rahmah, Simpan Zakiyah, serta Deposito Prima. Manfaat yang diberikan oleh BPR Syariah "Gebu Prima" kepada nasabah antara lain: Lebih aman dan menguntungkan, tabungan / Deposito dijamin oleh Pemerintah, mendapatkan bagi hasil halal, murni, adil, menguntungkan, terhindar dari RIBA dan tingkat profit bersaing Bank bersedia menjemput setoran nasabah dan bersedia mengantar penarikan tabungan, serta mengamalkan Islam secara khaffah.(Ahs)

Kinerja Kabag Humas DPRD Sumut Perlu Dievaluasi Medan,BNKehadiran Humas dibutuhkan terutama dalam rangka mendiseminasi berbagai informasi publik yaitu semua informasi yang memang wajib disampaikan badan publik (lembaga pemerintah) kepada masyarakat. Untuk menjalankan tugas secara profesional maka ada berbagai faktor yang turut mendukung kelancaran tugas seorang Humas antara lain memahami cara berkomunikasi yang baik, memahami budaya birokrasi dan juga memahami adat istiadat masyarakat setempat, dimana Humas bertugas. Namun pada kenyataanya kalangan wartawan yang bertugas di lingkungan kerja DPRD Sumut menilai kinerja Kepala bagian Humas (Kabag Humas),Drs Satudin Wade kurang transparan, baik dalam hal informasi pemberitaan maupun pengelolaan keuangan. Padahal, sesuai tugasnya Humas harus informatif kepada siapa saja. "Akhir-akhir ini kinerja Kabag Humas mulai mendapat sorotan tajam dimana dalam realisasi di lapangan banyak kali ditemui kinerja Humas tidak maksimal. Karena, banyak kegiatan yang tidak dapat dipublikasikan para wartawan seperti kunjungan kerja karena tidak adanya

informasi yang diberikan dari pihak yang berkompeten" ujar salah seorang wartawan,Alfindo.. Lebih jauh dikatakannya tidak hanya itu saja, apabila wartawan bertanya mengenai berbagai permasalahan yang terjadi, jika dikonfirmasikan kebanyakan jawaban yang tidak memuaskan. "Maaf saya tidak tahu mengenai hal itu. Nanti saja tanyakan langsung ke bidang yang bersangkutan," kata Satudin Wade jika dikonfirmasi seakan-akan megelak. Kami sudah berulang-ulang mendapat keluhan dari rekan-rekan wartawan khusus yang pos liputannya di kantor DPRD Sumut,bahwa adanya pemberlakuan tidak adil terkait pada wartawan. Kami pikir kondisi ini harus disikapi, karena bagaimana pun anggaran yang ada di Humas itu adalah anggaran yang menjadi milik masyarakat, sehingga pengelolaannya harus transparan dan merata,lanjutnya lagi. "Seperti halnya dengan penghentian anggaran yang pernah diterima para wartawan yang bertugas di lingkungan DPRD Sumut yang masih menjadi tanda tanya besar ",ungkap Alfindo.Kalau memang anggaran dihentikan sampaikan kepada wartawan jangan didiamkan sehinggga menimbulkan fitnah. " Hampir tiga tahun anggota DPRD

Sumut periode 2009-2014 bekerja, namun tidak terlihat fungsi dari kinerja humas dalam mengayomi wartawan malah semakin hari perpecahan di kalangan wartawan semakin melebar ",ujarnya lagi, Disampaikannya saat ini banyak oknum-oknum yang mengaku kordinator wartawan unit DPRD Sumut tanpa keabsahan diakibatkan kabag humas sendiri seakan-akan lepas tangan."Kita menilai kondisi tersebut disengaja dibiarkan agar kebobrokan yang ada humas tidak terpantau ",ujarnya. Ditegaskan jika memang diperlukan seorang kordinator,kabag humas seharusnya memfasilitasi dengan mengundang seluruh wartawan dan dilakukan pemilihan.Bukan menjadi pemecah belah layaknya ular berkepala dua. Kalangan wartawan sendiri berharap Sekretaris DPRD Sumut,H.Randiman Tarigan sesegera mungkin mengevaluasi kinerja Kabag Humas atau mencari pengganti yang lebih mengetahui tupoksinya humas. "Pertimbangkan saja jabatan kabag Humas, kalau kinerja yang dilakukan tidak baik, sebab wartawan adalah mitra kerja yang harus diayomi bukan untuk dipecah belah," tandas Alfindo dengan tegas..(Ndo)

Lilik Riadi Terpilih Secara Aklamasi Sebagai Ketua Koordinator Wartawan Unit Pemko Medan REPORTER Harian Sumut 24, Lilik Riadi Dalimunthe resmi terpilih secara aklamasi menjadi Ketua Koordinator Wartawan Unit Pemerintah Kota (Pemko) Medan periode 2013-2015, dalam rapat pemilihan yang dilangsungkan di Ruang Rapat 3 lantai 4 Balai Kota Medan, Jumat (18/01/2013) siang. Rapat pemilihan Ketua Koordinator Wartawan Unit Pemko Medan yang dipimpin Pangihutan Rumapea (Harian Perjuangan Rakyat), H Anwardin (Garuda) dan Rohim Samsuri ( berlangsung cukup kondusif diikuti 68 peserta rapat yang merupakan seluruh reporter dari media massa yang bertugas di Pemko Medan. Dalam rapat

tersebut disepakati bakal calon ketua Koordinator diusung minimal 10 peserta sading. Dalam perjalananya, dua bakal calon diusung peserta diantaranya Lilik Riadi Dalimunthe Reporter Sumut 24 dan Zul Anwar Marbun reporter mingguan Gebrak, namun Zul Anwar Marbun tidak bersedia dicalonkan. Pimpinan sidang pemilihan Ketua Koordinator wartawan unit Pemko Medan, Pangihutan Rumapea akhirnya menetapkan secara aklamasi Lilik Riadi Dalimunthe sebagai Ketua Koordinator Wartawan Unit Pemko Medan Periode 2013-2015 terpilih.

“Sesuai dengan kesepakatan dan tidak adanya lagi bakal calon yang diusung maka saudara Lilik Riadi Dalimunthe sebagai Ketua terpilih,” ungkap Rumapea disambut tepuk tangan puluhan peserta rapat. Dalam sambutannya, Ketua Koordinator Wartawan Unit Pemko Medan, Lilik Riadi Dalimunthe menyampaikan terimakasihnya atas dukungan yang diberikan dan pihaknya berjanji akan mengutamakan kebersamaan . “Saya berterimakasih kepada kawankawan semua yang telah memberikan kepercayaan kepada saya. Kedepannya kita mengharapkan kebersamaan menjadi satu hal yang harus kita utamakan,” ungkapnya.

Pengurus Baru Diharapkan Lebih Baik Dalam kesempatan yang sama, Ketua Koordinator Wartawan Unit Pemko Medan periode 2011-2013, Muhammad Arifin, S.Pd. M.Pd menyampaikan terimakasih dan menyapaikan permohonan maaf dan mengharapkan Ketua terpilih dan pengurus yang baru dapat bekerja lebih baik lagi kedepan. “Sebelumnya saya berterimakasih kepada kawan-kawan dan saya juga menyampaikan permohonan maaf kepada kawan-kawan semuanya jika ada salah dalam kepemimpinan saya selama ini. Dan saya juga mengharapkan agar pengurus dan ketua terpilih dapat bekerja lebih baik lagi,” ungkapnya.(ndo)

Kantor Service Baru Sharp Medan Diresmikan Medan, BN Setelah mendapat pengakuan dari Rekor Bisnis Indonesia, sebagai perusahaan elektronik dengan jaringan service center terbanyak dan terbesar di seluruh Indonesia tahun 2012, PT Sharp Electronics Indonesia (SEID) selalu melakukan peningkatan kualitas layanan purna jual yang dimilikinya. Saat ini Sharp memiliki 30 kantor cabang, 29 service center yang sudah mengoperasikan 39 Sharp Direct Service Station, 252 Sharp Authorized Service Station, 22 Sharp Service Representative yang terbesar di seluruh Indonesia, 2 unit Sharp Mobile Service Station, 2 Sharp Service Corner serta fasilitas Sharp Customer Service Mobile Application. Untuk semakin meningkatkan kualitas pelayanan purna jual kepada pelanggan setia produk di Kota Medan, Sharp memindahkan kantor service center area Medan, yang sebelumnya di Jln Iskandar Muda No 77-B-C ke tempat baru di Jalan Kejaksaan No 8 D Kelurahan Petisah Tengah Kecamatan Medan Petisah 20112. Akses yang lebih mudah untuk dicapai, dan lokasi ini jauh lebih strategis, karena terletak di jantung kota menjadi alasan pemindahan tersebut. Didukung teknisi-teknisi profesional yang akan bertugas setiap hari (tidak termasuk hari libur nasional) kantor pelayanan service ini melayani pelanggan Sharp secara "In Home Service" atau mengunjungi pelanggan, atau "Carry In Service (pelanggan datang mengunjungi service center, Sharp), serta melayani penjualan komponen untuk produk-produk Sharp. Kantor pelayanan service tersebut resmi dibuka dan operasional mulai Kamis 17 Januari 2013. Selain itu kantor service yang baru ini juga telah menerapkan program Quick Service, yakni perbaikan unit yang diselesaikan pada hari yang sama. Sebanyak 14 teknisi Sharp yang andal dan mumpuni akan siap melayani pelanggan setiap Sharp di area Medan," ungkap Ronald R. Huawe, Asst GM Customer Satisfaction Dic. PT. Sharp Electronics Indonesia, didamping Kacab PT Sharp Medan Suwandi. Sebagai bentuk apresiasi Sharp kepada pelanggan setia di wilayah Medan dan sekitarnya, terhitung mulai 17-19 Januari 2013 Sharp akan mengadakan promosi kepada pelanggan yang memperbaiki produknya dalam periode tersebut, yaitu potongan harga 50% untuk biaya penggantian spare part dan gratis ongkos kerja (untuk produk diatas tahun 2007). (AHS)

Natal USBM Berlangsung Khidmat Medan, BN Keluarga besar Universitas Setia Budi Mandiri (USBM) Medan merayakan peringatan hari Natal berlangsung khidmat dan meriah, dengan tema Kelahiran Tuhan Yesus Membawa Solusi Bagi Umat Manusia, yang dilaksanakan di kampus perguruan tinggi Universitas Setia Budi Mandiri jalan Asrama Medan baru-baru ini. Tampil sebagai penghotbah Pdt. Drs. Arnold Budiman Hutasoit MBA mengatakan perayaan Natal menandakan kerinduan tuhan kepada umatnya, sehingga kita tidak memikirkan diri kita pribadi, tapi kita semua memandang semua umat didunia ini. Lanjutnya Arnold mengatakan Tuhan Yesus datang kedunia ini dikatakan Raja Damai, karena dia datang keduania ini membawa damai bagi semua umat manusia, sebab dengan datangnya tuhan kedunia ini tidak adalagi pertentangan dan pertikaian di tengah-tengah manusia. Sementara itu Ketua Yayasan USBM Budiman mengatakan memberikan ilmu yang tidak terbatas kepada mahasiswanya agar dapat menjadi bekal hidup dimasa mendatang sehingga berhasil, serta dapat melayani semua masyarakat. Selanjutnya Budiman mengatakan siapaun agamanya kita harus mendengar apa yang diperintah tuhan, kasih dapat memberikan apa yang diberikan apa yang diperintah tuhan, mengucap syukur kepada tuhan tapi tuhan akhirnya memberikan. Perayaan Natal USBM ini dimeriahkan oleh tarian dan nyanyian, dan dihadiri rektor USBM, wakil rektor ketua yayasan Drs. Arnold Budiman Hutasoit MBA, dosen, dan seluruh staf pegawai maupun seluruh mahasiswa. (AHS)

Wakil Walikota Medan Terima Audensi LSM Siri Medan, BN Wakil Walikota Medan Drs HT Dzulmi Eldin S,M.Si didampingi Kepala Badan Kesbang Linmas Ceko Wakhda Ritonga,SH, Kepala Dinas Infokom Zulkipli Sitpu menima audensi LSM Suara Independen Rakyat Indonesia (SIRI) cabang Sumut yang diketuai Zul badri, Rabu (16/1) di ruang Kerja Wakil Walikota Medan). Wakil Walikota menyambut baik dan memberikan apresiasi atas kehadiran LSM SIRI ini ditengah-tengah masyarakat Sumut. Kehadiran SIRI di Sumatera Utara dapat membawa nuansa pembangunan sebagai penyambung lidah rakyat ke Pusat untuk mencucurka dana pembangunan yang urgen bagi masyarakat Sumatera Utara, khususnya di Kota Medan, ungkapnya. Pmbangunan Kota, selain tanggung jawab Pemrintah kota, juga masih ada tanggung jawab instansi vertikal yang punya wewenang, misalkan, Inprasruktur jalan yang rusak di kota Medan, ini belum tentu tanggung jawab pemerintah kota Medan, karena ada jalan provinsi dan ada jalan negara. Sedangkan Jalan Provinsi menjadi Tanggung jawab Provinsi, dan Jalan Negara menjadi tanggung jawab Pusat, tapi masyarakat tetap menyalahkan pemerintah kota Medan, ungkapnya. Dengan kehadiran LSM SIRI ini, diharapkan dapat membantu pemrintahkota Medan untuk bersinergi dalam pmbangunan. Sementara ketua SIRI cabang Sumut Zul Badri, siap mendukung pembangunan di Sumatera Utara, khususnya di kota Medan. Untuk itu kepengurusan LSM SIRI Cabang Sumut akan dilantik pada tanggal 22 Februari 2013 nanti. Sebagai Ketua Zul Badri, wakil ketua Hendri Roja, wakil ketua Rafdinal ,S.Sos, Sebagai sekretaris Saaadi Sam, wakil sekretaris Darma Bakti, sedangkan bendahara Riduan Hasan Basri , dan wakil bendahara Sudirman. (AHS)

21 - 28 JANUARI 2013 | EDISI 343 | THN KE-VIII

Dukung Pengelolaan Tata Pelaporan Keuangan Lebih Baik

CV. BONGKAR PERS NEWS Badan Hukum: Akte Notaris Hermaini,SH No.4 Tanggal 10 Agustus 2009 Pengesahan PN Medan No: 1520/CV/PEND/2009 NPWP: 02.996.694.2-121.000 Pembina

Pemimpin Umum/ Pemred/Penjab

: Drs. H. Kasim Siyo MSi Drs. Hendra DS HMK Aldian Pinem, SH, MH Uli Tobing Benny Soetedjo Eben Pegagan Manik : Sunardi Bonang

Wakil Pemred I/ Wakil Penjab : ESP Parindoery Wakil Pemred II/ Wakil Penjab : A. Sani Simbolon Wakil Pemimpin Umum I Wakil Pemimpin Umum II

: Johnesly Meliala : Irwansyah B

Pimpinan Perusahaan

: Muhammad Ridwan

Redaktur Pelaksana

: Drs. Alfindo Amir Hamzah Siregar, SH Pendi Hariyono

Dewan Redaksi

: Mangatur Silaban Drs. Edward Pakpahan H.Zulkarnain Abidin Rudi Sirait EPP Ringo-ringo, SE Muhammad Siregar

Koordinator Liputan Koordinator Daerah Litbang/Iklan Fotografer/Teknisi Penasehat Hukum Sekretaris Redaksi Keuangan

: Jakfar : Indrawan Sukma Antoni Sagala : Sudari,SH (Kabag) Leonard Hutasoit : Supriadi : Nurmahadi Darmawan, SH Mardianto Situmeang, SH Rosmawati, SH : Toni Purwadi, SH : Rini Alamsyah SPd


STIKes Mutiara Indonesia Jadi Universitas Medan, BN Sesuai SK Mendikbud No. 10/E/O/2013 tanggal 10 januari 2013, maka Sekolah Tinggi Ilmu Kesehatan (STIKes) Mutiara Indonesia resmi menjadi Universitas Sari Mutiara (USM) Indonesia. PembinaYayasan Sari Mutiara Parlindungan Purba, SH,MM mengatakan, USM Indonesia mempunyai misi untuk menjadi universitas yang kompeten dan unggul di Sumatera Utara dalam pengembangan ilmu pengetahuan, teknologi modern dan seni budaya. Dengan demikian, USM Indonesia diharapkan dapat menghasilkan SDM berkualitas serta profesional dibidangnya, berwawasan nasional dan internasional. "Secara fisik, kampus yang ada sekarang akan dikembangan menjadi kampus representatif dengan membangun gedung baru. Kemudian, dilakukan renovasi terhadap gedung lama dengan menambah ruangan kelas dan laboratorium serta ruangan lainnva." ujar Parlindungan saat menggelar konfrensi pers dikampus USM Indonesia, Kamis baru-baru ini. Kata Parlindungan, USM Indonesia memiliki 17 Program Studi di antaranya Ilmu Kesehatan Masyarakat, Akuntansi, Kimia, Ilmu Hukum dan IImu Komunikasi. USM indonesia akan membangun kerjasama dengan universitas yang ada di Sumut baik PTN maupun PTS serta membangun networking (jaringan) dengan berbagai universitas di Malaysia, Singapura dan Thailand sehingga dapat berbicara secara ilmiah di tingkat ASEAN. "Rencananya, pelantikan DR Dra Ivan Elisabeth Purba, M.Kes sebagai Rektor USM Indonesia dilaksanakan pada 29 Januari 2013 sekaligus sebagai simbol pengabdian Sari Mutiara untuk masyarakat yang telah memasuki tiga dasawarsa,"kataya. Sementara itu, Rektor USM Indonesia DR. Dra Ivan Elisabeth Purba, MKes didampingi Ketua Yayasan Mutiara Indonesia Drs. Washington Purba mengucapkan terimakasih kepada berbagai pihak yang telah membantu pengembangan STTKES Mutiara Indonesia menjadi USM Indonesia hingga penerbitan izin penyelenggaraannya. Kami bertekad tetap menjalankan visi dan misi sesuai koridor peraturan yang berlaku. Diharapkan USM Indonesia akan mampu menghasilkan SDM berkualitas di bidangnya," ujar Ivan. (AHS)

Civitas Akademika ITM Gelar Perayaan Natal Medan, BN Masyarakat di sini sangat bangga melihat mahasiswa Institut Teknologi Medan (ITM), karena pada umumnya baik-baik dan biasa-biasa saja. Inilah yang dilihat masyarakat sebagai warga yang paling dekat dengan kampus ITM. Demikian sambutan mewakili orang tua Pak Tobing pada Perayaan Natal Oikumene Civitas Akademika ITM yang diadakan di Gereja HKI Teladan Medan baru-baru ini. Adapun tema yang diambil pada Perayaan Natal tersebut " Bangsa yang berjalan dalam kegelapan telah melihat terang yang besar " yang diambil dari Yeyasa 9 ayat 1 a. Tobing juga menyatakan, gereja ini sering dimanfaatkan mahasiswa ITM setiap ada perayaan Natal dan Paskah. Dengan demikian kepada mahasiswa ITM diharapkan jangan seperti orang yang ber-make up, karena orang yang ber-make up menutupi wajah yang sebenarnya. "Kami yakin mahasiswa ITM tidak seperti orang yang ber-make up," katanya sambil menambahkan, yang pantas dibanggakan 5 sampai 6 tahun mahasiswa digodok mental maupun jiwa. Untuk itu perayaan Natal seperti ini bagi mahasiswa untuk memperbaiki jati diri. "Artinya tidak ada artinya sarjana teknik kalau imanmu tidak ada," tandas Tobing. Dengan demikian, tambah Tobing, jangan jemu-jemu berbuat baik. Hal ini sesuai dengan harapan para orang tua, supaya mahasiswa menjadi manusia yang terang. "Oleh sebab itu topanglah dirimu menjadi manusia yang diinginkan Tuhan, agar mahasiswa ITM lebih baik dari yang sebelumnya," tandasnya. Ketua Panitia Natal Patiarma Damanik menyampaikan, kesuksesan Perayaan Natal Oikumene ini berkat kerja sama yang baik antara sesama mahasiswa ITM serta dukungan semua pihak. (AHS)

BPKP Siap Bantu Pemko Medan Medan, BN Wali Kota Medan Drs H Rahudman Harahap MM menerima kunjungan Kepala Badan Pengawasan Keuangan dan Pembangunan (BPKP) Perwakilan Sumatera Utara Drs Bonny Anang Dwiyanto di Balai Kota Medan, Jumat (18/1). Selain silaturahmi, kunjungan itu dilakukan dalam rangka peningkatan tata pengelolaan pelaporan keuangan di Pemko Medan agar menjadi lebih baik lagi. Didampingi sejumlah anggotanya seperti Mariyam dan A Widarwanto, Bonny mengatakan BPKP siap untuk membantu memberikan pendampingan dan bantuan bagi Pemko Medan agar pengelolaan

tata pelaporan keuangan untuk Tahun Anggaran 2012 dan tahun selanjutnya menjadi lebih baik. “Jadi intinya kita siap untuk memberikan pendampingan dan bantuan agar pelaporan keuangan Pemko Medan menjadi lebih baik, tranparan dan akuntabel lagi,” kata Bonny. Kepada Wali Kota yang didampingi Wakil Wali kota Drs H Dzulmi Eldin MSi, Sekda Ir Syaiful Bahri, Kepala Inspektorat Drs Farid Wajedi MSi, Kepala Badan Pengelola Keuangan Daerah (BPKD) Kota Medan Irwan Ritonga, Bonny selanjutnya menjelaskan BPKP ke depan tidak hanya sebagai pendamping saja tetapi akan fokus un-

tuk melakukan tindakan preventif. Untuk melaksanakan itu, Bonny mengaku pihaknya harus bekerja lebih keras mengingat jumlah tenaga yang dimiliki di BPKP Perwakilan Sumut saat ini hanya sekitar 200 orang. Sedangkan pemerintah kabupaten maupun kota yang ditangani berjumlah 33 kabupaten/ kota. Di samping tindakan preventif, Bonny juga mengungkapkan BPK perwakilan Sumut juga fokus menangani masalah pengelolaan aset. Terkait itu dia menilai pengelolaan aset di Pemko Medan sudah cukup baik. Terbukti Pemko Medan berhasil meraih opini Wajar Tanpa Pengecualian (WTP) dari

Badan Pemeriksa Keuangan (PBK ). ”Jika BPK sudah memberikan penilaian WTP berarti itu sudah baik,” ungkapnya. Wali Kota Medan Drs H Rahudman Harahap menyambut baik atas kunjungan yang dilakukan Ketua BPKP Perwakilan Sumut tersebut. Sebab, hubungan antara keduanya selama ini sudah terjalin dengan baik. Apalagi selama ini BPKP selalu memberikan pendampingan dan konsultasi secara terus menerus agar tata pengelolaan pelaporan keuangan Pemko Medan menjadi lebih baik, tranparan dan akuntabel. “Untuk itu atas nama Pemko Medan, saya mengucapkan terima kasih. Saya harap kerjasama ini bisa

Untuk Tingkatkan Pelayanan

Camat Diberikan Pelimpahan Wewenang Pemungutan Retribusi dan Sebagaian Pelayanan kebersihan Medan, BN Pelimpahan wewenang pemungutan retribusi dan sebagain pelayanan kebersihan kepada para Camat dimaksud adalah semata-mata untuk meningkatkan pelayanan kebersihan yang kita selenggarakan sekaligus sebagai bagian langkah dibirokratisasi dibidang pelayanan kebersihan, karena salah satu perfsepsi pokok tentang kualiotas kota baik itu keaman, kenyamanan maupun penataan serta keindahannya sangat dipengaruhi oleh kualitas pengelolaan kebesrsihan kota. Hal ini dikatakan oleh Walikota Medan Drs H Rahudman Harahap MM pada acara apel pelimpahan wewenang pemungutan retribusi dan sebagian pelayanan kebersihan kepada Camat se Kota Medan, Kamis (17/1) di Lapangan Mertdeka Medan, tampak hadir Dandim 0201/BS Letkol Inf Hendriyadi, Sekda Ir Syaiful bahri MM, sejumlah pimpinan SKPD jajaran Pemko Medan dan para kepling, Lurah, Camat, Pasukan Melati, Bestari, supr dan kenek angkutan kebersihan, serta mandor. Dikatakannya, mempertahankan dan meningkatkan capaian kinerja kebersihan sesungguhnya jauh lebih berfat dari sekedar meraihnya, berdasarkan pertimbangan tersebut slah satu kebijakan strategis yang akan kita tempauh dalam tahun 2013 adalah melimpahkan sebagain kewenagan pengelolaan kebersihan yang sebelumnya

ada di Dinas Kebersihan kepada pemerintah kecamatan atau Camat. Menurutnya, ada dua hal yang haqrsu dikerjakan sekaligus menjadi tanggung jawab Camat dalam pengelolaan kebersihan yakni, meningkatkan kebersihan di kecamatan masing-masing, selanjutnya menyelenggarakan pemungutan retribusi sampah secara lebih optimal, dan pelimpahan kewenangan ini memberikan konsekwensi penilaian prestasi kerja baik kepada Camat, Lurah dan para Kepala Lingkungan secara keseluruhan. Ditambahkannya, Camat selaku kepala wilayah mengkomadoi teramsuk route truk pengangkut sampah, selanjutnya mengarahkan para petugas Melati dan Bestari, karena Kepala Dinas Kebersihan tidak akam terjangkau, maka Camat harus bertanggung jawan di wilayahnya, makanya kita berikan kewenangan, diberikan sarana dan fasilitas untuk bisa menggerakkan kebersihan dengan harapan kebersihan itu meningkat. “ Camat lebih tau objek wajib retribusi sampah, bukan Kepala Dinas Kebersihan, dengan adanya pelimpahan wewenang ini tidaka ada alas an lagi Camat tidak bisa melayani kebersihan, pemerintgah melalui Dinas kebersihan mengupayakan penegakan Perda kebersihan, “u jar Rahudman Lebih lanjut dikatakan untuk mengefektifkan pelaksanaan tugas dan fungsi pen-

gelolaan kebersihan masing-masing kecamatan ada hal yang perlu diperhatikan yakni, meningkatkan koordinasi dengan penyelenggaara kebersihan serta SKPD,, gelorakan secara terus menerus semangat dan kesadaran kebersihan kepada masyarakat, optomalkan seluruh prasarana dan sarana kebersihan, optimalkan pencapaianh target pemungutan retribusi, laksanakan tata kelola retribsui kebersihan secara benar dan baik serta laksnakan evaluasi secara regular. “ Camat adalah pamong sekaligus administrator baik dibidang pemerintahan, pembangunan maupun pembinaan kemasyarakatan, saya percaya para Camat mampu melaksanakan tugas dan tanggung jawab pengelolaan kebersihan ini lebih baik, lebih optimal dimasa yang akan datang, “ harapnya. Adapun kewenangan pelayanan kebersihan yang dilaksanakan oleh Camat yang tertuang dalam SK Walikota Medan nomor 45 tahun 2012 tentang Pelimpahan wewenang pemungutan retribusi dan sebagaian pelayanan kebersihan kepada Camat dalam pasal 4 adalah, melaksanakan penagihan retribusi pelayanan kebersihan, melaksanakan pelayanan kebersihan yang sebaik-baiknya bagi pemakai jasa (masyarakat) mulai dari tempat sumber sampah ke TPS sampai ke TPA. Selanjutnya, melaksanakan pembinaan tehnik operasional pelayanan kepada Melati, dan Bestari, melaksanakan pembinaan tehnik operasional pelayanan kepada pengangkut sampah, melaksanakan pembinaan tehnik operasional pelayanan kepada petugas gerobak. Beca sampah dan melaksanakan pembinaan tehnik operasional pelayanan kepada supir/ kernet truk sampah. Acara ini ditandai dengan penanda tanganan kesepakatan pelimpahan wewenang kepada para Camat yang mewakili tgiga Camat yakni Camat Medan Marelan Pulungan Harahap, Camnat Medan Deli Hendra Asmilan, dan camat Medan Kota Parlindunga, dengan kepala Dinas Kebersihan Pardamean Siregar disaksikan Walikota Medan Drs H Rahaudman Harahap MM. (Ndo)

ditingkatkan lagi. Apalagi hasil opini yang diraih Pemko Medan dari BPK dalam dua tahun belakangan ini tidak terlepas berkat bantuan dan pendampingan bari BPKP Perwakilan Sumut,” ujar Wali Kota. Dalam kesempatan itu Wali Kota juga minta dukungan BPKP Perwakilan Sumut agar pengelolaan Perusahaan Daerah Air Minum (PDAM) Tirtanadi diserahkan kepada Pemko Medan. Sebab, PDAM Tirtanadi berada di wilayah Kota Medan dan pelanggannya 99 persen merupakan warga Medan. Apalagi seluruh pengelolaan PDAM di Indonesia tidak ada dikelola pemerintah provinsi. BPKP Siap Bantu Pemko Medan(Ndo)

Sertijab Kepala Perwakilan Bank Indonesia Wilayah IX Sumatera Utara & Aceh Medan, BN Ahli tugas merupakan tour of duty untuk melaksanakan proses regenerasi dan perkembangan SDM Bank Indonesia maka pengalihan tugas kantor perwakilan Bank Indonesia wilayah IX Achamd Fauzi selaku pejabat sementara pengganti Nasser Atorf yang telah memasuki masa purnabakti per 1 Januari 2013. Kepala perwakilan yang baru Hari Utomo diharapkan dapat semakin meningkatkan peran kantor perwakilan Bank Indonesia wilayah IX dalam memberikan kontribusi pada pencapaian kinerja perekonomian yang lebih baik di Sumatera Utara dan Aceh. Demikian dikatakan Gubernur BI DR. Darwin Nasution yang dibacakan dalam pidatonya di gedung BI lantai IX di Medan, Jumat kemarin. Selanjutnya Darwin mengatakan kinerja ekonomi bagian Sumatera Utara di tahun 2012 cukup baik, yang diperkirakan mencapai 6.0% yang tentunya turut mempengaruhi kinerja perekonomian nasional. Dalam lingkup nasional kinerja perekonomian kita tetap kuat, meskipun ditengah kondisi ekonomi global pada tahun 2012 lalu pertumbuhan perekonomian nasional diperkirakan mencapai 6.3% . Namun pertumbuhan ekonomi yang dicapai tahun 2012 memang lebih rendah dari perkiraan semula karena melambatnya kinerja expor. Ini sebagai imbas dari krisis ekonomi yang masih berlangsung di negara maju khususnya di zona Eropa, yang disertai merosotnya harga-harga komoditas. Saya mencatat kinerja expor Sumatera bagian Utara pun terkena dampaknya apabila pada tahun 2011 expor Sumatera bagian Utara tumbuh 13.4%, maka pada tahun 2012 diperkirakan menurun menjadi hanya 3.2%, terutama karena turunnya expor CPO dan karet alam sebagai komuditas utama wilayah Sumatera bagian Utara. Ditengah menurunnya harga komuditas di pasar internasional, perkembangan inflasi di berbagai daerah hingga kini terkendali pada tingkat yang cukup rendah. Saya mencatat inflasi di Sumatera Utara pada tahun 2012 lalu mencapai 3.86% lebih rendah dari inflasi dalam skala nasional yaitu 4.3%, kata Darwin . Selanjutnya Darwin menambahkan koordinasi dalam menjaga stabilitas harga, baik ditingkat pusat (TPI) maupun daerah (TPID) memiliki andil yang penting dalam menjaga rendahnya tingkat inflasi di Sumatera Utara. Kinerja yang baik dalam pengendalian inflasi ini ditunjukkan dengan pemberian penghargaan kepada TPID Sumut pada rakornas TPID 16 Mei 2012 lalu. Koordinasi dalam menjaga stabilitas harga ini perlu diperkuatkan mengingat karakteristik inflasi kita cendrung supply side bias. Artinya harga sangat sensitif terhadap perkembangan sisi pasokan, terutama situasi panen, tantangan geografis, hambatan transportasi dan kondisi cuaca. Dalam kesempatan ini saya meminta agar kepala perwakilan Bank Indonesia wilayah IX untuk dapat lebih semakin mengefektifkan Tim Pengendalian Inflasi Daerah (TPID) ungkap Darwin . Kata Darwin untuk kedepan, dinamika perekonomian di berbagai daerah masih akan menghadapi tantangan yang cukup berat. Ini karena luasnya dimensi dan kompleks permasalahan di negara maju, diperkirakan akan menyebabkan pemulihan ekonomi global berjalan cukup lama. Oleh karena itu, ditengah kondisi ekonomi global yang belum pulih, kemampuan daerah untuk dapat memacu pertumbuhan ekonomi akan sangat ditentukan yaitu kemampuan daerah untuk menggali dan memperkuat bazis-bazis pertumbuhan domestik. Kemampuan dalam menggali distinctive capabilities yang ada didaerah ini, sebagai keunggulan koperatif dubanding daerah lain. (AHS)

PTPN III Berikan Penghargaan Kepada Karyawan Berprestasi Terbaik MEMBERIKAN penghargaan kepada siapa saja yang berprestasi adalah tugas utama manajemen. Tujuan diberikannya penghargaan (reward) selain untuk memacu kreativitas, aneka macam inovasi juga menjadi momen penting bagi si penerima hadiah dalam bentuk pujian ataupun materi. Bila itu dilakukan secara berkesinambungan, maka prestasi demi prestasi akan terus terukir demi pencapaia target yang lebih baik lagi. Hal ini diterapkan oleh PT Perkebunan Nusantara III sebagai BUMN perkebunan yang terbaik di Indonesia saat ini. Pola reward (penghargaan) dan punishement (hukuman) bila karyawan berbuat kesalahan yang mengakibatkan kerugian bagi perusahaan telah lama diterapkan. Untuk itulah maka setiap tahun selain menyambut tahun baru digelar pemberian penghargaan bagi setiap karyawan yang berhasil menunjukkan prestasi terbaiknya dalam kurun setahun. Megananda Daryono, Direktur Utama mengucapkan selamat kepada semua pemenang

dan berharap kinerja yang telah ditunjukkan dapat dipertahankan dan tentunya bisa meningkat lebih baik lagi di tahun-tahun berikutnya. Ia juga menyampaikan informasi pada saat itu bahwa PTPN III telah menginvestasikan dana sebanyak 60% untuk pembangunan pabrik gula yang baru di kecamatan Glenmore, kabupaten Banyuwangi, Jawa Timur. Peresmian pembangunan Pabrik Gula Glenmore (PGN) merupakan perusahaan patungan antara PT Perkebunan Nusantara III (Persero), PT Perkebunan Nusantara XII (Persero), dan PT Perkebunan Nusantara XI (Persero), dengan komposisi kepemilikan saham berturut-turut 60%, 30%, dan 10% yang telah diresmikan pembangunannya oleh Deputi Menteri BUMN bidang industri primer, M. Zamkani pada 12 Desember 2012 lalu. Dalam kesempatan yang sama, Achmad Manggabarani, Komisaris Utama mengingatkan semua pihak bahwa capaian target produksi dan keuntungan di tahun 2012 memang tidak seperti yang

diharapkan karena fluktuasi harga komoditas di pasar internasional untuk karet dan sawit mengalami penurunan yang sangat tajam dan berimbas pada perusahaanperusahaan sawit di Indonesia, sehingga keuntungan PTPN III untuk tahun 2012 berada di bawah RKAP. Manggabarani pada saat itu juga memperkenalkan Wakil Komisaris Utama PTPN III yang baru, Pandu Djajanto. Adapun kualifikasi untuk performa estetika kinerja kebun kelapa sawit terbaik diraih kebun Sei Kebara, untuk kinerja kebun karet terbaik diraih kebun Bandar Betsy, kinerja PKS terbaik diraih PKS Sei Meranti, kinerja PPK crumb rubber terbaik diraih kebun Membangmuda, kinerja PPK ribbed smoked sheet terbaik oleh kebun Gunung Para, performa estetika PKS terbaik diraih PKS Sei Sumut, performa estetika PPK ribbed smoked sheet terbaik diraih kebun Sei Silau. Sementara untuk kategori Proper (Program Penilaian Peringkat Kinerja Perusahaan) PKS dan PPK untuk penilaian

tahun 2011-2012 dengan peringkat hijau diraih PKS Rambutan, sedangkan peringkat biru diraih oleh PKS Sei Silaum PKS Sei Baruhur, PKS Torgamba, dan kebun Membangmuda. Untuk kategori lomba panen kelapa sawit dengan egrek juara pertama diraih oleh Suparlan dari kebun Tanah Raja, untuk panen kelapa sawit dengan dodos diraih Darmansyah dari kebun Torgamba, kategori sadap karet juara pertama diraih Pranoto dari kebun Merbau Selatan. Untuk kategori inovasi terbaik bidang tanaman dengan judul pengendalian hama oryctes rhinoceres diraih oleh kebun Ambalutu, untuk inovasi terbaik bidang admi keuangan diraih oleh kebun Torgamba dengan jdul proses perhitungan premi panen dan inovasi terbaik bidang teknik/ teknologi diraih oleh Pabrik Sungai Silau dengan judul modifikasi screw press merk MJS dan kimseng dengan kapasitas 1517 ton TBS/jam. Untuk kategori kreativitas bidang tanaman terbaik pertama diraih oleh kebun Hapesong

dengan judul pemanfaatan flying box GJ pada areal TM kelapa sawit di seberang sungai, bidang teknik/teknologi terbaik diraih kebun PKS Sei Sumut dengan judul pemasangan sistem alat pengatur kerja optimatisasi shaking grade pada kernel silo. Untuk kategori Srikat Pekerja Perkebunan tingkat Basis terbaik pertama tetap diraih berturutturut selama tiga tahun oleh kebun Sei Silau. Mailanta Bangun, Ketua SPBUN dalam kesempatan yang sama mengucapkan terima kasih yang setinggi-tingginya kepada manajamen khususnya Direksi karena komitmennya dalam memotivasi karyawan dan unit kerja yang ada di lingkungan perusahaan sehingga penghargaan yang diberikan bisa memacu kerja lebih kreatif dan lebih produktif. Ia berharap agar seluruh unsur pengurus SPBUN baik tingkat perusahaan maupun basis agar secara serius dan konsisten memotivasi anggota tetap giat bekerja demi produktivitas yang lebih tinggi lagi di tengah harga komoditas yang masih belum stabil. (AHS)

Perwakilan Jakarta: Suryadi, Lukman Nyak Abas. Medan: Heru Indrabudi, Darta Lubis, Andi Utama Nasution, SE, Wiryanto Hadi, Friyadi, Fernando Meliala, Brav Shandy Meliala, M. Arif Thahar. Biro Belawan: Jakfar Latif, Suriono. Sub Biro Medan Utara: Ahmad Muhajir, M. Saleh, M. Yakup. Sub Biro Amplas : - . Binjai/Langkat: Munir Rangkuti (Ka.Biro), Sabar Gurusinga, Mimpin Sitepu, M. Hayat, Ruslan AG, Dedi Nupita Sitepu, Hendera Ginting, T. Zulfikardin, Jumadi, Frisca Osela, Jefriyansyah, Syalamuddin. Langkat Hilir: Irfan Nasirin ST (Ka.Biro). Langkat Hulu: Teger Bangun (Ka. Biro). Deli Serdang: - . Tanah Karo: Farhan Parinduri (Ka. Biro), Aman Harahap Sub.Biro Pancur Batu: Friyadi, Amd. M Rizal Effendi Bako,SPdi, . Serdang Bedagai: Ibnu As (Ka.Biro), Suherman, Abdul Rahman. Tebingtinggi: Dirlan Effendi Ritonga (Ka.Biro). P Siantar/Simalungun: Drs Edward Pakpahan (Ka.Biro), Erikson Pakpahan, Drs. Kaliderman Siregar. Batubara: Suyanto (Ka. Biro), Jamilah (Waka Biro), Eko, S, Sunaryo Wijaya, Parlin Tampubolon. Asahan/Tanjungbalai: Sunaryo Wijaya, Wahidun. Labuhanbatu: -. Kotapinang/Labusel: Syamsul Siregar. Aek Kanopan/Labura: Sriwaty Sinuraya (Ka. Biro), L. Parulian Simarmata, SE. Sumbagut: Mhd Syahrul Hasibuan SH, Sutardi, Supendi. Dairi: Mangisi Lumban Gaol (Ka.Biro), Jiki Sagala (Waka Biro), Loedeik Simamora, Meslin Br Sigalingging, Duat Sianturi. Pakpak Bharat: Yusuf Manik (Ka.Biro). P Sidimpuan/Tapsel/Paluta: Sugiono SP (Koordinator), Safruddin Pulungan (Ka. Biro), Muhammad Srg, Baun Aritonang, Hasanuddin Siregar, Ibnu Saad Harahap, Unggul Fahmi Hasibuan. Kotanopan/Madina: Saharman Nasution (Ka Biro)-. Padang Lawas Selatan: Ali Akbar (Ka. Biro).Humbang Hasundutan: Mangatur Silaban (Koordinator), Rikardo Simamora (Ka. Biro), Chuharto Simamora, Pardomuan Silaban. Biro Taput: Mangatur Silaban (Ka. Biro) Biro Tapteng/Sibolga/Nias: - Per wakilan Riau/Kepri: EPP. Ringo-ringo, SE. Korwil Riau/Kepri: Rudi Sirait. Pekanbaru: Jaraya Garingging, S.Sos. Siak: Jaraya Garingging, S.Sos. Pelalawan/Pkl.Kerinci: EPP. Siringoringo (Ka.Biro), Lingkon S. Dumai: Albekri, Tengku Kamaruddin, Belwiyono, MG, Suhartono, Elias G.S.M Sidabutar. Bengkalis: Mahir Ritonga, Misron Tarihoran, Parulian Manurung, Novalis P. Hutahaen, Irwansyah Nasution, Alwi. Rokan Hilir (Rohil): Juminan (Ka.Biro), Basri M Noer, Supryanti, Julientri. Biro Rokan Hulu: -. Biro Kampar: -.Perwakilan Kepri/Batam: Herman Hendro Manurung (Ka Biro), Nelson Hutapea Perwakilan Aceh: T Muktarruddin US - . Biro Banda Aceh/Aceh Besar: T Muktarruddin US (Ka. Biro), Ibrahim Yusuf, Afrizal. Biro Pidie/ Pidie Jaya: Mahdi Aziz, SHi. Biro Langsa/Aceh Timur: Mustafa M. Adami, Syamsudin Arsyad. Aceh Tamiang: Zulherman (Ka Biro), Fori Zalmi Wandi Akbar- Biro Aceh Singkil/ Subulussalam: Rahmin Banchin (Ka. Biro), Henri, B,SE. Biro Aceh Jaya: Syarkawi. Aceh Barat: Kairul Aryadi. Biro Kutacane: . Lhokseumawe: - . Aceh Utara: Jamaluddin (Ka. Biro), M Suud, Ramli, Sayed Fauzi. Biro Blangkejeren/Gayo Lues: Antoni Nasipul. Biro Aceh Tengah/Bener Meriah: Al Muzaini (Ka Biro), Sabri (WARTAWAN BONGKAR NEWS DILENGKAPI IDENTITAS DAN NAMANYA TERCANTUM DALAM BOKS REDAKSI)

21 - 28 JANUARI 2013 | EDISI 343 | THN KE-VIII

Berbuat yang Terbaik untuk Sumut Hingga Akhir Hayat NAMA Drs H Djumiran Abdi tiba-tiba membuat geger Sumatera Utara. Pria berusia 62 tahun ini tibatiba didapuk menjadi calon Wakil Gubernur Sumatera Utara (Cawagubsu) mendampingi Effendi MS Simbolon yang diusung PDI Perjuangan, PPRN dan PDS sebagai Gubernur Sumut. Nama Djumiran Abdi memang selama ini tak menjadi buah bibir atau digadang-gadangkan menjadi Cagub atau Cawagub Sumut. Pria berambut putih ini memang dikenal sebagai tokoh Jawa di Sumatera Utara, namun ia selama ini lebih banyak beraktivitas di organisasi sosial kemasyarakatan usai pensiun menjadi birokrat. "Hidup saya ini mengalir saja. Setelah pensiun dari PNS, saya menikmati hidup dengan santai dan damai bersama isteri, anak dan cucu-cucu saya. Diminta untuk mendampingi Pak Effendi Simbolon, saya sangatnyatakan siap. Ini pengabdian terakhir saya untuk Sumut. Saya akan berbuat yang terbaik," kata Djumiran belum lama ini. Mantan Komisioner KPU Sumut periode 20032008 ini bukanlah wajah baru di dunia perpolitikan di

Sumut. Djumiran dikenal aktif berorganisasi sejak kuliah di Medan. Ia tercatat pernah menjadi pengurus DPD Golkar Medan periode 1984-1993. Djumiran juga pernah duduk di kepengurusan KNPI Sumut periode 1979-1984 sebagai Wakil Sekretaris. Sebagai tokoh Jawa, Djumiran juga mendedikasikan hidupnya dengan menjadi Ketua Paguyuban Putra Jawa Kelahiran Sumatera (Pujakesuma) sejak tahun 1996-2005. Selama 10 tahun itu, Djumiran membesarkan Pujakesuma bersama para tokoh Jawa lainnya di Kota Medan. Selain itu, Djumiran juga kini memegang sejumlah jabatan di organisasi kemasyarakatan seperti menjadi Ketua Persatuan Wredatama Republik Indonesia (PWRI) Kota Medan sejak tahun 2006 hingga sekarang. Ia juga didapuk menjadi Wakil Ketua Forum Kewaspadaan Dini Masyarakat Sumut serta menjabat Wakil Ketua Kwarda Pramuka Sumut. "Sebenarnya saya juga terkejut diminta jadi Cawagubsu. Saya dulu pernah mendaftar sebagai Cawagubsu 10 tahun lalu, tapi kali ini berhasil,"

ucapnya dengan penuh semangat. Sebelum terjun ke dunia sosial kemasyarakatan, Djumiran dikenal sebagai birokrat yang bersih di Pemko Medan. Ia dipercaya menduduki berbagai jabatan strategis oleh dua Walikota Medan, yakni H Bachtiar Djafar dan H Abdillah. Selama rentang waktu dari tahun 1993-2003, ia menduduki jabatan seperti Kadis Pertamanan Kota Medan, Direktur Utama Perusahaan Daerah (PD) Rumah Potong Hewan, Direktur Utama PD Kebersihan. "Kuncinya keikhlasan mengabdi. Saya juga tak neko-neko hidup ini. Yang penting bagi saya ya bekerja. Saya biasa Salat Zuhur dan Ashar di Masjid Agung Medan. Di sana biasanya saya beserta kawankawan ngobrol sambil menunggu waktu salat," terangnya. Kesederhanaan itu juga ditunjukkan dalam kesehariannya. Djumiran kerap dijumpai berkemeja putih lengan pendek. "Ini uniform saya setiap hari. Saya ini cuma punya dua motif baju yaitu warna putih dan batik," ucap Djumiran sambil tersenyum.(r)

Effendi Simbolon Didoakan Ephorus HKBP

Hasyim dan Djumiran Abdi Bantu Korban Kebakaran

Medan,BN Bendahara Partai Demokrasi Indonesia Perjuangan (PDIP) Kota Medan, Hasyim SE, menyerahan bantuan semen kapada korban kebakaran di Jalan Arief Rahman Hakim, Gang Bakung, Senin (14/1).

Penyerahan bantuan menyertakan calon Wakil Gubernur Djumiran Abdi. Hasyim SE mengatakan, bantuan ini merupakan bentuk kepedulian Djumiran Abdi selaku Cawagubsu dari PDI Perjuangan kepada masyarakat yang tertimpa musibah.

Apalagi keinginan pasangan Nomor urut 2 dalam pilkada Gubsu ini adalah mensejahterahkan masyarakat. Sementara itu, Calon Wakil Gubernur Djumiran Abdi yang berpasangan dengan Effendi Simbolon mengatakan, penyerahan

bantuan bahan bangunan berupa semen sebanyak 104 sak ini, sekadar untuk membantu para korban kebakaran kiranya dapat membangun rumahnya kembali. Kordinator korban kebakaran Alwi mengatakan, pada 2012 sudah dua kali terjadi musibah kebakaran di Kelurahan Tegal Sari. Dikatakan, kebakaran pertama terjadi 6 Pebruari 2012, sebanyak 87 rumah di Gang Bakung dan Gang Tanjung habis terbakar. Apresiasi Namun yang patut diapresiasi adalah, lanjut Alwi, kepedulian kader PDI Perjuangan Hasyim SE. Sesaat setelah terjadi musibah kebakaran, Hasyim juga Ketua Fraksi PDI Perjuangan DPRD Medan langsung membuat posko dan memberikan bantuan. "Bukan itu saja Hasyim juga membantu mengurus air PDAM Tirtanadi bagi korban kebakaran secara gratis begitu juga dengan instalasi PLN" jelasnya. Diejelaskan, kebakaran kedua pada Jum’at 21 September 2012 yang menghanguskan 8 rumah di daerah yang sama hanya beda gang. Ketika terjadi kebakaran juga Hasyim SE dan para pengurus PAC PDIP Medan Area bergerak membantu masyarakat yang tertimpa musibah. "Kini Hasyim kembali datang dan membantu bahan bangunan berupa semen. Mudah-mudahan bantuan ini bermanfaat bagi korban kebakaran, dan semoga Pak Hasyim sukses meniti karirnya," ujar Alwi. (r)

Siantar,BN Ephorus HKBP Ompu Pdt WTP Simarmata serta Ketua STT HKBP Nomensen Pdt Dr Darwin Lumbantobing mengulosi, mendoakan dan merestui Cagubsu Effendi MS Simbolon untuk merebut hati masyarakat Sumatera Utara pada Pilgubsu mendatang. Prosesi perestuan itu saat Effendi berkunjung ke Sekolah Tinggi Theologia HKBP Nomensen Siantar, Selasa (15/1) siang. Effendi datang untuk mendengarkan kuliah umum dan bersilaturahmi dengan staff pengajar serta seluruh mahasiswa. Dia mengaku lama tidak berkunjung ke sana. Effendi menggambarkan, suasana kampus masih memberikan aroma damai dan ketenangan, dan harapan. Kondisi seperti itu, dinilai harusnya dimiliki setiap lembaga pendidikan. "Tak banyak yang berubah dari kampus ini. Suasana yang tergambar masih suasana damai, tenang dan menggambarkan harapan. Ini masih menunjukkan aroma kekristenan HKBP," ujar Effendi MS Simbolon di hadapan staf pengajar dan mahasiswa STT seusai ibadah pembukaan semester baru STT HKBP Nomensen. Effendi berharap para mahasiswa yang nantinya akan menjadi penggembala jemaat HKBP bisa meneruskan cita-cita pendiri HKBP. "Adek-adek memiliki tugas dan tanggung jawab untuk meneruskan cita-cita pendiri HKBP untuk menjadi gembala jemaat HKBP," sebut Effendi yang juga meminta doa untuk perjuangannya menjadi Gubernur Sumatera Utara. Ephorus HKBP Ompui Pdt WTP Simarmata yang berkesempatan memberikan kuliah umum mengatakan, hadir di STT dan memberikan kuliah umum mengingatkannya kepada masa-masa ia menjadi dosen pengajar yang baru berhenti semester lalu. WTP Simarmata bercerita bagaimana ia menerapkan pola bersahabat dengan para mahasiswa dengan mengajak sarapan bersama usai kuliah subuh. Ini menurut WTP Simarmata menjadi salah satu cara mendidik mahasiswa. Karena seorang dosen yang baik adalah dosen yang bisa bersahabat dengan mahasiswa. "Dosen yang baik itu adalah dosen yang bisa membawa mahasiswanya keluar dari permasalahan hidup sehari-hari," ujar WTP Simarmata. Menurutnya, untuk bisa menghadapi tantangan zaman, HKBP harus mulai melakukan pembaruan. Pembaruan itu bukan hanya di kulit saja, tetapi harus menyentuh hingga ke dalam. "Kita mau pembaharuan yang kita lakukan itu seperti yang dilakukan kepompong. Awalnya memang terlihat menjijikkan, tetapi setelah berubah menjadi kupu-kupu maka akan terlihat lebih indah, lebih berwarna. Pembaruan lebih berwarna ini juga lah yang kita inginkan untuk Sumatera Utara," imbuh WTP Simarmata. Sebelumnya Ketua STT HKBP Nommensen Pdt Dr Darwin Lumbantobing mengatakan, Effendi MS Simbolon bukan orang baru di lingkungan HKBP, karena hingga saat ini masih berperan serta dalam pengembangan HKBP Menteng, Jakarta, sebagai dewan penyantun dan penasihat. (rel)

Masyarakat Pantai Barat Dambakan Sosok Gus Irawan Rapimcab Partai Gerindra Marelan Madina, BN Masyarakat kawasan Pantai Barat meliputi Kecamatan Natal, Muara Batang Gadis, Batahan, Sinunukan, Lingga Bayu mendambakan sosok Gus Irawan Pasaribu untuk memimpin provinsi Sumatera Utara periode 2013-2018. "Selama memimpin salah satu perbankan Gus Irawan sudah menunjukkan kepiawaiannya, maka kami optimis Sumut akan sejahtera di bawah kepemimpinannya," ujar salah seorang ketua koperasi yang juga tokoh masyarakat Kecamatan Natal Baharudin kepada wartawan, Rabu (16/1). Dikatakan, dalam kepemimpinannya Gus Irawan memiliki program-program perbankan yang menyentuh langsung kehidupan masyarakat. "Program itu tentunya yang berorientasi untuk peningkatan kalangan usaha menengah ke

bawah, " katanya. Selain itu katanya, Gus Irawan bukan dari kalangan politik, birokrasi, melainkan dari kalangan profesional. "Dengan basik itu, kami yakin taraf perekonomian masyarakat akan semakin meningkat di bawah kepemimpinannya nanti," tegasnya. Hal senada dikatakan, Nurman (45) salah seorang warga SikaraKara, Kecamatan Natal, Kabupaten Madina yang menilai programprogram yang dijalankan Gus Irawan saat memimpin perbankan dapat diadopsi dalam percepatan pembangunan dan peningkatan kesejahteraan masyarakat. "Awalnya, usaha saya tidak bisa berkembang karena keterbatasan modal, namun setelah mengikuti program-program Gus Irawan, maka usaha saya dapat berkembang. Banyak pengusaha UKM yang berkembang karena

mengikuti program Gus selama ini," ungkapnya. Sementara Darasan (40), warga Aek Godang, Kecamatan Muara Batang Gadis, Kabupaten Madina mengatakan, masyarakat didaerahnya sudah banyak merasakan dampak program Gus Irawan, terutama warga miskin yang tidak

mempunyai modal untuk membuka usaha. "Ya, setelah mengikuti program Gus Irawan, ekonomi masyarakat di desa ini mulai naik, karena program Gus Irawan selama memimpin salah satu perbankan di Sumut, membantu peningkatan ekonomi masyarakat," ujarnya.(r)

Medan,BN Rapat pimpinan anak cabang (rapimcab) Partai Gerakan Indonesia Raya (Gerindra) Kecamatan Medan Marelan,tampak mendapat pujian dan sambutan hangat, dari para pimpinan DPD Sumut juga DPC Kota Medan, yang hadir pekan lalu, di Jalan Paluh Nibung, Kel.Paya Pasir, Kec, Medan Marelan. Hal itu diketahui, saat gelar rapat yang dihadiri langsung ketua DPD Partai Gerindra Sumut, Ramses Simbolon, ketua DPC Kota Medan, Yohanna Pardede SH, bersama jajaranya,memuji terlaksananya kegiatan Rapimcab, tepat waktu sesuai yang diprogramkan. “Kita selaku pengurus DPD Sumut, menyampaikan rasa hormat dan terima kasih kepada pimpinan PAC Partai

Gerindra Medan Marelan, Surianto SH (Butong), menjalankan program organisasi dan dapat melaksanakan Rapimcab sesuai struktural organisasi serta tepat waktu� kata Ramses. Disebutkan Ramses lagi bahwa, Rapimcab, merupakan program dalam roda organisasi, dan merupakan hal strategis, untuk mensukseskan tugas secara struktural partai, dan hal ini merupakan catatan untuk laporkan kita (DPD Partai Gerindra Sumut red) kepimpinan DPP Jakarta. Jadikan partai untuk membentuk persaudaraan yang sejati (satu idiologi red), sebab belum tentu hal itu didapat diluar organisasi, bahkan dalam satu keluarga sekalipun, sehingga apa yang menjadi tujuan akan terlaksana dengan

sukses, jelas Ramses Simbolon. Hal senada juga disampaikan pimpinan DPC Partai Gerindra Kota Medan, Yohanna Pardede SH, dan menambahkan bahwa Rapimcab, selain efektif dalam menjalankan struktural organisasi, juga dapat dijadikan pengawasan terhadap pengurus/anggota dalam soliditasnya. Surinto SH (Butong), selaku ketua PAC Partai Gerindra, dalam laporan kegiatan Rapimcab, yang dibacakan Dedek Sofia M, selaku sekertaris, antara lain menyampaikan hasil kerja, berhasil membentuk sejumlah 5 pengurus ranting dan 20 pengurus anak ranting seKecamatan Medan Marelan, serta menjalankan secara keseluruhan program organisasi secara structural.(San)

Wushu Indonesia Sumut Dapat Apresiasi KETUA Umum KONI Sumut H Gus Irawan Pasaribu SE Ak memuji dan memberi apresiasi atas program Pengprov WI Sumut pimpinan Master Supandi Kusuma yang menjadikan Kejuaraan Provinsi (Kejurprov) Wushu Sanda Yunior dan Senior Sumut 2013 sebagai sarana penjaringan atlet untuk pembinaan jangka panjang. Pujian dan apresiasi tersebut disampaikan Gus Irawan Pasaribu ketka membuka Kejuaraan Provinsi (Kejurprov) Wushu Sanda Yunior dan Senior Sumut 2013 di Gedung Serba Guna Unimed, Jumat (18/1). "Kami berterimakasih dan memberi apresiasi kepada Pengprov WI Sumut yang menjadikan Kejurprov Wushu Sanda Yunior dan Senior 2013 untuk menjaring atlet potensial yang nantinya digembleng untuk pembinaan jangka panjang," ulang Gus Irawan. Dikatakan, langkah yang dilakukan Pengprov WI Sumut sangat tepat, khususnya guna menjaga kesinambungan, atau regenerasi atlet. Disamping itu, program ini

nantinya diyakini akan membuat Wushu Sanda Sumut yang di PON XVIII/2012 di Pekanbaru menyumbangkan 3 medali emas 3 perak dan 1 perunggu, bisa lebih berprestasi. Sebab itu kepada seluruh peserta Kejurprov, Gus yang juga Calon Gubsu Sumut ini meminta untuk memperlihatkan talentatalenta terbaiknya karena event ini memang diharapkan untuk melahirkan pesanda wushu terbaik masa depan. Gus juga menyebutkan, sejarah mencatat, wushu Sumut sebenarnya memiliki potensi luar biasa. Buktinya, di Wushu Taolu atlet asal Sumut Lindswell pernah menjadi Juara Dunia Junior 2008 di Bali dan Juara Dunia Senior 2009 di Toronto Kanada. Sukses di nomor taolu ini diharapkan menjadi motivasi bagi atlet-atlet Wushu Sanda Sumut untuk menorehkan prestasi lebih baik, khususnya di tingkat internasional. "Kita berharap, Wushu Sanda Sumut juga bisa menjadi nomor satu," tegas Gus

Irawan. Dalam kesempatan tersebut ia kembali menyampaikan terimakasih kepada Master Supandi Kusuma selaku Ketua Umum PB WI yang

memilih Sumut sebagai tempat Pelatnas Tim Wushu SEA Games Indonesia. "Ini merupakan kebanggan kita sebagai orang Sumut, karena dipilih

menjadi tuan rumah Pelatnas Wushu," pungkasnya. Sebelumnya, Ketua Pengprov WI Sumut diwakili Serketaris Iwan Kwok memang menjelaskan, event

ini dijadikan pihaknya sebagai ajang mencari atlet-atlet berprestasi yang akan dibina lebih berkesinambungan untuk menghadapi event nasional dan internasional. Sedangkan, Ketua Panitia Rahman Situmeang melaporkan, kejurda ini diikuti 11 kabupaten/kota dengan jumlah atlet 122 orang. Even ini berlangsung hingga Minggu (20/1) besok. Ada pun daerah yang ambil bagian pada kejurda ini, yaitu Kota Medan, Tanah Karo, Pematang Siantar, Toba Samosir, Tapanuli Tengah, Tanjung Balai, Sibolga, Simalungun, Tapanuli Utara dan Humbang Hasundutan. Turut hadir pada acara pembukaan Ketua Harian KONI Sumut John Ismadi Lubis, Sekum Chairul Azmi Hutasuhut MPd, Dekan FIK Unimed Drs Basyaruddin Daulay, Ketua Bapopsi Sumut H Sakiruddin SE MM dan para pengurus Pengkab dan Pengkot WI se-Sumut. Usai pembukaan langsung dilanjutkan dengan menggelar babak penyisihan. (r)

Harga Eceran Rp 3500,Luar Daerah + Ongkos Kirim



21-28 JANUARI 2013| EDISI 343| THN KE-VIII


Saksi Mengaku Lupa

Oknum Kontraktor Tojok Bibir Wartawan ACEH TAMIANG,BN Tindakan kekerasan dan ancaman kerap kali terjadi yang biasa dirasakan oleh seorang kuli tinta ,hal seperti ini terjadi kembali ditanah bumi muda sedia Kabupaten Aceh Tamiang, Pada Jumat jumat jam 11.15 wib ( 18/1). Tindakan kekerasan kali ini di lakukan oleh seorang oknum kontraktor kawakan Kalid Arfan yang sering di sebut sebut Mengusai proyek miliyaran rupiah yang ada di dinas PU Aceh Tamiang. Impormasi di Proleh Wartawan dari korban yang bernama Rudi Kurniawan alias Dedi BACA OKNUM KONTRAKTOR


Minta Bupati Turun Jabatan

Massa Demo DPRD Madina MADINA,BN Kurang lebih 3000 orang massa berunjuk rasa ke DPRD madina yang dipimpin aliansi, ulama, masyarakat, pemuda, mahasiswa, melakukan unjuk rasa ke DPRD Madina (17/1). Untuk meminta Bupati Madina Hidayat Batubara segera diturunkan dari jabatannya. Para pengunjuk rasa tiba di gedung DPRD Madina jam 11.00 wib dengan mengendarai sepeda motor, angkutan kota, mobil pribadi. Pengunjuk rasa yang berada di halaman gedung DPRD Madina memampangkan sepanduk dan poster yang bertuliskan hujatan kepada bupati madina Hidayat Batubara berorasi dan membacakan pernyataan sikap yang ditanda tangani H.Baist Nasution, LC.MA, H.Yahyanuddin, S.Ag, H.Kamaruddin Pulungan, Mangaraja Kumala Oloan Nst, Samsul bahri Matondang, Irawansyah Nasution, Miswaruddin Daulay, ustadz Kembar dan Ahmadi Irwandi Nst. Dalam pernyataan sikap aliansi menyatakan bahwa bupati madina Hidayat Batubara diduga melanggar pasal 29 UU nomor 32 tahun 2004. dengan alasan pertama hingga saat ini 1,7 tahun pemerintahan bupati madina Hidayat Batubara belum menunjukkan pelaksanaan visi misi pendidikan gratis, kesehatan gratis, lapangan kerja baru, secara signifikan. Kedua Hidayat Batubara dinilai tidak memiliki sensitifitas dan kepedulian terhadap permasalahan-permasalahan sosial konflik pertambangan, konflik perkebunan dan kenakalan remaja, aliansi menilai bupati madina tidak menunjukkan sikap mengayomi dan membina aparatur pengangkatan pajabat eselon. tidak BACA MASSA DEMO HAL..10

Akibat Dipertanyakan Surat Nikah, Korban KDRT Gagal Buat Pengaduan Pangkalan Berandan , BN Ibu muda beranak satu, Sari (19) menjadi korban kekerasan dalam rumah tangga (KDRT) yang dilakukan suaminya Sulistio (33) warga Gotong royong Pelawi Darat P. Berandan ke aparat kepolisian.Tidak tahan dianiaya Sari yang baru melahirkan membuat bikin pengaduan di Polsek Berandan, (15/1) Oleh Kapolsek Pangkalan Brandan, AKP Zainuddin Lubis menyarankan agar Sari mengambil visum dari rumah sakit guna melengkapi berkas pengaduan. Namun saat berada di ruang pemeriksaan untuk Berita Acara Pidana ( BAP) oleh Juper Surasdianto,hampir selesai. "Tiba-tiba Kanit serse Iptu Iswanto menyarankan untuk mengambil surat nikah yang bertujuan memperkuat pengaduan", ujar Sari. Permintaan kanit serse tentu membuat hati Sari menjadi gundah gulana dan berniat untuk menarik kembali pengaduannya. "Bagaimana hendak mengambil surat nikah sementara suaminya sendiri berada di rumah dan kondisi rumah tangga mereka sedang panaspanasnya", ujarnya lagi sambil memelas.(tim)

Sekretaris Unit Layanan Pengadaan (ULP) Barang dan Jasa Kabupaten Pakpak Bharat,Sukardi Martages Purba,David Karosekali dan beberapa saksi lainya saat memberikan kesaksian dugaan korupsi, pembangunan Pembangkit Listrik Tenaga Micro Hydro (PLTMH) Lae Mrempat, didepan Majelis Hakim Tipikor diruang Cakra 1,Selasa (15/1). (Foto/ BN/pb.007)

PAKPAK BHARAT, BN Sidanglanjutan kasus Korupsipengadaan Pembangkit Listrik Tenaga Micro Hydro (PLTMH) Lae Mrempat, Kecamatan Sitellu Tali Urang (STTU) Jehe APBD Tahun 2009 sekitar Rp. 800 juta di Dinas Kehutanan Pakpak Bharat dengantigaorang terdakwa, mantan Kadis Kehutanan,Ir Sujarwo, Pejabat Pelaksana Teknis Kegiatan (PPTK) Bahrum Sihotang serta Mangiring Purba selaku pihak rekanan,kembali digelar di ruang Cakra I Pengadilan Tindak Pidana Korupsi (Tipikor) Medan, Selasa(15/1) laludengan agenda mendengarkan keterangan saksi-saksi. Jaksa Penuntut Umum (JPU) dari Kejari Sidikalang,Perana Manik SH MH menghadirkan enam orang saksi untuk didengar kesaksiannya didepan Majelis Hakim yang diketuai oleh Jonny Sitohang SH MH didampingiduaHakim Anggota. Keenam saksi yang akan didengar keterangannya terlebih dahulu disumpah didepan majelis hakim adalah,Sukardi Martages Purba, Sekretaris Unit Layanan Pengadaan (ULP) Barang dan Jasa Kabupaten Pakpak Bharat,David Karosekali Anggota ULP,Rahman Kudadiri,Ketua Tim PHO/FHO (penerima barang),Sariani Maharaja selaku sekretaris Tim PHO/FHO,Siprin Manikbendahara pengeluaranserta Benny Boangmanalu sebagaipengawas. BACA BANTUAN DANA HAL..10

Penampungan CPO dan BBM Illegal Digerebek HANYA BEBERAPA HARI TUTUP KEMUDIAN LANGSUNG BEROPERASI RIAU,BN Petugas Tim gabungan dari TNI, Polri dan Polisi militer (PM) Pertengahan desember 2012 pada bulan lalu merajia sejumlah lokasi penampungan BBM dan CPO yang diduga illegal. Penggrebekan dilangsungkan pada senin 10/12 yang lalu disejumlah lokasi tempat penampungan ilegal.mulai dari Kandis kabupaten siak , daerah

pinggir kabupaten bengkalis serta Rohil dan Wilayah Dumai. beberapa mafia BBM dan CPO diwilayah kecamatan bukit kapur Dumai jadi kebakaran jenggot . Toke mafia penampung gelap minyak CPO itu aman aman dan “selamat”. pantauan wartawan Koran ini , beberapa petugas melakukan rajia.tetapi sebagian penampungan Minyak CPO dan BBM sudah keburu ada yang tutup . sehingga petugas tidak dapat menemukan berupa barang bukti. saat tim petugas

turun merajia ke lokasi, tampak beberapa pekerja dipenampungan BBM illegal dan dilokasi penampungan CPO kelabakan, bahkan ada yang lari lintang pukang bak seperti rusa yang hendak disergap harimau bersembunyi. Petugas berhasil mengamankan puluhan drum minyak solar dan minyak CPO illegal. Ironisnya Toke alias Bigbos selaku pemilik usaha illegal itu tidak ada yang ditangkap pihak berwajib saat rajia tersebut. Sesuai keterangan dirangkum media ini

dilapangan (di wialayah dibagan besar kecamatan bukit kapur) tepatnya ketika ada rajia pada senin 10/12 pukul 16.00 wib beberapa lokasi penampungan BBM illegal itu tampak sepi , diduga kuat karena rajia sudah keburu duluan bocor. Sehingga mafia tersebut berupaya dengan cepat mengamankan barang tadahannya berupa CPO dan BBM. Dan untuk sebahagian lokasi penampungan illegal itu sedang diperiksa TIM Petugas ,tampak BACA PENAMPUNGAN GELAP HAL..10

Traffic Light Asal Jadi

Pemkab Aceh Barat, Rombak Kabinet MEULABOH,BN Pemerintah Kabupaten Aceh Barat, Jumat (18/1) melakukan perombakan terhadap 311 pejabat di lingkup Pemkab Aceh Barat di aula Setdakab. acara pelantikan pejabat eselon II, III, dan IV itu turut dihadiri Muspida, dan pejabat terkait lainya. Sebanyak 311 pejabat yang dimutasi, 21 diantaranya kepala satuan kerja perangkat kabupaten (SKPK), juga 12 camat dalam Aceh Barat. Bupati Aceh Barat, Alaidinsyah usai acara

pelantikan, mengingatkan kepada seluruh Pejabat yang dilantik, agar meningkatkan semangat dan prestasi kerja atas dasar kemampuan yang dimiliki. Serta menyempurnakan perbaikan kerja yang semakin efektif. “kita meminta kepada saudara adanya perubahan positif dari pelaksanaan tugas dan jabatan yang diamanahkan” katanya. Menurut Bupati , Pemutasian tersebut dilakukannya, atas dasar pertimbangan Baperjakat, guna mencapai percepatan pemban-

gunan dan kesejahteraan masyarakat ke depan. “ saya akan selalu memantau dan mengavaluasi kinerja saudara-saudara, dan hasil evaluasi itu akan menjadi catatan bagi saya untuk pertimbangan karir saudara nantinya” papar Alaidin. Ia mengharapkan kepada Pejabat yang telah dilantik, agar tidak menyia-nyiakan kepercayaan yang telah diberikan, selain itu Bupati juga berpesan agar para pejabatnya tidak melakukan perbuatan yang melanggar hukum nantinya. (@rul)

PTT KPPN Sepelekan Dinas Lingkungan Langkat Langkat BN Walau sudah diperingatkan berulang kali oleh Dinas Lingkungan Hidup Kabupaten Langkat namun PT KPPN masih juga membandel dengan melakukan pengorekan di sekiar Daerah Aliran Sungai (DAS). "Perusahaan galian C ,PT KPPN yang terletak

di Desa Perhiasan Kecamatan Selesai sampai saat ini masih melakukan pengorekan pasir", ujar warga setempat.Hal ini tentu saja dapat menimbulkan erosi sehingga ekosistem alam terganggu. Menurut warga PT KPPN sudah perbah dieperingatkan setahun yang lalu tapi diduga

memiliki beking maka pihak pengusaha seakan besar kepala dan tidak menanggapi. "Pihak Dinas Lingkungan Hidup Kabupaten Langkat harus bertindak tegas dengan menyita alat-berat yang dipergunakan PT KPPN dan melaporkannya ke pihak berwajib", tegas warga.(tim)

ACEH TAMIANG, BN Trafick ligh yang dipasang pada persimpangan jalan kota kualasimpang aceh tamiang dibuat asal jadi sehingga sebahagian besar lampu nya tidak berfungsi. Lampu merah, kuning, hijau (Trafick Ligh) yang dipasang oleh dinas perhubungan aceh tamiang pada anggaran 2007 tersebut diindikasikan oleh masyarakat dan Himperata dibeli/diadakan tidak sesuai spek dan dipasang asal jadi sehingga beberapa titik rawan kecelakaan lampunya tidak berfungsi. Ketua Himperata joko menilai trafik laigh yang dipasang hanya buang-buang uang daerah saja, kalau memang mau dipasang, buatlah yang sebenarnya sehingga berguna bagi pemakai jalan dan dapat mengurangi kecelakaan lalulintas tetapi sebaliknya dijelaskan Rijal kalau dibeli barang rongsokan dan dipasang asal jadi lebih baik tidak usah dipasang sebab hanya akan menjadi pantasi saja. Selain itu ditambahkan joko trafick laigh berfungsi tidak normal jarak waktu pertukaran lampu merah ke hijau antar persimpangan tidak singkron dan sering membingungkan pemakai jalan, dalam hal ini diharapkan kepada dinas perhubungan agar segera menata kembali fungsi lampu dan segera meminta pertanggung jawaban bagi rekanan yang terlibat dalam pengadaan trafik laigh tersebut. Ketua atcw aceh tamiang edi rinaldi menambahkan bahwa Pemda Aceh Tamiang baik DPRK maupun Dinas terkait dalam mengusulkan dan menganggarkan pengadaan trafik laigh harus secara professional tidak asal jadi apa lagi yang dibeli barang bekas, hal ini harus dihindari dan mestinya dapat pengawalan ketat dari tim teknis pada saat serah terima barang. BACA TRAFFIC LIGHT HAL..10

Huru-hara di Fraksi Demokrat DPRD Sumut

Mantan Terpidana Protap Diminta PAW Huru hara yang dipertontonkan Fraksi Demokrat pada setiap sidang Paripurna DPRD Sumut semakin meyeruak dengan aksi-aksi yang dilakukan kader-kader Partai Demokrat baik itu di gedung dewan maupun di kantor DPD Partai Demokrat itu sendiri.

Laporan: ALFINDO, Medan KAMIS (17/1),ratusan massa dari masyarakat Deli Serdang dan Mahasiswa serta LSM Forum Komunikasi Masyarakat Madani Sumatera Utara menggelar aksi unjuk rasa di kantor DPRD Sumut, menggugat mantan terpidana kasus Protap,Tahan Manahan Panggabean sebagai anggota DPRD

Sumut. Kordinator Aksi, Syaibun mendesak Badan Kehormatan DPRD (BKD) Sumut melakukan pergantian antar waktu (PAW) terhadap Tahan sesuai dengan tata terbit DPRD Sumut Nomor 10/ K/2012 karena Tahan dilantik sebagai anggota DPRD Sumut masih berstatus terdakwa yang diancam hukuman 7 tahun penjara. Untuk itu, Tahan menjalani tugas sebagai anggota DPRD Sumut tidak sah karena status yang bersangkutan bertentangan dengan Undangundang (UU) Nomor 10 tahun 2008 pasal 218 ayat 1 dan 2, PP Nomor 16 tahun 2010 terkait pergantian antar waktu. Sementara itu, keputusan Mahkamah Agung BACA MANTAN HAL..10

21-28 JANUARI 2013 | EDISI 343| THN KE-VIII

Relawan Amri RE Tebingtinggi Bantu Korban Kebakaran

TEBINGTINGGI.BN KetuaRelawanPemenanganPasanganCagubsuNo4H AmriTambunandanRENainggolanKotaTebingtinggi,Frans EdySinagaSEdidampingisejumlahpengurusmenyerahkan bantuankepadakorbanmusibahkebakarantigaunit rumah yang terjadi Jumat malam (11/1) di Jalan Bakti Kelurahan Damar Sari Kecamatan Padang Hilir KotaTebingtinggi. Bantuan pasangan Cagubsu No.4 yang disalurkan melalui Relawan Pemenangan Amri RE berupa material bahan bangunan terdiri dari batu bata, pasir, semen dan kerikil serta bingkisan sembako dan uang tali asih itu

Puluhan Warga Desa Bandar Bayu Unjuk Rasa ke Kantor Bupati Sei Rampah,BN Sedikitnya 40 orang warga Desa Bandar Bayu Kec.Kotarih yang sebagian besar kaum Ibu rumah tangga (IRT) menduduki teras Kantor Bupati Serdang Bedagai di jl.Negara Desa Sei Rampah Kec.Sei Rampah.Senin(14/1). Aksi tersebut sebagai bentuk tuntutan agar Kepala Desa mereka dipecat. Ketua BPD Bandar Bayu, Lioner Purba, Johaman Saragih (51), Dedy Sipayung (35), Rotua Purba(35) mewakili puluhan warga mengatakan aksi dipicu sikap tidak pedulinya Kades kepada warganya. Pengurusan surat-menyurat sulit, saat ada kemalangan maupun pesta sang Kades tak pernah hadir, serta penggunaan Alokasi Dana Desa (ADD) tidak jelas. Aksi memuncak setelah pihak perkebunan karet PT.SRA memasang pilar (batas) tanah perkebunan dari coran beton setinggi satu meter pada malam hari, pilar-pilar tersebut masuk ke areal batas tanah warga. “Ironisnya Kades tetap diam dan tidak bertindak,” ungkap Lioner Purba yang diamini puluhan warga lainnya. Mereka berharap Bupati Sergai memberhentikan Kades yang tidak peduli dengan warga. Perwakialn warga diterima Asisten I Pemkab Sergai, Rudi Sitorus, SH, Kaban BPMPD, H.Ifdal,S.Sos,MAP, Kakan Kesbag Polinmas,Drs,Ramses Tanbunan dan Kabag PMD, Sudarno,S.Sos. Hasil pertemuan Asisiten I menerima tuntutan warga dan akan turun ke lapangan karena tuntutan warga berkaitan dengan beberapa SKPD yang akan ditindaklanjuti di Kantor Camat Kotarih. Setelah itu puluhan warga Desa Bandar Bayu membubarkan diri dan beranjak dari Kantor Bupati Sergai. Sementara Kepala Desa Rasiaman Damanik ketika dihubungi telepon selulernya tidak aktif.(Ibnu)

diterima langsung Saniah, Edi Damanik dan Erwin yang merupakan korbanmusibahkebakaranyanghinggakini menempatitendadarurat bantuandariDinsossetempat, sembarimenunggurumahmerekadirehab kembali.Pada kesempatan itu, para korban kebakaran juga menerima bantuan tali asih dari HjYusniar Sunartopo. Frans Edi Sinaga mengatakan, pemberian bantuan itu merupakan ‘setawar sedingin’ bagi korban musibah kebakaranyangmemusnahkanketigarumahyangletaknya berdampingan. “Atas nama Tim Pemenangan Amri RE dikotaini,kamiturutprihatinatasmusibahyangmenimpa

saudarakita,siapapuntidakmenginginkankejadianseperti ini.Sebagaimakhluksosialdanhidupberdampingansudah selayaknyakitasalingmeringankanbebandarimusibahyang kini sedang menimpa keluarga ini”, ujar Frans Sinaga. Dijelaskanjuga,bantuanyangdiberikanitumerupakan supportbagiparakorbanmusibahkebakaranyangterjadi akibatmeledaknyatabunggaselpiji3kilogram.“Inibukan kampanyemelainkansupportdanpenjemputsemangat, seperti kita ketahui bersama bahwa sosok Bapak H Amri Tambunan memang memiliki jiwa sosial yang tinggi, beliau lebih mengedepankan kegiatan sosial seperti ini

daripada kegiatan hura-hura”, tutur Frans. Saniah, perwakilan dari korban musibah kebakaran mengucapkanterimakasihataskunjungandanbantuan yang di berikanTim Pemenangan Pasangan Cagubsu No. 4 Amri RE Kota Tebingtinggi kepada mereka,“Kami para korbanmusibahkebakaranmerasaterharudanbersyukur sebab masih ada yang peduli dengan penderitaan yang kami alami saat ini, terima kasih kami sampaikan kepada Relawan Pemenangan H Amri Tambunan dan RE Nainggolan, semoga mendapat balasan yang berlipat gandadariTuhanYangMahaEsa”, katanya.(DER)

Perguruan Karate Kota Tebing Tinggi Gelar Gashuku Bersama TEBING TINGGI | BN Perguruankarate-doseKotaTebingtinggimenggelar gashuku (latihan) bersama untuk menjalin tali silaturrahmiyangbekerjasamadenganDisporabudpar, sekaligus memberikan penghargaan kepada Pembina Olahraga Karate di KotaTebingtinggi, Jumat sore (18/1) di Lapangan MerdekaTebingtinggi. Pemberian penghargaan diberikan kepada Walikota Tebingtinggi diwakili Staf Ahli Ismail Budiman SH, Kadisporabudpar diwakili Drs Saptono Sapri dan Ketua Umum KONI Kota Tebingtinggi HM Daniel Sulthan SE oleh empat perguruan masingmasing TAKO, KKI, Inkanas dan KKNSI. Walikota Tebingtinggi Ir H Umar Zunaidi Hasibuan MM dalam bimbingan tertulis yang dibacakan Staf Ahli Ismail Budiman SH mengatakan bahwa kegiatan gashuku ini akan memberikan semangat bagi para atlit karateka dan dapat memotivasi dalam meningkatkan prestasi, yang saatnya nanti akan melahirkan atlit-atlit yang

berbakat untuk membawa nama Kota Tebingtinggi khususnya dan nama bangsa Indonesia pada umumnya, “gashuku bersama dilaksanakan menyamakan gerak dan membina mental para atlit dalam proses regenerasi secara sistimatis, berjenjang dan berkelanjutan merupakan kunci utama dalam pembinaan atlit untuk meraih prestasi”, katanya dihadapan sekitar 400-an atlit karate dikota itu. Pada kesempatan itu Walikota berpesan dan mengharapkan agar perguruan karate-do di Kota Tebingtinggi mempunyai komitmen, visi dan aksi yang di formulasikan menjadi prestasi dan perguruan karate-do menetapkan tujuan serta targetnya. Diakhir sambutannya, Walikota minta agar atlit karate-do dapat menunjukkan prestasinya yang dapat menjadikan kebanggaan Kota Tebingtinggi. Sementara Ketua Umum KONI Kota Tebingtinggi HM Daniel Sulhtan SE mengatakan bahwa gashuku

ini untuk menyatukan tekad seluruh perguruan karate-do di KotaTebingtinggi yang sama dan samasama punya mental dan tujuan dan memberikan apresiasi atas kegiatan ini dan meminta kepada perguruan karate-do yang ada di Kota Tebingtinggi menjadikannya kegiatan rutin minimal dalam setahun 3 kali dilaksanakan. “Saya yakin atas pembinaan yang dilakukan para sabuk hitam di perguruan karate-do masing-masing, akan melahirkan atlit yang berprestasi serta dapat mengharumkan dan membawa nama Kota Tebingtinggi”, harapnya. Disamping gashuku bersama, juga ditampilkan atraksi diantaranya Basidai dan Bunkhai oleh atlit Inkanas, atraksi Ji On oleh Nikita (SMK 2) dari Inkanas, Kata Kan Kudai olehWahyudi dari KKI, Seni BeladiriTako oleh Samsul dan Bambang dan Kata En Ki oleh Taufik Muharmin siswa kelas 7 SMPN 2 Tebingtinggi yang berhasil meraih jura III dalam kejuaraan di Kuala Lumpur. ()

PWMR Gelar Pelatihan Jurnalis MEULABOH,BN PersatuanWartawanMeulabohRaya(PWMR)gelar pelatihan jurnalis selama dua hari sabtu dan minggu (20/1) acara berlangsung dari pagi hingga sore hari , pelatihan tersebut di laksanakan di Aula ayam penyet Pak Ulis Jalan Nasional Meulaboh. Pelatihan jurnalis tersebut diikuti para pewarta di wilayahliputanKabupaten,AcehBarat,NaganRayadan Aceh Jaya, serta di ikuti dua pengawai humas dari tiga Kabupatentersebut. Ketua Umum PWMR Dedi Iskandar kepada mengatakan, pelatihan tersebut guna memberi pencerahan tentang pers secara

konfrehensif kepada wartawan yang selama ini belum memahami kaedah pers secara sempurna, pelatihan tersebut bermatrikan, tentang UU Pers, kode etik jurnalistik (KEJ) dan cara membuat berita yang benar dan objektif sehingga tidak ada yang di rugikan, kata

Dedi. Pematri professional yang akan mengisi acara tersebut,yakniYarmendinamikaRedpelSerambiIndonesia dan Tarmizi Harva, pewarta photo Reuters, juga dihadiri 25 waratwan dan enam peserta dari pegawai humas.(@rul)

Purba.Dari beberapa pertanyaan yang diajukan JPU terhadap saksi Sukardi Martages Purba, saksi selalu berdalih mengaku lupa, tidak tahu dan tidak ingat, kepada Jaksa Penuntut Umum (JPU) AndreasTarigan. Saksi lainnya David Karosekali,anggota ULP dalam kesaksiannya,tugas darianggotaULPdengansembilanoranganggotalainyasamadengantugas Ketua ULP, menerima dan mengevaluasi seluruh penawaran yang masuk,“Pelelangan tersebut telah sesuai dengan Kepres 80 tahun 2008,dengan memenangkan perusahaan yang melakukan penawaran terendah”, ujar David Karosekali. Rahman Kudadiri dalam kesaksiannya menjelaskan,dirinya (Rahman Kudadiri,red) diangkatmenjadiketuatimPHO/FHOtanpaSK,“awalnyakami

tidakmengetahuiproyektersebut,kamidiberitahuberitaacaratentangPHO/ FHO, kami sama sekali tidak mengetahui proyek tersebut”, jelas Rahman, namun belakangan Tim PHO/FHO (penerima barang) tesebut menandatanganinyasetelahdipanggilmantanKadisKehutananIrSujarwo keruangannya.“Kalau nanti ada masalah pada proyek ini, saya yang bertanggungjawab”,ujarRahmanKudadiri,menirukanperkataanSujarwo. Usaimendengarkanketerangankeenamorangsaksi,majelishakimyang diketuaiJonny SitohangSH MH menunda sidang hingga kembali digelar minggudepan,Selasa(22/1)denganagendamendengarkankesaksianPendi Solin, sementarasidangTipikor tersebut dimulai sekitar pukul 11.00 Wib hingga pukul 17.30 Wib. (pb.007/tim)

tanggapannya . menurut maulana ishak lagi ,langkah tgas apartur Negara yangmerajialokasipenampunganyangdidugaillegalitu sangattepat.Karena selaintidakproceduraljugamerugikannegara sebutaktivisLSMLEMBAGA PEMANTAU PENYELENGGARA NEGARA REPUBLIK INDONESIA (LPPNRI) itu menjelaskanpadaBN. TerkaitrajiayangdilakukanTIMtersebut, berhasilmengamankanbarang bukti BBM dan CPO.berbagai tanggapan dari masyarakat dan mendukung positiflangkahmerajialokasipenampunganminyakCPOdanBBMtersebut. Bahkan dari aktivis LSM Di Dumai seperti DPC Clean Governance ( CG ) dan LSMLPPNRI mintaagarproseshukumannyasampaikepengadilan.Karena dengan adanya tindakan Hukum yang bertarti , kejahatan mafia BBM dan CPOitudapatdiminimalisir,yangtetntunyamenyelamatkanassetNegaraRI ujar Maulana Ishak yang juga Sekretaris PK Partai Golkar Dumai Barat itu, yang diamini Syamsul kamar Ketua DPC CG (lembaga relawan anti korupsi )itumenjawabWartawan Media ini.ditambahkannyamafiaBBMdanCPO ituharusditindaktegassesuaihukumyangberlaku.NegarakitakanNegara HukumsebutaktivisDPCCGdan LPPNRItersebut mengakhiri.sampaiberita

ini di Ekspos KAPOLDA RIAU dan Kapolresta Dumai belum berhasil dikonfirmasi BN. Dari penelusuran investigasi media ini, rajia yang digelar dengancara“kilatitu”,terrnyatatidakmembawanilaiyangsignifikan.Dimana baru sekitar satu minggu dirajia ,yach sudah beroperasi kembali.ironisnya lagi dalamsatupekan terahirini mylaipertengahanjanuari2013pada baru baru ini, terlihat dilapangan,beberapa lokasi penampungan BBM dan CPO sudah tutup mendadak kembali.tertapi penam0ungan CPO illegal masih terussajaberoperasi.disinyalirtindaklanjuthasilrajiaTimpetugas terhadap MafiaCPOtersebuttidakberjalanaliasdiPetiEskan?.Bahkanpenampungan CPO Ilegal di lintas Balam_ Simpang batang( Wilayah rohil _red )penampunganpunyatoke mafiatersebutberjalanmulus.Untukinisesuai kenyataan diduga kuat pihak mafia tersebut dibekingi oknum tertentu sehingga kebal hukum.karena itu , di himbau KaPOLRI untuk menurunkan TIMkhususmenangkapmafiaminyakCPOdan Mafiapenampungminyak BBMyangdidugaillegal,karenakejahatantersebut selamainiterusmeraja lela ,kegiatan usaha yang melanggar hukum itu diduga ada pembiaran di wilayah Riau?.(RDS )

Aksi itu diterima anggota DPRD Sumut, Sudirman Halawa dan Mulkan Ritonga dari Fraksi Golkar, serta Iman B Nasution dari Fraksi Gerindra yang berjanjiakanmembawaaspirasimassakepadapimpinanDPRDSumut. MelihatkebelakanghuruharaFraksiDemokratyangmerupakan fraksi terbesar di DPRD Sumut telah terjadi selama dua bulan terakhir di setiap rapatparipurnaberlangsung ,sepakterjangfraksiinijustrumenjadibahan pergunjingan dan terkesan mempermalukan diri sendiri. Betapa tidak, kisruh di tubuh Fraksi Demokrat DPRD Sumut, semakin lamabukannyasemakinreda,malahsemakinkeruhdanmengeruh.Apalagi pimpinan DPRD Sumut sendiri terkesan tidak terlalu optimal, bahkan terkesantidakmaumelakukanintervensiterlalujauhdalampenyelesaian kisruh ini. Kericuhan di sidang paripurna ini merupakan buntut perpecahan di FraksiDemokratDPRDSumut,pergantiansusunanFraksibelumdilakukan. DimanapersoalannyamenyangkutpergantianketuaFraksidanbeberapa ketua komisi yang menjadi jatah kader demokrat. Seperti diketahui, Ketua Fraksi Demokrat saat ini masih dijabat Tahan Manahan Panggabean yang akan digantikan Sopar Siburian tapi tak terlaksana. Pantesanlah Sopar bersikeras, ambisi jabatan membuat kekisruhan pembahasan RAPBN. Lebih penting jabatan daripada kepentinganmasyarakat.Persoalaninternalterbawakepadaimbasanfraksi lain yang hadir TerkaitkisruhyangtengahterjadidiFraksiDemokratDewanPerwakilan

Rakyat Daerah (DPRD) Sumatera Utara (Sumut), pasca walk out-nya sejumlah anggota Fraksi Demokrat DPRD Sumut saat paripurna alat kelengkapandewan,membuatsejumlahfungsionarispartaimulaiangkat bicara. WakilSekretarisIDewanPimpinanDaerah(DPD)PartaiDemokratSumut, Farianda Putra Sinik.menegaskan, penyusunan alat kelengkapan DPRD Sumutmaupunkebijakanfraksisepenuhnyakewenanganpartaiditingkat daerah. Untuk itu, kata Farianda, pimpinan fraksi diminta untuk menjalankan dan mengambil keputusan di tingkat fraksi dengan selalu berkoordinasi dan mengacu kepada pimpinan partai. “Jadi tidak ada yang salah terhadap surat DPD Partai Demokrat Sumut, tentang penyusunan alat kelengkapan DPRD Sumut yang telah ditandatangani oleh Ketua DPD Partai Demokrat Sumut, Pak Milwan, dan sayasebagaiwakilSekretarisIPartaiDemokratSumut.Sebab,surattersebut sesuai keputusan rapat bahkan mengacu pada AD/ART Partai Demokrat Sumut Pasal 62 ayat 1,2, 3 dan 4,”ungkap Farianda.Salah satunya adalah Wakil Sekretaris I Dewan Pimpinan Daerah (DPD) Partai Demokrat Sumut, Farianda Putra Sinik. Sementara itu sejumlah anggota Fraksi Partai Demokrat DPRDSU yang tergabung dalam kelompok 19 tetap bersikukuh bahwaTahan Manahan Panggabean tidak lagi menjabat sebagai Ketua Fraksi Partai Demokrat DPRDSU. Sebab, Tahan Manahan Panggabean telah resmi dicopot lewat keputusan DPD Partai Demokrat Sumut.(ndo)

Penampungan Gelap beberapa oknum petugas TIM , terdiri dari oknum TNI dan Polri sedang melakukanpenggrebekan,sementarasamahalnyadilokasipenampungan CPO dibukit nenas turut dirazia petugas namun tak terlihat ada dilokasi itu lagioknumyangsetiapharimenongkrongipenampungantersebut.diduga kuat bodiguardnya langsung ciut nyalinya dan lari terbirit birit saat Tim petugasdatang merajia ,sehinggabeberapa wartawan tidakdapatuntuk konfirmasi kepada Humas usaha penampungan CPO itu Terkait rajiatersebut, Berbagai kalangan dimasyarakat wialayah bukit kapur Dumaimendukunglangkahtegasaparatyangseriusmenindaktegas kejahatan mafia BBM dan CPO yang diduga melanggar hukum itu. sebab merugikanNegaraapalagididugasejaklamamafiaBBMmenampungBBM Subsidi yang banyak dilego sang sopir truk tankgki ke pada mafia penadah BBMdisejumlah penampunganillegal yangmenjamurdikawasanwilayah kecamatan bukit kapur. Bisnis illegal tersebut selama ini sudah meraja lela. Bahkan LSM di Dumai terhadap kejahatan mafia ini angkat bicara. karena selamainisepertinyaada,pembiaranujar aktivisLSMLPPNRIMaulanaIshak dan Samsul K Direktur eksekutive DPC CG (Clean Governance)saat dimintai

Mantan Republik Indonesia Nomor 833/K/Pid/2010 menyatakan Tahan sudah ditetapkanbersalahmelanggarpasal156KUHPjoPasal55ayat1danpasal 335 ayat 1 yang mana saudaraTahan dijatuhi hukuman. Menurut massa alasan agarTahan diPAW, karena pada saat dia dilantik sebagaianggotaDPRDSumut14September2009,masihberstatussebagai terdakwamelakukantindakpidanamelanggarPasal146KUHPJO,pasal55 ayat 1 dengan ancaman hukuman 7 tahun penjara. StatusterpidanayangdisandangTahanManahankarenadiaturutterlibat dalamperistiwademoyangmenyebabkanmeninggalnyaKetuaDPRDSumut DrsHAzizAngkatsertaterjadikerusakanmaterialdansaranasertaprasarana DPRD Sumut. Hinggadalamstatusnyaitudiatetapmenjalankantugassebagaianggota DPRDSumut.Padahalhalitu,menurutmassa,telahbertentangandengan UU Nomor 10 tahun 2008, pasal 218 ayat 1 dan 2, juga PP nomor 16 tahun 2010 BAB XII bagian kesatu pergantian antar waktu pasal 102 ayat 1 huruf C dan ayat 2 huruf C. KemudianberdasarkankeputusanMahkamahAgungRepublikIndonesia omor 833/K/Pid/2010 menyatakanTahan Manahan sudah ditetapkan bersalah melanggar pasal 146 KUHP JO, pasal 55 ayat 1 dan pasal 335 ayat 1,ke-1yangmenyatakanTahanManahandijatuhihukuman8bulandan15 hari.“KamijugatelahmenyampaikansuratresmikeBKDDPRDSumutterkait persoalanini,jadikamimintaagarsegeraditindaklanjuti,”teriakmassaFKMM yangdiketuaiMuhammadYusufTambunan.

Massa Demo ... mempertimbangkan kamuan dan eselonisasi. Ke empat bupati dinilai tidak mencirminkan sikap sebagai figur yang jujur dan bertanggung jawab dalam hal ini di tandai banyaknya janji-janji di pilkada ternyata tidak ditepati. Kelima, aliansi menilai bahwa sejak kepempinan bupati madina Hidayat Batubara, tidak mampu membangun komunikasi politik yang baik dengan partai pendukung dan anggota DPRD Madina hingga sampai saat ini gejolak politik dan perpecahan di tubuh DPRD Madina sudah menjadi polemik yang mengakibatkan menurunya kinerja legislatif. Ke enam, bupati madina juga dinilai tidak mampu membangun persatuan dan kesatuan dengan tokoh-tokoh masyarakat dan generasi muda untuk bergandengan tangan membangun Madina disegala asfek. Selain itu juga bupati Madinajuga di duga melanggar UU nomor 32 tahun 2004 pasal 32 karena satu buati Madina diduga melakukan tindak pidana korupsi. Berdasarkan hasil investigasi yang dilakukan, bupati diduga meminta uang secara langsung maupun tidak langsung kepada calon pejabat dalam proses pengangkatan pejabat eselon. Kedua, pelaksanaan proyek APBD 2012 diduga syarat pelanggaran hukum yakni, pelanggaran Pepres Nomor 54 tahun 2010 terkait pembatalan tender atas perintah bupati tanpa alasan yang dibenarkan. Kemudian dugaan pengutipan uang dari kontraktor untuk dimenangkan dalam tender. Mewajibkan kontraktor membayar fee 7 persen kepada bupati melalui pejabat di Dinas Keuangan. Melunasi proyek yang belum selesai dikerjakan yang semestinya dilakukan final kontrak berdasar Pepres Nomor 54 tahun 2010. Ketiga, pemberian Izin Operasi Produksi kepada PT. Madina Madani Mining padahal perusahaan itu sudah dicabut IUP-nya oleh bupati sebelumnya. Keempat, Hidayat diduga melakukan pemerasan terhadap anak buahnya (kepala dinas) lalu diberhentikan dari jabatan. Untuk itu, Aliansi meminta DPRD Madina agar segera menggunakan hak interplasi dan hak angket atas dugaan pelanggaran perundang-undangan oleh Bupati Madina Hidayat Batubara. Usai berorasi, sejumlah perwakilan dipersilahkan masuk ke ruang paripurna untuk berdialog dengan DPRD Madina dipimpin Ketua DPRD Madina As Imran Khaytami Daulay. Dialog itu menghasilkan kesimpulan bahwa DPRD Madina akan melakukan hak angket dan hak interplasi sebagaimana yang diminta pengunjukrasa. (sn)

Oknum Kontraktor ....

Saksi Mengaku SukardiMartagesPurbaselakuSekretarisUnitLayananPengadaan(ULP) BarangdanJasadalamkesaksiannyamenjelaskanpadapelelanganpertama diikuti oleh tiga perusahaan,yakni CV Yusran/Mangiring Purba,CV Yakob Tehnik/DSondangBerutu,kemudianCVRamosKarya/JomarisonTumangger, ketiga perusahaan tersebut dinyatakan gugur dan dibatalkan karena administrasi ketiga perusahaan tersebut tidak lengkap sehingga lelang dinyatakan batal. Kemudian pihak ULP kembali melakukan pelelangan dengan mengundang ketiga perusahaan tersebut melakukan penawaran,hingga pada pengumuman pemenang,CV Yusran dinyatakansebagai pemenang lelang, saat ditanya JPU siapa direktur CV Yusran, saksi menjawab “saya tidak ingat,tidak tahu pak”, ujar Sukardi


yang kini bertugas di sebuah Medya Suara Nasional ( SN ). Menurut korban iya nya benar ada menanya kan kepada salah seorang yang bernama Said Tar yang juga teman dekat pelaku , tentang proyek pekerjaan gedung capil yang belum selesai dikerjakannya, sedang kan masa kontrak kerja sudah habis. walau pun ada perpanjangan waktu dengan jaminan gransi bank , “yang namanya wartawan kan wajar saja menanyakan “ disebabkan saudara Kalid selama ini sukar di temui sedangkan hp nya selala melbok . Menurut keterangan Dedi kepada BN , Dedi saat itu sedang duduk diwarung kedai kopi Alam Asri dI Jalan Ir H Juanda Kecamatan Karang Baaru Tiba tiba saja korbaan di panggill oleh oknum kontrktor yang arogansi ini, lalu dedi langsung menghampiri secara tiba tiba langsung saja Kalid mengatakan “cerita apa kau sama Orang tentang aku”sambil menonjokan gempalan tangannya kebibir korban kejadian ini di saksasikan langsung olah seorang wartawan Reporter TV ANTVuntuk Aceh , yang bernama Taupik secara kebetulan berada di tempat kejadian juga disaksikan beberapa rekan wartawan serta beberapa para oknum penegak hukum yang sedang berkunjung ngopi di warung ini . Selanjutnya korban juga mengatakan” di depan oknum penegak hukum dan di depan umum saja oknum kontraktor arogan ini berani melakukan tindakan kekerasan seperti ini apa lagi kalau di tempat lain yang tidak di saksikan orang banyak mungkin entah apa yang terjadi pada diri saya “ sebut Dedi dengan wajah yang lesu dan memelas. Akibat efek dari kejadian ini mungkin dedi tidak dapat mengerjakan tugas tugas jurnalistiknya karena menurutnya nya batin nya sangat terkejut , badan terasa lemas,jantung berdebar, kepala terasa pusing ,bila berfikir konsentrasinya sangat terganggu sebut Dedi. melihat tidak ada glagat etika baik kontraktor arogan ini, yang telah merugikan baik secara moral maupun materi korban , oknum wartawan SN ini, melaporkan halnya ke penegak hukum di Polres Aceh Tmiang dengan nomor tanda bukti laporan TBL/10/2013/res Atam. Menyikapi tent5ang masalah pelecehan insan pers ini wakil skretaris ( wasek ) exsekutif LSM GUGAT Indra “plecehan ini murni karma di sebabkan tonjokan gempalan tangan yang sudah menempel di muncung wartawan ini “ sebut indra . Selanjutnya menyahuti masalah pelecehan terhadap insan pers ini skretaris Serikat Wartawn Aceh Tamiang ( S W A T ) Rizal Hutasuhut yang bertugas di di Koran tabloid INTERPOOL dengan tegas mengatakan“ Kontraktor Arogan ini harus diproses secara hokum yang berlaku , karena ini sudah mengangkangi UU pokok Pers No 40 tahun 1999 pasal 18 yang berbunyi “ setiap orang yang melakukan tindakan yang menghambat atau menghalangi kinerja wartawan sesuai pasal empat( 4) ayat tiga (3) dapat di jatuhkan Hukuman dua (2) tahun penjara dan denda lima ratus juta rupiah ( Rp 500,000,000 ) Terkait permasalah ini S W A T juga telah melaporkan hal ini ke Dewan pers baik tingkat Daerah maupun ke tingkat Nasional. Ketika ingin di komfirmasi wartawan BN terkait masalah ini sampai berita ini di terbitkan saudara kalid , pelaku tindakan kekereasan terhadap wartawan ini tidak dapat di temui, juga di hubungi melalui hand pone slular nya selalu mel,box di SMS juga tidak ada balasan.( Zul )

Traffic Light ... Sekda aceh tamiang Saiful Anwar menjelaskan tidak berfungsinya trafik laigh tidak ada kaitannya dengan menunggaknya rekening PLN ditegaskan saiful pemda siap membayar tunggakkan listrik tersebut asal PLN punya perhitungan yang jelas menyangkut semua lampu jalan tidak punya meteran. PLN harus mampu mengklarifikasikan angka-angka tagihan tersebut berdasarkan apa. (poris)

21-28 JANUARI 30 DES 2011 - 6 JAN 2013 2012 | |EDISI EDISI343| 296|THN THNKE-VIII KE-VII


Bupati Minta TNI Membangun Makodim Aceh Timur Aceh Timur,BN Bupati Aceh Timur, Hasballah bin M Thaib meminta pihak tni untuk segera mermbangunMarkasKomandoDistrikMiliter atau MAKODIM 0104 AcehTimur di lokasi lahan yang sudah tersedia di kawasan Idi. Hal itu disampaikannya ketika silahturahmi Danrem 011 Lilawangsa, Kol. Inf. A. Rachim Siregar di Pendopo Bupati AcehTimur pada Selasa, (15/ 01) dengan para Muspida. Dalam kunjungan silahturahmi tersebut, Bupati Aceh Timur yang didampingi oleh Muspida kepada Danrem 011 LW menyampaikan agar pihak TNI bisa secepatnya membangun MAKODIM 0104 Aceh Timur di idi mengingat Makodim 0104 sampai saat ini masih berada di Kota Langsa, “kita saat ini sedang berupaya untuk membangun tata kota dengan baik dengan melengkapi seluruh kantor, baik itu kantor pemerintahan, dan yang lainnya termasuk Mapolres dan Makodim di Aceh Timur, dan semua itu

sudah tersedia yang belum hanya Makodim saja sementara lahannya sudah tersedia “ ujar Bupati Aceh Timur. Sementaa itu Danrem 011 LW sendiri mengatakan terkait dengan pembangunan Makodim Aceh Timur hal tersebut akan segera disampaikan kepada Panglima Kodam IM dan Panglima TNI sendiri di Jakarta, bahkan lebih baik lagi apabila pihak Pemerintah Aceh Timur juga ikut melobi Panglima TNI agar bisa membangun Makodim secepatnya di Aceh Timur, mengingat kebutuhan daerah akan Makodim sangat mendesak terutama saat menjelang Pemilihan Umum Tahun 2014 mendatang dimana pengamanan dan keamanan daerah sangat dibutuhkan guna menciptakan kesetabilan keamanan yang baik dan sangat kondusif di aceh timur ini sekaligus memberikan rasa aman dan nyaman terhadap para investor luar yang akan menanamkan modalnya di Aceh Timur ini nantinya.(@Mus)

Disdik Aceh Minta Bongkarnews `Dinginkan` Pemberitaan Negatif Banda Aceh, BN Dinas Pendidikan Aceh, meminta redaksional Media BONGKARNEWS terbitan Medan, Sumatera Utara, untuk dapat mendinginkan pemberitaan yang sifatnya negatif.Tujuannya, agar capaian mutu pendidikan di Aceh dapat dilaksanakan dengan sempurna. Demikian diungkapkan Kepala Dinas Pendidikan Aceh, melalui Kabid Dikmen Disdik Aceh, Drs. Laisani, Mpd, kepada Bongkarnews, Selasa pekan lalu diruang kerjanya. Seraya mengatakan, pasca pemberitaan terkait kucuran dana hibah terhadap sejumlah SMK Kedinasan di Aceh, telah mengundang reaksi aparat penegak hukum. "Kami sangat mengharapkan partisipasi media Bongkarnews, untuk tidak melangsir pemberitaan yang sifatnya negatif. Sebab, selama ini, pasca pemberitaan dibeberapa edisi itu, telah meresahkan pihak kepala sekolah hingga harus berhadapan dengan aparat penegak hukum," ungkapnya. Tidak hanya aparat penegak hukum, kata Laisani, bahkan beberapa wartawan ikut memamfaatkan isu yang dilangsir Media Bongkarnews. Semisal, sebut dia, pada hari ini, Ia harus memberikan keterangan kepada sepuluh awak media yang menanyakan persoalan tersebut. "Hari ini, ada sekitar sepuluh rekanrekan dari berbagai media, menanyakan soal pemberitaan yang dimuat Media Bongkarnews. Selain itu, ada beberapa kepala sekolah mulai diperiksa aparat penegak hukum," katanya. Menurutnya, apabila pemberitaan tersebut masih terus mencuat,

Kunker Pangdam IM ke Subulussalam

SUBULUSSALAM, BN Setelah dilantik menjadi Panglima Daerah Militer Iskandar Muda Aceh Mayjen Zahari Siregar Kunjungan Kerja ke Kota Subulussalam pada hari Rabu ( 16/1) Rombongan tiba dipendopo Walikota pada pukul 15:30 WIB disambut dengan pengalungan bunga dan Tari dampeng serta Walikota bersama istri,Wakil Walikota, anggota DPRK para pejabat, Setdako turut menyambut selanjutnya Pangdam bersam istri dipesejuk oleh Walikota/Istri,Wakil Ketua DPRK Siti Ansari Bancin, SE, dan Ketua MPU H.Qaharuddin Kombih, S.Ag Selesai dipesejuk dilanjutkan makan siang dan acara ramah tamah dihalaman pendopo. Walikota Merah Sakti dalam sambutan nya banyak mengucapkan terima kasih kepada Pangdam IM atas kesediaannya melu-

angkan waktu berkunjung ke Subulussalam dan menyampaikan pembangunan yang telah diperbuat selama 4 tahun kepemimpinannya di Pemko Subulussalam antara lain Pembangunan PKS sebanyak 2 unit, RSIA, Kantor Walikota , DPRK, Rumah Dinas Sebanyak 8 Unit tahun ini (2013) ditempati selain itu sakti juga memaparkan Kondisi Subulusslaam pada saat ini dan luas Daerah serta jumlah Desa/Penduduk seterusnya sakti mengatakan akan membangun Pabrik minyak goreng di subulussalam, sekaligus meminta dukungan kepada Pangdam iskandar Muda karena dalam tahun ini juga ada 2 agenda ( event) besar dilaksanakan yaitu MTQ ke XXXI, Tingkat Provinsi Aceh dan Pesta Demokrasi Pemilihan Walikota Subulussalam.Demikian juga untuk pembentukkan Makodim Subulussalm Sakti

meminta kepada Pangdam agar dapat segera mungkin untuk membentuk Makodim karena kantornya telah mulai dibangun dan juga mengingat jarak tempuh Subulussalam – Singkil ( Dandim 0109 ) sangat jauh. Sedangkan Pangdam IM Mayjen Zahari Siregar mengatakan sangat terkejut melihat sambutan yang diberikan Pemko Subulussalam begitu meriah dan penuh papan bunga.Saya tidak menyangka sambutan yang diberikan kepada kami begitu hangat, dan saya sangat bangga melihat perkembangan Kota Subulussalam setelah mekar dari Kabupaten Aceh Singkil begitu maju. Padahal kami capek dengan perjalanan 600 KM dari Banda Aceh naik mobil, tapi karena Sambutan penuh antusias dan meriah capeknya pun hilang kata Zahari. Kun-

Wawako Hadiri HUT Kampung Lae Oram sebagai konsekwensinya, Gubernur Aceh, Zaini Abdullah, dipastikan bakal membatalkan program tersebut untuk dilaksanakan. "Ini sangat berbahaya jika terus diberitakan. Sementara dana ini diperuntukkan untuk peningkatan mutu pendidikan di Aceh," tuturnya. Mendengar permintaan itu, Media Bongkarnews, juga meminta pihak Dinas Pendidikan Aceh untuk melakukan hak sanggah. Namun, Laisani menilai cukup disampaikan secara lisan sebagai mitra Disdik Aceh. Sebelumnya diberitakan Bongkarnews, Lembaga Swadaya Masyarakat (LSM) Masyarakat Transparansi Aceh (MaTA), mendesak aparat penegak hukum di Aceh untuk segera mengusut bantuan hibah sektor pendidikan terhadap sejumlah SMK kedinasan di Aceh. "Jika pencairan maupun pengalokasian dana hibah itu menyalahi aturan dan berpotensi rawan penyimpangan, kami mendesak aparat penegak hukum, untuk mengusut dengan tuntas," ujar Koordinator LSM MaTA, Alfian. (T.Muktaruddin/AFRIZAL)

Kadis Atam Bingung Lihat Proyek Otsus 2012 ACEH TAMIANG BN Kadis PU Aceh Tamiang Ir Irwansyah bingung melihat Proyek Otsus 2012 di Aceh Tamiang , Kebingungan ini di karnakan tidak adanya kordinasi baik secara Internal maupun Externaldi Instansi terkait kususnya di Dinas PU. Hal ini terlihat ketika BN mengkomfirmasi kepada Kadis PU Senin (14 /1 ) di ruang kerjanya “ saya sendiri bingung melihat Proyek Otsus ini “ jawabnya, tentang Jembatan Desa Menasah Paya Kecamatan Manyak Payed yang kondisi penyelesaian bangunanya hanya satu buah Abutmen. Hasilpantauandankunjungankerjapansus DPRK Aceh Tamiang Ke Manyak Payed Abudmen tersebut yang pembuatan bentuknya hanya di bangun sebelah saja ,sementara Abudmen sebelahnya tidak ada tanda tanda pembangunan berikutnya . Pada hal proyek Abudmen Jembatan dengan judul Pembangunan Jembatan Senebok Gayo Kecamatan Bendahara Dengan anggaran 2,300,000,000 (Dua

Pangdam Iskandar MudaMayjen Zahari Siregar didampingi istri setelah menerima pengalungan bunga di halaman pendopo walikota

miliyar tiga ratus juta rupiah ) , ini “yang di kerjakan oleh CV.Pelopor “ dalam pekerjaannya CV Pelopor tidak menggunakan papan plang nama proyek”. Sementara Kabid Bina Marga Rulina ST menyebutkan dalam pekerjaan proyek tersebut memiliki plang proyek namun kenyataan nya ketika saat di komfirmasi Kabid tidak dapat menunjukan Foto Plang nama proyek tersebut Abudmen tunggal yang menelan biaya 2.300. 000, 000 (Dua miliyar tiga ratus juta ) akibat keterbatasan dana anggaran maka abudmen sebelah berikutnya akan di bangun pada tahun berikutnya. Sementara hasil pansus keproyek DPRK kelapangan Elpian raden dari komisi “D “ menjelaskan belum ada temuan, tetapi proyek abudmen itu belum siap masih ada timbunan yang belum selesai kami masih menunggu hasil rapat resmi kerja pansus sebut Elpian Raden. ( zul )

SUBULUSSALAM, BN Wakil Walikota H.Affan Alfian Bintang, SE hadiri Hari UlangTahun ke XI Kampung Lae Oram Kecamatan Simpang Kiri pada hari senin ( 14/1) sekaligus membuka secara resmi pertandingan Motor Cros di Tingkat Pemko Subulussalam di lokasi Kampung Lae Oram. Kepada Kampong Lae Oram Rasad Cibro dalam laporannya mengatakan HUT Kampung Lae Oram ini untuk pertama kali dirayakan dengan bermacam – macam kegiatan olahraga seperti tarik tambang,panjat pinang dan motor cros sekaligus meminta kepada Wakil Walikota untuk membuka dan menyerahkan piala ( hadiah ) bagi pemenang. Sedangkan H.Affan Alfian Bintang dalam sambutannya meminta kepada warga Lae Oram agar saling mendukung dan bersatu untuk menyukseskan kan pelaksanaan MTQ ke XXXI Tingkat Provinsi Aceh seperti menjaga kebersihan rumah,ramah tamah dan menjun-

jung Syariat Islam karena pelaksanaan MTQ berlokasi di daerah kampong Lae Oram” kata Bintang. Mari kita tunjukan kepada penduduk luar daerah bahwa masyarakat Sada Kata Kota Subulussalam adalah masyarakat yang ramah tamah, sopan santun dan menegakkan syariat islam pungkasnya. Sementara itu tokoh masyarakat Penah Solin, SH menyampaikan sejarah terbentuknya Kampung Lae Oram adalah pemekaran dari kampong Pasar Panjang sebelas tahun yang lalu.serta menyebutkan nama - nama kepala mukim dan kepala kampong yang pernah memimpin sebelum mekar dan sesudah mekar nya.Acara tersebut dihibur sebagian taritarian adat pak – pak,minang dan jawa. Pertunjukan Tarian Adat Pak – Pak dibawakan oleh remaja putri dari kampong Suka Makmur Kecamatan Simpang Kiri Subulussalam.Wakil Walikota H.Affan Alfian Bintang bersama undangan lainnya turut menari bersama penari adat pak – pak di pentas. (RB)

Mayjen Zahari Siregar Serahkan Cendera Mata

Wakil Walikota H.Affan Alfian Bintang, SE menyampaikan kata sambutan dalam acara HUT kampong Lae Oram ke X

Dana Terbatas, Prestasi Olahraga Aceh Terancam Bobrok BANDA ACEH, BNTerbatasnyapengalokasiananggaranterhadap Satuan Kerja Pemerintah Aceh (SKPA), dalam hal ini Dinas Pemuda dan Olahraga (Dispora) Aceh, bakalmengakibatkanprestasiolahragaAcehterancam bobrok pula. “Dalam Prioritas Plafon Anggaran Sementara atau PPAS tahun 2013 ini, kita mendapat alokasi dana sebesar Rp2 Miliar. Sedangkan usulan yang kami ajukan mencapai diatas Rp150 Miliar,”kata Kepala Dinas Pemuda dan Olahraga Aceh, Syarifuddin Z, SH, MM, melalui Sekretaris Dispora Aceh, H. Bustamam, kepada Bongkarnews, baru-baru ini. Dikatakandia,pihaknyapadatahuninibertekad untuk membenahi sejumlah fasilitas olahraga. Ia mencontohkan seperti akan dilakukannya pembenahan terhadap stadion harapan bangsa di Lhoong Raya, Kota Banda Aceh. “Disinikitaberniatuntukmembenahifasilitasfasilitas yang rusak dan mengaspal lingkaran stadion itu. Selain itu juga berencana untuk melanjutkan kembali dengan Pemerintah

5 Desa Pesisir di Seunuddon Konsumsi Air Asin Aceh Utara,BN Lima Desa di kawasan pesisir kecamatan senuddon, kabupaten Aceh Utara,mengalami

jungan kerja ini kata Pangdam adalah untuk melihat secara dekat Kondisi /Keamanan di daerah Wilayah Dandim masing – masing apakah Daerah tersebut aman, tidak ada gangguan kepada masyarakat ternyata semua daerah yang kami kunjungi adalah aman ucap Zahari. Sedangkan menyinggung permintaan Walikota untuk mendirikan Makodim di subulussalam Pangdam IM mengatakan akan mempelajari dulu, karena mendirikan Makodim baru tidak mudah seperti membalikkan telapak tangan, tapi begitupun kita akan berusaha agar keinginan tersebut dapat terwujud pungkasnya. Setelah selesai acara Pangdam IM bersama rombongan melanjutkan kunjungan kerja ke Kabupaten Aceh Singkil esok harinya pulang ke Banda Aceh melalui Kota Medan. ( RB )

Paraguay.,”katanya. Masih kata dia, tahun ini, sejumlah usulan dari sejumlahorganisasijugatidakmendapatkucuran dana. Diantaranya meliputi, KONI Aceh, yang mengusulkan Rp13,5 Miliar, Pramuka Rp24 Miliar dan KNPI Aceh senilai Rp1 Miliar. “Setelah kita mengetahui dana yang tersedia dalam PPAS sangat terbatas, sehingga dipastikan akan berdampak mempengaruhi prestasi olahraga Aceh. Ini sangat kita sayangkan, namun kita terus berupaya dengan sumberdana yang ada,” ucapnya. Ia menyebutkan, sekitar Rp32 Miliar usulan masyarakat tentang fasilitas olahraga, yang sudah menumpuk di Dispora Aceh juga terancam tidak terkabulkan. Meskipun, pihaknya mengakui masyarakat sangat membutuhkan. “Semua sarana olahraga sudah pasti dibutuhkan, tapi mengingat sumberdananya yang terbatas. Namun, kita terus memperjuangkan aspirasi masyarakat dari masing-masing daerah,” sebutnya. Meski demikian, pihaknya sudah memper-

siapkan sejumlah program untuk tahun 2013 ini, namun belum diketahui pasti disetujui atau tidaknya pengalokasian anggaran untuk instansi tersebut. “Salah satunya kita akan melanjutkan kembali program luar negeri seperti sepak bola yang bekerjasama dengan Paraguay, Spanyol, dan taekwondo yang bekerjasama langsung dengan Korea,” ujar Bustamam. Selain itu, Dispora, berniat untuk merombak Stadion Harapan Bangsa di Lhong Raya menjadi sarana olahraga. Nantinya, sarana olahraga itu akan bermanfaat bagi warga untuk berolahraga seperti balap motor, joging dan lapangan-lapangan permainan olahraga lainnya. “Harus kita lakukan pembenahan terlebih dahulu, seperti menentukkan area jogging dan area balapan. Mengenai area balapan harus diaspal ulang lagi. Sehingga, bisa mengurangi balapan liar dijalan raya yang dapat terjadinya kecelakaan dan mengganggu pengguna jalan raya,” katanya. (AFRIZAL)

krisis air bersih.Sebahagian warga terpaksa minum air asin dan air payau untuk kebutuhan merekasehari-hari. Kelima desa tersebut masing-masing Desa uleeRubekBarat,uleerubektimur,bantayan,lhok puuk,dandesatepingkuyun.Pascatsunamiawal 2006,NGO Cordaid sudah membangun pipa air bersihkewilayahkamidenganbantuandanayang

sangatlemayanbesar.Ungkapsalahsatusumber yangdapatdipercaipadamediaBN17/1.Namun taksampaisetahunsuplaiairbersihkedesakami macet total. “Masalah ini sudah sering kami keluhkan kepada pihak PDAM Tirta Mon Pase,kabupaten Aceh Utara.Tapi sampai saat ini air yang sangat kami butuhkan bulum juga terealisaikedesakamiungkaptokohmasyarakat

SUBULUSSALAM, BN PangdamIskandarMudaMayjenTNIZahari Siregar berikan Cendera mata dan ucapan TerimakasihkepadaWalikotaSubulussalam dalamacaraRamahTamahdenganpejabatKota SubulussalambesertaMasyarakatsetempat pada hari Rabu ( 16/1). Selain pemberian Cindera mata Pangdam jugamenyerahkanbantuankepadamasyarakat kampong wilayah kecamatan rundeng yang terkena banjir beberapa minggu lalu, bantuan tersebut diterima oleh kepala kampong yang bersangkutan yaitu kepala kampong Panglima Saman dan Kepala Kampung Sibungke. Mayjen Zahari Siregar menyampaikan ucapan terima kasih kepada Walikota atas bantuannya begitu besar terhadap turnamen catur yang diselenggarakan Pangdam IM di Banda Aceh beberapa waktu yang lalu. Walikota Merah Sakti sangat berperan membantu mensukseskan turnamen tersebut ucap zahari. Sedangkan bantuan yang diberikan Zahari siregar mengatakan jangan dinilai dari jumlah nya tapi itulah yang bisa kami bantu, bentuk kepedulian kami ( TNI ) kepada masyarakat karena TNI juga bersala dari Rakyat kita saling membutuhkan terimlah dan manfaatkan dengan baik inbuhnya.Sekaligus meminta kepada Walikota Merah Sakti agar terus berupaya untuk membangun Kota Subulussalam. Karena Subulussalam adalah Strategis pintu gerbang Provinsi Aceh bila itu terjadi nama Aceh yang harum dan mendoakan dalam event pesta demokrasi nanti agar Sakti dapat duduk kembali untuk kedua kalinya memimpin Kota Subulussalam agar program pembangunan yang telah dicanangkan dapat berlanjut dan subulussalam bisa lebih maju Rakyat Sejahtera tegas Pangdam mengakhiri sambutanya . Selain Pangdam IM, Walikota juga menyerahkan Cindera Mata kepada Pangdam IM Zahari Siregar.( RB ) Mawardi pada BN 17/1,melalui telepon selulernya.Pihak kami selaku beberapa tokoh masyarakat sudah jenuh dengan janji-janji perusahaan tersebut.Kami mengharap kepada perusahaanTirta mon pase lihatlah kami sebagai masyarakatpesisiryangsangatmembutuhkanair bersih dan kami sudah jenuh denganb janji-janji ungkapsalahsatumasyarakatpadaBN.(021).

21-28 JANUARI 30 DES 2011 - 6 JAN 2013 2012 | |EDISI EDISI343| 296|THN THNKE-VIII KE-VII


Dinas Pertanian dan Holtikultura Aceh Timur Sosialisasi Program PUAP Aceh Timur,BN. Berdasarkan data Badan Pusat Statistik (BPS) pada tahun 2007 jumlah penduduk miskin tercatat 37,2 juta jiwa. Sekitar 63,4% dari jumlah tersebut berada di perdesaan dengan mata pencaharian utama di sektor pertanian dan 80% berada pada skala usaha mikro yang memiliki luas lahan lebih kecil dari 0,3 hektar. Kemiskinan di perdesaan merupakan masalah pokok nasional yang penanggulangannya tidak dapat ditunda dan harus menjadi prioritas utama dalam pelaksanaan pembangunan kesejahteraan sosial. Oleh karena itu pembangunan ekonomi nasional berbasis pertanian dan pedesaan secara langsung maupun tidak langsung akan berdampak pada pengurangan penduduk miskin. Permasalahan mendasar yang dihadapi petani adalah kurangnya akses kepada sumber permodalan, pasar dan teknologi, serta organisasi tani yang masih lemah. Untuk mengatasi dan menyelesaikan permasalahan tersebut Pemerintah menetapkan Program Jangka Menengah (2005-2009) yang fokus pada pembangunan pertanian perdesaan. Salah satunya ditempuh melalui pendekatan mengembangkan usaha agribisnis dan memperkuat kelembagaan pertanian di perdesaan.oleh sebab itu, Dalam rangka penanggulangan kemiskinan dan penciptaan lapangan kerja diperdesaan, Bapak Presiden RI pada tanggal 30 April 2007 di Palu, Sulawesi Tengah telah mencanangkan Program Nasional Pemberdayaan Masyarakat Mandiri (PNPMM). Pengembangan Usaha Agribisnis Perdesaan (PUAP) yang dilaksanakan oleh Departemen Pertanian pada tahun 2008 dilakukan secara

Jajaran Pemkab Aceh Timur Gelar Rapat Koordinasi Aceh Timur,BN Sekretaris Daerah Kabupaten AcehTimur, Drs. Bahrumsyah, M.M, mengumpulkan seluruh kepala Satuan Kerja Perangkat Kabupaten (SKPK) dan para Camat dalam wilayah Kabupaten AcehTimur, rapat kerja koordinasi dalam jajaran Pemerintah Kabupaten AcehTimur yang berlangsung di gedung serbaguna Setdakab setempat, jum’at (18/1) pagi. Rapat koordinasi ini bertujuan untuk meningkatkan kinerja aparatur Pemerintahan Kabupaten AcehTimur dalam menjalankan program-program kerja sesuai dengan visi dan misi Bupati-Wakil Bupati Aceh Timur priode 2012-2017. Pada rapat tersebut Sekda berharap kepada para Camat dalam kabupatenAceh Timur untuk lebih meningkatkan perannya, sebagaimana diketahui Kecamatan merupakan perpanjangan tangan Pemerintah Kabupaten juga sebagai ujung tombak dan pada kecamatan juga telah dilimpahkan tugas dan wewenang Pemerintahan Kabupaten, Dalam kesempatan itu dia juga meminta agar para Camat menjaga perfomance Kecamatan, baik buruknya Kecamatan merupakan cermin dari Pemerintah Kabupaten, kepada para Kepala SKPK beliau menegaskan untuk melakukan pembinaan dan meningkatkan kedisiplinan serta memberdayakan bawahannya. Selain di hadiri Sekda dan Kepala SKPK serta para Camat, rapat koordinasi tersebut juga dihadiri Asisten Pemerintahan, Muhammad, S.H., M.H., Asisten Keistimewaan Aceh, Ekonomi dan Pembangunan, M. Ikhsan Akhyat, S.STP, M.Ap dan Asisten Administrasi Umum Setdakab Aceh Timur, Abdul Munir, S.E., M.Ap. (@Mus)

Ribuan PNS Apel Hari Kesadaran Nasional Aceh Timur,BN Ribuan Pegawai Negeri Sipil (PNS) Kabupaten Aceh Timur dari seluruh Satuan Kerja Perangkat Kabupaten (SKPK) dan instansi ,Kamis (17/1) pagi mengikuti upacara apel Peringatan Hari Kesadaran Nasional Kabupaten Aceh Timur yang dipusatkan di halaman Pusat Pemerintahan Kabupaten Aceh Timur Titi Baro, Idi. Bertindak sebagai pembina upacara Bupati Aceh Timur Hasballah M Thaib. Dalam amanatnya, bupati mengharapkan agar momentum peringatan Hari Kesadaran Nasional yang diperingati setiap tanggal 17 dalam setiap bulannya diharapkan menjadi tonggak sejarah bagi penegakan disiplin aparatur pemerintahan di lingkungan Pemkab Aceh Timur. "Aceh Timur saat ini butuh pemikiran dan dharma bakti serta kerja keras kita semua terutama aparatur pemerintahannya dalam membangun daerah ini serta mengejar berbagai ketertinggalan kita selama hijrah dari Kota Langsa,'tegas bupati Hasballah M Thaib. Jadi dengan momentum apel hari Kesadaran Nasional ini diharapkan pelayanan pemerintahan kepada masyarakat juga akan semakin baik dan cepat. Bupati juga menyampaikan terimakasih kepada seluruh pejabat dan PNS daerah ini yang telah menunjukkan komitmen kuatnya untuk bersama sama membangun Aceh Timur tercinta ini. (@Mus)

terintegrasi dengan program PNPM-Mandiri. Untuk pelaksanaan PUAP di Departemen Pertanian, Menteri Pertanian membentuk Tim Pengembangan Usaha Agribisnis Perdesaan melalui Keputusan Menteri Pertanian (KEPMENTAN) Nomor 545/Kpts/OT.160/9/2007. PUAP merupakan bentuk fasilitasi bantuan modal usaha untuk petani anggota, baik petani pemilik, petani penggarap, buruh tani maupun rumah tangga tani. Di aceh timur sendiri pengembangan usaha agribisnis pedesaan (PUAP) yang dilaksanakan oleh dinas pertanian dan holtikultura kabupaten aceh timur pada tahun 2012 dilakukan secara terintegrasi dengan program PNPM-Mandiri. PUAP merupakan bentuk fasilitasi bantuan modal usaha untuk petani anggota, baik petani pemilik, petani pengarap, buruh tani maupun rumah tangga tani yang ikoordinasikan oleh GAPOKTAN. Hal tersebut dikatakan oleh Kepala Dinas Pertanian dan Holtikultura Kabupaten Aceh Timur, Sugiarto, SP ketika membuka acara sosialisasi program pengembangan usaha agribisnis perdesaan (PUAP) Tahun Anggaran 2012. Lebih lanjut ia mengatakan, Gabungan Kelompok Tani (GAPOKTAN) merupakan kelembagaan tani pelaksana PUAP untuk penyaluran bantuan modal usaha bagi anggota. Untuk mencapai hasil yang maksimal dalam pelaksanaan PUAP, GAPOKTAN didampingi oleh tenaga Penyuluh Pendamping dan Penyelia Mitra Tani. GAPOKTAN PUAP diharapkan dapat menjadi kelembagaan ekonomi yang dimiliki dan dikelola petani.

Untuk mencapai tujuan PUAP, yaitu mengurangi tingkat kemiskinan dan menciptakan lapangan kerja diperdesaan, PUAP dilaksanakan secara terintegrasi dengan kegiatan Departemen Pertanian maupun Kementerian/ Lembaga lain dibawah payung program PNPM Mandiri. Sementara itu, Ir. Anas Johan, MM dalam laporannya mengatakan Pengembangan Usaha Agribisnis Perdesaan (PUAP) merupakan langkah

terobosan Departemen Pertanian untuk mengurangi kemiskinan dan pengangguran. PUAP merupakan entry point dan perekat bagi seluruh program Departemen Pertanian dan sektor lain yang terkait dalam program PNPM-Mandiri. Dalam rangka mempercepat keberhasilan PUAP diperlukan berbagai upaya dan strategi pelaksanaan yang terpadu melalui: (1) Pengembangan kegiatan ekonomi rakyat yang diprioritaskan pada penduduk

miskin perdesaan melalui peningkatan kualitas SDM; (2) Penguatan modal bagi petani, buruhtani dan rumahtangga tani; dan (3) Penguasaan teknologi produksi, pemasaran hasil dan pengelolaan nilai tambah. Adapun program PUAP ini bertujuan untuk yaitu Mengurangi kemiskinan dan pengangguran melalui penumbuhan dan pengembangan kegiatan usaha agribisnis di perdesaan sesuai dengan potensi wilayah, Meningkatkan kemampuan pelaku usaha agribisnis, Pengurus Gapoktan, Penyuluh dan Penyelia Mitra Tani, Memberdayakan kelembagaan petani dan ekonomi perdesaan untuk pengembangan kegiatan usaha agribisnis, Meningkatkan fungsi kelembagaan ekonomi petani menjadi jejaring atau mitra lembaga keuangan dalam rangka akses ke permodalan.Anas Johan juga menambahkan,Dengan Sasaran PUAP yaitu Berkembangnya usaha agribisnis di 10.000 desa miskin/ tertinggal sesuai dengan potensi pertanian desa, Berkembangnya 10.000 GAPOKTAN/POKTAN yang dimiliki dan dikelola oleh petani, Meningkatnya kesejahteraan rumah tangga tani miskin, petani/peternak (pemilik dan atau penggarap) skala kecil, buruh tani, dan Berkembangnya usaha pelaku agribisnis yang mempunyai usaha harian, mingguan, maupun musiman. Keberhasilan PUAP sangat ditentukan oleh kerjasama dan komitmen seluruh pemangku kepentingan mulai dari tahap persiapan, pelaksanaan sampai dengan dukungan anggaran dari tingkat pusat sampai daerah, Tandasnya”.(@Mus)

Ratusan Warga Gampong Alue Seulemak Aceh Timur Masih di Pengungsian Aceh Timur,BN Ratusan kepala keluarga (KK) warga Gampong (desa) Alue Seulemak Kecamatan Rantau seulamat Kabupaten Aceh Timur yang mengungsi ke luar Aceh saat konflik berkecamuk tahun 1999 lalu, hingga kini masih berada di luar Gampong tersebut yang belum kembali. Mereka masih bertahan di pengungsian yang tersebar di sejumlah provinsi di Sumatera, terbanyak di Sumatera Utara serta menjadi warga ilegal di propinsi sumatera utara. Upaya pemulangan pengungsi tersebut terakhir terhenti akibat tak tersedianya dana, baik di APBA maupun APBK Aceh Timur,kata Geuchik Gampong Alue Seulemak Kecamatan Rantau Seulamat Kabupaten Aceh Tumr. Kepala Desa (Geuchik) Alue Seulemak, Suhardi (foto) yang ditanyai BN, minggu

(13/01) mengatakan pihaknya tetap akan meminta perhatian pemerintah kabupaten Aceh Timur soal kapan pemulangan warga Gampong Alue Seulemak ke Gampong yang dipimpinnya sekarang ini yang mereka tempati dulu, karena sejak Agustus 2005 konflik sudah berakhir, Aceh sudah aman dan damai. Salah seorang pemerhati sosial di Langsa menyebutkan, pemulangan seluruh warga Aceh terutama warga Gampong Alue Seulemak Kacamatan Rantau Seulamat Kabupaten Aceh Tumr yang mengungsi keluar sejak tahun 1999 silam itu sangat perlu demi alasan kemanusiaan, sekaligus menjadi indikator keberhasilan perdamaian di Aceh khususnya Aceh Timur . “Pulangnya seluruh pengungsi akibat konflik ke

Aceh terutama Warga Gampong Alue Seulemak bisa menjadi salah satu parameter bahwa program reintegrasi dan rekonsiliasi berhasil, sekaligus akan memperkuat kembali kohesi sosial kita sesama anak bangsa yang cinta damai dan menghargai keberagaman,” kata Direktur Esekutif LSM Cakra Donya Aceh,Sofyan Shuri,S.sos ditanya terpisah. Ia juga mengingatkan, program pemulangan pengungsi akibat konflik itu haruslah menjadi fokus perhatian Pemerintah Aceh Timur mulai tahun ini dan tahun depan, karena akan dipantau oleh berbagai pihak di luar Aceh. Paling tidak, katanya menyarankan, pada awal tahun 2013 ini semua pengungsi warga Gampong Alue Seulemak sudah harus kembali ke Aceh Timur.(@Mus)

Bupati Atam Serahkan Hadiah Kepada Kelompok Tani dan BPP Terbaik ACEH TAMIANG BN Bupati Aceh Tamiang H. Hamdan Sati.ST dalam rangka kunjungankerjanyadiDusunKelonengKampungSeunebok Punti Kecamatan Manyak Payed, memberi hadiah kepada Kelompok Tani, Penyuluh dan BPP (Badan Penyuluhan Pertanian) Terbaik Tingkat Kabupaten Aceh Tamiang atas prestasikerjadariyangdicapaidarihasilevaluasikinerjayang dilakukanolehBAPEL(BadanPenyuluhanPertanian)beserta Tim Khusus yang dibentuk dalam masa kerja tahun 2012. (17/01) Adapun Kelompok Tani berpredikat terbaik tahun 2012 tersebut yakni KelompokTani Kloneng Jaya Kampung Seunebok Punti Kecamatan Mayak Payed sebagai Juara I memperolrh hadiah 1 unit Hand Traktor, Kelompok Tani Gotong Royong Kampung Jambo Labu Kecamatan Rantau JuaraIImemperoleh1unitMesinThreserdanKelompokTani Tunas Muda Kampung Pante Cempa Kecamatan Banda Pusaka sebagai Juara III memperoleh hadiah 1 unit Mesin Pompa air sedangkan Penyuluh Terbaik I yakni Bambang SugiantoroSP BPPManyakPayedhadiahberupa1unitcomputer note book 14’, II Kiki Hermawan STP BPP Rantau 1 unit computer note book 12’, dan Penyuluh Terbaik III Dian Mayasari STP BPP Karang Baru mendapatkan hadiah 1 unit computer note book 10’. SelanjutnyaBPPpredikatterbaikItingkatKabupatenAceh Tamiang yakni BPP Bendahara mendapatkan hadiah 1 unit TV Color 29’, Juara II BPP Rantau 1 unitTV Color 21’dan Juara III (BPP) BPP Seruway 1 unitTV Color 17’. Sedangkan untuk Kelompok Wanita Tani terbaik III diraih oleh KWT Bungo Selanga Kampung Sungai Kuruk I mendapat hadiah 1 unit Pan Stove, Juara II diraih oleh Kelompok Wanita Tani Nilam PanteTinjau BPP Banda Pusaka 2 unit Pan Stove dan Juara I diraih oleh KelompokWanitaTaniWarahmahTanjung Lipat Kecamatan Banda Mulia mendapatkan hadiah 3 unit Pan Stove Pada acara penyerahan hadiah tersebut dalam kata sambutannyaBupatiAcehTamiangH.HamdanSati,STyang didampingi Ir.Rusman selaku Ketua DPRK Aceh Tamiang, Asisten II Ir. Zulkifli, MM, Kadis PU Ir. Irwansyah, Ka. Badan Penyuluhan Ir. Zakirman, dan Ketua MPU serta unsur Muspida lainnya, Kapolres/mewakili, Dandim 0104 Aceh Timur dan Camat Kecamatan Manyak Payed Ahmad

Yani,S.STP.M.SI beserta jajarannya pada acara yang berlangsung hikmat dan semarak tersebut berjanji akan memperhatikan dan mendukung program demi keberhasilan para petani. PadakesempatanituHamdanSati,ST.mengakudarilubuk hatinya yang paling dalam dirinya merasa bangga bisa bertatapmukalangsungdenganparapetaniseAcehTamiang konon petani nya berprestasi dengan ada nya peningkatan hasilpangandari4ton/Ha/musimPanenmenjadi6ton/Ha/ musim tanam ini merupakan prestasi yang patut kita banggakan dan hendak nya dapat ditingkatkan lagi dimasa yang akan datang dan saya tidak akan, hanya duduk dibelakang meja sebut Hamdan Sati, ST yang disambut semaraktepuktangansemangatparapetani. Lebih lanjut di jelaskan Hamdan Sati bahwa suksesnya pembangunan dibidang pertanian ini perlu adanya Pemantapan Sistem Penyuluhan Pertanian, Pemantapan Sistem Pelatihan Pertanian, Revitalisasi Sistem Pendidikan Pertanian serta Dukungan Manajemen dan Teknis lainnya, darikeempathaltersebutkitawujudkandalambentukprogram dengan harapan mampu menjadi indikasi aksi yang berdampakpadakebijakanPengembanganyangbermuara kepadapeningkatankesejahteraanpetani. kita menyadari bahwa kinerja dan tanggung jawab para PenyuluhPertanianLapanganinisangatlahberat,olehsebab itu dibutuhkan tenaga penyuluh yang handal dan professional dalam memberikan informasi informasi terbaru dan mudahdimengertiolehpetanitentangteknologipertanian, secaraefektifdanefesiensehinggakerepanproduksipertanian AcehTamiang dapat ditingkatkan. Dan kita tau ini bukanlah hal yang mudah apa lagi kecendrungan petani kita masih menggunakan pola-pola yang sudah tertinggal. Jelas HamdanSati. AkhirnyadiharapkanolehH.HamdanSati.STkepadapara petani,jadikanlahacarapenyerahanhadiahhariinimenjadi motifasi bagi petani untuk berlomba menjadi yang terbaik dan khusus nya kepada Badan Penyuluhan Pertanian agar tingkatkan pelayanan penyuluhan kepada para petani baik penyuluhan dengan cara melakukan pertemuan langsung ataupenyuluhanmelaluiMediaPenyuluhsepertipemutaran

film-film penyuluh petanian atau dalam bentuk lainnya sehingga di tahun 2013 ini dapat kita sahuti apa yang di canangkanPresidenRIdapatmemberikansumbangandalam bentuk Program Peningkatan Produksi Beras Nasional (P2BN). Harap Bupati AcehTamiang H. Hamdan Sati, ST. Kepala Badan Penyuluhan Pertanian Aceh Tamiang Ir. Zakirman menjelaskan akan menyambut positif apa yang menjadiharapanBupatitentumenjadiharapannyajugadan berjanji akan mengupayakan semaksimal mungkin untuk tercapainyapeningkatanproduksipangandimasayangakan datangterutamapadidimanaselamainidari4ton/Hamenjai 6 ton/Ha dan tidak tertutup kemungkinan ditahun 2013 ini lebih meningkat lagi sebab di daerah lain produksi padi ada yang mencapai 8 hingga 10 ton/Ha sebut Zakirman Pencapaian peningkatan produksi pangan dan kesejahteraan petani ini tentu nya selain semangat daya juang dan disiplin tenaga penyuluh dalam melakukan pembinaan terhadap masyarakat tani juga penyuluh itu sendiri juga akan kita tingkatkan pendidikan dan kesejahteraan nya dengan penerapan konsep SMART (Specification, Meurable, Achievment, Realistic danTime Bone) dalam kinerja penyuluh semoga apa yang kita harapkan dapat tercapai yang kesemua nya itu mengacu pada UU No: 16 Tahun 2006 tentang system Penyuluh Pertanian, Perikanan dan Kehutanan jelas penyuluh adalah bagian dari upaya mencerdaskan kehidupan bangsa dan memajukan kesejahteraan umum.ungkap Zakirman. Selain itu Camat Kecamatan Manyak Payed Ahmad Yani,S.STP.M.SI dalam sambutannya memaparkan bahwa jumlah sawah yang ada di Kecamatan Manyak Payed seluas 5.491 H hanya 200 H saja persawahan warga yang mendapat pengairan (irigasi) yang baik selebihnya merupakan sawah tadah hujan, seandainya persawah ini mendapat pengairan yang cukup maka Ahmad Yani yakin Kecamatan Manyak Payed akan menjadi Lumbung padi untuk Kabupaten Aceh Tamiang untuk itu diharapkan Ahmad Yani agar Bupati dapat memberi perhatian khusus menyangkut irigasi yang benar benar dapat mengairi persawah warga. ( Zul )

Pusat Pemerintahan Atim di Titi Baro ACEH TIMUR,BN Komitmen Pemerintah Kabupaten Aceh Timur untuk memindahkan seluruh Satuan Kerja Perangkat Kabupaten ( SKPK ) dan instansi daerah ini ke ibukota Aceh Timur yang baru di Idi berhasil terwujud dimana dalam akhir bulan ini ( Januari-red), dipastikan seluruh dinas ( SKPK ) Aceh Timur sudah beroperasional di Gedung Pusat Pemerintahan Aceh Timur di kawasan Titi Baro Idi. Sejak pemindahan di awal Agustus 2012 lalu , PNS daerah ini mulai bekerja dan beraktifitas melayani masyarakat di Idi, namun masih ada

sejumlah Dinas atau Kantor yang belum beroperasi penuh di Idi akibat belum selesainya pembangunan gedung perkantoran untuk masing masing dinas tersebut di Titi Baro ( Kompelek Pusat Pemerintahan Aceh Timur ). Kini, seiring perjalanan waktu dan kesiapan pusat pemerintahan, semua Dinas (SKPK) dapat dipastikan bisa berkantor di pusat pemerintahan ini termasuk juga dengan rencana kepindahan Sekretariat Daerah ke pusat pemerintahan di Titi Baro ini. Sementara itu, pantauan Bongkarnews sejak, Selasa (15/1) sejumlah dinas (SKPK) Kabupaten

Aceh Timur yang semula beraktifitas di sejumlah tempat dikawasan Idi, juga mulai memindahkan barang dan mobiler kantor mereka ke gedung pusat pemerintahan di Titi Baro seperti Dinas Peternakan dan Kesehatan Hewan, Badan Kepegawaian,Pendidikan dan Pelatihan (BKPP) juga sejumlah Dinas lainnya yang selama ini menempati gedung Rumah Sakit Umum Daerah Aceh Timur di kawasan lokasi pembangunan RS Internasional Medco juga mulai mencicil barang dan mobiler kantor mereka ke gedung pusat pemerintahan Aceh Timur di kawasan perbukitan tersebut.(@Mus)

Pejabat Aceh Timur Diminta Peduli Segala Situasi Aceh Timur,BN Sekretaris Daerah (Sekda) Kabupaten Aceh Timur ,Drs Bahrumsyah MM mengajak segenap pejabat dan pegawai negeri sipil (PNS) daerah ini untuk peduli dengan segala situasi . Bekerjalah dengan kompak, tekun dan bersemangat dalam membangun dan memajukan daerah ini. Terapkan motto "Satu untuk semua, semua untuk satu". Bekerjalah secara teamwork . Hal itu ditegaskan Sekda saat memimpin rapat dengan Asisten,Kabag dan Kasubbag dijajaran Sekretariat Daerah Kabupaten Aceh Timur, Selasa (15/1) sore di Aula Serbaguna Setdakab Idi. Dikatakan sekda, kita semua tidak dapat bekerja secara sendiri sendiri dalam memenej pemerintahan ini, kita harus saling peduli dan bekerjasama. Lanjut Sekda, mari kita manfaatkan kesempatan sebaik mungkin, karena kesempatan tak pernah datang dua kali,namun kegagalan berkali kali.Pahami tupoksi anda masing masing sebagai pemangku jabatan dan selamat bekerja membangun Aceh Timur ke arah lebih baik lagi,'"pesannnya. Saya pribadi tidak dapat bekerja dengan sendirinya tanpa dibantu para Asisten, demikian juga dengan bantuan Kabag dan Kasubbag serta seluruh staf yang ada di Setdakab.Karenanya, untuk mewujudkan semua ini butuh kepedualian dan kerjasama kita bersama. Dalam rapat tersebut sekaligus sebagai silaturahmi Sekda dengan jajaran pejabat di Setdakab ini, Bahrumsyah meminta agar semua pejabat memahami tugas pokok dan fungsi (tupoksi) tugas dan tanggungjawab masing masing. Kita semua juga dituntut untuk terus mau belajar dan belajar dalam mengasah kemampuan serta motivasi yakni sikap untuk mau berbuat dan memenej diri kita. Jangan bekerja ego sektoral dan individual serta jangan pernah putus asa dengan kegagalan masa lalu.(@Mus)

21-28 JANUARI 2013 | EDISI 343| THN KE-VIII


Terkait Pelayanan 24 Jam, Sekda Sidak ke Sejumlah Kantor Camat Simalungun, BN Menindak lanjuti program Bupati Simalungungun DR JR Saragih yang telah mengintruksikan kepada seluruh Camat agar terhitung tanggal 15 Januari 2013, seluruh Kantor Camat buka 24 jam untuk memberikan pelayanan kepada masyarakat. Untuk melihat dilapangan, Sekretaris Daerah Simalungun Drs Gidion Purba MSi bersama Kadis Perhubungan, Komunikasi dan Informatika Mixnon Andreas Simamora SIP melakukan inspeksi mendadak ke berbagai kantor camat seperti Kantor Camat Tapian Dolok, Kantor Camat Siantar dan Kantor Camat Raya. Dalam pertemuan tersebut, Sekretaris Daerah Drs Gidion Purba MSi berharap kepada seluruh Camat dan pegawai untuk melaksanakan tugas dengan penuh tanggung jawab dan senantiasa mengendepankan pelayanan prima kepada masyarakat. Kita ingin, pelayanan kepada masyarakat tidak hanya Kantornya saja yang buka 24 jam, melainkan para pegawainya juga harus siap ditempat dan melayani masyarakat. Terlebih untuk urusan-urusan penting seperti KTP, pelayanan surat keterangan maupun yang lainnya. Untuk itu pelayanan Kantor Camat 24 jam harus kita sukseskan. Pelayanan kantor Cama buka 24 jam harus kita sikapi serius. Jangan ada kami dengar setelah pelayanan kantor camat buka 24 jam ada masyarakat yang mengeluh tidak bisa dilayani. Kalau kami mendapati hal yang demikian, kami tidak segan-segan untuk mengevaluasi Camat yang bersangkutan, kata Sekretaris Daerah Drs Gidion Purba. (ps-01)

Pemkab Simalungun dan BPK RI Perwakilan Sumut

Sepakati Juknis e-Audit SIMALUNGUN, BN Pemerintah Kabupaten (Pemkab) Simalungun bersama Badan Pemerikasa Keuangan Republik Indonesia (BPK-RI) Perwakilan Sumatera Utara (Sumut) menyepakati petunjuk teknis (juknis) e-Audit. Kesepakatan tersebut tertuang dalam nota keputusan bersama tentang petunjuk teknis pengembangan dan pengelolaan sistem informasi data (e-Audit) yang ditandatangi oleh Bupati Simalungun DR JR Saragih SH MM bersama dengan kepala BPK RI Perwakilan Provinsi Sumut , Muktini, di Kantor BPK RI Perwakilan Prov. Sumut, Kamis, 17/ 01/2013. Selain Pemkab Simalungun yang melakukan kesepakatan tentang juknis e-Audit tersebut, 6 kabupaten/kota di Prov. Sumut juga melakukan hal yang sama. Keenam kabupaten/kota yang menyepakati tersebut yaitu, Kabupaten Serdang Bedagai, Samosir, Ahahan, Tapanuli Utara, Karo, Kota Binjai dan masing-masing kepala daerah melakukan

penandatanganan bersama dengan BPK RI. Menurut Kepala Perwakilan BPK RI Perwakilan Prov. Sumut, Muktini, dalam sambutannya mengatakan bahwa kegiatan ini merupakan tindak lanjut dari penandatanganan nota kesepakatan tentang pengembangan dan pengelolaan sistem informasi untuk akses data antara BPK RI dengan pemerintah daerah Sumut pada tanggal 12 juli 2013 lalu. “Petunjuk teknis secara tertulis ini nantinya akan dijdikan pedoman baik BPK maupun bai Pemerintah Daerah dalam penerapan e-audit. Dimana e-audit ini nantinya akan menciptakan suatu sinergi secara elektronik antara informasi di BPK (e-BPK) dan sisite informasi milik entitas pemeriksaan (e-auditee)”, ungkap Muktini. Dikatakan, pelaksanaan kegiatan ini akan dilakukan secara bertahap terhadap entitas pemeriksaan di 33 daerah di Sumatera Utara. Seperti pada tanggal 27 September 2012 lalu kegiatan yang sama juga telah dilakukan oleh Kota Medan, Kota

Sibolga dan Kabupaten Humbang Hasundutan. “Ketiga Kabupaten/kota ini merupakan pilot projek pelaksanaan e-audit diwilayah sumut karena dinilai memiliki ketersediaan sistem dan data yang lengkap, mereka juga telah mendapat opini Wajar Tanpa Pengecualian (WTP) dan BPK”, kata Muktini. Selanjutnya dikatakan, pada tanggal 6 Desember 2012 kegiatan yang sama dilaksanakan oleh 13 kabupaten/kota dan pada 17 Januari 2012 dilakukan oleh 7 Kabupaten/Kota dan untuk sesanya akan dilaksanakan dalam waktu dekat. Namun sebelumnya bagi daerah yang belum menyepakati juknis e-audit akan mengadakan kegiatan pembahasan keputusan bersama tentang juknis pengembangan dan pengelolaan sistem informasi untuk akses data (e-audit). Dalam kesempatan tersebut, Bupati Samosir Mangindar Simbolon mewakili 7 kepala daerah antara lain mengatakan bahwa, banyak pengalaman yang di berikan BPK RI kepada daerah dalam rangka

perbaikan pengelolaan keuangan di daerah. Namun dengan e-audit ini diharapkan BPK tidak hanya melihat dari sistem ini akan tetapi tetap memberikan masukan masukan kepada daerah dalam pelaksanaanya. “Apalagi ini hal yang baru tentu saja masih banyak yang harus dipelajari, sehingga kedepan kami juga mendapat hasil audit tidak hanya Wajar Dengan Pengecualian (WDP) tetapi WTP”, tandasnya. Sebelumnya LO IT BPK RI Perwakilan Pro. Sumut, Karyanto Wijaya melakukan demo penarikan data auditee oleh BPK dengan menggunakan metode eaudit. Untuk demo ini, sampel penarikan data di ambil dari Pemko Medan. Kryanto mengatakan bahwa data yang dikirimkan akan dimunculkan pada fortal audit BPK RI dan data yang ditampilkan tidak dapat rubah. Tampak hadir dalam kesempatan tersebut antara lain Sekretaris Daerah, Inspektur Daerah, Kadis Pendapatan dari masing-masing daerah dan para staf yang terkait. (ps-01)


Pengololan Dana BUMG Tidak Berjalan Sesuai Aturan LANGSA,BN Penyaluran dana Rp4,2 miliar untuk bantuan modal yang diserahkan lewat Badan Usaha Milik Gampong (BUMG) di Kota Langsa, agar pelaksanaannya wajib memedomani Petunjuk Teknis (Juknis), jika tidak menimbulkan permasalahan di kemudian hari, karena semuanyaadakonsekuensihukum. ”Hal ini sebagaimana tertuang dalam Peraturan Walikota Langsa Nomor 26 Tahun 2009, tentang petunjuk teknis (Juknis) penyaluran bantuan modal bergulir sumber dana APBA pos Otsus Kota Langsa Tahun 2009,” kata kepala Badan Pemberdayaan Masyarakat (BPM) Kota Langsa, Mursyidin Budiman, waktu itu semasih menjabat kepala Badan Pemberdayaan Masyarakat (BPM) kota Langsa.

Kini nasib Dana di Badan Usaha Milik Gampong (BUMG) tidak jelas pengunaannya di semua Gampong dalam kota Langsa yang menerima dana tersebut,jumlah dana yang diterima disetiap gampong berpariasi jumlahnya. Salah satu lembaga swadaya masyarakat LSMTOPAN- RI kota Langsa melaporkan temuanya kepada media,jum’at,(18/01) melalui Direktur khusus Bidang Penyelamatan Aset Negara,zulfadli,mengatakan salah satu contoh Gampong dikecamatan langsa Barat yaitu Gampong sungai Pauh,disini ada BUMG nya akan tetapi lembaga ini pada saat pemberian pinjaman kepada orang yang membutuhkan hanya orang-orang yang dekat dengan pengurus BUMG, sementara orang lain

Pemko Kota Langsa Rombak Pejabat Eselon II, III dan IV Kota Langsa,BN Kota Langsa - Wakil Walikota, Drs. Marzuki Hamid, MM, Selasa (15/1) sore melakukan pemberhentian dan pengangkatan PNS dalam jabatan struktural di Lingkungan Pemerintah Kota Langsa Provinsi Aceh,dan berlangsung di aula Sekretariat Daerah Pemerintah kota Langsa.Berdasarkan Surat Keputusan Walikota Langsa Nomor Peg.821.2/05/ 2013 dan Nomor : 821.2/06/2013 yang berisikan untu melantik lima pejabat eselon II (dua), pejabat eselon III (tiga), eselon IV (empat), sementara itu sebanyak 37 pejabat berbagai eselon dibangku panjangkan. Drs. Marzuki Hamid, MM (Wakil Walikota) dalam sambutannya mengatakan, mutasi jabatan dan yang dilaksanakan ini merupakan hasil pertimbangan objektif dari Badan Pertimbangan Jabatan dan Kepangkatan (Baperjakat), yang disampaikan oleh Walikota Langsa selaku pejabat Pembina kepegawaian daerah dalam penempatan PNS pada suatu jabatan, kami berupaya dengan sangatsangat selektif mungkin, sesuai dengan pronsip the right man and the right place, guna meningkatan karir dan profesionalisme PNS. Momentum pelantikan diharapkan akan dapat lebih bermakna dalam mengantisipasi tugas-tu-

gas ke depan. Adapun pejabat eselon II yang dilantik terdiri dari Drs Saifuddin Razali (Mantan Wakil wali kota langsa periode 20062012) menjadi Asisten Keistimewaan Aceh, Pembangunan dan Ekonomi pada Sekretariat Pemko, Ir Fauzi sebagai Kepala Badan Pemberdayaan Masyarakat, Karnaini, S.Pd sebagai Pj Kepala Dinas Pemuda, Olahraga, Kebudayaan dan Pariwisata, Ir Iskandar Sukri sebagai Kadis PU dan Aji Asmanuddin S.Ag,MA sebagai Pj Kadis Kependudukan dan Pencatatan Sipil. “Saya harap saudara-saudara dapat berperan aktif dan dapat memberikan kontribusi yang konstruktif bagi kepentingan institusi. Tugas pokok jabatan harus didasarkan pada rincian tugas, tanggung jawab, dan wewenang jabatan yang secara umum telah ditetapkan dalam struktur dan tata kerja organisasi,” demikian Wakil Walikota Langsa. Pelantikan dan pengambilan sumpah para penjabat ini dihadiri juga oleh Ketua DPRK Langsa M Zulfri, Sekda Kota Langsa M Syahril, Kasi Intel Kejari Kota Langsa Zainal Akmal, Kabag Sumda Polres Langsa, Kompol Jufri, Pasiter Kodim 0104 Aceh Timur, Kapten Nana Sutriani, unsur Muspida dan Muspika serta para undangan.(@Mus)

yang tidak dekat dengan pengurus selalu dibilang dananya sudah habis atau menunggu pengembalian dari masyarakat yang telah meminjam duluan inikan tidak benar cara-cara seperti itu,pada hal dana yang dikelola oleh BUMG adalah bergulir,katanya. Zulfadli menambahkan,Dana BUMG sebaiknya dikelola dengan cara yang benar dan disosialisasi kepada masyarakat tentang pemamfaatan Dana tersebut agar masyarakat tahu apa yang harus disiapkan untuk dapat memperoleh dana dari BUMG diGampong meraka. mengabil sebuah kebijakan disosialisasikan terlebih dahulu kepada masyarakat tentang juknis dan juklaknya sebelum sebuah keputusan diambil,saya tahun betul kata zulfadli terkadang lahir sebuah kebijakan karena dilihatnya

dari situasi dan kondisi permasalahan itu sendiri,namun demikian alangkah cakepnya apabila pengambilan sebuah kebijakan haruslah ditanyakan terlebih dahulu kepada yang membuat aturan atau tim Juknis dan juklaknya sehingga tidak melahirkan sebuah permasalahan yang baru dikemudian hari. Dikatakan, bila aturan pengololaan BUMG tersebut tidak dijalankan sesuai Juknis, maka secara otomatis menimbulkan pelanggaran hukum dan pihak berwajib berhak mendalami kasus tersebut. Bahkan dampak buruk dari itu semua, masyarakat yang akan dirugikan karena dana modal bergulir yang telah ada tidak bisa dirasakan manfaatnya. Disebutkan, Pemko Langsa waktu itu terdiri dari 51 kampung yang berada di lima kecamatan yaitu,

Kecamatan Langsa Kota, Langsa Barat, Langsa Timur, Langsa Lama, dan kecamatan Langsa Baro, dalam penyaluran bantuan ini hendaknya dapat berjalan sesuai aturan dan mekanisme yang ada. Dijelaskan, untuk pendirian BUMG sudah ada dilandasan hukumnya yaitu UU Nomor 32 tahun 2004 Tentang Pemerintahan Daerah dan PP Nomor 72 Tahun 2005 Tentang Desa.(Gampong) Sedangkan pembentukan BUMG ditetapkan dengan Qanun Gampong, yang mengatur tentang tujuan dan sasaran, syarat pendirian, permodalan, kepengurusan, tugasdanwewenangpengurus,mekanismepengembalian dan pembagian keuntungan serta beberapa ketentuan lain yang dapat mendukung BUMG berjalan secara profesional,kata zulfadli.(@Mus)

Puskesmas Sungai Raya Tingkatkan Pelayanan SUNGAI RAYA,BN Puskesmas adalah ujung tombak pembangunan dan pelayanan kesehatan kepada masyarakat. Oleh karena itu, keberadaan puskesmas harus diperkuat baik dari sisi aparatur, sarana dan parasarana maupun alokasi anggaran. “Tidak akan terlayani dengan maksimal jika pendukung untuk melakukan pembangunan itu tidak tersedia,

termasuk tenaga kesehatan di puskesmas kecamatan sungai raya kabupaten Aceh Timur yang selalu siap sedia memberikan pelayanan kepada masyarakat,” sebut Kepala UPT.Puskesmas Sungai Raya , Marmeam,S.Kep kepada,jum’at,(11/01), lalu. Menurutnya, visi pembangunan dan pelayanan kesehatan yang diselenggarakan puskesmas adalah

tercapainya kecamatan Sungai Raya sehat menuju terwujudnya Aceh Timur sehat. Kecamatan Sungai Raya sehat adalah gambaran masyarakat kecamatan Sungai Raya masa depan yang dingin dicapai. UPT Puskesmas kecamatan Sungai Raya sudah mempunyai ruang inap yang memadai untuk menampung pasien yang perlu rawat inap,di puskesmas ini juga ada poli anak,poli usila,poli gigi,poli

Wali Siswa Gembira RSBI Dihapus

Langsa,BN Mayoritas siswa RSBI yang berasal dari kalangan ekonomi menengah ke atas membuat siswa miskin merasa tertekan karena tidak siap memasuki perbedaan gaya hidup dan budaya orang kaya. Hal itu diungkapkan seorang orangtua murid kelas VII RSBI di Kota Langsa kepada wartawan Bongkarnews,Rabu,(16/01) lalu,sekarang kita bergembira RSBI di hapus oleh Pemerintah. Orangtua siswa ini mengungkapkan RSBI menyebabkan culture shock bagi siswa miskin, Siswa yang orang tuanya kaya otomatis mendominasi keadaan dan pergaulan, sedangkan siswa miskin tidak berdaya mengimbangi gaya hidup mereka sehingga menyebakan tekanan mental. Belum lagi guru yang cenderung materialistis sehingga terjadi diskriminasi perlakuan, Secara terpisah, Ketua Kominitas Transformasi Lintas Sosial (Katalis),Mustafa, di Langsa, mengatakan kebijakan RSBI seperti kebijakan pada zaman penjajahan Belanda yang memberlakukan diskriminasi antara warga Belanda

dan pribumi. Contohnya, sekolah Europeesche Lagere School (ELS) atau Meer Uitgebreid Lager Onderwijs (MULO) khusus orang-orang Eropa dan bangsawan. Sedangkan untuk kalangan inlandeer atau orang Indonesia bersekolah di Hollandsch Inlandsch School (HIS). Namun dengan dihapusnya RSBI ini bukan berarti bahwa pendidikan Indonesia terjadi penurunan dalam hal kualitas tapi lebih kepada penghapusan kesenjangan di jenjang sekolah sehingga tidak ada yang namanya siswa elite yang sekolah RSBI dengansiswayanghanyasekolahdisekolah lokal saja. Tentang penghapusan RSBI sendiri telah dilakukan berdasarkankesepakatanantaraKetuaMahkamahKonstitusi (MK) Mahfud MD dengan Menteri Pendidikan dan Kebudayaan beberapa hari lalu, Mendikbud,mengatakan untuk menghentikan program rintisan sekolah bertaraf internasional (RSBI) mulai tahun ajaran 2013-2014 namun sekolah yang mempunyai program RSBI masih bisa meneruskanprogramnyasampaiempatbulanmendatang katnaya.(sym)

umum,poli IGD, serta mobil ambulance yang siap menjemput dan mengantar pasien rujukan ke rumah sakit kabupaten. “Puskesmas ini akan selalu berupaya memelihara dan meningkatkan kesehatan, mencegah dan menyembuhkan penyakit serta memulihkan kesehatan perorangan, keluarga dan masyarakat kecamatan Sungai Raya,” pungkasnya (@mus)

TDL Listrik Naik, Warga Resah BIREM,BN Masyarakat Gampong Keude Birem mulai resah memikirkan dengan kenaikan Tarif Dasar Listrik (TDL) yang telah diberlakukan tahun 2013 ini oleh pemerintah. Kehidupan masyarakat Keude Birem kecamatan Birem Bayeun kabupaten Aceh Timur yang seolah tak bisa lepas dari listrik untuk aktifitas setiap harinya merasa sangat terbebani dengan naiknya TDL. "Melihat dari pendapatan kami yang hanya sebagai petani dan buruh yang tidak menentu, sudah pasti akan merasa berat bila tarif listrik naik." Ujar Muhammad Idris (37) salah seorang warga Gampong Keude Birem kecamatan Birem Bayeun Kabupaten Aceh Timur kepada Bongkarnews, Senin, (14/01). Dia berharap agar pemerintah memiliki langkah untuk mengantisipasi dampak dari kenaikan listrik,"biasanya kalau tarif listrik naik pasti akan diikuti dengan naiknya harga bahan-bahan pokokjuga.Jadikamiharapagarpemerintahpunyacaraagarrakyat tidak terlalu menderita nanti." Harap Muhammad Idris."Tagihan listrik kami terus mengalami kenaikkan bahkan bulan ini dua kali lipatnaiknya.Padahalpemakaiankamitidakbertambah,untukitu kamibingungkenapatagihankamimengalamikenaikkanterus," ujarnya.(@Mus)

21-28 JANUARI 2013 | EDISI 343| THN KE-VIII

Ketua DPW FKWJ Nusantara Ingatkan Cagub Jangan Mudah Percaya Orang Mengaku FKWJ KETUA umum DPW FKWJ Sumatera Utara Djamin Sumitro saat konfrensi Pers di kediamannya hari Selasa (8/1) di Desa Senembah Tanjung Morawa Medan kepada wartawan mengatakan, Forum Komonikasi Warga Jawa (FKWJ Nusantara ) ada dimana mana tapi bukan kemana-mana. Selain itu ditegaskannya, hingga saat ini FKWJ Nusantara DPW Sumatera utara masih solid Dibawah Pinpinan ketua DPW FKWJ Nusantara Sumatera Uatra Djamin Sumitro. Merut Djamin Sumitro dengan adanya pemilihan calon Gubernur Sumatera Uatra diduga ,ada salah satu calon gubernur yang mencoba mengotak atik FKWJ Nusantara DPW Sumatera Utara dengan memanfaatkan situasi pemilihan calaon gubernur sumatera utara . Untuk itu beliau meminta supaya seluruh kandidat calon gubernur Sumatera Uatara jangan percaya terhadap orang orang yang mengaku –ngaku FKWJ yang indikasinya untuk mendapatkan keuntungan pribadi. Ditambahkannya lagi ,ada beberapa pengurus DPW Nusantara Sumut yang sudah di berhentikan atau dibekukan ,dan sebagian pengurus FKWJ DPD Medan masih menggunakan nama dan atribut organisasi.untuk mendekati salah satu calon gubernur. Dengan demikian Djamin Sumitro selaku ketua FKWJ Nusantara DPW Sumatera Utara tidak bertanggung jawab terhadap semua tindakan yang dilakukan oknum tersebut dan menyatakan bahwa segala tindakan yang telah dilakukannya adalah liar , Tentuntunya untuk tindakan liar tersebut, maka FKWJ Nuasantara DPW Sumatera Utara akan dilakukan tuntuan karena telah menggannggu kenyamanan FKWJ , dan selanjutnya para calon Gubernur agar tidak menanggapi segala tindakan tersebut . Lanjut Djamin,dengan rangkaian tersebut DPW FKWJ Nusantara Propinsi Sumatera Utara akan melantik ketua dan pengurus DPDFKWJ Padang Lawas pada tgl 27/1 di lapagan Merdeka Sibuhuan ,sedangkan rangkaian acaranya nantinya adalah pelntikan,pendeklarasian cagubsu,dan pengobatan garatis bagi masyarakat Padang Lawas yang berkesempatan.(Ali)

Bupati Tobasa Ambil Sumpah 22 Pejabat Struktural Balige,BN KabagHumasdanProtokolSetdakabTobaSamosirElisber Tambunan menyebutkan, evaluasi kinerja akan memacu pejabatuntuklebihmengembangkankapasitasnyasesuai denganamanahjabatanyangdiembannya. "Itulah salah satu sasaran pelantikan pejabat eselon III dan IV yang dilaksanakan hari ini. Dengan pelantikan ini diharapkanpejabatakanterpacuuntukmengembangkan kapasitasnya dalam bekerja sesuai amanah jabatan yang diemban,"sebutElisberdiruangkerjanyadiSimanjaloBalige Kamis (17/1). Jumlah pejabat eselon III dan IV yang dilantik dan diangkat sumpah oleh Bupati Pandapotan Kasmin Simanjuntak di Aula Bagian Umum dan Perlengkapan SekretariatKantorBupatiTobaSamosirdiSimanjaloBalige sebanyak 22 orang. Dalam amanatnya, Bupati Pandapotan Kasmin Simanjuntakmengatakan,jabatanmerupakanamanahdan kepercayaan,karenaitudiharapkanparapejabatyangbaru dilantikdapatmenjalankannyadengansebaik-baiknya. "Teruslah berbenah diri dengan meningkatkan kemampuan, wawasan, pengetahuan dan keahliannya sesuatu kompetensi jabatan yang dipercayakan. Laksanakanlahtugasdankewajibandenganpenuhdedikasi, bertanggung jawab, loyal, jujur serta mengedepankan rasionalitas dan ketaatan akan peraturan," ujar bupati. Adapun pejabat eselon III yang dilantik dan diambil sumpah oleh bupati antara lain Dimposma Sihombing S.Sos,MAPmenjabatCamatSilaen,EduardSitorusAPCamat Parmaksian,DrsBenniSiagianCamatPintuPohanMeranti, Bakhtiar Simanjuntak SE Camat Borbor dan Alfaret Manurung Camat Lumban Julu. Sementara Harapan Napitupulu SH dilantik menduduki jabatan Kabag Kesejahteraan Sosial, Nikson Siringoringo S.Kom Kabid Kesejahteraan dan Pembinaan Pegawai pada Badan Kepegawaian Daerah dan Jose Rizal Pasaribu sebagai Sekretaris Dinas Pekerjaan Umum. Kemudian dr. Tumpak Halomoan Butarbutar dilantik menjadiDirekturRSUDPorsea,HendraButarbutarAPKabid Pelayanan Catatan Sipil, Robert Marpaung S.Pd Sekretaris Dinas Dukcatpil, dr. Rajaipan O. Sinurat Kabid Jaminan/ Pembiayaan,PromosidanRegulasiKesehatandanLamhot Mauli Simanjuntak S.Pd menjadi Kabid Promosi dan PelayananDinasKebudayaandanPariwisata. Sementara pejabat eselon IV antara lain Hercules Butarbutar Kasubbag Program dan Akuntabilitas Dinas Kebudayaan dan Pariwisata, Marihot Pardosi Kasubbag Umum dan Perlengkapan Dinas Kesehatan, Manuntun Sagala Kasie Pembinaan dan Pengembangan Dinas Perindagkop, Freddy A. Panjaitan Kasie Inventarisasi, PemeliharaandanRehabilitasiDinasPendidikan,Manosor Panjaitan Kasie Pelayanan Umum dan Kessos Kecamatan Silaen,JhonH.GultomKasieRehabilitasiSosialDinasSosial, Delima Juliana Simanjuntak S.Sos Kasie Pemerintahan, KetentramandanKetertibanKelurahanSigumparDangsina, ErwinDanielP.SianiparKasiePembangunanKelurahanPasar Porsea dan Tetty Masrina Panjaitan Kasie Pemerintahan, Ketentraman dan Ketertiban Kelurahan Pardede Onan. (r)


Cuaca Ekstrim, Banjir Hantam Kecamatan SDH Tapsel, BN Akibat cuaca extrim dengan curah hujan yang cukup tinggi dan terus menerus sejak 4 s/ d 11 Nopember 2012 lalu, menyebabkan bencana alam banjir pada beberapa titik di 3 Desa dan 24 Kampung (Anak Desa) di Kecamatan SDH (Saipar Dolok Hole) dengan kerugian sekitar Rp. 4 Miliyar lebih. Hal tersebut disampaikan Camat SDH M. Syarif Pane, SH kepada BN beberapa waktu lalu diruang kerjanya. Menyikapi kejadian tersebut

Camat beserta Unsur Muspika mengambil sikap dan berupaya untuk memperbaiki sarana prasarana yang rusak dengan bergotong royong bersama masyarakat, seperti memperbaiki jembatan yang putus dengan menggunakan kayu panel. “Kami bersama Dan.Ramil 04 SDH juga Kapolsek dan Kakan Kemenag telah meyampaikan laporan kejadian tersebut kepada Bupati Tapanuli Selatan” ucap Camat SDH. Berdasarkan laporan yang disampaikan

tersebut Pemerintah Daerah Kabupaten Tapanuli Selatan segera menyalurkan bantuan berupa beras dan bantuan lainnya yang bermanfaat bagi masyarakat, jelas camat. Selain terputusnya jembatan penghubung tiga tersebut dengan ibukota kecamatan, banjir juga menrusak puluhan hektar lahan pertanian dan perkebunan, serta menyapu bersih sejumlah ternak warga. “Memang bencana tersebut tidak menyebabkan korban jiwa akan tetapi banyak

sarana air bersih yang hanyut dan rusak bahkan beberapa bendungan irigasi jebol” jelas Camat sembari menegaskan bahwa pihaknya telah berupaya untuk membersihkan badan jalan dan jembatan dari bekas banjir dengan menyewa alat berat. M. Syarif Pane, SH beserta Muspika menghimbau masyarakat agar lebih hati- hati dan siaga saat curah hujan tinggi dan apabila hujan terus menerus agar kiranya masyarakat dapat di evakuasi ke daerah yangt lebih aman.( KS.03)

PPK Kecamatan Huragi Tetapkan DPT Pilgubsu

TSO Serahkan 12 SK Plt Eselon II dan Lantik 49 Eselon III dan IV Palas BN Bupati Padanglawas H. Ali Sutan Harahap (TSO) lantik 49 orang eselon III dan IV. Pelantikan dirangkai dengan penyerahan SK pelaksana tugas (Plt) terhadap 12 orang eselon II. Pelantikan yang terdir dari 20 pejabat eselon III dan 29 eselon IV serta penyerahann 12 SK Plt eselon II, dilaksanakan di aula kantor Bupati Padang Lawas Selasa (15/1), siang menjelang sore. Adapun pejabat eselon III yang dilantik diantaranya, H.Paruhum Mulia Daulay SE, sebagai Sekretaris Dinas dukcapil, Sarwedi Hasibuan sebagai Kabid Aset di dispenda dan seterusnya. Sedangkan pejabat eselon IV yang dilantik diantaranaya, Pangadi, S.Pd sebagai kasubbag

protokol dan perjalanan dinas pada sekretariat DPRD palas. Abdul Rauf Hasibuan sebagai Kasi tapem dikantor camat Hutaraja Tinggi, Syamsul Bahri Siregar sebagai Kasi kemasyarakat di kantor Camat Ulu Barumun. Sementara pejabat eselon II yang menerima SK Plt yakni, Ir Soleman Harahap MM yang sebelumnya menjabat Kadis Kehutanan dan perkebunan diangkat menajadi Plt Stap ahli bidang kemasyarakatan sedangkan Thamrin Harahap SP yang sebelumnya sebagai sekretaris Dinas pertanian kini diangkat menjabat Plt Kadis Kehutanan dan Perkebunan Palas. Syahruddin Harahap, SP sebagai Plt Kadis Perikanan dan Peternakan, Alwinsar Hasibuan SH Plt Inspektur ,Drs.Hamzah Hasibuan sebagai Ass III, Drs Abdul Rahim Hasibuan sebagai Plt Stap Ahli

bidang pemerintahan, H. Ismail Siregar SP sebagai Plt Kaban Penyuluhan Pertanian dan Kehutanan. Sedangkan Hasanuddin Nasution S.Sos yang sebelumnya menjabat Ass I, kini di percaya menjabat Plt Kadis Pendapatan Keuangan dan Aset Daerah yang sebelumnya dijabat Drs Risman K Harahap. Yenni Nurlina Siregar SP yang sebelumnya menjabat Sekretaris Bappeda kini menjabat Plt Kaban Bappeda yang sebelumnya dijabat Drs Choirul Insan Harahap.Sedangakan Drs Choirul Insan Harahap diangkat menjabat Plt Ass II, Ir. Abdullah diangkat menjabat Plt Kadis pertanian dan Gunung Tua Hamonangan Daulay yang sebelumnya menjabat Kabag Tapem kini diangkat Plt Ass I bidang pemerintahan. (Ali )

PALAS BN Ketua PPK Kecamatan Hutaraja Tinggi (Huragi) Drs Ali Sati Harahap (ALS) saat di konfirmasi di ruang kerjanya mengatakan,Kecamatan Huragi sudah menetapkan jumlah pemilih untuk pemilihan Gubernur Sumatera Utara yang akan di laksanakan pada 7 Maret 2013. Menurut ALS dari hasil rapat pleno KPUD Palas tanggal 5 Januari 2013 telah menetapkan rekapitulasi jumlah pemilh terdaftar pemilihan umum Gubernur dan wakil Gubernut Sumatera Utara oleh panitia pemilihan Kecamatan yang terdiri dari 13344 laki-laki,13507 perempuan dengan total keseluruhan 26.851 jiwa. Lanjut ALS jumlah tersebut adalah akumulasi dari total jumlah pemilih seluruh desa yang berada di kecamatan Huragi yakni,Desa Aliaga 773 pemilih,Hutaraja Tinggi 647,Lubuk Bunut 2,755,Mananti Sosa Jae 919,Panyabungan 180,Parmainan 530,Pagaran Dolok Sosa Jae 115,Pasar Panyabungan 242,Payaombur 374,Pir Trans Sosa IA 1100,Pir Trans IB 952,Pir Trans Sosa II 1334,Pir Trans Sosa III A 771,Pir Trans IIIB 651,Pir Trans Sosa IV 937,Pir Trans Sosa V 608,Pir Trans Sosa VI 580,Siabu 335,Sibodak Sosa Jae 1227,Sigalagala 138,Siglapung 666,Simangambat 136,Sungaikorang 999,Tanjung Bale 409,Tanjung Baringin 230,Ujung Btu I 1974,Ujung Batu II 1957,Ujung Btu III 1598,Ujung Batu IV 2100,Ujung Btu V 1477 dan Desa Ujung Padang 137 pemilih. Ditambahkannya lagi dalam mensukseskan pemilihan nantinya pihaknya sudah menyediakan 76 TPS yang tersebar di seluruh desa yang berada di Kaecamatan Hutaraja Tinggi.Disamping itu beliau berharap supaya masyarakat Kecamatan Huragi merasa terpanggil untuk menggunakan haknya pada TPS yang sudah disediakan nantinya pada pesta demokrasi Pemillihan Gubernur dan wakil Gubernur Sumatera Utara.(Ali )


2 Pelaku dan Supir Betor Diamankan Polisi Binjai, BN Sat-ReskrimPolresBinjai,Jumat(18/1)Sekirapukul03.50 Wib,melakukanpenagkapanterhadapMaulanaGinting(24) Warga Raja Tengah Kuala, Kab Langkat, dan Jeri (33)Warga Jalan Soekarno Hatta,TanahTinggi, Kecamatan BinjaiTimur atas pencurian aset milik Sekolah Taman Kanak-kanak (TK) AisyahBinjaiJalanRAKartiniBinjaiKotayangakanmembawa barang curian dengan becak bermotor setelah melakukan aksi.DarihasilpenagkapanPolisi,barangyangberhasildibawa keluar dari loksi Sekolah Taman Kanak-kanak Aisyah oleh kawanan pencuri berupa alat berharga prangkat elektronik, sepertiTV,Tape Corder, Lodspeaker Ampli, Keyboard, 3 buah Maic, Remot,Termos, Carger, dan segulunganWayar. Keterangan yang di peroleh BN dari Kepolisian menyebutkan ,” bahwa dari penagkapan pelaku berkat

kecurigaan Anggota Sat Reskrim yang melihat adanya dua priasedangmengangkutbarangdarilokasisampingSekolah TK Aisyiyah dengan Betor, dan berdasarkan kecurigaan itu Polisi langsung melakukan menghenikan Betor yang selanjutnyamelakukanpemeriksaanbarang-barangyangdi bawakeduapelaku. Ketika Polisi melakukan introgasi dan pemeriksaan di lapangan,MaulanaGintingdanJerimencobaberkelitdalam menjawabpertanyakanpetugasyangberalasankalaubarang tersebutadalahmiliknyayangmaudipindahkankekontrakan baru,bahkanmerekaberalasanmaumemindahkanbarang miliknya ke kontrakan baru. Namun demikian, Polisi sendiri tidak begitu yakin dengan jawaban para pelaku, hingga petugas meminta KTP sebagai jaminan, namun demikian selanjutnyakeduapelakubersamabarangbuktisekaligussupir

becaknyadiamankandandiboyongkeKomandoSat-Reskrim Polres Binjai, hingga di lakukan pemeriksaan secara intensifkeduapelakumengakuikalaubarangituhasilcurian mereka Dalam aksi pencurian tersebut awalnya dilakukan sendiri oleh Maulana seorang di lokasi Sekolah, dan sebelumnya Molana sudah 2 hari melihat kondisi keadaan SekolahTKtersebut,Maulanamelakukanpencuriandengan cara membukan jendela kaca nako dari samping dan mengeluar barang curian dari ruangan, selanjutnya menghubungi jeridiluarlokasisekolahdanmemerintahkan agarmencari becakuntukangkutan,dandalamketerangan diKepolisian,bahwaMaulanatercatatsebagaiResediviskasus pencurian, dan bahkan tercatat Maulana baru bebas tahun 2011 dari LP Tanjung Pura. KepadaBN,MaulanasaatberadadiselSatReskrimPolres

Penggunaan Dana Rehab Sekolah Perlu Pengawasan Serius Langkat BN Pemerintah Kabupaten Langkat telah mengalokasikan DAK dari APBN dan APBD yang jumlahnya mencapai milyaran rupiah untuk merehabsekolah. "DAKdipergunakanuntukmerehabsekolahyang pencairannya melalui transfer kerekening kepala sekolah yang mendapat bantuan secara bertahap", ujar warga. DariinformasiyangdiperolehdariKUPTDmasingmasing disebutkan ada beberapa sekolah yang mendapatkan bantuan di Langkat Hulu antara lain : Kecamatan Bahorok sebanyak 10 sekolah SD, 1 SMP, dan di Kecamatan Kuala juga 10 sekolah SD, di

Kecamatan Selesai 6 SD 1 SMP, dan di Kecamatan Kutan Baru sekolah yang mendapat bantuan rehap sebanyak 6 SD. Namun hasil inVestivigasi wartawan koran ini dilapanganmasihbanyaksekolahyangtidakmemakai dan mengikuti petunjuk tehnis bangunan. Bahkan adasekolahyangmenggunakanbahanbangunannya darikayusembarangandanjugatidakmenggunakan plangpelaksanaankerja. Anehnyalagiadajugasekolahyangmembangun hanyasekedarmenambahsedikitsajabangunannya agar seolah-olah pelaksanaan telah dilaksanakan sepenuhnya sesuai dengan standart, seakan-akan menutupipenyelewengankepalasekolahpenerima.

" Patut diduga kepala sekolah maupun KUPTD diduga bekerja sama ikut mencicipi sebagaian dari danatersebut",ujarwargayangtidakmaudisebutkan namanya. Salah satu kepala sekolah SD ketika dikomfirmasi wartawan tentang rehab sekolah menyebutkan mereka telah melaksanakannya dengan baik sementaradanayangmerekasangatminim. " Untuk tiga ruangan kami hanya mendapat anggaranRp139juta.Sementarabanyaksekolahyang mendapat bantuan Dana DAK yang menggunakan kayubekasdankayukelapa,meskipunpadadasarnya rehab ini semua harus diganti baru",ujarnya lagi, ” ujar salah seorang Kepala sekolah.(UDN)

Rumah Semi Permanen Ludes Terbakar DOLOK MASIHUL,BN Rumah semi permanen milik Roslina Br Pasaribu Ibu (48) tahun warga lingkungan VIII Pekan Dolok Masihul Kec.Dolok Masihul Kab.Serdang Bedagai ludes dilahap si jago merah, senin (14/1-13) sekira pukul 07.30 Wib. Kobaran api dengan cepat merambat dan menghabisi seluruh bangunan beserta isinya, hingga dalam waktu singkat rata dengan tanah.

Tidak ada korban, namun kerugian di perkirakan mencapai Rp.125 juta rupiah. Informasi dihimpun wartawan Bongkar di lokasi, pagi itu seperti biasa, korban yang membuka warung lontong di depan rumah sambil memasak kue dengan menggunakan kompor sumbu. Berhubung karena ada pembeli korbanpun meninggalkan kompor dan memasak kue dalam posisi kompor masih menyala. Tapi ketika korban kembali untuk

melihat, api sudah membakar bagian dinding yang terbuat dari tepas dan papan. Spontan korban berteriak histeris, mengetahui kejadian itu warga sekitar langsung heboh dan mencoba melakukan usaha untuk memadamkan api, yang bersebelahan dengan Kantor Lurah Pekan Dolok Masihul. Api baru dapat dipadamkan sekira satu jam dengan dibantu ratusan warga dengan menggunakan wadah seadanya saja.(Ibnu)

Binjai megatakan ,”aksi pencurian itu Saya lakukan karena butuh uang untuk bayar rumah kontrakan, sebab dari penghasilan supir angkot per harinya hanya 20 ribu saja, jadi tidak cukup untuk membayar kontrakan, terang Maulana sambil tertunduk Sementara itu Kasat Reskrim Polres Binjai AKP Revi Nur Velaniketikadikonfirmasimembenarkankejadiantersebut, dan menurutnya ,”kedua pelaku ditangkap berdasarkan kecurigaan anggota kita yang melihat pegerakann dari para pelaku,dankinikeduapelakudanpengumdibecaktengahdi lakukanpemeriksaan,untuksementaraitupengemudibecak di periksa hanya sebagai saksi, sedangkan kedua pelaku di tetapkan sebagai tersangka dan kita tahan, sebab terbukti melanggar pasal 363 KUHP dengan Ancaman 7 Tahun penjara, terang Revi.(Fris/007)

Pengukuran dan Pemotoan Jangan Hanya Menyenangkan Hati Warga LANGKAT BN PemberitaanterkaittidaktersentuhnyapembangunandiDusunSukurejoDesa Padang Brahrang mendapat tanggapan yang positif dari aparat desa.Warga mempertanyakankondisidusunmerekayangsangatterbelakangdikerenakantidak mendapat proyek pembangunan baik dari Dinas PU ,PNPM maupun ADD. "KepalaDesaseakantidakmemperhatikankondisidesamereka.Apakahproyek pemabngunan jalan pernah disampaikan kepala desa dalam musrenbang", tutur salahseorangwarga. Namun warga kini dapat berlapang hati akibat pemberitaan dari dari salah satu media terbitan Medan ,pihak Dinas PU telah mengukur dan memfoto jalan yang akan dibangun. "Jalan kami sudah diukur dan difoto,katanya akan segera diaspal", kata warga. Namun sampai saat ini kegiatan untuk proyek pembangunan jalan tidak ada tanda-tandanyaseakan-akanhanyauntukmenyenangkanwargasaja. Sementaraitutinformasiyangdiperolehdari pegawaikantorcamatyangberinisial (MY) menyatakan Rabu (16/1) sudah dilaksanakan Musrembang di kantor desa PadangBrahrang. " Kadus atas nama masyarakat Sukorejo telah mengusulkan sepanjang 1.5 KM jalan dusun sukerjo agar diaspal secepatnya, dan kepada PNPM diusulkan agar membangunlainingparetjalansepanjang300M",ujarnya.Rapatmenyatakansudah setuju dan hanya tinggal menunggu waktu pelaksanaanya saja,lanjutnya lagi. Menyikapi hal diatas warga bertekad bila mana dalam waktu dekat ini proyek belum terealisasi maka Dusun Sukoreja akan melakukan aksi dengan mendatangi Bupati dan DPRD Langkat untuk meminta sikap tentang pembangunan jalan tersebut. (TIM).

21 - 28 JANUARI 2013 | EDISI 343 | THN KE-VIII

Masyarakat Pematang Sijago Desak Dishub Kab Batubara Pasang Portal Air Putih, BN Dinas perhubungan Kab Batubara dinilai kalangan masyarakat daerah itu tidak berfungsi. Pasalnya sampai hari ini Dinas yang dipimpin oknum Kadis Asm,Spd belum mampu menindak truk melebihi muatan tonase yang kerap melintas diruas jalan Kuala Tanjung-Simp Pematang Sijago Kab Batubara. yang acap kali menimbulkan keresahan warga dan pengguna jalan. Untuk itu sudah selayaknya instansi itu segera memasang portal agar kondisi jalan bisa terlindungi.'Sebut Ketua DPD BMPAN Kab Batubara Yusrizal Siregar kepada Wartawan Selasa (20/1). Yusrizal menambakan,jika Dinas Perhubunga tidak segera memasang portal untuk mencegah kerusakan jalan yang baru saja dibangun dengan menggunakan anggaran APBD tersebut,maka indikasinya kerusakan jalan bakalan lebih parah lagi. 'Jalan itu baru dibangun sudah hancur, faktornya memang karena jalan hanya berkelas IIIc,tidak selayaknya dilalui truk yang melebihi muatan (tonase),ya pasti tidak tahan dan cepat hancur,' katanya. Menurutnya, meski perusahaan yang menggunakan jasa truk yang melebihi muatan telah melakukan perdamaian dengan warga yang mengalami rumahnya retak - retak akibat getaran. Tapi kedepan tidak tertutup kemungkinan untuk kedepan kalau tidak secepatnya dipasang portal jelas akan menimbulkan dampak yang negatif dan merugikan masyarakat sekitarnya. Dalam hal ini Dinas Perhubungan harus secepatnya mengambil tindakan demi melindungi kepentingan rakyat banyak dan harus mengambil langkah dengan memasang portal agar tidak timbul ketegangan gesekan terhadap warga dibelakang hari," tandasnya.(yan)

Bupati Batu Bara Menyerahkan Kartu Sehat Kepada Masyarakat Batu Bara , BN Bupati Batu Bara H. OK Arya Zulkarnain, SH, MM secara simbolis menyerahkan kartu sehat Jaminan Kesehatan Masyarakat (Jamkesmas) sebanyak 8650 lembar kepada masyarakat di desa Sukaramai, Sukorejo, Siajam Sei Balai, pada hari Selasa, 8 Januari 2012, yang mana pelaksanaannya dilaksanakan di komplek perguruan Pahlawan-Sukaramai( selasa , 08/01/13). Program Kesehatan gratis ini merupakan wujud dari visi dan misi Pemkab Batu Bara. Selama ini banyak masyarakat yang sakit, namun tidak dapat berobat, karena keterbatasan dana. Tidak ada alasan menunggu, bila sakit segera datangi Pusat Kesehatan Masyarakat (Puskesmas) dan Rumah Sakit Umum Daerah (RSUD) karena semua gratis dari penyakit ringan seperti demam, flu dan batuk hingga melahirkan semua gratis tanpa dipungut biaya apapun. Masyarakat hanya membawa dan menunjukkan kartu sehat dan para medis akan melayani. Kepada semua tenaga medis harus memberikan pelayanan terbaik kepada seluruh masyarakat. Bupati mengharapkan kepada kepada seluruh lapisan masyarakat Batu Bara yang telah mendapatkan kartu Jamkesmas untuk menggunakan sebaik-baiknya. Pemkab Batu Bara senantiasa tanggap dan peduli terhadap kesehatan. Terbuki pada anggaran 2013 jumlah anggaran untuk kesehatan masyarakat yang dituangkan dalam belanja Dinas Kesehatan dan pelayanan kesehatan. (Jamila )

Apel Gabungan Minggu I Pemkab Batu Bara Batu Bara , BN Apel Gabungan yang biasanya dilakukan setiap Hari Senin, bertindak sebagai pelaksana apel adalah Bagian Perlengkapan dan Perawatan Setdakab Batu Bara. Bertindak sebagai Pembina apel, Bupati Batu Bara H. OK Arya Zulkarnain, SH, MM. Bupati dalam sambutan mengatakan Kepala satuan kerja perangkat daerah (SKPD) yang akan melaksanakan lelang umum/tender pada tahun 2013 harus sudah melalui layanan pengadaan secara elektronik (LPSE). Mengingat masih minimnya PNS yang telah lulus ujian dan memiliki sertifikat keahlian pengadaan barang/jasa, oleh karenanya kepala SKPD diharapkan untuk mempersiapkan personil yang menguasai di bidang pengadaan barang/jasa pemerintah untuk diikut sertakan dalam pendidikan dan pelatihan serta ujian sertifikasi pengadaan barang/jasa pemerintah, sehingg dalam pelaksanaan proses pengadaan barang/jasa dilingkungan pemerintah Kab. Batu Bara tidak mempunyai hambatan lagi Dalam rangka pelaksanaan pengadaan barang/jasa sangat rawan terjadinya penyimpangan baik dalam bentuk administrasi maupun tindak pidana korupsi. Sangat diharapkan bagi aparatur yang terlibat langsung dalam pengadaan barang/jasa pemerintah agar betul-betul mempedomani ketentuan yang sudah ditetapkan seperti berpengalaman dan memahami tentang prosedur serta proses pengadaan barang/jasa pemerintah, memiliki sertifikat keahlian pengadaan barang/jasa sesuai dengan kompetensi yang dipersyaratkan. (Jamila )

Pemotongan Dana Siswa Miskin, Bukan Sukarela Tapi Kebijakan Kepala Sekolah Nakal

Oknum kepala sekolah yang melakukan kebijakan pemotongan dana miskin

Belawan, BN Mentang-mentang menjabat kepala sekolah, prilaku dan sifatpin berubah tidak mencerminkan pemimpin yang amanah, bahkan

asal itu duit sikat (AIDS) tidak peduli itu berupa bantuan untuk si miskin yang harus diserahkan tanpa adanya pemotongan yang beralasan pada simiskin. Sifat seperti itu tidak pantas ditiru oleh pimpinan atau kepala sekolah dasar negeri lainnya dibumi pertiwi ini yang telah menodai citra bantuan buat simiskin apalagi bantuan untuk siswa. Kebijakan pemotongan dana siswa miskin itu telah dilakukan oleh kepala sekolah dasar negeri 060969 Ainun Mardiah, S.Pd tahun anggaran bantuan siswa miskin 2012 kemarin. Dugaan pemotongan bantuan dana siswa miskin itu terkuak oleh sejumlah wali-wali murid yang menerima terjadinya pemotongan bahkan juga sebaliknya wali murid yang tidak menerima bantuan yang selayaknya mendapat bantuan dari pemerintah Terkait dugaan pemotongan

Pelantikan Pejabat Kepala Desa Sebanyak 35 Orang se -Kab. Batu Bara

Batu Bara , BN Pelantikan Pejabat Kepala Desa se- Kab. Batu Bara sebanyak 35 orang dilakukan secara langsung oleh Bupati Batu Bara H. OK Arya Zulkarnain, SH, MM pada tanggal 14 Januari 2013 di aula DPRD Kab. Batu Bara. Bupati dalam sambutan mengatakan Pemerintahan desa se-

bagai unsur yang terdepan dan bersentuhan langsung dengan masyarakat diharapkan untuk lebih aspiratif, kreatif, inovatif, cepat tanggap terhadap perkembangan situasi dan kondisi kehidupan masyarakat. Bupati juga mengingatkan kepada kepala desa yang dilantik agar

menjadi pelayan bukan harus dilayani. Kepada seluruh masyarakat desa agar dapat turut serta membantu tugas pejabat kepala desa sehingga tujuan masyarakat sejahtera dan berjaya segera terwujud, yang paling terpenting saat ini partisipasi aktif yang positif dari masyarakat sangat diperlukan dalam mengisi pembangunan. Mari kita berikan dukungan kepada pejabat kepala desa dalam mensukseskan program pemerintah. Kepala desa yang dilantik terdiri dari Kecamatan Sei Balai 5 orang, Talawi 3 orang, Tanjung Tiram 4 orang, Lima Puluh 5 orang, Air Putih 5 orang, Sei Suka 6 orang dan Medang Deras 7 orang. Turut hadir dalam acara ini Ketua DPRD Batu Bara Selamat Arifin, SE, M.Si, Asisten Pemerintahan H. Zulhendri, SH, Asisten Administrasi Umum H. Azrai, SH, Kepala BPMPD Budi Iswan Sinaga SSTP, Camat se Batu Bara dan Kapolsek Lima Puluh AKP MA Ritongah. (Jamila )

Peringatan Hari Amal Bakti ke - 67 Kementrian Agama RI Batu Bara , BN Seiring dengan dinamika kementerian dan dinamika masyarakat, fokus sasaran pembangunan bidang agama yang menjadi tumpuan tugas Kementerian Agama adalah untuk mendekatkan kita pada visi terwujudnya masyarakat Indonesia yang taat beragama, rukun, cerdas, mandiri dan sejahtera lahir bathin. Dalam hubungan tersebut 5 (lima) bidang yang menjadi program strategis Kementerian Agama adalah peningkatkan kualitas kerukunan umat beragama, peningkatan kualitas pendidikan agama dan pendidikan keagamaan, peningkatan kualitas penyelenggaraan ibadah haji serta tata kelola kepemerintahan yang baik (Good governance). Hal ini ter-

cantum dalam sambutan Menteri Agama RI yang dibacakan oleh Bupati Batu Bara H. OK Arya Zulkarnain SH, MM pada Peringatan Hari Amal Bakti Ke-67 Kementerian Agama RI pada hari Kamis, 3 Januari 2013. Tolak ukur keberhasilan program Kementerian Agama tidak seluruhnya dapat dituangkan dalam grafik dan angka-angka yang bersifat kuantitatif, tetapi banyak pula yang bersifat kualitatif. Peningkatan kualitas kehidupan beragama, kerukunan umat beragama serta pendidikan agama dan keagamaan mencakup dimensi pembangunan manusia dan perubahan masyarakat yang membutuhkan proses dan waktu untuk menikmati hasilnya.

Serah Terima Jabatan Ketua Dharma Wanita Persatuan Tebingtinggi, BN Serah Terima Jabatan Ketua Dharma Wanita Persatuan Kota Tebing Tinggi, Sumatera Utara, dari Ny Gabena Marapusuk kepada Ny Milda Silvaniati Johan, Selasa 16/ 1, bertempat di gedung Hj Sawiyah dan di saksikan PenasehatDWP Kota Tebing Tinggi Ny Hj Sri Kurnia Ningsih Umar Zunaidi. Serah terima berdasarkan SK Ketua DWP Propinsi Sumatera Utara tentang pengesahan ketua DWP KoTA Tebing Tinggi masa bhakti 2009-2014. Penasehat DWP KoTA Tebing Tinggi, Ny Hj Sri Kurnia Ningsih Umar Zunaidi, dalam arahannya mengatakan acara serah terima jabatan DWP Kota Tebing Tinggi telah kita saksikan, semoga dengan dilantiknya Ny Milda Xilvaniati Johan sebagai ketua DWP Kota Tebing Tinggi dapat melaksanakan tugas-tugas Dharma Wanita. Karena Dharma Wanita turut berkiprah mengambil bagian dalam upaya membangun bangsa, melalui kaum perempuan, istri dari PNS. Kinerja Dharma Wanita Persatuan dilakukan dengan baik dalam kerja nyata guna meningkatkan wawasan dsan pengetahuan anggotanya, serta memanfaatkan potensi dan kualitasnya dengan sebaik-baiknya sebagai ibu rumah tangga maupun sebagai abdi masyarakat. Dalam menjalankan peran sebagai Organisasi Kemasyarakatan yang bernaung dibawah Pemerintah, DWP diharapkan dapat berperan aktif untuk mensukseskan program kemasyarakatan bersama-sama dengan Tim Penggerak PKK yang merupakan mitra kerja Pemerintah dimana kedua institusi ini dapat bekerja sama bergandengan tangan dalam mewujudkan masyarakat Kota Tebing Tinggi yang sejahtera. (DER)

dana miskin ketika mau dikomfirmasi wartawan koran ini oknum kepala sekolah dasar negeri 060969 Ainun Mardiah, S.Pd bersifat arogan dan sebaliknya mengusir wartawan koran ini tidak mau dikomfirmasi. Sementara atas adanya pemberitaan di edisi kemarin dikoran ini terkait perbuatan oknum kepala sekolah yang melakukan kebijakan pemotongan dana miskin yang telah mencoreng citra pendidikan yang beralamat dijalan cimanuk kelurahan belawan II kecamatan medan belawan selanjutkan dikomfirmasikan ke Unit Pelaksana Teknik (UPT) TK SD Nur Aisah, S.Pd sangat sulit ditemui, bahkan berulang kali mendatangi kantor di jalan veteran belawan. Oleh sejumlah pegawai mengatakan ibu lagi sakit dan yang lain juga mengatakan ada tamunya. Padahal wartawan koran ini mau komfirmasi tentang mengambil dana ban-

Tetapi dalam beberapa aspek yang dapat langsung terukur, pencapaian kinerja Kementerian Agama cukup membanggakan, misalnya lembaga pendidikan yang dikelola Kementerian Agama tidak lagi dipandang sebagai lembaga pendidikan kelas dua. Tidak sedikit lulusan madrasah dan pesantren yang mampu menembus perguruan tinggi negeri unggulan baik di dalam maupun di luar negeri. Dalam penyelenggaraan ibadah haji, segenap jajaran Kementerian Agama bersyukur dan gembira bahwa penyelenggaraan haji pada tahun ini lebih baik dibanding tahun sebelumnya. Pemerintah terus berupaya meningkatkan kualitas pelayanan haji, pembaruan kebijakan penyelenggaraan ibadah haji, baik di tanah air maupun di Arab Saudi dan mewujudkan akuntabilitas pengelolaan dana haji. Selain itu, menyangkut pencapaian kinerja dalam aspek tata kelola, khususnya dalam pengelolaan anggaran dan laporan keuangan, Kementerian Agama telah meraih opini 5 Wajar Tanpa Pengecualian (WTP) Dengan Paragraf Penjelasan (DPP) dari Badan Pemeriksa Keuangan (BPK). Prestasi tersebut harus kita pertahankan dan tingkatkan di tahun-tahun mendatang. Turut hadir dalam acara ini(kamis,03/01/13) Ketua DPRD Batu Bara H. Selamat Arifin, SE,, Kakan Kemenag Batu Bara Sainik, Br serta peserta acara Hari Akmal Bakti ke- 67. (Jamila )

tuan siswa miskin ke kantor pos apa bisa dilakukan oleh kepala sekolah langsung? Dan inilah yang mau dikomfirmasikan. Terkesan Ka. UPT tersebut alergi menemui wartawan koran ini. Ada apa sebenarnya!" Ka. UPT Kecamatan Medan Belawan. Disisi lain ketika ditemui wartawan koran ini selaku komite sekolah Abdul Munaf Harahap kemarin mengatakan dirinya sejak 15 Juli 2012 telah mengundurkan diri dari Anggota komite sekolah dasar negeri 060969 dikarenakan tidak adanya SK komite yang akurat sesuai peraturan yang dikeluarkan oleh dinas pendidikan kota medan sebagaimana adanya ketua, sekretaris, bendahara, dan anggota disebutkan ia hanya sebagai komite sekolah. Lanjut tentang adanya usulan bantuan siswa miskin (BSM), pemilihan barang-barang untuk keperluan sekolah atau ATK maupun dana BOS tahun anggaran 2010,2011,

2012 ia tidak mengetahui bahkan tidak pernah dipanggil ataupun diundang oleh kepala sekolah bahkan disebutkan tidak pernah menerima dana atau honor bahkan dalam rapat-rapat komite tidak pernah diundang sama sekali, jelas Munaf. Terkait adanya arogansi dan kebal hukum terhadap oknum kepala sekolah dasar negeri 060969 sejumlah wali murid merasakan kekesalannya dan sumpah serapah terhadap oknum kepala sekolah yang belum ditindak oleh dinas pendidikan kota medan maupun Ka UPT, wali-wali murid mengharapkan dan sejumlah pemerhati pendidikan dikota belawan agar dinas kota medan mencopot jabatan kepala sekolah, karena dinilai telah mencoreng norma-norma pendidikan yang berazaskan tut wuri handayani apalagi telah mengusir wartawan koran ini ketika dikomfirmasi. (Muhazir/Jafar)

Upacara Kesadaran Nasional Aparatur Pemerintah Batubara Batu Bara , BN Upacara Kesadaran Nasional Aparatur Pemkab Batu Bara yang biasanya dilakukan pada tanggal 17 setiap bulannya dilaksanakan pada hari Kamis, 17 Januari 2013. Bertindak sebagai pelaksana upacara adalah Kantor Pelayanan dan Perizinan Terpadu. Bertindak sebagai Pembina upacara, Bupati Batu Bara H. OK Arya Zulkarnain, SH, MM yang dalam hal ini diwakili oleh Sekretaris Daerah, Erwin, SE. Bupati dalam sambutan mengatakan kantor pelayanan perizinan terpadu Kab. Batu Bara telah ditetapkan sebagai lembaga pelayanan penerbitan izin, sedangkan tugas pembinaan dan pengawasan terhadap perizinan menjadi kewenangan SKPD teknis. Oleh sebab itu kantor pelayanan perizinan terpadu perlu meningkatkan koordinasi dengan SKPD teknis melalui tim teknis. Dengan mempedomani peraturan perundang-undangan yang berlaku. Untuk menghindari terjadinya deviasi atau penyimpangan dalam proses pelayanan perizinan oleh setiap aparatur, harus dilaksanakan berdasarkan Standar Operational Procedure (SOP) yang jelas dan rinci mengenai alur kerja yang harus dilakukan. Dengan kata lain dalam melaksanakan tugas setidaknya dibuat tata cara dan tahapan layanan, mulai dari pengajuan permohonan, pemrosesan, pembayaran retribusi sampai pada penyerahan izin kepada pemohon. (Jamila )

Pesta Muda-Mudi Batu Bara I Ormas MP3 Bajaya Batu Bara , BN Sebagai bangsa yang besar Indonesia memiliki keanekaragaman suku bangsa. Bahwa keberadaan budaya dan adat istiadat tumbuh dan berkembang sampai ke pelosok negri. Keberagaman suku, adat serta budaya bukanlah suatu penghalang untuk kokohnya kesatuan dan persatuan bangsa, melainkan sesuatu yang mesti disyukuri dan dijadikan perekat yang utuh. Bupati Batu Bara H. OK Arya Zulkarnain, SH, MM dalam sambutannya( jum'at,11-01-2013 mengatakan keanekaragaman adat budaya di Indonesia umumnya dan di Batu Bara khususnya, telah teruji kemumpuninya dalam menghadang serta filterisasi peradaban modren budaya asing. Melalui acara pesta muda mudi Kab. Batu Bara para tokoh masyarakat, agama, budaya, cendikiawan dan Ormas MP3 Bajaya meluangkan fikiran dan kesempatannya untuk meramu filter dalam mempertahankan budaya bangsa dengan berbagai kegiatan positif. Bupati juga mengucapkan terima kasih kepada tokoh masyarakat, adat, cendikiawan serta Ormas MP3 Bajaya sebagai penyelenggara atas terselenggaranya acara ini. Semoga kegiatan ini membawa perubahan karakter muda mudi di Kab. Batu Bara yang menjunjung tinggi budi pekerti yang luhur serta nilai-nilai budaya bangsa. (Jamila )

e-KTP Desa Guntung Dibagi Gratis Limapuluh, BN Pembagian Kartu Tanda Penduduk KTP telah di bagian. Menurut nara sumber perangkat Desa Guntung kec. Lima Puluh Amir Husin sebagai kaur Pen menegaskan pada kabiro Koran (BN) jumat 18/1 di bak Desa setempat Pembagian Kartu Penduduk di mulai pada hari Rabu 16/1 sampai selesai masyarakat tanpa di pungut biaya apapun dalam pengambilan EKT semuanya berjalan sukses aman masyarakat juga senang dalam pembagian EKTP Elektronik karena ini gagasan Bupati Batu Bara H. OK Arya Julkarnain, SH. MM sebagai Bupati batu bara yang komitmen terhadap masyarakatnya. Pembagian EKTP Elektronik terjun langsung Kepala Desa baru yang juga selalu setia pada warganya Kades. MUKLIS didampingi oleh perangkat Desa Guntung semuanya berjalan aman.(Susianto)

Waka Poldasu Berpesan Agar Putri Sumut Berlaga Ingat Tuhan WAKA Polda Sumut Brigjen Cornelis Hutagaol menerima audensi Putri Sumut 2012 Eva Septriani Sianipar, Kamis[17/1] yang didampingi anggota Komisi E DPRD Sumut Richard Eddy M Lingga yang akan berlaga di ajang Pemilihan Putri Indonesia[PPI] 2013 mendatang. Brigjen Cornelis Hutagaol yang didampingi Direktur Binmas Poldasu Kombes Pol Hery Subiansauri berpesan agar tidak mengharumkan nama Sumut saja,

tapi tujuan yang paling penting memuliakan Tuhan. Juga disebutkannya sebagai mahluk Tuhan yang diberikan berkat sehingga dapat unggul dan dipilih,terlalu kecil bila Eva berniat memenangkan PPI 2013 hanya untuk membawa nama Sumut. Tujuan yang paling mulia adalah menyenangkan Tuhan, hal itu yang disebutkannya sebagai bukti mensyukuri berkat Tuhan yang telah diberikannya. Cornelis mencontohkan dalam

karirnya dirinya hanya mengandalkan Tuhan untuk mendapatkan jendral. Oleh sebab itu, ia meminta Eva berdoa agar Tuhan memberkatinya. Eva mengaku sangat terkesan dengan sambutan dan antusiasme yang luar biasa dari Waka Poldasu.Ia menyebutkan Waka Poldasu telah memberikan saran dan motivasi yang membangun semangatnya untuk mengikuti PPI 2013 mendatang. Eva juga berharap masyarakat Sumut

terutama personil Polri dapat mendukungnya. Ia pun siap untuk memenangkan PPI mendatang. Ia juga merasa terbangun dengan pesan Waka Poldasu yang menyebutkan ,dirinya sebagai wanita Batak yang dikenal gigih harus mampu mengharumkan nama Provinsi Sumatera Utara[Sumut].Dan mengucapkan terima kasih kepada Richard Eddy M Lingga yang telah membuka jalan baginya. Dikesempatan yang sama juga

Richard Eddy M Lingga mengatakan, dirinya memberikan apresiasi dan ucapan terima kasih atas semangat yang diberikan Waka Poldasu kepada Eva untuk berlaga di PPI 2013. Dijelaskannya sudah menjadi tanggung jawab DPRD Sumut untuk memfasilitasi rakyat dengan pemerintah dan ia juga berharap pemerintah memperhatikan perwakilan Sumut keajang nasional, apalagi tujuannya untuk membawa nama baik Sumut. [HZA]



21 - 28 JANUARI 2013 | EDISI 343 | THN KE-VIII

Yudi Kurnia (Ketua DPRK Banda Aceh)

Melangkah dari Usahawan Hingga ke Dunia Politik YUDI Kurnia saat ini menjabat sebagai Ketua Dewan Perwakilan Rakyat Kota Banda Aceh, dia terpilih sebagai anggota legislatif periode 2009 - 2014 mewakili Partai Demokrat. Sebelum terjun ke dunia politik, alumni Fakultas Ekonomi Unsyiah ini adalah seorang pengusaha. Dia pernah menjabat sebagai salah satu orang penting di Himpunan Pengusaha Muda Indonesia (HIPMI) Aceh. Bahkan Yudi Kurnia merupakan salah seorang yang ikut mendirikan Partai Demokrat di Aceh. Oleh karena itu, pada tahun 2004 ketika masih aktif sebagai pengusaha dia mencoba untuk mencalonkan diri sebagai anggota Dewan Perwakilan Rakyat Republik Indonesia (DPR-RI), akan tetapi dia tidak berhasil. Sebagai pengusaha dia pernah menjadi direktur pada CV. Karya Budi & Co. sejak tahun 1990 - 2007. Dia juga pernah menjabat sebagai Ketua Gabungan Pelaksana Konstruksi Nasional Indonesia (Gapensi) Aceh, Ketua Persatuan Konsultan Indonesia (Perkindo) Aceh, dan Wakil Sekretaris Partai Demokrat Aceh tahun 2002. Data Pribadi

SEKIRA 14 tahun lalu pemerintah pusat telah mengambil sikap dengan menyetujui UU Nomor 44 Tahun 1999 yang mengatur tentang Syariat Islam di Aceh. Dan, untuk mengatur tentang pelaksanaan Syariat Islam tersebut, dibuatlah Perda Nomor 5 Tahun 2000. Dalam Perda Nomor 5 Tahun 2000 tentang Pelaksanaan Syariat Islam menyatakan bahwa seluruh aspek syariat akan diterapkan, termasuk yang berhubungan dengan 'aqidah, ibadah, transaksi ekonomi, akhlak, pendidikan dan dakwah agama; baitu al-mal; kemasyarakatan, termasuk cara berbusana bagi Muslim. Selain itu tertera pula di dalamnya perayaan hari raya Muslim, pembelaan Islam, struktur peradilan, peradilan pidana dan warisan. Tak hanya itu, sebagai pemantau atau pengawas bagi pelanggar Syariat Islam maka dibentuklah wilayatu al-hisbah (WH). Bahkan, Ketua Komisi D DPRK Banda Aceh, Subhan M Isa memastikan Qanun Jinayah dan Acara Jinayah bisa menjadi solusi penegakan Syariat Islam. Sebab, katanya lagi, apabila qanun tersebut sudah ada, tidak ada lagi punishment (hukuman) yang diberlakukan berdasarkan 'kesukaan' masyarakat, seperti halnya memandikan pelanggar syariat. Begitu juga dengan Reusam di gampong, yang mengatur soal hukuman terhadap pelanggar syariat tapi dengan cara melihat pada aturan yang lebih tinggi. Untuk itu dia berharap agar secepatnya qanun itu disahkan demi kebaikan semua masyarakat Aceh. "Saya secara pribadi tidak sepakat dengan tindakan main hakim sendiri. Kemudian jangan sampai ada tuntutan balik kepada penegak syariat dari pelaku maksiat, maka memberikan hukuman harus sesuai aturan," ujar Subhan. Pemberlakuan UU UU Nomor 18 Tahun 2001 tentang Otonomi Khusus Bagi Propinsi Daerah Istimewa Aceh sebagai Propinsi Nanggroe Aceh Darussalam (selanjutnya UU PNAD) mem-

bawa perkembangan baru di Aceh dalam sistem peradilan. Pasal 25 26 UU PNAD mengatur mengenai Mahkamah Syar'iyah NAD yang merupakan peradilan syariat Islam sebagai bagian dari sistem peradilan nasional. Mahkamah Syar'iyah adalah lembaga peradilan yang bebas dari pengaruh pihak manapun dalam wilayah PNAD yang berlaku untuk pemeluk agama Islam. Kewenangan Mahkamah Syar'iyah selanjutnya diatur lebih lanjut dengan Qanun PNAD. Qanun PNAD adalah Peraturan Daerah sebagai pelaksanaan dari wewenang yang diberikan oleh UU Nomor 18 Tahun 2001 untuk mengatur daerah dan Mahkamah Agung berwenang melakukan uji materiil terhadap Qanun.[10] Mahkamah Syar'iyah tersebut terdiri dari: Makamah Syar'iyah Kabupaten/Sagoe dan Kota/Banda sebagai pengadilan tingkat pertama; Mahkamah Syar'iyah Propinsi sebagai pengadilan tingkat banding yang berada di ibukota Propinsi, yaitu di Banda Aceh. Selain undang-undang ini masih ada beberapa undang-undang yang lain tentang pemberlakuan syariat Islam di Aceh, termasuk yang terakhir sekali disahkan yaitu UU Nomor 11 Tahun 2006 tentang Pemerintahan Aceh. Dalam pasal 125 ayat (1) undang-undang ini diatur bahwa syariat Islam yang dilaksanakan di Aceh meliputi aqidah, syariah dan akhlak; ayat (2) syariat Islam tersebut meliputi: ibadah, ahwal al-syakhshiyyah (hukum keluarga), mu'amalah (hukum perdata), jinayah (hukum pidana), qadha (peradilan), tarbiyah (pendidikan), dakwah, syiar dan pembelaan Islam. Qanun No. 10 tahun 2002 ten-

tang Peradilan Syariat Islam untuk pertama kalinya memperluas jangkauan wewenang hukum pengadilan agama hingga di luar hukum keluarga dan warisan, termasuk transaksi ekonomi yang sebelumnya tidak termasuk dalam yurisdiksi pengadilan agama, dan juga kasus-kasus pidana (jinayat). Mu'amalat meliputi masalah jual beli; permodalan; bagi hasil pertanian; pendirian perusahaan; pinjam meminjam; penyitaan properti untuk membayar hutang; hipotek; pembukaan lahan; pertambangan; pendapatan; perbankan; perburuhan; dan bermacammacam bentuk infaq dan sedekah. Seperti diketahui bahwa kebutuhan akan adanya sebuah Qanun Acara Jinayat di Aceh sejak dari dulu disuarakan oleh rakyat Aceh yang peduli syariat di bumi iskandar ini. namun sampai sekarang belum mencapai hasil seperti yang kita harapkan yaitu belum disahkannya qanun tersebut menjadi qanun. Sementara hukum materil sudah disahkan pada 2003 sebanyak 3 qanun yang khusus mengatur tentang delik pidana Islam, yaitu Qanun Nomor 12 Tahun 2003 tentang Khamar (Minuman Keras), Qanun Nomor 13 Tahun 2003 tentang Maisir (Judi), dan Qanun Nomor 14 Tahun 2003 tentang Khalwat (Mesum). Ketiga qanun tersebut hanya termuat dalam sebuah dokumen saja, dan belum bisa dijalankan dengan maksimal. Hal ini disebabkan karena belum adanya hukum formil (hukum acara) yang jelas yang mengatur agar hukum materil itu dapat dijalankan sebagaimana mestinya. Hukum materiil dan hukum formil keduanya saling berkaitan satu sama lain dan tidak bisa dipisahkan. Oleh karena belum adanya aturan hukum acara yang jelas yang khusus mengatur untuk melaksanakan qanun materil, maka untuk melaksanakan hukum materil tersebut masih berpedoman pada hukum peninggalan Belanda yaitu

Kitab Undang-undang Hukum Pidana (KUHP). Sehingga kejaksaan yang menuntut pelanggaran syariat masih berpedoman pada aturan yang termuat dalam KUHP. Malah sebenarnya apa saja yang termuat dalam KUHP tersebut belum lengkap mengatur tentang qanun-qanun yang ada di Aceh sekarang. Tidak pernah ditemukan ada kata-kata khalwat dalam KUHP tersebut dan begitu juga tidak ada sanksi yang jelas yang mengatur untuk pelanggaran tersebut. Di tempat terpisah, Ketua Komisi D Dewan Perwakilan Rakyat Kota Banda Aceh, Subhan M. Isa juga mendukung pernyataan Wakil Gubernur Aceh Muzakkir Manaf, kalau penerapan Syariat Islam tumpul ke atas. Prilaku ini diharapkan segera dapat diubah pada tahun 2013 mendatang. Menurut Subhan, bahwa pen-

erapan syariat islam jangan pilih bulu. Hal ini disampaikannya, Minggu 30 Desember 2012. "Memang penerapan Syariat Islam saat ini masih belum maksimal dan terkesan pilih bulu. Aplikasi di lapangan terhadap pelanggar syariat juga terlihat tidak efektif, jarang masuk dalam dimensi hukum, efek jera juga tidak ada," kata Subhan. Menyangkut hal ini, Subhan juga mengatakan, efektifitas syariat islam harus berdampak positif untuk masyarakat Kota Banda Aceh. "Kita (DPRK-red) bersama masyarakat harus meningkatkan efektifitas dari syariat Islam, karena memang syariat islam akan berjalan baik jika sama-sama didukung dan diterapkan oleh semua pihak, baik masyarakat maupun pemerintah," ujar Subhan. (***)

FUNGSI WAKIL RAKYAT 1. Legislasi (membuat peraturan) Diwujudkan dalam membentuk peraturan daerah bersama kepala daerah. 2.Anggaran(Budgetting) Diwujudkan dalam menyusun dan menetapkan APBD bersama pemerintah daerah. 3.Pengawasan (Monitoring) Diwujudkan dalam bentuk pengawasan terhadap pelaksanaan undang-undang, peraturan daerah, keputusan kepala daerah dan kebijakan yang ditetapkan oleh pemerintah daerah. TUGAS & WEWENANG 1.Membentuk peraturan daerah yang dibahas dengan kepala daerah untuk mencapai tujuan bersama; 2.Menetapkan Anggaran Pendapatan dan Belanja Daerah bersama dengan kepala daerah; 3. Melaksanakan pengawasan terhadap pelaksanaan peraturan daerah dan peraturan perundang-undangan lainnya, keputusan kepala daerah, anggaran pendapatan dan belanja daerah, kebijakan pemerintah daerah dalam melaksanakan program pembangunan daerah dan kerjasama internasional di daerah;

Nama Tempat, Tgl Lahir Status Agama email Alamat Rumah

: Yudi Kurnia, SE : Banda Aceh, 3 September 1968 : Menikah : Islam : : Jl. Gabus No. 5 Lampriet Banda Aceh Alamat Rumah Dinas : Jl. Nyak Adam Kamil No. 13 Neusu Jaya Banda Aceh Pendidikan SD Negeri 1 Banda Aceh SMP Negeri 1 Banda Aceh SMA Negeri 1 Banda Aceh S1 Manajemen, Fakultas Ekonomi,UNSYIAH Riwayat Pekerjaan Direktur pada CV. Karya Budi & Co. Tahun 1990 - 2007 Ketua DPRK Banda Aceh Periode 2009 - 2014 Data Keluaga : Diana Purmasuri Anak 1. Nabila Arfah Yuana 2. Vega Savera Yuana 3. Yashirly Asyhurin Okta Yuana Istri

4. Mengusulkan pengangkatan dan pemberhentian kepala daerah/wakil kepala daerah kepada menteri dalam negeri Republik Indonesia melalui Gubernur; 5. Memberikan pendapat dan pertimbangan kepada Pemerintah Daerah terhadap rencana perjanjian internasional yang menyangkut kepentingan daerah; 6. Meminta laporan pertanggungjawaban Kepala Daerah dalam pelaksanaan tugas desentralisasi; Selanjutnya menurut UU No. 32 Tahun 2004 pasal 24, Tugas dan Wewenang DPRD ditambah dengan: 7. Memilih Wakil Kepala Daerah dalam hal terjadi kekosongan jabatan Wakil Kepala Daerah; 8.Memberikat persetujuan terhadap rencana kerjasama internasional yang dilakukan oleh pemerintah daerah; 9. Membentuk panitia pengawasan pemilihan Kepala Daerah; 10. Melakukan pengawasan dan meminta laporan KPUD dalam penyelenggaraan pemilihan Kepala Daerah; 11. Memberikan persetujuan terhadap rencana rencana kerjasama antara daerah dan dengan pihak ketiga yang membebani masyarakat dan daerah. VISI MISI VISI Menjadikan Lembaga Perwakilan Rakyat yang terpercaya, kreatif, proaktif dan aspiratif. MISI -Menyelenggarakan fungsi legislasi secara proaktif untuk kepentingan masyarkat; -Menyelenggarakan fungsi anggaran dengan berorientasi pada pengalokasian anggaran untuk pemenuhan kebutuhan dasar masyarakat; -Menyelenggarakan fungsi pengawasan secara bertanggungjawab dan bertanggung gugat; menyelenggarakan fungsi representasi rakyat dalam rangka membangun hubungan konstituensi dengan rakyat; -Membangun kelembagaan DPRK yang kuat dan mandiri dengan didukung oleh ketaatan anggota terhadap tata tertip dan kode etik.

Kinerja 20 12 Cuk up Maksimal 2012 Cukup

DEWAN Perwakilan Rakyat Kota (DPRK) Banda Aceh, menilai kinerja mereka selama 2012 sudah cukup maksimal. Beberapa qanun telah dipaipurnakan selama tahun CMY K

2012, seperti masalah Qanun Rumah Sakit, Qanun Restribusi Parkir, Qanun Kesehatan Ibu dan APBK. Namun keberadaan Qanun

APBK dinilai paling penting dalam pengesahan selama tahun 2012 ini. Hal ini disampaikan oleh Teuku Mahdi, Anggota komisi D DPRK Banda Aceh, Minggu 30 Desember

2012. "Dari sekian banyak Raqan yang telah diparipurnakan dan disahkan, bagi saya yang paling penting selama tahun 2012 adalah Qanun APBK. Qanun ini memang sangat baik telah disahkan pada akhir tahun," kata Teuku Mahdi. Menurutnya, APBK kota Banda Aceh telah diparipurnakan pada pertengahan Desember lalu yang menjadi penutup di akhir tahun 2012. Namun Teuku Mahdi juga mengatakan, kalau qanun yang lain juga penting. "Qanun yang lain juga sama pentingnya, tapi memang APBK menjadi sumber utama segala bentuk kegiatan di Kota Banda Aceh," ucap Teuku Mahdi. Anggota Badan Legislasi DPRK Banda Aceh itu juga menambahkan bahwa sangat banyak Pansus yang dibentuk selama 2012 di DPRK Banda Aceh.

45% Diplot Bagi Pendidikan Seperti diketahui bahwa sebanyak 45 persen Anggaran Pendapatan dan Belanja Kota (APBK) Banda Aceh tahun 2013 untuk sektor pendidikan. "Sektor pendidikan merupakan fokus utama dalam APBK, yang mana 45 persen dari APBK diamprah sektor tersebut. Oleh karena itu perlu hasil yang baik untuk pendidikan kedepan, dan program-program yang dijalankan memang harus benarbenar bermanfaat," kata Ketua Komisi D DPRK Banda Aceh, Subhan M. Isa. Menurut dia, DPRK mempunyai 3 fungsi, yaitu pengawasan, penganggaran dan legislasi. Oleh karena itu, fokus pengawasan di bidang pendidikan sangat ditekankan. "Setelah APBK menetapkan 45 persen untuk sektor pendidikan,

maka pengawasan harus kita ketatkan dalam menjalankan program untuk meningkatkan pendidikan di Kota Banda Aceh. Namun sampai hari ini saya sangat heran, melihat angka kelulusan UN pelajar SMA yang tinggi, tapi kenapa masuk pergurun tinggi negeri (SNMPTN-red) sangat sulit bagi pelajar-pelajar di Kota Banda Aceh," kata Subhan lagi. Sementara itu, terkait dengan peningkatan sekolah kejuruan di Kota Banda Aceh, Subhan mengatakan harus melihat efektifitas dari setiap program. Menurutnya, saat ini sekolah belum menjadi fokus utama dalam peningkatan mutu. "Secara umum masih lebih banyak sekolah-sekolah umum dari pada sekolah kejuruan. Maka kita harus mengekfektifkan yang umum, dalam artian SMK tidak juga ditinggalkan," kata Subhan lagi. (***) CMY K

koran bongkar news edisi 343  

koran bongkar news edisi 343 beredar di sumatera utara indonesia aceh riau membongkar kasus sampai tuntas media terpaercaya di sumut utara m...
