Page 1

B

14-21 MEI 2012| EDISI 315| THN KE-VII

KANTOR REDAKSI Jl. Flamboyan Raya/Raharja No. 37 Medan Telp (061) 8213786, HP. 081375395392 - 08163134392 Fax (061) 8215552

Harga Eceran Rp 3500,Luar Daerah + Ongkos Kirim

SAMPAH Medan

Jual Pupuk di Atas HET Langgar Perbup Langkat, BN Mahasiswa Semester II Fakultas Ekonomi Universitas Panca Budi, Boga Arfiansyah Simanjuntak menyatakan, proses distribusi pupuk bersubsidi untuk petani Kota Binjai dan Kabupaten Langkat harus diawasi secara ketat. Hal ini dilakukan untuk mengantisipasi terjadinya penyimpangan dan mafia pupuk. ”Banyak anggota kelompok tani di Kota Binjai dan Kabupaten Langkat kesulitan memperoleh dan mendapatkan pupuk bersubsidi . Kalau pun pengadaan pupuk tersedia di kios –kios pengecer resmi harga bandrolnya di atas harga HET (Harga Eceran Tertinggi). Ini membuktikan lemahnya pengawasan dari instansi terkait,” ucap Boga Arfiansyah, Sabtu (12/5) Harga pupuk bersubsidi di kabupaten Langkat, ujar Boga Arfiansyah dijual para pemilik kios pengecer kepada anggota kelompok tani jauh lebih tinggi dari harga yang ditentukan oleh pemerintah. Meski pun Bupati Langkat Ngogesa Sitepu secara khusus telah menerbitkan bersa Peraturan Bupati Nomor : 03 ke halammbuanng tertanggal 7 Februari 2012 tentang Alokasi Kebutuhan dan Harga Eceran Tertinggi pupuk bersubsidi

Luar biasa. Dengan jumlah penduduk 2,8 juta jiwa, warga Medan mampu memproduksi sampah 1.500 ton perhari. Keterbatasan Tempat Pembuangan Akhir (TPA) kini menjadi permasalahan bagi Walikota Medan, Drs Rahudman Harahap. Medan, BN Ironinya lagi, dari 1.500 ton produksi sampah perhari, yang terangkut ke TPA sekitar 81 persen. Artinya, 11 persen lagi sampah yang diproduksi masyarakat Kota Medan dengan luas 25.510 hektar tersebut, saat

11

12 Jenis Ikan Hilang di Belawan bersa ke halammbaunng

11

Limbah yang tak diolah bisa menyengsarakan warga dan habitat laut. Imbasnya, menurut pengurus HNSI bersam Kota Medan, Rusli AS, sekitar 12 jenis ikan dan dua ke halambuanng jenis karang menghilang dari perairan Belawan. Hal ini pertanda tidak adanya ketegasan Pemko Medan soal pengelolaan limbah dan sanksi kepada

11

FOTO:INT/WSP

Terkesan Pilih Kasih

Pengurusan Akta Lahir & Nikah Jadi Sorotan

Panitia Lelang Dinilai Tak Profesional Pelalawan, BN Verifikasi perusahaan yang ikut serta dalam kegiatan tender pengadaan barang/jasa di BPMPD Pelalawan ini, membuat sejumlah rekanan kontraktor lokal merasa kecewa terhadap panitia pelaksana lelang. Kekecewaan sejumlah rekanan ini, karena panitia lelang di BPMPD, dinilai tidak profesional melakukan pengumuman koreksi hasil Verifikasi Arimatik terhadap perusahaan peserta lelang. “Kita kecewa atas sikap ketidakprofesionalan panitia lelang enam paket pengadaan barang/jasa di BPMPD Kabupaten Pelalawan,”sesal Suprianto, SE selaku rekanan kontraktor kepada wartawan, kemarin. Dikatakan, dari 20 perusahaan yang dibawanya dalam pengadaan barang/jasa di BPMPD tersebut, tak satu pun perusahaan diundang oleh panitia. “Padahal saya selaku rekanan yang menawarkan jasa untuk pelaksanaan kegiatan pembangunan fisik di BPMPD itu, telah mendaftarkan sebanyak empat perusahaan di setiap paket, Namun tidak dihargai bahkan saya telah menghabiskan dana mencapai sepuluh juta untuk membuat penawaran, jaminan penawaran, dukungan bank, biata materai serta fhoto copynya,” ucap Suprianto. Memang perusahaan yang diundang dan atau lulus dari verifikasi panitia tersebut, tidak mutlak sebagai pemenang tender, karena masih dilakukan verifikasi atau evaluasi selanjutnya untuk mengoreksi perusahaan-perusahaan dapat ditetapkan calon pemenang, Jelasnya. "Saya selaku profesi kontraktor, tentu sangat kecewa, sebanyak 20 perusahaan (CV) yang saya tawarkan untuk Paket-paket pengadaan tersebut dan tidak diundang,.” Imbuhnya. (RINGO)

Kasi Monitoring Hasil Tambang pada dinas Kehutanan, Pertambangan dan LH Kabupaten Pakpak Bharat, Bahrum Sihotang, Amd (foto kiri), Dua unit Pembangkit Listrik Tenaga Surya (PLTS) yang diduga digelapkan oknum Kadis Kehutanan seperti yang diungkapkan Bahrum Sihotang kepada BN, Jumat (11/5) di Salak. BN/pb.007

2 Unit Alat PLTS Diduga Diselewengkan Pakpak Bharat, BN Pengadaan Pembangkit Listrik Tenaga Surya (PLTS) bantuan Pemkab Pakpak Bharat kepada masyarakat melalui Dinas Kehutanan, Pertambangan dan Lingkungan Hidup (KPLH) tahun 2009 sebanyak 85 unit, yang dimenangkan CV Ramos Karya, diduga dua unit alat tersebut tidak

sampai kepada masyarakat. Hal itu dikatakan Kepala Seksi (Kasi) Monitoring Hasil Tambang Dinas Kehutanan Pakpak Bharat, Bahrum Sihotang Amd, kepada BN, Jumat (11/5) di Salak. Menurut Sihotang, pada saat pemasangan yang dilakukan CV Ramos Karya, ternyata dua unit PLTS tersebut tidak dipasang dengan alasan

masyarakat penerima bantuan PLTS telah meninggal dunia. Sementara salah satu penerima bantuan pindah rumah dari Pakpak Bharat, sehingga bersa kedua alat tersebut ke halammbuanng disimpan digudang menunggu proses penyaluran kepada

11

Izin Trayek Dishub Provsu Tidak Diakui Tebingtinggi,BN Perusahaan angkutan CV Netis perwakilan Tebingtinggi mengaku sangat menyesalkan sikap Dinas Perhubungan Kota Tebingtinggi yang tidak mengakui izin trayek. Padahal sebelumnya Dishub Provsu terlebih

dahulu mengeluarkan izin bagi CV Netis untuk mengangkut penumpang dengan mobil penumpang umum. “Ada diskriminasi terhadap CV Netis karena tidak diberi kesempatan menyampaikan aspirasi dan pendapat yang pada pokoknya untuk membahas

permasalahan kesimpang siuran angkutan CV Netis dan CV Tambun,” ujar mandor bersambung CV Netis Tebingtinggi, k e halaman Janes Sinaga kepada wartawan, kemarin. Sementara, lanjutnya,

11

Menilik ‘Kampung Organik’ Weh Porak

Pupuk Kimiawi ‘No Way’ Desa Weh Porak, Kecamatan Pinturime Gayo, Kabupaten Bener Meriah dikenal dengan kesejukannya. Tanah yang subur, masyarakatnya arif dan ramah. Namun di balik itu semua, tersimpan ‘kemegahan’ di Desa Weh Porak.

Liputan : Sabda EP Parinduri BUKAN soal kemoderanan, tapi kesehatan bagi warganya. Kini Desa Weh Porak dikenal dengan ‘Kampung Organik’ nya. Dari 23 kabupaten/kota yang ada di Aceh, hanya Desa Weh Porak, Kabupaten Bener Meriah yang telah mendeklarasikan ‘Kampung Organik’ nan sehat alami. Pasalnya, seluruh tanaman di desa bersambung itu menggunakan pupuk organik. k e halaman Pencetus ide Kampung Organik itu tak lain dari seorang lelaki berusia 40 tahun. Dialah Agusnadi Budaya, putra

website: www.bongkarnews.com

11

ILLUSTRASI

Email:bongkarnews@gmail.com - indrabongkarnews@gmail.com

Pangkalan Kerinci, BN Sulitnya mengurus akta kelahiran anak berusia di atas satu tahun kerap menjadi keluhan kalangan orang tua. Selain memakan waktu yang cukup panjang, hambatan yang dialami masyarakat yakni biaya penetapan akta yang harus diterbitkan oleh Pengadilan Negeri setempat. Informasi diperoleh BN, belum lama ini, kuat dugaan adanya permainan pengurusan akta lahir maupun akta nikah. Sebab, selain dikenakan biaya yang mengikat masyarakat juga menunggu sampai waktu berbulan-bulan untuk mendapatkan akta tersebut. Pelaksanaan Undang-Undang tentang administrasi kependudukan yang diterbitkan tahun 2006, nampaknya membuka peluang adanya pungli di tubuh pengadilan. Sebab, dalam undang-undang tersebut mengatur penerbitan akta lahir seorang anak bersa dengan kategori lebih ke halammbuanng dari satu tahun baru dilapor, harus melalui putusan Pengadilan.

11


14 - 21 MEI 2012 | EDISI 315 | THN KE-VII

CV. BONGKAR PERS NEWS Badan Hukum: Akte Notaris Hermaini,SH No.4 Tanggal 10 Agustus 2009 Pengesahan PN Medan No: 1520/CV/PEND/2009 NPWP: 02.996.694.2-121.000 Pembina

Pemimpin Umum/ Pemred/Penjab

: Drs. H. Kasim Siyo MSi Drs. Hendra DS HMK Aldian Pinem, SH, MH Uli Tobing Benny Soetedjo Eben Pegagan Manik : Sunardi Bonang

Wakil Pemred I/ Wakil Penjab : ESP Parindoery Wakil Pemred II/ Wakil Penjab : A. Sani Simbolon Wakil Pemimpin Umum I Wakil Pemimpin Umum II

: Johnesly Meliala : Irwansyah B

Pimpinan Perusahaan : Laini Gustina Wakil Pimpinan Perusahaan : Muhammad Ridwan Redaktur Pelaksana Dewan Redaksi

Koordinator Liputan Koordinator Daerah Litbang/Iklan Fotografer/Teknisi Penasehat Hukum Sekretaris Redaksi Keuangan

: Drs. Alfindo Amir Hamzah Siregar, SH Pendi Hariyono : Mangatur Silaban Drs. Edward Pakpahan H.Zulkarnain Abidin Rudi Sirait EPP Ringo-ringo, SE Muhammad Siregar Hotman Marbun Amran Effendi Hsb Juni Asian Tampubolon SP : Jakfar : Indrawan Sukma Antoni Sagala : Sudari,SH (Kabag) Leonard Hutasoit : Supriadi : Nurmahadi Darmawan, SH Mardianto Situmeang, SH Rosmawati, SH : Toni Purwadi, SH : Rini Alamsyah SPd

KONTAK PERSON IKLAN/SIRKULASI HP. 0816 3134 392/0813 7539 5392 IKLAN DISPLAY/UMUM RP 6.000/MM FULL COLOUR RP 21.000/MM KANTOR REDAKSI JL. FLAMBOYAN RAYA/RAHARJA NO. 37 MEDAN TELP (061) 8213786, FAX (061) 8215552 NO. REKENING: 5310 - 01 - 004167 - 53 - 5 AN. SUNARDI, BANK BRI UNIT TANJUNG SARI MEDAN PERCETAKAN/PRA CETAK : PT. SELECTA UTAMA (Isi Diluar Tanggung Jawab Pra Cetak/Percetakan)

BNI Tawarkan KPR Berbunga 11% Medan BN Bank Negara Indonesia (BNI) Kantor Wilayah Medan menawarkan kredit pemilikan rumah (KPR) BNI Griya Idaman dengan bunga flat sebesar 11% per tahun. Hingga saat ini tercatat 250 nasabah telah mengajukan permohonan untuk memperoleh KPR ini. CEO BNI Kanwil Medan, Achmad Miad Sentosa kepada wartawan mengatakan BNI Griya Idaman ini dihadirkan untuk memenuhi harapan masyarakat Indonesia, khususnya Sumut yang berpenghasilan terbatas. "Hunian ini disiapkan khususnya bagi pengajar dan tenaga pengajar. Oleh sebab itu, kami bekerja sama dengan Dinas Pendidikan setempat," ujarnya di Medan, kemarin. Achmad Miad mengatakan, program ini juga sebenarnya untuk mendukung pemerintah sebelum diluncurkannya program Fasilitas Likuiditas Pembiayaan Perumahan (FLPP) dari pemerintah. Perbedaan program ini dengan FLPP terlihat pada suku bunga kredit yang flat sebesar 11% per tahun. Sedangkan bunga FLPP yang masih digodok yakni 7,25%. Ahmad juga mengatakan, pemasaran dari program ini sejak 20 Maret sampai 30 Juni 2012 sedangkan realisasi booking pada 31 Juli. Plafon kreditnya, katanya, minimal Rp 50 juta sampai Rp 150 juta untuk rumah tipe 36. Pembiayaan yang dilakukan bank 90% dari nilai jaminan dan tenor 10 tahun sampai 20 tahun. "Jumlah unit belum bisa dipastikan dan masih diinventarisir. Ini kerja sama dengan REI. Soal letak yakni kawasan juga diserahkan ke REI," ujarnya. Achmad Miad yang didampingi Pemimpin Sentra Kredit Konsumen, Darul Kutni mengatakan bunga yang berlaku yakni 11% selama lima tahun, setelah itu diserahkan ke pasar alias bunga suka-suka tergantung kemampuan. Pihaknya juga bekerja sama dengan 121 developer di Sumut yang sudah menjadi anggota REI. "Karena baru diluncurkan, pemohonnya masih 250 orang," ucapnya. (AHS)

SMAN 10 Gelar Acara Perpisahan Medan BN Siswa kelas XII SMAN 10 Medan yang telah menyelesaikan ujian nasional tahun 2012 baru-baru ini menggelar acar perpisahan, acara perpisahan siswa SMAN 10 dilaksanakan di Uniland Medan, Rabu Kemarn. Kepala sekolah SMAN 10 Medan Drs. Suprizal Tanjung MSi mengatakan kegiatan perpisahan siswa kelas XII SMAN 10 Medan merupakan ucapan rasa syukur siswa SMAN 10 karena telah selesai melaksanakan ujian nasional dan sekaligus perpisahan sesama guru dan siswa. Sesuai dengan Thema Kegiatan Acara Perpisahan Siswa Kelas XII SMAN 10 Medan Adalah Perpisahan Bukan Akhir Dari Segalanya, tapi semoga sukses meraih cita-cita untuk kakanda kelas xii tahun 2012. Drs. Ahmad Rifaldi sebagai Sekretaris Komite SMAN 10 Medan mengatakan , hasil kelulusan tahun 2012 ini dapat lulus 100% sedangkan tahun lalu hasil kelulusan 100% sehingga nantinya siswa dapat merencanakan program pendidikan lanjutan apakah akan melanjutkan ke perguruan tinggi sesuai jalur undangan ada 44 orang yaitu IPS 20 orang IPA 24 orang sedangkan tahun lalu sekitar 30 orang, makanya harus lebih baik lagi dari tahun sekarang. Ahmad menambahkan komite sekolah SMAN 10 menjalin hubungan yang baik itu dapat kami tingkatkan dengan pengurus komite sekolah SMAN 10 dengan oang tua murid. Wakil Kepala Sekolah SMAN 10 bidang kesiswaan Drs. E Puadi Nasution mengatakan siswa SMAN 10 akhir-akhir ini banyak mengikuti kegiatan perlombaan seperti lomba gerak jalan tingkat Kota Medan, dalam rangka Hut Sumut dan mendapat juara harapan dua. Puadi menambahkan pihak sekolah SMAN 10 harus kerjasama dengan orang tua murid untuk mendidik siswa murid, makanya pihak sekolah mendidik siswa semua sekitar 6 jam dan selebihnya orang tua murid mendidik anaknya dirumah.(AHS)

Dana Talangan Haji Bank Sumut Capai Rp 28,789 Miliar Medan, BN Dirut Bank Sumut Gus Irawan Pasaribu mengatakan, total pembiayaan dana talangan haji PT Bank Sumut pada Maret 2012 mencapai Rp 28,789 miliar. Sementara target dana talangan haji pada bulan itu Rp 14,93 miliar. "Realisasi dana talangan haji pada Maret 2012 sudah melewati dari target dimana realisasi mencapai 192,82%," ujarnya kepada wartawan di Medan Kamis kemarin . Jumlah ini, kata Gus, mengalami peningkatan sebesar 530,72% jika dibanding Maret 2012 yang realisasinya hanya Rp 4,564 miliar. Gus melanjutkan adanya peningkatan seperti ini, menandakan bahwa banyak masyarakat yang ingin menunaikan ibadah haji. Dan Bank Sumut, katanya, memberikan apresiasi kepada masyarakat yang telah memercayai Bank Sumut dalam hal pembiayaan. Sebelumnya Gus Irawan juga telah melepaskan 41 jemaah umroh. Dari jumlah tersebut belasan jemaah di antaranya nasabah Bank Sumut Syariah yang meraih hadiah

paket perjalanan umroh gratis pada penarikan undian tabungan iB Martabe Maret lalu. Kehadiran Gus Irawan melepas langsung keberangkatan tamu Allah itu menambah spirit para jemaah umroh. "Saya doakan agar bapak dan ibu-ibu sekalian dapat menjalankan ibadah umroh dengan lancar dan penuh kekhusukan. Tiba di Makkah Al Mukarromah nanti, mohon kiranya bapak ibu-ibu sekalian mendoakan agar Bank Sumut tetap diberikan kemudahan dalam urusannya dan dipermudah rezekinya, sehingga Bank Sumut bisa terus berkembang dan berjaya serta mampu memberikan pelayanan terbaik kepada nasabah," harap Gus Irawan yang spontan diamini oleh para jemaah. Pada kesempatan itu, Gus Irawan didampingi Pemimpin Divisi Syariah Didi Duharsa dan Direktur PT Gadika Travel & Tour M Nasir, yang memfasilitasi perjalanan umroh. Dia menjelaskan, dari penarikan undian Tabungan iB Martabe di Merdeka Walk yang dilaksanakan pada 30 Maret

ITM Promosi Penerimaan Mahasiswa Baru di Sumbagut Medan, BN Institut Teknologi Medan (ITM) melakukan promosi penerimaan mahasiswa baru (PMB) tahun 2012 di 204 SMA dan SMK di wilayah Sumbagut yang dibagi atas empat tim, Aceh, Pekan Baru, Dairi/Tobasa dan Kota Medan yang berlangsung baru-baru ini. Hadir pada rapat presentasi promosi PMB itu diantaranya, Rektor ITM Prof Dr Ilmi Abdullah MSc, Ketua Yayasan Pendidikan dan Sosial Dwiwarna Drs H Syamsuddin Djamin MM, para wakil rektor, Ketua Panitia Promosi PMB Drs Syafrawali MT, Kahumas ITM M Vivahmi Manafsyah SH MSi dan unsur panitia lainnya, kemarin. Rektor ITM Ilmi Abdullah mengatakan, promosi ekternal di luar kota dan dalam kota ini bertujuan untuk memperkenalkan program studi dan keberadaan ITM di sekolah dengan memberikan presentasi, pemasangan spanduk dan baleho tentang lembaga pendidikan tinggi. Disamping itu bagi siswa SMA dan SMK, kegiatan ini akan sangat bermanfaat karena siswa dapat mengetahui kemana dan program studi/jurusan apa yang akan dipilih sebelum memasuki dunia pendidikan tinggi. "Kita mengarahkan siswa agar tidak salah memiliki jurusan agar sukses meraih prestasi dan menggapai masa depan," tambahnya. Didalam promosi eksternal ini juga disampaikan persiapan proses belajar mengajar yang baik dan bermutu sesuai dengan kebijakan Mendikbud melalui Dirjen Dikti. ITM juga mempersiapkan sarana dan prasarana pembelajaran, ruangan dan infrastruktur lainnya dan meningkatkan pendidikan dosen lanjutan S2 dan S3. Pada saat ini, dosen ITM yang melaksanakan studi S3 ada di Inggris, Jepang dan Malaysia dan beberapa dosen juga

sedang kuliah di dalam negeri. Hal ini dilakukan untuk meningkatkan kualitas pendidikan kedepan yang akan diberikan kepada anak didik. Selain itu ITM juga sedang membangun lembaga penelitian yang mampu menghadirkan sumber daya manusia dapat bersaing dan meraih meraih hibah penelitian. Terbukti dosen ITM memperoleh 20 orang mendapatkan hibah nasional dan 15 mahasiswa juga mendapatkan hibah program PKM. Dengan promosi ini diharapkan ITM semakin maju dan sukses dalam memajukan pendidikan teknologi yang unggul di Sumut. Salah satu upaya yang terus digalakkan adalah promosi yang mengoptimalkan kemitraan dengan Dinas Pendidikan Provinsi, Dinas Pendidikan Kabupaten/ Kota. Kedepan rektor meminta panitia PMB juga melakukan promosi jaringan internet sebagai media online di website, facebook maupun twitter, memberikan janji pemberian beasiswa dan menindak lanjuti kembali promosi yang telah dijalin dengan 204 sekolah itu secara komprehensif. Ketua Yayasan Syamsuddin Djamin mengharapkan promosi ini bisa mendapatkan mahasiswa yang lebih banyak, lebih jauh jangkauannya dan lebih sempurna lagi. "Kita juga harus berserah diri dan memohon doa kepada Tuhan agar niat dan tujuan kita ini tercapai," ujarnya. Sementara itu Ketua Panitia Syafrawali, mengatakan, promosi di 204 sekolah ini meliputi wilayah Aceh, Dairi, Kotacane, Sidikalang, Dolok Sanggul, Brastagi, Samosir, Sibolga, Pematang Siantar, Madina, Rantau Prapat, Pekan Baru dan sekitarnya. Ditambahkannya, dari promo ini ditargetkan 1.000 mahasiswa baru dapat diterima di ITM. (AHS)

lalu, 15 nasabah beruntung memperoleh hadiah utama perjalanan umroh gratis ke Tanah Suci Makkah. Seluruh nasabah yang mendapatkan paket umroh tersebut berasal dari 4 cabang Bank Sumut Syariah meliputi Medan, Tebingtinggi, Padangsidimpuan dan Sibolga. Penyerahan hadiah umroh gratis selanjutnya diserahkan langsung kepada nasabah pada 17 April 2012 di kantor Bank Sumut. Menurut Gus Irawan, undian paket umroh merupakan apresiasi dari Bank Sumut Syariah kepada nasabah yang memiliki produk simpanan berupa Tabungan iB Martabe (Marwah) dan iB Martabe Bagi Hasil (Marhamah). "Setiap nasabah yang memiliki saldo harian rata-rata Rp 500.000 akan mendapatkan satu nomor undian dan akan dikumpulkan selama satu tahun, kemudian diundi memperebutkan Paket Umroh dari Bank Sumut Syariah," katanya. Pemimpin Divisi Syariah Bank Sumut, Didi Duharsa, menjelaskan bahwa Tabungan iB Martabe Bagi Hasil senantiasa dis-

empurnakan dari segi fitur atau layanan untuk dapat memuaskan masyarakat. Dengan demikian, diharapkan semakin banyak masyarakat menggunakan Tabungan iB Martabe Bagi Hasil sebagai alternatif penyimpanan uang dan investasi. "Bahkan, masyarakat dapat memeroleh investasi dengan menjadi nasabah Tabungan iB Martabe Bagi Hasil antara lain tingkat bagi hasil yang cukup menjanjikan, memeroleh kartu ATM dengan banyak kemudahan dan fitur/layanan serta memperoleh kesempatan untuk mendapatkan hadiah umroh," jelasnya. Sementara itu, Tabungan Marhamah, lanjut Didi, adalah produk tabungan yang memberikan solusi investasi dan rencana masa depan setiap nasabah, sebab berbagai manfaat dapat diperoleh dengan membuka tabungan Marhamah. Menurut Didi, Bank Sumut Syariah bukan hanya diperuntukkan bagi masyarakat yang beragama Islam melainkan untuk semua masyarakat tanpa membedakan agama dan golongan. (AHS)

PTPN III & PTPN IV Tandatangani MoU Medan, BN Usaha untuk memajukan dan menjadikan BUMN perkebunan di Indonesia menjadi the number one business player adalah cita-cita dan harapan besar pemerintah, mengingat tingginya eskalasi industri kelapa sawit yang menuntut tidak saja tersedianya pasokan raw materials yang cukup karena kekayaan alam Indonesia sangat besar potensinya untuk memenuhi itu, namun kemampuan memproduksi barang jadi adalah keharusan yang mutlak agar BUMN perkebunan tetap eksis menjadi pemain utama di industri sejenis tidak saja di tanah air namun juga di manca negara. Pada tanggal 8 Mei 2012 di aula kantor direksi PTPN III Medan, dua perusahaan perkebunan negara yang sangat maju saat ini yaitu PTPN III dan IV telah melakukan penandatanganan nota kesepahaman (MOU) tentang kerjasama usaha industri oleokimia terintegrasi, yang ditandatangani oleh Direktur Utama PTPN III, Megananda Daryono dan Direktur Utama PTPN IV Erwin Nasution, disaksikan oleh seluruh jajaran direksi dari kedua perusahaan diantara dari PTPN III yaitu Kusumandaru NS, Wakil Direktur Utama, Bagas Angkasa, Direktur Pemasaran, Nurhidayat, Direktur Perencanaan dan Pengembangan, Erwan Pelawi, Direktur Keuangan dan Balaman Tarigan, Direktur Produksi. Sementara dari PTPN IV hadir jajaran direksi antara lain Ahmad Aslan Saragih, Direktur Produksi, Andi Wibisono, Direktur SDM, Setia Darma Sebayang, Direktur Keuangan dan Memed Wiramihardja, Direktur Perencanaan dan Pengembangan, serta para kepala

bagian dari PTPN III dan PTPN IV. Megananda dalam keterangannya mengatakan bahwa penandatanganan kesepahaman antara PTPN III dan IV adalah langkah awal untuk mewujudkan cita-cita yang sudah lama diprakarsai perkebunan, dimana perkebunan sawit tidak hanya menghasilkan komoditas CPO saja, namun harus mampu mengambil peranan yang lebih penting lagi dengan memasuki industri hilir. "Pada tahun 2012 ini juga pabrik oleokimia terintegrasi harus sudah terbangun dan running," kata Megananda dengan penuh semangat. Megananda juga mengatakan bahwa sebelum holding terbentuk nantinya, upaya menerobos bisnis industri hilir tetap akan dilakukan dengan mendorong semua PTPN I hingga XIV di tanah air baik yang bankable maupun yang tidak kuat secara financial akan diupayakan semaksimal mungkin untuk mengambil langkah strategis memasuki industri hilir dan ekspansi lahan. "Selama ini swasta melakukan itu dengan mudah dan kita BUMN sendiri ketinggalan. Ini saatnya babak baru bagi BUMN perkebunan," tambahnya lagi. Erwin Nasution dalam kesempatan yang sama juga mengungkapkan bahwa pihaknya dari PTPN IV sangat menghargai PTPN III yang telah memprakarsai kerjasama usaha industri oleokimia terintegrasi yang baru saja ditandatangani ini. "Kita tahu PTPN III dan PTPN IV itu perusahaan perkebunan yang besar oleh karena itu kita akan sama-sama terus tumbuh menjadi besar dan apa yang kita upayakan hari ini akan membuahkan hasil maksimal dikemudian hari," katanya. Semoga.(AHS)

CV Indako Trading Co Adakan Donor Darah Medan, BN CV Indako Trading Co, main dealer Honda di wilayah Sumut, menggelar donor darah, dalam rangka memperingati Hari Palang Merah se-Dunia, 8 Mei 2012. Aksi tersebut digelar bekerja sama dengan Perhimpunan Darah Indonesia (PDDI) Medan dan RSU Sari Mutiara Medan, di Kantor CV Indako Trading Co Jalan Pemuda Medan Rabu kemarin. Marketing Manager CV Indako Trading Co, Leo Wijaya mengungkapkan, pihaknya mengapresiasi aksi donor darah ini. Menurutnya, karyawan tidak hanya sekadar menyumbangkan darahnya, tetapi juga menunjukkan bahwa mereka punya kepekaan, jiwa sosial yang tinggi dan kepedulian kepada sesama. "Kegiatan donor darah ini pastinya sejalan dengan komitmen PMI yang selalu melakukan kegiatan sosial kemanusiaan untuk membantu sesama kita yang sedang membutuhkan," ujar Leo Wijaya kepada wartawan di sela kegiatan. Kegiatan yang dihadiri Ketua PDDI

Medan, Janlie ini merupakan persembahan seluruh karyawan CV Indako Trading Co untuk mendukung upaya PDDI menghimpun masyarakat dari semua kalangan untuk mendonorkan darahnya untuk membantu masyarakat yang membutuhkan. "Donor darah merupakan salah satu bentuk tindakan sosial yang sangat mulia dan tidak mengenal pamrih, karenanya kami sangat menyambut baik itikad CV Indako Trading Co, yang menyempatkan waktu menggelar aksi sosial donor darah. Ditambah lagi saat ini kebutuhan darah dalam masyarakat masih cukup tinggi, karenanya menyumbangkan sebagian darah untuk kemudian disalurkan kepada yang membutuhkan menjadi suatu sumbangan berarti dalam kehidupan sosial bermasyarakat," ujar Janlie. HRD Manager CV Indako Trading Co Eddy Tioe mengungkapkan, keberhasilan aksi donor darah periode sebelumnya menjadikan karyawan semakin antusias untuk menyumbangkan darahnya, apalagi kegiatan ini dilakukan di sela-sela jam

kerja, jadi lebih efektif dan lebih memudahkan karyawan mendonorkan darahnya. Kantongkantong darah sumbangan sukarela dari para karyawan telah siap untuk disumbangkan. Kegiatan ini benar-benar menunjukkan semangat para Karyawan/ manajemen CV Indako Trading Co, main dealer Honda di karyawan untuk wilayah Sumut, sedang mendonorkan darahnya dalam aksi donor darah menolong sesama. yang digelar memperingati Hari Palang Merah Sedunia, di Kantor CV Banyak karyawan Indako Trading Co Jalan Pemuda Medan yang ingin berpartisipasi mendonorkan darahnya, kan darah untuk pertama kali. "Senang namun tidak sedikit yang harus gagal sekali kali ini bisa mendonorkan darah, karena tidak memenuhi persyaratan tahun lalu kebetulan sakit, jadi gak yang telah ditentukan. bisa donor. Harapannya sih kegiatan Wulan, salah satu karyawan CV ini terus berlanjut, bisa kerja sambil Indako Trading Co mengungkapkan beramal kan asyik juga," tukasnya. (AHS) rasa bahagia karena dapat mendonor-

Perwakilan Jakarta: Suryadi, Medan: Heru Indrabudi, Darta Lubis, Andi Utama Nasution, SE, Wiryanto Hadi, Friyadi, Fernando Meliala, Brav Shandy Meliala. Biro Belawan: Jakfar Latif, Herry Susanto Sitepu, Suriono. Sub Biro Medan Utara: Ahmad Muhajir, M. Saleh, Ismail Ahmad, M. Yakup. Sub Biro Amplas : Saulus Panjaitan. Binjai/Langkat: Munir Rangkuti (Ka.Biro), Sabar Gurusinga, Sulaiman, Mimpin Sitepu, M. Hayat, Ruslan AG, Dedi Nupita Sitepu, Samsul Bukit, Hendera Ginting, T. Zulfikardin, Jumadi, Grensi Ginting, Rusdi. Langkat Hilir: Irfan Nasirin ST (Ka.Biro) Deli Serdang: Juni Asian Tampubolon SP (Ka.Biro), Sofian Syukri Lubis (Waka Biro), Rukun Tarigan, SH, . Tanah Karo: Farhan Parinduri (Ka. Biro), Aman Harahap Sub.Biro Pancur Batu: Friyadi, Amd. M Rizal Effendi Bako,SPdi, . Serdang Bedagai: Ibnu As (Ka.Biro), Raman Adjiman, Suherman. Tebingtinggi: Dirlan Effendi Ritonga (Ka.Biro). P Siantar/Simalungun: Drs Edward Pakpahan (Ka.Biro), Erikson Pakpahan, Drs. Kaliderman Siregar. Batubara:Dasri Tanjung, Eko, S, Sunaryo Wijaya, Jamilah, Parlin Tampubolon. Asahan/Tanjungbalai: Hamdan Samosir (Ka. Biro), Hariadi, Wahidun. Labuhanbatu: Ihsanul Siddik Daulay, SH (Ka. Biro). Kotapinang/Labusel: Syamsul Siregar, Firman Hasibuan. Aek Kanopan/Labura: Sriwaty Sinuraya (Ka. Biro), L. Parulian Simarmata, SE, Ali Usman Silalahi. Sumbagut: Mhd Syahrul Hasibuan SH, Sutardi, Supendi. Dairi: Mangisi Lumban Gaol (Ka.Biro), Jiki Sagala (Waka Biro), Loedeik Simamora, Meslin Br Sigalingging, Duat Sianturi. Pakpak Bharat: Yusuf Manik (Ka.Biro). P Sidimpuan/Tapsel/Paluta: Sugiono SP (Koordinator), Safruddin Pulungan (Ka. Biro), Muhammad Srg, Baun Aritonang, Hasanuddin Siregar, Ibnu Saad Harahap, Unggul Fahmi Hasibuan. Kotanopan/Madina: -. Padang Lawas Selatan: Ali Akbar (Ka. Biro).Humbang Hasundutan: Mangatur Silaban (Koordinator), Rikardo Simamora (Ka. Biro), Chuharto Simamora, Pardomuan Silaban. Biro Taput: Mangatur Silaban (Ka. Biro) .Biro Tobasa: Risman Siboro (Ka. Biro), Donny Sinabutar Biro Tapteng/Sibolga/Nias: - Perwakilan Riau/Kepri: EPP. Ringo-ringo, SE. Korwil Riau/Kepri: Rudi Sirait. Pekanbaru: Jaraya Garingging, S.Sos. Siak: Nujum Sitepu (Ka.Biro), Jansen Hutahaean, Jaraya Garingging, S.Sos. Pelalawan/Pkl.Kerinci: EPP. Siringoringo (Ka.Biro), Ryan Ade Liany, ST, Andi Usman, Lingkon S. Dumai: Albekri, Tengku Kamaruddin, Belwiyono, MG, Suhartono, Elias G.S.M Sidabutar. Bengkalis: Mahir Ritonga, Misron Tarihoran, Parulian Manurung, Novalis P. Hutahaen, Irwansyah Nasution, Alwi. Rokan Hilir (Rohil): Juminan (Ka.Biro), Basri M Noer, Supryanti, Julientri. Biro Rokan Hulu: -. Biro Kampar: -. Perwakilan Aceh: T Muktarruddin US - . Biro Banda Aceh/Aceh Besar: T Muktarruddin US (Ka. Biro), Ibrahim Yusuf, Chandra. Biro Pidie/Pidie Jaya: Mahdi Aziz, SHi. Biro Langsa/Aceh Timur: Mustafa M. Adami, Syamsudin Arsyad. Aceh Tamiang: Rudi Kurniawan, Baihaki Ahyat, ST, Ir Fadly-. Biro Aceh Singkil/ Subulussalam: Rahmin Banchin (Ka. Biro), Henri, B,SE, Bolon. Biro Aceh Jaya: Syarkawi. Biro Kutacane: . Lhokseumawe: M Fauzi, Jamaluddin, S.Sos. Aceh Utara: M Suud, Ramli, Sayed Fauzi. Biro Blangkejeren/Gayo Lues: Antoni Nasipul. (WARTAWAN BONGKAR NEWS DILENGKAPI IDENTITAS DAN NAMANYA TERCANTUM DALAM BOKS REDAKSI)


14-21 MEI 2012 | EDISI 315| THN KE-VII

Bupati Pelalawan Minta Mitra PT Kalila Hentikan Pekerjaan PANGKALAN KERINCI, BN Bupati Pelalawan HM Harris desak pimpinan manajement PT Kalila untuk menghentikan pelaksanaan pemasangan pipa gas dari kecamatanm langgam Ke kecamatan Bandar Sei.Kijang Pasalnya, bupati menilai masalah izin pelaksanaan pemasangan pipa gas dilakukan perusahaan tersebut belum jelas hingga kini karena pelaksanaannya tak sesuai prosedur. Permintaan penghentian itu diungkapkan Bupati Pelalawan HM Harris kepada sejumlah wartawan usai melakukan coffe morning, baru baru ini di Pangkalan kerinci.Bupati menuding proses pemasangan jaringan pipa gas dilakukan PT Kalila di Kabupaten Pelalawan belum berizin. Karena itu, Bupati minta aktivitas kegiatan tersebut dihentikan.Bahkan Bupati sangat menyayangkan sikap manajement PT Kalila tersebut yang melaksanakan pemasangan pipa gas di wilayah kabupaten Pelalawan tanpa ada perizinan yang jelas. "Karena itu saya secara tegas minta pada pimpinan manajement PT Kalila agar menghentikan sementara kegiatan operasi pemasangan pipa gas yang melintasi dua kecamatan diwilayah kabupaten Pelalawan sebelum ada izin pelaksnaannya yang jelas dikantongi," tegas Bupati Karena kata Bupati, perusahaan sekelas PT.Kalila dalam melaksanakan pemasangan pipa gas didaerah ini tanpa pengurusan izin terlebih dahulu. Padahalan seharusnya,sebelum dilaksanakan pengerjaan pemasangan pipa gas tersebut dilapangan,harus ada izin yang dikantonginya dan pihak Pemkab pelalawan harus tahu apa saja kegiatannya dilapangan tersebut. "Masak PT.Kalila melakukan aktivitas kegiatan pemasangan pipa gas didaerah kita tidak mengurus ijin, seharus mereka mengurus ijin kegiatan apa saja sebelum dimulai pengerjaannya lapangan. Apalagi perusahaan sekelas PT Kalila malah tak kantongi izin sudah beroperasi dilapangan," tegasnya. Semenetara pimpinan manajement PT Kalila Dahrul Hidayat saat dikonfirmasi Senin (7/ 5) terkesan menghindar dan mengarahkan untuk konfirmas langsung ke PT Sarana Pembangunan Riau (SPR) Nur Kozim. Ketika dikornfirmasi pada Nur Kozim mengaku hanya selaku sub kontraktor PT Aditya Protek. PT Aditiya Protek merupakan perusahaan memenang tender pipanisasi yang akan disewa

oleh PT.Kalila. Ia mengaku bahwa semuanya izin pemasangan pipa gas dilakukan dilapangan sudah dikantongi PT.Kalila. Namun demikian agar lebih pasti maka pihaknya akan coba cek ke perusahaan tersebut. "Bila ternyata ada kekurangan dalam pengurusan izin yang perlu kami lengkapi maka kami akan secepatnya untuk mengurusnya ke Pemkab Pelalawan melalui Bupati atau melalui camat setempat nantinya. Yang terpenting untuk kelancaran kami dalam bekerja maka kami pasti akan mengurus izin yang belum dilengkapi nantinya," ujar Nur Kozim. Sementara Camat Bandar Sei.Kijang Surakhmat kepada mengaku hasil investigasi tim bentukannya yang telah turun kelapangan melakukan evaluasi kegiatan

pemasangan pipa gas dilakukan mitra PT. Kalila itu sudah dilaporkannya pada bupati Pelalawan. "Memamanmg hasil temuan Tim yang saya bentuk yang dilaporkan pada Bupati itu belum jelas ada izin kegiatannya karena sampai sekarang secara adminitrasi PT.Kalila bersama sub kontarktornya itu belum ada melaporkan kegiatanya pada kami dipemerintah kecamatan selaku perpanjangan tangan dari Bupati Pelalawan sebagaimana yang diatur dalam perbup no 50 tahun 2011 tersebut tentang pelimpahan kekwenanan oleh Bupati pada Pemerintah kecamatan tersebut," ujarnya. Surakhmat mencontohkan, ibarat seorang mahasiswa yang melakukan kegiatan didaerah ini mereka harus melaporkan asal perguruan tinggi dan

jenis kegiatan dilaporkannya pada kami selaku pemegang wilayah didaerah ini. Sementara PT.Kalila dengan sub kkntraktornya belum ada melaporkan secara adminitrasinya pada kami tentang semua kegiatannya termasuk surat SK penunjukan pelaksanaan kegiatan pada para sub kontraktornya pada kecamatan. "Mungkin mereka sudah mengantongi izin tapi karena belum ada dilaporkan maka tentu kami masih menganggapnya belum jelas karena secara data belum ada dilaporkannya termasuk laporan sejumlah izin telah dikantonginya. Baik IMB penggalian, izin kegiatan pemasangan pipa dan izin lainnya. Jika semua laporan itu sudah disampaikan PT Kalila atau sub kontraktornya maka surat rekomendasi pasti kami keluarkan nantinya," tegas Camat Bandar Sei Kijang.(ringo)

Kontraktor Diminta Lakukan Perawatan Sesuai Kontrak PANGKALN KERINCI, BN Seluruh Kontraktor yang telah menyelesaikan pekerjaan fisiknya di tahun anggaran 2011 diminta agar segera melakukan perawatan pekerjaannya masing-masing, terutama pekerjaan fisik pembangunan jalan berupa pengaspalan dan pengerasan (Bes C), permintaan ini disampaikan oleh anggota Komisi C DPRD Pelalawan H.Muklis Ali kepada wartawan, Senin (11/5) di ruang kerjanya. "Sebentar lagi kan masuk perawatan hasil pekerjaan kawan-kawan kontraktor akan berakhir, maka sebelum jaminan perawatan hasil pekerjaan mereka diambil maka kami dari komisi C minta agar hasil pekerjaan mereka dilakukan perawatan khususnya perawatan

dalam pembangunan jalan seperti pengaspalan dan peningkatan badan jalan (bes C)," kata Muklis Ali. Muklis Ali juga mengatakan bahwa perawatan itu dilakukan untuk mempertahankan kualitas bangunan yang saat ini sebahagian sudah mulai rusak seperti pembangunan peningkatan badan jalan ataupun aspal. Sementara perawatan tersebut memang wajib dilakukan setelah pekerjaan fisik yang dikerjakan selesai dibangun. "Dan batas waktu masa perawatan itukan ada sekitar 6 bulan setelah pekerjaan itu selesai dikerjakan, artinya, apabila pekerjaan itu selesai dikerjakan masih ada waktu tersisa untuk dilakukan perawatan hasil pekerjaan sebab uang

yang akan dicairkan kepada kontraktor itu tidak semua di cairkan dan pastinya ada ditinggalkan beberapa persen dari anggran yang tujuannya untuk biaya perawatan pekerjaan mereka sehingga hasilnya tetap terjaga kualitasnya," kata Muklis. Ketika disinggung soal proyek mana saja yang perlu dilakukan perawatan, Muklis mengatakan bahwa sejumlah pekerjaan yang perlu dilakukan perawatan hamper semuanya proyek jalan seperti peng aspalan dan pengerasan, khusus peng aspalan saat ini yang ditemui oleh Komisi C pekerjaan di desa Sari Makmur Kecamatan Pangkalan Lesung terihat sudah mulai rusak dan perlu dilakukan perawatan. "Selain itu juga sejumlah pekerjaan pisik

berupa pengerasan jalan di seputaran kota Pangkalan Kerinci juga demikian, saya minta agar dilakukan perawatan karena keadaan badan jalan yang sudah dilakukan pengerasan saat ini sudah mulai rusak dan kebanyakan tanahnya sudah menepi dibagian tepi jalan karena saat dilakukan pekerjaan Bes C saya menilai pekerjaan mereka lebih banyak tanah ketimbang kerikilnya," kata Muklis Ali. Muklis berharap kepada Kadis Bina Marga dan setker yang lainnya agar secepatnya memerintahkan para kontraktornya melakukan perawatan sejumlah pekerjaan yang sebelumnya mereka kerjakan sehingga kualitas bangunan yang telah dianggarkan tetap terjaga kualitas bangunannya (ringo)

Walikota Dumai Tidak Tanggap Akan Perda No. 4 / 2007 Dumai, BN Warga RT 10 Kel. Bangsal Aceh Kec. Sei Sembilan Kota Dumai, kembali menyurati Walikota Dumai sebagai pertanda atas penolakan Sopian sebagai Ketua RT 10 karena pengangkatan SK yang dikeluarkan Camat dianggap melanggar Perda No. 4 / 2007. Sebelumnya warga juga sudah ada 3 kali menyampaikan Surat Keberatan Penolakan atas diri Sopian namun masih belum di tindaklanjuti oleh pihak Kecamatan. Pihak warga di RT 10 sangat kecewa melihat kinerja Pemerintah di Kota Dumai karena tidak patuh terhadap aturan UndangUndang yang telah dikeluarkan seolah-olah hukum dianggap sepele. Sopian merasa besar kepala karena mendapat perlindungan dari Lurah maupun Camat Sei Sembilan walau sudah beberapa kali dilaporkan oleh Warga setempat, namun tidak ditanggapi seakan kebal dengan hukum yang berlaku. Rahim Lubis salah seorang tokoh masyarakat mengatakan kepada Bongkar, kalau Camat dan Lurah tetap memelihara seorang ketua RT yang ilegal pasti nanti ada akibatnya dibelakang hari. Kita tunggu saja masing-masing pihak menanti jeratan hukum. Camat dan lurah baik Ketua LPMK samasama pertahankan Ketua RT ilegal bernama Sopian. Sejak hadirnya Ketua RT 10 Di Kelurahan

Bangsal Aceh Kecamatan Sungai Sembilan Dumai sejumlah warga setempat merasa resah sekali. Dari sejak terbitnya SK Pengangkatan RT Sopian yang dikeluarkan oleh Camat Sungai Sembilan walaupun diketahui secara tertulis melanggar aturan hukum yang telah ditetapkan oleh Pemerintah Kota Dumai hal ini tetap tidak ditegakkan kebenarannya. Camat, Lurah dan Ketua LPMK Kamaruzaman walau telah dilaporkan secara tertulis oleh warga RT 10 terkesan tidak menanggapi seolah-olah tutup mata dan tak peduli akan hati nurani warga yang menolak kehadiran Sopian yang masih menjabat sebagai Ketua RT 010. Ironisnya Sopian yang cacat hukum itu walau pada hakekatnya jelas melanggar Perda No. 4 / 2007 masih saja tetap difungsikan sebagai perpanjangan tangan dari Pemerintah setempat. Sebagai contoh soal, Sopian masih diberi hak menjuali lahan masyarakat setempat kepada pihak-pihak lain sekaligus membuatkan dan menciptakan Surat yang dikeluarkan oleh Lurah berbentuk Suparadik. Perlu dipertanyakan kenapa Camat dan Lurah masih memakai Sopian sebagai perpanjangan tangan Pemerintah dan turut juga menandatangani Surat Suparadik sebagai orang pertama dalam surat tersebut ? Menurut keterangan beberapa warga yang

Kasus Pembunuhan Warga Nias

Polres Pelalawan Amankan 8 Orang PELALAWAN, BN Kamis kemarin jajaran kepolisian Polres Pelalawan melakukan pemanggilan dan jemput paksa saksi pelaku pengeroyokkan Oktarianus Gulo hingga tewas, di Sorek Kecamatan Pangkalan Kuras, Pelalawan. Komitmennya Kapolres Pelalawan AKBP Guntur Aryo Tejo SIK SH dalam menegakkan hukum di wilayah hukumnya, Ia berjanji dihadapan sejumlah Pengurus Ikatan Keluarga Nias yang terdiri dari Ketua Umum IKN Drs. Sozifao Hia MBA, Wakil Ketua IKN Yulius Halawa, Ketua PAC HIMNI Samazasa Ndruru, Humas IKN Yulianus, dan sejumlah LSM dan wartawan asal Nias diruangan kerjanya mengatakan, terkait kasus pengeroyokan ini yang menewaskan saudara Oktarianus Gulo, jajaran Polres akan bekerja keras untuk segera menangkap pelaku, kata Kapolres Guntur menjelaskan kejadian ini tidak ada unsur kelompok etnis atau golongan, "Kasus ini adalah kriminal murni, jadi tidak ada kelompok atau etnis, siapa-pun pelaku nantinya jika terbukti, kita akan tangkap dan diproses sesuai hukum yang berlaku. Untuk itu kepada masyarakat khususnya warga Nias yang ada di pelalawan untuk tetap tenang dan percayakan kepada Aparat kepolisian menangani masalah ini secara hukum," tegasnya. Kasat Reskrim AKP Dermawan SH Jum'at (11/ 5) melalui HP nya kepada wartwan, membenarkan adanya pihaknya sudah mengamankan sejumlah 8 orang tersangka pengeroyokkan oktarianus tersebut. Saat ini, sedang menjalankan pemeriksaan, Dermawan, nama-nama tersangkan pengeroy-

okkan itu, belum bisa disampaikan, dikarenakan masih dalam proses penyidikan, bila tersangka ini sudah ditetapkan sebagai tersangkan sesuai hasil penyidikkan baru kita berikan kepada rekan-rekan wartawan, jelasnya singkat. Ditempat terpisah Drs. Sozifao Hia selaku Ketua Umum IKN Kabupaten Pelalawan saat dimintai tanggapannya atas berhasilnya jajaran Kapolres Pelalawan telah mengamankan sejumlah delapan orang tersangka pengeroyokkan Oktarianus Gulo ini, atas nama IKN Kabupaten Pelalawan mengucapkan terimakasih sebesar-besarnya terhadap aparat penegak hukum, mudah-mudahan dengan ditangkapnya sejumlah tersangka ini, masyarakat kita lebih tenang, mari kita serahkan sepenuhnya proses hukumnya kepada Pihak Polres Pelalawan

diperoleh dimana Sopian sejak diterbitkannya SK pengangkatan oleh Camat Sungai Sembilan, suasana dilingkungan RT 10 Kel. Bangsal Aceh dari KM 13 sampai dengan KM 20 (Mulai dari Sungai Masjid hingga perbatasan Kota Dumai) terkesan resah dan meresahkan hati warga karena tingkah laku Sopian yang merasa dirinya sebagai Penguasa di daerah itu tidak peduli akan fungsinya. Yang timbul suasana meresahkan warga saat ini banyak warga jijik melihat beliau oleh karena kebutuhan masyarakat untuk mengurus Surat Tanahnya selalu di persulit dengan alasan bahwa tanah anda bermasalah dengan pihak lain sementara yang dimaksud oleh Sopian, pihak lain itu adalah keronikeroninya sendiri tanpa ada bukti-bukti yang akurat namun Sopian sepertinya sengaja mengatakan Tanah anda bermasalah tanpa dasar hukum. Begitu juga ada Mesin Genset yang dihibahkan oleh Pihak TNI AL melalui Camat Sungai Sembilan beberapa waktu yang lalu hingga saat ini warga bertanya-tanya bagaimana rimba mesin tersebut karena tidak jelas di fungsikan sebagaimana mestinya. Selanjutnya Sopian membagikan beras raskin seenak perutnya saja menurut keterangan warga setempat yang tidak bersedia di sebut namanya. Pernah di undang beberapa warga mewakili sejumlah warga RT 10 di Kecamatan Sungai

Sembilan dipertemukan bersama Sopian di hadapan Camat, Lurah M. Noor B, Babinsa, Ketua LPMK Kamaruzaman dan sejumlah staf Kecamatan. Pihak warga yang hadir dalam pertemuan menyampaikan tetap merasa keberatan apabila Sopian menjadi Ketua RT di lingkungan mereka namun Camat bersikap Arogan dan bentak-bentak warga yang hadir sambil mengatakan anda maksudnya warga jangan bawa-bawa Perda tetapi kalau anda mau kita buatkan pernyataan / Perjanjian apabila Sopian dalam waktu 2 bulan ada berbuat kesalahan SKnya akan saya cabut tutur Camat . Karena Camat tidak konsisten terhadap apa yang sedang terjadi di tengah-tengah masyarakat, pihak warga yang diundang pulang tanpa ada kesimpulan penolakan SK Sopian sebagai Ketua RT. Dalam kesempatan itu, Bongkar mendapat keterangan dari Mantan RT sebelumnya bernama Azari Lubis, beliau mengatakan dengan jelas bahwa tidak ada serah terima kepada Sopian dan hal ini menjadi akan timbul permasalahan dimana lahan-lahan yang belum diurus SKT atau suparadik oleh pemilik sudah pada dijuali oleh Sopian. Menurut Azari Lubis, biarkan saja dia berbuat nanti juga akan timbul kasus sementara instansi Pemerintah juga akan kena imbasnya. (DOR)

Pelanggaran UU Pers oleh Kabag Humas Pelalawan Kapolres: Akan Diproses Sesuai Prosedur Hukum

Pelalawan BN Menanggapi laporan Pemimpin Umum Media Riausidik.com, Kapolres Pelalawan AKBP Guntur Aryo Tejo SIK SH melalui Kasat Reserse AKP Dermawan SH, berjanji akan menindaklanjuti dugaan pelanggaran Undang-Undang Pers tersebut sesuai prosedur hukum yang berlaku. "Sudah kita terima, saat ini sudah ditingkat Reserse turun dari Kapolres dan akan kita tindaklanjuti sesuai prosedur hukum yang berlaku," demikian sms singkat AKP Dermawan SH kepada poniman pimpinan riau sidik, Rabu siang (9/5) di Pelalawan. Pimimpinan Umum Media Riausidik.com Amponiman Bate'e, melaporkan Kepala Bagian (Kabag) Humas Setda Kabupaten Pelalawan T. Nahar ke Polres Pelalawan, terkait dugaan pelanggaran Undang-Undang Pers Nomor 40 tahun 1999 dan Undang-Undang nomor 14 tahun 2008 tentang Keterbukaan Informasi Publik (KIP). Menurut Amponiman, jikan sebuah konfirmasi berbagai upaya dilakukan, namun pejabat yang bersangkutan tidak memberikan, justru menjawab yang dinilai mengandung adanya pembohongan dan pembodohan publik, saya kira sudah saatnya hal semacam ini langsung keranah hukum, sebab sengat bertantangan dengan 2 produk undang-undang yang berlaku,

bebernya. Pihaknya menjelaskan, di Riau misalnya, tidak sedikit pemberitaan pers paksaan, sebab objek konfirmasi tidak kunjung terjawab, dengan alasan sang pejabat, sikitsikit rahasia negara, padahal itu indikasi Korupsi, akhirnya dalam sebuah pemberitaan selalu wartawan yang disudutkan (konfirmasi tidak lengkap), untuk itu kepada pihak kepolisian dalam hal ini Polres Pelalawan, kita berharap agar segera meproses laporan ini dan segera memanggil pihak-pihak terkait, sesuai prosedur yang berlaku, kata Poniman. "Perilaku pejabat tersebut (T. Nahar) jika dibiarkan, kita khawatir akan membias kepada pejabat lainnya nantinya diriau, untuk itu perlu diberi pembelanjaran, hal ini hanya semata-mata mendukung transparansi/reformasi pemerintah saat ini yang tampak mulai berbenah," tutup Poniman panggilan sehari-hari ini. Pada pemberitaan sebelumnya, laporan dugaan pelanggaran Undang-Undang Pers dan UU KIP ini disampaikan langsung Pemimpin Umum Media Riausidik.com ke Polres Pelalawan nomor surat: 064/PU/ RSC/PKU-V/2012, Tertanggal 07 Mei 2012, dan diterima Briptu Widya Woni bagian Spri Kapolres Pelalawan. Materi konfirmasi yang tidak kunjung dijawab adalah, dana humas 2010 dan 2011 Saat dikonfirmasikan hal ini kembali kepada T. Nahar, namun baik sms maupun telepon saat dihubungi, meski laporan masuk, namun yang bersangkutan memilih bungkam.( Lingkon)

Diskes Pelalawan Akan Rekrut Ribuan Dokter Kecil PANGKLAN KERINCI, BN Untuk menciptakan hidup sehat diusia dini dikalangan pelajar, Dinas Kesehatan (Diskes) Pelalawan bersama jajaran Puskesmas Se-Kabupaten Pelalawan akan merekrut sekitar 1000 lebih siswa pilihan disetiap sekolah, mulai tingkat SD,SLTP dan SLTA yang ada di Kabupaten Pelalawan untuk diangkat dan dibina menjadi dokter Kecil. Demikian disampaikan Kepala Diskes Pelalawan Drs Darwis Al Qadam M.Si di Pangkalan Kerinci usai sholat jumat kemarin di ruang kerjanya. Menurut Kadiskes, sebagai salah satu upaya untuk menciptakan Kabupaten Pelalawan sebagaimana yang dicanangkan Bupati Pelalawan HM Harris, untuk mengaplikasikannya program bupati itu, khusus dikalangan pelajar yang ada disetiap sekolah didaerah ini. Pihak Diskes Pelalawan bersama jajaran Puskesmas disetiap kecamatan akan merekrut para siswa pilihan disetiap sekolah SD/MI,SMP/MTs,dan SMA/ SMK/MA yang ada didaerah ini dalam waktu dekat ini. Para siswa disetiap tingkatan sekolah yang akan direkrut untuk diangkat menjadi petugas kesehatan sekolah disetiap sekolah itu yang diberi nama Dokter Kecil itu bukan sembarangan rekrut tapi para siswa pilihan. Begitu juga dari segi jumlah Dokter kecil yang direkrut disetiap sekolah tidak terbatas tapi disesuaikan jumlah murid disekolah bersangkutan. Semakin banyak jumlah murid disekolah tersebut semakin banyak dokter kecil direkrut nantinya. "Jadi setiap persoalan masalah kesehatan yang terjadi disetiap sekolah maka untuk penanganan sementaranya bisa langsung ditangani para Dokter Kecil yang ada disekolah itu sendiri.Kecuali persoalan kesehatan yang terjadi disekolah itu sudah kasus berat maka akan langsung ditangani petugas Puskesmas dan pihak petugas Rumah sakit terdekat. Tapi kalau kasus kesehatan yang terjadi dikalangan pelajar di sekolah bersangkutan masih ringan cukup ditangani para Dokter kecil yang ditunjuk disekolah tersebut," jelas Darwis. Untuk merekrut ribuan dokter Kecil, menurut Darwis, pihaknya bersama Puskesmas setiap kecamatan juga akan membentuk kader Tim Juru Pemantau Jentik (Tim Jumantik) nyamuk disetiap desa dan sekolah nantinya. Para kader Tim Jumantik Nyamuk dibentuk dan akan dibina guna untuk mendeteksi tempat-tempat yang diindikasi berkembangnya jentik-jentik nyamuk ditengah masyarakat dipedesaan dan didalam lingkungan setiap sekolah. "Kebijakan program ini kami lakukan untuk mengatasi pengatasi penyakit menular malaria dan penyakit Demam Berdarah Dengue (DBD) ditengah masayarakat dipedesaan dan dikalangan para pelajar yang ada didaerah ini kedepannya," jelas Darwis.(ringo)

Belum Terima Bagi Hasil Pendapatan Jembatan Timbang PANGKALAN KERINCI, BN Walaupun sudah beroperasi lebih dari setahun, namun sampai saat ini Pemkab Pelalawan khususnya Dishubkominfo Kabupaten Pelalawan belum menerima hasil setoran retribusi pendapatan dari Jembatan Timbang milik Provinsi Riau yang terletak di desa Terantang Manuk Kecamatan Pangkalan Kuras, untuk itu dalam waktu dekat ini pihak Dishubkominfo akan melakukan pertemuan dengan Kadishub provinsi Riau untuk mempertanyakan soal penerimaan jembatan Timbang tersebut untuk daerah pelalalawan "Sampai saat ini kita belum ada menerima retribusi pemasukan dari jembatan timbang yang ada di desa Terantang Manuk, maka dari itu kita saat ini sudah berupaya melakukan pertemuan dengan kadishub provinsi untuk mempertanyakan soal penerimaan untuk daerah berapa besarannya," demikian hal ini disampaikan oleh Kadishubkominfo Kabupaten Pelalawan T.Ridwan Mustafa kepada sejumlah wartawan baru baru ini diruang kerjanya. Lebih lanjut T Ridwan mengatakan bahwa dengan adanya penerimaan tersebut nantinya diharapkan bisa menjadi sumber Pendapatan Asli Daerah bagi pemkab Pelalawan, pasalnya walaupun jembatan Timbang tersebut yang membangun pihak Provinsi namun lokasi dan lahan yang menyiapkan pemerintah daerah. "Kebetulan saya inikan masih baru menjabat sebagai Kadishub, jadi saya kurang memahami seperti apa perjanjian dahulu terkait pembangunan jembatan timbang itu dan berapa persen untuk kita dan berapa juga untuk pemprov, maka dari itu kita akan mencoba membicarakan masalah ini ke Kadishub Provinsi," kata Ridwan. Ketika ditanya sudah ada upaya untuk mempertanyakan hal tersebut kepada Kadishub Provinsi, T Ridwan mengaku bahwa dirinya sudah pernah datang ke Dishub Provinsi namun saat berkunjung kesana dirinya tidak jumpa dengan Kadishubnya sehingga batal membicarakan soal penerimaan dari jembatan timbang tersebut, namun yang jelas pihaknya akan terus berupaya untuk menjumpai Kadishub guna menjelaskan dan membicarakan soal penerimaan yang sudah seharusnya diterima oleh Dishubkominfo Kabupaten Pelalawan sebagai Sumber PAD bagi daerah, katanya. Ridwan berharap dengan selesainya permasalahan soal penerimaan tersebut maka setidanya kedepan hasil retribusi dari jembatan timbang tersebut bisa diambil sebahagian oleh Pemkab sebagai PAD yang dapat menambah anggaran belanja daerah, dengan begitu penerimaan yang diperoleh oleh Dishubkominfo juga bertambah (ringo)

Warga Masyarakat Kelurahan Gurun Panjang Belum Nikmati Listrik Dumai,BN Sebanyak ratusan KK warga yang berada di wilayah kelurahan Gurun Panjang kecamatan Bukit Kapur Dumai sampai sekarag belum menikmati aliran penerangan lampu listrik, maka selama ini masyarakat harus mengeluarkan anggaran yang memberatkan setiap bulannya membayar sewa listrik kepada salah satu pemilik mesin Genset Swasta di daerah tersebut. Menurut warga Gurun Panjang , bahwa listrik adalah merupakan bagian salah satu pokok bagi masyarakat, apalagi zaman sekarang ini, karena itu kita sangat mengharapkan kiranya pemerintah dapat membangun penambahan aliran listrik masuk ke Gurun Panjang ini ujar beberapa anggota warga itu yang bertemu dengan wartawan BN baru-baru ini di Bukit Kapur , keluhan soal belum adanya lsitrik sudah di sampaikan ke DPRD Dumai sejak beberapa waktu lalu sebut warga itu yang enggan memberikan namanya pada wartawan Media ini. Ddari pantauaan BN, tindak lanjut atas keluhan warga masyarakat Gurun Panjang ini, akhirnya Komisi III DPRD Dumai melaksanakan Hearing untuk mencari Solusi yang di langsungkan pada tanggal 30/04. Hearing dengan pihak PLN Kota Dumai yang di hadiri oleh Manager PLN Area Dumai, Maneger PLN Rayon Dumai Hendry Pasaribu, edan Kadis Tata Kota Zulfa Indra , Kepala Bappeko Camat Bukit Kapur Wan Kamaruddin serta perwakilan masyarakat dari Kelurahan Gurun Panjang. Dari hasil Hearing tersebut ternyata di ketahui kendalanya untuk pembangunan penambahan Jaringan aliran Listrik ke Wilayah Gurun Panjang hal itu karena keterbatasan anggaran yang dimiliki PLN. karena itu PLN Dumai akan segera merealisasikan penambahan jaringan baru di kawasan Gurun Panjang jikalau kesiapan anggaran sudah ada ujar Manager PLN Rayon Dumai Hendry Pasaribu menjawab Wartawan barubaru ini di Dumai.(Sirait/Tengk)


14 - 21 MEI 2012 | EDISI 315 | THN KE-VII

Dugaan Korupsi di Unimed

Jika Terbukti Akan Dibawa ke Ranah Hukum Medan, BN Aksi unjukrasa mengatasnamakan JIMAT PEMDIKSU (Jaringan Masyarakat Pemerhati Pendidikan Sumatera Utara), Kamis (10/ 5) minta DPRD Sumut mengusut tuntas dugaan korupsi ratusan milyar di Universitas Negeri Medan (Unimed), serta menangkap Prof Syawal Gultom, yang dinilai bertanggung jawab dalam proyek tersebut. Pengunjukrasa yang berjumlah puluhan orang yang dipimpin koordinatornya, Amsal Siregar, membagi-bagian selebaran mengenai proyek-proyek di Unimed Tahun 2011. Tahun 2011, Unimed memperoleh anggaran yang amat sangat besar, hing-

ga ratusan milyar rupiah. Dan dalam catatan kami Unimed telah melakukan pelaksanaan realisasi penggunaan anggaran, namun dalam penggunaan tersebut menurut hemat kami sangat penuh kejanggalan dan rawan korupsi serta sarat KKN ", kata Amsal Siregar, dalam orasinya. Dia menjelaskan, penggunaan anggaran yang diduga kuat telah menyalahi aturan dan sarat KKN diantaranya Pembangunan gedung perpustakaan Rp 80 M yakni Penggiringan Proyek/ sarat KKN. Dalam perjalanan mekanisme pelelangan tender proyek tersebut disinyalir telah terjadi penggiringan secara sengaja oleh para oknum pejabat Unimed untuk memenangkan salah satu perusahaan yang diduga memberikan uang dalam bentuk vi guna meloloskan perusahaannya sebagai pemenang tender. Kemudian, penggelembungan anggaran/mark-up dalam proses pembangunan dan pembelian bahan yang notabene terjadi penggelembungan harga.

Polda Riau Diminta Sikat Sindikat Judi Togel dan Mafia Penampung Kencing BBM Ilegal Riau, BN Maraknya perjudian di Dumai kian meresahkan rakyat kecil, kini di soroti berbagai kalangan, bahkan protes keras terus menggema dari pihak warga Masyarakat. merebaknya jenis judi Togel di tengah-tengah masyarakat seperti di Kecamatan Bukit Kapur Dumai dapat merusak sendi-sendi perekonomian rakyat kecil dan bisa merongrong keselamatan moral generasi. Di sinyalir Bandar judi Togel terselubung di wilayah Kecamatan Bukit Kapur itu Sulit di tangkap oleh pihak berkompeten di DumaiRiau. Pantauan Media ini, Modus permainan yang di lancarkan mafia Judi Terselubung itu cukup rapi dengan Menyusup bergerak di tengah lingkungan Masyarakat. memberdayakan kurir atau penjual nomor judi Togel di beberapa tempat. konon strategi mafia Togel ini sebahagian dapat tercium dan di laporkan masyarakat Kepada Pihak Berwajib akhirnya pelaku atau kurir pengedar Nomor Togel tersebut berhasil di ciduk petugas Dumai, penangkapan di langsungkan pihak kepolisian setelah mendapat informasi resmi dari warga masyarakat. Beberapa dari pelaku bisnis illegal itu di gerebek saat merekap nomor togel para tersangka di tangkap dari Tempat Kediamannya masing-masing. kasus perjudian toto gelap terselubung ini bukan rahasia umum lagi karena permanan Bandar besar judi Togel di Wilayah Bukit Kapur itu sejak lama terus berkembang Biak di duga dibeking sehingga aman-aman saja. keterangan dan sejumlah informasi di Peroleh,diantara tersangka di Ciduk dari daerah Jaya Mukti, dari jalan Tomat Sukajadi, dari Bumi Ayu dan dari jalan Hang Tuah. saat ini dalam tahap menjalani proses Hukum di Polresta Dumai, sampai sejauh ini media BN belum dapat mengkonfirmasikan ke Polresta terkait kasus penangkapan pebisnis judi Togel tersebut. maraknya judi Togel di daerah Dumai belakangan ini cukup Menonjol di wilayah kecamatan Bukit Kapur di diga memiliki jaringan sindikat membuat jenis judi togel terselubung itu berkembang luas di tengahtengah kehidupan warga masyarakat di sana, bahkan di duga kuat ada yang membeking , melihat kondisis Wilayah Kecamatan Bukit Kapur menjadi Salah satu kawasan yang menarik perhatiam bagi banyak kalangan , hal itu di karenakan bukan saja jadi tempat sarang judi tetapi di juluki sebagai kawasan wilayah yang rawan dan jadi sarang bisnis illegal penampung kencing truk BBM dan minyak CPO dan Di duga di daerah itu bercokol para pemain Ilegalloging mrambah kayu di wilaya Bukit Kerikil. para mafia-mafia bisnis illegal itu sampai kini belum tersentuh Hukum. sesuai catatan media ini , pada bulan Februari lalu mafia penimbun dan penadah BBM hasil kencing berhasil di tangkap petugas jajaran Polresta Dumai. dan saat ini tersangka menjalani proses Hukum. perkara tersebut sudah di limpahkan Pengadilan Negeri Dumai, di harapkan oleh masyarakat agar tersangka dapat di Hukum Berat. untuk kasus ini aparat Hukum Dumai harus bertindak tegas ujar beberapa pemerhati dan beberapa Tokoh warga yang mengamati kejahatan Kencing BBM tersebut yang selama ini merajalela di Wilayah Kecamatan Bukit Kapur. hal senada juga di lontarkan warga masyarakat di Bukit Kapur menghimbau aparat berwajib untuk segera memberangus para Bandar judi Togel di daerah itu. Sorotan terhadap bisnis illegal penampung kencing CPO di bukit Nenas, "bisa berjalan mulus dan transparan aman-aman saja" dimata umum membuat sejumlah kalangan menaruh kuat dugaan, bahwa penampung dan penadah kencing dari truk pengangkut CPO itu bukan tidak mungkin dibeking oleh oknum tertentu. "Wah ini merupakan tantangan buat Polda Riau" dan termasuk aparat berkompeten sebagai penegak Hukum di Riau, seyogianya harus mengambil langkah tegas untuk mengusut kasus penampung BBM dan CPO yang di duga kuat illegal. karena selama ini berlangsung mulus dan tidak tersentuh Hukum.(RDS)

&

TRAGIS

Selanjutnya, pengadaan peralatan laboratorium FMIPA dan ilmu keolahragaan Rp 40 M, yang mana terjadi penggiringan untuk menenangkan satu perusahaan serta diduga kuat penggelembungan harga dalam pengadaan alat-alat laboratorium. Pengadaan sarana dan prasarana TIK Rp 18 M yakni bantuan pemprovsu untuk kegiatan IMG-GT (Pembangunan tiga serangkai) Rp 1,8 M, juga diduga terjadi penggelembungan anggaran dalam pengelolaan keuangan. Yang mana, patut diduga kegiatan tersebut tidak sampai menghabiskan dana demikian besar. Serta,pengadaan jaket almamater mahasiswa luar kampus (PSKGJ) program sarjana kependidikan bagi guru dalam jabatan). Ironinya diduga kuat telah terjadi pungutan liar dalam hal pengadaan jaket almamater bagi mahasiswa luar kampus. Adapun besaran dari kutipan tersebut Rp 130 ribu/orang dengan jumlah pengutipan senilai Rp 1,1 M Kemudian penggunaan keuangan terse-

but tidak melalui proses tender sebagaimana mekanisme yang telah diatur oleh undang-undang. Dalam pengadaan jaket almamater, beberapa kejanggalan yang ditemukan berupa: kualitas tidak sesuai harga, dari bahan dan kualitas diperkirakan biayanya hanya sekitar Rp 65000/jaket artinya diduga kuat telah terjadi praktek korupsi dalam pengadaan baju tersebut. Para pengunjukrasa diterima angggota komisi E DPRD Sumut,Hamamisul Bahsan (foto) yang mengatakan akan menyampaikan tuntutan kepada pimpinan dewan dan diadakan pemanggilan terhadap instansi terkait. "Pernyataan mahasisswa akan kami sampaikan ke pimpinan dewan untuk diagendakan di dalam Bamus agar diadakan rapat terkait dengan persoalan di atas.Kalau memang terjadi penyimpangan kita tidak segan-segan menyampaikannya ke pihak berwenang untuk dibawa ke ranah hukum", ujar Sekretaris Fraksi Partai Hanura Sumut ini lagi.(ndo)

BNN Curigai Oknum Pejabat Aceh Salahgunakan Narkoba Banda Aceh, BN Dewasa ini penyalahgunaan Narkoba (Narkotika, Psikotropika dan Bahan Adiktif lainnya) tidak terkecuali di provinsi Aceh yang semakin hari kian meluas, dan telah sampai pada tahap membahayakan. Bahan ini diduga bukan hanya dikonsumsi oleh lapisan masyarakat bawah, melainkan juga disinyalir ikut disalahgunakan sejumlah oknum PNS mulai dari staf hingga pejabat. Perlahan-lahan suhu terik matahari Sabtu pekan lalu mulai menurun. Angin sepoi-sepoi mengisi suasana kota Banda Aceh. Nada dering handphone genggam reporter Bongkar News yang bertugas di kota Banda Aceh terdengar suara lelaki paruh baya yang berisyarat mengangkat sambungan panggilan alat komunikasi miliknya itu. Ia tak lain adalah Ketua Badan Narkotika Nasional (BNN) Provinsi Aceh, Saidan Nafi. “Dari hasil evaluasi yang kami lakukan dari isteri mereka, banyak suaminya yang diduga terlibatpenyalah gunaan narkoba. Untuk itu, kita akan melakukan tes urine dengan tujuan segera dilakukan rehabilitasi,” ungkap Ketua BNN Provinsi Aceh, Saidan Nafi, dengan nada setengah semangat. Saidan mengatakan, sejak hadirnya BNN di provinsi Aceh, staf dan pejabat dalam lingkup Setda Aceh belum pernah melalukan tes urine. Kecuali itu, saat penerimaan personil Satuan Polisi Pamong Praja dan Wilayatul Hisbah (Satpol-PP dan WH) baru-baru ini. “Padahal ini sangat penting dan menjadi acuan bagi abdi negara kepada masyarakat. Se-

hingga bisa menjadi contoh teladan yang diberikan kepada kalangan bawah,” katanya. Menurut dia, tidak dilakukannya tes urine oleh pejabat dan staf di jajaran Setda Aceh, disebabkan kurangnya pengetahuan dari PNS tersebut. Namun begitu, sejauh ini pihaknya telah melakukan advokasi kepada sejumlah SKPA.“Setiap SKPA ada sekitar lima orang staf, dan memang hingga kini sudah mulai mengetahui apa tujuan tes urine tersebut,” tutur Saidan. Ia menyebutkan, sejak awal berdirinya BNN di Aceh Pemerintah Aceh sudah mengeluarkan Intruksi Gubernur (Ingub), setiap calon legelatif dan eksekutif seyogyanya terbebas dari jeratan narkoba. Selain pejabat dan staf di Setda Aceh, pihaknya juga memastikan bakal melakukan tes urine kepada pekerja swasta di Aceh.Sehingga, tes urine berlaku untuk semua komponen dengan harapan Aceh terbebas dari jeratan narkoba. “Tes urine dilakukan BNN Aceh, sebagai antisipasi agar PNS dan tenaga kerja swasta di Aceh terbebas dari pengaruh penggunaan narkoba. Selain itu, pemeriksaan urine di kalangan PNS dan pegawai swasta untuk menekan angka penyalahgunaan narkotika,” tukasnya. Ditanya kapan tes urine akan dilakukan BNN Aceh, Ia menolak menyebutkan. Sebab, jika pihaknya menyebutkan jadwal pemeriksaan urine, banyak pejabat dan staf di jajaran Setda Aceh menghindar pemeriksaan urine itu, paparnya. Masih menurut Saidan, Aceh yang dikenal sebagai daerah penghasil ganja terbesar di In-

donesia menjadi target utama Badan Narkotika Nasional (BNN) untuk mengembangkan program pembangunan alternatif, sebagai upaya pemberantasan ganja, Program tersebut didukung Perserikatan Bangsa Bangsa (PBB). “Program pemberantasan alternatif yang disupport PBB, awalnya hanya dilakukan oleh para penanam kokain di Amerika Latin. Tapi belum dilakukan untuk para petani ganja di 172 negara. Lalu, pada 2006, BNN meyakinkan PBB, bahwa hal tersebut bisa dilakukan untuk para penanam ganja,” imbuhnya. Sambung dia lagi, Aceh kemudian dipilih sebagai daerah percontohan. Pemberantasan ganja di barengi dengan membangun ekonomi masyarakat, misalnya dengan membangun ekonomi masyarakat, misalnya dengan memfasilitasi masyarakat agar beralih ke tanaman lain atau beternak, sambung Saidan. Pada tahun 2015 mendatang, pihaknya menargetkan provinsi Aceh dapat terbebas dari narkoba. Meskipun sulit untuk mencapai hal itu, tapi setidaknya peredaran dan penggunaan narkoba di Aceh akan dapat diatasi. Karena diakui atau tidak, penyalahgunaan dan peredaran gelap narkoba, kini telah merambah tanpa mengenal usia dan profesi. Karena itu, sangat perlu dilakukan pencegahan sedini mungkin. “Untuk mencapai Aceh terbebas dari narkoba, tentunya sangat dibutuhkan peranan dari elemen masyarakat. Karenanya, mari bersama-sama kita perangi peredaran narkoba guna menyelamatkan masyarakat tanpa pengecualian usia maupun profesi dari pengaruh barang haram itu,“katanya. (Zal/TM)

Polres Sergai Tangkap Penulis Togel Sergai, BN Polres Serdang Bedagai berhasil menciduk tersangka penulis judi togel / kim pada hari Senin (7/ 5/12) pukul 21.00 Wib di Blok 10 Desa Silau Rakyat Kec. Sei Rampah Kab. Serdang Bedagai. Tersangka Agus (44) tahun warga Desa Silau Rakyat, barang bukti 1 buah pulpen, 2 lembar kertas berisikan angka 2 tebakan judi togel / kim, uang tunai

Rp.61.000,-. Setelah menerima informasi dari warga dan tokoh agama kepada Kasat Reskrim Polres Sergai AKP Danny Boy Panggabean. Kemudian Kasat Reskrim memerintahkan kanit Judi Aiptu Subono bersama opsnalnya langsung melakukan penyelidikan terhadap tersangka yang diduga turut campur dnegan kegiatan judi. Setelah diselidiki beberapa

didapat data yang akurat dan kebenarannya bahwa tersangka sedang menunggu pembeli dirumah / warung milik tersangka dan ditemukan barang bukti dari tersangka. Saat itu juga tersangka dan BB diamankan Sat Reskrim Polres Sergai guna pengembangan perkaranya. Kasubbag Humas Polres AKP ZN. Siregar membenarkan penangkapan tersebut (Ibnu)

Tersangka Traficking Diringkus Polisi Suka Dame, BN Telah ditangkap tersangka kasus perdagangan orang (Trifikink) dan perlindungan anak pada hari Jumat tanggal (11/5/12) Pukul 16.00 wib, dikamar No.13 Hotel Top In Desa Suka Dame Kec. Sei Bamban Kab. Serdang Bedagai. Korban 1. Marta Aprilia Sitorus (15) tahun Kelas I SMA Desa Pangkalan Budiman Kec. Sei Rampah, 2. Fitri (15) tahun Kelas 3 SMP Desa Pangkalan Budiman Sei

Rampah. Tersangka Yudi (20) Tahun warga Dusun 5 Desa Suka Dame Kec. Sei Bamban, barang bukti uang tunai Rp. 800.000,- Dalam kasus ini tersangka melanggar Pasal UU No.23/2002 tentang perlindungan anak dan UU No.21/2007 tentang perdagangan orang. Perdagangan ini sudah sering dilakukan tersangka kepada kedua korban, rupanya kali ini apes bagi tersangka, tersangka

dipancing oleh Team SUS untuk menyerahkan korban Marta sesuai yang dijanjikan untuk bertemu di Hotel Top In Suka Dame, dan sebelumnya tersangka sudah menerima uang hasil penjualan korban kepada Team SUS yang menyamar sebagai laki-laki hidung belang. Setelah tersangka membawa korbannya kedalam kamar Hotel untuk dijual, ketika itu datang Team SUS menggrebek kamar hotel.

Setelah diintrogasi benar tersangka mengakui menjual korban sebagai pemuas nafsu, dan tersangka juga mendapat hasil dari penjualan orang / komisinya sebesar Rp.50.000/Tip. Dan saat ini tersangka bersama barang bukti diamankan Satreskrim Polres Serdang Bedagai guna penyidikan perkaranya. Kasubbag Humas Polres AKP ZN. Siregar membenarkan penangkapan tersebut. (Ibnu)

Sulaiman Nurza (Kiri) Panglima Bungsu Laskar Melayu BersatuRiau Kecamatan Dumai Timur Menyerahkan Bukti Kepemilikan Tanah Warisan Keluarganya Terletak di Parit Bakrie Batu Teritip Kepada Panglima Laskar Hulu Balang Melayu Dumai H. Awaluddin dan Sepakat Siap "Mengusir" Para Penyerobot Lahan Warisan dan Lahan Milik Laskar Melayu Dumai

Ratusan Ha Lahan Tanah Milik Laskar Hulu Balang Melayu Diduga Diserobot Dumai, BN Lebih kurang 210 HA lahan milik Laskar Hulu Balang Melayu di Dumai di garap oleh salah seorang warga Dumai Di duga salah satu toke berduit berinisial A . tindakan penyerobotan terhadap lahan yang terletak di RT 08 di jalan Lingkar Prit Markitang Kelurahan Bangsal Aceh itu akhirnya berhadapan dengan ratusan anggota Laskar Hulu Balang Melayu Dumai, di harapkan aksi penyerobotan agar segera di hentikan.hal itu di tegaskan Datuk Panglima Laskar Hulu Balang H.Awaluddin saat menjelaskan pada media in (09/05) kemarin lalu. Keterangan Petinggi LaskarHulu Balang Melayu itu yang akrab di panggil H. Gedang , bahwa lahan tersebut adalah di beli pada tahun 2007 yang lalu dua bidang lahan tersebut di antaranya berukuran 150 Ha dan satu lagi berukuran 60 Ha. jadi lahan itu adalah merupakan milik Laskara Hulu Balang Melayu Dumai yang sudah kita beli dari JM selaku pemilik lahan Kelompok Tani Harapan Jaya ujarnya menjawab Wartawan BN. Untuk di ketahui lanjut Panglima Laskar Hulu Balang ini lagi bahwa lahan tersebut di beli adalah untuk kesejahtraan anggota Laskar Hulu Balang Melayu di Dumai yang pimpinnya , sebab kita sangat prihatin melihat nasib anak tempat (anak Dumai-red) Tidak memiliki lahan di kampong halaman sendiri jadi anak Negeri ini hanya sebagai penonton semata, karena itulah saya beserta seluruh anggota berusaha untuk membeli lahan tersebut tahun 2007 lalu papar H, Gedang di kantornya. Dikataknnya, tidak jelas kita ketahui siapa actor atau di duga sebagai dalang pelaku penyerobotan lahan milik Laskar Hulu Balang Dumai yang terletak di kelurahan Bangsal Aceh kecamatan Sungai Sembilan, karena penyerobotan itu keluarga besar Laskar Hulu Balang Melayu musyawarah, akan menurunkan lebih kurang 500 orang masuk kelokasi lahan yang di garap kelompok oknum warga Dumai berinisial A tersebut. Kami tetap komit mempertahankan Hak atas lahan tersebut, "kita tidak akan mundur satu langkahpun dan keputusan memperjuangkan nya juga sudah harga mati, apapun yang terjadi hak kami tetap kami perebutkan sampai titik darah penghabisan tegas Panglima Laskar Hulu Balang Melayu Dumai itu menjawab saat di wawancarai media BN. Makanya kita minta pada pihak penyerobot agar "Supaya Segera Sadar Diri" yang jelas lahan tersebut secara sah di beli dari JM seharga Rp.287.500.000- lanjut H.Gedang di jelaskan pembelian lahan itu juga di saksikan oleh anggota DPD RI Intisiawati Ayus SH.MH dan angora DPRD Riau H.Zulkarnaen Nurdin SH.MH serta salah seorang pengacara di Dumai R.Junaidi SH tegas H.Gedang sembari memberitahukan, bahwa sudah terjalin ada kesepakatan Laskar Hulu Balang Melayu di Dumai dengan Laskar Melayu bersatu-Riau kecamatan Dumai timur di Dumai bersama sama memperjuangkan hak atas tanah yang di serobot itu sampai titik darah penghabisan tegasnya pada Media ini. (RDS)

4 Orang IRT Penjual Miras Diamankan Subulussalam. BN 4 Orang Ibu rumah tangga separuh baya penjual Miras warga Jln. Pemancar Kecamatan Penanggalan pada hari selasa (8/5) pukul 22.00 Wib diamankan Muspika dibantu SatpolPP/WH bersama barnag bukti 4 (empat) jeregen tuak, raru dan gitar memboyong ke kantor Satpol PP/WH Subulussalam untuk diproses. Penangkapan penjual miras tersebut berawal adanya laporan warga setempat kepada Muspika Penanggalan, bahwa selama ini mereka tidak nyaman akibat ulah wanita separuh baya dengan secara bebas menjual tuak yang dilarang Agama dan Hukum Syariat Islam sesuai dengan Qanun No. 12 tahun 2013 tentang larangan khamar, berlaku diseluruh wilayah Aceh, tapi mereka tidak memperdulikan larangan (Qanun) tersebut. Menyikapi laporan warga Muspika Penanggalan terdiri Camat Hotma Capah, Kapolsek IPDA Sofyah, Danramil Kap. Inf. Rusli bersama Satpol PP/WH turun ke lokasi dan menangkap pelaku beserta barang bukti. Kadis Syariat Islam Subulussalam Ust. Drs. Usni begitu mendengar penangkapan penjual miras, langsung turun ke kantor Satpol PP dan terlihat sangat geram kepada ke 4 wanita penjual miras tersebut, sebab sudah sering terjadi dan pelakunya pun itu-itu juga. Sehingga dia menyarankan agar diproses secara hukum, agar kejadian tidak terulang kembali, dan yang lain pun menjadi takut untuk menjual minuman haram, tegas Usni. Disisi lain warga subulussalam begitu mendengar ada penangkapan penjual miras, mengatakan yang diangkap 4 orang itu hanya sebagian kecil, karena kata mereka yang tidak mau disebut jati dirinya diwilayah Hukum Subulussalam terlebih Kecamatan Penanggalan sudah berjamur kalau pedagang tuak, selain tuak Miras yang beralkohol tinggi pun sudah biasa dijual terlebih di cafécafé, namun yang kita dengar tidak pernah ada pemeriksaan (rajia) dari pihak keamanan, inikan lantaran ada laporan warga maka ditangkap ungkap mereka. (RB).

Tabung Gas Karbit Meledak Sai Jingge, BN Telah meledak tabung gas karbit 30 kg pada hari Jumat tanggal 11 Mai 2012 sekira pukul 10.40 wib, di Dusun 3 Desa Sai Jingge Kec. Perbaungan tepatnya di bengkel milik Nasir (64) tahun warga Dusun 3 Desa Sai Jingge, Kab. Serdang Bedagai. Korban Supianto (35) tahun mengalami luka pada bagian punggung dan retak tulang belakang serta tulang telinga, Winda 27 tahun ibu rumah tangga mengalami luka bakar pada bahu dan tangan kanan. Akibat kejadian tersebut kedua korban dirawat di RS Trianda Perbaungan. Saat itu (korban Supianto) sedang bekerja sebagai tukang las besi dibengkelnya, tiba-tiba tabung gas yang berisikan karbit meledak. Dan diduga karena tabung gas tersebut sudah tua dan menipis sehingga ledakan karbit panas mengenai tubuh kedua korban.Saat ini kasusnya dalam penyelidikan Sat Reskrim Polsek Perbaungan. (Ibnu)


14 - 21 MEI 2012 | EDISI 315 | THN KE-VII

Kasus 4 Batang Bambu di Polsek Binjai Selatan Jadi Berita Nasional Binjai, BN Kasus 4 batang bambu yang ditangani Polsek Binjai Selatan terus mendapat sorotan sejumlah elemen masyarakat. Mulai dari tokoh pendidikan yang minta perlindungan hukum, hingga desakan LSM Forum RI Bersatu Sumut, agar Kapoldasu Irjen Pol Wisjnu AS mencopot Kapolsek Binjai Selatan Kompol Kamaluddin T dari jabatannya. Kasus dugaan pencurian empat batang bambu yang sudah menjadi berita nasional ini, penanganannya terbilang masih jalan ditempat meskipun perkaranya sudah hampir memakan waktu selama 1,5 tahun. Berkaitan dengan perkara ini, Sekjen LSM Perjuangan Hukum dan Politik (PHP) Sumut M.Sitepu,SH angkat bicara. Dikatakannya, kisruh serta berlarut-larutnya penanganan kasus dugaan pencurian 4 batang bambu tersebut, gaungnya kini semakin hangat dan malah sudah menjadi perkara nasional, seperti halnya perkara “sendal jepit” yang menghebohkan Indonesia. M.Sitepu,SH yang juga Praktisi hukum di Kota Binjai, sangat menyayangkan proses penanganan kasus 4 batang bambu tersebut, dimana pihak Polsek Binjai Selatan,terkesan tidak mempedomani KUHAP dan UU No.7 tahun 2004 tentang Daerah Aliran Sungai (DAS). sebagai acuan dalam pengusutan perkara. Meskipun terindikasi sudah melanggar peraturan, Polsek Binjai Selatan sepertinya tetap ngotot melanjutkan perkara tersebut. “Ada apa dibalik semua ini” ?, tanya M.Sitepu. Sedangkan saksi korban,Ir.H.Suprie Hamdani, lanjutnya sudah melayangkan surat yang berisi kronologis dugaan pencurian 4 batang bambu tersebut pada 11 Februari 2012 yang lalu, ke Kapolres Binjai, yang ditembuskan kepada instansi terkait seperti : Kapoldasu, Kapolri, Kompolnas,Kejagung,Kejatisu, BPN pusat,BPN Sumut,Walikota Binjai, Kejari Binjai,Camat Binjai Selatan dan Lurah Rambung Barat. Namun surat kronologis kejadian itu dianggap angin lalu oleh Kapolres Binjai AKBP Musa Tampubolon. “Sebagai orang nomor satu di jajaran Polres Binjai, AKBP Musa Tampubolon dinilai tidak merasa terbebani, sehingga beliau tidak merespon perkara ini dengan baik, padahal perkara 4 batang bambu tersebut disoroti banyak pihak”, ujar M.Sitepu,SH. Dikatakan Sekjen LSM PHP Sumut ini lagi, bahwa kebijakan Kejaksaan Negeri Binjai yang menolak dua kali BAP Polsek Binjai Selatan dinilai sangat tepat, karena penanganan perkara 4 batang bambu tersebut, diduga kuat telah melanggar KUHAP dan UU DAS, tegas M.Sitepu seraya mengharapkan Kapolres Binjai lebih bijaksana menindaklanjuti perkara yang sudah dapat diakses di dunia maya, terang M.Sitepu. Ditegaskan M.Sitepu, jika Polsek Binjai Selatan tetap ngotot meneruskan perkara ini, tangkap saja Supangat yang dituding melakukan pencurian 4 batang bambu di Jalan Padang Sidempuan,Kelurahan Rambung Barat, agar perkara ini menjadi jelas. Jangan seperti sekarang ini, sudah satu tahun setengah, Supangat dijadikan tersangka dan wajib lapor ke Polsek Binjai Selatan. “Dan baru saya tahu, ada perkara Tipiring (Tindak Pidana Ringan) wajib lapornya hingga 1,5 tahun. Penanganan kasus seperti ini baru ada di Polsek Binjai Selatan yang dipimpin Kompol Kamaluddin T”, tandas M.Sitepu yang merasa heran dan geli.[B.005]

FRB Sumut Desak Kegiatan Galian C di Kelurahan Mencirim Diusut Tuntas Binjai, BN Forum Rakyat Bersatu (FRB) Sumut bersama seratusan warga kelurahan Mencirim melakukan unjuk rasa ke lokasi kegiatan galian-c di Kelurahan Mencirim,Kecamatan Binjai Timur,Jum,at 4/5. Mereka mendesak pihak berkompeten mengusut tuntas tindakan pengerukan tanah seluas 250x150 m yang di klaim milik masyarakat petani Kel.Mencirim yang diduga dirampas PTPN II pada tahun 1966 lalu. Dalam aksi pengerukan tanah itu, kerugian ditaksir sekitar 7 miliar, ujar pengunjuk rasa. Menyikapi masalah tersebut, ketua kongres FRB Sumut Drs Prabu Alam,Msi mengatakan kegiatan galian-c di kelurahan Mencirim harus dihentikan,sebelum terjadinya korban jiwa di lapangan. Kita sangat menyesalkan pihak kepolisian yang kurang tanggap atas laporan warga tentang adanya kegiatan galian-c yang diduga ilegal tersebut. Sementara adanya tudingan pengerusakan lahan tebu di lahan Ex. HGU, yang dilakukan warga, langsung ditahan Polres Binjai tanpa meneliti sang pelapor mempunyai hak atau tidak atas lahan tersebut, ujar Prabu. Dalam kaitan pengerukan tanah di lahan Kelurahan Mencirim, FRB Sumut tetap akan memperjuangkan dan membela hak-hak masyarakat petani atas lahan tersebut, karena disini ada oknum-oknum yang bermain untuk mengeruk keuntungan. “Lambannya respon polisi menindaklanjuti laporan warga mengenai adanya kegiatan galian tanah di Keurahan Mencirim,dapat memicu bentrok fisik antara warga dengan pihak pengusaha”, papar Prabu Alam yang diamini Joni Siregar. Malah Joni Siregar menuding sikap pembiaran yang diset aparat berwenang untuk tidak mengusut kegiatan pengerukan lahan yang sudah berlangsung lama tersebut, terindikasi telah menerima upeti dari pengusaha. . Sementara itu, ketua Satgas FRB Sumut Zaini Sembiring,kepada wartawan mengatakan sebagai ketua LMP Binjai yang mewakili masyarakat merasa kecewa atas tindakan oknum pejabat yang terkesan mengambil keuntungan di air keruh.Hal itu dikemukakannya di Sekretariat FRB Sumut Jalan Medan-Binjai KM 16, usai memimpin aksi unjuk rasa petani,Jum,at 4/5 kemarin. Dikatakan, dalam memperjuangkan hak, pihaknya tidak mundur sejengkalpun, sepanjang yang diperjuangkan itu benar. Kita hanya minta keadilan di negeri ini agar ditegakkan. “Pejabat jangan selalu membodohi dan menyakiti hati rakyat, sehingga rakyat menjadi bodoh dan sakit”, ujar Zaini. Ditambahkan Zaini, Polres Binjai dalam menangani masalah lahan perkebunan sebenarnya tidak bisa lagi mengunakan pasal 21 - 47 UU No.18 tahun 2004, dan menerapkan KUHP kepada petani penggarap, karena sudah bertentangan dengan keputusan Mahkamah Konstitusi (MK) No.55/PUU-VIII/2010. “Dengan keputusan MK tersebut, secara otomatis pasal 21 dan 27 UU No.18 tahun 2004 tidak bisa dijadikan dasar hukum untuk menangani permasalahan lahan perkebunan.Keputusan MK inilah yang akan diberikannya kepada Kapolres Binjai”,ungkap Zaini Sembiring. [B.005]

2 Kabupaten Sumut Dilanda Puting Beliung Sergai, BN Deli Serdang dan Kab. Serdang Bedagai rusak berat dan ringan dan satu sekolah rusak akibat diterjang angin puting beliung disertai hujan lebat dan petir. Selasa (8/5/12) sekira pukul 19.30 Wib. Informasi Media Bongkar peroleh di Sergai 367 rumah warga rusak dan di Deli Serdang 65 Rumah. Peristiwa itu sempat membuat trauma warga didua Kabupaten tersebut. Bahkan di Serdang Bedagai puting beliung merusak dua unit kilang padi milik Iswandi (32) dilingkungan 1 Kel. Tualang Kec. Perbaungan, dan milik Parulian (52) di Dusun 1 desa Sei Bamban Kec. Sei Bamban, serta menerbangkan seng SDN 106841 Pematang Pulau Kec. Pantai Cermin. Namun begitupun tidak mengganggu proses Ujian Akhir Nasional (UAN) dihari terakhir. Sedangkan korban luka, Tukiran (71) dan anaknya Juanto (29) warga Lingk. I Kel. Tualang menderita luka gores dilengan dan tertusuk paku akibat tertimpa rumahnya yang rubuh. Ditempat yang berbeda Sumiarni (33) warga Gang Durian Desa Melati II Kec. Perbaungan mengalami luka di kening hingga mendapat lima jahitan akibat tertimpa broti rumah, ketiganya telah mendapat perawatan. Salah seorang warga yakni, Tukirin menuturkan sebelumnya angin kencang

datang, terlebih dahulu terjadi hujan lebat disertai suara petir, serta aliran listrik padam. Tak lama, angin kencang berputar-putar," pohon mangga yang ada didepan rumahku terbongkar dan menimpa rumahku," kata kakek yang kesehariannya sebagai penggali kubur itu kepada wartawan Bongkar dihalaman rumahnya. Kepala Badan Penanggulangan Daerah (BPBD) Kab. Sergai Drs. Joni W. Manik didampingi Sekretaris BPBD Sergai, Banjarnahor, Kabid Kedaruratan, Yansen Sianturi, S.Pd dan beberapa staf menerangkan akibat peristiwa bencana puting beliung, data sementara sekitar 367 rumah mengalami rusak berat, dan ringan dienam Kecamatan 1 Suasana di Kampung Kuningan, Desa Sei Periok ussai dihajar puting beliung, kemarin sekolah, dua kilang padi mengatakan, untuk pelayanan kesehajuga mengalami kerusakan. ingatkan masyarakat tetap waspada, tan, pihaknya telah mengirimkan petugas Sementara itu Wakil Bupati Sergai H. karena menurut data BMKG cuaca ekkesehatan kelokasi-lokasi bencana, sedanSoekirman di Posko Bencana didampin- strim akan terus terjadi hingga akhir Mai gkan bantuan dari berbagai pihak kepada gi Camat Perbaungan Akmal, Kepala 2012. Kepala Dinas Kesehatan Sergai korban bencana terus mengalir. (Ibnu) BPBD Sergai Drs. Joni W. Manik, meng- drg. Zaniyar ketika dihubungi wartawan

Sambut Hari Jadi Tebingtinggi dan Hari Bhayangkara

Warga Tuna Daksa Terima Bantuan Kaki dan Tangan Palsu Tebingtinggi,BN Dalam rangka menyambut Hari Jadi Kota Tebingtinggi ke 95 dan Hari Bhayangkara ke 66, Wakil Walikota Tebingtinggi H Irham Taufik SH MAP dan Kapolresta Tebingtinggi menggelar bakti sosial pemberian bantuan kaki dan tangan palsu kepada 25 orang warga tuna daksa (cacat tubuh) di Aula Mapolresta Tebingtinggi, Jumat (4/5). Wakil Walikota Tebingtinggi menyampaikan ucapan terimakasih kepada Ketua Panitia Bakti Sosial dr Djohan Zen serta Ketua Yayasan Surya Kebenaran Internasional (YSKI) Ev Elyus dan para pendonor lainnya atas diberikannya bantuan kaki dan

tangan palsu secara gratis. “Pemko Tebingtinggi sangat berterimakasih kepada para donator dan dermawan yang telah peduli dengan warga berkebutuhan khusus dikota ini, bantuan ini tentunya sangat membantu mereka semua”, sebut Irham Taufik. Dihadapan Kapolresta Tebingtinggi dan jajarannya, para camat dan lurah se Kota Tebingtinggi, Ketua FKUB Abu Hasyim Siregar dan puluhan kaum penyandang cacat, Wakil Walikota menyampaikan bahwa Pemerintah Kota Tebingtinggi sangat prihatin kepada warganya terlebih yang berkebutuhan khusus yakni para penyandang cacat dalam meringankan beban mereka, “Untuk itu, pemer-

Walikota Tebingtinggi: Peningkatan Kompetensi PNS Hal Yang Mutlak Tebingtinggi,BN Walikota Tebingtinggi Ir H Umar Zunaidi Hasibuan menegaskan, sebagai unsur utama sumber daya pemerintah dalam pelayanan publik, peningkatan kompetensi dan kinerja merupakan hal yang mutlak bagi Pegawai Negeri Sipil. “Sejak diberlakukannya UndangUndang Aparatur Sipil Negara (ASN), para PNS harus terus menerus meningkatkan kompetensinya sebagai salah satu tolok ukur dalam penilaian angka kredit”, demikian disampaikan Walikota Tebingtinggi dalam sambutan tertulis yang dibacakan Plt Sekdako Drs H Hadi Winarno MM pada pembukaan Diklat Penghitungan Angka Kredit Bagi Jabatan Fungsional Guru, Selasa (8/5) di Gedung TC Sosial Jalan Rumah Sakit Umum Kota Tebingtinggi. Diklat yang dilaksanakan selama tiga hari oleh Badan Kepegawaian, Pendidikan dan Pelatihan (BKPP) Kota Tebingtinggi itu diikuti oleh 40 peserta,

terdiri dari 15 orang guru SD, 10 orang guru SMP, 4 orang guru SMA, 4 orang guru SMK, 5 orang staf Dinas Pendidikan dan 2 orang Staf BKPP menghadirkan narasumber Dra Rita Clara MPd dari Dinas Pendidikan Provsu. Kepala BKPP Kota Tebingtinggi dalam laporannya yang disampaikan Sekretaris BKPP, Fadlan SH menyatakan, tujuan dilaksanakannya Diklat ini agar pejabat fungsional dapat memahami unsur-unsur yang dinilai dalam penghitungan angka kredit dan memotivasi guru dalam meningkatkan kinerjanya. Tampak hadir dalam pembukaan Diklat Penghitungan Angka Kredit Bagi Jabatan Fungsional Guru di Pemko Tebingtinggi itu antara lain, Kepala Dinas Pendidikan dan Kebudayaan diwakili Sekretaris Zahidin M.Pd, Kepala Kantor Pemberdayaan Perempuan, Anak dan Keluarga Berencana (PPKB) drg Dina Kamarina serta sejumlah pimpinan SKPD dilingkungan Pemko Tebingtinggi.(DER)

intah akan terus mendorong siapa saja baik lembaga social, organisasi masyarakat atau siapa saja yang akan melaksanakan bakti social serupa, kami akan terus mendorong terselenggaranya acara serupa di kemudian hari, semoga di peringatan hari hari besar lainnya kita akan adakan acara sejenis”, tegasnya. Sementara Kapolresta Tebingtinggi AKBP Andi Rian Djayadi menyampaikan bahwa, selaku manusia yang baik maka kita juga harus berbuat kebaikan kepada orang lain, “Agama apapun pasti mengajarkan kepada pengikutnya untuk berlomba-lomba berbuat kebaikan dan kegiatan ini salah satunya, untuk itu kepada warga yang menerima bantuan agar kiranya nanti kaki yang dipasangkan sesuai dan sama kita tularkan berbuat baik kepada orang lainnya”, imbuh Kapolres. Kegiatan dilanjutkan dengan pengukuran kaki bagi penyandang cacat secara simbolis. Pada kesempatan itu, Wakil Walikota sempat bertanya kepada salah seorang pasien, Agus Salim (30) warga Kelurahan Tanjuk Marulak apa penyebab kakinya putus dan dijawab akibat terlindas kereta api. “Saya berharap setelah mendapat kaki palsu nanti saya akan lebih mudah beraktifitas dan tidak banyak menyusahkan orang lain lagi”, katanya. Setelah dilakukan pengukuran, kaki dan tangan palsu tersebut akan diberikan dan dipasangkan rencananya di bulan Juli 2012 mendatang, mengingat pengukuran dan pembuatannya tidak mudah dan butuh waktu, terlebih Yayasan Surya Kebenaran Internasional (YSKI) tidak hanya memberikan bantuan di Tebingtinggi saja tetapi juga di daerah lainnya.(DER)

Sosialisasi Analisa Jabatan dan Analisis Beban Kerja di Tebing Tinggi Tebing Tinggi,BN “Penundaan sementara formasi dan penerimaan calon PNS yang diberlakukan mulai tanggal 1September 2011 sampai dengan 31 Desember 2012 adalah dalam rangka penataan dan penghematan anggaran belanja pegawai,” papar Sekdakot Tebing Tinggi, Drs Hadi Winarno, MM, mewakili Walikota Kota Tebing Tinggi, pada sosialsasi analisa jabatan dan analisa beban PNS lingkungan Pemko Tebing Tinggi di Balai Kartini (3/5). Hadir dalam acara sosialisasi ini Asisten II, Staf Ahli, Narasumber dari Kantor Regional VI BKN Medan dan Kepala SKPD se-Kota Tebing Tinggi. Sosialisasi ini diikuti oleh 92 pegawai eselon IV masing-masing unit kerja di ligkungan Pemko Tebing Tinggi sebagai peserta. Kepala Badan Kepegawaian, Pendidikan dan Pelatihan (BKPP) Kota Tebing Tinggi dalam laporannya menyampaikan bahwa tujuan sosialisasi anilisis jabatan dan analisis beban kerja sebagai pedoman perhitungan jumah kebutuhan PNS untuk suatu daerah dan sebagai acuan bagi pemerintah daerah untuk merumuskan jumlah kebutuhan pegawai secara tepat sesuai kebutuhan riil organisasi berdasarkan karakteristik dan kondisi daerah. Dalam bagian lain Sekdakot menyampaikan bahwa ke depan akan disusun proyeksi kebutuhan PNS lima tahun, yang pemenuhan dilakukan secara berkesinambungan dan sasara prioritas pertahun yang jelas. “Semua ini tentu sesuai dengan kemampuan keuangan Negara dan hasilnya disampaikan paling lambat 30 Juni 2012,” ujar Hadi Winarno. Sekdakot menambahkan sesungguhnya analisa jabatan merupakan tugas seluruh SKPD, meskipun dalam hal fungsi koordinasi dan sesuai dengan tugas pokok dan fungsinya yang menjadi penanggungjawab dan coordinator dari pelaksanaan analisa jabatan dan analisa beban kerja ini adalah unit kerja bagian hokum dan organisasi dan SKPD Badan Kepegawaian, Pendidikan dan Pelatihan. “Sehubungan dengan hal-hal tersebut maka Pemerintah Kota Tebing Tinggi melaksanakan kegiatan sosialisasi analisis jabatan dan analisis beban kerja kepada seluruh seluruh unit kerja yang ada,” ujarnya.(DER)

Ribuan Massa Hadiri Penutupan MTQ ke-33

Sergai, BN Ribuan Massa dari berbagai daerah di Sumatera Utara, menghadiri acara malam penutupan Mushabaqo Tilawatil Qur'an (MTQ) ke 33 di Kabupaten Sergai Kecamatan Pegajahan Desa Melati Kebun. Plt. Gubsu Gatot Pujonugroho secara resmi menutup pelaksanaan MTQ ke 33 tingkat Provinsi Sumatera

Utara tahun 2012, Sabtu (5/5) dalam sambutannya, Plt. Gubsu mengatakan tidak terasa ditujukan bagi kegiatan yang mengasikkan, dan penyelenggaraan MTQ ini upaya kita bersama dalam melestarikan Al-Qur'an dan diselenggarakan dengan baik, kata Gubsu. Selama 7 hari 7 malam daerah ini disirami dengan

bacaan-bacaan Qalam Illahi, diharapkan tentunya kawasan ini mendapat berkah Nurilahi dan selain itu adanya hal-hal yang lebih baik lagi. Al-Qur'an mampu menginsipirasi pembacanya dikarenakan, banyak nilai-nilai yang baik terkandung didalam AlQur'an dan mampu memberikan spirit bagi pembacanya." Ucapnya. Sementara itu, Bupati Sergai HT. Erry Nuradi selaku ketua umum Panpel MTQ Ke 33 menyampaikan, bahwa pelaksanaan ini demikian cepat dan tidak terasa kita berada dipenghujung acara, karena baru Sabtu yang lalu acara ini dibuka oleh Menko Kesra dan dihadiri oleh Menteri Agama serta 26 Duta Besar Negara sahabat, ungkap Bupati. Terima kasih atas kepercayaan yang diberikan kepada Sergai, sebagai tuan rumah MTQ ke 33 tahun 2012 dan mohon maaf atas segala

kekurangan, dan kami sampaikan bahwa selama berlangsungnya acara ini, ribuan warga setiap hari menghadiri lokasi ini untuk melihat kegiatan diarena MTQ, terutama malam final kemarin kata Bupati. Dalam kesempatan itu, Bupati HT. Erry Nuradi mengungkapkan bahwa, pelaksanaan MTQ tingkat nasional pada bulan Juni 2012 mendatang di Ambon, untuk itu dua tahun kedepan jika Tuhan memperkenankan, Sergai siap sebagai tuan rumah, kata Bupati. Terkait adanya usulan Bupati Sergai, pada pelaksanaan MTQ tingkat nasional dua tahun kedepan, dalam kesempatan ini Plt.Gubsu sangat mendukung karena lokasi MTQ ke 33 ini, jika ditambah lagi dengan adanya lahan pinjam pakai dari perkebunan seluas 20 Hektar, maka hal tersebut sangat

memungkinkan, ujar Plt. Gubsu. Usai Plt. Gunsi menutup pelaksanaan MTQ ke 33 Provinsi Sumatera Utara, dilanjutkan pembacaan pemenang oleh Ketua Dewan Hakim MTQ Ke 33 Provinsi Sumatera Utara, H. Hasan Basri Sa'i disaksikan oleh ketua LPTQ Sumut H. Nurdin Lubis SH. MM. Adapun hasil rekapitulasi secara keseluruhan, maka sebagai juara umum lima besar dalam MTQ ke 33 di Sergai, adalah : juara umum 1 Kabupaten Serdang Bedagai, ke II Kota Medan, ke III Kabupaten Deli Serdang, ke IV Kabupaten Asahan dan Ke V PTPN Wilayah Hadiri pada acara penutupan tersebut, forum pimpinan daerah Sumut, Bupati Sergai HT. Erry Nuradi, Muspida Plus Sergai dan mewakili Bupati/ Walikota se-Sumut, serta lebih sepuluh ribu warga dari berbagai daerah datang memadati lokasi MTQ. (Ibnu)


14-21 MEI 2012 | EDISI 315| THN KE-VII

DR JR Saragih SH MM Ajak Masyarakat

Bangkit dan Buat Komitmen Bangun Simalungun SIMALUNGUIN, BN DR JR Saragih SH MM mengajak seluruh elemen masyarakat untuk bangkit bersama dan membuat komitmen dalam membangun Kabupaten Simalungun menuju perubahan yang lebih baik. Hal tersebut diungkapkannya dalam bimbingan dan arahannya pada peresmian kantor Dewan Pimpinan Pusat (DPP) Pertuha Maujana Simalungun (PMS), yang berlokasi di Jln. Perintis kemerdekaan Pematangsiantar (Eks Rumah Dinas Bupati Simalungun), Sabtu, 05/05/2012. “Mari kita bersatu untuk menghidupkan marwah Simalungun melalui kebersamaan dan kekompakan, sehingga kita bisa saling bangkit bersama, karena kita bekerja semata-mata untuk kepentingan cita-cita para leluhur kita sekligus melaksanakan pesan mereka”, ajak DR JR Saragih Selanjutnya DR JR Saragih SH MM yang juga sebagai Ketua Umum DPP PMS berharap kepada seluruh pengurus PMS termasuk Dewan Pimpinan Cabang (DPC) agar bersama-sama memajukan dan melestariakan kesenian dan kebudayaan Simalungun kepada para generasi muda agar kedua bidang ini tetap terjaga dengan baik.

“Kesenian dan kebudayaan daerah harus dilestariakan, karena kedua bidang ini merupakan kekayaan kita bahkan sebagai aset negara dan jika dikemas dengan baik tidak mustahil kesenian dan

Motivasi dan Nilai Juang Remaja/Pelajar, Pemuda Gereja GKPS se-Distrik II SIMALUNGUIN, BN Bupati Simalungun DR JR Saragih SH MM memberikan motivasi dan nilai juang remaja/ pelajar, pemuda gereja saat menghadiri kegiatan pembinaan remaja/pemuda se-GKPS distrik II sekaligus menjadi juru bicara yang dipusatkan di Aula Griya Hapoltakan Pamatang Raya, Minggu, 06/05/2012. Dihadapan para remaja/pemuda yang berjumlah sekitar 2.000-an orang berasal dari para pejar SMP dan SMA/SMK mengatakan, dalam menentukan cita-cita yang akan diraih dimasa depan harus ada motivasi dan nilai juang dalam diri. “Ini harus kita tanamkan dalam diri kita sehingga terpacu untuk meraih cita-cita yang akan dicapai”, katanya. Untuk meraih semua itu, Bupati mengatakan, seorang harus tekun belajar dalam rangka menambah wawasan ilmu pengetahuan, bekerja keras dan tentunya dibarengi dengan ibadah kepada Tuhan Yang Maha Esa, sehingga apa yang diperoleh dapat bermanfaat bagi orang banyak. “Jjika ditanya adik-adik ini tentang motivasi dan cita-citanya tentu jawabannya akan berbedabeda. Namun yang perlu diketahui bahwa jika kita bercita-cita menjadi Dokter, Tentara, Guru ataupun yang lainnya, pertama-tama yang perlu kita ketahui yakni apa tugas dari masing-masing pekerjaaan yang akan kita geluti. Tentang citacita dan motivasi dalam memilih pekerjaan yang dimintai, tentu adik-adik ini juga memiliki jawaban yang berbeda-beda. Oleh karenanya saya himbau kepada adik-adik sekalian ketika kamu memiliki cita-cita, diharapkan motivasi tersebut berasal dari hati sendiri bukan motivasi dari orang lain”, ungkap Bupati. Disamping memberikan arahan kepada para remaja/pelajar dan pemuda, Bupati juga memutar film tentang bio data dan oto biagrafinya melalui slide. Menurutnya, pemutaran film tersebut bertujuan untuk memberikan dorongan bagi para remaja/pelajar dan pemuda untuk lebih termotivasi dalam menentukan masa depan mereka. Didalam arahannya, Bupati juga melukan dialog langsung dengan peserta, terutama difokuskan motivasi apa untuk

mendorong para peserta dalam meraih masa depan yang lebih baik. Pada dialog tersebut para peserta secara apa adanya memberikan jawaban saat ditanya oleh Bupati. Seperti Chatrine SL Damanik pelajar SMA Negeri 5 Pematangsiantar ini bercita-cita menjadi Komando Wanita Angkatan Darat (KOWAD) dan Ardian Immanuel Damanik yang menginginkan melanjutkan sekolah di STPDN (Sekolah Tinggi Pemerintah Dalam Negeri). Mendengar keinginan kedua anak ini, Bupati memberikan apresiasi dan bersedia membantu untuk mengabul keinginan dan cita-cita kedua anak tersebut. Lain lagi dengan Novita Sari Simambela yang masih duduk di SMA Plus Partuha Maujana Simalungun dan Hotrasari Saragih yang masih di bangku SMP. Mereka keduanya adalah anak yatim piatu dan mempunyai keinginan bersekolah yang tinggi. Melihat keduanya dan mendengar keinginan mereka, DR JR Saragih SH MM yang mantan periwira tinggi ini, bersedia memberikan bea siswa dan mengangkat mereka menjadi anak asuhnya. Dalam mengakhiri arahannya Bupati Simalungun memberikan beberapa pesan untuk dijadikan motivasi begi para peserta antara lain, jika mempunyai cita-cita maka gantungkanlah motivasimu dengan sebaik-baiknya dan berjuanglah dengan penuh keikhlasan. Sebagai rasa berterima kasih kepada DR JR saragih SH MM yang telah memberikan dorongan bagi para pelajar/pemuda, Panitia meberikan kenang-kengan kepadanya sebuah foto DR JR Saragih SH MM dengan istrinya yang bertuliskan “Dibalik laki-laki yang hebat, selalu ada wanita yang bijaksana”. Sebelumnya kegiatan pembinaan remaja/ pemuda se-GKPS distrik II, dilaksanakan ibadah minggu yang dipimpin oleh Pdt Marlan Damanik STh, sebagai votum Sy Jan Sudarman Purba STh. Dalam ibadah minggu ini menampilkan paduan suara anak-anak GKPS se-Kecamatan Raya. Tampak hadir dalam kesempatan tersebut, Plt Sekda Drs Gidion Purba bersama beberapa pejabat dijararan pemkab Simalungun. (ps-01)

Kebudayaan dapat mengangkat harkat dan martabat Simalungun itu sendiri. Kesenian dan kebidayaan juga merupakan sejarah bagi kita”, ungkap JR Saragih sebari mengucapkan terima kasih kepada DPC Kota Tebing

Tinggi yang telah menerbitkan buku tentang sejarah perkembangan Simalungun di kota itu, karena hal ini telah mengingatkan kita tentang sejarah. Untuk mengembangkan kesenian dan kebudayaan, disamping sebagai ketua umum DPP PMS, DR JR Saragih SH MM juga sebagai Bupati Simalungun mengharapkan agar ciri khas Simalungun ada disetiap gedung-gedung instansi pemerintah maupun swasta yang ada di daerah ini seperti ukiran-ukiran (uhir) Simalungun maupun bentuk bangunannya, sekaligus memerintahkan Plt Sekda agar hal ini segera dibuat Peraturan Daerahnya (Perda). Sementara itu, perwakilan dari keturunan Raja Marpitu Drs Kamen Purba memberikan apresiasi yang tinggi kepada Bupati Simalungun DR JR Saragih SH MM yang telah peduli akan sejarah dan kesenian serta kebudayaan Simalungun. Untuk itu, Kamen mengajak kepada turunan Raja Marpitu untuk bersama-sama memberikan dukungan atas kebijakankebijakan Pemerintah dalam membangun dan meningkatkan kesejahteraan masyarakat Kabupate Simalungun. Sebelumnya, Sekretaris Umum DPP PMS Pardi Purba SE dalam laporannya antara lain memaparkan

tentang fungsi Kentor DPP PMS. Pardi mengatakan selain sebagai kantor sekeretariat juga akan dijadikan sebagai sarana pengembangan kesenian dan kebudayaan Simalungun. “Kita mau melalui kantor ini dapat terbentuk keluarga besar Simalungun untuk membangun daerah ini secara bersama-sama dan kita menginginkan Simalungun kedepan menjadi tuan dinegeri sendiri.Artinya kita bukan bermusuhan dengan etnis lain yang ada di daerah ini, tetapi kita mau menjadi satu kesatuan secara keselurahan, intinya Simalungun itu bukan hanya sekedar merek tetapi ada dan mari kita saling menghargai dan saling menganyomi, sehingga kita dapat maju bersama”, tandasnya. Turut memberikan kata sambutan dalam acara tersebut, perwakilan DPC PMS Jarniden Purba, tokoh masyarakat Sarmedi Purba dan Janipoh Purba, Majelis Hapartuahon Nabolon (MHN) dr Valentino Girsang dan H Nikmat Saragih. Acara tersebut ditutup dengan do’a yang dipimpin oleh Jonam Purba Dasuha yang dilanjutkan dengan makan siang bersama. Namun sebelum makan siang panitia memberikan makanan khas Simalungun kepada Bupati Simalungun, perwakilan turunan Raja Marpitu, tokoh masyarakat dan perwakilan DPC.(ps-01)

Warga GKPS Diharakan Dapat Menjadi Corong Pembangunan SIMALUNGUIN, BN Bupati Simalungun DR JR Saragih SH MM mengharapkan kepada warga GKPS (Gereja Kristen Protestan Simalungun) agar dapat menjadi corong pembangunan dan memberikan pencerahan bagi jemaatnya. Harapan tersebut di sampaikan Bupati dihadapan warga GKPS dalam sambutannya, saat meresmikan rumah Parases GKPS Distrik II yang beralamat di Pamatang Raya, yang ditandai dengan pengguntingan pita oleh Bupati dan pembukaan pintu oleh Ephorus GKPS Ptd Jaharianson Saragih STh MSc PhD disaksikan oleh Plt Sekda Drs Gidion Purba, Senin, 07/05/2012. “Saya melihat ada yang menarik dari gedung ini. Jika dipandang dari luar mirip rumah dinas Sekda dan didalamya kamar mandi tidak didalam kamar, melaikan berada diluar kamar. Ini menandakan Praeses siap untuk melayani dan bukan dilayani”, kata Bupati. Oleh karena itu, Bupati berharap rumah ini dapat dijadikan sebagai sarana untuk pelayanan bagi warga

GKPS dan dapat berfungsi dengan sebaik-baiknya. Kepada panitia diharapkan agar rumah Praeses dberi ornamen Simalungun, sehingga seni budaya Simalungun itu juga terlihat. “jaga dan rawatlah dengan baik rumah ini, sehingga dapat lebih bermanfaat”, tambahnya Diakhir sambutannya Bupati berharap kepada Praeses dan warga GKPS untuk mendo’akan Pemerintah Kabupaten Simalungun dan aparatnya agar selalu dalam keadaan sehat, sehingga dapat melaksanakan program pembanguann di daerah ini dalam menuju Simalungun yang lebih baik. Sementara itu, Ephorus GKPS Ptd Jaharianson Saragih STh MSi dalam sambutannya mengucapkan terima kasih kepada Pemerintah Kabupaten Simalungun yang telah membantu pembangunan rumah pelayanan ini. “Dalam kurun waktu sekitar 12 tahun kami sangat mengharapkan adanya rumah dinas Praeses di Distrik II, tapi ternyata baru saat ini terwujud, oleh karena itu terimakasih kepada Bupati dan Pemerintah Kabupaten Simalungun dan diharapkan segeralah tempat rumah

ini”, ungkapnya.Sebelumnya, Ir Jhon Sabiden Purba MUM selaku ketua panitia didamping Drs Jan Sardiaman Sinurat melaporkan proses pembangunan rumah Praeses Distrik II GKPS. Dia menyampaikan bahwa, dana untuk pembangunan rumah tersebut merupakan hibah dari Pemerintah Kabupaten Simalungun. Rumah tersebut seluas 200 M² dilengkapi dengan fasilitas pendukung seperti ruang tamu, ruang keluarga, 4 ruang tidur, MCK, penerangan dan garasi serta pagar rumah. Peresmian Rumah Praeses Distrik II GKPS tersebut sebelumnya juga diawali dengan kebaktian yang dipimpin langsung oleh Ephorus. Dikesempatan tersebut juga, Ephorus didampingi Praeses Distrik II GKPS Pdt Marlan Damanik STh, Ir Jhon Sabiden Purba MUM dan ketua pembangunan memberikan ulos kepada Bupati Simalungun. Tampak hadir dalam acara tersebut, para pejabat dijajaran Pemkab Simalungun, para pendeta se-Distrik II GKPS, Camat Raya, masyarakat dan pelajar SMA GKPS kecamatan Raya.. (ps-01)

Bupati, Polres dan Komisi IV DPRD Simalungun Tinjau Pelaksanaan UN di SD Negeri No. 091317 Pamatang Raya

Peserta UN di Kab. Simalungun Sebanyak 18.589 Siswa SIMALUNGUIN, BN Bupati Simalungun DR JR Saragih SH MM bersama Kapolres Simalungun AKBPAgus Fajar SIK, Komisi IV DPRD Simalungun Sulaiman Sinaga dan Walpiden Tampubolon ST serta Kadis pendidikan Resman H saragih SSos, meninjau pelaksanaan UN (Ujian Nasional) di SD Negeri Nomor 091317 Pamatang Raya, Senin (23/4). Dalam kesempatan tersebut Bupati mengharapkan pelaksanaan UN untuk tingkat SD dapat berjalan dengan tertib, aman dan lancar serta semua peserta UN dapat menerima lembar soal ujian dan Lembar Jawaban Komputer (L J K). Kepada Kepala Sekolah untuk berperan aktif mensukseskan wajib belajar 9 tahun, karena itu sudah kewajiban kita untuk mensuseskan program pemerintah wajib belajar 9 tahun. Menyinggung tentang kelulusan peserta UN pada tahun yang lalu, Kadis Pendidikan Resman H Sinaga mengatakan, untuk tahun pelajaran yang lalu peserta ujian tingakt SD di kabupaten Simalungun lulus 100 % dan yang tidak lulus dikarenakan tidak mengikuti UN. Untuk tahun ini Resman mengatakan semua peserta UN di kabupaten Simalungun diharapkan dapat lulus semua.

Sementara itu Kabid Dikdas (Kepala bidang Pendidikan Dasar) sekaligus ketua penyelenggara UN Drs Wasin Sinaga MH yang turut mendampingi Bupati dan rombongan meninjau pelaksanaan UN mengatakan bahwa, untuk tahun pelajaran 2011/2012 peserta UN tingakt SD (Sekolah Dasar) sebanyak 18.589 orang, yang terdiri dari SD Negeri sebanyak 16.482 orang yang berasal dari 783 sekolah, SD swasta sebanyak 1.234 orang yang berasal dari 41 sekolah, jumlah seluruhnya peserta UN SD Negeri dan Swasta sebanyak 17.716 orang. Untuk Madrasah Ibtidaiyah Negeri (MIN) peserta

UN sebanyak 142 orang yang berasal dari 4 sekolah, Madrasah Ibtidaiyah Swasta (MIS) sebanyak 731 orang yang berasal dari 32 sekolah. Jumlah seluruhnya peserta UN MIN/MIS sebanyak 873 orang Menurut Wasin, naskah soal ujian tiba di Disdik (Dinas Pendidikan) Kabupaten Simalungun dan mendapat pengawalan petugas Disdik Provinsi Sumatera dan dari Kepolisian Daerah Sumatera Utara yang diterima langsung oleh ketua penyelenggara UN, yang selanjutnya di distribusikan ke ketua sub rayon yang juga mendapat pengawalan dari petugas keamanan dari Polsek.(ps-01)

LINTAS SUMATERA - LINTAS SUMATERA - LINTAS SUMATERA - LINTAS SUMATERA - LINTAS SUMATERA - LINTAS SUMATERA

Pemkab Aceh Utara Diminta Tindak PNS yang Main Batu Jam Kerja ACEH UTARA, BN Sejumlah kalangan mendesak pemerintah kabupaten aceh utara merazia pegawai negeri sipil (PNS) didaerah ini yang asik main batu pada saat jam dinas kantor. Pasalnya hamper setiap hari pada jam kerja dengan menggunakan pakaian dinas beberapa oknum PNS lebih memilih main batu dikantin-kantin atau pohon kayu yang rindang di seputaran kantor dinas yang berlokasi gedung Hibbah Exxon Mobil / Landeng Lhokseukon ketimbang melayani masyarakat. Ketua LSM Aceh Fiture Razali pada bongkar news, PNS yang main batu pada saat jam kerja dengan berseragam dinas dapat ditemukan dengan mudah mulai dari kawasan perkantoran maupun di warungwarung banyak sekali yang main batu pada saat jam kerja. Celakanya lagi mereka memakai seragam dinas sehingga ketahuan sebagai PNS yang seharusnya menjadi contoh yang baik sebagai abdi Negara, LSM Fiture juga mendesak PEMKAB Aceh Utara menggelar razia terhadap PNS yang main batu pada saat jam kerja, kemudian diberi sangsi yang tegas kalau perlu dijemur, mengingat perbuatan mereka mencoreng nama baik pemerintah apalagi mereka di gaji dengan uang rakyat. Hasil temuan Media Bongkar News, PNS yang main batu antara lain di kalagan dinas, pekerjaan umum, dinas kebersihan dan lain sebagainya. Para oknum ini terperogok dengan wartawan lagi asik main batu di bawah pohon dan di kantin-kantin yang ada di seputaran perkantoran tersebut. (RAMSAY)

SDN 10 dan SDN 1 Tanah Jambo Aye, Ikut Ambil Bagian Memperebutkan Piala Danon Nations Cup Banda Aceh ACEH UTARA, BN Sebuah kebangga nmemang, Maimun SPd, guru olahraga SDN 10 Tanah Jambo Aye kali ini seharusnya mendapat kehormatan dari sekolah UPTD Tanah Jambo Aye untuk membawa dua tim usia dini. Masingmasing SDN 10 Tanah Jambo Aye dan SDN 1 Tanah Jambo Aye. Kedua tim ini telah dipersiapkan untuk berlaga memperebutkan piala Danon Nations Cup yang dijadwalkan pada 19-20 Mei ini di Stadion Harapan Bangsa Lhong Raya Banda Aceh. Apakah cita-cita anak-anak usia dini ini mampukah membawa nama baik sekolah dan kecamatannya ke ajang paling bergengsi. “Ini kita lihat nanti,” kata Maimun kepada Bongkar (11/5). “Yang penting kita telah berusaha untuk ikut dan saya punya keyakinan bahwa mereka mampu, itulah sebabnya saya sangat terderong untuk membawa mereka bertarung di sana. Sebelumnya anak-anak Jambo Aye ini juga pernah

mengikuti prestasi gemilang di Jawa. Yaitu ketika tim Patriot diunggulkan melawan team-team tangguh di Jawa. “Dan rasanya hal yang sama mungkin akan kembali terulang di Stadion Harapan Bangsal,” ucap Maimun. Menurut Maimun, dua tim yang dibawanya ini hasil seleksi paling ketat, bukan asal ikut. “Yang jelas kita lihat nanti bagaimana masingmasing tim ini mempertunjukan kebolehannya. Dalam hal ini meski tidak menanggelora semangat kebanggaan sudah ada, yaitu dipercaya untuk mewakili kecamatan jika mereka sanggup membawa pulang kemenangan. “Itulah harapan kita, jika tidak menang juga masih pantas. Karena baru kali ini mereka berlaga di luar kandang. Mereka memang menjadi harapan kita semua, untuk itu saya harapkan doa semua pihak agar mereka dapat sukses,” pintanya.(RAMSAY)

Kontingen O2SN Kecamatan Bukit Batu di Lepas Camat Bukit Batu Mengikuti Pertandingan Dalam Rangka Hardiknas

Kontingen O2SN Bukit Batu Raih Medali BENGKALIS,BN Kontingen O2SN tingkat SD mewakili SDN Sekecamatan Bukit Batu mengikuti 9 cabang Olahraga dalam rangka Hardiknas Kabupaten Bengkalis pada pertandingan yang di gelar mulai (tanggal 26/4 s/d 28/4) Kontingen Kecamatan Bukit Batu berhasil Raih Piala Emas. Perak dan Perunggu yang bertarung mengikuti 9 cabang Olahraga. Ketua panitia Kontingen O2SN Kecamatan Bukit Batu Muhammad Yasan Spd pada BN mengatakan, peserta Kontingen O2SN tingkat SD SeKecamatan Bukit Batu yang di berangkatkan Camat Bukit Batu mengikuti Pertandingan Olahraga dalam rangka Hardinas tahun 2012 ini hasilnya cukup

menggembirakan dan membawa nama harum Kecamatan Bukit Batu. Dimana bahwa Kontingen O2SN mewakili SD Sekecamatan Bukit Batu sukses mengukir kemenangan cukup membanggakan sukses mengikuti pertandingan 9 Cabang Olahraga sebut M. Yasan Spd. keterangan di rangkum BN bahwa peserta Kontingen DARI Bukit Batu sebanyak 38 Orang sedangkan jumlah Official 9 orang ujar Ketua Tim Kontingen , Aju Sopiyan Spd. di katakannya Cabang Olahraga yang di ikuti yakni: Atletik,Sepak Bola, Takraw, Volly Ball, Catur, Silat, Karate, Tenis Meja dan Bulu Tangkis. Pada pertandingan 9 Cabang Olahraga

ini Kontingen O2SN Sekecamatan Bukit Batu berhasil sukses meraih Piala 2 Emas, 4 Perak dan 4 Perunggu, perolehan 2 piala Emas dari cabang olahraga Atletik dan Bulu Tangkis Putra , sedangkan perolehan Perak di raih dari cabang Olahraga Takraw dan piala Perunggu dari Cabang Olahraga Karate, Sepak Bola dan Tenis Meja. Juara mendapat Emas atas nama Kevin Philip SDN 2 Sei Pakning dan Wahyu dari SDN 16 Tenggayun Bukit Batu, Piala Perak atas nama Fahru Siyani dari SDN 2 Sei Pakning Perunggu atas nama Rian Syah Putra dari SDN 2 Sei Pakning dan atas nama Tata Anugrah dari SDN 2 Sei Pakning, dan Piala Perak atas nama Weslen dari SD YKPP Sei Pakning. (RDS/Ritonga)


14 - 21 MEI 2012 | EDISI 315 | THN KE-VII

Anggota DPR RI Sempatkan Kunjungi Kader Partai Golkar Atam Nomor Lampiran Perihal

: 62/JG/PHB/IV/2012 : 1 (satu) berkas. : Hak Jawab (I) Berdasarkan UU RI Nomor 40 Tahun 1999 Tentang Pers

Gebang tgl, 24 April 2012.-

Kepada Yth, Saudara Pemimpin Redaksi/Penanggungjawab Media Bongkar News Jalan Flamboyan Raya/Raharja No. 30 Medn Telp/Fax (061) 821 3786-821 5552 Email : - HP 08163134392/081375395392 di MEDAN Saudara Pemimpin Redaksi/Penanggungjawab Yang Terhormat, A. Mempedomani bunyi Undang-Undang Republik Indonesia Nomor 40 Tahun 1999 tentang Pers, sebagaimana tertuang di dalam Bab I "Ketentuan Umum" Pasal (1) butir 11, 12 dan 13. Kemudian Bab II Tentang "Azas-Fungsi-Hak-Kewajiban dan Peranan Pers". Sebagaimana tertuang di dalam Pasal (5) butir 2 dan 3. Berikut Bab VII Tentang "Peran Serta Masyarakat" sesuai bunyi Pasal (17) butir 2 alinea (a) dan (b). B. Memperhatikan berita Media Bongkar News terbitan Senin 23-30 April 2012. Edisi ke 312 Tahun ke VII (tujuh)/2012. Sebagaimana dimuat di halaman 7 (tujuh) kolom 3, 4 dan 5, Sub Judul/judul 10 Tahun Bertugas Tanpa Mutasi "Jembatan Timbang Gerbang Diduga Sarang Korupsi", kode/penulis berita (Tim). C.Ringkasan Pokok BAHASAN : 1. Bahwa "penulis berita" mengatasnamakan keresahan pengusaha truk, menyoroti dan mengkritisi Kinerja/konditie Kepala/Wakil Kepala Jembatan Timbang Gerbang Langkat, di antaranya : a. Menuduh, Kepala/Wakil Kepala Jembatan Timbang Gerbang Langkat membuat aturan sendiri. b. Memvonis petugas UPPKB Gerbang berbuat semena-mena, dengan cara "memerintahkan truk harus memasuki jembatan timbang" dan melakukan penekanan/mewajibkannya 'agar membayar mahal'? c. Menuduh serta menyimpulkan mekanisme UPPKB Gerbang mengaut 'ala kerjaan', termasuk perilaku 'Pimpinannya bagaikan diktator'. (Persilahkan saudara Pemred/Penjab yang terhormat melakukan analisis/baca ulang tentang paparan kofy berita terlampir). 2.Bahwa "penulis berita' untuk memperhatahankan 'opininya' pada butir (1) di atas, "berdalih" atas keterangan sumber, kemudian seterusnya : a.Memfitnah Waka UPPKB seakan bertindak arogan, dengan cara memindahkan Kepala Regu disebutnya bernama "Rusli Bintang"? Maksudnya karena Rusli Bintang tidak patuh kepada Waka UPPKB? b.Dan sejumlah tudingan yang mengarah kepada pelecehan terhadap individu personal maupun institusi, tidak mungkin kami paparkan secara lengkap dalam surat bantahan ini. (Hanya kami persilahkan saudara Pemred/Penjab yang terhomrmat, untuk melakukan analisis/baca ulang tentang pemaparan kofy berita terlampir). Ringkasan ANALISA : Saudara Pemimpin Umum/Pemimpin Redaksi Yang Terhormat, Membaca penulisan berita wartawan SK MINGGUAN "BONGKAR" (pengguna kode 'Tim') perhatikan cuplikan singkat yang kami kemukakan sebahagian di antaranya pada butir (1) alinea a, b, dan c, termasuk bunyi butir (2) alinea a, b, di paragraf 'Ringkasan Pokok Bahasan'. Penilaian kami terhadap 'penulis berita', terlalu 'bombastis menyimpulkan' : a.'Kepala/Wakil Kepala Jembatan Timbang Gebang Langkat membuat aturan sendiri'. b.'Petugas UPPKB Gebang berbuat semena-mena, dengan cara memerintahkan truk harus memasuki jembatan timbang' dan mewajibkannya 'agar membayar mahal'? c.Mekanisme UPPKB Gebang menganut 'ala kerjaan', serta menyamakan perilaku "Pimpinanya bagaikan diktator'? d.Waka UPPKB seakan bertidak arogan, dengan cara memindahkan Kepala Regu 'Rusli Bintang'? karena Rusli Bintang, tidak patuh kepada Waka UPPKB? e.Sejumlah tudingan (sebagaimana bunyi pada kofy berita terlampir), orientasinya mengarah kepada pelecehan terhadap individu personal maupun institusi Dinas Perhubungan secara keseluruhan . (Dan sejumlah pelecehan lainnya yang tidak memungkinkan, untuk kami paparkan secara mendetail di dalam surat bantahan ini. (Terkecuali dengan segala hormat, kami persilahkan saudara Pemred/Penjab untuk melakukan analisis/baca ulang tentang paparan kofy berita telampir). 1.Bahwa penilaian kami terhadap 'Tim' (penulis kofy berita terlampir), dalam menjalankan 'tugas pokok dan fungsinya sebagai seorang wartawan', (terutama dalam hal penyampaian laporan/tulisan yang berhubungan dengan karya jurnalistik), jelas tidak mengedepankan kejujuran. Temasuk tidak memahami, betapa urgentnya tentang penelitian 'kebenaran sesuatu informasi atau keterangan', sebelum menyampaikan berita tersebut kepada public. Atau dengan kata lain, 'Tim' sebagai wartawan tidak mampu mempertahankan tentang 'kredibilitas sumber berita' yang bersangkutan. 2.Bahwa penilaian kami berikutnya khusus untuk hal tersebut di atas, 'Tim" (sebagai penulis kofy berita terlampir), dalam menjalankan 'tugas pokok dan fungsinya sebagai seorang wartawan', (terutama mengenai pelaporan/tulisan yang berhubungan dengan karya jurnalistik), layaknya tidak memiliki kemampuan membedakan antara 'fakta dan opini'. Akhirnya terjadi penulisan berita yang mencampur-baurkan 'peristiwa dengan pendapat' atau antara fakta dan opini. 3.Bahwa penilaian kami terhadap 'Tim" (sebagai penulis kofy berita terlampir), dalam ulasannya yang terkait 'opini' (pendapat) berhubungan dengan 'peristiwa' (by line story), sebaliknya mampu bersikap 'objektif, jujur, sprotif. Artinya mengutamakan landasan kebebasan yang bertanggungjawab, dengan upaya maksimal. Guna menghindarkan diri dari mekanisme penulisan berita yang berisikan tuduhan, namun tidka memiliki landasan fakta (hanya desasdesus), yang orientasinya menyebar fitnah, termasuk pemutarbalikan fakta dari peristiwa sebenarnya. Kemudian berupaya menghindarkan diri ke penulisan berita yang bersifat pelanggaran kehidupan pribadi (privacy), sensasional, immoral atau bertendensi pelecehan rasa kesusilaan. 4.Bahwa kami menulis 'Tim' (sebagai penulis kofy berita terlampir), tidak memiliki kemampuan mewujudkan informasi sebagai pemberitaan yang objektif, actual tajam dan terpecaya. Atau kurang memahami dan memperhatikan betapa pentingnya konfirmasi untuk menegakkan sebuah kebenaran dan keadilan . demi terwujudnya 'berita yang berimbang', alias tidak berpuas diri dengan keterangan sepihak. 5.Bahwa penilaian kami terhadap 'Tim" (sebagai penulis kofy berita terlampir), secara realita tidak mampu untuk memahami dan membedakan antara 'Pejabat pembuat keputusan' dengan 'Aparatur yang menjalankan putusan dimaksud'. Khususnya tentang Peraturan Daerah (Perda) yang memberlakukan terhadap 'kendaraan bermotor pengangkutan barang', di wajibkan memasuki jembatan timbang. (Tegasnya aparatur yang ditugaskan di UPPKB Gebang dimaksud, diperintahkan untuk melakukan pengawasan/pengendalian terhadap berbagai jenis kendaraan bermotor pengangkutan barang. Serta merta menjalankan sanksi terhadap kendaraan bermotor pengangkut barang tersebut sesuai tingkat pelanggarannya, berdasarkan Perda yang diterbitkan Pemerintah Provinsi Sumatera Utara dalam hal ini 'Gubernur'. 6.Bahwa memperhatikan hasil peliputan 'Tim' (sebagai penulis kofy berita terlampir), yang mendiskreditkan 'aparat (petugas) termasuk Kepal/Wakil Kepala UPPKB yang ditudingnya, mewajibkan kendaraan bermotor pengangkut barang agar masuk ke jembatan Timbang Gebang. Seyogianya bukanlah atas kepentingan individu personal, sebagaimana disimpulkan 'Tim' (sebagai penulis kofy berita terlampir). 7.Bahwa penilaian dan kesimpulan kami, wartawan 'Tim' (sebagai penulis kofy berita terlampir), jelas tidak memiliki wawasan tentang 'Tugas Pokok dan Fungsi' yang diberlakukan kepada satuan tugas di UPPKB Wilayah I Dinas Perhubungan Provinsi Sumatera Utara, khususnya (Jembatan Timbang Gebang Langkat). Demikian juga yang berkaitan dengan berbagai kewenangan antara Kepala maupun Wakil Kepala. Sementara tugas di antara kedua peringkat jabatan yang berbeda tersebut diatur sedemikian rupa, khususnya di kalangan internal institusi Dinas Perhubungan yang membidangi permasalahan teknis. 8.Bahwa pertimbangan kami lainnya yang meragukan "keobjektiban" berita dimaksud, 'Tim" selaku wartawan ketika mengangkat identitas salah seorang 'Kepala Regu UPPKB Jembatan Timbang Gebang (Rusli Bintang), yang ditudingnya terkena mutasi karena ketidak patuhannya memberikan setoran kepada Huseini'? Tegasnya nama dimaksud, tidak pernah ada atau tercatat menjadi petugas di UPPKB Jembatan Timbang Gebang. Sehingga realita tersebut memperlihatkan suaru pembuktian, 'Tim' (sebagai penulis kofy berita terlampir), tidak menguasai permasalahan di sa'at membuat tulisan bersifat kritikan (social control). Dan untuk melengkapi berita tersebut, bukan UPPKB Gebang Langkat. 9.Bahwa untuk keakuratan sebuah tulisan 'Tim' (sebagai penulis kofy berita terlampir), tampak dominasi "sifat egois serta imaginasinya sendiri", yang kemudian berbaur dengan aneka ragam kabar burung, sementara legalitas kebenarannya masih mengambang, alias sulit mempertanggungjawabkan. Artinya 'Tim' (sebagai penulis kofy berita terlampir), secara bersahaja melalaikan 'chek and rechek' (konfirmasi) ke bagian objektifitas berita terpenting, atau nara sumber yang dipandang lebih konkrit untuk hal tersebut. (persilahkan dengan segala hormat, saudara Pemred/Penjab mentela'ah beberapa cuplikan singkat yang kami kemukakan terdahulu pada butir (1) aliena 'a, b, c') yo bunyi butir 2 dan seterusnya di paragraph (C) 'RIngkasan Pokok Bahasan' termasuk (D) 'Ringkasan Analisa'. E. Ringkasan SANGGAHAN dan PEJELASAN : a.Bahwa dengan landasan bunyi Undang-undang Republik Indonesia Nomor 40 Tahun 1999 tentang Pers ". Atau sebagaimana tertuang di dalam Bab II menyangkut "Azas-Fungsi-Hak-Kewajiban dan Peranan Pers", yang dipaparkan dengan jelas di Pasal (5) butir 2 dan 3. Serta ringkasan "POKOK BAHASAN" maupun "ANALISA" sebagaimana yang kami kemukakan terdahulu di paragraph 'C' dan 'D', masing-masing butir 1 hingga 3. 1.Bahwa sangat kami tegaskan kepada saudara Pemimpin Redaksi/Penanggungjawab yang terhormat, (Khusus menyangkut kofy berita terlampir). Bahwa penulis berita sepertinya belum mampu mengedepankan profesinya sesuai misi media cetak, sebagai alat sosial control dan pencerdasan bangsa. Hal dimaksud, terbukti dengan dangkalnya pemahaman "penulis berita" tentang tupoksi, di antara kewewenangan Kepala dan Wakil Kepala di UPPKB maupun Kepala Regu Satuan Tugas, para aparatur Dinas Perhubungan Provinsi Sumatera Utara di UPPKB (Jembatan Timbang Gebang Langkat), termasuk berbagai paying hukum tentang pelaksanaanya. 2.Bahwa di bahagian lainnya, pemberita bersahaja mengangkat tulisan terlampir tanpa mempedomani "Mempedomani bunyai Undang-Undang Republik Indonesia NOmor 40 Tahun 1999 Tentang Pers', sebagaimana tertuang di dalam Bab I "Ketentuan Umum" Pasal (1) butir (14) yang menegaskan, 'Kode Etik Jurnalistik merupakan himpunan etika profesi kewartawanan'. Sehingga tercermin karakter pemberitaan karena factor ketidak puasan dan penuh nada emosional, yang diduga berlatar belakang factor 'X'. Seyogianya sebagai wartawan professional, cenderung mengejar kelayakan penulisan agar masuk kategori "terakurat, actual, tajam dan terpercaya". Sebelum mengirimkan laporan/liputannya ke meja redaksi dan mempublikasikannya kepada pembaca atau khalayak ramai. Maksudnya terlebih dahulu melakukan "chek and rechek', atau konfirmasi ke objek berita yang menjadi isu terpanas maupun sedang dipergunjingkan segelintir anggota masyarakat. Kesimpulan setelah melakukan pengkajian secara berulang-ulang, serta menyikapi ketidak objektiban tentang penulisan berita dimaksud, termasuk tudingan tersebut di atas. Kami sebagai Wakil Kepala UPPKB Wilayah I Dishubsu (Pos Jembatan Timbang Gebang), memandang perlu untuk memberikan penjelasan dan melakukan klarifikasi atas kekeliruan berita yang bertendensi pelecehan dimaksud. Artinya, agar media yang menjadi sarana sosial kontrol tersebut, terhindar dari kategori pembohongan publik dan lebih dominan menjurus kepada pelecehan tanpa alas hukum. Termsuk fitnah yang disiarkan secara terbuka, karena cenderung menyalahgunakan profesi kewartawanan. Padahal persuratkabaran merupakan salah satu alat unutk menegakkan kebenaran dan keadilan, bukan sarana pelampiasan emosional karena keinginan individu tidak tercapai. Sementara profesi yang sangat mulia dan diagungkan masyarakat dunia tersebut, harus terlepas dari berbagai intervensi kepentingan pribadi melawan hukum. Demikian "Hak Jawab" ini kami sampaikan kepada saudara Pemimpin Redaksi/Penanggungjawab yang terhormat, dengan harapan dapat diterbitkan di persurat kabaran dimaksud sebagaimana mestinya berdasarkan bunyi Undang-Undang Republik Indonesia Nomor 40 Tahun 1999 Tentang Pers. Akhirulkalam sebelum maupun sesudahnya diucapkan terima kasih.

CC : -Kepada yang terhormat, institusi terkait dan berwenang di tempat. -Pertinggal.

BNI Griya Idaman Tawarkan Kredit Rumah Murah Guru Medan,BN Guna membantu masyarakat Sumatera Utara yang belum memiliki rumah, Bank Negara Indonesia (BNI) Medan bekerjasama dengan Real Estate Indonesia (REI) Sumut menawarkan kredit pemilikan rumah (KPR) BNI Griya Idaman dengan bunga flat sebesar 11% per tahun. CEO BNI Kanwil Medan, Achmad Miad Sentosa mengatakan, hingga saat ini BNI telah mencatat 250 nasabah yang telah mengajukan permohonan untuk memperoleh KPR. “BNI Griya Idaman dihadirkan untuk memenuhi harapan masyarakat Indonesia, khususnya Sumut yang berpenghasilan terbatas. Hunian ini disiapkan khususnya bagi pengajar dan tenaga

pengajar. Kita juga bekerjasama dengan Dinas Pendidikan Sumut,” ucapnya, kemarin, di Medan. Achmad menambahkan, program BNI Griya Idaman ini diadakan guna mendukung mendukung pemerintah sebelum diluncurkannya program Fasilitas Likuiditas Pembiayaan Perumahan (FLPP) dari pemerintah. “Perbedaan program ini dengan FLPP terlihat pada suku bunga kredit yang flat sebesar 11% per tahun. Sedangkan, bunga FLPP yang masih digodok yakni 7,25%,” katanya yang sering disapa Cecep. Ia menjelaskan, pemasaran dari program tersebut dilaksanakan sejak 20 Maret sampai 30 Juni 2012, sedangkan realisasi booking pada 31 Juli. Plafon kreditnya,

katanya, minimal Rp 50 juta sampai Rp 150 juta untuk rumah tipe 36. Pembiayaan yang dilakukan bank 90% dari nilai jaminan dan tenor 10 tahun sampai 20 tahun. “Jumlah unit belum bisa dipastikan dan masih diinventarisir. Ini kerja sama dengan REI. Soal letak yakni kawasan juga diserahkan ke REI,” ujarnya. Ia mengatakan, bunga yang berlaku yakni 11% selama lima tahun, setelah itu diserahkan ke pasar alias bunga suka-suka tergantung kemampuan. Guna merealisasikan program tersebut, akui Miad, pihaknya sudah bekerja sama dengan 121 developer di Sumut yang sudah menjadi anggota REI. “Karena baru diluncurkan, pemohonnya masih 250 orang nasabah,” ujarnya. (OB/INT)

Aceh Tamiang , BN Selain kunjungan kerja ke Tingkat I provinsi Aceh di Banda Aceh Drs.Marzuki Daud, kunjungi kader Golkar DPD Tingkat II Kabupaten Aceh Tamiang Jum'at kemaren (11/5), guna silaturahmi kepada segenap kader golkar serta mendukung penuh keikut sertaan T.Yusni dan Ismail dalam pemilukada Bupati/Wabup Aceh Tamiang periode 2012-2017 yang akan datang. Kunjungan anggota DPR RI yang merupakan anggota komisi VI bidang

Perikanan,Kelautan dan Pertanian pada pertemuan di Kantor Sekretariat Partai Golkar , mengajak serta memberikan motivasi serta support kepada pasangan calon Bupati/Wabup melalui kader-kader yang ada di seluruh kecamatan yang ada di Aceh Tamiang untuk bekerja secara maksimal menuju pemenangan. Pada pertemuan tersebut Drs.Marzuki Daud juga membuka peluang bagi kaderkadernya untuk berkarya serta menampung program kerja partai golkar khususnya di bidang pendidikan sesuai jabatan

beliau di pengurus Dewan Pimpinan Pusat (DPP) Partai Golkar. Akhir dari kunjungan Marzuki pun di barengi berjabat tangan erat kepada pasangan calon Bupati/Wabup T.Yusni dan Ismail seakan-akan kebahagian pada pertemuan itu menunjukan rasa kekeluargaan, kedekatan serta keramah tamahan yang tak terlupakan, namun waktu juga yang menentukan beliau untuk melanjutkan perjalanannya menuju kota Banda Aceh untuk melaksanakan kunjungan kerja DPR RI sebagai wakil rakyat.(Indra)

Demi Mengharumkan Nama Daerah

Persati Atam Siap Bertarung di Putaran IV Aceh Tamiang , BN Penyisihan Group I Sumbagut Divisi I PSSI 2012 sudah menyelesaikan 20 partai pertandingan,Kesebelasan PSAU Aceh Utara selaku tuan rumah lolos sebagai juara Group didampingi Persati Kualasimpang dari Kabupaten Aceh Tamiang sebagai Runner up siap berlaga di Putaran IV dengan 18 Kesebelasan lainnya. Kesebelasan Persati Kualasimpang lolos Ke putaran IV sebagai Runner up dengan 6 ( enam ) setelah di pertandingan terakhir .Rabu lalu.( 09-05 ) hanya bermain

Seri 0-0 alias Kacamata dengan Tuan rumah PSAU Aceh Utara dengan nilai 10 ( sepuluh ) dari 4 partai yang sudah di lalui ,sudah terlebih dahulu lolos sebagai juara Pool Penyisihan Group I Sumbagut Divisi III PSSI 2012 di Lapangan Alur Bili Lhok Sukon dengan Tempo sedang hingga 2x45 Menit Normal. Manajer TIM Persati, Idris Bardan. Pada Media menjelaskan keberhasilan ini tak terlepas dari usaha keras pemain, pelatih, official dan dukungan maupun Do'a masyarakat aceh tamiang yang sangat

menginginkan prestasi persepakbolaan Aceh Tamiang dapat berbicara di tingkat Propinsi maupun di kancah Tingkat Nasional,'ujarnya. Dia menambahkan pemain jangan lekas puas diri, tapi jadikan hasil sekarang ini menjadi motivasi untuk membangkitkan semangat menuju laga berikutnya, serta berbenah diri dalam menghadapi lawan-lawan tangguh di putaran IV Divisi III PSSI 2012 yang sudah di depan mata demi mengharumkan nama daerah Aceh Tamiang,'terangnya.(R1)

Bupati Hadiri Pelantikan Pengurus Parna Kab Batubara Batubara, BN Parna merupakan perkumpulan sosial yang diikat rasa persaudaraan dan hubungan silaturahmi serta meliputi sektor agama,etnis membuat kita menjadi satu untuk mencapai harapan. Hal itu dikatakan Penasehat Persadaan Raja Nai Ambaton (Parna) Boru,Bere dan Ibebere se-Indonesia,Letjend Purn Cornel Simbolon saat melantik Parna Kab Batubara periode Tahun 2012-2017,di Lapangan Indra Sakti,Indra Pura. Ketua panitia pengurus pelantikan mengatakan bahwa jumlah penduduk Kab Batubara keseluruhan sekitar 380 juta jiwa dan 17 ribu jiwa,berarti 15 persen dari jum-

lah penduduk Kab Batubara terdiri dari Parna,dengan jumlah yang besar ini tidak menutup kemungkinan putra parna bisa memimpin sumut bahkan indonesia,jelas Cornel Simbolon. Ditambakan Simbolon, untuk meraih cita-cita hendaknya seluruh keluarga parna harus selalu mendidik agama yang kuat serta moral dan ilmu pengetahuan pendidikan. Sementara itu Asmadinata Dalimunthe ketua panitia pelantikan pengurus parna Kab Batubara priode Tahun 20122017,mengatakan,tujuan dilaksanakan acara untuk melestarikan adat budaya suku batak serta mempererat tali silaturahmi dan mempersatukan marga parna di Kab Batu-

bara. Seterusnya Ketua Parna se-Indonesia Kolonel DP Nadeak melantik,Ketua Ir Riswan Simarmata MM,Wakil Ketua SM Simbolon,Sekretaris Betty Banuarea dan Bendahara Drs Sahala Nainggolan,untuk kepengurusan Parna Kab Batubara priode Tahun 2012-2017. Pelantikan Pengurus Parna berlangsung sangat meriah dan dihadiri Bupati Kab Batubara,H.OK Arya Zulkarnain beserta Nyonya Khadijah,Ketua umum Parna se-Indonesia Kolonel Purn DP Nadeak, Anggota DPR RI Anton Sihombing, Direktur Bisnis PT.Inalum Drs SS Sijabat dan Seluruh pengurus Parna se-Kab Batubara.(naryo)

Popda Kab Batubara Tahun 2012 Batubara, BN Seperti diketahui pelajar adalah cikal bakal penerus bangsa,ibarat bunga yang bakal mekar serta berkembang untuk menghiasi taman perlu diperhatikan dan dirawat dengan baik mulai dari Sekolah,Club,Pengcab,Koni hingga Pemerintahan. Demikian dikatakan Bupati OK Arya Zulkarnain SH,MM saat membuka pelaksanaan,Pekan Olahraga Pelajar Daerah (Popda) Kab Batubara Tahun 2012 di

Kwala Tanjung,Kec Sei.Suka,Selasa (8/5) Pekan Olahraga merupakan salah satu agenda untuk penyeleksian mengikuti Popda se-Sumatera Utara yang diadakan di Kab Mandailing Natal,pada pertengahan Juni 2012 dan merupakan wujud dari pelaksanaan UU RI No.3 Tahun 2005 tentang Sistem Keolahragaan Nasional, jelasnya. Siswa yang mengikuti kejuaraan harus menunjukkan kemampuannya agar meraih

prestasi yang maksimal untuk mengangkat harkat martabat daerah dan dapat menjalin silaturahmi serta integritas antar pelajar,jelas Bupati. Selanjutnya Bupati mengucapkan terima kasih kepada PT.Inalum yang telah memberikan bantuan sarana dan prasarana serta apresiasi kepada Disbudparpora dan Dinas Pendidikan Kab Batubara atas kesinergisan dalam mensukseskan menyelenggarakan Popda Tahun 2012.(naryo)

2012, KB Pria 49 Orang Medan, BN Sejak bulan Januari hingga Maret 2012 peserta program Keluarga Berencana (KB) pria atau Medis Oprasi Pria (MOP) di Sumatera Utara hanya 49 orang atau 3,51% persen. Jumlah tersebut masih jauh dari target peserta KB MOP yang harus dicapai sebesar 2960 orang pada tahun 2012 ini. “Kalau disetiap kabupaten/ Kota yang ada di Sumatera Ut-

ara bisa mendapatkan peserta MOP 10 orang setiap harinya,target program ini akan berhasil,” kata Kepala Seksi Advokasi Pergerakan dan Informasi (Adpin) Perwakilan Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN) Provinsi Sumut, Anthony SSos, kemarin. Tony menilai, selama ini kendala yang dihadapi dalam menyukseskan program KB

adalah kurangnya tenaga yang diperlukan untuk melakukan sosialisasi. Padahal, sosialisasi ini sangat penting mengingat saat ini kesadaran pria dalam ber KB sangat rendah. Ia mengatakan, saat ini perbandingan peserta KB wanita dan pria adalah 99 wanita dan 1 laki-laki. ”Selama ini yang terus melakukan KB adalah perempuan. Padahal, pria juga

harusnya turut mendukung program KB,” katanya. Untuk itu, dirinya terus mensosialisasikan kepada masyarakat akan pentingnya melaksanakan program KB. “Kita terus memberikan pemahaman bahwa program KB bukan hanya untuk kepentingan pemerintah,melainkan untuk keluarga itu sendiri agar kesejahteraan terjamin,” katanya. (DOER)

Menteri LH Tinjau Pemukiman Korban Angin Puting Beliung Dikunjungi Camat Kutalimbaru Kumuh di Belawan BELAWAN,BN Menteri Negara Lingkungan Hidup Prof.DR.Balthasar Kambuaya, MBA didampingi Walikota Medan Drs Rahudman Harahap MM beserta rombongan tiba di Belawan langsung disambut Camat Medan Belawan .Rencananya Menteri lingkungan hidup beserta rombongan akan meninjau kondisi pemukiman kumuh dan sejumlah pabrik yang ada di pesisir Belawan serta limbah impor besi beracun yang tertahan di BICT Pelabuhan Belawan. Hadir dalam kunjungan Menteri tersebut diantaranya anggota DPD RI Parlindungan Purba, Ketua DPRD Kota Medan Amirruddin, Camat Medan Belawan Andi S Harahap, Ketua Tim Penggerak PKK Kota Medan serta Lurah maupun para Kepling. Informasi, Menteri Lingkungan Hidup yang baru dikenal itu hadir sejak pagi serta berada di Medan Belawan selama 2 hari tak hanya guna mengecek ketat proses perizinan Analisa Mengenai Dampak Lingkungan (AMDAL) di kawasan Medan Utara yang bakal menuju pe-

mekaran menjadi Kotamadya Medan Utara tersebut melainkan juga melihat langsung 40 kontener impor limbah beracun yang ditahan di Pelabuhan Belawan Internasional Contener Terminal (BICT). Menurut aktivis LSM PHP Armen Tanjung, kehadiran Menteri ke Kota Belawan sangat diharapkan jangan hanya sekedar seremonial belaka, lebih dari itu masyarakat berharap agar sejumlah pelaku perusak lingkungan hidup diantaranya penimbunan lahan hutan mangrove disunglap jadi depo kontener, maupun jadi lokasi industri /pabrik agar segera ditindak tegas. Apalagi belakangan ini kawasan Belawan terancam tenggelam dilanda banjir Rob yang besar kemungkinan akibat kerusakan lingkungan pesisir hutan Mangrove maupun gencarnya pembuangan limbah pabrik ke laut sehingga mengancam punahnya habitat di laut, terbukti saat ini kalangan nelayan sudah kesulitan mencari ikan di pesisir Belawan bahkan sejumlah jenis ikan sudah menjadi langka, kata Armen.(dna/muzair)

Kutalimbaru,BN Angin puting beliung sekurangnya merusak empat rumah warga Desa Switrejo Kecamatan Kutalimbaru dan tiga rumah warga Desa Namorih Kecamatan Pancur Batu,pekan lalu. Tidak ada korban jiwa. Hasil pantauan di lapangan didapati di Desa Sawitrejo, Camat Kutalimbaru Drs Imanuel Bangkit Ginting bersama istri selaku Ketua TP PKK Kecamatan Kutalimbaru, Danramil-02 Kapten Arh Ibrahim, Kapolsek AKP Robinson Surbakti, SH meninjau lokasi bencana. Kerusakan rumah terparah di Desa Sawitrejo milik Jumadi (64), Suntoro (24), sedang rusak ringan rumah Parni (54), Rebin (74), warga Dusun 2. Menurut Camat Kuta limbaru, kepedulian Bupati Deli Serdang Drs H Amri Tambunan terhadap warga korban angin puting beiung cukup antusias. "Bupati melalui ajudannya menghubungi saya agar kerusakan bangunan rumah warga segera diperbaiki dengan gotongroyong. Saya sudah siap melaksanakan petunjuk bupati," kata Camat . Sedang Danramil-02/Kutalimbaru Kapten Arh Ibrahim ketika dikonfirmasi menyatakan, dia juga diperintahkan Komandan Kodim-00204/DS Letkol Arh Wawiek Dwinanto, S.Sos, S.IP agar segera mengatasi kesulitan korban angin puting beliung di Desa Sawitrejo. "Saya bersama anggota Ba Binsa Koramil-02 sejak pagi sudah melaksanakan perintah Dandim dan hingga detik ini tidak ada keluhan warga, malahan warga mengucapkan terimakasih pada Muspika", tukas Danramil-02. Warga Desa Namorih merasa salut karena ada partisipasi spontanitas baik dari Kepala Desa Namorih Timotius Ginting yang memberikan beras dan indo mie kepada para korban.(bako)


14-21 MEI 2012 | EDISI 315| THN KE-VII

Rapat Evaluasi PNPM MP Tapsel di Aula MAN 2 Padangsidimpuan Tapsel,BN Melalui rapat kordinasi evaluasi PNPM yang mana dilakukan rutin setiap bulan diharapkan mampu dapat meningkat kinerja dalam mengelola kegiatan PNPM di Pedesaan,hal ini dikatakan Kepala Badan Pemberdayaan Masyarakat dan Pemerintahan Desa Kabupaten Tapsel,Drs Rustam Efendi Hasibuan melalui PJOK,Ir.Muhammad Yusuf Nasution dalam Kegiatan rapat evaluasi PNPM di aula MAN 2 Padangsidimpuan,dalam minggu ini. Sebagaimana biasanya peserta diikuti Camat,PJOK Kecamatan,FT,FK dan UPK,Ir.Muhammad Yusuf Nasution dalam arahannya lebih menekankan kepada pelaku PNPM yang ada di Pedesaan agar lebih proaktif dan mampu memanfaatkan dana PNPM lebih efisien termasuk SPP (Simpan Pinjam untuk permodalan perempuan). Ditegaskannya,beberapa Kecamatan pengembalian SPP BLM dan perguliran banyak yang macet per 28 perbruari 2012 seperti Kecamatan Sayurmatinggi tunggakan pokok 9,44 Persen Kecamatan Angkola Barat tunggakan pengembalian SPP BLM dan perguliran 17,02 Persen,Kecamatan Angkola Selatan 10,66 Persen,Kecamatan Sipirok 20,03 Persen. Katanya lagi,berbagai aspek pokok permasalahan yang dihadapi akan dapat terselesaikan bersama dengan melalui rapar kordinasi Bulanan,terutama juga diharapkan peran serta dari pelaku PNPM yang ada di tingkat Desa selaku TPK (Tim Pengelola kegiatan) dalam pengelolaan kegiatan dilapangan dengan baik demi untuk mencapai tingkat keberhasilan yakni dalam mempercepat penanggulangan kemiskinan melalui pemberdayaan masyarakat”Ucapnya.Ir.M Yusuf lebih banyak menekankan kepada pentingnya informasi dan koordinasi dalam rangka menyelesaikan segala aspek permasalahan yang dihadapi.Ditekannya setiap ada maslah yang dihadapi silahkan kordinasi jangan didiamkan saja”Pungkasnya. “Kita harapkan bisa terus bergulir dan berkembang, pengembaliannya lancar. Manfaat dari SPP, bukan sebatas simpan pinjam tapi untuk modal dan mengembangkan usaha. Memang harus ada keterwakilan perempuan.Untuk tahun ini,diharapkan selektif dalam pemberian dana SPPnya,” pungkasnya.(KS-04)

Untuk Tentukan Kriteria Figur Calon Gubsu 2013-2018

Sumut Cemerlang Adakan Dialog Interaktif Antar Mahasiswa se-Tabagsel P.SIDIMPUANBN Untuk menentukan bagaimana kriteria Figur seorang calon Gubernur Sumut menurut mahasiswa yang layak dipilih pada Pemilukada Gubsu priode 2013-2018. Sumut Cemerlang sengaja mengundang unsure Badan Eksekutif Mahasiswa (BEM) dari 13 Perguruan Tinggi yang berada di Tapanuli Bahagian Selatan (Tabagsel) diantaranya UMTS, STAIN, UGN, STKIP, STIE Kampus, Universitas Benteng Huraba, PERTINU, AKBID Sentral, AKBID Syuhada dan lainnya untuk mengadakan dialog interaktif di aula perjuangan SMK N 1 Padangsidimpuan, Sabtu minggu lalu. Ketua Panitia, Nasruddin Setiawan, SE dalam laporannya mengatakan dialog antar mahasiswa seTabagsel ini pihaknya mengundang dua orang nara sumber dari kalangan akademis. “Peserta dialog interaktif terdiri dari unsure BEM Perguruan Tinggi se-Tabagsel yang mana acara ini diprakarsai, Sumut Cemerlang bertujuan untuk menyamakan pandangan mahasiswa se-Tabagsel dalam menentukan bagamana Figur pemimpin Sumut yang pas untuk dipilih pada Pemilukada Gubsu 2013-2018. Tampil sebagai nara sumber, Dekan F Sospol UGN, Yusril Harputra, MAP dan ketua Prodi bahasa Inggris di F KIP UGN, saudara Yuswin. Apapun hasil dari dialog interaktif ini, nantinya akan menjadi acuan Sumut Cemerlang untuk menetapkan figur pemimpin Sumut ke depan menuju Sumut gemilang”, ujarnya. Sementara itu, ketua umum Sumut Cemerlang, Daudsyah dalam sambutannya mengatakan Sumut Cemerlang adalah komunitas masyarakat biasa yang anggotanya terdiri dari berbagai kalangan ada guru, nelayan, buruh, dosen dan profesional lainnya. Lahir

dari diskusi-diskusi kecil kalangan mahasiswa di kota Medan dan dideglarasikan pada tanggal 25 Maret 2012 di Medan untuk menjawab tantangan masyarakat Sumut dalam menghadapi Pemilukada Sumut 20132018. “Sumut Cemerlang lahir adalah untuk menjaring masukan-masukan dari masyarakat maupun dari kalangan mahasiswa untuk menentukan bagaimana kriteria seorang Figur calon Gubsu yang layak dipilih pada Pemilukada Gubsu 2013 nanti. Saya berharap mahasiswa-mahasiswa se-Tabagsel akan memilih peminpin yang cerdas, merakyat dan jujur. Tidak akan mungkin mahasiswa se-Tabagsel memasukkan tokoh yang Korup dan asusila untuk dijadikan Figur sebagai calon Gubsu. Yang paling penting dan tolong di catat,

Sumut Cemerlang tidak akan memasukkan tokoh atau Figur seorang calon Gubsu yang berdomisili diluar Sumut walaupun tempat lahirnya di daerah Sumut’, paparnya. “Selain itu, tambah Daudsyah, saya juga mengucapkan banyak terima kasih kepada inisiator atau penggagas acara ini saudaraku, Ir Sutan Pulungan yang sama-sama kita kenal sebagai Pembantu Dekan II di F Pertanian UGN Padangsidimpuan yang telah bersusah payah untuk mensukseskan acara kita ini. Kemudian perlu saya terangkan bahwa kata. “Cemerlang” dalam kalimat Sumut Cemerlang adalah singkatan dari “CErdas, MErakyat dan jujuR insyaallah akan bisa mambawa sumut yang gemiLANG“, terangnya sambil mengucapkan yel-yel

AMPERA Tuntut Ketegasan Plt Bupati Padang Lawas PALAS BN Puluhan Aliansi Mahasiswa Perjuangan Rakyat (AMPERA) unjuk rasa di Halaman Kantor Bupati Padang Lawas, Jalan Kihajar Dewantara Sibuhuan,belum lama ini , Dalam orasinya, mahasiswa menuntut Pemkab Padang Lawas (Palas) untuk segera mengusir Koperasi Serba Usaha Aek Natio Group (KSU ANG) dari bumi Palas karena dinilai telah menghina pemkab dan kedaulatan rakyat Palas. Pengamatan yang terjadi dilapangan , dengan pengawalan ketat dari pihak Polres Tapanuli selatan (Tapsel) pengunjuk rasa bergerak dari Lapangan Merdeka Sibuhuan menuju halaman kantor bupati Palas dengan tertib.akan tetapi setibanya di halan kantor Bupati mereka dihadang barisan satuan polisi pamong praja (Satpol PP) yang dilapisi aparat kepolisian dari polres Tapsel yang terlebih dahulu berjaga-jaga.. Kemudian melalui pengeras suara mereka meminta agar pejabat yang berwenang bersedia menjumpai mereka.

Setelah sekian lama menunggu sembari melontarkan tuntutan dan membentangkan beberapa poster yang bertulisan ‘’agar KSU ANG segera diusir ‘’ barulah Assisten II bidang Ekonomi Samsul Bachri MAP dan kadis Kehutanan Ir Soleman Harahap serta staf ahli Irfan Soaduon Hasibuan langsung menjumpai pengunjuk rasa yang sebelumnya melakukan rapat kordinasi. Mahasiswa pengunjuk rasa dalam pernyataan sikap yang di bacakan, mereka menyebutkan agar aparat hukum menangkap oknumoknum yang bertanggungjawab terhadap keberadaan tanah masyarakat LuatAek Nabara yang telah dikuasai KSU ANG, sesuai dengan UU No.18 Tahun 2004 pasal 46 ayat 1 tentang Pidana Perusahaan perkebunan, memeriksa oknum perambah hutan dan mengembalikan tanah tersebut kepada masyarakat. Mereka menilai KSU ANG telah melakukan pelanggaran karena tidak memiliki izin perkebunan, hak guna usaha dan amdal. Karena itu kata mereka, secara legalitas KSUANG diduga illegal dan perambah

hutan pada hutan kawasan. Sementara Pemkab Palas hanya mampu menyurati dan menandatangani tanpa realisasi. Selain itu mereka meminta agar Plt Bupati Padang Lawas H. Ali Suatan Harahap mencopot Camat Aek Nabara Barumun Syahmiran Hasibuan S.Pd yang telah melukai hati rakyat dengan cara menghalangi masyarakat untuk menyampaikan aspirasi kepada Bupati dan DPRD Palas. Dalam pernyataan sikapnya mereka meminta dalam jangka tujuh kali duapuluh empat jam kami meminta agar Bupati mencopot camat Aek Nabara Barumun karena dia telah melarang dan menghalangi warga untuk menuntut haknya, dan maha siswa mengancam bila tidak di tanggapi akan turun ke lapangan dalam jumlah yang lebih besar, “ ujar Ketua ikatan Mahasiswa Palas Saharuddin Sahala Hasibuan. Selain itu mereka juga meminta PTPN IV untuk segera menyerahkan lahan seluas 107 hekter kepada masyarakat 17 desa di Kecamatan Sosa, serta meminta

Warga Desak PT PR Harus Hengkang dari Madina

Wakapolres Pakpak Bharat Kompol Drs. Soepriatmono P. SH, MH, Mpsi.

Polres Pakpak Bharat Komit Berantas Segala Bentuk Pelanggaran Hukum Pakpak Bharat, BN Polres Pakpak Bharat tetap komit memberantas segala bentuk tindak kejahatan yang ada di wilayah hukum Polres Pakpak Bharat, jajaran Polres Pakpak Bharat tetap komit melaksanakan perintah pimpinan tersebut untuk menegakkan hukum yang mengarah ke pelanggaran hukum seperti pelaku Korupsi, Perjudian, Traffiking, Illegal Logging, Illegal Mining, Illegal Fising, Terorisme serta Penyelundupan dan lainnya, jika ditemukan oknumoknum yang membekingi kegiatan seperti itu, pihaknya tetap komit memberantas tindakan tersebut. Hal itu disampaikan Wakapolres Pakpak Bharat Kompol. Drs. Soepriatmono. P. SH, MH, Mpsi, kepada wartawan baru-baru ini diruang kerjanya. "Kami tidak akan mentolerir perbuatan-perbuatan yang melanggar hukum yang merugikan masyarakat, apalagi sampai ditemukan ada oknum Polres Pakpak Bharat yang membekingi kegiatan-kegiatan melanggar Hukum tersebut, bagi oknum yang terlibat akan kita tindak tegas sesuai dengan aturan yang berlaku, tegasnya. Dari awal pihak Polres telah tegas terhadap ketentuan-ketentuan tersebut, karena hal itu merupakan atensi dari pimpinan untuk memberantas segala bentuk kejahatan dengan harapan masyarakat Pakpak Bharat ini bebas dari hal-hal yang merugikan, apalagi jika sampai ada oknum-oknum yang membekingi kegiatan tersebut, Polres Pakpak Bharat akan menindak tegas oknum yang terlibat, kami tidak akan tolerir oknum-oknum yang bertindak nakal, apalagi sampai melakukan pembekingan di tempat-tempat atau kegiatan-kegiatan yang melanggar hukum di wilayah hukum Polres Pakpak Bharat. Untuk itu dihimbau kepada masyarakat yang melihat langsung adanya tindak kejahatan, agar segera melaporkannya ke Polres Pakpak Bharat, masyarakat jangan takut/ sungkan untuk melaporkannya, laporan tersebut akan segera ditindaklanjuti pihak Polres Pakpak Bharat, ujarnya. (pb.007)

Sumut Cemerlang yang disambut peserta dengan kata, Menang dan Gemilang. Pantauan Wartawan, dialog yang melibatkan unsure mahasiswa se-Tabagsel untuk mendefinisikan kriteria peminpin Sumut lima tahun ke depan yang ditawarkan oleh Sumut Cemerlang sebagai fasilitator dialog yang nantinya hasil dialog akan disusun dalam bentuk pernyataan sikap yang mengatasnamakan mahasiswa se-Tabagsel ini tergolong cukup sukses. Dibuktikan, antusias seratusan lebih peserta mahasiswa dari 13 Perguruan Tinggi se-Tabagsel ini memberikan masukan-masukan pada sesi acara dialog interaktif guna menentukan kriteria pemimpin Sumut ke depan. Sementara di tempat dan waktu yang sama, lapangan upacara SKM N1sedang berlangsung pembukaan pertandingan bola basket antar SLTA sekota Padangsidimpuan oleh ketua KONI Sumut, H Gus Irawan Pasaribu, SE, Ak MBA. Sebelum pertandingan bola basket antar SLTA tersebut dibuka, panitia dialog interaktif Sumut Cemerlang mengundang H Gus Irawan agar bersedia meluangkan waktu untuk bertatapmukadenganpesertadialoginteraktifdansekaligus memberi sedikit masukan. Setelah lebih dua jam mahasiswa bersama nara sumber mengadakan dialog, akhirnya membuahkan hasil dengan menentukan kriteria untuk Figur yang layak jadi calon Gubsu priode 2013-2018 yang akan diusung Sumut Cemerlang harus bersih, cerdas, jujur, terpercaya, berasal dan berdomisili di Sumut, relatif muda usia, pemberani, memiliki semangat revolusi, memiliki fasilitas dan winwin solution. Selain itu, mahasiswa se-Tabagsel juga akan menilai calon Gubsu yang mampu untuk meningkatkatkan kesejahteraan masyarakan di bidang ekonomi, pendidikan, keamanan, infrastruktur dan moralitas. (KS-04)

Panyabungan,BN Warga Desa Batahan, Desa Batahan I dan Desa Batahan III, Kecamatan Batahan, Kabupaten Mandailing Natal (Madina), bersikukuh dan mendesak PT Palmaris Raya (PR) harus segera hengkang dari wilayahnya. Pasalnya, PT PR telah merampas lahan warga yang berada di daerah itu. Hal itu terungkap dalam Rapat Dengar Pendapat (RDP) antara perwakilan warga Batahan dengan Ketua Pansus, Bahri Efendi Hasibuan, di ruang Banmus DPRD Madina, Jumat (11/5). Masyarakat yang mewakili warga Batahan, di antaranya Amrun. Amrun mengatakan, sejak awal masyarakat menuntut agar PT PR memberikan tanah masyarakat yang telah ditanami sawit. Tujuannya, agar masyarakat bisa kembali mengusahainya untuk menopang kehidupan keluarga mereka. "Pada RDP kita berharap kepada pansus untuk menjembatani agar lahan-lahan yang sudah bersertifikat di Batahan III dikembalikan, sementara di Batahan itu persoalan KUD Pasar Baru Batahan yang ditanami Palmaris lebih kurang 800 ha itu dikembalikan," katanya. Bahkan katanya, lahan garapan masyarakat juga diserobot sekitar 1.000 ha, Batahan III lahan sertifikat 400 ha ditambah lahan garapan 267 ha sehingga total yang dipersoalakan 2.467 ha. Sementara ijin lokasi Palmaris hanya 2.800 ha. "Inilah lahan-lahan masyarakat yang dipermasalahkan dan hingga sekarang plasma yang

dijanjikan belum terealisasi dan tentang MOU Tahun 2008 seluas 200 ha belum juga dibangun sampai sekarang. Pada pertemuan itu Pansus berencana akan turun untuk meninjau lokasi sengketa bersama pejabat dari Pemkab Madina. Karena itu, kita harapkan pada peninjauan lapangan ini agar tim bekerja semaksimal mungkin sehingga apa yang didambakan masyarakat selama 13 tahun ini terjawab," katanya. Sementara itu, sebelumnya pernyataan sikap warga Batahan III melalui Serikat Petani Indonesia (SPI) Batahan III sebanyak 11 poin yang diterima MedanBisnis antara lain, menyatakan kronologis perjalanan PT PR yang sarat dengan rekayasa dan bertentangan dengan hukum, kehadirannya membuat sengsara masyarakat. Pihaknya juga meminta PT PR, mematuhi surat Bupati Madina yang menstanvaskan kegiatan perusahan di atas lahan bersengketa. Tak hanya itu, warga juga berharap kepada aparat penegak hukum bertindak kooperatif sehingga yang perlu dilindungi dan dibela adalah masyarakat. Kepada Legislatif dan eksekutif tetap mengacu pada kepentingan masyarakat. Kemudian masyarakat juga menyampaikan bahwa rapat yang dilaksanakan pada 29 April kemarin adalah sepihak yang mengatasnamakan individu dan meminta kepada Bupati Madina, BPN untuk tidak merekomendasikan HGU PT PR secara keseluruhan adalah lokasinya di Batahan III.(int)

pemkab Palas mendata perusahaan perusahaan yang tidak memiliki izin usaha perkebunan (IUP) dan hak guna usaha (HGU), serta meminta pemkab agar menekan perusahaan untuk membayarakan corporate social responsibility (CSR) sesuai dengan peraturan yang berlaku. Pada kesempatan yang sama Kasubabbag protokoler dan humas sekretariat Bupati Palas Ali Anda Lubis S.Pd MM, saat dikonfirmasi mengatakan, Plt Bupati Palas H. Ali Sutan Harahap sedang melaksanakan tugas pemerintahan di Medan. Sementara Sekretaris Daerah(Sekda) Drs Gusnar Hasibuan berada di Padang Sidimpuan sedangkan Assisten I Bidang Pemerintahan Drs Ramal Guspati Pasaribu tidak diketahui keberadaanya hingga usainya unjuk rasa para mahasiswa. Usai menyampaikan tuntutan dan aspirasi, pengunjuk rasa membubarkan diri sekitar jam 11’30 wib dengan tertib dan bergerak menuju gedung DPRD Padang Lawas dengan pengawalan penuh dari pihak Polres Tapsel.(Ali)

Pemkab Dairi Targetkan 6.000 Rumah dari Stimulan Kemenpera Sidikalang,BN Pemerintah pusat, melalui Kementerian Perumahan Rakyat (Kemenpera), meluncurkan program pembangunan rumah baru dan peningkatan kualitas rumah layak huni bagi masyarakat berpenghasilan rendah. Dananya dari dana Stimulan Kemenpera tahun anggaran 2012 ini, jumlahnya 250 ribu unit. Pemerintah kabupaten (Pemkab) Dairi mentargetkan 6.000 unit dapat dibangun dari dana dimaksud. Hal tersebut diungkapkan, Kepala Dinas Cipta Karya dan Tata Ruang, melalui Kepala Bidang (Kabid) Kebersihan dan Perumahan Dairi, Albert H Simamora kepada wartawan, kemarin di kantornya. Menurut dia, masyarakat yang berhak bisa mengajukan permohonan untuk pembagunan rumah baru ataupun meningkatkan kwalitas rumahnya menjadi layak huni. Pengajuan dilakukan dengan mengisi formulir pendataan. Disebutkannya juga, persyaratan untuk mendapatkan dana bantuan stimulan tersebut antara lain; berpenghasilan dibawah Rp1,25 juta per bulan, mempunyai Kartu Tanda Penduduk (KTP) baru (16 digit), Kartu Keluarga (KK), kepemilikan tanah sesuai nama di KTP, punya sertifikat tanah. "Jika

belum ada sertifikat, pemohon diperbolehkan membuat surat pernyataan belum memiliki rumah dan juga belum pernah menerima bantuan yang sama dari kepala desa maupun lurah," katanya. Lebih lanjut Simamora mengatakan, formulir pengisian data bagi masyarakat telah diedarkan ke 15 kecamatan di Kabupaten Dairi, untuk segera dibagikan kepada kepala desa dan kelurahan. Selanjutnya mendata masyarakat berpenghasilan rendah, serta masyarakat yang rumahnya perlu mendapatkan peningkatan kwalitas supaya dapat layak huni. Besaran dana bantuan stimulan untuk pembangunan rumah baru, menurut Simamora, sebesar Rp 11 juta per satu unit rumah. Sementara, untuk peningkatan kualitas rumah sebesar Rp 6 juta per unitnya. Ukuran rumah yang diiginkan pemerintah (Kemenpera) dengan luas minimal 36 meter persegi dan maksimal 45 meter persegi. "Pengisian formulir yang dibagikan kepada kepala desa maupun kelurahan merupakan pendataan awal, selanjutnya nanti akan diverifikasi oleh petugas dari kementerian perumahan rakyat layak tidaknya data masyarakat yang kita usulkan," sebutnya.(int)

LINTAS SUMATERA

Telkom Akan Pasang 100 Hotspot Wifi di Kota Cyber City Islami Banda Aceh, BN PT Telekomunikasi Indonesia. Tbk, menargetkan akan memasang sekitar 100 hotspot wifi di Kota Banda Aceh yang merupakan kota Cyber City Islami. Hal ini mengingat kemajuan Informasi Teknologi (IT) dipusat Ibukota Provinsi Aceh terus berkembang pesat. Demikian disampaikan Kepala Telkom Aceh, Ir. Muhammad Salmi, MM, usai peresmian New Plasa Telkom di Jalan Daud Beureueh, Banda Aceh, barubaru ini, yang juga dirangkai dengan penyerahan hadiah juara olimpiade speedy cerdas tahun 2012, yang sebelumnya telah digelar. Prosesi peresmian New Plasa Telkom dan penyerahan hadiah juara olimpiade speedy cerdas tahun 2012, turut dihadiri oleh Wakil Ketua DPRK Banda Aceh, Muslem Ayub, Sekretaris Daerah Kota Banda Aceh Drs Ramli Rasyid MPd, Kadisdikpora Banda Aceh Drs Sofyan Sulaiman, dan sejumlah pejabat Pemko BandaAceh serta eksekutif PT Telkom lainnya. Muhammad Salmi, mengatakan, kehadiran new plasa telkom akan memberikan berbagai kemudahan bagi pelanggan, khususnya yang berdomisili di kota Banda Aceh. Ia mencontohkan, seperti, memberikan layanan gratis kepada pelanggan yang telah memasang wifi dengan kecepatan 10 mega selama dua jam. “Selain mudah cara berlangganan yang dibimbing oleh Customer Service, pembayarannya juga mudah dan lebih murah dari produk lainnya. Karena itu, dengan adanya new plasa telkom din kota Banda Aceh akan menjadi sebuah kesempatan untuk menikmati saluran berinternet,” katanya. Menurutnya, masyarakat kota Banda Aceh sudah sangat familiar dengan dunia IT, dimana setiap sudutsudut kota sudah dipenuhi dengan jaringan internet hingga merambah ke warung-warung kopi, caffe. “Yang akan kita pasang nantinya dilokasi-lokasi yang belum memiliki hotspot wifi, sebab, tidak bisa kita pungkiri hubungan masyarakat dengan jaringat internet sudah sangat familiar,”tutur Muhammad Salmi. Masih kata dia, pihak PT Telkom akan terus berupaya untuk memberikan pelayanan prima, termasuk dalam memberikan informasi kepada

pelanggan, mulai bagaimana proses pemasangan baru hingga layanan komplain atas gangguan jaringan internet produk-produk Telkom. “Nantinya, petugas tanpa mengenal hari libur sampai malam hari siap melayani pelanggan dalam memberikan informasi-informasi yang dibutuhkan pelanggan Telkom. Disamping itu, kami juga menerima pembayaran rekening telepon, warnet, wartel dan beragam transaksi yang berhubungan dengan Telkom,” katanya lagi. Ia menyebutkan, saat ini PT Telkom juga menargetkan pemasangan produk terbaru Telkom bernama Groovia TV berbasis Internet protocol atau IPTV di kota Banda Aceh. Televisi yang siarannya disiarkan lewat koneksi internet berkecepatan tinggi, produk Groovia TV di pusat Ibukota Provinsi Aceh, dikarenakan pihaknya menilai kota Banda Aceh memilliki pasar prosfektif. “Telkom Aceh terus membuat jaringan baru yang siap disambungkan IPTV serta terus meng-upgrade eksisting secara berkala. TV Groovia sudah diuji coba beberapa waktu lalu dan peluncurannya secara nasional dilakukan secara komersial yaitu pada Juni 2011 lalu di Atrium Mall Gandaria City, Jakarta Selatan. Peluncuran Groovia TV yang mengusung tagline “Groove up Your Life” tersebut dilakukan oleh Direktur Utama PT Telkom Rinaldy Firmansyah. Telkom Group juga melakukan penandatanganan kerjasama dengan berbagai provider konten televisi berbayar yang dapat disaksikan melalui Groovia TV. TV Groovia dikhususkan bagi pelanggan maupun calon pelanggan Speedy. Ini adalah salah satu produk Telkom Indonesia berupa layanan akses internet bagi rumah tangga, bisnis skala kecil, dan menengah. "Pada awal peluncurannya, cukup dengan membayar Rp50 ribu para pelanggan Speedy bisa menikmati layanan Groovia TV yang menayangkan 80 channel televisi dunia," ujar Salmi. Groovia TV memiliki berbagai fitur interaktif yang belum pernah tersedia sebelumnya. Melalui tayangan Live TV dan video on demand, Groovia TV mendukung kualitas tayangan standar definition dan high definition. Groovia TV juga mampu merekam, mem-for-

ward, me-rewind maupun mem-pause tayangan televisi sesuai dengan keinginan pemirsa. Seperti disebutkan di situs promosinya, GROOVIA bukan hanya televisi konten yang didistribusikan melalui internet, melainkan suatu bentuk sinergi antara internet dan web kekuatan interaksi dikombinasikan dengan kekuatan media televisi. Terkait dengan perlombaan olimpiade speedy cerdas tahun 2012, ia mengatakan, pihaknya telah menggelar olimpiade speedy cerdas yang diikuti oleh 100 siswa SLTP dan SLTA se- Indonesia. Dari jumlah itu Aceh menyertakan sebanyak 44 finalis. “Kegiatan yang dilaksanakan mulai 23 Januari sampai 3 April 2012 ini bertujuan agar para siswa memiliki pengalaman sebelum menghadapi ujian akhir. Karena biasanya, ketidaksiapan siswa menghadapi variasi bentuk soal yang disajikan dalam ujian memberikan pengaruh yang besar terhadap kemampuan siswa dalam menjawab soal-soal, dengan waktu yang terbatas,” terangnya. Menurutnya, melalui Olimpiade Speedy Cerdas ini, para siswa diajak memasuki suasana ujian seperti yang sesungguhnya agar mereka lebih memiliki kesiapan mental dan teknik menjawab soal-soal secara baik, sehingga diharapkan akan mendapatkan hasil yang maksimal,” kata Muhammad Salmi. “Olimpiade Speedy Cerdas diperuntukkan bagi siswa-siswi yang saat ini berada di kelas 5 dan 6 (SD), kelas 8 dan 9 (SMP) serta kelas 11 dan 12 (SMU/ SMK). Untuk mengikuti Olimpiade Speedy Cerdas ini, para siswa diwajibkan melakukan registrasi gratis dengan mengisi form yang tersedia di http:// www.speedycerdas.com. Namun, khusus Aceh hanya mengikusertakan siswa SLTP dan SLTA. ujarnya bangga. Dikatakan dia, perhatian PT Telkom terhadap masyarakat di Aceh, kian terlihat disepanjang tahun. Seperti pada tahun 2009 lalu, PT Telkom pernah melatih seribuan perempuan Aceh tentang keterampilan berinternet. “Kami terus memberikan pengetahuan bagi masyarakat Aceh dalam mengetahui internet. Apalagi,

perkembangan internet di era globalisasi saat ini sudah menjadi bagian dari kehidupan dalam memenuhi kebutuhan,” katanya. Selain itu, sambung Muhammad Salmi, Kota Banda Aceh sudah memiliki Sekolah Menengah Kejuruan Negeri Telkom, yang saat ini juga sekolah tersebut juga sudah memiliki Laboratorium Telekomunikasi Jaringan Lokal Akses Tembaga (Jarlokat). “Karena itu, sangat tepat apabila kita terus melakukan pengembangan IT di kota Banda Aceh. Tentunya, membutuhkan dukungan dari berbagai pihak, sehingga, Kota BandaAceh benar-benar menjadi Cyber City di tanah air,” sambungnya. Ia menambahkan, pihaknya juga menyatakan siap memfasilitasi sarana internet dalam konsep BandaAceh Islamic Cyber City. Seperti pada sebelumnya, Telkom sudah menyiapkan sekitar 60 titik hotspot wifi yang tersebar di berbagai lokasi pusat keramaian masyarakat BandaAceh, meliputi taman, warung kopi/cafe maupun restoran. “Menjamurnya warung kopi/cafe dan restourant yang menyediakan akses internet gratis kepada para pelanggan merupakan salah satu kondisi faktual yang mencermimkan masyarakat kota Banda Aceh membutuhkan teknologi informasi untuk aktifitas rutinnya, Fenomena ini disikapi secara positif oleh Pemerintah Kota Banda Aceh dengan mencanangkan Program Banda Aceh Islamic Cyber City (BAICC). Dan Telkom siap mendukung dan memfasilitasinya,” tambah Muhammad Salmi. Dalam mewujudkan konsep Cyber City, Pemerintah Kota Banda Aceh bersama Telkom telah melakukan MoU dan bersinergi untuk menyediakan akses internet gratis kepada masyarakat pada Area Publik Taman Kota melalui penyediaan “Halte Speedy” di Taman Sari Kota Banda Aceh serta menyediakan akses internet di beberapa Kantor Pemerintah di Kota Banda Aceh, seperti Balai Kota, Kantor Pelayanan Terpadu, Kantor Dinas Pekerjaan Umum, Kantor Dinas Perhubungan dan Kantor Dinas Pendidikan dan Olahraga (UPTD Tekkomdikbud). (Afrizal)


14 - 21 MEI 2012 | EDISI 315 | THN KE-VII

Walikota Medan Raih Goverment Award 2012

Medan,BN Walikota Medan Drs H Rahudman Harahap MM bersama delapan Bupati/Walikota lainnya di Sumatera Utara mendapat penghargaan Government Award 2012 di Hotel Santika Premiere Dyandra, Jumat (11/5). Penghargaan ini diberikan langsung Menteri Koordinator (Menko) Bidang Perekonomian Ir M Hatta Rajasa karena orang nomor satu di Pemko Medan ini bersama dengan delapan kepala daerah tersebut, dinilai berprestasi dalam upaya mensejahterakan masyarakat di wilayahnya masing-masing. Selain Walikota Medan, adapun delapan kepala daerah yang mendapatkan penghargaan itu masing-masing Bupati Deli Serdang Drs H Amri Tambunan, Bupati Simalungun Dr Jr Saragih SH MM, Walikota Sibolga Drs H M Syarfi Hutauruk, Bupati Langkat H Ngogesa Sitepu SH, Bupati Tapanuli Tengah Raja Bonaran Situmeang SH MHum, Walikota Tebing Tinggi Ir H Umar

Zunaidi Hasibuan MM, Bupati Serdang Bedagai Ir H Erry Nuradi dan Bupati Nias Selatan Drs Idealisman Dachi. Dalam sambutannya, Menko Perekonomian Ir M Hatta Rajasa mengungkapkan award yang diberikan ini sangat penting sehingga harus diapresiasi. Hal ini tidak terlepas dari kondis yang terjadi di tengah-tengah masyarakat saat ini, dimana sangat sepi memberikan penghargaan maupun apresiasi terhadap upaya yang telah dilakukan anak bangsa, termasuk di dalamnya kepala daerah."Seakan-akan apa yang telah dilakukan anak anak bangsa selama ini tidak ada prestasinya," kata Hatta. "Padahal sejak krisis ekonomi yang terjadi pada 1998, terjadinya reformasi dan sampai saat ini begitu banyak peningkatan yang telah terjadi. Baik terjadinya penurunan angka pengangguran hingga meningkatnya pendapatan perkapita masyarakat. Padahal jika melihat krisis ekonomi yang terjadi ketika itu,

Program Medan Berhias Tanamkan Tanggungjawab Masyarakat Medan, BN Dalam upaya mendukung program kebersihan lingkungan sekaligus peningkatan kualitas kesehatan masyarakat, Walikota Medan Drs H Rahudman Harahap MM menggagas untuk dilaksanakannya program Medan Berhias yakni bersih, hijau, sehat dan sejahtera. Untuk mendukung program ini akan digalang kemitraan antara Pemko Medan, LSM, pelaku usaha, praktisi akademisi, media, relawan Kota Medan dan masyarakat di setiap kelurahan. Menurut Dewi Budiarti Teruna Jasa Said, praktisi lingkungan yang ikut menggagas program ini, Medan Berhias merupakan sebuah program pemberdayaan masyarakat yang difasilitasi oleh pemerintah, pelaku usaha, LSM, media dan kelompok masyarakat sebagai upaya perbaikan lingkunghan dan meningkatkan kualitas kesehatan masyarakat tiap kecamatan, kelurahan, lingkungan di Kota Medan dengan sistem kompetisi atau perlombaan. Tujuan Medan Berhias dilaksanakan untuk menciptakan Kota Medan yang bersih, hijau, sehat dan sejahtera sekaligus mendidik dan menanamkan rasa tanggung jawab kepada masyarakat terhadap kebersihan, kenyamanan dan kelestarian lingkungan,kata Dewi ketika memaparkan secara lengkap program Medan Berhias yang akan dilaksanakan kepada perwakilan sejumlah perusahaan di ruang rapat I Balai Kota Medan, Selasa (8/5). Adapun realisasi program yang akan dilaksanakan, jelas Dewi, seperti mesosialisasikan metode pertanian perkotaan (urban farming) dengan mengoptimalkan lahan pekarangan untuk diberdayakan, membudayakan pola 3R yakni reduce, reuse dan recycle. Kemudian, peningkatan ekonomi masyarakat dengan mendorong industry kecil daur ulang seperti pembuatan bank sampah, pembuatan kompos organic, pupuk cair, aneka kerajinandari barang bekas serta mengolah sampah organik menjadi pakan ikan/ternak. Di samping itu realisasi program yang akan dilaksanakan juga akan mensosialisasikan penghematan penggunaan air dan penggunaan energi. Serta sebagai studi kasus dalam upaya menciptakan pangsa pasar sampah organic (sampah basah bernilai jual) layaknya sampah kering (an organik). Khusus hal ini baru pertama kali dilakukan di Indonesia,jelasnya. Untuk melaksanakan kegiatan ini, lanjutnya, akan dibangun kemitraan antara Pemko Medan , LSM, pelaku usaha, praktisi, akademisi, media, relawan Kota Medan dan masyarakat di tiap kelurahan. Sedangkan pendanaan untuk program ini akan dilakukan patungan antara Pemko Medan, Coorporate Social Responsibility (CSR) dari perusahaan-perusahaan serta perorangan maupun donator. Dalam pemaparan yang turut dihadiri Walikota Medan Drs H dzulmi Eldin MSi, Sekda Ir Syaiful Bahri dan Asisten Ekbang Ir Arif Trinugroho, Dewi optimistis program Medan Berhias akan berjalan sesuai dengan harapan karena saat ini telah terbentuk kelompok sadar lingkungan seperti komunitas pemuda peduli lingkungan (koppling) dan kelompok sadar lingkungan (darling) yang siap dan telah dibekali cara-cara mengelola lingkungan. Ditambah lagi dengan adanya puluhan ribuan kader lingkungan di Kota Medan di setiap kelurahan serta pemerintah dalam hal ini Pemko Medan mendukungnya.Selain itu kita juga memiliki praktisi, tim ahli dan motivator cukup banyak. Di samping itu metode/teknologi yang akan diterapkan mudah dioperasikan dan berbiaya murah, LSM yang ditunjuk cukup serta relawan cukup banyak. Faktor inilah yang membuat peluang kita untuk keberhasilan program Medan Berhias cukup besar,jelasnya. Sedangkan kompetisi yang diperlombakan, paparnya, mencakup kantor camat berhias, kantor lurah berhias, wilayah (jalan/lorong/gang) minimal 1 tiap kelurahan, puskesmas berhias, kelompok sadar lingkungan aktif, kelompok komunitas pemuda peduli lingkungan aktif, bank sampah (rumah kompos aktif) dan pertanian perkotaan (urban farming). Sementara pesertanya berrasal dari kecamatan/kelurahan se-Kota Medan dan kelompok sadar lingkungan di tiap kelurahan di Kota Medan. Walikota Medan Drs H Rahudman Harahap MM berharap program Medan Berhias ini agar didukung semua pihak, termasuk perusahaan-perusahaan yang ada untuk menjadikan Kota Medan bersih dan hijau. Apalagi masalah kebersihan merupakan suatu harga diri yang harus bisa dipertahankan, sebab Medan merupakan kota metropolitan.(ndo)

sulit rasanya bisa meraih seperti yang ada saat ini,"tambahnya. Untuk itulah Hatta mengajak semua untuk memberikan apresiasi kepada para pemimpin yang telah berupaya dan bekerja keras dalam upaya meningkatkan kesejahteraan masyarakat, siapapun peminpin tersebut. Termasuk, kepala daerah mulai gubernur, bupati, walikota, camat sampai lurah. Karenanya, Hatta menegaskan pasti akan menghadiri setiap acara pemberian penghargaan yang diberikan kepada kepala daerah sekalipun tingkat kecamatan. "Ini penting bagi kita untuk mensyukuri atas kinerja yang telah dilakukan para kepala daerah tersebut," ungkapnya. Mengacu dari itu, Ketua Umum DPP Partai Amanat Nasional ini merasa Government Award 2012 ini begitu sangat penting. Apalagi penghargaan ini diberikan atas kerja keras yang telah dilakukan para kepala daerah guna mensejahterakan masyarakat di wilayahnya masing-masing, termasuk dalam memberikan

pelayanan public terbaik. Walikota Medan Drs H Rahudman Harahap MM atas nama Pemko Medan menyampaikan apresiasi sekaligus terima kasih yang sebesar-besarnya kepada Sinda Media karena telah menggagas Government Award 2012. Penghargaan ini tentunya semakin memotivasi para kepala daerah untuk terus meningkatkan kualitas tata kelola pemerintahan yang diharapkan akan berdampak kepada peningkatan kesejahteraan masyarakat. Dijelaskan Walikota, tata kelola pemerintahan yang efektif telah menjadi isu panjang dalam pembangunan dan tak pernah surut. Hal ini disebabkan prinsipprinsip dasar manajemen pemerintahan ini, diyakini akan memberikan dampak positif bagi kesejahteraan masyarakat. Meski demikian tidak dapat mengabaikan peranan dari stakeholder pembangunan lainnya, termasuk Badan Usaha Milik Negara (BUMN)/Badan Usaha Milik Daerah (BUMD).

"Kita menyadari tantangan pemabngunan di tiap-tiap daerah pasti berbeda. Untuk itu konsolidasi yang kokoh anatara pemerintah, BUMN/BUMD serta stakeholder pembangunan lainnya, termasuk media akan mendorong terciptanya iklim pembangunan yang semakin kondusif, progressif, berdaya saing dan selanjutnya akan melahirkan citra daerah yang lebih baik," ujar Walikota. Kemudian, Walikota menilai pemberian award ini sejatinya menujukkan bahwa sebeanrnya Sumut memiliki potensi yang besar untuk semakin tumbuh dan berkembang menjadi daerah kompetuitif serta menjadi andalan dalam berbagai bidang pembangunan pada tingkat nasional. Hal ini ditunjukkan oleh tata kelola pemerintahan yang semakin baik oleh seluruh kabupaten/kotanya. "Semoga pemberian award ini menjadi cambuk semangat untuk memberikan prestasi yang lebih baik lagi pada masa yang akan datang," harapnya.(ndo/r)

Wakil Walikota Gelar Video Teleconfrence Dengan Dinas Bina Marga Kota Medan

Medan, BN Wakil Walikota Medan Drs HT Dzulmi Eldin S Msi menggelar video confrence dengan jajaran Dinas Bina Marga Kota Medan, video confrence yang di fasilitasi oleh Dinas Kominfo ini dalam rangka persiapan menghadapi Adipura, yang digelar di ruang rapat-I balai kota Medan, kemarin. Dalam video confrence tersebut Wakil Walikota Medan didampingi dengan sejumlah Pimpinan Satuan Kerja Perangkat Daerah (SKPD) terkait menanyakan tentang kesiapan Dinas Bina Marga serta jajarannya, tentang masalah Drainase, genangan air, serta jalan, yang menjadi objek titik pantau penilaian tim Adipura.

Wakil Walikota Medan Drs HT Dzulmi Eldin meminta kepada jajaran Dinas Bina Marga untuk melakukan kerja ekstra, apa lagi di masa pancaroba yang tidak jelas suatu waktu bisa saja hujan turun, dimana lokasi yang rawan akan genagan air segera diatasi, dan hal ini harus menjadi perhatian untuk segera mencari solusinya. Menurutnya, Dinas Bina Marga harus membuat program dimana titik-titik lokasi yang rawan tergenang air, dan lokasi mana yang genangan airnya lambat mengering, ini harus menjadi perhatian kita dan segera cari solusinya, lakukan pekerjaan secara simultan disamping pekerjaan yang sudah menjadi rutinitas. Dinas Bina Marga harus membuat program dimana titik rawan genangan air, selain melaksanakan kerja rutinitas, juga secara simultan mengerjakan lokasi yang rawan genangan banjir dan drainase yang tersumbat, ini harus menjadi perhatian untuk jajaran Dinas Bina Marga, ujar Dzulmi Eldin. Selain itu juga Idan Bina Marga melakukan koordinasi dengan

para camat, buat contac person yang bisa cepat dihubungi, agar pihak kecamatan dapat menginformasikan hal yang harus dikerjakan dan sama-sama mencari solusinya untuk mengatasinya, juga kita perlu keluar rumah bila terjadi hujan untuk memantau lokasi mana yang tergenang air dan drainase mana yang tersumbat. Video conference ini digelar setelah usai melakukan talks show yang digelar Radio Sindo didalam program Walikota mendengar yang langsung pembicara utamanya Walikota Medan Drs H Rahudman Harahap MM, didampingi Ketua DPRD Medan Drs Amiruddin, Wakil Walikota Drs HT Dzulmi Eldin S MSi. Sekda Ir Syaiful Bahri MM serta pimpinan SKPD jajaran Pemko Medan. Program Walikota mendengar ini ditayangkan dua kali dalam satu bulan di balai Kota Medan adalah untuk mendengar dan menerima masukan dari masyarakat tentang apa yang sedang dan akan dikerjakan oleh Pemko Medan serta mendengar keluhan masyarakat, dan pemerintah Kota Medan langsung meresponnya.(ndo)

STIE Nusa Bangsa Wisuda Sarjana dan Ahli Madya ke-23 Medan, BN Wisuda sekolah tinggi Ilmu Ekonomi Nusa Bangsa pada tahun Akedemi 2011 / 2012 kembali melaksanakan kegiatan wisuda yang ke 23 sejak berdirinya beberapa tahun yang lalu. Dalam wisuda hari ini yang merupakan kegiatan wisuda pertama pada priode kepengurusan yayasan dan Ketua STIE Nusa Bangsa yang baru akan dilantik sebanyak 216 alumni yang telah berhasil menyelesaikan pendidikannya, mereka terdiri dari 72 orang sarjana ekonomi jurusan akuntansi dan 141 orang jurusan manajemen ditambah 3 orang ahli (D-3) jurusan manajemen keuangan dan perbankan. Demikian dikatakan Ketua STIE Nusa Bangsa Prof. DR. Azhar Maksum, MEc.Ac dalam pidatonya. Selanjutnya Azhar mengatakan Civitas Akademika STIE Nusa Bangsa kegiatan wisuda ini merupakan ti-

tik awal kami melepaskan para wisuda ke masyarakat, meskipun secara formil beban kami pada saat ini berkurang. Namun secara formal sebenarnya beban tersebut justru semakin bertambah, karena pada saat ini justru semakin bertambah, karena pada saat saudara terjun kemasyarakat baru dapat dibuktikan bagaimana sebenarnya kwalitas pendidikan yang telah berhasil dicapai oleh lembaga ini. Ketua YAPPBIN, Prof. DR. Hj Ade Fatma Lubis MBA, Mafis, CPA mengatakan para wisudawan/ ti dapat mengembangkjan karirnya ditengah-tengah masyarakat sehingga bisa mencapai tujuan yang diinginkan. Kami menyadari bahwa dalam era globalisasi ini tantangan untuk mendapatkan lapangan pekerjaan yang baik sangat sulit, disamping kondisi ekonomi Negara kita sekarang ini. Untuk itu diperlukan

kerja keras untuk mengejar cita-cita. Ade menambahkan dunia pendidikan tinggi diharapkan dapat meningkatkan kualitas pendidikan disamping itu juga diharapkan mampu menghasilkan insan akademis yang mempunyai wawasan kebangsaan yang luas, rendah hati dan paling penting mempunyai hati nurani untuk berbuat kebaikan dan keperibadian yang jujur dan bermoral. Marilah kita bina hidup dalam kebersamaan, saling hormat menghormati, harga menghargai dan mampu menghindari segala bentuk kekerasan. Ketua panitia wisuda STIE Nusa Bangsa Drs. Toman Panggabean MM mengatakan para wisudawan/ ti diharapkan akan terjalin hubungan tali silaturahmi lebih kokoh dan saling memberikan informasi diantara para wisudawan/ti baik yang sekarang mapun yang terdahulu. (Ahs)

Walikota Ingin ICMITM Mampu Gaet Wisatawan

WALIKOTA Medan Drs H Rahudman Harahap MM berharap kegiatan Indonesia Coporate Meeting and Incentive Travel Mart (ICMITM) yang berlangsung di Santika Dyandra Hotel Medan selama empat hari, mampu membawa suatu terobosan baru dalam rangka menggaet wisatawan domestik maupun mancanegara datang mengunjungi Kota Medan ke depan. Kita berharap 103 perusahaan yang mengikuti ICMITM ini mamu membiayai karyawannya untuk melaksanakan tour ke Indonesia, terutama Kota Medan. Berdasarkan data dari

pihak Bank Danamon, hari ini saja sudah berlangsung transaksi sebesar Rp2 miliar di Kota Medan, kata Walikota dalam acara jamuan makam malam ICMITM di Royal Sumatera Club, Selasa (8/5) malam. Atas dasar itulah Walikota sangat mensyukuri karena Kementrian Pariwisata dan Ekonomi Kreatif Republik Indonesia dan Bank Danamon American Express karena telah memberikan kepercayaan kepada Kota Medan sebagai tuan rumah penyelenggaraan ICMITM ke-5. Tentunya penunjukan itu akan memberikan kontribusi positif terhadap perkembangan industry MICE (Meeting,Incentive, Convention dan Exibition) di Kota Medan, sekaligus mendukung program Visit Medan Year 2012. Dijelaskan Walikota, ICMITM ini merupakan ajang business travel mart terbesar di Indonesia yang akan memberi-

kan peluang one-on one business appoitmen, khususnya bagi industri MICE di Indonesia. Ajang tahunan ini merupakan kegiatan business travel mart yang berfokus pada industry MICE di Indonesia. Tak sekedar table top,para pembeli juga akan diajak berjalan-jalan dan bermalam di daerah wisata yang ada di Sumatera Utara. Menurut Walikota, Medan memiliki berbagai keunggulan kompetitif dan komporatif untuk dikembangkan sebagai kota tujuan wisata, khususnya wisata MICE. Secara geogrfis, Medan berbatasan langsung dengan Selat Malaka sehingga berbatasan langsung dengan pusat perdagangan Singapura, Malaysia dan Thailand. Melalui keunggulan yang dimiliki ditambah dengan kelengkapan fasilitas jasa hotel, hiburan dan pariwisata yang ada, Walikota berharap penyelenggara ICMITM dapat

mendorong pengembangan industry pariwisata dan ekonomi masyarakat. jadi Pemko Medan sangat mendukung penyelenggaraan even ini, sebab dapat mendorong investasi swasta di sector pariwisata, terutama sector perhotelan, travel dan pembangunan sarana kesehatan bertaraf internasional,harapnya. Wakil Menteri Pariwisata dan Ekonomi Kreatif Republik Indonesia Sapta Nirwandar mengatakan, ICMITM ini diikuti sekitar 103 perusahaan. Diharapkan,perusahaan yang yang hadir bisa mengenal lebih jauh Kota Medan sehingga apabila ada kegiatan bisa melaksanakannya kembali di ibu kota provinsi Sumatera Utara ini. Apalagi, lanjutnya, Kota Medan memiliki berbagai keunikan seperti budaya karena memiliki multi culture seperti Budaya Melayu, Budaya Batak yang bermacam-

macam maupun budaya lainnya. Ditambah lagi dengan aneka kuliner yang sudah terkenal dengan kenikmatan dan kelezatannya, serta peninggalan sejarah yang dimiliki. Untuk itu Walikota harus bekerja keras untuk mengembangkan Medan menjadi kota wisata, jasa,dagang dan industri,ujar Nirwandar. Jamuan makan makan malam ini turut dihadiri Wakil Walikota Drs H Dzulmi Eldin MSi, unsur Forum Komunikasi Pimpinan Daerah Sumatera Utara dan Kota Medan,Executive Vice President Card Business Head bank Danamon Desi Masri, panitia ICMITM,peserta, pengguna (buyers) dan penjual (sellers jasa industri MICE dan seluruh stakeholder serta asosiasi kepariwisataan baik dari Kota Medan maupun luar Kota Medan , sejumlah pimpinan SKPD di lingkungan Pemko Medan serta undangan lainnya.(ndo)

PT Telkom Kembangkan Empat Area Bisnis Time Medan, BN Dalam kaitan portofolio bisnis TIME, Telkom telah mengembangkan empat area pertumbuhan layanan TIME, yakni Cloud Computing, Home Digital Environment, Mobile Broadband dan Machine to Machine. "Layanan Mobile Broadband yang dapat dinikmati masyarakat dalam waktu dekat, antara lain adalah Indonesia Wifi, yaitu layanan hotspot untuk mempermudah publik mengakses internet di berbagai tempat," kata Direktur Utama (Dirut) PT Telkom, Rinaldi Firmansyah, dalam siaran persnya. Menurutnya, mulai tahun ini, Telkom merencanakan untuk membangun satu juta access point dengan kapabilitas multi service set identifier (SSID) yang dapat digunakan untuk melakukan akses Internet tidak hanya oleh pelanggan Telkom tetapi juga oleh pelanggan operator/Internet provider lainnya. Home Digital Environment (multi-play dan multiscreen) mulai dimanfaatkan di Indonesia dengan layanan antara lain Groovia TV yaitu televisi berbasis Internet protocol television (IPTV) yang berisi program-program premium yang disalurkan melalui pita broadband. Layanan ini mempunyai beberapa fitur interaktif yang tidak dimiliki oleh TV kabel biasa seperti fast, forward, rewind, store dan lain-lain sehingga penonton dapat menentukan waktu yang diinginkan untuk menikmati tayangan yang disukainya. Layanan berbasis Machine to Machine diproyeksikan akan menjadi lifestyle masyarakat dari berbagai kalangan yang akan memberikan kemudahan hidup. Beberapa produk yang sudah disiapkan, antara lain adalah Delima, yaitu layanan pengiriman uang (remittance) tanpa harus memiliki akun atau rekening di bank. Pelanggan dapat melakukan pengiriman uang dari agen ke agen maupun dari handphone ke handphone Delima juga dapat dipergunakan untuk melakukan transaksi pembelian, bayar tagihan ataupun donasi. Berikutnya adalah Cloud Computing yang terbagi ke dalam kelompok layanan Infrastructure as a Services (IaaS) dan Software as a Services (SaaS), duaduanya membantu dalam peningkatan efisiensi dan efektivitas. Kelompok layanan IaaS merupakan layanan infrastruktur komputasi on-demand untuk segmen korporasi dan usaha kecil dan menengah (UKM). Kelompok layanan SaaS antara lain e-Office, yaitu layanan aplikasi perkantoran dengan target pasar segmen korporasi dan UKM. (AHS)

Marzuki Daud Beri Motivasi Kader Partai Maju di Pemilukada Atam Aceh Tamiang, BN Drs.Marzuki Daud merupakan pengurus Dewan Pimpinan Pusat ( DPPP ) Partai Golkar menjabat Ketua Bidang Pendidikan menyempatkan Diri bersilatuhrahmi dengan Kader-kader DPD II Partai Golkar Aceh Tamiang,di Sambut oleh H.T.Yusni dan segenap Pengurus dari 12 Tingkat Kecamatan maupun Kampung di Kantor Sekretariat jalan Medan-Banda Aceh,Kecamatan Kota Kualasimpang,Kabupaten Aceh Tamiang,jum'at lalu.( 11-05 ). Selain menunaikan tugas untuk kunjungan kerja ke Tingkat I provinsi Aceh di Banda Aceh dari DPR RI ( Pusat-red ) di Bidang Perikanan,Kelautan dan Pertanian,Drs.Marzuki Daud.mendukung penuh keikut sertaan Kader Partai T.Yusni dan Ismail dalam pemilukada Bupati-Wabup Aceh Tamiang periode 2012-2017 yang akan datang dari Kader Partai yang berlambang Pohon beringin. mengajak seluruh Kader-kader Partai Tingkat Kecamatan,Kampung maupun Underbond Partai mendukung dan bekerja sama secara maksimal menuju Pemenangan,serta memberikan motivasi serta support kepada pasangan calon Bupati/Wabup Periode 2012-2017 nantinya. Pada Kesempatan itu,Drs.Marzuki Daud juga membuka peluang bagi kader-kadernya untuk berkarya serta menampung program kerja partai golkar khususnya di bidang pendidikan sesuai jabatan beliau di pengurus Dewan Pimpinan Pusat (DPP) Partai Golkar. Akhir dari kunjungan Drs.Marzuki Daud foto bersama dengan calon Bupati-Wabup 2012 .H.T.Yusni dan Ismail ,berjabat tangan dan erat dengan segenap Kader-kader pengurus DPD II Golkar Aceh Tamiang untuk melepaskan Tokoh Partai Golkar untuk melanjuti tugas sebagai Wakil Rakyat tanpa memandang jauhnya Daerah Tugasnya, seakan-akan kebahagian pada pertemuan itu menunjukkan rasa kekeluargaan, kedekatan serta keramah tamahan yang tak terlupakan demi mempererat tali silatuhrahmi pengurus Daerah dengan hingga Pusat .(Rudi Kurniawan)


14-21 30 DES 2011 - 6MEI JAN 2012 2012 || EDISI EDISI 315| 296| THN THN KE-VII KE-VII

Pemko Adakan Sosialisasi Permendagri No. 32 Tahun 2011 SUBULUSSALAM. BN Pemko Subulussalam adakan sosialisasi Peraturan Menteri Dalam negeri NOmor 32 Tahun 2011 tentang pedoman pemberian hibah dan bantuan sosial yang bersumber dana anggaran pendaptan dan belanja daerah pada hari kamis (10/5) bertempat di Aula Setdako Subulussalam dengan mengundang Kepala Bidang Pengendalian Keuangan Dinas Pengelolaan Keuangan dan Kekayaan Provinsi Aceh Muhammad Nasir dihadiri para Kepala Dinas / Jabatan, Camat dan tokoh agama / masyarakat serta LSM. Wakil Walikota Subulussalam H. Affan Alfian Bintang, SE saat membuka acara sosialisasi tersebut mengatakan sosialisasi Pereturan Menteri Dalam Negeri No. 32 tahun 2011 ini sangat perlu sekali untuk dipahami, dalam pelaksanaan Anggaran serta pertanggung jawaban untuk pemberian bantuan berupa hibah, dan bantuan sosial baik berupa uang dan barang. Dengan demikain Affan Alfian Bintang mengharapkan kepada peserta agar serius untuk mengikutinya sampai selesai agar kedepan dapat terlaksana dengan baik ssuai dengan ketentuan. Semntara itu Ketua Panitia Soleh Kadri dalam laporannya mengatakan sosialisasi ini sengaja diadakan dengan mengundang nara sumber dari provinsi Aceh gunanya untuk pemahaman dan pertanggung jawaban bagi si pemberi dan si penerima bantuan dengan Tema terciptanya tertip administrasi, akuntablitas dan transparansi dalam penanganan hibah/bantuan social, sedangkan Muhammad Nasir nara sumber dari Provinsi Acehd alam paparanya antara lain mengatakan pelaksanaan Anggaran hibah berupa uang berdasarkan DPA-PPKD dan berupa barang atau jasa berdasarkan DPASKPD dapat diberikan kepada pemerintah, perusahaan, masyarakat dan organisasi kemasyarakatan. Bila hibah kepada masyarakat diberikan harus memiliki kepengurusan yang jelas berkedudukan dalam wilayah Pemerintah Daerah yang bersangkutan, kalau kepada organisasi diberikan dengan persyaratan telah terdaftar, berkedudukan dalam wilayah setempat, memiliki Sekretariat (Kantor) tetap, ucap Nasir, selanjutnya disampaikan bagi penerima hibah berupa uang harus menyampaikan laporan penggunaan melalui PPKD dengan tembusan SKPD terkait dan bila hbiah berupa barang atau jasa dicatat sebagai obyek belanja hibah dan jasa dalam program dan kegiatan SKPD terkait jelas Nasir. Menyinggung bantuan social untuk pemberian harus memenuhi kriteria selektif, seipenerima memnuhi persyaratan bersifat sementara tidak terus menerus. Diberikan kepada penanggulangan bencana, kemiskinan pemberdayaan sosial dan jaminan sosial dan bantuan sosial di cantumkan dalam RKAPPKD dna RKA-SKPD dan ditetapkan oleh Kepala Daerah berdasarkan peraturan Daerah tentang APBD dan peraturan Kepala Daerah tentang penjabaran APBD. Selanjutnya dikatakan sipenerima bantuan sosial harus membuat pertanggung jawaban penggunaan bantuan, surat pernyataan bantuan yang diterima telah digunakan sesuai dengan usulan dengan bukti-bukti yang lengkap dan disampaikan kepada Kepala Daerah paling lambat tanggal 10 Januari tahun anggaran berikutnya. (RB).

Pelaksanaan UN SD Berjalan Lancar

Tampak dalam gambar Wakil Walikota didampingi Anggota DPRK Subulussalam saat menghadiri acara sosialisasi Permendagri No. 32 tahun 2011.

Capaian Target Swasembada Daging Butuh Kecukupan Bibit BANDAACEH, BN Dalam rangka mengsukseskan swasembada daging tahun 2014 mendatang di provinsiAceh, sangat dibutuhkan adanya kecukupan benih atau bibit mulai dari segi kualitas maupun kuantitas. Tapi, apa yang terjadi akhir-akhir ini bahwa impor sapi, daging dan susu cukup tinggi. Karena, pasokan dari dalam negeri belum mencukupi. Demikian disampaikan Kepala Dinas Kesehatan Hewan dan PeternakanAceh, Ir.Murthada Sulaiman, usai membuka sosialisasi penguatan manajemen dan organisasi kelompok peternak mengelola sapi, Sabtu pekan lalu, di Banda Aceh. Katanya, saat ini yang menjadi salah satu kendala dan hambatan yang dihadapi dalam pencapaian pembangunan disektor peternakan adalah terjadinya penurunan populasi ternak sapi dan kerbau. Oleh karena itu pemerintah berupaya meningkatkan populasi melalui program pencapaian swasembada daging sapi/kerbau (PSDSK) tahun 2014 dan peningkatan penyediaan protein hewani, sehingga perlu didukung dengan ketersediaan jumlah ternak sapi yang cukup. “Untuk pencapaian target swasembada daging diperlukan adanya kecukupan benih atau bibit dari segi kualitas dan kuantitas. Tapi, apa yang terjadi akhir-akhir ini bahwa impor sapi, daging dan susu cukup tinggi. Karena, pasokan dari dalam negeri belum mencukupi,” kata Murthada Sulaiman. Dikatakan, hal ini disebabkan oleh kurangnya populasi sapi potong yang tersedia sebagai bibit, sehingga diperlukan upaya peningkatan produksi melalui penambahan jumlah bibit sapi potong. Sebagaimana yang diamanatkan dalam undang-undang nomor 18 tahun 2009 bahwa pemerintah berkewajiban melakukan pengembangan usaha pembenihan atau perbibitan dengan melibatkan peran serta masyarakat. “Maka dalam hal ini peran serta kelompok ternak sapi potong sangat dibutuhkan untuk menentukan, calon bibit yang berkualitas serta meningkatkan produksi yang diharapkan, memotivasi/menumbuhkembangkan pembibitan ternak rakyat untuk mendukung ketersediaan bibit sapi potong yang cukup dan kontinui, dan pembentukan spesifitas wilayah sumber bibit sapi potong,” ujarnya. Menurutnya, untuk menjadikan kelompok-kelompok ternak yang tangguh dan mandiri

bukanlah perbuatan yang mudah, banyak kendala yang dihadapi terutama menyangkut dengan modal usaha. Upaya penyediaan bibit ternak yang baik tentu memerlukan modal. “Maka peran pemerintah sangat dibutuhkan dan peran itu pemerintah pada saat ini sedang menggalakkan skim kredit bagi usaha pembibitan sapi potong seperti Kredit Usaha Pembibitan Sapi (KUPS), Kredit Usaha Rakyat (KUR) dan Kredit Ketahanan Pangan dan Energi (KKPE),” paparnya. Sambung dia lagi, untuk menjadikan kelompok ternak yangmandirisertadapatmemamfaatkansumberpendanaan dan pelayanan dalam upaya meningkatkan skala usaha, pengetahuan dan keterampilan teknologi perbibitan. “Disadari dari pengalaman usaha pembibitan sapi yang dilakukan oleh peternak, masih berjalan lambat, usaha pembibitan belum banyak dilakukan oleh pelaku usaha, karena dianggap usaha ini kurang menguntungkan dan memerlukan waktu yang lama,” sambung Murthada. Ia menambahkan, pemamfataan kredit program tersebut sangat bermamfaat bagi masyarakat/kelompok pembibitan, sehingga dengan sendirinya kelompok tersebut akan tumbuh dan berkembang sehingga terjadi peningkatan populasi ternak sapi dan terciptanya lapangan kerja baru bagi masyarakat, tambahnya. Terkaitdengansapiacehyangmenjadiprodukunggulan nasional, Ia mengatakan ternak sapi tersebut sebelumnya juga telah dilakukan pemeriksaan hasil uji DNA yang dilakukan oleh tim ahli dari Fakultas Pertanian Universitas Syiah Kuala, Banda Aceh. “Jika selama ini di Indonesia sudah ada produk unggulan sapi, seperti sapi bali, sapi madura, kini pemerintah sudah meresmikan bahwa sapi aceh akan menjadi plasma nutfah secara nasional,” kata Murtadha. Ia menyebutkan, upaya mendukung program swasembada daging Nasional tahun 2014, diperlukan peningkatan populasi ternak terutama ternak sapi dan kerbau melalui penyediaan bibit yang cukup, baik dalam jumlah maupun mutu. Salah satu cara yang dilakukan untuk meningkatkan mutu genetik sekaligus produktivitas ternak yakni melalui teknologi Inseminasi Buatan (IB) dengan mengunakan sperma beku yang berasal dari penjantan unggul.(Afrizal/TM)

Seramoe Irwandi Kota Langsa Dukung Zulkifli Zainon Langsa,BNMantan Wakil Komandan Kompi A Gerakan Aceh Merdeka (GAM) Dearah III Langsa wilayah Peureulak, Burhanuddin Berdansyah alias Mualem Paneuk meminta kepada semua elemen masyarakat untuk dapat bersamasama mensukseskan Pemilukada putaran kedua calon Walikota Langsa danWakilWalikota Langsa priode 20122017 yang akan dilaksanakan pada 14 Juni 2012 mendatang.kepada wartawan dia mengatakan “kita mengimbau kepada semua komponen masyarakat jangan sampai takut terjadinya intimidasi maupun hal lainnya yangbisamenggangguhakpilihsehinggabertentangandengan pilihan hati nuraninya, “ungkap Burhanuddin, Jum’at (4/ 5) lalu di Langsa. Ia juga mengutuk keras jika ada terjadi intimidasi yang dilakukan kepada masyarakat jelang Pemilukada Kota Langsa putaran kedua oleh oknum-oknum tertentu yang nantinya bisa mengganggu jalannya pesta demokrasi ini. “Kita minta juga aparat penegak hukum jangan ragu-ragu menindak pelaku intimidasi tersebut, “pintanya. “Jika pemimpin yang dipilih dari cara-cara yang tidak baik, maka

dikhawatirkan pula kepemimpinannya,”tukas Burhanuddin seraya mengatakan, untuk itu masyarakat Kota Langsa jangan terpengaruh kepada orang-orang yang memujuk rayu dan harus memilih yang ditentukan kepada mereka,itusemuahanyakepentingansesaat,namun,pilihlah calon pemimpin sesuai dengan hati nurani kita masingmasing, jangan pilih dengan paksaan dari orang punya kepentingan di Kota Langsa ini, tegasnya lagi. Padakesempatanyangsama,BurhanuddinBerdansyah menambahkan, dirinya yang tergabung dalam organisasi SeramoeLangsayangjugatelahmendeklarsikanmendukung pasangan calon nomor urut 3 Zulkifli Zainon-Syaifullah sangat berharap kepada semua tim pemenangan calon ini agardapatbekerjasebaikmungkinsesuaiaturanyangberlaku danjangansampaiterjadinyapelanggaranPemilukadaapalagi hingga kriminalitas.Adapun tim Seramo Langsa yang mendukung calon Walikota Langsa Zulkifli ZainonSyaifullah yaitu Ketua Seuramoe, Bahtiar. M.Saleh alias Bang Lades mantan Kuangan D III Kota Langsa. SekretarisSeuramoe,AbdullahUbitmantanBendahara Sago Kota Langsa, Bendahara Seuramoe, MulyadiYusup

alias Camat mantan pelatih TNA D III Langsa dan juga mantan perwakilan AMM Kota Langsa.Kemudian, Nazaruddin Yusup alias PS Din mantan Panglima Daerah IIILangsa,BurhanYusupaliasKrikilmantanWakilPanglima Sagoe Langsa Lama, Syahrul alias Makyun mantan Komandan Operasi Daerah Langsa, Jon Raja Tapak ,M. Bahrum, Mursid alias Agen, Bodat, Dekgam alias Krumtong, Amir Khan, Doini alias Sprit, Sopian alias Abuyan,RuslialiasCabak.SelanjutnyaadalahRidwanalias Gure, Bukhari alias Wak- Kari,TM. Nasir alias Wak-Nas danTengku Ridwan mantan penerangan Daerah III Langsa serta sejumlah nama mantan GAM lainnya yang tergabung dalamSeramoe. Lebih lanjut Mualem menegaskan, bahwa dukungan yang diberikan Seramoe kepada Zulkifli Zainon-Syaifullah telah mendapat izin dari Tengku Muhammad Sanusi yaitu AbuSanusimantanpanglimaKomandoWilayahPeureulak, Aceh timur dengan memberikan izin dukungan kepada mereka guna mendukung penuh calon Wali Kota/Wakil Wali Kota Langsa Zulkifli Zainon- Syaifullah pada Pemilukada putaran kedua,ujar Burhanuddin(MUS)

Pemkab Aceh Timur Kembali Kucurkan Beasiswa Pendidikan Tahun 2012 ACEH TIMUR,BN Pemerintah Kabupaten Aceh Timur kembali menggulirkan beasiswa tahun 2012 bagi putra putri terbaik daerah ini yang menuntut ilmu diberbagai perguruan tinggi baik lokal maupun dalam dan luar negeri semua jurusan, eksakta maupun ilmu sosial. Beasiswa yang akan dikucurkan, proses pendaftaran dan penyeleksiannya dilakukan melalui Bagian Keistimewaan Aceh Setdakab Aceh Timur yakni untuk program D-2,D-3, S-I,S-2 dan S-3 baik perguruan tinggi lokal, dalam maupun luar negeri. Adapun batas akhir penerimaan berkas atau

kelengkapan calon penerima beasiswa adalah tanggal 15 Juni 2012 mendatang. Demikian diutarakan Kabag Keistimewaan Aceh Setdakab,Amiruddin SAg kepada Bongkarnews,kemarin dikantornya. Adapun persyaratan untuk S-1,S-2,S-3 luar negeri dan S-2,S-3 dalam negeri adalah membuat permohonan tertulis, fotocopi Kartu Tanda Mahasiswa (KTM), Foto Copy Kartu Tanda Penduduk /KTP (Aceh Timur-red), Surat Keterangan aktif Kuliah dari Fakultas bersangkutan dan melampirkan nomor rekening bank online atasnama mahasiswa yang bersangkutan (bukan rekening oranglain walaupun orangtua atau keluarga).

Selanjutnya syarat untuk bantuan biaya pendidikan tahun 2012 ,D-2,D-3 dan S-1 adalah membuat surat permohonan, bantuan khusus bagi mahasiswa yang telah menduduki semester 3, mahasiswa eksak memiliki IPK 2,50 keatas, program ilmu sosial IPK 2,70 keatas, foto copi KTM,KK,KTP, KHS semester 3 dan surat keterangan camat serta surat keterangan aktif masih kuliah dari kampus plus fasfoto serta melampirkan nomor rekening bank online atas nama pemohon bukan orang lain. Khusus bagi mahasiswa UNSAM,STAIN ZCK Langsa, STIM Pase persyaratan diurus melalui kampus masing masing, demikian tutup Amiruddin.(MUS)

Disiplin PNS Turun, Salah Satu Faktor Hutang Kredit Bank Aceh Timur,BN Penjabat (Pj) Bupati Aceh Timur Ir Nasrullah Muhammad MSi MT, Kamis(3/5) bertindak sebagai Pembina apel pagi di Inspektorat KabupatenAceh Timur. Hadir dalam apel tersebut ,InspekturAceh Timur, Fuadi SH MH serta puluhan pejabat dan stafnya. Dalam kesempatan tersebut, Pj Bupati yang juga Kepala Badan Kepegaaian Pendidikan dan Pelatihan (BKPP) Propinsi Aceh ini kembali mengingatkan para abdi negara ini untuk benar benar bekerja tulus,ikhlas dan disipilin.

Layanilah masyarakat dengan baik, jagan kecewakan. Diakuinya, sebagai pemimpin dan pembina kepegawaian, dirinya pantas mengingatkan ini dan tak bosan bosannya berpesan kepada PNS untuk mengindahkannya. Jadilah PNS yang baik dan bertanggungjawab. Fenomena saat ini, disiplin PNS semakin mengendur, namun sebagai pemimpin kita harus terus mengingatkan mereka dan memberi motivasi. Salah satu faktor disiplin menurun sebut Pj Bupati adalah banyaknya PNS yang terjerat dengan hutang dan kredit

di bank. Ini hampir terjadi di semua kabupaten kota di Aceh bahkan PNS ditanah air, sebut Nasrullah. Karenanya, persoalan PNS mengambil atau meminjam uanga dengan kredit bank menjadi pekerjaan rumah bagi kita bersama untuk mencari solusi terbaik."Jangan terlalu konsumtif yang pada gilirannya makin mengendurkan semangat kerja dengan alasan gaji tak ada lagi, telah dipotong bank. Padahal sewaktu menerima uang kredit tersebut dalam jumlah besar, PNS malah tak mengeluh namun mengumbar senyum.(MUS)

Subulussalam BN Ali Musdi (41) warga Lae Motong Kecamatan Penanggalan foto di atas salah seorang warga korban konflik dari Takengon Aceh Tengah tinggal di Kampong Lae Motong Kecamatan Penanggalan Pemko Subulussalam sejak tahun 2003 lalu karena rumah tempat tinggalnya dibakar OTK. Selama di Lae Motong tempat tinggal selalu berpindah – pindah karena tidak memiliki rumah sendiri, dan untuk cari nafkah menghidupi keluarganya 7 orang anak bersama istri hanya mengandalkan upahan di tempat orang lain. Sehigga saat ini mereka terpaksa tinggal dirumah sekolah Madrasah berlokasi dekat Mesjid Motong karena kebetulan Madrasah terebut belum dipergunakan, seandainya nanti tempat tinggal kami (Madarasah) dipakai kami tak tahu lagi tah mau pindah kemana, ucapAli Musdi. Sedangkan untuk mengontrak rumah dana tidak ada, gaji yang saya dapat dari hasil upahan hanya pas makan saja tuturnya. Sedangkan menyinggung rumah bantuan dari Pemerintah seperti BRA dan Duafa, Ali Musdi mengatakan sudah bosan katanya, pasalnya selama dia tinggal di Lae Motong sudah tiga kali datang untuk mendata bahkan surat / uang administrasipun sudah diberikan setiap ada yang datang untuk mendata sesuai dengan permintaan sipendata tersebut, namun apa yan

ada hasilnya Nihil juga, padahal tanah untuk pertapakan rumah tersbut sebagaimana persyaratan yang diminta kita sudah sediakan dengan ukuran 10 x 70 meter, ucapnya. Selannjutnya Ali Musdi mengatakan, pada saat ini dia ada mendengar kabar bahwa di Pemko

Subulussalam akan mendapat bantuan rumah Duafa dari dana Otsus sebanyak 48 unit, dengan demikian saya (Ali. Red) mengharapkan sekali pertolongan dari Pemko Subulussalam agar bisa mendapatkan bantuan rumah duafa terebut, dan apa persyaratan yang dibutuhkan saya siap sedia melengkapi kata Ali. (RB).

Warga Miskin Korban Konflik Mengharapkan Bantuan

Subulussalam. BN Pelaksanaan Ujian Nasional tingkat SD diwilayah Pemko Subulussalam mulai dari awal (7/5) sampai dengan terkahir (9/5) berjalan lancar. Pantauan BN dibeberapa Sekolah nampak para siswa sedang tekun untuk mengisi jawaban dengan pengawasan yang ketat dari Dinas Pendidikan Kebudayaan Pemuda dan Olahraga Kota Subulussaam selama pelaksanaan UN berlangsung. Seperti halnya di SD Sukamakmur Kecamatan Simpang Kiri Subulussalam dihari terakhir Rabu (9/5) saat BN bertemu dengan Kepala Sekolah Nuraisiah br Padang, S.Pd mengatakan jumlah murid peserta UN di sekolah tersebut sebanyak 30 orang dan semua hadir, dibagi dengan dua ruangan untuk tempat UN, satu ruangan 20 orang satu ruangan lagi 10 orang. Sedangkan menyinggung target kelulusan para muridnya untuk tahun ini Nuraisyah mengatakan sama dengan kelulusan tahun lalu (2011) yaitu 100%. Selain menyinggung masalah UN Nuraisyah juga menyampaikan keluhan di sekolahnya, yaitu masalah Gedung sekolah yang dimiliki sebanyak tiga local keadaannya cukup memprihatinkan, karena dinding sekolah tersebut yang terbuat dari beton sudah dipenuhi dengan lobang dan retak

akbiat imbas gempa bumi pada tahun 2010 lalu, sehingga di kawatir apabila cuaca buruk padahal anak-anak sedang belajar didalam, kalau gempa atau angin kencanag datang bagaimana keselamatan anak murid jelasnya. Sementara itu saat BN berkunjung ke SD Pasir Panjang Lae Tarutung hal senada juga disampaikan kepala Sekolah Fadlilah sekolahnya juga sangat parah terkena gempa sehingga sampai saat ini (12/5) para murid masih belajar dibawah tenda darurat dan sudah berlangsung lebih satu tahun namun tidak ada perhatian dari Pemko Subulussalam untuk membangun gedung sekolah tersebut, pungkasnya. Lebih jauh dikatakan yang paling susah apabila musim hujan datang, buku dan pakaian anakanak yang sedang belajar dibawah tenda sering basah, sheingga terganggu belajar, namun bagaimana mau kita buat itu yang ada gedung atau rumah untuk di pinjam tidak ada kata Fadlilah. Disisi lain saat ditanya jumlah murid kelas VI yang mengikuti UN dikatakan sebanyak 28 orang juga semuaa hadir tidak ada yang absent, dan target kelulusan untuk tahun ini Fadlilah mengatakan 100% karena mengingat para murid anak didiknya sangat tekun belajar walaupun dibawah tenda. (RB).

Dirjen PAUDNI Kemendikbud RI Kunjungi Aceh ACEH BESAR,BNDirektur Jenderal PendidikanAnak Usia Dini (PAUD), Nonformal dan Informal, Kementerian Pendidikan dan Kebudayaan RI, Prof. Dr. Lydia Freyani Hawadi Psi., Rabu menjelang siang (9/ 5), tiba di UPT BPKB Disdik Aceh, Lubuk bersama rombongan. Direktur Pembinaan Pendidikan Masyarakat Dr.Ella Yulaelawati dan beberapa staf turut mendampingi kunjungan dinas sang dirjen ke daerah dengan julukan serambi mekkah dan tanah rencong. Menyambut kedatangannya, panitia telah menyiapkan tarian ranup lampuan yang di peragakan oleh cilik-cilik asuhan sebuah PAUD di Aceh besar. Usai menyaksikan tarian Ranup Lampuan, sang Dirjen berlatar belakang tenaga pengajar itu mencium satu persatu anak PAUD yang sangat lincah menari itu.Lembaran uang lima puluh ribu pun di bagi satu persatu kepada generasi emas di masa akan datang itu."terima kasih bu," ucap salah satu dari peserta tari itu, sambil mencium tangan Ibu Dirjen. Selanjutnya, dengan di dampingi Kepala Dinas Pendidikan Aceh, Bakhtiar Ishak dan Sekretaris Dinas Pendidikan Aceh, Zulkifli Namploh, S.Pd, Sang Dirjen bersama Dirdikmas Kemendikbud RI Dr. Ella Yulaelawati, di persilahkan untuk mengisi kursi di depan menjadi pembicara pada acara temu ramah dan tanya jawab antara orang nomor satu di Direktorat Jenderal PAUNI Kemendikbud RI itu dengan pengurus PAUD, PKBM,SKB se Aceh Besar dan Pejabat teras di lingkungan Dinas Pendidikan Aceh. Beragam pertanyaan di tanggapi serius dan ramah, sehingga suasana keakraban memancari pertemuan tersebut. Saking bersemangat proses tanya jawab, Sekdis PendidikanAceh yang akrap di panggil Jol 60 terpaksa mengambil alih mikrofon dan segera terucap dari mulutnya dengan tegas."mohon maaf, kesempatan tanya jawab harus di akhiri, karena ibu dirjen harus

Dirjen PAUDNI Kemendikbud RI Prof.Dr. Lydia Freyani Hawadi,Psi,(berkerudung merah) mencium penari Ranup Lampuan cilik dari PAUD setempat pada kunjuangannya di UPTD BKPB Aceh di Lubuk, Aceh Besar,Rabu (9/ 5).Foto:Masbram/BNC

segera pulang ke Jakarta, jadwal penerbangan hampir tiba,". Dengan raut wajah kecewa, para peserta temu ramah dengan petinggi di dunia pendidikan itupun harus merelakan acara tersebut di akhiri. Sebelum terbang ke Jakarta melalui bandara SIM Blang Bintang, Aceh Besar,Rombongan Dirjen PAUDNI Kementerian Pendidikan dan kebudayaan RI dijamu makan siang oleh Pihak Dinas Pendidikan Aceh di sebuah restoran khas Aceh Rayeuk yang berada di lintasan menuju Bandara bertaraf internasional. Usai makan siang, tak lama berselang seorang lelaki datang menghampiri rombongan dan mengingatkan jadwal chek in segera tiba. Dengan bergegas, rombongan tersebut segera berangkat menuju bandara. "Selamat jalan," itulah kata yang diiringi lambaian tangan dari pimpinan PAUD, PKBM, SKB, pejabat teras dan staf Dinas Pendidikan Aceh kepada rombongan Ibu Dirjen itu.(TM)

PNS BKPP Harus Jadi Tauladan Aceh Timur,BN Penjabat (Pj) Bupati Aceh Timur, Nasrrullah Muhammad kembali mengingatkan jajaran PNS dan honorer daerah ini untuk terus memupuk disiplin kerja dan jangan berkeliaran tanpa hal atau alasan yang dibenarkan pada saat saat jam dinas. "Ini penting, karena tugas PNS adalah melayani masyarakat dalam kerja pemerintahan. Hal itu disampaikannya saat memimpin apel pagi di Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Kabupaten Aceh Timur ,Rabu(9/5) pagi. Sementara di Setdakab Aceh Timur, apel pagi dipimpin oleh Asisten I Pemerintahan ,Muhammad SH MH dan turut dihadiri Sekda Syaifannur SH MM dan para Asisten, Kabag, Kasubbag dan ratusan staf di Setdakab. Lanjut Pj Bupati, khusus bagi pegawai BKPP dan pimpinannya, haruslah menjadi contoh tauladan dalam kedisiplinan PNS ini. "Jangan sekali kali saya mendapat laporan ada pimpinan atau staf BKPP yang tertangkap dalam razia terhadap aparaturnya.

Karenanya, kedepan saya berharap tingkat kedisiplinan PNS daerah ini terus meningkat dan sebagai pemimpin kita harus mampu memberikan contoh yang baik dan terus memotivasi para staf, ajak Nasrullah Muhammad. Sehari sebelumnya, Pj Bupati juga menjadi pembina apel pagi di lingkungan Sekretariat DPRK Aceh Timur.Amanat yang sama juga disampaikan kepada PNS dijajaran DPRK.(MUS)


14-21 MEI 2012 | EDISI 315| THN KE-VII

Mahasiswa Unimed Demo Rektor

Medan, BN Puluhan mahasiswa yang tergabung dalam Jaringan Masyarakat Pemerhati Pendidikan Sumatera Utara (Jimat Pemdiksu) menggelar aksi unjukrasa di depan Gedung Kejatisu,jalan A.H Nasution . Dalam aksinya, mahasiswa menduga adanya korupsi di dalam kampus Universitas Negeri Medan senilai Rp 138,8 miliar yang melibatkan Rektor Unimed, Prof Ibnu Hajar, kemarin. Koordinator Aksi Jimat Pemdiksu, Amsal Siregar mengungkapkan, tahun 2011 Unimed mendapat anggaran senilai Rp138,8 miliar yang bertujuan untuk pembangunan gedung perpustakaan, pengadaan peralatan laboratorium FMIPA dan IlmuKeolahragaan, pengadaan sarana dan prasarana TIK serta untuk kegiatan IMT-GT (pembangunan tiga serangkai). Tetapi, dalam penggunaannya Jimat Pemdiksu melihat ada beberapa keganjalan dan rawan korupsi serta saratKKN.

Kemudian,pembangunan gedung perpustakaan diduga menghabiskan anggaran senilai Rp 80 miliar. Ia mengatakan ,dalam perjalanan mekanisme pelelangan tender proyek tersebut telah terjadi penggiringan secara sengaja oleh para oknum pejabat unimed untuk memenangkan salah satu perusahaan yang diduga memberi uang dalam bentuk ‘fee’ guna meloloskan perusahaannya sebagai pemenang tender. Bukan itu saja, ungkap Amsal, dalam proses pembangunan serta pembelian bahan diduga telah terjadi pengelembungan harga. Setelah itu, tambahnya, dalam pengadaan peralatan laboratorium FMIPA dan Ilmu Keolahragaan senilai Rp 40 miliar juga terjadi penggiringan proyek yang sarat KKN serta pengelembungan anggaran. “Begitu juga dengan pengadaan sarana dan prasarana TIK senilai Rp 18 miliar serta bantuan pemprovsu untuk kegiatan IMT-GT (pembangunan tigaserangkai) senilai Rp 1,8 miliar,” ucapnya. Menurut Amsal, dalam kegiatan IMT-GT pengelolahan

keuangannya sangat misterius. Dimana, terangnya, dalam kegiatan tersebut diperkirakan hanya menghabiskan dana senilai Rp800 juta. Pasalnya, tambah Amsal, dalam kegiatan tersebut memiliki banyak sponsor dana yang memberikan sumbangsih berupa materi dan sebagainya. Setelah itu, Amsal membeberkan, dalam pengadaan jaket almamater mahasiswa luar kampus seperti PSKGJ atau program sarjana kependidikanbagi guru dalam jabatan diduga telah terjadi pungutan liar senilai Rp130 ribu setiap orangnya dengan jumlah pengutipan senilai Rp1,1miliar. Kemudian, penggunaan uang tersebut tidak melalui proses tender sebagaimana mekanisme yang diatur oleh undang-undang. “Kami juga menemukan beberapa kejanggalan, yakni kualitas harga tidak sesuai. Karena dari bahan dan kualitasnya kami memperkirakan biaya hanya senilai Rp 65 ribu per jaket. Artinya telah terjadi korupsi juga dalam pengadaan baju tersebut,” ucapnya. Dengan alasan itulah, terangnya, kami meminta Kejatisu

Dosen Dituntut Tingkatkan Kualifikasi & Kompetensi Medan, BN Rektor Universitas Muhammadiyah Sumatera Utara (UMSU), Drs Agussani MAP mewisuda 898 pascasarjana, sarjana dan ahli madya periode I Tahun 2012 di Selecta Convention Hall Jalan Listrik Medan,kemarin . “Statistik penerimaan mahasiswa baru pada tahun akademik 2011/2012 menunjukkan angka signifikan sebanyak 6.500 orang menjatuhkan pilihannya ke UMSU,”katanya, kemarin. Jumlah ini, menurut Agussani, meningkat dibanding penerimaan pada tahun sebelumnya. Ini menjadi tantangan bagi UMSU dalam mengelola proses belajar mengajar dengan total mahasiswa dewasa ini seluruhnya melebihi 20.000 orang . Menurutnya, dengan jumlah mahasiswa yang dikelola tersebut, UMSU turut mendukung program Pendidikan Tinggi dalam mendor-

ong Angka Partisipasi Kasar (APK) dari 18,36% menjadi 25%, yang artinya keterlibatan UMSU dalam meningkatkan mu-tu mahasiswa agar SDM Indonesia memenuhi kebutuhan global. “Capaian ini sebagai upaya mendukung daya saing bangsa melalui peningkatan kualitas pendidikan tinggi de-ngan berbagai inisiatif dan program,” katanya. Guna peningkatan kualitas di internal UMSU, kata Agussani, para dosen didorong mengembangkan dan meningkatkan kualifikasi serta kompetensi pendidikan ke jenjang S2 dan S3 sebagaimana amanat Undang-undang Nomor 14 Tahun 2005. Dengan demikian, lanjut Agussani, proses belajar mengajar, berjalan dalam koridor penjaminan mutu pendidikan yang bermuara kepada lulusan UMSU yang unggul, cerdas, dan terpercaya den-

gan kompetensi: keislaman, keilmuan, kebangsaan, kebahasaan dan keterampilan. Menurutnya, UMSU berupaya menjawab keinginan Pendidikan Nasional dalam membentuk karakter bangsa dan peradaban bangsa bermartabat serta mengembangkan potensi diri peserta didik menjadi manusia beriman dan bertaqwa kepada Allah , berakhlak mulia, sehat, berilmu, cakap, kreatif dan menjadi warga negara yang demokratis serta bertanggung jawab. Selain mengikuti kegiatan proses belajarmengajar secara rutin, mahasiswa UMSU juga menoreh berbagai prestasi pada bidang olah raga, seni budaya dan karya ilmiah tidak hanya pata tingkat lokal namun juga pada tingkat nasional maupun internasional, antara lain, di kejuaran Sea Ga-mes, memperoleh medali emas. Begitu juga, dalam kegiatan The 13th Indonesia Malaysia Thailand Growth Treangle (IMT-

GT) Carnival 2011, tim sepakbola UMSU dan tim Bulutangkis putera menoreh prestasi emas. Dalam lomba debat bahasa Inggris tingkat wilayah Sumut & Aceh diikuti PTN & PTS, mahasiswa UMSU berhasil keluar sebagai juara pertama dan berhak mengikuti lomba debat bahasa Inggris tingkat nasional yang akan dilaksanakan di Bali,Juli 2012. Begitu juga, prestasi para dosen UMSU cukup membanggakan, seperti dalam bidang penelitian. UMSU masuk dalam katagori claster madya, yang artinya UMSU mendapat kepercayaan dari pemerintah untuk melakukan penelitian dengan pendanaan Dikti. ”Sampai saat ini UMSU telah melepas 30.543 alumninya, telah bersaing dan berkompetisi serta mewarnai kehidupan masyarakat dan dunia profesi,” tegasnya. (DOER)

Kasus Tanah Terus Menerpa Sumut Medan, BN Munculnya kasus sengketa tanah di Indonesia sejak bangsa ini merdeka, negara belum bisa memberikan jaminan hak atas tanah kepada rakyatnya. Ironisnya, persoalan administrasi hukum justru telah merambah ke ranah politik yang mempengaruhi permasalahan tanah dewasa ini. Demikian dikatakan Hakim Agung MA RI, Dr Supandi SH MHum pada Seminar Penyelesaian Masalah Pertanahan dan Pelaksanaan Putusan Pengadikan Yang Berkekuatan Hukum Tetap di Sumut yang dilaksanakan di Universitas Panca Budi Medan, kemarin. Seminar dibuka Plt Gubsu diwakili Asisten I Hasiholan Silaen SH menampilkan pembicara Kapoldasu Irjen Pol Drs Wisjnu Amat Sastro, Ketua DPRD Sumut H Saleh

Bangun, Kepala BPN diwakili Masniari SH, anggota DPD Dr H Rahmadsyah, dan Dr Dayat Limbong SH MHum dan dihadiri Rektor Unpab M Isa Indrawan SE MM, Rektor IV Bidang Kerjasama dan Informasi Indrajaya Lubis SH. Ia mengatakan ,berdasarkan data statistik Polda Sumut dari tahun 2005 hingga 2011 kasus tanah di sumatera utara mencapai 7.294 lebih kasus. Dari jumlah Kasus sengketa tanah tersebut terdiri dari 2460 kasus karena sengketa tanah antara kelompok warga dengan kelompok masyarakat, 143 kasus lainnya sengketa tanah antara kelompok warga dengan badan hukum publik seperti PTPN II, III dan IV. Selebihnya adalah kasus tanah yang terjadi antar masyarakat dan pihak swasta. Karenanya memprihatinkan sekali kasus

tanah di Sumut ini. Menurutnya, kompleknya persoalan tanah di Sumut menjadi fenomena yang sangat pelik, sehingga diharapkan segera dicarikan solusinya dalam penanganan progresif. “Kemauan dan komitmen dari seluruh kalangan baik pemerintah daerah, aparat penegak hukum dan perguruan tinggi dan seluruh masyarakat agar mendahulukan penyelesaian secara kekeluargaan,” ujarnya. Namun,apabila masih belum tercapai dapat dilakukan penyelesaian melalui mediasi karena pengadilan merupakan jalan terakhir yang harus ditempuh.Sehingga putusan hakim sebagai jalan terakhir (ultimum remedium) dalam sengketa pertanahan tersebut. Sedangkan, Rektor Unpab Isa Indrawan mengatakan, tujuan seminar ini untuk berdiskusi dengan beberapa pakar mencari

akar masalah dan solusi bagaimana menyelesaikan masalah tanah yang sering terdengar di Lampung, Jambi, bahakan di Sumatera Utara sendiri. Isa juga mengatakan, seminar ini juga merupakan rentetan kegiatan dari diskusi publik yang dilakukan dengan serikat petani yang merekomendasikan beberapa keputusan yakni untuk penyelesaian tanah di Sumut harus ada forum atau komite, dibentuknya peradilan agraria dan adanya blue print yang jelas tentang perundang-undangan penyelesaian sengketa tanah. Pada diskusi dalam seminar ini, walau permasalahan tanah sangat klasik tapi dengan era keterbukaan saat ini, pihaknya mencoba memberi rekomendasi pada pemerinrah karena persoalan tanah dapat diselesaikan untuk masyarakat banyak. (DOER/INT)

Pupuk Kimiawi .. daerah yang ingin menyehatkan kampungnya sendiri. Kata Agus, munculnya ide mendirikan Kampung Organik di Desa Weh Porak, karena milihat banyaknya makananan yang dikonsumsi telah terkontaminasi dengan pupuk kimiawi. “Bayangkan saja, kalau setiap hari kita mengkonsumsi makanan yang terkontaminasi pupuk kimiawi, sudah pasti penyakit yang datang dan itulah sekarang yang sering terjadi di tanah air kita ini,” ungkap Agus soal ide mendirikan Kampung Organik, kemarin. Lebih membanggakan lagi, dari 23 kabupaten/kota se Aceh, baru Desa Weh yang mendeklarasikan Kampung Organik. Walau baru Desa Weh, tapi Agus optimis idenya itu akan dikembangkan hingga ke seluruh Aceh. “Kalau bisa seluruh Indonesia,” ujar ayah dua orang anak ini. Agus mengakui kesehatan itu cukup mahal harganya. Salah satu menjaga kesehatan adalah dengan rutin berolahraga, tapi jangan mengenyampingkan makanan yang dikonsumsi. Berangkat dari kesehatan tubuh itulah, Agus bersama PT Permata Agro Indonesia bekerjasama dengan pemerintah setempat mendistribusikan pupuk organik ke kalangan petani di Desa Weh Porak. “Kita akan mensubsidi petani khusus untuk pupuknya. Dan kalau bisa hasil petani akan kita tampung, karena kita tahu bahwa hasil tani kaum petani sudah pasti sehat, “ujarnya. Saat ini, lanjut Agus, sekitar 83 kepala keluarga (KK) yang tergabung di Kampung Organik. Lahan yang tersedia

seluas 459 hektar. “Dan, bagi kalangan petani akan diberikan bantuan masing-masing Rp 1,35 juta berbentuk penyaluran pupuk organik,” papar Direktur Utama PT Permata Agro Indonesia tersebut. Dikisahkan Agus, ide mendirikan Kampung Organik telah lama tertanam dipikirannya. Hanya saja, ide itu baru muncul kali ini. “Ide ini sudah cukup lama saya pikirkan. Setelah rencana yang matang, baru kali inilah ide ini saya aplikasikan di masyarakat. Alhamdulillah, respon masyarakat cukup positif, sebab pupuk organik adalah pupuk hayati yang sehat,” tukas Agus di kantornya Jalan Sidodame No 54 A Medan. Ketika ditanya dari mana sumber dana untuk mensubsidi petani di Kampung Organik, Agus menjelaskan, sejauh ini sumber dana 50 persen dari perusahaannya sendiri dan 50 persen lagi bantuan dari pemerintah daerah. “Desa sehat, kecamatan sehat, kabupaten sehat, provinsi sehat dan seluruh rakyat Indonesia bisa sehat. Makanya saya optimis untuk menyehatkan rakyat Indonesia melalui pemakaian pupuk organik. Meski saat ini sebagai contoh saya bermula dari Desa Weh Porak ini. Kita akan menyerahkan pupuk Agrobost, Humagold kepada petani,” sahut Agus. Untuk ke depan, target Agus memang tak muluk-muluk. Target itu terutama menyehatkan masyarakat Takengon dan Bener Meriah. “2012 ini kita akan mengembangkan tanaman kacang kedelai dengan menggunakan pupuk

Sampah ... ini masih berserakan di lingkungan masing-masing. Dikhawatirkan tanpa adanya penanggulangan sampah yang berarti, bakal membawa dampak negatif bagi Ibukota Provinsi Sumatera Utara ini. Bila tidak dikelola dengan baik, beberapa tahun mendatang sekitar 250 juta uta rakyat Indonesia akan hidup bersama tumpukan sampah. Kementerian Lingkungan Hidup mencatat rata-rata penduduk Indonesia menghasilkan sekitar 2,5 liter sampah perhari atau 625 juta liter dari jumlah total penduduk. Kondisi ini akan terus bertambah sesuai dengan kondisi lingkungannya. "Setiap hari masing-masing orang menghasilkan 2,5 liter sampah, kalkulasikan dengan jumlah penduduk," kata Menteri Lingkungan Hidup, Balthasar Kambuaya, kemarin. Sedangkan untuk Jakarta saja, perhari memproduksi sampah berkisar 3.000 ton. Malah kondisi tersebut membuat pejabat setempat berpikir panjang, bagaimana harus menyelesaikan persoalan sampah yang kian menumpuk. Walikota Medan, Drs Rahudman Harahap, ketika meresmikan Bank Sampah Mutriara di Jalan Pelajar menyebutkan, saat ini sampah tidak dipandang sebagi musuh karena bisa menghasilkan rupiah. Namun bukan rupiah yang menjadi fokus melainkan adanya peningkatan kesadaran, kepedulian serta tanggung jawab masyarakat dalam pengelolaan persampahan. "Untuk itu kita akan terus berupaya untuk menumbuhkan rasa butuh masyarakat akan lingkungan yang bersih, tertata dan sehat," ujar Walikota. Selain melalui program bank sampah, dikatakan Rahudman, pengelolaan sampah juga digerakkan dengan program 3 R yakni Reduce, Reuse dan Recycle. Kemudian, memfasilitasi pelatihan di tingkat masyarakat sehingga melahirkan komunitas-komunitas peduli lingkungan. Hal ini dilakukan untuk mendesain bagaimana program pengelolaan sampah yang tepat berbasis partisipasi

masyarakat. "Semua yang dilakukan ini dipengaruhi komitmen kami untuk mewujudkan Medan Bebas Sampah yang telah dicanangkan sejak 1 April 2011," ucapnya. Peresmian Bank Sampah Mutiara ini turut dihadiri Wakil Walikota Drs H Dzulmi Eldin Msi, Sekda Syaiful Bahri, Ketua Dewan Adipura Sarwono Kusumaatmaja, unsur dewan kota, pimpinan SKPD di lingkungan Pemko Medan serta pemerhati pembangunan kota dan kelompok pemerhati lingkungan. Peresmian bank sampah ditandai dengan penandatanganan prasasti oleh Menteri Negara Lingkungan Hidup dan Walikota. Setelah itu dilanjutkan dengan pengguntungan pita sekaligus meninjau bank sampah dan sejumlah stand yang memamerkan produk bernilai jual tinggi berasal dari sampah. Walikota Medan Drs H Rahudman Harahap MM mengungkapkan Bank Sampah Mutiara yang baru diresmikan Menteri Lingkungan Hidup LH) Prof DR Balthasar Kambuaya MBA merupakan wujud dari pendekatan pengelolaan persampahan berbasis masyarakat. Menurut Walikota, programn bank sampah ini bukanlah sesuatu nyang asing bagi segenap warga Kota Medan. Selain Bank Sampah Mutiara, banyak bank-bank sampah lainnya yang dikelola secara rutin oleh masyarakat. Malah masyarakat sudah terampil memberdayakan sampah menjadi aneka produk yang memiliki nilai ekonomi sangat tinggi. Diakui Walikkota, pengelolaan sampah pada masa mendatang semakin berat. Jika mengacu pada target Millenium Development Goals, pada 2015 diharapkan 65 persen penduduk Indonesia harus memperoleh akses terhadap sanitgasi yang layak. Sedangkan di sisi lain, pingkatan jumlah sampah di perkotaan juga bergerak eksponesial seiring dengan pertambahn jumlah penduduk. (NDO)

organik Agrobost,” tandasnya. Sempat Menolak Awal-awal mendirikan Kampung Organik, sudah pasti ada pro dan kontra. Terutama kalangan petani yang menilai bahwa penggunaan pupuk organik tidak akan meningkatkan kualitas serta kuantitas tanaman mereka. Namun berkat kegigihan Agus, semuanya bisa terjawab. “Yang ada dipikiran masyarakat adalah meningkatkan produksi. Apalagi selama ini cara peningkatan produksi dengan menggunakan pupuk kimiawi, bukan pupuk organik. Perlahan, kita pun berusaha memberikan pembelajaran kepada masyarakat akan fungsi dan keunggulan serta peningkatan produksi tanaman petani. Setelah itu petani puas karena apa yang diragukan petani ternyata sama sekali tidak benar,” imbuh Agus. Bahkan, ujar Agus, dengan menggunakan pupuk organik khususnya Agrobost dan Humagold, petani bisa menghasilkan keuntungan berlipat ganda. Salah satunya, meminimalisir pengeluaran pupuk kimiawi. Sayangnya pemerintah seolah cuek akan kesehatan dan tetap ‘mensahkan’ yang namanya pemakaian pupuk kimiawi. “Memang pemerintah kalau kita tilik tidak salah, tapi lebih baik memberikan pengetahuan tentang kesehatan penggunaan pupuk organik kepada kaum petani. Kita harapkan ke depan pemerintah lebih berperan aktif dalam memberikan pengetahuan pada petani, jangan sampai imaj petani hanya pupuk kimiawi yang ada di pikiran mereka,” tukasnya. (*)

untuk segera menangkap dan mengadili para pelaku yang diduga melakukan korupsi di Unimed. Pasalnya, tegas Amsal, Ibnu Hajar merupakan penanggung jawabpenggunaan anggaran tersebut. Sementara itu, Humas Unimed, Tappil Rambe saat dikonfirmasi via SMS seputar dugaan korupsi tersebut mengatakan, ‘Langsung ke pak rektor saja. Karena tadi kita sudah sepakat bahwa dalam hal ini rektor akan langsung yang memberikan komentar’. Sementara, Rektor Unimed Prof Ibnu Hajar yang di SMS seputar dugaan korupsi Unimed tidak memberikan jawabannya. (DOER)

12 Jenis Ikan Dari Halaman 1 perusahaan yang nyata mencemarkan lingkungan hidup. “Baru-baru ini kami mengangkat limbah sampah masyarkat sebanyak 60 ton. Namun yang kami sayangkan, tidak ada tindak lanjutnya dari Pemko Medan sendiri,” sesal Rusli pada acara dialog interaktif tentang lingkungan hidup di Medan, kemarin. Ketidakberdayaan Pemerintah yang tak tegas dalam menerapkan peraturan yang berlaku tentang lingkungn hidup dituding sebagai biangkerok kian merajarelanya kerusakan lingkungan. Zainuddin Nasution Akademisi Dosen UISU berpendapat, ada semacam konsolidasi tapi tak bersifat provokatif. “Bicara soal lingkungan hidup sesungguhnya kita telah diingatkan Allah SWT berbunyi kerusakan di darat dan di laut akibat ulah tangan manusia, maka siapa yang bikin ulah maka perlu kita telusuri, “tukasnya. Parahnya lagi, lanjut Zainuddin, semua aliran sungai sudah berubah menjadi aliran limbah. “Dulu sungai Deli bisa diminum dan, kalau pemerintah kita tak peduli, sudah pasti bakal membawa dampak kepada masyarakat,” ujarnya. 128 perusahaan tercatat masih membuang limbahnya, terbukti sudah banyak ikan dialiran sungai Deli yang langka. Kecuali ikan sapu kaca yang kategori tahan akan limbah. (NDO/INT)

Jual Pupuk

Dari Halaman 1

di kabupaten Langkat, namun buktinya para pemilik UD/Kios tetap menjual di atas HET. Berdasarkan SK Bupati Langkat Nomor :03 Tahun 2012, kata Boga Arfiansyah, alokasi kebutuhan pupuk bersubsidi dan harga eceran tertinggi untuk kabupaten Langkat adalah sebagai berikut Pupuk Urea Rp.1.800/kg (1 zak Rp.90.000,-) Pupuk SP36.Rp.2.000/kg ( 1 zak Rp.100.000,-) Pupuk ZA Rp.1.400/kg ( 1.zak Rp.70.000,-) Pupuk NPK Rp.2.300/kg (1.zakRp.115.000,-) pupuk organik Rp.500/kg (1.zak Rp.25.000,-) Menurutnya, kebutuhan pupuk bersubsidi setiap musim tanam di Kabupaten Langkat tidak pernah tersalurkan sesuai dengan alokasi kebutuhan. Bahkan para petani selalu kecewa tidak pernah mendapat pupuk bersubsidi sesuai dengan RDKK plus SK GUBSU Nomor :12 tahun 2011 “Kita minta Bupati Langkat Ngongesa Sitepu menindak tegas para pemilik UD/ kios yang menjual pupuk bersubsidi di atas harga HET,” pungkasnya. (MR/MSTP )

2 Unit Alat

Dari Halaman 1

masyarakat dengan persetujuan Bupati. Lebih lanjut dikatakan, setelah Ir MHG menjabat Plt Dinas KPLH, kedua unit alat tersebut diduga telah "digelapkan"nya. “Sesuai dengan penuturan penjaga malam ketika alat tersebut saya cek digudang, alat tersebut sudah tidak berada di tempat. Pengadaan alat tersebut diperuntukkan kepada masyarakat yang memerlukan, bukan kepada oknom Kadis, sehingga hal ini menjadi pertanyaan besar dan nyata sangat menyalahi dari segi etika, serta sangat merugikan masyarakat yang sangat membutuhkan", ungkap Sihotang. Ditambahkannya, dia sebagai Kasi Monitoring Hasil Tambang di Dinas Kehutanan dan Pertambangan siap menanggung segala resiko dan konsekuensi atas diungkapnya kasus PLTS tersebut, demi kepentingan masyarakat Pakpak Bharat yang masih sangat miskin, kiranya aparat penegak hukum segera menyelidiki keberadaan alat tersebut. Sementara, ketika dikonfirmasi kepada Kadis Kehutanan, Pertambangan dan Lingkungan Hidup, Ir. Muh Aris Gajah seputar keberadaan dua unit alat PLTS dimaksud, tidak dapat dihubungi. (PB.007)

Izin Trayek

Dari Halaman 1

berdasarkan SK Kadis PHB Prop Sumatera Utara tertanggal 10 November 2008 dengan Nomor :551.21/ 12931/R/PHB/2008 oleh Kepala Dinas Perhubungan Sumatera Utara diberikan kartu pengawasan kepada CV Netis yang dipimpin oleh Asrat N W Baroes pada tanggal 26 Maret 2012 sampai tanggal 15 Februari 2013 untuk mengangkut penumpang pada trayek T.Tinggi (Bandar Kajum), Dolok Masihul, Galang, Lubuk Pakam, Medan (Terminal Amplas) PP (pulang pergi – red). Dia menyesalkan sikap Kadis Perhubungan Kota Tebingtinggi yang dalam rapat dengar pendapat itu dengan enteng menyuruh agar angkutan umum CV Netis supaya tidak boleh ke Tebingtinggi khususnya tujuan Terminal Bandar Kajum dan menyarankan agar ke Terminal Bandar Sakti saja. Akibat sikap arogansi Kepala Dinas Perhubungan Kota Tebingtinggi itu, Janes Sinaga menyebutkan, pihak CV Netis keberatan dan akan terus berjalan sesuai izin trayek (KPPS) yang ada dan siap menghadapi segala hal yang terjadi di lapangan. “Kepala Dinas Perhubungan Tebing Tinggi mengangkangi SK Dishub Provinsi Sumatera Utara. Kami meminta agar Walikota Tebingtinggi menegur Kadishub Tebingtinggi supaya jangan terlalu arogan dalam mengambil sikap,” tegas Janes Sinaga. Sebelumnya, Ketua DPD Organda Kota Tebingtinggi, Murli Purba S.Fil, meminta kepada pengusaha Direksi, mandor maupun para pengemudi angkutan umum antar kota dalam provinsi (AKDP) khususnya CV Netis agar mematuhi kesepakatan bersama yang telah dibahas dalam Rapat Forum Lalu Lintas Kota Tebingtinggi. (TIM)

PengurusanDari Halaman 1 “Pengurusan akta sesuai UU Nomor 23 Tahun 2006. Kelahiran anak di atas satu tahun lebih harus menyertakan putusan pengadilan. Sedangkan di bawah satu tahun akan diterbitkan akta kelahirannya dengan menyertakan surat keputusan Kepala Dinas Pencatatan Sipil setempat saja,” ujar Kadis Kependudukan dan Pencatatan Sipil Drs H Syafruddin, M Si di ruang kerjanya, kemarin. Bahkan, katanya lagi, untuk anak yang lahir di luar nikah juga diatur dalam UU tersebut dengan Peraturan Presiden 25/2008. “Anak yang lahir, sebelum 60 hari harus dilaporkan ke Pencatatan sipil supaya diterbitkan akte kelahirannya. Baik di lahir di luar nikah atau yang lahir dari perkawinan resmi,”tukasnya. Sementara Ketua Pengadilan Negeri (PN) Pelalawan Heru Budianto, SH.MH ketika dikonfirmasi melalui Humas Heri Cahyono, SH menjelaskan menyambut antusias masyarakat untuk masa depan anaknya. Untuk prosedur pengurusannya, masyarakat diwajibkan membawa fhoto copi KTP, KK, Akta Nikah, bukti kenal lahir dari bidan atau dukun kampung yang disertai surat dari pemerintah setempat ”Memang masyarakat yang bersangkutan harus datang langsung dan mengikuti sidang yang tidak begitu lamalah, tapi setelah persyaratan permohonan dan biaya sudah dibayarkan ke Bank BRI melalui kwitansi yang sudah diberi nomor rekening dari PN Pelalawan,” akhirinya. (RINGO)


CMY K

CMY K

14 - 21 MEI 2012 | EDISI 315 | THN KE-VII

PENGUMUMAN Disampaikan kepada seluruh Kepala Biro/ Wartawan Media Bongkar News untuk hadir pada: Hari/Tanggal : Jumat, 18 Mei 2012 Pukul : 14.00 Wib Tempat :Kantor Redaksi Bongkar News, Jalan Flamboyan Raya/ Raharja No. 37 Medan. Acara :Pembentukan Panitia HUT Bongkar News ke-7 dan halhal yang berkembang. Demikian pengumuman ini disampaikan untuk dilaksanakan dan dihadiri. Ttd Sunardi Bonang Pemimpin Redaksi

Pemprovsu Kurang Tanggap Terhadap Penyebaran AIDS Medan, BN Provinsi Sumatera Utara (Sumut) kini masuk kategori mengkhwatirkn dalam kasus penyebaran HIV/AIDS. Sampai April 2012, tercatat sudah 3.461 orang terjangkit penyakit menular mematikan itu. Tragisnya,Pemprovsu terkesan kurang tanggap bahaya sedang mengancam, dengan tidak disiapkannya anggaran di APBDSU tahun 2012 untuk penanggulangan penyakit itu. Bahkan mayoritas Pemkab/Pemko di Sumut, belum membentuk pengurus KPA (Komisi Penanggulangan HIV/AIDS) sebagaimana diamanahkan Peraturan Presiden Republik Indonesia (Perpres) No 75 tahun 2006. Demikian Ketua dan anggota Komisi E DPRD Sumut Ir Jhon Hugo Silalahi, MM dan Nurhasanah, SSos kepada wartawan, Jumat (11/5) di DPRD Sumut, seusai menerima pengurus KPA (Komisi Penanggulangan HIV/AIDS) Sumut membahas semakin “mengganasnya” penyebaran penyakit HIV/AIDS di Sumut. Benar-benar seperti fenomena gunung es, penderita penyakit HIV/AIDS di Sumut sudah masuk kategori darurat sosial yang harus disegerakan penanganannya, agar jumlah penderitanya tidak terus meningkat setiap bulannya. Sebab pada kurun waktu April 2012 ini saja, jumlah penderita penyakit HIV/AIDS sudah mencapai 3.461 orang. “Terjadi kenaikan, jika dibandingkan pada TA 2011 yang jumlah penderitanya hanya 2.800 orang,” tegas Jhon Hugo Silalahi. Ditambahkan Jhon Hugo yang juga Wakil Ketua DPD Partai Demokrat Sumut itu, meningkatnya setiap tahun penderita penyakit HIV/AID tersebut, membuat Komisi E sangat prihatin sekaligus menyesalkan. Apalagi Pempropsu dan Kabupaten/ Kota di Sumut terkesan kurang serius menanggulanginya, terbukti Pempropsu sendiri tidak menampung anggaran penanggulangannya di APBD Sumut TA 2012. Pada TA 2011, Pempropsu masih menganggarkan dana penanggulangannya di APBD sebesar Rp200 juta. Tapi pada TA 2012, tidak sepeserpun mencantumkan anggarannya di APBD. “Padahal, Gubsu termasuk Ketua KPA Sumut yang seharusnya jeli terhadap penaggulangan HIV/AIDS,” tegas Jhon Hugo senada dengan Nurhasanah sembari meminta Plt Gubsu segera mencari solusi untuk mengatasi penanggulangan penyakit yang sangat berbahaya tersebut. Jhon Hugo anggota dewan Dapil Pematangsiantar dan Simalungun ini bahkan mendesak Plt Gubsu untuk lebih peduli terhadap penyakit HIV/AIDS ini, agar tidak terus menggerogoti kesehatan masyarakat. Minimal dengan dukungan anggaran dari APBD, agar target Sumut sehat pada 2013 sesuai visi misi Gubsu/Wagubsu tentang rakyat tidak sakit dapat tercapai. Diakui Jhon Hugo, dari 33 Kabupaten/Kota di Sumut, baru 11 Kabupaten/Kota yang sudah terbentuk KPA dan dari 11 tersebut, hanya 6 kabupaten yang aktif. Yakni Medan, Deliserdang, Sergei (Serdang Bedagai), Tanjung Balai, Pematangsiantar dan Simalungun. Sementara, 5 kabupaten lainnya seperti Labuhan Batu, Toba Samosir, Langkat, Asahan dan Nias kurang aktif. Tapi yang paling aneh bagi Komisi E, sejumlah lembaga yang dibentuk Pemprovsu, seperti Lembaga Pemberdayaan Perempuan dan Penanggulangan Anak, Badan Pengawas Pendidikan, KPAID (Komisi Perlindungan Anak Indonesia Daerah) Sumut terkesan kurang perhatian dari segi anggaran. “Hampir sama nasibnya dengan KPA Sumut, sehingga perlu dibuat Peraturan Daerah (Perda) untuk mengharuskan penangannya,” tegas Jhon Hugo dan Nurhasanah . (r/ndo)

HUT ke-13 Kota Dumai Dimeriahkan Lomba Mancing Bersama Pers Dumai:BN Dalam merayakan dan memeriahkan hari jadi Ke-13 Kota Dumai berbagai kegiatan telah dilakukan oleh Pemko Dumai tidak ketinggalan pula sempena Hut Kota Dumai tersebut juga di laksanakan kegiatan Lomba memancing pada minggu (6/5) pagi di kediaman Walikota Dumai . lomba memancing dengan tema "mancing mania" bersama pers itu di ikuti puluhan waratawan dan beberapa pejabat di lingkungan Pemko Dumai. Acara lomba memancing bersama insane pers itu merupakan acara penuh kehangatan dan bersahabat antara insane pers dengan jajaran pejabat di Pemko Dumai, puluhan wartawan media cetak dan elektronik dengan antusias mengikuti perlombaan mincing yang di prakarsai bagian Humas, Infokom Setda Dumai. acara seperti ini merupakan pertama kalinya diadakan bersama pers di Kota Dumai."ini perdana event yang di gagas Humas Infokom dan di harapkan Event seperti ini berkelanjutan.

Dalam lomba memancing bersama pers kali ini selain Walikota Dumai Khairul Anwar dan Wakil Walikota Agus Widayat juga di ikuti oleh beberapa pejabat di lingkungan Pemko Dumai di antaranya Kepala Dinas Tata Kota Zulfa Indra . Kepala Kantor Pasar Suardi, Kabag SDA Bambang dan beberapa pejabat lainnya termasuk dari anggota DPRD Dumai Komisi I Jhon Fikardan juga rombongan Kantor Jamsostek Dumai yang di kendalikan Kepala Kantor Jamsostek Dumai Nurdin. Proses lomba memancing ini untuk setiap wartawan di bekali 1 paket alat memancing yang di berikan oleh panitia dan untuk pemenang lomba memancing ini adalah peserta yang bisa memperoleh ikan dengan ukuran terberat. acara tersebut juga di selingi acara hiburan dan seluruh peserta di jamu makan bersama. pada perlombaan memancing mania bersama pers ini 3 pemenang yakni juara 1 wartawan dari Dumai Pos dan wartawan dari Detik Pos dan wartawan Surat Kabar Riau Pesisir. (Sirait/Tengk/Yono)

Warga Minta PLN dan Dinas Pertamanan Jeli

Trafo J50 Bertengger di Atas Pohon

Beberapa warga melintas di lokasi Trafo J50 yang sering meledak akibat pohon disebelahnya yang menjulang dan mengenai kabel Listrik

Patumbak, BN Warga jalan Pertahanan Patumbak, Dusun VI, Desa Patumbak Kampung Kecamatan Patumbak, Kabupaten Deli Serdang selama ini resah, disebabkan pohon warga yang berdekatan dengan trafo J.50 sering meledak akibat Korsleting listrik. Menurut pengakuan warga sekitar sering kali terjadi ledakan di terfo tersebut seperti dikatakan Petrus tarigan (53) " sudah 3 bulan ini trafo J.50 itu sering meledak , akibat ledakan itu membuat kami panik dan listrik langsung padam akibat kabel dan ranting pohon saling menyentuh" ungkapnya ketika berbincang dengan Koran ini. Ditambahkan warga yang sama Syahsyam Moncho (59) yang juga tokoh masyarakat (BKM) Seruai" Saya sudah lupa nama petugas PLN yang datang dengan mengendarai mobil dinas berlambang PLN

yang waktu itu memperbaiki Trafo yang meledak saya juga menyarankan agar pohon yang menyebabkan meledaknya trafo segera dipangkas namun petugas tersebut enggan dan mengatakan pemangkasan pohon memang harus melalui ijin dari dinas pertanaman dan menyarankan untuk kordinasi ke pihak terkait" dikatakanya. Demikian pula warga lainya yang resah karena belum adanya upaya untuk melakukan pemangkasan terhadap pohon tersebut , sementara kejadian serupa sering terulang . Kini mereka hanya bisa berharap dan memohon kepada pihak yang terkait yaitu Dinas Pertamanan dan PLN agar segera melakukan pemangkasan terhadap pohon jalan yang mengganggu kabel listrik , apalagi sekarang musim penghujan tentu sangat beresiko tinggi memakan korban yang ada disekitar lokasi tersebut. (S.Panja.SH)

Pengusaha SPBU Baru Wajib Sediakan Dispenser Pertamax Medan, BN Sejalan dengan rencana pemerintah untuk membatasi bahan bakar minyak (BBM) bersubsidi, PT Pertamina mewajibkan setiap pengusaha baru SPBU menyediakan dispenser pengisian pertamax. Hal ini bertujuan, agar konsumen lebih mudah mendapatkan BBM jenis pertamax saat pemerintah memberlakukan pembatasan penggunaan BBM bersubsidi. “Untuk SPBU lama kita anjurkan agar menambah jumlah dispenser pertamaxnya.Ini dilakukan agar program pembatasan BBM subsidi berjalan secara maksimal,” kata Assistant Customer Relation Region I PT Pertamina, Sonny Mirath, kemarin. Ia mengatakan, saat ini penjualan pertamax di sejumlah SPBU di Sumatera Utara masih terbilang sedikit. Karena, dari 308 SPBU yang saat ini masih beroperasi hanya 82 SPBU yang memiliki layanan dispenser penjualan prtamax dan 226 SPBU belum memiliki dispenser tersebut. Ia mengatakan, penjualan pertamax saat ini masih cen-

derung berada di daerah perkotaan seperti Medan yang tersebar di 44 SPBU, Deliserdang 15 SPBU, Lankat dan Sergai 4 SPBU, Labuhan Batu 3 SPBU, Binjai, Tebingtinggi, Siantar 2 SPBU dan Asahan, Karo, Tapanuli Selatan, Padangsidimpuan, Batubara, Labuhan Batu Selatan 1 SPBU. “Selain akan memperbanyak jumlah SPBU yang menjual pertamax, Pertamina juga terus mempromosikan BBM ramah lingkungan itu seperti gebyar pertamax akhir tahun dan nonton bareng dengan konsumen,” katanya. Sementara itu, pengamat ekonomi dari USU, Jhon Tabfu Ritonga mengatakan, dengan adanya kebijakan baru tersebut, PT Pertamina harus berkomitmen penuh dapat mengatasi pembatasan pembelian BBM bersubsidi tersebut. “Menambah jumlah SPBU baru untuk menjual pertamax sampai ke daerah pedesaan memang harus dilakukan,” katanya. Untuk itu, dirinya berharap, kebijakan yang dikeluarkan dari. PT pertamina harus dapat disosialisasikan ditengah

masyarakat. “Jika, BBM bersubsidi di-

batasi kemudian pertamax tidak ada atau sulit didapat tentun-

ya menimbulkan masalah baru,” katanya. (DOER/OB)

Pembinaan PKK dan Tertib Desa Kecamatan Patumbak PEMBINAAN PKK dan tertib Desa yang diselenggarakan di aula kantor Desa Patumbak kampung dan Desa Sigaragara, Kecamatan Patumbak, Kabupaten Deliserdang. berlangsung serentak di dua desa. Masing-masing dipimpin 2 tim dari Pemkab Deli serdang. Satu Tim terdiri dari tiga pembinaan yaitu Pembina PKK Deli Serdang, Karinadiah Purba , tim BPMD Deli Serdang, J.Sinambella serta Syafi'i Sihombing membuka acara di Desa Patumbak Kampung. Acara berlangsung pada CMY K

Kamis (10/5) dimulai pada pukul 10 wib berjalan dengan baik. Pada kesempatan itu tim PKK karinadiah purba menyampaikan program yang bertujuan meningkatkan pengetahuan kepada pengurus baru PKK agar PKK Kecamatan Patumbak, agar dapat lebih meningkatkan segala program PKK sebagaimana yang telah di tetapkan oleh tim PKK Deli Serdang terlaksana lebih baik lagi. Adapun acara tertib Desa yang terselenggara di dalam kantor kepala Desa oleh tim

BPMD, LKMD, BPB, Kepala Desa, dan tokoh masyarakat, J.Sinambella, Syafi'I Sihombing selaku dari tim BPMD Deliserdang menyampaikan tujuan tertib Desa agar Kepala Desa, LKMD, dan BPD, dapat menjalankan fungsi dan tugasnya sesuai jurlak yang sudah ditetapkan oleh BPMD Deliserdang dan Kepala Desa berhak dan mempunyai wewenang mengangkat menentukan setaf desanya juga mengangkat kepala dusunnya demi tujuan terselenggaranya desa yang baik itu semua tang-

gung jawab dan wewenang kepala desa tandas tim BPMD DS, hal itu dikatakan kepala desa patumbak kampung syahrial barus, usai acara tersebut. Dari tujuan pembinaan PKK dan tertib desa yang sudah terlaksana masyarakat mengharapkan agar semua yang sudah di tetapkan oleh pemerintah kabupaten deli serdang dapat di jalankan dengan baik oleh aparataparat desa maupun dari penggerak PKK yang ada di Kecamatan Patumbak. (S.PANJA. SH)

CMY K

Koran bongkar NEws edisi 315,  

Koran bongkar NEws edisi 315, beredar di sumatera utara, aceh, riau, Membongkar kasus sampai tuntas media terpaercaya di sumut

Read more
Read more
Similar to
Popular now
Just for you