Issuu on Google+

B

23-30 APRIL 2012| EDISI 312| THN KE-VII

KANTOR REDAKSI Jl. Flamboyan Raya/Raharja No. 37 Medan Telp (061) 8213786, HP. 081375395392 - 08163134392 Fax (061) 8215552

Harga Eceran Rp 3500,Luar Daerah + Ongkos Kirim

Saat kampanye pasangan Zaini Abdullah-Muzakir berjanji akan terus berupaya menciptakan Aceh yang bermartabat, sejahtera, berkeadilan dan mandiri berlandaskan Undang Undang Nomor 11/2006 tentang Pemerintah Aceh (UUPA). Banda Aceh, BN Segelintir janji yang tertuang tersebut akan tetap diingat 4,6 juta masyarakat Aceh. Apalagi, masyarakat Aceh memang mengharapkan perubahan di tangan Gubernur yang baru terpilih ini. Memang, hasil pleno Komisi Independen Pemilihan (KIP Aech menyebutkan, pasangan Zaini AbdullahMuzakir Manaf (Zikir) menang mutlak dibanding pasangan lainnya. Bahkan sejak awal, kemenangan Zikir telah diprediksi terlebih dahulu. Perolehan suara pasangan ini mencapai 1,327.645 suara atau 55,75 persen. Dengan raihan suara cukup signifikan diatas 50 persen, maka pasangan diusung Partai Aceh tersebut

bersa ke halammbaunng

11

FOTO: IST/INTERNET

Keluyuran Saat Jam Dinas

LMR-RI : Bukti Akan Dikirim ke Polda, Kejatisu, Kejagung dan KPK Binjai, BN Lembaga Misi Reclassering Republik Indonesia (LMR-RI) wilayah I Sumbagut melihat ada kejanggalan dalam kasus dugaan Korupsi proyek Swakelola Cipta Karya dan Pengairan Pekerjaan Umum (PU) bersumber APBD 2010 Kota Binjai yang telah merugikan Negara mencapai Rp 1,3 miliar lebih itu. Dikatakan Ketua Komisaris LMRRI Sumbagut, Amin Sari, bahwa kasus ini jelas mengorbankan tiga tersangka lainnya, yaitu mantan Kepala Dinas Hj M ST dan Zulfansyah bersama Alfan Batubara. “Kita dari LMR-RI wilayah I Sumbagut yang mengikuti kasus ini dalam waktu dekat akan segera membuat laporan pengaduan tertulis kepada Kapoldasu, Kejatisu Kejagung, KPK dan bahkan kepada Presiden dengan melampirkan dokumen bukti-bukti bersama Caset Dist liputan selama di persidangan unuk membuktikan adanya para saksi baik pimpro dan pengawas menerima uang yang terlepas dari jerat hukum oleh penyidik,” urai Amin kepada BN, kemarin.?? Selain itu, pihaknya mengharapkan kepada Majelis Hakim Suhartanto,SH bersama anggota Rodslowny L Tobing, dan H Ahmad Drajad,SH dalam menjatuhkan vonis lebih arif dan bijaksana sesuai dengan Ketuhanan Yang Maha Esa. “Sebab kita juga menilai bahwa

bersa ke halammbaunng

11

164 PNS dan Honorer ‘Disemprot’

Desa Lae Mbalno sampai saat ini belum memiliki penerangan listrik, tampak salah seorang warga Parulian Berutu didepan rumahnya yang belum memiliki listrik, menghimbau Pemkab Pakpak Bharat dapat memperhatikan keluhan mereka. BN/pb/007

LISTRIK BELUM MERAKYAT

Dusun Masih Gelap Gulita TAPSEL,BN Ternyata listrik belum merakyat. Di Kecamatan Saipar Dolok Hole,

Kabupaten Tapanuli Selatan (Tapsel) ada sekitar 25 dusun yang masih gelap gulita. Tak

hanya di Tapsel, hal yang sama juga dirasakan warga Lae Mblano Kecamatan Salak, Kabupaten Pakpak bersa Bharat dan ke halammbuanng sejumlah desa lainnya di daerah

11

DUGAAN KONSPIRASI KASUS SEKDES PATUMBAK I

Inspektorat Jalan di Tempat Lubukpakam, BN Bupati Deliserdang (DS), Amri Tambunan diminta segera menindaklanjuti soal dugaan manipulasi data yang dilakukan oknum Sekdes Patumbak I Agus Siswanto. Sayangnya, sang bupati seolah enggan menyikapi kasus bawahannya itu. Walau telah dilaporkan lembaga swadaya masyarakat (LSM), namun hal

“Seharusnya Bupati Deliserdang Amri itu seakan bukanlah menjadi Pekerjaan Tambunan jangan diam saja. Rumah (PR) oleh Bupati Amri Semestinya mengambil sikap Tambunan. tegas terhadap bawahan yang Yang dikesalkan lagi, menurut menyelewengkan tugas sejumlah LSM, laporan tindak tanduk sebagai abdi Negara,” ujar Sekdes Patumbak I terebut, telah bersambung Sekretaris LSM Komunitas bergulir sejak tahun 2011. Hanya k e halaman Peduli Keadilan (KPK) Sumut, saja, yang jadi pertanyaan, kenapa Indrawan S kepada BN, kasus Agus Siswanto ‘dibungkam’ kemarin. begitu saja.

11

Ubi Raksasa Hebohkan Sumut LAPORAN : PARDOMUAN SILABAN Aneh tapi nyata. Tanaman palawija jenis Ubi Jalar baru-baru ini ditemukan di Kabupaten Humbang Hasundutan. Ubi dengan warna putih yang mencapai berat 12kg, 10kg dan 8 kg. Ubi yang lajim disebut Singkong terdapat di desa Aeknauli Kecamatan Pollung milik warga Manganju Tampubolon (Sekjen DPD Partai NasDem Humbahas). Tak ayal, Ubi Jalar tersebut cepat tersiar dari mulut ke mulut dan media massa sehingga menghebohkan Sumatera Utara. Selanjutnya, ubi raksasa itu dipertontonkan kepada jemaat Gereja HKBP Sola Mercy setelah kebaktian pada

pekan lalu. Dari keterangan jemaat menjelaskan mereka heran ukuran ubi sebesar ember itu. “Karena penasaran kami mencoba mengkonsumsi secara rame-rame dengan menggoreng ubi tersebut dan rasanya lumayan manis dan enak,” ujar mereka. Ketika beberapa rekan pers turun ke lokasi dan mewawancarai petani Ubi dimaksud menjelaskan, ubi tersebut tumbuh dan berkembang adalah rahmad Tuhan. “Saya tidak menyangka bersam ukurannya seperti itu barangkali ke halambuanng jawaban Doa.Tadinya hanyalah ekperimen dan ternyata itulah keadaanya,” jawabnya.

website: www.bongkarnews.com

11

Email:bongkarnews@gmail.com - indrabongkarnews@gmail.com

Subulussalam. BN Akibat tidak disiplin, 71 Orang PNS dan 93 orang tenaga honorer yang bertugas di SKPK Pemko Subulussalam dipanggil dan diberikan peringatan keras. Pemanggilan bagi PNS dan tenaga honorer yang tidak disiplin bertugas tersebut di Pemko Subulussalam sudah berulang kali terjadi. Bahkan Walikota Merah Sakti di setiap acara yang berhubungan dengan PNS seperti selalu mengingatkan para PNS agar disiplin bekerja, kalau bersambung tidak disiplin akan dijatuhi k e halaman sanksi berat. Seperti penundaan kenaikan jabatan/golongan. Hanya

11

Terkait Utang, Anggota Dewan Diperiksa Polisi Pelalawan, BN Akhiruddin, anggota Dewan Perwakilan Rakyat Daerah (DPRD) Pelalawan diperiksa penyidik Satuan Reserse Kriminal Polres Pelalawan terkait masalah utang piutang dengan seorang warga Pangkalan Kerinci Basarudin. Akhiruddin memenuhi panggilan pihak penyidik Polres Pelalawan, sesuai surat panggilan, belum lama ini. Pemanggilan terhadap bersa politisi dari Partai ke halammbuanng Persatuan Pembangun (PPP), merupakan yang

11

23 - 30 APRIL 2012 | EDISI 312 | THN KE-VII

CV. BONGKAR PERS NEWS Badan Hukum: Akte Notaris Hermaini,SH No.4 Tanggal 10 Agustus 2009 Pengesahan PN Medan No: 1520/CV/PEND/2009 NPWP: 02.996.694.2-121.000 Pembina

Pemimpin Umum/ Pemred/Penjab

: Drs. H. Kasim Siyo MSi Drs. Hendra DS HMK Aldian Pinem, SH, MH Uli Tobing Benny Soetedjo Eben Pegagan Manik : Sunardi Bonang

Wakil Pemred I/ Wakil Penjab : ESP Parindoery Wakil Pemred II/ Wakil Penjab : A. Sani Simbolon Wakil Pemimpin Umum I Wakil Pemimpin Umum II

: Johnesly Meliala : Irwansyah B

Pimpinan Perusahaan : Laini Gustina Wakil Pimpinan Perusahaan : Muhammad Ridwan Redaktur Pelaksana Dewan Redaksi

Koordinator Liputan Koordinator Daerah Litbang/Iklan Fotografer/Teknisi Penasehat Hukum Sekretaris Redaksi Keuangan

: Drs. Alfindo Amir Hamzah Siregar, SH Pendi Hariyono : Mangatur Silaban Drs. Edward Pakpahan H.Zulkarnain Abidin Rudi Sirait EPP Ringo-ringo, SE Muhammad Siregar Hotman Marbun Amran Effendi Hsb Juni Asian Tampubolon SP : Jakfar : Indrawan Sukma Antoni Sagala : Sudari,SH (Kabag) Leonard Hutasoit : Supriadi : Nurmahadi Darmawan, SH Mardianto Situmeang, SH Rosmawati, SH : Toni Purwadi, SH : Rini Alamsyah SPd

KONTAK PERSON IKLAN/SIRKULASI HP. 0816 3134 392/0813 7539 5392 IKLAN DISPLAY/UMUM RP 6.000/MM FULL COLOUR RP 21.000/MM KANTOR REDAKSI JL. FLAMBOYAN RAYA/RAHARJA NO. 37 MEDAN TELP (061) 8213786, FAX (061) 8215552 NO. REKENING: 5310 - 01 - 004167 - 53 - 5 AN. SUNARDI, BANK BRI UNIT TANJUNG SARI MEDAN PERCETAKAN/PRA CETAK : PT. SELECTA UTAMA (Isi Diluar Tanggung Jawab Pra Cetak/Percetakan)

Walikota Medan Apresiasi Kinerja KPUM Medan, BN Koperasi Pengangkutan Umum Medan (KPUM) mencatatkan Sisa Hasil Usaha (SHU) tahun buku 2011 sebesar Rp 3,958 miliar lebih, atau meningkat sekitar 811% dibanding torehan SHU 2010 yang tercatat Rp 434,08 juta lebih. Perolehan SHU tersebut tersaji dalam buku laporan keuangan dan kinerja KPUM tahun buku 2011 yang dibagi-bagikan kepada peserta RAT KPUM yang digelar di Pardede Hall, Senin. SHU tersebut merupakan selisih dari total pendapatan sepanjang tahun 2011 sebesar Rp 15,611 miliar lebih dikurangi total pengeluaran senilai Rp 11,652 miliar. Total pendapatan tahun 2011 yang ditorehkan koperasi angkutan terbesar di luar Pulau Jawa itu yang tercatat sebesar Rp 15,611 miliar mengalami peningkatan sekitar 39,7% dibandingkan pendapatan tahun buku 2010 yang tercatat senilai Rp 11,174 miliar. Sedangkan pengeluaran tahun 2011 yang tercatat sebesar Rp 11,652 miliar, meningkat sekitar 8,53% dibanding tahun 2010 yang tercatat Rp 10,74 miliar. Ketua Umum KPUM T Ferdinand Simangunsong dalam sambutannya di hadapan Walikota Medan Rahudman Harahap dan ratusan anggota koperasi tersebut menyebutkan Kantor Akuntan

Publik (KAP) yang telah memeriksa laporan keuangan KPUM tahun 2011 dan dalam kesimpulannya menyatakan KPUM telah menyajikan laporan keuangan secara wajar dalam semua hal yang materiil. Ferdinand Simangunsong juga mengungkapkan, dalam kiprah KPUM selama 49 tahun mengasuh usaha angkutan yakni sejak berdiri 17 April 1963 telah berperan besar membantu warga dan Pemko Medan, khususnya di bidang penyediaan jasa angkutan. Kata Ferdinand, KPUM yang kini mengoperasikan sekitar 6.000-an unit angkutan (penumpang umum, taksi, dan Medan Raya Ekspress) serta 4.000-an betor telah mampu "menyuapi" sekitar 85.000 orang meliputi keluarga pengemudi, keluarga pemilik KPUM dan usaha kecil yang tumbuh atas ekses positif operasional KPUM. Ferdinand menambahkan, dalam operasionalnya KPUM selalu memberi subsidi kepada mahasiswa dan pelajar. Patokan ongkos teranyar adalah SK Walikota Medan No 1/2009 yang mematok ongkos penumpang umum Rp 2.600/estafet dan pelajar/mahasiswa Rp 1.600/per estafet atau masiswa/pelajar disubsidi Rp 1.000/ orang. Sedangkan kapasitas daya angkut KPUM menurut Ferdinand berkisar 1 juta

Pelaksanaan RAT KPUM dibuka oleh Walikota Medan Rahudman Harahap

penumpang setiap hari. "Jika sekitar 20% penumpang KPUM adalah pelajar, maka setiap hari KPUM telah mensubsidi sekitar 200.000 orang. Berarti jumlah subsidi yang diberikan KPUM berkisar Rp 200 juta/hari," kata Ferdinand seraya menyebutkan jika di luar negeri maka subsidi tersebut diganti

Galeri Saudara Hadir di Kota Medan

DPD SPINDO Sumut Gelar Seminar Nasional Jamsos Medan, BN Serikat Pekerja Sektor Informal Indonesia (SPINDO) menyatakan betapa pentingnya jaminan sosial (jamsos) bagi kesejahteraan masyakarat di Indonesia khususnya di Provinsi Sumatera Utara. Bahkan sesuai undang-undang, setiap warga negara Indonesia berhak mendapatkan jaminan sosial. "Sesuai dengan Undang-undang Dasar dan Pancasila bahwa jaminan sosial (jamsos) sangat penting bagi masyarakat. Sebab, setiap warga negara berhak mendapatkan jaminan sosial dari pemerintah, seperti selama ini dilakukan oleh negara lain," kata Ketua Umum DPP-SPINDO H Maliki SSos dalam sambutannya pada seminar nasional dengan tema "Jaminan Sosial Hak Semua Warga Negara" pada, Sabtu, di Hotel Danau Toba Internasional. Dia mengatakan, jamsos juga merupakan tiang penyanggah bagi kekuatan ekonomi negara. Untuk itu, betapa pentingnya jamsos bagi seluruh masyarakat baik pekerja sektor informal seperti pedagang, tukang becak, buruh, nelayan dan lain sebagainya. "Saya meminta kepada seluruh pengurus DPD SPINDO Sumut berjuang dan semangat untuk mengangkat harkat pelaku sektor informal dengan memfasilitasikan jamsos" ujarnya. Sementara itu, Ketua DPD SPINDO Sumut Jon Piter Silaen mengatakan Kementerian Tenaga Kerja dan Transmigrasi (Kemenakertrans) telah mendukung program kerja SPINDO terutama dalam program Jamsos dan pembudayaan usaha kecil untuk mengurangi pengangguran di Sumatera Utara (Sumut). DPD SPINDO akan selalu berupaya semaksimal mungkin untuk membantu kesejahteraan masyarakat khususnya di Sumut. Jon Piter berharap pemerintah daerah (pemda) di Sumut dapat mendukung dan berperan serta dalam program SPINDO. Mengingat pemerintah daerah terlihat masih setengah hati dengan kehadiran SPINDO di Sumut. Kehadiran SPINDO sendiri, akan dapat berjalan sesuai dengan harapan. Mengingat kehadiran SPINDO di Sumut merupakan gerakan yang pertama bagi pekerja sektor informal. Harapannya SPINDO di Sumut akan bersinergi dengan baik di seluruh pemerintah kabupaten/kota yang ada di Sumut. Dia menjelaskan keberadaan SPINDO di Sumut bertujuan memperkuat perekonomian sektor ekonomi informal bagi masyarakat yang berpenghasilan kecil. "SPINDO Sumut untuk memperkuat perekonomian sektor informal seperti para saudara kita supir angkot, tukang becak, pedagang kecil, pedagang kaki lima, petani, nelayan, pedagang keliling, kuli angkut, serta saudara kita yang saat ini masih termajinalkan," tegasnya. Dalam sambutannya, pihak Kemenakertrans diwakili Staf Ditjend Pembinaan Hubungan Industrial dan Jaminan Sosial Ketenagakerjaan Eti Sugiarti SH MM mengatakan selama ini pemerintah telah menerbitkan UU No 24 Tahun 2011 tentang Badan Penyelenggara Jaminan sosial (BPJS) yang merupakan instrumen pelaksana pasal 5 ayat 1 dan pasal 52 UU No 40 Tahun 2004 tentang Sistem Jaminan Sosial Nasional. "Saya harapkan dengan diberlakukannya jamsos bagi seluruh masyarakat tanpa terbatas oleh karena status pekerjaan, bisa membuat segenap masyarakat dapat menikmati jaminan sosial," tegasnya. Hadir dalam seminar nasional DPD SPINDO Sumut antara lain Ketua Umum Federasi Serikat Pekerja Badan Usaha Milik Negara (BUMN) H Abdul Latif Alqaff MSi, Ketua Umum Federasi Serikat Pekerja Seluruh Indonesia-TKI Luar Negeri HM Satya SH, Ketua Umum Kesatuan Buruh Marhaeinis Manganar Pasaribu dan Kepala Cabang PT Jamsostek (Persero) Medan Pangarapen Sinulingga mewakili Direktur Utama PT Jamsostek.(AHS)

Medan, BN Seni lukis merupakan suatu karya yang sangat berharga bagi pelukis maupun bagi penggemar lukisan tersebut. Dalam menjawab keinginan penggemar lukisan yang ada di Medan khususnya Sumatera Utara, kini telah hadir di Kota Medan, Galeri Saudara, Senin di Palladium Plaza Lantai Ground Floor GS : 25 No. 1-7, Medan Richard mengatakan bahwa Galeri Saudara ini merupakan galeri yang pertama di Kota Medan, yang sebelumnya ada di Jakarta yakni di Pantai Selatan dan galeri ini dibuka bertujuan agar masyarakat Kota Medan khususnya Masyarakat Sumatera Utara dapat mengenal atau-

pun tau tentang adanya Ibu Nyonya Roro Kidul. Serta semua lukisan Nyi Roro Kidul yang ada di sini terlebih dahulu di doakan. Richard menjelaskan tujuan kita buka Galeri Saudara ini supaya masyarakat Kota Medan khususnya Sumatera Utara dapat mengenal ataupun tau tentang adanya Ibu Nyi Roro Kidul tersebut dan semua lukisan yang ada di galeri kita ini merupakan lukisan asli. Ibu Nyi Roro kidul yang dilukis oleh Pelukis yang berasal dari pulau jawayang terkenal yakni F. Swandi semua lukisan kita yang ada ini terlebih dahulu didoakan jelasnya. Lebih lanjut Richard mengatakan bagi konsumen yang in-

gin lukisan ibu Nyi Roro Kidul boleh dating melihat mana yang disukai, lalu konsumen boleh memesannya serta langsung diantar ketempat alamat pemesan. Konsumen yang ingin membeli lukisan Ibu Nyi Roro Kidul boleh datang untuk melihat-lihat ke galeri Saudara dan konsumen bisa dapat langsung memesan lukisan yang ada kita juga siap untuk mengantar pesanan konsumen tersebut serta harga lukisan yang ada digaleri kita ini berkisar Rp. 2.5 juta sampai dengan Rp. 22 juta pun juga ada, bingkai dari pada lukisan kita adalah bingkai yang bagus sekali dan lukisannya asli yang dikerjakan pelukisnya, jelasnya. (AHS)

pemerintah. Pada kesempatan itu Walikota Rahudman Harahap dalam sambutannya sangat mengapresiasi kinerja KPUM yang telah membantu warga Kota Medan penyediaan angkutan. Dia berharap, ke depan pelayanan KPUM di bidang jasa angkutan semakin ditingkatkan. (AHS)

Staf Ahli Pertanian Menristek Kuliah Umum di ITM Medan, BN Memeriahkan Penyelenggaraan Demotech 2012, Staf Ahli Pangan & Pertanian Menteri Riset dan Teknologi (Menristek) Republik Indionesia (RI) Dr Masrizal akan memberikan kuliah umum kepada mahasiswa mesin perguruan tinggi nasional di kampus Institut Teknologi Medan (ITM) Jalan Gedung Arca Senin. DR Masrizal dalam kuliah umum tersebut akan menyampaikan tema "Pentingnya Peranan Teknologi dalam merubah pola pikir manusia demi kemajuan bangsa di Era Globalisasi". Demikian dikatakan Ketua Panitia Try Herwaman kepada Koran ini di Kampus ITM didampingi Ketua Himpunan Mahasiswa Mesin Arif Permana dan Kahumas ITM M Vivahmi Manafsah SH MSi, Hermawan menambahkan acara Demotech yang dilaksanakan mulai tanggal 16-21/4, Pembukaan Demotech 2012 akan secara simbolis dibuka Rektor ITM Prof Dr Ilmi Abdullah MSc, juga akan dihadiri Pembantu Rektor I,II, III dan IV, dosen dan pegawai di sejajaran ITM. "Berbagai kegiatan dilaksanakan Demotech 2012, diantaranya bazar buku, lomba kopetensi SMK Se-Sumatera Utara, pelatihan autocad se-Kota Medan, Pameran Karya Ilmiah 10 HMJ ITM dan Gebyar Musik."katanya Tujuan pelaksanaan Demotech adalah, untuk melatih mental siswa SMK dan menjadi wadah penyaluran kaulah muda di kota medan khususnya. "Demotech merupakan agenda tahunan HMM-ITM," ujarnya.seraya menambahkan kegiatan turut di sponsori Umatic dan Ristek. Kahumas ITM M Vivahmi Manafsah SH MSI, mengatakan, kegiatan Demotech 2012, merupakan kegiatan yang positif dilakukan HMM ITM, apalagi digelarnya berbagai perlombaan di kalangan pelajar SMK dan juga pelatihan autocap karenanya beliau mendukung sepenuhnya pelaksanaan acara tersebut " Saya harapkan kepada peserta yang tampil diajang perlombaan tersebut untuk menunjukkan kemampuannya masing-masing untuk membuat desain-desain terbaru." Katanya Khusus kepada staf Ahli Pangan & Pertanian Menristek RI DR Masrizal, Vivahmi mengucapkan terima kasih karena akan menyampaikan kuliah umum dikampus ITM.(AHS)

PT BPR ABC Targetkan Rp 8 Miliar Pada Penyaluran Kredit Medan BN, PT Bank Perkreditan Rakyat Asia Bintang Cemerlang (PT BPR ABC) menargetkan penyaluran kredit sebesar Rp 8 miliar pada 2012. Hal itu dikatakan Dirut PT BPR ABC, Mariana usai meresmikan gedung PT BPR ABC di Jalan Gunung Krakatau No 115 AB Medan, Rabu. "Kita menargetkan penyaluran akan dioptimalkan ke UKM," ujarnya. Mariana mengatakan, kehadiran PT BPR ABC diharapkan mampu menggali dan mengembangkan ekonomi yang merupakan pendukung otonomi daerah dengan meberdayakan pelaku usaha mikro. Acara dihadiri oleh pemegang saham PT BPR ABC, Hasan Basri, Kepala BI Medan, Nasser Atorf diwakili Dany Surya Sinaga, Gus Irawan Dirut Bank Sumut, Ketua Perbarindo Syarifuddin Siregar, tokoh masyarakat Sofyan Tan, dan pelaku usaha. Mariana mengatakan, PT BPR memiliki beberapa produk seperti tabungan yang terdiri dari Tabungan Bintang dengan bunga 4% per tahun, Tabungan Cemerlang dengan bunga 5% per tahun. Lanjutnya, deposito dengan jangka waktu 1 bulan dengan bunga 6% per tahun. Kemudian deposito berjangka

Pemegang Saham PT BPR ABC Hasan Basri (kanan) foto bersama dengan Direktur Utama Bank Sumut Gus Irawan selesai memberikan cendramata

waktu 3 bulan berbunga 6,5% per tahun, 6 bulan berbunga 7% per tahun, dan 12 bulan berbunga 8% per tahun. "Ada juga kredit modal kerja, kredit investasi, kredit konsumsi. Jaminan bisa berupa sepeda motor, mobil, surat tanah dan deposito," jelasnya. Dia optimis PT BPR ABC bisa menjadi lembaga keuangan yang tangguh, produktif, dan aman. Perwakilan Bank Indonesia (BI), Dany Surya Sinaga, mengatakan,

kontribusi BPR terhadap share perbankan secara keseluruhan sampai saat ini masih sangat kecil. Sinaga mengatakan total aset BPR per akhir Desember 2011 sebesar Rp 786 miliar, bank umum Rp 160 triliun, atau share ke Sumut sebesar 0,49% sedangkan share nasional sebesar 0,59%. "Di Indonesia ada 1.669 BPR dan ada 37 BPR selama 2011 yang dilikuidasi," sebutnya. Selama 2011, ucapnya, tercatat ada

2 BPR baru sehingga pada tahun itu jumlah BPR di Sumut sebanyak 60 unit. Dua BPR itu beroperasi di Pusat Pasar Medan dan Sibolga. Sementara pada 2012 ada dua BPR yang dicabut izin usaha karena tidak beroperasi dan tidak ada Dana Pihak Ketiga (DPK). "Diharapkan perkembangan UKM meningkat," katanya. Katanya, komitmen dari pemilik agar BPR tetap jalan dijalurnya. Dia mencontohkan penguatan pada Sumber Daya Manusia (SDM), meningkatkan hubungan dengan masyarakat sebagai salah satu penentu bisnis. Ketua Perbarindo, Syarifudin Siregar mengaku share BPR memang masih sangat kecil, apalagi di Sumut yang pertumbuhan ekonominya lebih tinggi dari nasional. "Jumlah BPR memang sedikit. Ini artinya, merupakan peluang untuk membuka BPR. DPK-nya akan tumbuh di atas Rp 100 triliun. Masih banyak peluang yang akan diraih. BPR adalah asli bank masyarakat mikro dan untuk rakyat setempat," jelasnya. Menurutnya hasil dari BPR akan dinikmati masyarakat. Dia berharap agar masyarakat sekitar menyimpan dana di BPR karena menawarkan bunga lebih tinggi. . (AHS)

Perwakilan Jakarta: Suryadi, Medan: Heru Indrabudi, Darta Lubis, Andi Utama Nasution, SE, Wiryanto Hadi, Friyadi, Fernando Meliala, Brav Shandy Meliala. Biro Belawan: Jakfar Latif, Herry Susanto Sitepu, Suriono. Sub Biro Medan Utara: Ahmad Muhajir, M. Saleh, Ismail Ahmad, M. Yakup. Sub Biro Amplas : Saulus Panjaitan. Binjai/Langkat: Munir Rangkuti (Ka.Biro), Sabar Gurusinga, Sulaiman, Mimpin Sitepu, M. Hayat, Ruslan AG, Dedi Nupita Sitepu, Samsul Bukit, Hendera Ginting, T. Zulfikardin, Jumadi, Grensi Ginting, Rusdi. Langkat Hilir: Irfan Nasirin ST (Ka.Biro) Deli Serdang: Juni Asian Tampubolon SP (Ka.Biro), Sofian Syukri Lubis (Waka Biro), Rukun Tarigan, SH, . Tanah Karo: Farhan Parinduri (Ka. Biro), Aman Harahap Sub.Biro Pancur Batu: Friyadi, Amd. M Rizal Effendi Bako,SPdi, . Serdang Bedagai: Ibnu As (Ka.Biro), Raman Adjiman, Suherman. Tebingtinggi: Dirlan Effendi Ritonga (Ka.Biro). P Siantar/Simalungun: Drs Edward Pakpahan (Ka.Biro), Erikson Pakpahan, Drs. Kaliderman Siregar. Batubara:Dasri Tanjung, Eko, S, Sunaryo Wijaya, Jamilah, Parlin Tampubolon. Asahan/Tanjungbalai: Hamdan Samosir (Ka. Biro), Hariadi, Wahidun. Labuhanbatu: Ihsanul Siddik Daulay, SH (Ka. Biro). Kotapinang/Labusel: Syamsul Siregar, Firman Hasibuan. Aek Kanopan/Labura: Sriwaty Sinuraya (Ka. Biro), L. Parulian Simarmata, SE, Ali Usman Silalahi. Sumbagut: Mhd Syahrul Hasibuan SH, Sutardi, Supendi. Dairi: Mangisi Lumban Gaol (Ka.Biro), Jiki Sagala (Waka Biro), Loedeik Simamora, Meslin Br Sigalingging, Duat Sianturi. Pakpak Bharat: Yusuf Manik (Ka.Biro). P Sidimpuan/Tapsel/Paluta: Sugiono SP (Koordinator), Safruddin Pulungan (Ka. Biro), Muhammad Srg, Baun Aritonang, Hasanuddin Siregar, Ibnu Saad Harahap, Unggul Fahmi Hasibuan. Kotanopan/Madina: -. Padang Lawas Selatan: Ali Akbar (Ka. Biro).Humbang Hasundutan: Mangatur Silaban (Koordinator), Rikardo Simamora (Ka. Biro), Chuharto Simamora, Pardomuan Silaban. Biro Taput: Mangatur Silaban (Ka. Biro) .Biro Tobasa: Risman Siboro (Ka. Biro), Donny Sinabutar Biro Tapteng/Sibolga/Nias: - Perwakilan Riau/Kepri: EPP. Ringo-ringo, SE. Korwil Riau/Kepri: Rudi Sirait. Pekanbaru: Jaraya Garingging, S.Sos. Siak: Nujum Sitepu (Ka.Biro), Jansen Hutahaean, Jaraya Garingging, S.Sos. Pelalawan/Pkl.Kerinci: EPP. Siringoringo (Ka.Biro), Ryan Ade Liany, ST, Andi Usman, Lingkon S. Dumai: Albekri, Tengku Kamaruddin, Belwiyono, MG, Suhartono, Elias G.S.M Sidabutar. Bengkalis: Mahir Ritonga, Misron Tarihoran, Parulian Manurung, Novalis P. Hutahaen, Irwansyah Nasution, Alwi. Rokan Hilir (Rohil): Juminan (Ka.Biro), Basri M Noer, Supryanti, Julientri. Biro Rokan Hulu: -. Biro Kampar: -. Perwakilan Aceh: T Muktarruddin US - . Biro Banda Aceh/Aceh Besar: T Muktarruddin US (Ka. Biro), Ibrahim Yusuf, Chandra. Biro Pidie/Pidie Jaya: Mahdi Aziz, SHi. Biro Langsa/Aceh Timur: Mustafa M. Adami, Syamsudin Arsyad. Aceh Tamiang: Rudi Kurniawan, Baihaki Ahyat, ST, Ir Fadly-. Biro Aceh Singkil/ Subulussalam: Rahmin Banchin (Ka. Biro), Henri, B,SE, Bolon. Biro Aceh Jaya: Syarkawi. Biro Kutacane: . Lhokseumawe: M Fauzi, Jamaluddin, S.Sos. Aceh Utara: M Suud, Ramli, Sayed Fauzi. Biro Blangkejeren/Gayo Lues: Antoni Nasipul. (WARTAWAN BONGKAR NEWS DILENGKAPI IDENTITAS DAN NAMANYA TERCANTUM DALAM BOKS REDAKSI)

23-30 APRIL 2012 | EDISI 312| THN KE-VII

Terminal Tidak Difungsikan, Retribusi Kendaraan Dijalanan PANGKALAN KERINCI, BN Ketua Asosiasi Pengusaha Indonesia (Apindo) Kabupaten Pelalawan Rusdianto meminta kepada Dinas Perhubungan tidak melakukan pengutipan retribusi kendaraan bermotor di jalanan, melainkan agar dapat diarahkan masuk kedalam terminal. "Saya meminta kepada Dinas perhubungan kabupaten Pelalawan agar tidak mengutip retribusi di jalanan kepada sopir angkutan umum, sebab kita tidak mau kutipan yang dilakukan oleh petugas dianggap pungli, ini saya sampaikan sebab beberapa pemilik PO angkutan umum melaporkan kepada saya agar hal ini bisa di tertib dengan melakukan kutipan di dalam terminal," ujar Rusdianto pada wartawan, Rabu (18/4/12) di

Ustad Yusuf Mansur Kagum dengan Perkembangan Pelalawan Pelalawan, BN Bupati Pelalawan HM Harris beberkan kondisi kehidupan keagamaan ditengah masyarakat kabupaten Pelalawan pada Ustad Yusuf Mansur saat didaulat menjadi Pemeberi tausiah pada acara tablik akbar di Gedung Daerah Laksamana Mangkudiraja di Pangkalan Kerinci, (17/4/12). Menurut Bupati, dikabupaten Pelalawan terdapat tiga agama yang berkembang ditengah masyarakat namun jumlah penganut agama islam sebanyak 76 persen dan sebanyak 24 persennya masyarakat menganut agama Kristen dan Budha. Dengan jumlah 24 persen jumlah penduduk beragama Islam di daerah menunjukan masih tingginya tingkat pengamalan ibadah ditengah masyarakat didaerah ini. "Memang didaerah ini ada terdapat sebanyak 46 gereja, namun tentu semua pemeluk agama berlomba dalam mengembangkan agamanya masing-masing. Begitu juga didaerah ini terdapat semua suku dari berbagai provinsi yang ada di negara kita ini. Sementara warga negara asing ada dari sebanyak 18 negara didaerah ini," ujar Bupati. Didaerah begitu pesat perkembangan penduduknya dimana pada tahun 2000 lalu penduduk Kabupaten pelalawan hanya sekitar 120 ribu lebih tapi sekarang sudah mencapai 300. ribu lebih penduduknya. Hal itu disebabkan kondisi letak geografis sangat startegis dan invenstasi didaerah ini begitu cepat pertumbuhannya. Sementara Ketua Badan Wakaf Pendidikan Islam At Taqwa Pelalawan, H Syaudi Sahab selaku panitia pelaksana kegiatan tablik akbar dalam kata sambutanya mengaku bahwa pihaknya sangat berterima kasih pada Bupati pelalawan yang telah mensupport pelaksanaan acara tausiah ini sehingga bisa berjalan dengan lancar. "Sebenarnya keberadaan yayasan badan Wakaf Pendidikan Islam Attaqwa bukan hanya milik PT.RAPP tapi milik semua umat islam yang ada didaerah ini dan milik negara ini," tegasnya. Kemudian ustad Yusuf Mansur selaku Pengasuh PPA Darul Qur’an Jakarta yang didaulat untuk memberikan tausiah pada peserta yang hadir yang kebanyakan dari kalangan Para pejabat Pemkab pelalawan, para pegawai PNS dan para pengurus Persatuan persaudaraan haji Indonesia(PPHI) Pelalawan dalam kata sambutan pembukaannya menuturkan bahwa dirinya sangat kagum dengan perkembangan pembangunan ekonomi didaerah ini. Karena itu dirinya suatu saat bisa berkunjung untuk berjualan ke daerah ini nantinya.(ringo)

Empat Perwira Polres Pelalawan Disertijab PANGKALANKERINCIEmpat perwira Polisi dari dilingkungam Polres Pelalawan Jum’at (20/4/12) Disertijabkan. Serah terima jabatan ini dilaksanakan dengan melaksanakan upacara serah terima jabatan yang dipimpin langsung oleh Kapolres Pelalawan AKBP Guntur Aryo Tejo di aula Teluk Meranti Kompleks markas Polres Pelalawan. Keempat Perwira yang disertijabkan diantaranya Wakapolres Pelalawan Kompol Jon Wesli digantikan oleh Kompol Robin Lumban Raja, selanjutnya Kasat Sabara Polres Pelalawan AKP.Zulkifli Ahmad digantikan oleh AKP Firdaus, Kapolsek Pangkalan Lesung AKP Anisman digantikan oleh AKP Sudino Manulang dan terakhir Kapolsek Kerumutan Iptu Adi Pranyoto digantikan oleh Iptu Sahardi SH. Dalam sambutanya, Kapolres pelalawan AKBP Guntur Aryo Tejo mengatakan bahwa Mutasi jabatan ini suatu hal yang biasa di jajaran kepolisian demi meningkatkan kinerja dan promosi jabatan akan mendapat kepercayaan menjabat jabatan baru, untuk itu kepada pejabat yang baru selamat bertugas dalam memberikan pelayanan kepada masyarakat agar lebih baik lagi, sedangkan pejabat yang lama kapolres juga mengucapkan ribuan terimakasih atas kerja sama yang telah memberikan pelayanan maksimal terutama pengamanan Kantibmas. Selanjutnya Kapolres Juga berpesan kepada para pejabat yang baru bahwa selama tiga bulan terakhir ini sejumlah kasus Curat, Curanmor dan lakalantas di wilayah hukum Polres Pelalawan mengalami peningkatan, hal itu di tandai dengan semakin nekatnya para pelaku Curat menjalan aksinya dan bahkan tak tanggungtanggung mereka melakukannya dihalamaan masjid dimana korbannya sedang menjalankan ibadah sholat berjamaah. “Maka dari itu saya berpesan kepada para pejabat yang baru agar dapat memaksimalkan pengamanan terlebih lagi kita sebagai polisi di tuntut untuk dapat memberikan pelayanan dan juga bisa memberikan jaminan rasa aman kepada masyarakat, paling tidak mengurangi angka kejahatan diwilayah hukum di masingmasing daerah, semoga dengan pelayanan yang maksimal kita berikan kepada masyarakat semoga tindak kejahatan yang mulai menonjol dapat di kurangi,” tandas Kapolres.(ringo)

Pangkalan Kerinci. Lebih lanjut Rusdianto mengatakan, kutipan yang dikenakan oleh Dinas perhubungan kepada para sopir angkutan seharusnya dipungut di dalam terminal, bukan di luar terminal sebab hal ini dapat menimbulkan kesan kalau kutipan tersebut terkesan pungli. "Kan lebih bagus dikutip di dalam terminal dengan memasukan kendaraan umum itu kedalam terminal dan di kutip di dalam terminal, selain itu juga apabila di kutip di luar maka dapat membahayakan bagi para pengutip retribusi itu sendiri dari kecelakaan," Katanya. Menanggapi hal ini Kadishub Kabupaten Pelalawan, Tengku Ridwan Mustafa mengatakan, bahwa pihaknya melakukan kutipan tersebut sah

sesuai dengan aturan dan kutipan retribusi itu sendiri menurutnya sepenuhnya sebagai PAD. "Kutipan yang kita lakukan di simpang Lago Pangkalan Kerinci itu sah sesuai dengan aturan. Itu kita lakukan untuk peningkatan PAD kita." Kata Riwan. Terkait pengutipan yang dilakukan dijalanan dan tidak dilakukan di dalam terminal, Tengku Ridwan mengatakan bahwa memang seharusnya demikian, namun karena saat ini terminal nya tidak resperentatip sehingganya kendaran tidak lagi masuk terminal maka kutipan dilakukan di luar terminal. "Terminal kitakan tidak memadai dan kurang resperentatip, oleh karenanya retribusi yang kita

Menganggap Tidak Sejalan dengan Pemda Pelalawan

Kepala Desa Mekar Jaya Mengundurkan Diri PELALAWAN, BN Tertanggal 18 April lalu, M Syawaladin H resmi mengundurkan diri dari jabatannya sebagai Kepala Desa Mekar Jaya Kecamatan Pangkalan Kerinci. alasan pengunduran dirinya syawal sebagai kepala desa menganggap tidak sejalan dengan roda pemerintahan daerah kabupaten pelalawan berbagai kebijakan dan program yang di tawarkan kepada pemerintah pelalawan sebutnya namun tidak di indahkan hal in menjadi alasan utamanya Syawal mengungkapkan rela menghibahkan tanah sebanyak satu hektar kepada masyarakat termasuk terminal 5,menit yang disebut sebut didesanya sangat ironis motif apa yang sesunnguhnya yang membuat kades mekar jaya ini mundur sementara kepala desa ini baru dilantik Mei 2010 lalu, namun secara garis besarnya disebutkan dia merasa sudah tidak mampu lagi menjalankan tugas sebagai kepala desa terkait permohonannya menggantikan satuan perangkat desa yang ada sebelumnnya hal ini membuat nya sangat tertekan dalam menjalankan tugasnya sebagai aparat /kepala desa "Ya saya baru saja menerima surat pengunduran

diri saudara M Syawaladin H sebagai Kepala Desa Mekar Jaya. Alasannya, berdasarkan surat pengunduran itu yang bersangkutan merasa tidak mampu lagi menjalankan tugas sebagai kepala desa," kata Camat Pangkalan Kerinci, Drs Novri Wahyudi yang membenarkan adanya salah seorang kepala desa yang mengundurkan diri. Novri menjelaskan, berdasarkan surat pengunduran diri yang memakai kop surat desa setempat dengan nomor : 140/Ds.MJ/IV/2012/004 dan ditanda tangan langsung M Syawaladin dan ditujukan kepada Bupati Pelalawan itu, M Syawaladin yang baru menjabat selama dua tahun masa berjalan juga meminta Bupati Pelalawan secepatnya memberikan surat keputusan pemberhentiannya, demi kelancaran roda pemerintahan di Desa Mekar Jaya. "Surat pengunduran diri kepala desa ini baru saja diantar ke Bupati Pelalawan dan tembusannya kepada saya dan diantar langsung oleh sekdes," terangnya. Terkait pengunduran diri M Syawaladin itu pula, Novri mengatakan juga segera mengirimkan surat kepada Bupati Pelalawan untuk menunjuk saudara Yuyu yang saat ini menjabat sebagai Sekretaris Desa sebagai pejabat sementara (Pjs) Kepala Desa Mekar

Jaya. "Roda pemerintahan dan pelayanan public harus tetap berjalan dan tidak boleh vakum yang mengakibatkan banyak kendala nantinya. Jadi setelah surat pengunduran diri M Syawaladin sebagai kepala desa, saya juga tentunya juga harus mengambil kebijakan dengan mengajukan permohonan kepada Pak Bupati Pelalawan agar ditetapkan Pjs kepala desa, ya Sekdesnya saja yang diusulkan sementara menunggu surat pemberhentian keluar," ujar Camat Pangkalan Kerinci. Seiring pengunduran dirinya sebagai orang nomor satu di Desa Mekar Jaya yang sebelumnya dikenal dengan Desa Bukit Agung ini, M Syawaladin juga menanda tangan penyerahan satu uni sepedamotor dinas kepala desa jenis Suzuki Thunder. Sementara itu, meski Camat Pangkalan Kerinci menolak menyebutkan detil permasalahan yang terjadi di Desa Mekar Jaya yang membelah KM 59 Jalan Lintas Timur itu sehingga mundurnya kepala desa terkait, namun dari berbagai informasi yang beredar di masyarakat setempat, pengunduran diri M Syawaladin ini terkait tidak harmonisnya hubungannya dengan perangkat desa yang lain, sepeti BPD.(ringo)

Ganti Rugi Lahan Pipa Gas PT Kalila Dipertanyakan PELALAWAN Ganti rugi jalur pipa gas, dari Langgam ke Sungai Duku Pekanbaru untuk pembangkit listrik dipertanyakan karena dinilai aneh oleh banyak kalangan. Pasalnya, hanya Kepala Desa Simpang Beringin Kecamatan Bandar Sikijang, Kabupaten Pelalawan yang dilibatkan oleh perusahaan tanpa mengikutkan Pemda setempat termasuk bupati. Menurut warga yang namanya tidak ingin disebutkan pada media ini, Sabtu (21/04/12) menyampaikan, bahwa dalam proses ganti rugi ini dirasakan aneh, karena hanya melibatkan Kades, M. Arifin. Lahan yang akan diganti rugi oleh perusahaan PT Sarana Pembangunan Riau (SPR) dengan total Rp 21 Miliar. uang sebesar itu, hanya dikelola oleh Kades Simpang Beringin Kecamatan Bandar Sikijang. Berdasarkan informasi uang untuk ganti rugi tanah tersebut belum dibagikan ke warga desa Simpang Beringin Kecamatan Bandar Sikijang, ini sengaja didiamkan oleh Kades pada pemilik lahan. Pantauan dilapangan, lahan warga saat ini telah dikerjakan pembangunanya untuk jalur pipa gas milik PT Kalila, tanpa kejelasan ganti rugi lahan. Menurut informasi warga, Kepala Desa Simpang Beringin, Kecamatan Bandar Sei Kijang, Kabupaten Pelalawan, Riau, M. Arifin

diduga telah menerima uang fee pembebasan lahan tersebut sebesar Rp 2,1 milyar dari PT. Kalila, uang tersebut diberikan melalui perusahaan, PT. SPR (Sarana Pembangunan Riau) "Kades terima uang dari SPR sebanyak Rp 2,1 Miliar," ujarnya. PT. SPR adalah salah satu dari tiga perusahaan yang memenangkan tender yang telah dilaksanakan oleh PT Kalila, sebelum

pekerjaan ini dilaksanakan PT SPR bertugas untuk membebaskan lahan tempat jalur pipa dengan total ganti rugi lahan warga total keseluruhanya sekitar Rp 21 miliar dan ketentuan fee untuk Kepada Kades sebesar 10 persen dengan tugas sebagai menghubungi warga yang lahannya terkena jalur gas tersebut. Dalam melaksanakan tugas pembebasan lahan tersebut, sejumlah RT dan RW di desa Simpang Beringin Bandar Sikijang juga dilibatkan untuk mendata lahan-lahan warga yang dilalui pipa gas PT Kalila. Tak hanya itu, warga Simpang Beringin beberapa waktu lalu juga telah dikumpulkan oleh Kades di Balai Desa Simpang Beringin untuk menyampaikan persoalan ganti rugi tersebut. "Satu batang pohon sawit diganti rugi Rp 1 juta, dibawah 3 tahun Rp 600 ribu. Sementara untuk lahan diganti rugi dari Rp 30-60 ribu permeternya," ujar warga. Saat hal tersebut dikonfirmasi kepada Kades Simpang Beringin Bandar Sikijang, M Arifn di rumahnya membantah hal tersebut. Diakuinya, telah menerima uang ganti rugi melalui PT SPR bukan untuk warga tetapi untuk lahan miliknya serta keluarganya. Sedangkan Humas PT Kalila yang dihubungi melalui handphone berkali-kali tak diangkat demikian juga SMS yang dikirimkan juga tidak ada balasan.(ringo)

MTQ VIII Tingkat Kecamatan Siakkecil Berjalan Sukses dan Meriah Sei Pakning ,BN Pelaksanaan MTQ VIII tingkat kecamatan siak kecil di pusatkan di desa Tanjung Belit berlangsung sukses , acara MTQ ini di buka oleh Bupati Bengkalis Herliyan Saleh pada 17/4 minggu lalu, acara MTQ tahun 2012 tingkat Kecamatan Siak Kecil ini cukup Penuh Hikmat. Bupati Herliyan Saleh dalam sambutannya mengharapkan dan mengajak umat untuk mensiarkan Islam demi untuk meraih kemenangan yang hakiki dalam menyungsung masa depan yang cemerlang Gemilang. karena itu menurut Bupati agar memasyarakatkan program mehgrib mengaji. ini adalah dalam untuk membentuk masyarakat yang Islami dan benar-benar mencintai dan memahami makna inti dari AL Quran ujar Herliyan Saleh. Sementara itu camat Siak Kecil di lubuk Muda Syafruddin dalam pembukaan MTQ ini memaparkan , mari jadikan acara pelaksanaan MTQ ini sebagai wahana untuk menggali potensi, minat dan bakat menuju generasi Qur”ani yang unggul , Cerdas, agamai dan berakhlakkul karimah menuju

Situasi di Areal PT MUP Sudah Kondusif PELALAWAN, BN Pasca terbakarnya sebuah truk milik PT Mitra Unggul Perkasa (MUP) di Langgam Senin malam, polisi dan aparat pemerintah setempat berkoordinasi mengendalikan situasi Kamtibmas. Kepala kepolisian Subsektor Langgam, Iptu Sahardi kepada Riau Pos mengatakan, situasi Kamtibmas di kawasan tersebut ebrangsur pulih. Tidak ada konsentrasi massa dari kelompok warga maupun karyawan perusahaan. "Kita terus berkoordinasi dengan pihak kecamatan, pemerintah desa dan juga tokoh masyarakat. Hari ini situasi cukup kondusif, namun kita dari kepolisain Seubsektor tetap melakukan pemantauan wilayah bersama-sama dengan intel Polres," ungkap Iptu Sahardi Rabu kemarin Diakuinya bahwa pada Senin malam warga karyawan PT MUP berkumpul di sekitar lokasi kejadian pembakaran truk. Namun konsentrasi massa itu dapat telah terkonfirmasikan tidak untuk melakukan penyerangan. Tetapi hanya sebatas reaksi spontan warga karyawan yang didorong rasa ingin mengetahui apa yang tengah terrjadi. "Kalau menurut versi mabajemen perusahaan, tidak ada upaya mobilisai massa. Yanga da adalah orang pada berdatangan ke TKP untuk melihat ada apa. Kemudain malam itu juga kita menghimbau masyarakat jangan melakukan hal-hal yang tidak diinginkan. Kita minta pulang ke rumah masing-masing, dan itu mereka patuhi," imbuhnya. Saat ditanya pihak mana yang melakukan pembakaran truk, dikatakan Sahardi, hal tersebut masih dalam penyelidikan Polres Pelalawan. "Belum tahu, sekarang perkaranya ditangani Satreskrim Polres Pelalawan berdasarkan laporan pihak korban. Kita dari Subsektor lebih fokus pada tindakan pengendalian situasi," imbuhnya lagi. Sejauh ini pihak Polres Pelalawan telah memeriksa sejumlah saksi dari pihak pelapor. Para saksi antara lain sopir truk yang dibakar, dan beberapa orang karyawan yang pada saat peristiwa terjadi berada di dekat TKP. "Untuk saksi pelapor sudah memberikan keterangan. Kabarnya dari masyarakat akan dipanggil penyidik Polres dalam dua atau tiga hari kedepan. Karena sudah ada anarkis, kemudian dilaporkan. Maka tentu saja kepolisian melakukan penyelidikan. Perkembangannya silahkan Tanya ke Polres saja," kata Sahardi. Kapolres Pelalawan AKBP Guntur Aryo Tejo SIk membenarkan kalau pihaknya tengah menyelidiki kasus tersebut. Siapapun pelakunya, akan diproses sesuai hukum yang berlaku. Namun pihak Polri dan pemerintah setempat tetap memberi ruang bagi para pihak untuk menyelesaikan (ringo)

Warga Dumai Harapkan Percepatan Penanggulangan Banjir

Astaka MTQ VIII Tingkat Kecamatan Siak Kecil Di Desa Tanjung Belit

Insani yang bersih, sportif, berkualitas dan berprestasi ujarnya. untuk acara MTQ ke VIII tingkat Kecamatan Siak kecil tahun 2012 – 1433 H ini di ikuti peserta dari 13 Desa berjumlah 182 orang, acara berlangsung selama 4 hari di mulai dari 17/4 s/d 20/4 2012, berjalan dengan lancar dan tertib penuh dengan Hikmat sebut Ketua panitia penyelengara MTQ ini Hazly selaku Sekcam Siak Kecil menjawab BN. uSementara itu menurut Kepala Desa Tanjung

Belit Joko Margono, dengan di adakannya MTQ ini, yang utama adalah untuk di jadikan Moment berharga dalam membangun semangat anak-anak kita generasi muda, untuk dapat mendalami dan memahami makna yang terkandung di dalam AL Quran , di harapkan menjadi modal untuk kehidupan keseharian, dan menjadi tauladan bagi sesama umat manusia menuju jalan yang di Ridhoi oleh Allah SWT. ujar Joko Margono mengakhiri. (Sirait/ Ritonga)

Tanah Lahan Kelompok M. Nurza dan Sulaiman Dikapling dan Dijual Dumai:BN Persoalan masalaha penyerobotan tanah merupakan kejahatan yang belum teratasi hingga kini masih terus menggila di Sungai Sembilan Dumai, kali ini lahan tanah dari warisan atau peninggalan keluarga besar Penghulu pertama Batu teritip tahun 1918 (Penghulu Makdan-red), di perkirakan dari lahan warisan itu seluas puluhan Ha telah di gasak mafia tanah di jual pada warga asal Sumatra Utara dan Sumatra barat, dari gejolak dan merajalelalanya aksi penyerobotan lahan di Sungai Sembilan di duga “bisa terjadi peristiwa Mesuji ke3 setelah lampung, Labuhan Belawan yang berujung memakan korban hal ini harus segera ada langkah konkrit dari aparat berkompeten. Keterangan di peroleh media ini , sesuai di jelaskan ahli waris Makdan , kita yang merupakan keturunan atau waris dari Penghulu Makdan sampai matipun tetap mempertahankan Hak warisan itu, karena lahan tersebut sejak dahulu memang di usahai dan disana keluarga bertempat tinggal tegas Sulaiman Nurza yang menyandang gelar panglimo Bungsu itu pada BN sabtu 21/4, menurutnya lagi lahan tersebut di garap semena mena oleh pihak pihak yang berlindung di balik Koperasi DARMA SAWIT, dan peraktek peny-

ambil dari kutipan pada saat ini dilakukan di luar terminal karena para sopir juga enggan masuk terminal sehingganya mau tidak mau retriobusi diambil dipinggir jalan menjelang kita memiliki terminal yang resperentatif," jelasnya. Namun demikian sampai sejauh ini pihak Dishub belum mendapat keluhan secara lisan dan tertulis terkait keberatan dari masyarakat atau organda adanya kutipan yang diambil di pinggir jalan tersebut. "Namun bagitu kita akan upayakan bagaimana dalam waktu dekat pemerintah kabupaten Pelalawan memiliki terminal sehigganya retribusi yang kita ambil ini bisa dipungut didalam terminal," ujarnya.(ringo)

erobotan terhadap lahan warisan kami tersebut hingga sekarang masih terus berlangsung ujar Sulaiman. Untuk di ketahuai jelas sulaiman lagi, bahwa orang tua dan nenek moyang kami beberaa tahun yang silam berangkat meninggalkan tempat itu yakni meninggalkan Desa Parit Makdan di Tiangjong, namun lahan tersebut tidak pernah di perjual belikan kepada siapapun. dimana Tiangjong sekarang jadi ibu kelurahan yaitu Kelurahan Batuteritip kecamatan Sungai Sembilan, ketika zaman itu masyarakat di tiangjong takut mati di bunuh perampok , yang datang dari pulau ketam Malaysia yang di kenal pasukan Tentara Bintang merah, ini semua orang turunan Cina sebut nya, tindakan beringas perampok ini tidak berprikemanusiaan , banyak waraga yang mati di bunuh dan harta di rampok oleh tentara Bintang Merah jahanam itu , peristiwa bunuh membunuh itu membuat masyarakat harus menyelamatkan diri tegasnya Sesuai penjelasan di rangkum di Sungai Sembilan, pihak pihak yang bermain di duga menjual lahan itu dengan berkedok koperasi, yang bernama Koperasi Darma Sawit ,sampai sekarang para penyerobot lahan warisan kami tersebut masih terus berlangsung memperjual belikan pada orang pembeli sebut sulaiman yang baru saja kembali dari lahan di Tiangjong , dikatakan

lahan itu di jual kepada pembeli yang berasal dari luar daerah Dumai. untuk melindungi dan di duga mempermulus upaya dalam menguasai lahan itu mereka berkedok Koperasi, sementara berdasarkan informasi resmi kita peroleh Koperasi Darma Sawit sudah di bubarkan pemerintah pada Maret 2012 belum lama ini tegas Panglimo Bungsu itu sembari menyebutkan pengurus koperasi Darma Sawit itu adalaha Sembiring, Syukri dan Anggiat Raja Gukguk kata Sulaiman. Saat di konfirmasi BN,Apa ? langkah dari waris selaku keluarga besar dari Penghulu Makdan? Untuk ini dalam waktu dekat kami segera bergegas kelapangan melakukan evaluasi terhadap lahan tersebut untuk melihat nyata seberapa banyak yang sudah di lego atau di jual pada pihak lain selain itu kita memasang Plangkat di lokasi lahan tersebut, perlu di ketahui kata Sulaiman lagi apapun alasan mereka itu bukan hambatan buat kita yang artinya tetap harus kami hadapi di dalam jalan kebenaran sebagai pewaris dari Penghulu Pertama Batuteritip, kita tetap menempuh langkah jalur persuasife, tetapi bila tidak dapat dengan cara baik-baik lagi yach, kita lihat lah nanti apapun yang terjadi kita tidak akan Mundur tegas Sulaiman Nurza. (RDS/Tengk/Yono)

Dumai:BN Keluhan masyaralat terhadap persoalan banjir yang sudah sekian lama sampai sekarang belum nampak titik terang penanganan penagggulangannya. padahal banyak warga yang sejak lama mengeluhkan genangan banjir setiap hujan turun deras di tambah lagi dengan pasang keeling air laut. kerugian masyarakat tidak sedikit bahkan akibat genangan banjir itu warga Dumai yang ada di beberapa titik rawan terendam banjir merupakan jadi bulan-bulanan banjir yang harus menderita hingga sekarang. Berbagai kalangan mendesak tentang konsep penanganan penanggulangan banjir yakni Pemko Dumai selalu mengatakan sedang menyiapkan Detail Engginering Desain (DED) namun sampai saat ini penerapan penanggulangan tersebut belum kunjung terealisasi. bahkan karena persoalan banjir ini banyak warga mengadu ke DPRD Dumai agar Aspirasi Masyarakat yakni terutama Pemko Dumai di harapkan dapat mengatasi banjir yang selama ini melanda masyarakat. Bukan rahasia dan memang kenyataan usia Dumai menjadi kota kini telah13 tahun namun masyarakat masih terus mengelukan persoalan banjir. pada umumnya warga masyarakat yang berada di tempat yang sering di landa banjir khususbya dalam wilayah Kota Dumai. warga masyarakat ini mengharapkan untuk secepanya masalah banjir tersebut dapat di tangani dan teratasi. sehingga masyarakat terlepas dan selamat dari petaka bencana banjir yang sudah puluhan tahun menanggung penderitaan ujar beberapa anggota masyarakat baru-baru ini menjawab BN di jalan Kamboja Dumai yang sedang mengkuras air genangan banjir di dalam Rumah. Harapan berbagai pakar dan pengamat maupun Politisi di Dumai senada dengan yang di dambakan masyarakat agar Pemko Dumai dapat secepatnya menangani persoalan banjir tersebut. kalau lah Pemko sedang mencanangkan Desain penanganan banjir sebaiknya di upayakan agar cepat terealisasi sehingga masyarakat dapat merasakannya sebab sudah Empat kali berganti Walikota Dumai dengan yang sekarang namun yang di harapkan semoga program Pro Rakyat Pemko Dumai sekarang dapat terealisasi ujar sejumlah tokoh warga yang tidak mau di tulis namanya yang meminta Pemko Dumai dapat memperioritaskan penanganan banjir tuntas dan Air Bersih dapat di nikmati masyarakat Dumai ujar warga itu mengakhiri. (Sirait/Tengk/Yono)

23 - 30 APRIL 2012 | EDISI 312 | THN KE-VII

FSWL-SS Desak Poldasu Copot Kapolres Siantar Medan, BN Puluhan massa dari Forum Solidaritas Wartawan dan Lembaga Swadaya Masyarakat Siantar dan Simalungun [FSWL-SS] mendatangi Mapolda Sumut, Kamis[19/4] mendesak Polda Sumut mencopot Kapolres Pematang Siantar AKBP Alberd TB Sianipar dari jabatannya karena tidak professional melakukan penyelidikan kasus pencemaran nama terhadap wartawan dan LSM yang dilakukan Walikota Pematang Siantar Hulam Sitorus SE. Desakan yang diajukan puluhan massa FSWL-SS itu merupakan rentetan dari laporan pengaduan Nomor STPL/

67/III/2012/SU/STR tanggal 12 Maret 2012 dan pengaduan ke Bidang Profesi dan pengamanan [Propam] Poldasu tanggal 29 Maret 2012, namun tidak ada kejelasan hingga saat in dari kepolisian. Ditegaskannya Kapolres Pematang Siantar, Kasat Reskrim serta penyidik tidak professional sebab seharusnya penyidik memanggil dan memeriksa wartawan yang menerbitkan pemberitaan di Harian Metro Siantar dan Simantab . Pernyataan Walikota Pematang Siantar Human Sitorus SE "Pers dan LSM Penghambat Demokrasi dan Pembangunan serta membahayakan Negara"

Poldasu Tangkap Agen Judi Togel Dairi Medan, BN Polda Sumut menangkap seorang tersangka agen judi toto gelap[togel],Anto Tamba[35] warga Jalan Batu Kpur Keluruahan Kuta Gambir Kecamatan Sidikalang Kabupaten Dairi, Rabu[18/4] sekitar pukul 22.00 WIB dirumah kediamannya dan dari tersangka disita lima buah HP dan 248 lembar rekap togel. Di Mapoldasu tersangka mengemukakan nomor judi togel yang keluar dari Singapura dan Hongkong dengan sistim putaran Senin, Rabu, Kamis, Sabtu dan Minggu. Omset sekali putaran Rp.4 juta hingga Rp.5 juta. Gaji yang kuterima tiga persen dari omset dan sudah menjalani sejak November 2011. Menurutnya saat polisi melakukan penggerebekan ditempat tinggalnya yang merupakan rumah mertuanya itu yang ada hanya isterinya Indri Manalu dan adik iparnya Erwin Manalu. "Barang bukti yang kusimpan dilemari pakaian ditemukan polisi.Aku ditangkap sewaktu pulang mau istirahat", katanya.

Untuk penyelidikan lebih lanjut, Anto Tamba, Indri Manalu, Erwin Manalu berikut barang bukti dibawa ke Mapoldasu Jalan Sisingamangaraja Km 10,5 Medan. Kasubdit III/Umum Ditreskrimum Poldasu AKBP Andry Setiawan mengatakan Anto Tamba dijerat pasal 303 KUHPidana dengan ancaman hukuman penjara 10 tahun. Sementara itu Subdit III/ Umum Ditreskrimum Poldasu menangkap agen judi bola Samsir[22] warga Jalan Ahmad Yani Tebing Tinggi, Rabu[18/4] sekitar pukul 22.30 WIB di Jalan Iskandar Muda Tebing Tinggi dengan barang bukti uang Rp.2.985.000 dan sebuah HP Namun tersangka mengaku uang yang disita itu hasil dagangan warung kopinya. "Ngak ada aku bang mengumpulkan uang judi bola, itu uang hasil jual warung kopi",katanya kepada wartawan. Menurut Kasubdit III/ Umum Ditreskrium Poldasu AKBP Andry Setiawan tersangka diduga berperan mengumpulkan omset taruhan judi bola. [HZA]

Ditpolairdasu Tangani Sembilan Kasus Perompakan Medan, BN Direktorat Polisi Perairan Daerah Sumatera Utara [Ditpolairdasu] Belawan hingga bulanApril 2012 telah menagani sembilan kasus perompakan dan penyanderaan kapal ikan di laut. Diantaranya, enam kasus sudah dilimpahkan ke Kejari Belawan untuk disidangkan. Hal ini diungkapkan Direktur Ditpolairdasu Belawan, Kombes Pol Ario Gatut Kristianto, kepada wartawan, Jumat[20/4/. Sedangkan tiga kasus lagi menurutnya masih dalam proses karena pelakunya belum ditangkap. Sedangkan tahun 2011, lanjut Ario Gatut Kristianto,

pihaknya menangani 47 kasus kejahtan dan dari jumlah itu baru 26 kasus selesai diproses, serta disidangkan di Pengadilan Negeri Medan di Belawan. Sementara 21 kasus lagi belum rampung sebab pelakunya belum berhasil ditangkap. Kasus-kasus kejahatan itu, paparnya perampokan dan penyanderaan nahkoda kapal 21 kasus diantaranya sembilan kasus disidangkan, perikanan lima kasus semaunya sudah disidangkan, penganiayaan empat kasus, kebakaran satu kasus, pelayaran empat kasus, distribusi BBM dan oenyeludupan trenggiling masing masing satu kasus. [HZA]

&

TRAGIS

dilontarkannya dalam suatu kegiatan pada 7 Maret 2012 dalam acara konsolidasi Gerakan Mahasiswa Kristen Indonesia [GMKI] di Restoran Internasional Jalan Gereja Pematang Siantar pada 7 Maret 2012 dan diterbitkan di harian Metro Siantar dan Simantab pada 8 Maret 2012. "Kami kecewa dan tidak percaya lagi dengan Polres Pematang Siantar yang diduga berpihak pada Walikota Pematang Siantar',teriak koordinator aksi Samsudin Harahap. Ada ketimpangan dalam UU Pers 1999 pasal 130 diatur bahwa hak jawab dapat dilakukan kepada media yang menerbitkan berita tidak sesuai, na-

mun anehnya hak jawab tersebut diterbitkan dimedia lain,yakni Harian Analisa,tegas Samsudin. Prosudur penyidikan sudah sesuai namun penanganannya tidak sesuai sebab saksi atau wartawan Metro Siantar dan Simantab tidak pernah dimintai keterangan. "Seharusnya penyidik memanggil untuk dimintai keterangan pihak redaksi Metro dan Simantab, dan bukan mendengarkan rekaman dari Humas Pemko Pematang Siantar",ujar Samsudin. Sementara itu Kapolres Pematang Siantar AKBP Alberd Sianipar SIK membantah laporan tersebut tidak diproses.

"Untuk mengetahui duduk masalahnya pihak Polres mengundang panitia GMKI, PWI, LSM dan wartawan, dari hasil rekaman tidak ada amenyebutkan kata"Pers" dan LSM Penghambat Demokrasi dan Pembangunan serta Membahayakan Negara. 'Saya juga telah meminta rekaman dari teman wartawan agar kasusnya ditindak lanjuti, namun teman teman tidak bias menunjukkan. Dari rekaman Humas Pemko Pematang Siantar, teman teman wartawan amengatakan itu sudah dipotong potong. Terserah mau dilaporkan kemana saja aku sudah siap",tegasnya. [HZA]

Kanit Laka Lantas Polresta Medan Dilaporkan ke Propam Medan, BN Kepala Unit[Kanit] Kecelakaan Lalu Lintas[Laka Lantas] Polresta Medan AKP Juwita dan penyidik pembantu Laka Lantas Polresta Medan Aiptu K.Nasution dilaporkan ke Bidang Profesi dan Pangamanan [Propam] Poldasu, Selasa[17/4] siang ,pasalnya laporan pengaduannya dengan no.LP/119/KS/2012 tanggal 20 Januari 2012 diduga dipolitisir pemilik mobil dengan Kanit Laka Lantas Polresta Medan. Menurut ibu korban Gina Satyo alias Apeng[45] warga Jalan Lembu No.8 Medan ke Propam Poldasu sesuai dengan nomor pengaduan No.STPL/ 68/2012/Propam, diterima oleh bagian Subbag Yanduan Brigadir Devi Novianti SIP lantaran tidak senang dengan penanganan kasus laka lantas yang menimpa anaknya Adrian Hartanto[18] yang kritis dilindas mobil kijang Inova BK 1183 JY yang dikemudi oleh supir Amat Aidi[50] warga Jalan Letda Sujono No.107 Medan Tembung, di Jalan Thamrin simpang Jalan Ambon Medan. "Saat itu anak saya, Adrian naik sepeda motor Vrga JR BK 3085 AI menyenggol pintu kiri depan mobil inova BK 1183 JY. Tapi oleh supirnya maju mundur melindas bagian perut anak saya. Saat itu saya tidak ber-

pikir bagaimana mempersoalkan masalah kecelakaan itu yang penting saya harus menyelamatkan anak saya agar bias tertolong dan ditangani dokter di Rumah Sakit Methodis Medan di Jalan Thamrin", jelas Gina di Mapoldasu didampingi Sugihana Ahwat, Selasa[17/4]. Dijelaskannya di RS pemilik mobil itu Edi Syaputra alias Edi Negara pengusaha kawat las di Tanjung Morawa dating dan marah marah karena mobilnya disenggol mengalami penyot dibagian pintu depan sebelah kiri. Namun saya tidak memperdulikannya karena yang penting saya harus menyelamatkan anak saya yang mengalami luka dikepala,pinggang,perut bekas lindasan mobil,bahu hingga lengan kanan tangan kanan luka lecet. Semua bajunya berlumuran darah,kata ibunya. Saat itu karena saya tidak mau peduli sama pemilik mobil tersebut yang katanmya mau membayar Rp.1 juta ongkos perobatan anaknya. Sedangkan perobatan anaknya saja untuk kepala sudah Rp.1 juta. Disebutkannya selesai gelar perkara di Sat Lantas Polresta Medan, ibu korban dihardik untuk segera menyerahkan sepeda motor anaknya agar mobil kijang inova bisa dilakukan penahanan sebagai barang bukti."Ketika usai gelar perka-

ra ibu Juwita bilang, dalam tiga minggu berkas perkaranya akan lanjut,jika tidak ada kesepakatan perdamaian. Tapi sampai saat ini,jangankan berkas yang lanjut, mobil yang melindas anak saya belum ditahan, hanya surat izin mengemudi yang ditahan",katanya. Lebih lanjut dikatakannya, saat akan dilakukan scaning di RS Deli Medan, pengusaha pemilik mobil membawa pihak Bankom dan akan memberi Rp.2 juta dan ditambah secara peribadi dari pihak Bankom Rp.200.000. "Katanya itu untuk biaya awal dan akan ada selanjutnya apabila saya tidak amelaporkan kepihak kepolisian. Karena tidak ada niat baik, setelah empat hari dari kejadian kami laporkan ke Sat Lantas Polresta Medan untuk mendapat perlindungan hokum",imbuhnya. Sementara Kanit Laka Lantas Polresta Medan AKP Juwita menyebutkan pihaknya sudah melakukan tindakan apenyidikan sesuai dengan prosudur. "Untuk penyitaan mobil kita masih menunggu surat dari pengadilan. Sebelumnya kita sudah minta kepada supirnya untuk mengantar mobil sebagai barang bukti, namun pada saat itu mobil tersebut dibawa pemiliknya ke luar kota",jelasnya. [HZA]

Satpam Ditangkap Sebagai Kurir Sabu Sabu Medan, BN Seorang petugas Satpam Legino[42] warga Jalan Suluh Kelurahan Siderejo Kecamatan Percut Sei Tuan di Villa Jati Mas, ditangkap aparat Direktorat Narkoba Poldasu , Sabtu[14/4] sebagai kurir sabu sabu secara discover dikediamannya. Darinya disita 90,24 gram sabu sabu, sebuah Hand Phone dan SIM C. Setelah ditangkap, polisi kemudian mengembangkan penyelidikan ke kediaman Ic yang diduga Bandar. Walau tidak berhasil menangkap Ic

dari rumahnya di Jalan Sering yang berdekatan dengan Jalan Suluh itu, polisi menyita dua paket sabu sabu seberat delapan gram. Kepada wartawan di Mapoldasu, Senin[16/4] siang, Legino mengaku mendapatkan barang haramitu dan seorang pria berinisial Ic,"Barangnya dari Ic, aku bertugas mengantar saja",katanya. Ia mengaku mendapat upah Rp.25.000 dari setiap satu gram sabu sabu yang terjual. Menurutnya dia yambi jadi kurir sabu sabu karena gajinya Rp.1 juta per bulan

dari bekerja sebagai satpam di Villa Jati Mas Jalan Perintis Kemerdekaan Medan tidak cukup untuk membiayai anak beserta keluarganya. Direktur Direktorat Reserse Narkoba Poldasu, Kombes Pol Andjar Dewanto, membenarkan penangkapan itu. "Sudah kita amankan satu orang tersangka sebagai kurir",ujarnya di Mapoldasu dan menambahkan, pihaknya saat ini masih melakukan pengembangan untuk mengungkap dugaan keterlibatan Ic sebagai pemilik sabu sabu itu. [HZA]

15 Kali Menjambret

Pembalap Liar Divonis 8 Bulan Pertapaan. BN Joki pembalap liar yang sudah melakonkan 15 kali aksi jambretnya diberbagai lokasi dikota Tebing Tinggi, Muhammad Ridwan Alias Wawan (18) Tahun warga Desa Pertapaan KEc. Tebing Tinggi Kabupaten Serdang Bedagai divonis majenis hakim 8 bulan penjara, yang mana putusan tersebut dua bulan lebih ringan dari tuntutan jaksa penuntut umum, Kamis (19/4) yang digelar di PN Tebing Tinggi. Lelaki yang dikenal sebagai pembalap liar ini hanya divonis ringan, walaupun diketahui terdakwa telah kurang lebih hampir 15 kali melakukan aksi penjambretan.

Jaksa penuntut umum (JPU) Perry Sukhairi, SH sebelumnya, yang meminta terdakwa dijatuhi hukuman ringan ini, majelis hakim beralasan karena terdakwa mengakui semua perbuatannya. Sementara hal yang memberatkan perbuatan terdakwa sangat meresahkan masyarakat Tebing Tinggi. Dalam isi surat dakwaan (JPU) disebutkan perbuatan terdakwa bersama rekannya Boiman Alias Boi alias Bedul (berkas terpisah) yang telah dijatuhi hukuman satu tahun enam bulan sebelumnya ini, dilakukan pada jumat 11 Pebruari 2012 lalu. Dimana dua korbannya baru saja melaksanakan sembahyang Imlek, dan saat itu melintas dikawasan

jalan DI Panjaitan persisnya didepan panglong Setia Tebing Tinggi. Kedua korban yang saat itu sedang mengendarai sepeda motor langsung diapit oleh kedua terdakwa yang kebetulan menunggangi sepeda motor jenis suzuki satria FU. Saat diapit, aksi tarik menarik antara terdakwa dengan kedua korban pun tak terelakkan. Naas, ketika si korban mempertahankan tasnya, salah satu korban terjatuh dan terpental keaspal, dan seketika meninggal dunia saat dibawa menuju kerumah sakit lantaran pendarahan dibagian kepala. Tak hanya itu, terdakwa juga

mengakui pernah menjambret uang senilai Rp.2 juta dari dalam tas milik korbannya bernama Rosnelly yang ketepatan baru saja keluar dari salah satu apotik dikawasan Kapten F. Tandean Tebing Tinggi. dalam gelar sidang sebelumnya, terdakwa akhirnya mengaku bila dirinya telah melakukan aksi penjambretan sebanyak 15 kali. Namun pengakuan terdakwa ini ternyata tidak jadi pertimbangan utama bagi majelis hakim, sebab akibat perbuatannya ini sudah ada korban yang telah meninggal dunia. Dalam amar putusannya, terdakwa dinyatakan majelis hakim bersalah melanggar pasal 363 KUHP pidana tentang perbuatan pencurian. (IBNU)

Kanit Reskrim Polsek Lubuk Dalam: AIPDA Muhammad Fazri

Polisi Berhasil Tangkap Mobil Bermuatan Minyak Tanah Ilegal Siak,BN Kepolisian Sektor Lubuk Dalam bekerja sama dengan satuan reskrim berhasil menangkap sebuah mobil pribadi kijang Krista dengan nomor polisi BA 1848 MN , hari Sabtu ( 14 / 4 ) jam ; 14 ,00 Wib di salah satu pasar Rawang kao jalan pertamina Kecamatan Lubuk Dalam Kabupaten Siak . Sementara pelaku dan supir berinisial M ( 37 ) alamat Jalan , Soekarno - Hatta Payakumbuh Propinsi Sumatera - Barat. Kapolres Siak AKBP Sugeng Putut Wicaksono SIK yang diminta keterangan masalah kasus minyak tanah yang ditangkap oleh anggota satuan Reskrim Polsek Lubuk Dakam melalui Kapolsek nya AKP Fridolin Nababan didampingi Kanit Reskrim AIPDA Muhammad Fazri mengatakan memang ada kita tangkap Mobil Pribadi yang bermuatan 39 jerigen minyak tanah illegal yang akan dipasarkan. Kanit Reskrim AIPDA Muhammad Fazri menceritakan Kronologisnya Sesuai informasi masyarakat bahwa ada sebuah mobil kijang Krista sedang lagi bongkar di pasar , setelah itu kita turunkan anggota ke TKP dan sambil kita selidiki dan kita tanya kepada supir, ternyata supir tersebut tidak dapat menunjukkan dokumennya. Sehingga Mobil dan supir kita bawa ke Mapolsek Lubuk - Dalam guna kita periksa dan ternyata tidak ada surat izin. Sewaktu kita tanya tersangka mengaku bahwa minyak tanah saya beli d salah satu lokasi Payakumbuh Sumatera Barat dan dibawa ke kabupaten Siak untuk dijual dan diecer pedagang kecil kota kabupaten khusus pasar Rawang - Kao Kecamatan Lubuk Dalam . Sekarang tersangka kita tangkap dan diproses secara Hukum dan kita sildiki lebih lanjut, siapa tahu ada yang membek uph alias deking ; Sapa Kanit Resktim AIPDA M Fazri. Barang buktinya kita sita berupa satu buah mobil kijang Krista BA ; 1848MN, 39 jeregen yang isina Minyak Tanah Ilegal alias tidak ada surat suratya atau dokumen lengkap . (JG )

Diberhentikan Sebagai Bupati Palas, Gelar Perkara Dibatalkan Medan,BN Gelar perkara dugaan korupsi Bupati Palas Basyrah Lubis dibatalkan karena Mabes Polri sudah menerima tembusan pemberitahuan pemberhentian Basyrah Lubis sebagai Bupati Padang Lawas[Palas]. Penyidik Dit Reskrimsus Poldasu bersama penyidik Polres Tapanuli Selatan yang rencananya melakukan gelar perkara dugaan korupsi pembangunan prasarana perkantoran[proyek multi years] senilai Rp.6,7 miliar yang melibatkan Basyrah Lubis, di Bareskrim Mabes Polri, Rabu[18/4]. Sementara itu penyidik Tindak Pidana Korupsi[Tipikor] Subdit III/Tipikor Direktorat Reserse Kriminal Khusus[Ditreskrimsus] Poldasu masih menunggu petunjuk dan arahan Mabes Polri untuk melanjukan ksus dugaan korupsi tersebut. Demikian diungkapkan Direktur Ditreskrimsus Poldasu Kombes Pol Sadono Budi Nugroho kepada wartawan di Mapoldasu,Selasa[17/4]. "Karena harus digelar dulu sebelum permintaan izin dilayangkan ke Presiden, penyidik harus jelaskan ke Mabes Polri terkait kasusnya seperti apa, kemudian suratnya ditandatangani Kapolri atau Kabag Reskrim untuk dilayangkan ke Presiden melalui Sekertariat Negara",jelas Sadono Budi Nugroho. Namun lanjutnya, gelar perkara batal dilakukan karena Mabes Polri sudah menerima tembusan pemberitahuan mengenai pemberhentian Basyrah Lubis sebagai Bupati. "Jadi kita menunggu petunjuk dan langkah selanjutnya dari Mabes Polri untuk perkara ini",ujarnya dan menambahkan secara khusus Poldasu belum menerima pemberitahuan pemberhentian Bsyrah Lubis sebagai Bupati Palas. Menurutnya, jika sudah ada arahan lebih lanjut dari Mabes Polri, pihaknya akan berkoordinasi dengan Polres Tapsel untuk kelanjutan kasus ini. "Jika disana[Tapsel] mampu, cukup disana saja, karena kan sudah tidak Bupati lagi. Tapi kalau mempengaruhi situasi kondisi di Palas, akan kita periksa disini",kata Sadono. Poldasu, Rabu[25/1] telah melakukan gelar perkara dugaan korupsi pembangunan prasarana perkantoran senilai Rp.6.7 miliar itu dan hasilnya Basyrah Lubis beserta empat orang lainnya ditetapkan sebagai tersangka. Kelima orang yang ditetapkan sebagai tersangka berdasarkan gelar perkara oleh Ditreskrimsus Poldasu dan Polres Tapsel terdiri dari Basyrah Lubis, Chairul Windu[mantan Kadis PU Palas], Abdul Hamid Nasution[pejabat pembuat komitmen], Pruhum Daulay[BUD] dan HM Ridho Harahap[Ketua DPRD Palas] . [HZA]

Polres Serdang Bedagai Tangkap Bandar Dadu Sergai,BN Telah ditangkap tersangka bandar judi dadu pada hari Selasa tanggal (17/4-12) pukul 21.05 Wib di Desa Sei Mulyo kecamatan Sei Bamban Kabupaten Sergai. Tersangka Paimun (Bandar) 53 tahun Dusun 5 Desa Sei Rejo Kec. Sei Rampah, barang bukti berupa 1 lembar beberan plastik, satu set mata dadu, 1 buah piring, 1 buah mangkuk, 2 buah lilin, 1 buah tas hitam, uang tunai Rp. 73.000,Kronologis, pada waktu melaksanakan patroli kring Serse anggota Reskrim yang dipimpin Aiptu Subono melihat secara langsung orang berkerumun, setelah didekati dan dilihat, tersangka sedang membuka judi dadu ditempat hiburan hajatan pesta. Seketika itu juga dilaksanakan upaya paksa menangkap bandarnya, dan para pemasang pada berserakan dan berlarian meninggalkan lokasi judi dadu tersebut. Dan barang bukti juga langsung diamankan Sat Reskrim Serdang Bedagai guna penyelidikan perkaranya. Kasubbag Humas Polres Serdang Bedagai AKP. ZN Siregar membenarkan penangkapan tersebut. (IBNU)

23 - 30 APRIL 2012 | EDISI 312 | THN KE-VII

PTPN III Kebun Sarang Giting Tekan Kebocoran, Tingkatkan Produktivitas Sergai, BN Sejak dini, upaya penekanan kebocoran produksi dan peningkatan keamanan sebagai implementasi amanah perusahaan di PTPN 3 Kebun Sarang Giting. Yang merupakan komoditi karet dan sawit tetap terkendali dan dilakukan secara transparan. Memang, untuk kebocoran produksi dari lapangan disana sini tidaklah bisa secara murni dan tuntas. "Tidak ada kebocoran". Biar dikebun mana saja. Hal tersebut mustahil, tetapi mudah-mudahan berkat adanya

Umar Hasibuan Sarankan Tampilan Pajangan di PRSU Dirubah Tebingtinggi,BN Walikota Tebingtinggi Ir H Umar Zunaidi Hasibuan menyarankan Kepala Dinas Koperasi UKM Perindustrian dan Perdagangan (Diskouperindag) Drs H Asmali MBA dan Kepala Dinas Pekerjaan Umum (PU) Kota Tebingtinggi Ir HM Nurdin agar merubah bentuk tampilan dan pajangan hasil kerajinan UKM di stand Pekan Raya Sumatera Utara (PRSU). Hal itu disampaikan Walikota Tebingtinggi pada acara malam penutupan PRSU ke 41, Minggu (15/4) lalu melalui siaran pers yang disampaikan Kabag Humasy Ahdi Sucipto kepada wartawan, Selasa (17/4) diruang kerjanya. “Tahun depan kita rubah bentuk penampilan dan pajangan hasil kerajinan UKM Kota Tebingtinggi di stand arena PRSU agar lebih indah dan menarik”, ungkapnya. Menurut Umar Hasibuan, ruang stand pameran milik Pemko Tebingtinggi di PRSU akan di bagi menjadi tiga bagian yakni untuk pajangan, hasil kerjasama Pemko Tebingtinggi dengan Kota Tangerang Selatan dan Kota Depok yang baru saja dilakukan, “Hasil kerjsama kedua daerah tersebut akan kita pajang dan setiap malamnya akan kita lakukan lucky draw sederhana dengan hadiah berupa hasil UKM yang kita pajang tersebut”, saran Umar Hasibuan. Selain itu, Walikota Umar Hasibuan juga meminta agar guide (pemandu) lokasi stand PRSU sebaiknya orang yang menguasai betul hasil dan produksi milik pelaku UKM yang di pajang. “Selain orangnya harus bernampilan menarik, guide lokasi stand juga harus menguasai betul hasil serta produk-produk unggulan milik UKM Tebingtinggi sehingga pengunjung lebih menjadi tertarik dengan produk-produk kita, bahkan bisa jadi mampu menarik investor untuk membuka usahanya di Kota Tebingtinggi”, imbuhnya. Acara malam penutupan Pekan Raya Sumatera Utara distand Pemko Tebingtinggi yang dihadiri oleh hamper seluruh pimpinan SKPD sejajaran Pemko Tebingtinggi, Walikota Umar Zunaidi Hasibuan sempat melakukan dialog serta memberikan bingkisan kepada para pengunjung PRSU di stand milik Pemko Tebingtinggi berupa makanan ringan hasil produksi UKM kota itu.(DER)

kerjasama yang baik, terutama daripada pihak pengamanan, yaitu centeng, SPBUN, Managemen dan dari karyawan itu sendiri, namun kebocoran bisa lebih diperkecil. Demikian ditegaskan oleh Ir. Oloan Tambunan sekaligus selaku manager yang baru kebun Sarang Giting bersama APK M. Tondi Ramadhan, SH diruang tugasnya saat berbincang-bincang bersama Kabiro Wartawan Media Bongkar News baru-baru ini. Dalam kesempatan itu wartawan Bongkar News menany-

akan tentang hubungan masyarakat lingkungan sekitar kebun, managemen kebun mengakui mudah-mudahan tetap terjalin komunikasi yang baik. Artinya, semisal sektor sosial dan keamanan lain, tetap mendapat respon positif. Karena sesuai dengan juklak direksi. Pihak kebun memahami tentang "bina lingkungan kepada desa atau nagori yang ada disektor kebun sarang giting. Dari sisi kegiatan sosial dan keamanan dari masing-masing penganut agama dan kepercayaan ke-

pada Tuhan Yang Maha Esa, berjalan dengan baik, terlebih untuk kegiatan agama hari besar Islam. Disinggung tentang ternak sapi yang jadi tantangan dan dilema perkebunan dimana saja, AS BICE selaku papam kebun sarang giting mengakui sama, dan sangat memikirkannya, upaya yang dilakukan dengan sudah melakukan pendekatan dan sosialisasi kepada masyarakat pemilik ternak sapi agar tidak melepaskan ternaknya pada areal-areal yang dilarang, dan mengizinkan untuk di-

Kasat Lantas Sergai Pimpin Razia Tertib Lalu Lintas di Jalan Protokol Sei Rampah Sei Rampah. BN Kasat Lantas Polres Serdang Bedagai AKP Hasan Basri saat ditemui majalah Satya Bhakti Humas Poldasu, menyambut gembira dan berharap para wartawan Satya Bhakti Humas Poldasu dapat bekerja sama dengan baik untuk menumbuhkembangkan kesadaran masyarakat dalam tertib lalu lintas. "Saya baru bertugas satu bulan di Sergai, tetapi jiwa saya sudah melekat di Sergai" ungkapnya bersinerjik menyambut kehadiran tim Biro Media Bongkar Sergai, Ka-

biro Satya Bhakti Abd. Rahman. Menurut AKP Hasan Basri bahwa masih banyak masyarakat tidak menyadari fungsi dari tertib lalu lintas sehingga tidak mematuhi peraturan lalu lintas seperti kelengkapan surat-surat kendaraan, helm, dan pengaturan kecepatan berkendara. Untuk itu Sat Lantas Polres Serdang Bedagai beserta jajarannya kerap kali melakukan razia tertib lalu lintas, terutama didaerah-daerah yang rawan kecelakaan. Karena menurutnya dengan kerap kali melakukan razia dapat men-

gurangi peluang lalu lintas diwilayah Serdang Bedagai. Dengan semangat kerja yang tinggi, Kasatlantas Sergai AKP Hasan Basri kerap kali langsung turun kelapangan memimpin Razia tertib lalu lintas dan selalu memberikan pengarahan-pengarahan tentang perlunya kesadaran masyarakat untuk mematuhi Undang-Undang Republik Indonesia No. 22 Tahun 2009 tentang lalu lintas dan angkutan Jalan agar kecelakaan lalu lintas ditekan semaksimal mungkin. Usai berbincang beberapa

menit kemudian Kasatlantas AKP Hasan Basri memerintahkan Kanitnya untuk persiapan razia rutin dibeberapa tempat yang kerap kali rawan laka lantas. Dengan ketegasan dan disiplin yang tinggi, personil Satlantas Polres Serdang Bedagai langsung bergerak cepat ke titik lokasi yang telah ditentukan. Razia dimulai pada pukul 10.00 Wib baru-baru ini tepatnya di Jalan Umum Lintas, Kawasan Desa Sei Buluh. Dengan semangat kebersamaan dan motivasi kerja yang tinggi, seluruh per-

sonel, sehingga pelaksanaan razia berjalan lancar hingga satu jam kemudian. AKP yang dikenal tegas dan disiplin ini ternyata menyimpan banyak humor dan istilah-istilah agar tertawa, walaupun teriknya matahari menyengat tubuh, semua itu tidak mengurangi semangat para personil-personilnya. Seperti yang diungkapkan salah satu personilnya "Saya tidak ada rasa lelah kalau pak Kasat yang memimpin, karena beliau juga selalu bersinerjik dan bersemangat" ucapnya. (IBNU)

UU No.23 Tahun 2006 dan Peraturan Bupati Deliserdang No.190 tahun 2011 Lubukpakam. BN Kadis Kependudukan dan Catatan Sipil (Dukcapil) Kabupaten Deliserdang Drs HMA Yusuf Siregar MAP mengatakan pencatatan dan pelaporan kelahiran anak yang melampaui batas waktu satu tahun sejak kelahiran terlebih dahulu harus mendapatkan penetapan Pengadilan Negeri sebagaimana diamanahkan UU No.23 tahun 2006 pasal 32 ayat 2. Hal itu dinyatakan Kadis Dukcapil HMA Yusuf Siregar pada Sosialisasi UU No.23 tahun 2006 tentang administrasi kependudukan serta Peratu-

ran Bupati Deliserdang No.190 tahun 2011 tentang perpanjangan dispensasi pelayanan pencatatan kelahiran di Kabupaten Deliserdang berakhir tahun 2011 yang dibuka Wakil Bupati Deliserdang H Zainuddin Mars di aula Cadika Taman Pramuka Lubukpakam, Rabu (18/4) Sementara berdasarkan Peraturan Bupati Deliserdang No. 190 tahun 2011,maka sejak Jjanuari 2012,Dinas Dukcapil Deliserdang tidak akan melayani pembuatan akta kelahiran anak yang melampaui batas usia satu tahun terkecuali setelah mendapat penetapan dari Pengadilan

Negeri Lubukpakam,kata Kadis Dukcapil HMA Yusuf Siregar. Ketua Pengadilan Negeri Lubukpakam Pontas Efendi SH mengatakan penerapan UU No.23 tahu 2006 perlu kerjasama melalui satu pelayanan yang terkoordinasi hingga ketingkat desa agar tidak menambah beban bagi masyarakat. Instansi terkait agar satu visi dalam melakukan pelayanan yang terbaik karena hal ini merupakan hak mendasar dan harus direalisasikan secara cepat kepada masyarakat,kata Pontas Efendi. Syarat-syarat penetapan

Akta Lahir sesuai ketentuan Pengadilan Negeri Lubukpakam adalah Surat Pengantar dari Kepala Desa/Lurah tentang domisili,Kutipan Akta Nikah bagi agama Islam atau kutipan Akta Perkawinan dari Catatan Sipil bagi agama non Islam,Surat Keterangan Lahir Bidan/Ijazah bagi yang tamat SD,Kartu Keluarga dan KTP suami isteri, membayar uang perkara Rp. 121.000 dan mengisi blanko permohonan dan foto copy berkasberkas diatas bermaterai serta sidang hadir pemohon dan dua saksi serta membawa asli buktibukti berkas-berkas tersebut

Walikota Tebingtinggi Bersama Muspida Tinjau UN Tebingtinggi,BN Walikota Bersama Unsur Muspida Tinjau Ujian Nasional (UN) Di 4 Sekolah Antara Lain SMA 1, SMA 3, SMA Kartini Dan SMK 2, Senin (16/4). Terlebih Dahulu Walikota Tebing Tinggi Ir H Umar Zunaidi Hasibuan MM Meninjau SMA Negeri 1 Yang Mengikuti Ujian Nasional 247 Siswa Dan Bapak Umar Berpesan Kepada Kepala Sekolah untuk setelah anak selesai ujian Hari ini supaya di motivasi untuk tetap semangat dan mengingatkan jangan sampai terlambat dan jaga kesehatan.ujarnya Setelah Meninjau Berlangsung Nya Ujian Nasional Di SMA 1 Walikota Bersama Unsur Muspida Meninjau Ke SMA Negeri 3. Hasil Tinjauan Walikota Di SMA 3 Telah Terjadi kendala dengan ditemukan berkas kurang 4 Set di Ruang 9 Namun Dapat Teratasi, Bahan Tidak ada namun dapat teratasi dengan memfotocopy Satu Lembar Bahan. Jumlah siswa Yang Mengikuti 245 orang dan 2 orang Tidak Hadir. Walikota Bersama Muspida Kembali Meninjau Sekolah SMA Kartini Yang Mengikuti Ujian Nasional 179 Orang Dan Bapak Umar mengingatkan siswa untuk tidak melakukan budaya Coret Coret Baju dan Naik angkot yang berjubel hingga ke atas mobil angkutan.ujarnya Peninjauan Ujian Nasional (UN) terakhir Ke SMK 2 Walikota Bersama Muspida. SMK 2 yang harusnya mengikuti ujian 198 orang, 2 Orang mengundurkan diri dengan Masalal1 akibat sakit yang terus menerus dan 2. akibat broken home kedua orang Tuanya. Berdialog Langsung Selesai Ujian Walikota Ir H Umar Zunaidi Hasibuan MM Berdialog Dengan Siswa SMK 2, Senin (16/4). Dialog Walikota Dengan Siswa Seputar Berlangsung Ujiannya, Walikota Bertanya Bagaimana Ujiannya, Dan Para Siswa Menjawab Lancar Pak Dan Bilang Soal nya Gampang Gampang Susah pak. Tidak Sampai Disitu Saja, Walikota Berpesan Kepada Siswa Untuk Mengingatkan Kepada anak Didik untuk Yakin Kan Diri Bahwa kita Mampu Dalam Menghadapi Ujian, Jangan Cemas/Gelisah Dan Harus Yakin Kita Bisa Dalam Mengerjakan Soal Harus Dibaca Dan Pahami Serta Jangan Terburu Buru.ujarnya Walikota Tebing Tinggi Ir H Umar Zunaidi Hasibuan MM Mendoakan agar anak didiknya Berhasil agar kelak Nanti Bisa Melanjutkan Ke Perguruan Tinggi.Ujarnya.(DER)

gembala pada areal tanamantanaman tertentu. Kenyataannya memang beberapa waktu oleh pemilik ternak tersebut mematuhi dan melaksanakan makna dari sosialisasi tersebut, tetapi pada hari berikutnya terkadang bisa lepas dan bebas mengembala ternak tersebut dengan jumlah sampai ratusan ekor pada waktu malam dan siang hari. Ini juga menjadi pusung, namun demikian kita tetap menjaga dan menghalau ternak tersebut sebagaimana mestinya. (IBNU)

Wabup Deliserdang H Zainuddin Mars membuka Sosialisasi UU No.23 tahun 2006 tentang administrasi kependudukan serta Peraturan Bupati Deliserdang No.190 tahun 2011 tentang perpanjangan dispensasi pelayanan pencatatan kelahiran di Kabupaten Deliserdang berakhir tahun 2011.

diatas. Wabup H Zainuddin Mars mengatakan sejalan dengan berlakunya UU No.23 tahun 2006 maka perlu dilakukan pengaturan administrasi kependudukan yang didukung pelayanan yang profesional serta tingkat kesadaran masyarakat yang semakin tinggi terhadap hak dan kewajibannya sebagai warga negara. Sesuai pasal 27 UU No.23 menyatakan akan setiap kelahiran wajib dilaporkan oleh penduduk paling lambat 60 hari sejak kelahiran sedangkan bagi warga yang tidak melakukan pencatatan lebih dari satu tahun maka untuk mendapatkan akta kelahirannya harus berdasarkan penetapan Pengadilan Negeri setempat. Untuk itu kepada Camat, Kepala Desa/Lurah harus mensosialisaikan ketentuan ini kepada seluruh warga agar dalam penerapannya dilapangan masyarakat tidak merasa dipermainkan dengan bertambahnya persyaratan dan prosedur yang harus mereka tempuh hingga tidak memberi kesan negatif terhadap sektor pelayanan publik yang sedang dimantapkan dikabupaten ini. Khusus kepada Kadis Dukcapil dan staf ditekankan agar mengelola Akta Lahir dengan program yang sistematis,terarah dan berkesinambungan agar penanganan masalah kependudukan dan catatan sipil dikabupaten ini menjadi salah satu sektor pelayanan yang benarbenar prima,tegas Wabup H Zainuddin Mars. (Sof)

Pemko Tebing Tinggi Jalin Kerja Sama Dengan Pemko Tangerang Selatan Tebing Tinggi,BN Setelah menjalin kerja sama dengan Pemerintah Kota Depok, Pemerintah Kota Tebingtinggi kembali menjalin kerjasama dengan Pemko Tanggerang Selatan (Tangsel) yang ditandai dengan penandatanganan MoU, Rabu (11/4) di Ruang Rapat Kantor Walikota Tangerang Selatan. Penandatanganan MoU langsung dilakukan Walikota Tebingtinggi Ir H Umar Zunaidi Hasibuan dengan Walikota Tangerang Selatan Hj Airin Rahmi Diany SH MH, disaksikan Ketua DPRD Kota Tebingtinggi H Syahrial Malik, Ketua DPRD Tangerang Selatan, Bambang P Rahmudi, Wakil Walikota Tangerang Drs Benyamin Davnie serta para Kepala Dinas, Kantor dan Bagian masing-masing dari kedua Pemerintah Kota.

Pada kunjungannya ke Kota Tangerang Selatan itu, Walikota Tebingtinggi Umar Zunaidi Hasibuan mengaku tertarik untuk mengembangkan koperasi berbasis Islam saat mengunjungi KJKU (Koperasi Jasa Keuangan Syariah) BMT Al-Fath di Pamulang Tangerang Selatan. Menurut Umar, koperasi yang bersendikan Islam bisa menjauhkan masyarakat bawah dari jebakan rentenir. Hal itu bisa dilihat dari sistem koperasi yang baru berdiri 6 tahun dengan modal awal Rp 2 juta tapi saat ini sudah mempunyai asset Rp 10 miliar. Menurut Umar Hasibuan, tantangan kedepan di tahun 2015 mendatang dalam mengahadapi era globalisasi, adalah tentang pemasaran produk-produk yang kita miliki dengan pasar yang sangat

terbatas. “Maka dari itu, kita harus berperan, bagimana kita untuk menciptakan pasar kita sendiri atau pasar kita diambil orang, itulah manfaat dari kerjasama ini. Walaupun Kota Tebingtinggi dengan Tangsel mempunyai jarak yang jauh, namun berkat kemajuan tehnologi dan tranportasi jarak ini tidaklah jauh”, kata Umar Hasibuan. “Kota Tangerang Selatan mempunyai persamaan dengan Kota Tebingtinggi yang samasama daerah hinterland, kota jasa, mempunyai usaha mikro kecil dan menengah. Hal-hal yang menarik dari kota ini, dapat ditindak lanjuti dan sebagai bahan kerja, sebagai potensi bagi SKPD yang ada”, ujarnya. Sementara Walikota Tangerang Selatan, Hj Airin Rahmi Diany SH MH men-

gakui bahwa persoalan wilayah diperkotaan yang sangat rumit sekarang ini adalah jumlah penduduk yang semakin bertambah sedangkan luas wilayah tetap terbatas. “Kerjasama ini, diharapkan bisa berjalan dengan baik, bisa memproyeksikan persoalanpersoalan yang ada dengan baik”, katanya. Dijelaskan Walikota Tangerang Selatan ini, bahwa kota yang dipimpinya merupakan kota pemekaran yang baru memasuki tahun keempat berada di Provinsi Banten dengan luas wilayah 147 kilometer persegi dengan jumlah penduduk lebih kurang 1,3 juta jiwa, terdiri dari 7 kecamatan dan 54 kelurahan. “Kerjasama ini baru pertama kali dilakukan dengan Pemerintah Kota Tebingtinggi yang nantinya diharapkan dapat

memberikan pelayanan yang optimal dan maksimal, sebagai cikal bakal bagi program kerja SKPD masing-masing, dan tidak hanya sebatas MoU saja, tetapi dapat ditindak lanjuti sehingga dapat memberikan manfaat bagi masyarakat kita masing-masing”, harapnya. Acara penandatangan MoU diwarnai dengan penukaran cendramata dan Walikota Tebingtinggi memberikan ulos serta mengulosi Walikota Tangerang Selatan serta pemberian buah tangan berupa roti kacang dan dodol. Pada kesempatan itu, Walikota Tebingtinggi beserta rombongan juga diajak mengunjungi SMPN 4 rintisan sekolah bertaraf nasional yang pada tahun 2008 memperoleh ISO 9001 serta mengunjungi RSU Tangerang Selatan. (DER)

23-30 APRIL 2012 | EDISI 312| THN KE-VII

Untuk Membatu Perolehan Akte Kelahiran

BUPATI SIMALUNGUN TINJAU PELAKSANAAN UN

Jumlah Peserta 9.236 Siswa Simalungun, BN Mulai tanggal 16 – 19 April 2012 seluruh pelajar tingkat Sekolah Menengah Atas/ Sekolah Menengah Kejuruan/ Madrasah Aliyah (SMA/SMK/MA) kelas III semester akhir di Kabupaten Simalungun mengikuti pelaksanaan Ujian Nasional (UN). Dihari pertama pelaksanaan UN tersebut, langsung ditinjau oleh Bupati Simalungun DR JR Saragih SH MM didampingi oleh para Kepala Sekolah yang ditinjau, Senin, 16/04/2012. Sekolah yang ditinjau oleh Bupati yakni SMA Negeri 1 Saribudolok, SMA Cinta Rakyat Dwynhoven, SMK Negeri 1 Raya dan SMA Negeri 1 Raya. Setibanya di SMA Negeri 1 Saribudolok, Bupati langsung meninjau sistem pelaksanaan Ujian Nasional dan kondisi gedung-gedung Sekolah. Menurut Bupati tujuannya datang ke SMA Negeri ini untuk mengecek persiapan guru-guru termasuk Kepala Sekolah tentang Pelaksanaan UN. Disekolah ini jumlah peserta UN sebanyak 112 orang dan tidak hadir alasan sakit 1 orang. Melihat kondisi di SMA Negeri 1 yang halamannya tidak terawat, Bupati merasa kecewa. “Saya kecewa dengan kondisi sekolah ini, terutama Kepala Sekolahnya yang tidak memberikan terbaik kepada siswa-siswa itu. Lihat sendiri, keadaannya kotor semua”, tandas Bupati mengungkapkan kekecewaannya salah satu ruang disekolah itu. Dikesempatan itu juga, Bupati menghimbau kepada seluruh siswa yang mengikuti UN agar tetap serius dan dipastikan semua soal dapat diisi semua. “Saya berharap peserta UN di kabupaten Simalungun dipastikan memperoleh soal-soal ujian dan Lembar Jawaban Komputer (LJK) serta dapat lulus”, harapnya Setelah mengecek seluruh ruangan ujian termasuk sistem pengawasan yang dilakukan di sekolah itu. Kemudian dilanjutkan ke sekolah SMA Cinta Rakyat Dwynhoven dengan hal yang sama yaitu meninjau seluruh ruangan ujian dan sistem pengawasan, jumlah peserta UN sebanyak 105 orang. Usai meninjau pelaksanaan UN di kedua sekolah tersebut, Bupati pun melanjutkan perjalanannya ke Kecamatan Raya untuk melakukan hal yang sama. Di kecamatan Raya sekolah yang ditinjau yaitu SMK Negeri 1 Raya dengan peserta ujian sebanyak 323 orang, dan di SMA Negeri 1 Raya peserta ujian sebanyak 195 orang. Sementara itu, ditempat lain yaitu Kecamatan Ujung Padang Kadis Pendidikan Kabupaten Simalungun Resman Saragih S.Sos bersama dengan staf dijajarannya meninjau pelaksanaan UN. Sekolah yang ditinjau yaitu SMA Negeri 1 Ujung Padang, peserta UN sebanyak 101. Selanjutnya meninjau SMK Satrya Budi Perdagangan Kecamatan Bandar dengan pesertaa UN sebanyak 172 orang. (ps-01)

Pemkab dan PN Simalungun Gelar Persidangan Lapangan Simalungun, BN Dalam Undang-Undang Nomor 23 yang antara lain menyatakan bahwa pelaksanaan pencatatan kelahiran yang melalpaui batas waktu 1 (satu) tahun dilaksanakan berdasarkan penetapan pengadilan negeri. Menindak lanjuti isi UU tersebut, Ketua Pengadilan Negeri (PN) dan Kepala Dinas Kependudukan dan Catatan Sipil (Dukcapil) Kabupaten Simalungun mengadakan nota kesepakatan tertuang dalam nomor W2.U10.1007/Ht.04.10/ 2012 dan nomor 470/3028/DISDUKCAPIL-2012 tanggal 4 April 2012 tentang kesepakatan meluputi persidangan dilapangan. Untuk memberikan pelayanan dan kemudahan bagi masyarakat dalam pengurusan akte kelahiran yang pencatatan kelahirannya melampaui batas waktu 1 (satu) tahun, Pemkab bekerjasama dengan PN Simalungun melaksanakan persidangan dilapangan. Sebagai perdana, persidangan dilapangan dilaksanakan di Loods Nagori Cingkes Kecamatan Dolok Silou yang dipimpin langsung oleh Ketua PN Simalungun Abdul Siboro SH MH didampingi 2 orang Panitera, Jum’at, 20/04/2012. Kadis Dukcapil Albert Sinaga SPd MPd dalam laporannya mengatakan bahwa, pelaksanaan persidangan lapangan adalah untuk mendukung dan mewujudkan visi serta misi Pemkab Simalungun dalam rangka peningkatan pelayanan publik terhadap masyarakat. Di nagori Cingkes Kecamatan Dolok Silou yang telah mengajukan permohonan sebanyak 600 orang dan telah memenuhi syarat, persidangan ini diharapkan dapat berjalan lancar dan berkesinambungan diseluruh wilayah Kabupaten Simalungun. Menurut Albert, persidangan dapat dilaksanakan apabila pemohon (masyarakat) paling sedikit 30 (tiga puluh) orang atau labih disatu tempat, menyetorkan ongkos perkara ke rekening PN Simalungun, pemohon juga harus memperlihatkan asli surat-surat yang dimintakan oleh PN Simalungun dan fotocopy surat-surat tersebut disahkan oleh Panitera (sekretaris) PN Simalungun. Dikesempatan tersebut, Ketua PN Simalungun Abdul Siboro SH MH Abdul Siboro antara

lain mengatakan bahwa, pelaksanaan persidangan dilapangan merupakan program PN Simalungun dalam membantu masyarakat untuk pengurusan akte kelahiran yang pencatatan kelahirannya melampaui batas waktu 1 (satu) tahun. “Kami tau betul kesibukan masyarakat masyarakat dalam melakukan aktifitas untuk kebutuhan hidup sehari-hari, makanya kami melaksanakan persidangan lapangan untuk perolehan akte ini bersama Pemkab Simalungun, sehingga masyarakat tidak perlu lagi datang ke PN Simalungun, cukup hanya koordinatornya saja”, jelas Abdul Siboro. Selanjutnya, Ketua Pengadilan Negeri Simalungun Abdul Siboro SH MH mengatakan, dalam rangka pelaksanaan UU No 23 tahun 2006 tentang administrasi kependudukan, sebagai langkah meringankan beban masyarakat untuk mendapatkan akte lahir, pihaknya melakukan terobosan dengan melakukan sidang lapangan keliling kesetiap Kecamatan di Kabupaten Simalungun setiap

1 kali dalam seminggu. kegiatan ini bertujuan untuk memberikan kemudahan kepada masyarakat untuk mendapatkan akte lahir. Sementara itu, Bupati Simalungun DR JR Saragih SH MH dalam bimbingan dan arahannya mengatakan, Akte kelahiran merupakan salah satu bukti administrasi kependudukan bagi masyarakat. Oleh karena itu, bagi masyarakat diharapkan harus meliki akte kelahirannya. “Akte kelahiran sangat penting bagi kita, terutama untuk anak-anak kita. Uruslah segera akte mereka termasuk anak yang baru lahir sekalipun”, tandasnya. Langkah yang dilakukan oleh pihak Pengadilan bekerjasama dengan Kadis kependudukan dan catatan sipil tentang sidang lapangan ini, Bupati mengatakan, patut mendapat dukungan dari semua lapisan masyarakat, Karena hal ini yang menggembirakan dalam rangka memberikan pelayanan kepada masyarakat. Pelaksanaan persidangan dilapangan untuk perolehan akte kelahiran, Bupati

mengatakan, sudah merupakan komitmen Pemkab dan PN Simalungun dalam membantu masyarakat untuk mendapatkan akte kalahirannya. “Kepada para camat, pangulu dan masyarakat jangan sia-siakan kesempatan ini dan ini bukti kepedulian pemerintah kepada mayarakat untuk kepentingan administrasi kependudukan bahkan untuk kepentingan masyarakat saya siap dan tidak pilih kasih, karena saya datang ke Simalungun untuk melayani dan bukan dilayani. Mari kita sosialisasikan kepada masyarakat tentang pelaksanaan persidangan lapangan ini agar masyarakat mengetahuinya”, ungkap Bupati mengakhiri. Usai memberikan bimbingan dan arahan, selanjutnya Bupati Simalungun didampingi Plt Sekda Drs Gidion Purba, Kadis Dukcapil, beberapa pimpinan SKPD, Camat Dolok Silou Malem Ukur Barus, SE serta para pengulu se-Kecamatan Dolok Silou menyaksikan jalannya proses persidangan lapangan. (ps-01)

LINTAS DAERAH - LINTAS DAERAH - LINTAS DAERAH - LINTAS DAERAH - LINTAS DAERAH - LINTAS DAERAH - LINTAS DAERAH

Masyarakat Diharapkan Buang Sampah Pada Tempatnya P.Sidimpuan,BN Dinas Kebersihan dan Pertamanan Kota Padangsidimpuan menghimbau seluruh masyarakat Kota Padangsidimpuan agar meningkatkan kesadaran agar membuang sampah ditempat yang telah disediakan,hal ini untuk menjaga kebersihan dan kesehatan lingkungan sekitar pemukiman masyarakat disamping untuk menghindari penyakit.Demikian dijelaskan Kadis Kebersihan dan Pertamanan Kota Padangsidimpuan,Hj Syahraini Lubis SH

32 Ha Lahan Milik Sahari Belum Digantirugi PT.CPI Duri,BN Beberapa warga dari waris turun temurun Suku Sakai Batin Selapan Desa Sebangar kecamatan mandau Duri kabupaten Bengkalis kini menantikan kejelasan pihak PT.CPI. dimana soal pembayaran ganti rugi tanah milik Sahari di RT 01,02 RW 05 Desa Sebangar sesuai janji PT.CPI akan melakukan pembayaran ganti rugi namun hingga kini belum ada kepastian yang jelas. yang pasti sebahagian tanah milik Sahari sudah dip agar PT.CPI. Penjelasan warga selaku waris dari Suku Sakai batin Selapan pada BN baru-baru ini, dimana bahwa lahan Ulayat mereka sesuai Bukti penyerahan kerajaan Siak tahun 1934 silam sudah jelas. bahwa dulu lahan Ulayat itu sebahagian sempat di perkarakan karena di Kleam oleh seseorang bernama Laju, yang menyatakan sebagaian lahan Ulayat itu miliknya namun kenyataannya hasil perkara itu di menangkan pihak keluarga waris Suku Sakai Batin Selapan. tidak lama kemudian Laju pun meninggal Dunia. sebagai Bukti menang perkara berdasarkan putusan Hukum tetap yakni Putusan Pengadilan Tinggi Riau No. 141/PDT/12/ 1999/PTR Tgl 18 Desember 1999 maka karena itu lah tidak ada alasan lagi buat pihak PT.CPI tidak memberi ganti Rugi ujar Mara dan Jaii serta Batin Musa barubaru ini saat di konfirmasi BN. Secara terpisah menurut Sahari selaku Penasehat Batin Selapan Keluarga Besar Turun Temurun Suku Sakai di Desa Sebangar Duri Mandau dalam wawancaranya dengan wartawan BN pada jumat (20/4) kemarin lalu menegaskan bahwa lahan Ulayat Suku Sakai Batin Selapan resmi di serahkan Kerajaan Siak tahun 1934 . yakni lahan itu mulai dari daerah Minas, Ujung Tanjung sampaidaerah Simpang Jepang kelurahan Bagan Besar Kecamatan Bukit Kapur Dumai. untuk di ketahui jelas Sahari lagi bukan rahasia tetapi penyerahan itu ada Bisloid resmi di keluarkan Kerajaan Siak tegas Mantan Penghulu Desa Sebangar Periode tahun 1975 s/d 1985 itu dikatakan untuk di Wilayah Simpang Jepang Bagan Besar Bukit Kapur disana jelas Lahan Ulayat Suku Sakai dan itu sesuai Bisloid dari kerajaan Siak ujarnya. Terkait lahan warisan miliknya merupakan lahan Ulayat itu yang terletak di RT 01 RW 05 Desa Sebangar Kulim 75/ 76 saat ini dalam tahap proses untuk dig anti Rugi PT.CPI. tetapi pihak CPI dua Bulan lalu sudah menjelaskan bahwa tindak lanjut proses ganti Ruginya akan di lakukan pembayaran terhadap pemilik ujar Mara anak Sahari saat di konfirmasi BN di Kediamannya baru-baru ini. jadi lahan Sahari di RT 01 RW 05 Desa Sebangar Kulim Boncah Mahang seluas 32 Ha tinggal menunggu pembayaran ganti Rugi itu lah janji piak PT.CPI karena itu semua keluarga maupun petinggi Suku Sakai Batin Selapan di Duri Mandau Sekitarnya bahwa lahan milik saya sebahagian sudah dip agar PT.CPI dan kita harapkan pembayaran ganti ruginya dapat di bayarkan pihak PT.CPI ujarnya mengakhiri. (Sirait/ Dabutar)

melalu Kabid Kebersihan Enda Mora kepada BN dalam minggu ini. Ditegaskan Enda Mora,juga diharapkan kesadaran masyarakat untuk menjaga tong sampah,karena ahir-ahir ini banyaknya sejumlah tong sampah yang hilang sehingga kita kwatir masyarakat membuang sampah sembarangan sehingga petugas sulit mengangkutnya”UCapnya.Begitu juga masyarakat membuang sampah beraturan artinya sebelum mobil sampah datang masyarakat sudah membuang sampahnya

ketempat yang telah disediakan,dan tidak ada lagi sampah bertumpuk”Ujarnya. Menurutnya disamping menjaga kebersihan dan kesehatan juga untuk menambah keindahan karena kebersihan itu merupakan tanggung jawab bersama, bukan hanya pemerintah semata untuk itu marilah kita sama-sama menjaga kebersihan lingkungan disekitar kita karena tanpa didukung masyarakat kebersihan tidak akan berjalan baik meski telah dibuat tulisan diberbagai sudut Kota Padangsidimpuan Dilarang membuang sampang sembarang

buanglah sampah pada tempatnya“Ungkapnya. Untuk menciptakan kota bersih dan indah perlu dukungan penuh dari masyarakat dan ini menjadi tugas bersama bagaimana masyarakat memahami dan peka akan masalah ini.Kepekaan tersebut,diperlukan guna menciptakan dan menjaga lingkungan yang bersih dan sehat bebas dari sampah-sampah yang berserakan dimana-mana. Karena selain merusak keindahan kota , tumpukan sampah ditempat-tempat umum tersebut dapat

memicu timbulnya berbagai macam penyakit. Menurut pantauan dilapangan,setiap hari terlihat mobil pengangkut sampah beroperasi mulai dari pusat pasar Kota Padangsidimpuan sampai pinggiran Kota hal ini tidak terlepas dari kerja keras Dinas Kebersihan dan Pertamanan melalui Kabid Kebersihan,Enda Mora yang terus melakukan pengawasan dilapangan guna untuk mewujudkan Kota Padangsidimpuan Kota yang bersih sesuai dengan Motto Salumpat Saindege karena kebersihan sebahagian dari iman.(KS-04)

UN di Humbahas,Berlangsung Tertib dan Aman Doloksanggul, BN Pelaksanaan Ujian Nasional(UN) di sejumlah tingkat seko;lah SLTA yang terdiri dari SMU,SMK seKabupaten Humbahas berlangsung aman dan tertib.Demikian Pantauan Wartawan dibeberapa sekolah pada Senin 18/4.berlangsungnya UN juga dimonitoring Bupati Humbahas Drs Maddin Sihombing beserta rombongan,PWH (Persatuan Wartawan Humbang) ke beberapa sekolah diantaranya SMK I Doloksanggul,SMU I,SMK2,dan SMK I Pollung juga di tingkat Kecamatan. Kepala sekolah SMK N 1 Drs M.Sihombing ketika diwawancarai menjelaskan,Pelaksanaan ujian berlangsung

aman dengan diawasi Tim dari Unimed Medan,Diknas Tingkat I Medan,Diknas Kabupatn Humbahas,serta Sistim Pengawas Silang dari sekolah lain juga pihak Kepolisian.Sebelum Pelaksanaan ujian setiap siswa mengenakan kartu tanda Peserta Ujian dan tidak diperkenankan menbawa buku dan peralatan lainnya seperti alat Komunikasi HP kecuali yang telah ditentukan aturan dari pusat sepeti alat tulis pensil 2B. Ditambahkan,harapannya ke depan mudah mudahan siswa SMKN I dapat lulus 100% sepeti hasil yang dicapai tahun lalu.Jumlah siswa peserta ujian kelas III tahun ini 292 orang . Ujian berlangsung selamatiga hari yaitu Senin sampai Rabu dengan Bidang

Study Hari I bahasa Indonesia,selanjutnya Bahasa Inggris dan Matematika.Kita mengharapkan capaian tingkat kelulusan 5,5% dapat tercapai sebagai wujud dari perestasi guru guru kita disini mendidik siswa,yang kelak menjadi Pemimpin Bangsa dan mengisi Pembangunman di daerah ini,Ujarnya. Pantauan di SMUN I Doloksanggul,berkangsungnya ujian juga aman dan tertib dengan menghadirkan tim Pengawas secara lengkap sesuai yang ditentukan pihak Panitia.Kepala SMU N I Drs Sahata Purba ketika diwaancarai menjelaskan,Pelaksanaan ujian dari pihak pengawas sangat ketat tanpa ada toleransi,sehingga hasil ujian yang dicapai

Pasca Gempa Bupati Pakpak Bharat Turun Lapangan

Bangunan Rumah Miskin di Desa Lubuk Muda Diduga Tidak Memenuhi Standar Mutu Dumai, BN Pembangunan Rumah Miskin dari bantuan pemerintah kabupaten bengkalis di dsa Lubuk muda kecamatan Siak Kecil tahun (2010-2011) di sinyalir pengerjaannya tidak memenuhi standard mutu sehingga hasilnya tidak sesuai yang di harapkan , di kwatirkan bangunan yang sudah selesai di kerjakan bakal cepat Rusak. Dari keterangan dan informasi di peroleh BN, bahwa saat pengerjaan bangunan itu di antara bahan kayu yang di gunakan berlobang-lobang, bahkan campuran semennya jauh dari standar ujar beberapa anggota warga di Desa Lubuk muda yang melaporkan kasus ini pada BN baru baru ini, dikatakan warga itu lagi untuk Coor lantai rumah tersebut juga di ragukan ketahananya nya karena campuran semen tidak sesuai . Bangunan yang ada sebahagian sangat di ragukan . seperti kondisi rumah miskin yang di huni warga belum berapa lama di tempati sudah rusak , yakni rumah Maryam 60 tahun rumah nya kondisi lantainya sudah kupak kapik bahkan kayunya ada

yang berlobang lobang termasuk WC nya terancam ambruk pipa paralannya. bahkan ada yang pecah di duga karena terlalu tipis ujar Maryam pada BN ketika di konfirmasi kamis 19/4 pada pekan lalu, akan halnya bangunan rumah miskin serupa di Desa Lubuk Muda seperti yang di alami Ratna tepatnya di pasar lama. lantai nya berlobang dan banyak tempel tempelan.

Sementara pengerjaan rumah miskin tahun 2012 sekarang ini di desa Lubuk Muda ada terkendala, di duga karena factor Material yang tidak tersedia. karena itu bebagai kalangan di Siak Kecil mengharapkan agar tim dari Pemerintah Provinsi Riau turun “SIDAK” membuktikan pembangunan Rumah miskin yang di duga di kerjakan dengan asal-asalan itu. (RDS/ Tonga)

Pemkab Pakpak Bharat Rayakan Paskah Oikumene Pakpak Bharat, BN Perayaan Paskah Oikumene Kabupaten Pakpak Bharat yang digelar di Gedung Serbaguna, Salak, Rabu (11/4) berlangsung hikmad.Acara paskah Oikumene dihadiriratusanmasyarakatsertapegawaidilingkungan Pemkab Pakpak Bharat hampir seluruh PNS yang bertugas di lingkungan Pemkab turut hadir mengikuti acara perayaan Paskah tersebut. Perayaan Paskah tahun ini berbeda dengan tahun-tahun yang lalu, karena perayaan tahun ini diwarnai dengan pragmen yang menceritakan wafatnya Yesus Kristus di Kayu Salib untuk menebus dosa manusia. Pragmen Viadolorosa tersebut disambut hangat dan mendapat aplus dari para hadirin.

nantinya harus murni.Dikatakan jumlah siswa peserta ujian untuk jurusan IPA 156 orang,IPS 117 orang ,seluruhnya hadir 273 orang.Untuk tingkat SMU mata pelajaran yang diujikan terdiri dari Empat yang dimulai dari Senin sampai Kamis. Selamjutnya, Wartawan mengkonfirmasi beberapa siswa setelah selesai ujian mengatakan,ujian berlangsung ketat dari pihak pengawas,yamg jelas kami menyelesaikannya sangat tertib.Ketika ditanya apakah mereka ada dibantu guru atau pengawas kunci jawabannya,siswa menjawab jangankan kunci jawaban melirik kanan kiri saja tidak diperbolhkan.mengenai hasil ujian nanti siswa merasa Optimis dapat lulus melihat soal soal dapat di isi tepat waktu.(M.Sil).

Bupati Remigo Y Berutu dalam sambutannya mengatakan, kehidupan masyarakat Pakpak Bharat dalam kurun waktu beberapa tahun belakangan ini tentunya telah semakin dinamis seiring meningkatnya aktivitas sosial, ekonomi dan pemerintahan didaerah ini. Beberapa kemajuan yang kita capai patut kita syukuri walaupun dalam kenyataannya seiring dinamika yang ada belum sepenuhnya. Dikatakan, untuk mewujudkan kesejahteraan masyarakat, pola pikir tradisional, yang saat ini masih mendominasi ethos kerja kita dalam membangun Kabupaten Pakpak Bharat perlu kita ubah sedemikian rupa, agar selaras dengan visi pembangunan itu sendiri, mari kita berpikir lebih rasional bekerja keras ikhlas

dan berprestasi untuk mengelola peluang-peluang yang sudah ada dihadapan kita. Remigo Y Berutu berharap, Kebangkitan Kristus Membawa Kehidupan Baru, seperti tertulis dalam Surat Rasul Paulus yang kedua kepada Jemaat di Korintus 5 : 17, “Jadi siapa yang ada di dalam Kristus, Ia adalah ciptaan baru yang lama sudah berlalu, sesungguhnya yang baru sudah datang. Juga sesuai dengan thema Paskah Oikumene Kabupaten Pakpak Bharat pada tahun ini, yakni “Kasih Paling Besar Adalah PengorbananYesus Kristus” perlu kita jadikan sebagai tuntunan untuk mewujudkan motivasi dan komitmen yang lebih baik lagi dalam melayani masyarakat. (pb.007/tim)

Pakpak Bharat, BN Pasca Gempa yang terjadi pada hari Rabu, 11 April 2012 lalu, yang episentrum gempa di laut Simeulue pada pukul 15,38 WIB yang berkekuatan 8,5 SR dan diikuti gempa susulan sekira pukul 17.50 WIB, ternyata dampaknya dirasakan juga di seluruh wilayah Kabupaten Pakpak Bharat. Belajar dari kejadian gempa pada tanggal 06 September 2011 yang lalu, Bupati Pakpak Bharat, Remigo Y Berutu, yang pada kejadian tersebut sedang berada di ruang kerjanya, langsung turun meninjau masyarakat yang terkena dampak setelah sebelumnya menenangkan para PNS yang berada di lingkungan perkantoran Pemkab Pakpak Bharat. Didampingi Wakil Bupati Pakpak Bharat, H. Maju Ilyas Padang dan Sekretaris Daerah Drs. Holler Sinamo, MM, secara bersama-sama mengelilingi kota Salak untuk melihat langsung dampak dari gempa serta berkomunikasi dengan masyarakat Salak menyangkut kejadian gempa tersebut. Hampir semua masyarakat yang berdialog dengan Bupati menyatakan bahwa mereka sangat takut sekali karena gempa yang dirasakan kali ini cukup lama waktunya dibanding gempa yang pernah terjadi pada tahun lalu walaupun tidak menimbulkan korban jiwa. Rasa takut tersebut ditambah lagi dengan adanya gempa susulan beberapa jam sesudahnya. Bupati menyampaikan agar masyarakat jangan terlalu panik dengan gempa ini karena kepanikan akan menambah resiko yang lebih besar lagi. “Kita masih bersyukur karena cukup jauh dari lautan, karena menurut BMKG gempa kali ini berpotensi tsunami”, terang Bupati menenangkan masyarakat. Dalam kesempatan terpisah Bupati meminta kepada jajaran dibawahnya terutama para Camat, Kepala Desa sampai Kepala Dusun agar terus memonitor kejadian di lapangan dan melaporkan dengan segera apabila terjadi sesuatu. “Kepada jajaran PNS Pemkab Pakpak Bharat, khususnya Dinas Kesehatan, PU, Perhubungan, Satpol PP, Dinas Sosial dan BPBD agar selalu standby sehingga sesegera mungkin dapat dilakukan antisipasi apabila terjadi hal-hal yang tidak diinginkan”, pungkasnya. (pb.007/tim)

23 - 30 APRIL 2012 | EDISI 312 | THN KE-VII

Perayaan Paskah, Kegiatan Agama Kristen Batubara, BN Perayaan paskah merupakan kegiatan agama kristen diyakini yang terbesar karena dipercaya telah dimenangkan melalui kebangkitan Isa Almasih dan paskah oikumene juga berguna sebagai wadah bersekutunya umat kristen di Kab Batubara. Kita berharap perayaan ini dapat membentuk manusia yang beriman karena Tuhan dipercaya telah berkorban menebus dosa manusia dan saya mengucapkan selamat kepada pengurus BKAG,yang baru dilantik,ucap Bupati. BAKG sekarang lebih berperan dari priode sebelumnya karena wadah bersekutunya organisasi kekeristenan sehingga umat dapat merasakan telangkai hubungan dengan Pemerintah Kab Batubara yang selalu siap mendukung kegiatan dibidang ekonomi maupun mental spritual. Lebih lanjut dijelaskan OK Arya,Pemkab Batubara selalu memberikan apresiasi kepada panitia dan menyisikan dana untuk bantuan perbaikan rehab gereja serta rasa terima kasih kepada panitia paskah dan PT.Inalum yang telah memberikan bantuan sehingga pelaksanaan paskah berjalan sukses,jelasnya. (naryo)

Bupati Batubara Buka Kejuaraan Motocross Batubara, BN Ka.Disbudparpora Kab Batubara,H.Helman Herdady SH.MAP diwakili Kabid Keolaragaan Ilyas SPd membuka kejuaraan motocross memperebutkan trophy Bupati di Sirkuit Buatan Mandra Guna,Simp Inalum,Sabtu (14/4) Ilyas sangat bangga atas terselenggaranya kejuaraan motocross dan grasstrack Trophy Batubara Open Race III Tahun 2012 Karena open ini memiliki arti dan makna yang sangat besarsebagai upaya menambah jumlah frekwensi olah raga di Kab Batubara. Ditambakan Ilyas agar kroser yang ikut bertanding dengan sportivitas dan tetap memegang teguh sikap fair play serta memaksimalkan potensi untuk meraih prestasi. Kejuaraan Motocross yang memacu adrenalin diprakarsai oleh Organisasi DPD AMPI dan Batubara Motorsport yang mengaspirasikan talenta serta minat generasi muda dan melalui kejuaraan ini agar organisasi lain mampu berbuat hal yang sama,harap Ilyas. Warnai Pembangunan Bupati Kab Batubara,H.OK Arya Zulkarnain SH.MM didampingi Sekretaris Disbudparpora Irwan Zuhri Lubis secara resmi menutup kejuaraan Motocross dan grasstrack di Sircuit Simpang Kwala Tanjung,Kec Sei.Suka,Minggu (15/4) Irwan Zuhri sangat bangga dengan berkembangnya berbagai kegiatan kejuaraan cabang olah raga yang mewarnai khasana karakter pembangunan di Kab Batubara. Irwan sangat berterima kasih kepada panitia pengurus Batu Bara Motor Sport dan DPD AMPI karena event kejuaraan berjalan sukses serta berpesan kepada instansi terkait untuk terus memantau perkembangan dan terus berkordinasi hal yang menjadi wacana maupun pembangunan sehingga lintas sektoral dapat tercapai dengan efektif. Ditambakan Irwan agar peserta selalu menjalin silaturahmi dan yang meraih juara jangan berbangga hati,jadikan semangat untuk meraih prestasi yang lebih baik untuk menjadi modal di Tingkat Provinsi dan Nasional,ungkapnya. Lanjutnya bagi yang belum meraih juara jangan berkecil hati dan berputus asa tapi jadikanlah cambuk motivasi untuk meraih juara dimasa yang akan datang,jelasnya. (naryo)

OK Arya Zulkarnain Tinjau Pelaksanaan UN Batubara, BN Bupati Kab Batubara,OK Arya Zulkarnain SH,MM didampingi Ka.Dinas Pendidikan Zainal Alwi S.Pd,secara langsung meninjau pelaksanaan Ujian Nasional di Madrasah Aliyah Negeri I Lima Puluh,Senin (16/4) Bupati berharap agar siswa/i yang mengikuti ujian mengeluarkan seluruh kemampuannya yang selama ini didapat supaya mendapat predikat yang baik dan meraih prestasi untuk melanjutkan pendidikan kejenjang yang lebih tinggi. Seterusnya bupati menyarankan agar siswa/i yang mengikuti ujian untuk berdoa,dirangkai dengan penyerahan seperangkat alat tulis kepada seluruh peserta ujian nasional. Tinjauan Bupati dan Ka.Disdik disambut Kepala Sekolah MAN I Lima Puluh serta Pengawas dari Universitas Negeri Medan (Unimed) dan dihadiri,Asisten I,Kepala UPTD Kec Lima Puluh dan Camat Lima Puluh.(naryo)

PNS Pensiun Terima Penghargaan Batubara, BN Bupati Kab Batubara,H.OK Arya Zulkarnain SH,MM memberikan penali kasih dan piagam penghargaan kepada Pegawai Negeri Sipil (PNS) yang pensiun TMT di Aula Gedung DPRD Kab Batubara,Senin (16/4) Menurut Bupati,Undang-Undang Nomor:11 Tahun 1969, pensiunan pegawai negeri sipil merupakan jaminan hari tua sebagai balas jasa karena telah bertahun-tahun mengabdikan diri kepada bangsa dan negara. Atas nama Kab Batubara sebagai Bupati, OK Arya mengucapkan terima kasih kepada 117 orang pegawai negeri sipil atas pengabdian serta apresiasi yang setinggi-tingginya berkat pengabdian yang tulus. Bupati berharap agar pensiunan pegawai negeri sipil tetap menjaga kesehatan serta dapat menjadi contoh dan panutan untuk memposisikan diri sebagai orang yang dibutuhkan ditengah-tengah masyarakat. (naryo)

Penyidikan Kasus Pencemaran Nama Baik Jalan Ditempat Langkat, BN Laporan pengaduan Ong Satar Tampubolon pada Polsek P. Brandan sampai saat ini belum ada titik terang,karena Saur Manurung masih berkeliaran layaknya kebal hukum. Seperti diketahui perbuatan Saur Manurung sangat kejam dengan melakukan fitnah pada Ong Satar Tampubolon kepada warga Desa Teluk Meku Pangkalan Brandan. Melalui SMS dikatakan Ong Satar Tampubolon punya begu

ganjang dan diminya agar segera meninggalkan desa agar tidak terjadi pertumpahan darah. Antek-antek Saur Manurung seperti , RE.Gultom, D. Simatupang, Sopian Manurung, Farel Simare mare, Kasmin Dolok Saribu, Hasan Sitorus, D.Dwalter Sijabat, Santun Pakpahan mendatangi Ong Satar Tampubolon dan menggertaknya.. Hal ini tersebut yang disampaikan Ong Satar Tampubolon sekeluarga saat dikonfirmasi BN dirumahnya belum lama ini.

"Sampai sekarang dirinya tidak mengetahui kinerja Polsek P. Brandan karena sekitar Maret 2012 Cabang Kejaksaan Negeri Stabat di P. Brandan. Buat P18 dengan No.B/N.225.6/03/2012 perihal pemberitahuan hasil penyidikan H. Saur Manurung belum lengkap di tanda tangani Cakab Jari Muhamad Amin,SH 12 Maret 2012. Melalui P19 Jaksa No B-273/ N2.25.6/03 2012 perihal hasil penyidikan tersangka H. Saur Manurung melanggar pasal 310,311

10 Tahun Bertugas Tanpa Mutasi

Jembatan Timbang Gebang Diduga Sarang Korupsi

Ilustrasi

Langkat, BN HS dan HN petugas jembatan timbang Gebang hampir 10 tahun belum diganti dan diduga melakukan penekanan terhadap truk tanki yang melebihi tonase.Sehingga diwajibkan membayar sejumlah uang yang cukup mahal. Hal ini tentu sangat meresahkan para pengusaha karena dapat dipastikan penghasilan jembatan timbang dikorupsi oleh para petugas kepala dan wakilnya dengan sengaja membuat aturan sendiri. Menurut sumber yang enggan disebutkan jati dirinya mengatakan, Kepala Jembatan Timbang HS dan wakilnya HN membuat peraturan pada anak buahnya ada pekerjaan yang bersifat manulatif Tapi menurut HS beberapa waktu lalu dia mengatakan, dirinya hanya menerima kasbon laporan dari wakilnya HN yang punya wewenang,dimana HN sudah bertugas mencapai 10 tahun. Kalangan pegawai juga menilai tindakan HN seakan Jembatan Timbang Gebang milik ataupun warisan keluarganya sehingga sesuka hatinya berbuat. Dimana apabila pergantian Kepala seiring itu pula SK penempatan HN juga diper-

bahurui. Mereka juga menyebutkan HN takut dipindahkan ketempat lain, sementara aturan PNS harus bersedia dipindahkan kemana saja. Akibat kolusi dari HN maka bertahan di jembatan timbang Gebang dalam waktu yang cukup lama. Misalnya beberapa waktu lalu ada Kepala Regu yang tidak mau menuruti kemauan HN selaku Waka akibatnya kepala regu tersebut dipindahkan di pindahkannya, termasuk salah satu Kepala Regu ,Rusli Bintang yang menyetor dengan jumlah setoran yang ada di instruksikan oleh HN. Dan kalaupun ada pemberitaan di media mssa terhadap kinerja jembatan timbang Gebang maka dengan entengnya dia mengatakan bahwasanya berita tersebut hanya cerita kedai kopi. Bermoduskan Perda, HS dan HN menerima setoran melalui kaki tangannya di lapangan mencapai ratusan juta rupiah. Sehingga tidak jarang pula para truck kehabisan uang makan akibat dipersulit. Keadaan ini jelas merubah fungsi jembatan sebagai alat kontrol pengawas kendaraan yang lebih muatan berakibat kerusakan jalan dan jembatan

dan menimbulkan kecelakaan yang sangat fatal. Tidak jarang pula terjadi kecelakaan disebabkan HN mengutip uang Perda truk lebih muatan. Hal ini memang sengaja dipelihara HN. Angkutan tangki BBM. CPO tetap masuk jembatan timbang dengan bayaran yang sudah ditentukan, lain lagi banyak belasan mobil angkutan tangki. Dimana HS setiap bulannya selalu jemput bola datang ke kantor mobil angkutan tangki secara siluman, ada beberapa merek angkutan tangki bisa mencapai Rp 5 juta. Sumber lain menyebutkan diantaranya ada mobil yang bermerek BBM, MNA, Saka, RSA, GR, PJ, ANUGERAH, dan lainnya. HS juga sering melacak ambil setoran ke salah satu merek angkutan tangki MNA beralamat jalan Dagang, Medan dekat Carefour.Setiap bulan diduga HN sanggup mengeluarkan dana taktis dan bantuan Binas/Banbis mencapai Rp. 8.900.000/hari. Salah seorang supir truk yang enggan di sebut jati dirinya meminta penegak hukum bertindak tegas terhadap HN dan HS maupun kelompoknya yang telah mempermainkan Perda demi kepentingannya. (Tim)

Terkait Penangkapan Zeki Gtg

Polsek P Brandan Diduga Lakukan Rekayasa P. Brandan, BN Penangkapan Zeki penduduk Desa Securai Pasar I Kecamatan Pangkalan Brandan Langkat yang sejak 14 Februari mendekam di tahanan Polsek P. Brandan di tuduh penganiayaan dan penggelapan diduga sarat dengan rekayasa. Berdasarkan keterangan Marianan Br. Sitepu, ibunya Zeki dalam pertemuannya dengan BN disebutkan Zeki saat itu sedang berkunjung ke rumah Samsudin Lbs dalam rangka silaturrahmi. Dalam percakapan Zeki mengakui mengambil brondolan sawit dan ditampung si

Udin.Pekerjaan tersebut sudah dilakoninya sejak lama. Alasan penahanan Zeki dikarenakan saat bermain bilyard dengan Udin,dirinya kalah dan terutang Rp 1 juta kemudian keretanya ditahan.Karena tidak bisa pulang akhirnya Zeki meminjam kereta Udin yang sudah kelihatan butut. Pada hari kedua Udin datang bawa seorang berboncengan menanyakan dimana kereta yang saya pinjam.Dikatakan dipinjam teman sebentar. Udin marah-marah sambil memaki.Untuk menggetaknya ,saya ambil cangkul.Tak berapa lama Udin kembali dengan membawa Polisi Pangkalan

Brandan dengan delik aduan penganiayaan dan penggelapan kereta . Dalam hal ini Br. Sitepu mempertanyakan menambahkan Polisi Pangkalan Berandan. yang hanya memeriksa satu pihak saja.Dia menuduh mengokang dan mencuri kereta. Semua tuduhan belum terbukti namun Zeki terus ditahandan beberapa Udin minta damai, pertama minta Rp 5juta tidak kami mau, kedua minta Rp 3juta kami bilang tidak ada, ketiga minta Rp 1,5 juta .Dan semuanya tidak disanggupi pihak keluarga Zeki. (Inst)

dan 335 KUHP untuk dilengkapi Polsek Pangkalan Brandan ditanda tangani penuntut umum Bintang Simatupang,SH bahwa berdasarkan terangan tersangka Sopian Manurung, Rosman Efendi Gultom, Farel Simare mare, Kasmin Dolok Saribu, Santun Pakpahan, Dapot Dwaltu Sijabat, Darmawan Simatupang, Nur Hasan Sitorus, yang membuat surat tertanggal 19 Januari 2012, adalah H. Saur Manurung bahwa untuk memperjelas tentang duduknya

perkara dan peran masing-masing tersangka agar penyidik memisahkan (Splitsing) berkas perkara para tersangka apakah dia sebagai orang yang melakukan, yang menyuruh melakukan atau turut malakukan perbuatan itu sebagaimana dimaksud pasal 55 ayat 1 KUHP. Polsek P. Brandan telah menyurati ong Satar Tampubolon No. 51/III/2012/ Reskrim perihal pemberitahuan perkembangan hasil penyidikan tertanggal 27 Maret 2012 (INST)

Bupati Pimpin Apel Peringatan HKN dan Ultah Provsu ke-64 Batubara, BN "Dengan hari jadi ke-64 kita mantapkan persatuan kebersamaan dan kegotong royongan antar pemerintah serta masyarakat untuk membangun,memajukan provinsi sumatera utara". Hal itu dikatakan Bupati saat membacakan teks pidato,Plt Gubernur Sumatera Utara H.Gatot Pujo Nugroho,ST di halaman Kantor Bupati Kab Batubara,Senin (16/4) Kita terus tingkatkan komitmen persatuan,kebersamaan dan kegotong royongan untuk meningkatkan hubungan provinsi dengan seluruh kabupaten kota sesuai tema yaitu,Hari jadi ke-64 Provinsi Sumatera Utara,jelas OK Arya. Diusia yang ke-64,Pemprovsu telah berhasil menggapai pertumbuhan ekonomi indonesia bagian barat bahkan didunia dengan hadirnya kawasan bandara internasional kuala namu serta program masterplant percepatan dan perluasan pembangunan ekonomi indonesia (MP3EI) koridor I Sumatera khususnya Sumatera Utara. Ditambahkan Bupati,Perk Sei.Mangkei adalah kawasan industri yang menjadi kawasan ekonomi khusus (KEK) dan menyediakan proyek energi listrik khususnya power plant hidro dan menjadi pusat pangan nasional untuk itu atas nama provsu,Plt Gatot mengucapkan terima kasih kepada seluruh jajaran kabupaten kota.(naryo)

Dandim 0204/DS: Pertumbuhan Ekonomi Sumut Ditargetkan 7 Persen Tebingtinggi,BN Komandan Distrik Militer (Dandim) 0204/DS, Letkol Arh Wawik Dwinanto mengungkapkan, pada tahun 2011 lalu, pertumbuhan ekonomi di Sumatera Utara sebesar 6,58 % lebih tinggi dari ratarata nasional sebesar 6,10%. Sedangkan di tahun 2012 ini akan di targetkan tumbuh menjadi 7 %. “Keberhasilan meningkatnya pertumbuhan ekonomi Sumut ditopang oleh neraca perdagangan Sumut, dimana neraca perdagangan luar negri sampai akhir tahun 2011 lalu, Sumut masih surplus sebesar 6,93 miliar US Dolar. Hal ini disumbang dari hasil ekspor dengan volume impor sebesar 6,71 juta ton senilai 4,95 miliar US Dolar”, demikian isi pidato tertulis Plt Gubernur Sumut yang dibacakan Dandim 0204/DS, Letkol Arh Wawik Dwinanto saat menjadi inspektur upacara dalam rangka HUT ke 64 Propinsi Sumut, Senin (16/4) di halaman Pemko Tebingtinggi. Disebutkan bahwa terjadi penurunan persentase penduduk miskin Sumut, dimana jumlah penduduk miskin pada tahun 2011 sebesar 10,83 %, lebih rendah dibandingkan dengan tahun 2010 sebesar 11,31 %. “Untuk tingkat pengangguran terjadi penurunan dari tahun 2010 sebesar 8,01 %, di tahun 2011 berada pada posisi 6,37 %, tahun depan kita optimis pertumbuhan lapangan pekerjaan akan semakin meningkat dengan potensi investasi Sumut yang terus tumbuh, selama iklim investasi dan bisnis bisa tetap dijaga dengan baik”, sebutnya. Menurutnya, ke depan kita berobsesi setidaknya provinsi ini akan terus berkembang menjadi zona industri berbasis ramah lingkungan, antara lain karena penggunaan power plant hidro yang potensinya cukup besar, kemudian provinsi ini juga merupakan bagian dari pusat pangan nasional dengan pusat perkebunan, pertanian dan agribisnis. “Pemerintah Provsu pada 5 Januari 2012 telah menetapkan tim kerja pemerintah daerah tentang pembangunan ekonomi Indonesia tahun 2012-2025 sebagai implementasi MP3EI dan membentuk sekretariat tim kerja. Selain itu ada public private partnership (kerjasama pemerintah dan swasta) sebanyak 25 proyek yang pembiayaannya dikerjasakan dengan pihak swasta. Provinsi Sumut tahun 2012 ini juga telah mengajukan tambahan proyek MP3EI sebanyak 19 proyek”, demikian papar Letkol Wawik. Selain itu, katanya, komitmen mewujudkan masyarakat Sumut yang tidak lapar terus dipertajam dengan target untuk pertanian tanaman pangan dan holtikultura dengan peningkatan produksi rata rata sebesar 5 %, perkebunan dengan target peningkatan ekspor sebesar 7 % serta memacu produktifitas peternakan, perikanan dan kelautan lainnya. “Komitmen masyarakat tidak bodoh dengan target wajib belajar 12 tahun, meningkatnya partisifasi sekolah 99% dan angka partisipasi kasar penduduk usia 7-18 tahun sebesar 95% dengan rata-rata lama sekolah 10,07% pertahun dan lainnya”, jelasnya. Pada kesempatan itu, Dandim 0204/DS ini berpesan agar seluruh masyarakat Propinsi Sumut agar tetap menjaga kondusifitas khususnya menjelang pelaksanaan Pemilihan Gubernur Sumut, “Tahun depan kita akan menggelar pemilihan gubernur dan wakil gubernur Sumut masa bakti 2013-2018, Mari kita sukseskan pesta demokrasi lokal ini dengan tetap mempertebal komitmen dan peran kita masing-masing dalam menjaga Sumut tetap kondusif dan harmonis”, pesan Plt Gubsu melalui Dandim 0204/DS. Tampak hadir dalam upacara Apel Gabungan Memperingatu HUT ke 64 Propinsi Sumut di Kota Tebingtinggi itu antara lain, Walikota Ir H Umar Zunaidi Hasibuan, Wakil Walikota H Irham Taufik SH MAP, Plt Sekdako H Hadi Winarno, Ketua DPRD H Syahrial Malik, Wakapolres Tebingtinggi dan Ketua Pengadilan Agama serta para pimpinan SKPD sejajaran Pemko Tebingtinggi.(DER)

OK Arya Zulkarnain: Lahan Persawahan di Batubara Sangat Luas Batubara, BN Kab Batubara mempunyai lahan sawah seluas kurang lebih 20.000 Ha,dan merupakan komoditas tanaman padi andalan yang menghasilkan kurang lebih 157.500,ton setiap panin. Kecamatan Sei.Suka menghasilkan produktifitas 5 ton,memiliki lahan persawahan dengan luas luas kurang lebih 3.322 Ha,dan merupakan salah satu Kabupaten lumbung beras di

Sumatera Utara yang menduduki peringkat ke 3,setelah Sergei dan Deli Serdang. Pengembangan tanaman pangan yang potensial merupakan salah satu upaya untuk meningkatkan perekonomian dan menciptakan kegiatan ekonomi yang efisien berdampak bagi kemajuan masyarakat. Selain itu juga diharapkan agar petani memberikan motivas dimana petani Kab Batubara mendapat dana

APBN Tahun 2012 melalui Dinas Pertanian untuk meningkatkan produksi.Bantuan yang akan diberikan benih padi,111,25 ton untuk area seluas 4.450 Ha,benih jagung 4,5 ton dengan luas area 300 Ha dan benih kedelai 20 ton untuk area penanaman seluas 500 Ha. Melalui bantuan dari sumber dana APBN,terdapat juga bantuan APBD Provinsi dan APBD Kab,petani Kab Batubara lebih aktif menerapkan

teknologi pertanian sehingga sumber daya manusia petani dapat meningkat,harap Bupati. Seterusnya Bupati menjelaskan dari tangan petani Kab Batubara dapat meraih penghargaan dari Presiden Republik Indonesia sebanyak dua kali berturut-turut pada Tahun 2009/ 2010,semoga prestasi yang diraih petani yang dibantu dinas pertanian dapat mempertahankannya. (naryo)

23-30 APRIL 2012 | EDISI 312| THN KE-VII

Anggota DPRD Tapsel Sangkal Terima Uang Rp 150 Juta dari BKD Tapsel Tapsel Salah satu anggota DPRD Kabupaten Tapanuli Selatan dari Partai Amanat Nasional (PAN) Borkat ,S.Sos bersama salah seorang rekannya yang juga anggota DPRD Tapsel Tahun 2008 turut serta menikmati Anggaran BKD Tapsel Tahun 2008 lalu. Seperti tersurat didalam pernyataan mantan Bendahara BKD Tapsel Habibuddin , S.Sos bahwa anggaran BKD Tapanul;i Selatan Tahun Anggaran 2008 diberikan kepada atas nama Borkat dan Syarifuddin Hsb yang saat itu anggota DPRD Tapsel dengan nilai uang yang diberikan sebesar Seratus Lima Puluh Juta Rupiah. Uang tersebut diserahkan Habibuddin diruang kerja Kepala Badan Kepegawaian Tapanuli Selatan Drs. Aslim Simamora dan penyerahan uang dimaksud atas perintah dan sepengetahuannya (Aslim Simamora, red). Surat pernyataan tersebut dibuat di Padangsidimpuan tertanggal 1 Desember 2009 yang lalu bermaterai Rp.6000 ditanda tangani dicap Jempol. Borkat ,S.Sos yang dikonfirmasi melalui Telepon Selulernya mengatakan bahwa hal tersebut tidak benar adanya. Menurut borkat, yang membuat surat tersebut sedang dalam keadaan pening, karena pening makanya ia buat surat itu, demikian ucap Borkat yang waktu itu berbahasa daerah “Naponing do na mambaen surat i, haran ni poningna do ibaen ia surat i” ucapnya. Surat pernyataan Habibuddin tersebut terlampir dalam pernyataan sikap LSM LIRA yang demo di DPRD Tapsel tentang pembangunan Pasar Sitinjak yang dananya ditampung dalam Pos Anggaran Dinas Koperasi, Perindustrian dan Perdagangan Tapanuli Selatan dengan menelan dana sebesar Satu Miliyar Empat Ratus Sembilan Puluh Delapan Juta Tiga Ratus Ribu Rupiah, namun bangunan tersebut telah mengalami rusak parah sementara umurnya baru beberapa bulan. (KS.03)

Walikota Mutasikan 60 Pejabat Eselon II, III, IV Padangsidimpuan Pemerintah Kota Padangsidimpuan mutasikan pejabat eselon II, III dan IV sebanyak 60 orang yang pelantikannya dilaksanakan di Aula Kantor Walikota Padangsidimpuan, Jum’at (20/04) lalu. Acara yang dipimpin langsung oleh Walikota Padangsidimpuan Drs.H. Zulkarnaen Nasution, MM ini dihadiri oleh Sekda Para Kepala Dinas, Badan, Kantor dan Camat Se-Kota Padangsidimpuan. Pelantikan tersebut merupakan penyegaran dan salah satu upaya peningkatan kinerja untuk meningkatkan pelayanan terhadap masyarakat serta menunjang pencapaian visi- misi Pemerintah Kota Padangsidimpuan. Dalam Keputusan Walikota Padangsidimpuan No.49/KPTS/2012 tanggal 17 April 2012 tentang pengangkatan , pemindahan dan pemberhentian jabatan terlampir susunan nama-nama diantaranya jabatan eselon II yang dilantik pada hari itu ada yang dimutasi menjadi staf pada staf ahli di lingkungan pemerintah kota Padangsidimpuan yang sebelumnya menjabat sebagai kepala Badan. Untuk jabatan eselon II Marhan, SP, MM dimutasi menjadi Kepala Badan Perencanaan Pembangunan Daerah Kota Padangsidimpuan jabatan lamanya staf pada staf ahli Walikota Bidang Ekbang dan Keuangan Pemko Padangsidimpuan Sementara untuk Kepala Badan Perencanaan Pembangunan Daerah Kota Padangsidimpuan yang lama Drs. Samakmur, MM menjadi staf pada staf ahli Walikota Bidang Ekbang dan Keuangan Pemko Padangsidimpuan. Dalam Keputusan Walikota Padangsidimpuan No.50/KPTS/2012 tanggal 17 April 2012 tentang pengangkatan , pemindahan dan pemberhentian jabatan Eselon III, IV terlampir susunan nama-nama sebanyak 58 orang. (KS.03)

Pengerjaan Pipanisasi Amburadul

DOLOKSANGGUL ,BN. Jalan menuju Kecamatan Sijamapolang percisnya di simpang tiga Desa Purba Manalu Kecamatan Doloksanggul, selalu digenangi oleh air setiap datangnya hujan ,padahal sebelum Kabupaten delapan tahun silam tidak pernah terjadi banjir biarpun hujan terus menerus,sebab salurannya lancar alias tidak mampat , tetapi semenjak adanya pengerjaan dan pemasangan pipanisasi oleh Kantor PAM /Perusahaan Air Minum Doloksanggul Kabupaten Humbang Hasundutan jalannya selalu kebanjiran yang mengaliri aspal dan gubangan air . Menurut salah seorang penduduk setempat kepada BN, Bahwa semenjak dipasangnya pipanisasi atau pengerjaan pipa air yang dipasang dari bawah saluran air (bubusan) air jadi tidak lancar mengalir ,sebab pada saat pengerjaannya ada batu besar yang dipasang dibawah bubusan tersebut, akibatnya saluran air yang dibuat oleh Bangsa Belanda pada jaman penjajahan itu , tidak berfungsi dengan baik,sehingga airnya mengalir hanya sedikit dari bubusan karena terhalang dengan batu besar yang dibuat oleh pihak PAM , tanpa memikirkan kepentingan dan keamanan warga masyarakat yang tinggal disekitar bubusan peninggalan Belanda tersebut. Ada beberapa keluarga yang merasa terganggu kenyamanan dan rumahnya ikut terkena genangan air, dengan banjirnya pemukiman tersebut diantaranya : kel. Simatupang , Simamora , dan Purba, Sudah beberapa kali penduduk setempat untuk memperbaiki dan mengangkat batu tersebut dari bawah bubusan tetapi tidak bisa terlaksana dengan baik sebab batu tersebut terletak agak kedalam dan berat sehingga susah untuk meyingkirkannya, jalan satusatunya adalah dengan membongkar plat yang dibuat oleh PAM itu. Kiranya keluhan dan permintaan warga sekitar pemukiman itu bisa terealisasi dengan cepat dan ditanggap oleh i pihak yang berwenang dan berkepentingan .( RS)

Air Terjun Lae Mbilulu Kurang Perhatian Pakpak Bharat, BN Obyek wisata air terjun Lae Mbilulu dengan ketinggian sekitar 20 meter yang terletak di Desa Pronggil Julu, Kecamatan Tinada, Kabupaten Pakpak Bharat, hingga saat ini masih luput dari perhatian Pemerintah Daerah. Obyek wisata tersebut terkesan kurang diperhatikan serta tidak terurus, berbagai fasilitas pendukung juga masih sangat minim, seperti akses jalan menuju lokasi yang masih belum memadai, tempat persinggahan bagi pengunjung serta tempat bermain bagi anakanak juga belum tersedia, obyek wisata air terjun Lae Mbilulu tersebut sangat cocok dikembangkan menjadi tujuan wisata sehingga nantinya menjadi sumber Pendapatan Asli Daerah (PAD). Hal tersebut diungkapkan warga Pronggil Julu, Palotmo Padang kepada wartawan, Selasa (17/ 4),’’Air terjun Lae Mbilulu belum tergali sacara maksimal, sebab hingga saat ini fasilitas pendukung obyek wisata air terjun belum juga dibangun secara permanen, sementara obyek wisata air terjun ini sangat cocok dikembangkan serta dipromosikan menjadi daerah tujuan wisata, sehingga nantinya dapat menambah penghasilan asli daerah’’, jelasnya. Pantauan wartawan, Selasa (17/4) dilokasi air

Satuan Perlindungan Masyarakat Garda Terdepan Bagi Pemerintah

terjun Lae Mbilulu yang masih asri serta alami, sangat potensial untuk dijadikan sebagai obyek wisata, namun sangat disayangkan fasilitas pendukung di daerah tujuan wisata tersebut belum

tertata dengan baik, serta kurangya promosi yang dilakukan Pemkab Pakpak Bharat sehingga obyek wisata tersebut kurang dikenal masyarakat. (pb.007/tim)

Dinas Pendidikan Pakpak Bharat Laksanakan UN Pakpak Bharat, BN “Kita harus bekerja keras, bekerja cerdas dan bekerja ikhlas untuk meraih prestasi”, ucap Bupati Pakpak Bharat, Remigo Y Berutu, kepada seluruh masyarakat Pakpak Bharat dalam berbagai kesempatan. Kalimat inilah yang dijadikan cambuk oleh Dinas Pendidikan Kabupaten Pakpak Bharat untuk menyelenggarakan Ujian Nasional (UN). Kalimat itu juga diharapkan dapat memotivasi para siswa yang akan mengikuti UN nantinya, harap Remigo. Plt. Kadis Pendidikan Kabupaten Pakpak Bharat, Sampe Boangmanalu, S.Pd, Kabid Pendidikan Dasar, Jibun Padang, S.Pd, menyampaikan bahwa Dinas Pendidikan Pakpak Bharat sudah siap menyambut dan melaksanakan UN. “Pada tahun UN tahun 2012 diikuti oleh 2.684 peserta yang terdiri dari tingkat SD/ MI sebanyak 1.102 siswa, SMP/MTs sebanyak 939 siswa dan pada tingkat SMA/SMK sebanyak 181 siswa”, ujar Sampe Boangmanalu. “Kami siap melaksanakan dan menyukseskan UN secara jujur dan bermutu sebagaimana disyaratkan dalam pos Ujian Nasional”, tegas Sampe Boangmanalu lebih lanjut. Jibun Padang menambahkan, bahwa untuk penyelenggara UN pada tingkat SD/MI sebanyak 58 sekolah dan 6 sekolah menggabung, pada tingkat SMP/MTs sebanyak 18 sekolah dan 4 sekolah menggabung, serta pada tingkat SMA/SMK sebanyak 6 sekolah. Dikatakan juga oleh beliau bahwa Kartu Peserta UN sudah didistribusikan kepada masing-masing satuan pendidikan. Pada kesempatan yang berbeda Kabid Pendidikan Menengah, Drs. Morasi J. Berutu mengatakan bahwa sesuai Peraturan Menteri Pendidikan dan Kebudayaan, bahwa syarat kelulusan UN untuk tingkat SD/MI ditetapkan satuan pendidikan dalam rapat dewan guru. Sementara pada tingkatan lainnya telah ditetapkan dengan nilai rata-rata minimal 5,5 (lima koma lima) serta nilai terendah masing-masing mata pelajaran 4,0 (empat koma nol). Pelaksanaan UN tingkat SD/MI pada tanggal 08-10 Mei 2012, untuk tingkat SMP/MTs pada tanggal 23-26 April 2012, tingkat SMA/MA pada tanggal 16-19 April 2012 dan tingkat SMK tanggal 16-18 April 2012, lanjut Morasi Berutu. “Kami telah melakukan kegiatan pra UN seperti pen-

dataan peserta, sosialisasi dan himbauan kepada sekolah untuk memberi bimbingan tambahan bagi para siswa”, ujar Morasi Berutu mengakhiri pembicaraan. Bupati Pakpak Bharat Tinjau Pelaksanaan UN Hari Pertama Bupati Pakpak Bharat Remigo Y Berutu, hari pertama pelaksanaan Ujian Nasional (UN) tingkat SMA Sederajat di Kabupaten Pakpak Bharat tinjau sejumlah sekolah tempat diselenggarakannya UN. Diselasela peninjauanya Remigo Y Berutu kepada wartawan (16/4) menyampaikan bahwa pelaksanaan UN untuk hari pertama lancar dan tidak ditemukan masalah. “Semua berjalan dengan lancar, lembaran soal ujian dan lembar jawaban cukup dan sengaja saya turun pada saat jam pengumpulan soal, ternyata memang semua berjalan dengan baik dan sesuai dengan aturan”, jelas Bupati. Kepada para anak didik saat peninjauannya Bupati menghimbau kepada para anak didik untuk menjaga kesehatan, berdoa dan menjaga ketertiban dalam pelaksanaan UN serta terus meningkatkan kemampuan sehingga dapat meraih prestasi baik bagi diri

sendiri, keluarga bahkan untuk peningkatan pembangunan di Pakpak Bharat kelak. Sesuai dengan hasil rapat koordinasi seluruh Kepala Daerah dengan Dinas Pendidikan Sumatera Utara bahwa pada tahun ini lembar soal dapat ditinggalkan disekolah masing-masing dengan tujuan meningkatkan kemampuan anak didik yang masih duduk dibangku kelas dua untuk dipelajari sebagai bahan acuan ditahun berikutnya. Selain itu, kualitas kertas lembar jawaban juga semakin lebih baik. Menyangkut siswa yang tidak hadir, Remigo menyampaikan bahwa yang berhalangan hadir pada saat jadwal yang sudah ditentukan dapat mengikuti ujian susulan dengan soal ujian yang berbeda. Sementara menyangkut minimnya fasilitas yang terdapat di SMKN Pergetteng-getteng Sengkut (PGGS) tahun depan ia berjanji akan melakukan perbaikan dan penambahan khususnya menyangkut ruangan kelas yang sudah mengalami kerusakan. Usai melakukan peninjauan di SMKN PGGS Bupati bersama rombongan langsung menuju SMAN Salak. (pb.007/tim)

KIMP3 Siap Pantau Pemilukada P.Sidimpuan Ahmad Muda Hsb, SP: PNS Harus Netral Padangsidimpuan,BN Komunitas Independen Masyarakat Peduli Pemilu dan Pemilukada (KIMP3) Tabagsel siap mengawal dan memantau seluruh jalannnya proses tahapan Pemilukada kota Padangsidimpuan yang akan digelar pada Oktober mendatang. Selain itu, KIMP3 juga akan memantau kinerja KPUD, gerak-gerik Tim Sukses calon kepala daerah dan kinerja Panwas Pemilukada Padangsidimpuan.Karena menurut ketua umum KIMP3 Tabagsel,Ahmad Muda Hsb, SP untuk mewujutkan suatu Pemilukada yang demokratis, jujur, adil dan berkualitas pihak penyelenggara dan Pengawasan harus betu-betul bertindak Independen. “Tanggal 20 Februari lalu Lembaga kita sudah melayangkan surat No. 47/B/KIMP3-Psp/28/02/12 perihal permohonan ke KPUD kota Padangsidimpuan untuk diagreditasi agar mendapat visa sebagai salah satu lembaga Pemantau pada Pemilukada kota Padangsidimpuan yang akan digelar Oktober mendatang. Sekarang kita sedang melengkapi seluruh syarat-syarat sebagai Pemantau Pemilukada sesuai yang tertuang

di dalam Keputusan KPU daerah kota Padangsidimpuan No. 06/Kpts/KPU-Kota-002.43920/2012 tentang Pedoman Teknis tata cara Pemantau Dalam Pemilihan Umum Kepala Daerah Dan Wakil Kepala Daerah kota Padangsidimpuan Tahun 2012. Kita akan bekerja penuh waktu, namun kalaupun nanti KPU tidak memberikan agreditas kepada Lembaga kita untuk jadi pemantaua karena suatu hal, kita akan terus ikut berpartisipasi dengan cara lain demi terwujutnya Pemilukada yang demokratis, jujur, adil dan berkualitas”, papar Ahmad Muda Hsb, SP, didampingi Sekretaris KIMP3 Tabagsel, Ali asrun Pulungan saat dicegat Wartawan selesai melaksanakan Sholat Jum’at di Mesjid Nurul Majid Kel Wek I Padangsidimpuan Utara, Jum’at (20/4). “Sebagai Lembaga Independen, lanjut Muda Hsb, Lembaga kita juga akan mematau kinerja KPUD sebagai pihak penyelenggara, gerak-gerik TS calon kepala daerah sebagai pihak peserta dan kinerja Panwas sebagai pihak pengawasan. Khusus kepada Pegawai Negeri Sipil (PNS) dengan tegas kami tekankan agar jangan ikut-ikutan dukung mendukung kepada salah satu kandidat apalagi terdaftar sebagai TS salah satu calon kepala daerah. Sesuai amanah huruf (d) ayat 15 pasal 4 PP No. 53 tahun 2010 tentang disiplin PNS, PNS itu harus netral, karena itu kami harapkan kepada Panwas untuk menindak dengan tegas oknum PNS

yang terbukti ikut mendukung ataupun terdaftar sebagi TS salah satu calon kepala daerah. Kita berharap agar Pemilukada kota Padangsidimpuan tahun ini berlangsung dengan damai, demokratis, jujur, adil dan berkualitas. Untuk mewujutkan hal tersebut pihak penyelenggara yaitu KPU beserta jajarannya dan Panwas beserta jajarannya harus betul-betul bertindak independen dalam menentukan segala bentuk aturan, keputusan maupun kebijakan yang diterapkan. Jangan karena beberapa lembar uang rupiah recehan ataupun segepok uang Dollar, pihak penyelenggara maupun pihak pengawas Pemilukada bertindak tidak netral dalam menerapkan suatu aturan, keputusan maupun kebijakannya, karena itu jelas akan merugikan rakyat kota Padangsidimpuan”, cetusnya. Pada kesempatan tersebut, Muda Hsb juga mengingatkan masyarakat kota Padangsidimpuan agar ikut peduli untuk mengikuti jalannya seluruh tahapan Pemilukada dan agar mempergunakan hak pilihnya pada hari pencoblosan nanti. “Atas nama Lembaga kami mengingatkan masyarakat kota Padangsidimpuan agar peduli terhadap jalannya seluruh tahapan Pemilukada dan jangan lupa untuk mempergunakan hak pilihnya pada hari pencoblosan nanti demi mensukseskan pesta demokrasi tersebut”, ujarnya sambil berlalu dari hadapan Wartawan. (KS-04 )

PT.Petrokimia Gresik Cipta Sejahtera Gelar Temu Ramah dengan Kios Pengecer PADANGSIDIMPUAN,BN Dalam rangka untuk menjalin silaturrahmi dengan konsumen pendistribusian pupuk dikios pengecer agar pupuk yang diperlukan petani dapat memenuhi 6 azas (tepat jumlah,jenis,waktu,tempat,mutu dan harga) sebagai upaya untuk meningkatkan efektivitas penyaluran pupuk bersubsidi.Hal ini terungkap dalam temu rama antara PT.Petrokimia Gresik Cipta Sejahtera dengan distributor pengecer Pupuk bersubsidi di Aula SMK N 1 Padangsidimpuan Rabu (18/4). Hadir sebagai peserta,Seluruh kios pengecer yang ada di 5 Kab/ Kota,seperti,Kab.Tapanuli Selatan, Kota Padangsidimpuan, Padanglawas,Padanglawas Utara dan Tapanuli Tengah, dan nara sumber H.Abdul Rahim Pimpinan Cabang PT.Gresik Cipta Sejahtera.Dalam sambutannya,penyaluran Pupuk untuk Sumatera Utara 100 Persen namun daya serap penggunaan sekitar 80 Persen seperti NPK Ponska tersalur. Petani di Sumatera Utara, harus benarbenar memaksimalkan pemamfaatan pupuk bersubsidi, untuk mendukung keberhasilan program pertanian, dalam rangka mendukung program ketahanan pangan nasional.Kemudian sejalan dengan kegiatan ini “Kemitraan menuju optimalisasi penyaluran untuk kemajuan pertanian,dengan harapan swasembada pangan. Dalam kesempatan itu, H.Abdul Rahim menambahkan, menyampaikan komitmennya tahun 2012 berupaya memenuhi kebutuhan pupuk bersubsidi petani yang di 5 Ka/Kota. Hal ini sesuai dengan kebutuhan riil tanaman yang diusahakan walaupun melebihi alokasi yang ada terutama NPK Phonska minimal sesuai dengan alokasi SK Bupati/Walikota katanya. Dikatakannya bahwa secara keseluruhan

Pihak PT.Petrokimia Gresik Cipta Sejahtera ketika sedang memberikan bimbingan dan arahan kepada Kios pengecer Pupuk.Foto Dok.SAAD SIREGAR)

jenis pupuk bersubsidi (ZA, Sp dan NPK Phonska) terealisasi hanya 80 persen tahun 2011 yang lalu. Ini berarti ada sejumlah subsidi pemerintah pusat yang tidak bisa dimanfaatkan oleh petani di Kabupaten/Kota katanya.Tambahnya,sasaran pupuk berimbang peningkatan produksi padi,harus bisa menacapi 8 Ton/Hektare dengan pemakaian pupuk NPK Ponska dan pupuk Organik bersubsidi. Untuk itu diharapkan kedepan dalam penyusunan RDKK agar persepsi yang sama antara instansi, distributor, penyalur (kios) dan pengguna (petani). Digelarnya kegiatan ini sebagai upaya komitmen agar produktivitas petani secara umum meliputi

bidang tanaman pangan, kehutanan, peternakan dan perikanan, dapat berdaya guna. Ditegaskannya,apabila pupuk bersubsidi kurang kami selaku PT Petrokimia gresik akan berusaha ke Pemerintah agar jatah diperbanyak”Ucapnya.Dan ditekankannya apa bila ada masalah dan kendala dilapangan agar melakukan kordinasi dengan Ashari dan Suprianto untuk mengambil solusi. Turut hadir dalam acara,Kaban Penyuluh Pertanian Kabupaten Padanglawas,Ir Parimpunan Siregar,Kaban Ketahanan Pangan dan Penyuluh Pertanian Kota Padangsidimpuan,H M Soleh Nasution,dan Instansi terkait perwakilan setiap Kab/ Kota.(KS-04)

Pakpak Bharat, BN “Satuan perlindungan masyarakat adalah garda terdepan bagi pemerintah dalam membantu mengurangi resiko yang ditimbulkan oleh bencana alam, non-alam dan bencana sosial”,. Demikian amanat Menteri Dalam Negeri, Gamawan Fauzi pada peringatan HUT ke-50 Satuan Perlindungan Masyarakat (Linmas) dengan thema “Satuan Perlindungan Masyarakat Siap Mengemban Tugas Dalam Membantu Penyelenggaraan Penanggulangan Bencana“ yang dibacakan Sekretaris Daerah Kabupaten Pakpak Bharat, Drs. Holler Sinamo, MM, pada Upacara Peringatan hari ulang tahun ke-50 Satuan Perlindungan Masyarakat di Lapangan Napasengkut, Salak, Kamis (19/4) lalu. Upacara peringatan HUT ke-50 Linmas di Kabupaten Pakpak Bharat diwarnai hujan angin sehingga pelaksanaan upacara dilakukan di Tribun lapangan Napasengkut meski beberapa bagian acara dihilangkan guna menyesuaikan dengan kondisi. Tampak hadir pada upacara ini para perwira dari Polres Pakpak Bharat, Kodim 0206 Dairi dan Kejaksaan Negeri Dairi-Pakpak Bharat serta para pimpinan SKPD, juga dihadiri oleh jajaran PNS lingkup Pemkab Pakpak Bharat dan Siswa/siswi dari beberapa sekolah yang terdapat di Pakpak Bharat. Kepala Bagian Kesbang Linmas Setda Rahmad Kudadiri, S.Sos menyampaikan bahwa upacara ini dilaksanakan tidak untuk memperingati semata-mata, tapi juga untuk kembali mengingatkan tugas dan fungsi satuan Linmas itu sendiri, khususnya tugas dan fungsi membantu Pemerintah untuk melindungi masyarakat secara baik di lapangan. “Hal yang sama juga, sebagaimana sering disampaikan oleh Bupati Pakpak Bharat, Remigo Y Berutu, tentang tanggung jawab serta pengabdian kita kepada masyarakat”, tegas Kudadiri. (pb.007/

Masyarakat Harapkan Gubsu Realisasikan Pembangunan Jalan Propinsi Batas Dlleng Simpoon

Pakpak Bharat, BN Masyarakat dari Desa Batu Gajah, Desa Lae Ardan, Desa Hutagalung, Kecamatan Parlilitan, Kabupaten Humbang Hasundutan yang berada dekat kaki Gunung Simpon mengharapkan kepada Plt. Gubernur Sumatera Utara Gatot Pujo Nugroho, ST, merealisaikan pembangunan dan memperbaiki jalan Propinsi mulai dari batas (Gunung Simpon) Kabupaten Pakpak Bharat ke Desa Batu Gajah Kecamatan Parlilitan Kabupaten Humbang Hasundutan yang saat ini kondisinya sangat memprihatinkan dan dapat dikatakan tak layak lagi dikatakan jalan, namun karena jalan satu satunya alternatif membuat tak ada lagi pilihan lain terpaksa masyarakat dari beberapa desa dimaksud bila mengunjungi family ke Pakpak Bharat atau sebaliknya terpaksa melewati jalan dimaksud walaupun berjalan kaki dengan mendaki memakan waktu berjam-jam. Hal tersebut dijelaskan sejumlah masyarakat melalui telepon kepada Wartawan menanggapi adanya pernyataan anggota DPRDSU Komisi D saat mengunjungi Pakpak Bharat, Rabu (11/4) lalu, dimana akan mengupayakan realisasi pembangunan Jalan Propinsi dari batas Gunung Simpon menuju Parlilitan Humbahas sepanjang 5 Km pada Tahun Anggaran 2013 mendatang, kami masyarakat dari kecamatan Parlilitan dan Kecamatan Tarabintang yang berbatasan langsung, juga memiliki hubungan historis kekeluargaan dengan masyarakat Pakpak Bharat sangat berharap dan menghargai upaya yang dilakukan bapak-bapak anggota DPRDSU tersebut dan sangat berharap kepada Plt. Gubsu Gatot Pujo Nugroho, ST supaya tahun 2013 dapat mewujudkannya. Siat Tumanggor dan Saidi Berutu tokoh masyarakat dari Desa Batu Gajah mengatakan, kondisi yang cukup memprihatinkan jalan propinsi dari batas Gunung Simpoon hingga ke Batu Gajah hanya sepanjang 5 Km, bila ada kemauan dari Pemerintah sebenarnya bukan jadi masalah sebab masalah ijin yang selalu dikatakan menyebabkan gagalnya pembangunan dimaksud tidak masuk akal, karena dari Pakpak Bharat menuju Gunung Simpon sepanjang 31 Km kenapa bisa dibangun dengan aspal hotmix sehingga Mobil jenis Sedan sekalipun bisa lewat, padahal melewati hutan lindung juga, sementara dari kaki Bukit Simpoon ke Batu Gajah hanya 5 Km kenapa tidak bisa dibangun, ungkap Saidi Berutu merasa heran. Hal senada diucapkan tokoh masyarakat dari Desa Hutagalung dan Tarabintang Siantar Dairi Robinson Berutu, Manikkir Berutu dan Saudur Nainngolan. Mereka mengomentari masalah ijin dari Kementrian Kehutanan, menurut warga pada tahun delapan puluhan Jendral L.B Moerdani melalui ABRI Masuk Desa sudah memulai pembangunan jalan dimaksud dengan mengaspal sepanjang kurang lebih satu kilometer dimulai dari batas Simpoon, dilanjutkan dengan meresmikan beberapa prasasti di sekitar Gunung Simpoon dan di Desa Batu Gajah sebagai pertanda pembukaan dan pembangunan jalan dimaksud sangat vital dan penting, namun dari tahun delapan puluhan hingga sekarang tidak pernah diperdulikan sehingga kondisinya sangat memprihatinkan. Robinson mengakui bila jalan dimaksud bagus dan hubungan transportasi manusia dan barang lancar masyarakat dari dua Kecamatan (Parlilitan dan Tarabintang) bila bepergian menuju Pakpak Bharat dengan kenderaan roda dua dapat menempuh setengah jam perjalanan berikut hasil pertanian dapat dipasarkan ke Pekan Singgabur. Juga bila warga kedua Kecamatan tersebut pergi ke Medan via Pakpak Bharat hanya memakan waktu enam jam sudah sampai di Medan sementara melalui Dolok Sanggul memakan waktu Sembilan sampai sepuluh jam sebut Robinson Berutu yang juga Kepala SMP Budi Murni Desa Sitanduk. Sementara itu, masyarakat dari Desa Maneas dan Desa Singgabur Kecamatan STTU Julu Kabupaten Pakpak Bharat saat bincang bincang dengan wartawan di Singgabur, Rabu (18/4) menanggapi seputar pembangunan jalan dimaksud menyambut dengan gembira. Sebab kata Parmin Berutu mantan Kepala Desa Singgabur yang juga diamini Kadis PU Pakpak Bharat Ir. Mahadi Simanjuntak Msi, MM, Pemkab Pakpak Bharat pada tahun 2012 ini, disepanjang/sekitar Jalan Propinsi akan membangun pertanian Gambir dengan pembukaan awal 300 Ha dan pembukaan persawahan 200 Ha, bila transpotasi lancar dipastikan meningkatkan perekonomian bukan hanya masyarakat Pakpak Bharat, namun juga warga Kecamatan Parlilitan karena sebahagian masyarakat Parlilitan memiliki lahan pertanian disekitar jalan tersebut, jelas Mahadi Simanjuntak. BN/pb.007

23 - 30 APRIL 2012 | EDISI 312 | THN KE-VII

Pembangunan Hotel Grand Elite Diprotes Warga Medan,BN Sejumlah warga yang berdomisili di Jl Gatot Subroto Gg Sehati lingkungan 9 Kelurahan Sei Sikambing D Kecamatan Medan Petisah protes atas pembangunan Hotel Grand Elite. Pasalnya, akibat pembangunan gedung Hotel berbintang serta pagar menimbulkan banjir rumah penduduk akibat penutupan saluran drainase oleh pengembang. Salah seorang warga Maimunah menyampaikan keluhannya kepada anggota DPRD Medan daerah pemilihan (Dapil) 3 saat melakukan reses di Kelurahan Sei Sikambing D, Kamis (19/4). ?Rumah kami selalu banjir akibat pembangunan Hotel Grand Elite, pihak pengembang melakukan penyempitan parit dan penutupan drainase?, keluh Maimunah. Disampaikan Maimunah, seluruh rumah warga di sekitar pembangunan Hotel tergenang banjir. Pihak pengembang dinilai

tidak peduli dengan saluran drainase. Sehingga, jika hujan turun, air meluber ke rumah warga karena terjadi penyempitan. Sama halnya dengan ibu Rukiah yang dijumpai di lokasi, membenarkan akibat pembangunan Hotel tersebut rumah penduduk jauh lebih rendah. Sehingga seluruh pembuangan air membanjiri rumah penduduk karena terjadi gangguan drainase. Mendengar keluhan warga, anggota DPRD Medan yang berasal dari Dapil 3 dipimpin kordinator reses Drs Irwanto Tampubolon, Herri Zulkarnain Hutajulu, Irwan Sihombing, Ferdinan Lumban Tobing, Hasym SE dan Budiman Panjaitan langsung meninjau lokasi pembangunan hotel. Dalam kunjungan dewan ini menemukan sejumlah kejanggalan seperti penyempitan parit yang dilakukan pihak Hotel sepanjang Gg Sehati. Begitu juga rumah penduduk yang persis dibelakang Hotel menjadi sasa-

ran genangan air. Sebab pembungan saluran air hujan tidak disiapkan pengembang hotel. Menyikapi hal tersebut, Irwan Sihombing (P Demokrat) sangat menyayangkan pihak Hotel yang mendirikan bangunan dengan semenamena. Irwan menyebutkan akan memanggil pihak pengembang Hotel ke gedung DPRD Medan untuk klarifikasi serta mempertanggungjawabkan kerugian warga. Begitu juga dengan Irwanto Tampubolon (PPRN) menilai pihak pengembang kurang sosialisasi terhadap warga sekitar. Dalam hal ini, pihak hotel harus melakukan perbaikan saluran drainase sebelum masyarakat melakukan protes. "Pihak Hotel harus menyahuti keberatan warga," tegas Irwanto. Hal hampir senada juga disampaikan Herri Zulkarnen Hutajulu (P Demokrat), pihak Dinas Bina Marga dan Dinas Tata Ruang Tata Bangunan (TRTB) harus turun menyikapi keluhan

warga serta melakukan pengawasan bangunan hotel. "Ini pasti ada penyimpangan bangunan, Dinas terkait harus bertindak tegas. Kasihan rumah penduduk selalu tergenang karena drainase," ujar Herri saat peninjauan. Disambung Ferdinan Lumban Tobing (Golkar) lagi, jika ter-

bukti pihak hotel melakukan penyimpangan izin dan melanggar Gambar Situasi Bangunan (GSB), Dinas terkait harus berani membongkarnya."Kita (DPRD Medan-red) siap buat rekomendasi bongkar jika terbukti menyalah," tegas Sekretaris komisi D ini. (ndo/dna)

Panitia Dies Natalis ke-25 STIKP Diterima Walikota

Walikota Hadiri Anak Medan Berpaskah Medan,BN Sejarah perjalanan Krisrus dalam memanggul tiang salib penuh siksa dan darah menjadi penyadaran serta pencerahan kepada saudata-saudaraku umat kristiani dalam memaknai Tuhan kepada manusia, hal ini disampaikan Walikota Medan Drs.H.Rahudman Harahap,MM pada saat menghadiri Anak Medan Berpaskah Ria, di Pardede Hall. Menurutnya perayaan Paskah Tahun ini bukanlah tanpa makna . Kekuatan Kristus dalam menyebarkan ajaran Nasrani hingga harus menebus dosa seluruh umat seharusnya menjadi landasan keimanan yang kuat, mencerahkan pandangan dan ketakwaan kepada Tuhan segala upaya yang dilakukan Kristus dalam merangkul umat dan membawa kearah pencerahan tidaklah mudah. Dalam kesempatan ini saya menghimbau kepada kita semua untuk merenungi sejauh mana kita mampu mamaknai cinta kasih Kristus kepada kita dan sejauh mana kita mengharapkan ajaran tersebut guna menebarkan kasih ke sesama umat manusia apapun agama dan bangsanya. Kita sangat bersyukur, karena selama ini kerukunan hidup beragama di kota Medan telah tercipta dengan baik. Hal ini tentu berkat kesadaran dan pengertian semua umat beragama mengenai pentingnya kerukunan, dan perbedaan tidak harus dijadikan sumber permusuhan, akan tetapi pemberdayaan dapat dijadikan sebagai ruang untuk membina kebersamaan dalam bingkai persaudaraan sebagai sesame umat beragama, sesame umat manusia, sesama warga kota Medan dan sesame bangsa Indonesia, ungkapnya. Walikota Medan mengharapkan melalui perayaan ini saya mengajak semua umat Kristiani untuk terus membina kebesamaan ,kerukunan dan kedamaian, sehingga semangat kebinnekaan dapat terus kita pelihara dengan menjadikan perbedaan sebagai rahmat. Alangkah indahnya damai dalam perbedaan, dan kondisi seperti ini telah dapat kita ciptakan di kota Medan, sehingga kota ini relative dalam suasana kondusif selama ini. Paskah tentunya merupakan sesuatu yang dapat dijadikan acuan dalam memantapkan kerukunan social ditengah kehidupan masyarakat yang multi etnis dan agama seperti kota Medan, karena saya sangat yakin bahwa umat kristiani adalah umat yang selalu menebar kasih dan damai dimana saja berada sesui dengan ajaran kristus. Mari bersama-sama kita bahu membahu untuk berperan lebih aktif lagi dalam upaya memacu percepatan pembangunan di kota yang kita cintai ini. Semua ini kita lakukan untuk menciptakan kota yang layak dan damai kehidupan masyarakat kota Medan, tambah Rahudman. Hadir dalam acara Pernandus, RE Nainggolan, Pastor senior Pendeta Gilbert Lumoindong, Pastor local Pendeta Jack Marpaung, Budiman Nadapdap, Ir Bintatar hutabarat, Tim Glow Felosif center dari Jakarta, para SKPD dan para jemaat. (ndo/dna)

Medan,BN Dalam rangka memperingati ulang tahun peraknya, Sekolah Tinggi Ilmu Komunikasi "Pembangunan" (STIKP) Medan Jalan Sisingamangaraja Medan menggelar Dies Natalis ke-25. Selain melaksanakan kegiatan eksternal, juga digelar serangkaian kegiatan eksternal berupa bakti sosial untuk warga kurang mapu bekerjasama dengan Rumah Sakit Sari Mutiara berupa operasi katarak, pemberian kaki palsu dan alat bantu jalan. Hal ini diungkapkan Ketua Panitia Dies Natalis STIKP Drs Hendra DS didampingi ketika beraudiensi dengan Walikota Medan Drs H Rahudman Harahap MM di Balai Kota Medan. Dalam pertemuan dengan orang nomor satu di Pemko Medan itu, Hendra didampingi Pembantu Ketua III STIKP Austin Ernest Antariksa Tumengkol SSos dan Wakil Ketua Panitia David Swayna SKom. "Sudah 25 tahun STIKP berdiri. Alumninya banyak tersebar di media lokal maupun nasional. Ada pula yang di perusahaan swasta maupun instansi pemerintahan. Tentunya usia 25

tahun ini sangat special, sebab itu merupakan ulah tahun perak. Atas dasar itulah kami membuat serangkain kegiatan dalam Dies Natalis," kata Hendra. Selain kegiatan internal dan eksternal berupa bakti social, Hendra mengatakan pihaknya juga telah melakukan road show di sejumlah Sekolah Lanjutan Tingkat Atas (SLTA) tentang jurnalistik. Dalam road show itu, para siswa dikenalkan dan diajarkan dengan dunia jurnalistik sehingga mengetahui dan memahaminya. Untuk kegiatan bakti sosial seperti operasi katarak ini, Hendra menjelaskan pemeriksaannya mulai dilaksanakan, Kamis (19/4/2012), di Kampus STIKP Jalan Sisingamangaraja Medan. "Kita telah mengadakan kerjasama dengan Rumah Sakit Sari Mutiara untuk melakukan pemeriksaan sekaligus operasi katarak," ungkapnya seraya berharap agar Walikota meluangkan waktunya untuk menghadiri kegiatan tersebut. Menurut Hendra, puncak kegiatan Dies Natalis STIKP ke25 akan dilaksanakan di Hotel Garuda Plaza bulan depan. Un-

tuk itu Hendra mengharapkan kembali kehadiran Walikota. Selain Walikota, pihaknya juga telah menyampaikan undangan kepada Plt Gubsu H Gatot Pujonugroho. "Jadi kami mengharapkan sekali kedatangan Bapak Walikota," harapnya. Walikota Medan Drs H Rahudman Harahap MM didampingi Kadis Pendidikan DR M Rajab Lubis sangat mendukung kegiatan itu. Kemudian, Walikota menyarankan alumni STIKP yang telah berhasil diundang seluruhnya dan diminta untuk memberikan kesan dan pengalaman selama menimba ilmu di STIKP. Dengan demikian dapat memotivasi para mahasiswa untuk lebih semangat sehingga menjadi lebih baik lagi. "Saya sangat mendukung sekali atas digelarnya acara Dies Natalis STUIKP ke-25. Apalagi yang melaksanakan kegiatan ini merupakan para alumninya. Saya berharap kegiatan ini berjalan dengan lancar sesuai dengan yang diinginkan," kata Walikota seraya berjanji akan menghadiri ulang tahun perak STIKP tersebut. (r/ndo)

Rahudman Safari Jumat di Masjid Syuhada Medan,BN Walikota Medan Drs H Rahudman Harahap MM melaksanakan Safari Jumat di Masjid Syuhada Jalan Syuhada Pasar VI, Kelurahan Beringin, Kecamatan Medan Selayang. Kegiatan ini dilaksanakan sebagai tindak lanjut dalam upaya membangun silaturahmi antara pemerintah dengan masyarakat. "Dengan terjalinnya silaturahmi itu, maka kita ingin mendorong dan memotivasi masyarakat agar berperan aktif dalam mendukung pembangunan di Kota Medan. Tidak hanya pembangunan fisik, juga pembangunan mental dan spritual,"kata Walikota. Dalam upaya pembangunan mental dan spritual ini, Walikota berharap kenaziran masjid menghidupkan kembali Maghrib Mengaji. Untuk itu Walikota menyediakan dua orang guru mengaji untuk mengenalkan dan mengajarkan Al Quran kepada

anak-anak sejak dini. Kedua guru mengaji itu masing-masing diberi honor Rp.500 ribu setiap bulannya. "Gaji untuk kedua guru mengaji ini langsung saya bayarkan setahun. Jadi nanti saya tinggalkan Rp. 12 juta. Dengan demikian anak-anak kita yang ingin belajar mengaji bisa mengaji. Mudahmudahan apa yang dilakukan ini dapat membangun karakter anakanak kita pada masa yang akan dating," harapnya. Ketika melaksanakan Safari Jumat, Walikota turut didampingi Wakil Walikota Drs H Dzulmi MSi serta sejumlah pimpinan SKPD di lingkungan Pemko Medan. Ini merupakan kunjungan kedua kalinya Rahudman di Masjid Syuhada. Karebnanya, dia berharap kunjungan yang kedua ini semakin meningkatkan jalinan tali silaturahmi dengan masyarakat. "Apabila tali silaturahmi

sudah terjalin dengan erat, maka terciptalah kebersamaan. Dengan kebersamaan itu, maka semua kendala dan aral rintangan yang ada pasti bisa dihadapi. Di samping itu dengan kebersamaanlan seluruh program Pemko Medan dapat dijalankan sesuai yang diharapkan," ungkapnya. Selain menyerahkan honor untuk guru mengaji, Walikota juga memberikan bantuan untuk pembangunan Masjid Syuhada dari Pemko Medan sebesar Rp.30 juta ditambah dengan infak orang tua serta keluarga Rp.10 juta. Jumlah ini ditambah lagi dengan sumbangan sejumlah pimpinan SKPD yang ikut mendampingi Walikota Rp.10 juta. Dengan demikian malam itu BKM Masjid Syuhada mendapatkan batuan Rp.50 juta untuk pembangunan masjid dan Rp.12 juta untuk gaji dua guru mengaji.(r/ndo)

Siswi Medan Wakili Indonesia ke Konferensi Eno Asia Ocenia Kedua di Taiwan

Medan,BN Danellya ,Arizqa, salah seorang dari dua siswa asal Medan mendapat kehormatan mewakili Indonesia

mengikuti ajang lingkungan berskala internasional "Second Eno Asia Ocenia Conference" yang akan berlangsung 2328 April di Taichung Taiwan. Selain itu, Tuty Marmiaty, salah seorang guru SMP AlWashliyah Ampera II Medan yang aktip dalam Eno Asia juga berkesempatan mengikuti konferensi tersebut. "Terpilihnya Danellya Arizqa, siswi

SMP Panca Budi, dikarenakan ia siswi berprestasi. Selain itu anak pasangan H Jasa Wardani Ginting dan Ir Marsnelly ini sangat aktip dalam kegiatan lingkungan. Bahkan rajin pula mengikuti perkembangan lingkungan melalui internet," jelas Koordinator ENO Sumatera Utara Dra Irnawati yang juga Kepala Sekolah SMP Negeri 16 Medan usai mendampingi peserta "Second Eno Asia Ocenia Conference" bertemu dengan Kepala Dinas Pendidikan Kota Medan Dr M Rajab Lubis MS dan didampingi Wakil Sekretaris ENO Indonesia Drs Sri Panda MPd yang juga Kepala SMP Al-Wasliyah Ampra II Medan, Tuty Marmiaty dan Dra Marsnelly orang tua Danellya Arizqa, kemarin.

Dalam konferensi yang berlangsung enam hari tersebut, Danellya Arizqa akan mengikuti berbagai kegiatan seperti presentasi tentang lingkungan, workshop maupun lomba fotografi. Saat audiensi, Kadisdik Medan Dr M Rajab Lubis MS mendukung penuh siswi SLTP Medan yang mengikuti event tersebut. "Kita sangat mendukung, karena ini sesuai program Walikota Medan H Rahudman Harahap yang ingin menjadikan Medan sebagai kota metropolitan berbasis lingkungan," tegas Rajab. Dalam event tersebut nantinya, peserta akan mengikuti serangkaian kunjungan ke museum, ke sekolah-sekolah yang berbasis lingkungan, makan malam dengan pemerintah Taichung, Taiwan dan lainnya. (r/ndo)

Bank Sumut Salurkan Premi Sipanda MEDAN, BN PT Bank Sumut telah membayar biaya premi asuransi jiwa SIPANDA sebesar Rp 32,32 miliar hingga posisi Februari 2012. Hal itu disampaikan Dirut PT Bank Sumut, Gus Irawan Pasaribu dalam acara penyerahan santunan asuransi SIPANDA kepada ahli waris penabung tabungan Martabe, Simpeda, dan Makbul di KCP Sunggal, Rabu kemarin. "Uang santunan yang kepada ahli waris yang telah diserahkan sebesar Rp 32,04 miliar dengan jumlah rekening penabung sebanyak 4.591 orang," terangnya. Lebih lanjut Gus Irawan mengatakan, penerima santunan tabungan Martabe sebanyak 4.334 nasabah dengan uang santunan sebesar Rp 30,099 miliar. Sementara penerima santunan tabungan haji Makbul sebanyak 150 orang nasabah dengan uang santunan sebesar Rp 1,062 miliar, dan nasabah santunan SIMEDA sebanyak 107 orang dengan jumlah uang santunan Rp 882 juta. Dengan meningkatnya kepercayaan masyarakat dari waktu ke waktu, PT Bank Sumut telah berhasil menghimpun Dana Pihak Ketiga (DPK), giro dan tabungan. Dia menyebutkan deposito untuk posisi Maret 2012 sebesar Rp 16,983 triliun dan jumlah kredit yang disalurkan sebesar Rp 12,538 triliun dengan total aset Rp 20,522 triliun. Lanjutnya, untuk mewujudkan komitmen Bank Sumut dalam meningkatkan pelayanan dan kesejahteraan bagi masyarakat Sumut, pihaknya akan memperluas jaringan kantor sebanyak 55 unit dan kas mobil sebanyak 2 unit serta menambah jaringan ATM sebanyak 92 unit. "Produk Bank Sumut yang saat ini bisa dinikmati masyarakat yakni tabunganku, SMS Banking, MATM Bersama, BPD Net Online," sebutnya. Pada saat ini, penyerahan santunan dihadiri 34 orang nasabah tabungan Martabe, Simpanda dan Haji Makbul dengan jumlah keseluruhan santunan yang akan diserahkan sebesar Rp 429,5 juta. "Besarnya saldo bervariasi tergantung strata saldo rata-rata tabungan tiga bulan terakhir," sebutnya. ?Gus Irawan menyebutkan ahli waris penabung tabungan dengan asuransi SIPANDA tersebut merupakan nasabah penabung Bank Sumut dari cabang utama Medan Sukaramai, Medan Iskandar Muda, Kampung Lalang, Tembung, dan Simpang Kwala beserta unit kantor dibawahnya. (AHS)

Pengguna T-Cash Paling Tinggi di Sumatera Medan, BN Layanan uang elektronik (e-money) via ponsel pertama di Indonesia, Telkomsel Cash (T-Cash) lebih popular digunakan di Sumatera. Sepanjang tahun 2011, Sumatera merupakan wilayah dengan jumlah transaksi T-Cash terbanyak dengan rata-rata lebih dari 320 transaksi per hari. Secara nasional hingga kini T-Cash telah memiliki pelanggan sekitar 8,2 juta, Sumatera merupakan wilayah dengan jumlah pelanggan T-Cash terbesar dengan capaian sekitar 32%, disusul wilayah Sulawesi-Maluku-Papua dengan 14% dan wilayah Jabodetabek dengan pencapaian 12%. Head of Area Sumatera Group - Gilang Prasetya, menyatakan, "Tingginya animo dan kepercayaan masyarakat di Sumatera terhadap layanan T-Cash menjadikan tantangan tersendiri bagi perusahaan kami untuk secara cepat mengembangkan ekosistem layanan T-Cash ke berbagai penjuru daerah. Dengan demikian, kami berharap semakin banyak masyarakat yang memanfaatkan layanan T-Cash untuk solusi digital payment sehari-hari." Pelanggan Telkomsel Sumatera umumnya memanfaatkan T-Cash untuk beragam transaksi remote payment, di antaranya pengisian ulang pulsa prabayar, pembayaran tagihan listrik, dan transaksi pembayaran lain yang umumnya dilakukan melalui mesin ATM. T-Cash yang telah hadir sejak 2007, dapat dimanfaatkan oleh pelanggan kartuHALO, simPATI, dan Kartu As untuk beragam transaksi di ponsel, seperti pengiriman uang dan pembayaran tagihan (air, listrik, kartuHALO, telepon rumah, internet, TV kabel) sehingga pembayaran dapat dilakukan tanpa harus membawa uang tunai ataupun berbagai jenis kartu. Telkomsel juga menghadirkan sejumlah program berhadiah langsung bagi pelanggan yang melakukan transaksi belanja dengan menggunakan T-Cash di sejumlah merchant yang bermitra dengan Telkomsel. Untuk aktivasi T-Cash, pelanggan dapat mengakses *828# langsung dari ponsel. Selanjutnya, pelanggan akan mendapatkan PIN T-Cash (6 digit) yang akan digunakan setiap kali bertransaksi. Pelanggan dapat mengisi saldo (cash in) T-Cash miliknya di GraPARI, GeraiHALO, ATM BNI, Indomaret dengan nilai nominal hingga Rp 5 juta. Pelanggan juga bisa melakukan pengambilan uang tunai (cash out) di Indomaret hingga Rp 1 juta. Telkomsel telah bekerjasama dengan sejumlah mitra potensial untuk layanan T-Cash dengan sektor bisnis retail, webstore, dan juga restoran. "Kunci utama keberhasilan layanan e-money ditentukan oleh banyaknya customer base dan juga jumlah transaksi yang dapat di-generate oleh alat pembayaran e-money tersebut. Dengan semakin banyaknya mitra yang bekerjasama dengan penyelenggara layanan e-money, maka peluang untuk transaksi yang akan dilakukan oleh pelanggan pun semakin besar," tambah Gilang. (AHS)

30 DES23-30 2011 -APRIL 6 JAN 2012 2012 || EDISI EDISI 312| 296| THN THN KE-VII KE-VII

PNS Diminta Tingkatkan Disiplin ACEH TIMUR,BN Penjabat (Pj) Bupati Aceh Timur Ir Nasrullah Muhammad MSi MT menekankan tiga hal penting kepada jajaran Pegawai Negeri Sipil (PNS) daerah ini serta seluruh elemen masyarakat Aceh Timur . Pertama, Pj Bupati mengucapkan terimakasih kepada seluruh elemen masyarakat daerah ini dan jajaran muspida serta para kandidat bupati/wakil bupati yang telah bersama sama ikut mewujudkan pemilukada Aceh Timur yang sukses aman dan damai. "Ini adalah keberhasilan dan kesuksesan kita bersama, dimana selama ini mata publik tertuju ke Kabupaten Aceh Timur, apakah pemilukada akan berjalan aman damai atau terjadi konflik, namun nyatanyta dengan jiwa besar dan semangat kebersamaan seluruh elemen masyarakat daerah ini kita mampu membalikkan kekhawatiran publik tersebut. Pemilukada kita berjalan cukup sukses,aman dan damai. Pesan kedua, kepada pemimpin kepala daerah yang telah terpilih tersebut secara demokratis, saya berpesan agar seluruh elemen masyarakat mendukungnya dan mari kita bekerja bersama sama membangun Aceh Timur tercinta ini dan ketiga, kepada aparatur (PNS) daerah ini, saya ucapkan terimakasih karena telah menempatkan posisinya secara netral dalam pemilukada ini sesuai aturan perundang undangan yang berlaku dan kembali saya tekankan agar PNS daerah ini terus meningkatkan disiplin dalam bekerja. Bekerjalah secara sungguh sungguh dan ikhlas, jangan asal asalan. Dalam kamus keberhasilan, orang yang sukses ataua berhasil itu bukan karena asal asalan. Hal tersebut disampaikan Pj Bupati saat bertindak sebagai pembina pada apel atau upacara Hari Kesadaran Nasional Tingkat Aceh Timur yang dipusatkan di Halaman Pendopo Bupati Idi Rayeuk, Selasa(17/4) kemarin. Apel ini turut dihadiri Sekda Syaifannur SH MM, Ketua DPRK Alauddin SE, Para Asisten Setdakab, Kabag,Camat dan Kadis serta PNS sebagai peserta upacara.(MUS)

Tingkatkan Ekonomi Warga Miskin BANDA ACEH,BN Untuk tahun 2012 ini Pemerintah pusat telah menganggarkan dalam APBN sebesar Rp 38,168 miliar untuk membiayai Program Nasional Pemberdayaan Masyarakat (PNPM) Mandiri Perkotaan di Provinsi Aceh. “Besaran dana itu dialokasikan untuk 12 kota/kabupaten,”kata Team Leader PNPM Mandiri Perkotaan Aceh, Benny Supriyadi, Jumat (20/4) kepada Koran ini. Dikatakan, selain untuk mendanai program regular, alokasi dana ada beberapa tambahan program baru yang akan masuk diprovinsi Aceh tahun 2012 diantaranya, Program Penguatan Partisipatif Perempuan (P4), Peningkatan Mata Pencaharian Keluarga (PMPK) serta Program Penataan Lingkungan Berbasis Komunitas (PL-PBK) yang semua program tersebut di fokuskan untuk penerima manfaat masyarakat miskin. Lebih lanjut, Benny juga menyampaikan perlu adany adukungan semua pihak dalam upaya penanggulangan kemiskinan di Provinsi Aceh, sehingga program-program yang akan berjalan ditahun 2012 itu, bisa menyentuh kalangan masyarakat miskin. Dijelaskan, program yang selama ini telah berjalan difokuskan untuk kegiatan infrastruktur, sosial dan ekonomi. Namun dengan adanya tambahan program baru, maka sangat diharapkan, mampu meningkatkan taraf kehidupan serta perekonomian masyarakat miskin. Dana pendamping itu juga diharapkan dapat lebih tepat sasaran pada proses penyalurannya, maka dari itu diperlukan peran serta semua pihak untuk melakukan pengawasan, sehingga tidak ada penyimpangan dalam pelaksanaannya. (int)

Warga Diwarning Buat e-KTP LHOKSEUMAWE,BN Sekitar 20.530 warga di empat kecamatan di Kota Lhokseumawe, diwarning (peringatan) oleh Dinas Kependudukan dan Pencatatan Sipil setempat. Pasalnya, warga tersebut hingga saat ini belum membuat Kartu Tanda Penduduk (KTP) Elektronik (eKTP). Tentunya, jika batas akhir pembuatan e-KTP secara gratis pada 30 April mendatang, belum juga mendatangi kantor camat masing-masing dan dinas, maka akan dikenakan biaya pembuatan eKTP tersebut. Hal itu ditegaskan Kepala Dinas Kependudukan dan Pencatatan Sipil, Kota Lhokseumawe, T. Adnan, SE, kepada wartawan, Jum’at (20/4). Kata dia, waktu pembuatan e-KTP secara gratis bagi 20.530 warga itu tinggal 10 hari lagi. Kemudian terhitung mulai 1 Mei akan dikenakan biaya untuk membuat e-KTP. “Intinya, kita setiap hari baik di dinas maupun di empat kecamatan masih melayani pembuatan eKTP masyarakat di Kota Lhokseumawe, secara gratis tanpa dipungut biaya apapun,”ucapnya. Sebut T. Adnan, sesuai dengan kontrak dengan Pemerintah Pusat, jatah e-KTP untuk warga Kota Lhokseumawe, mencapai 110.530 lembar. Namun, hingga saat ini baru terealisasi pembuatan eKTP oleh warga wajib KTP mencapai 90 ribu jiwa dan tinggal 20.530 lagi yang belum membuat e-KTP. Selain itu, lanjut dia, terhitung 1 Januari 2013 di Kota Lhokseumawe pada khususnya dan umumnya seluruh Indonesia, sudah berlaku e-KTP dan tidak diperbolehkan lagi menggunakan KTP nasional. “Jadi dalam waktu 10 hari lagi, diharapkan puluhan ribu warga itu dapat segera membuat e-KTP dan jika sudah mati KTP nasional, terlebih dahulu memperpanjang KTP nasional tersebut,” harapnya. (int)

Bank Aceh Ogah Jadi Bank Devisa BANDA ACEH, BN Direktur Utama Bank Aceh mengatakan, pihaknya belum mengambil keputusan untuk menjadikan Bank Aceh sebagai bank devisa. Hal tersebut dilakukan karena minimnya pangsa pasar yang akan di garap. "Belum, kita tidak mau gegabah. Kondisi daerah kita tidak sama dengan daerah lain," ujar Islamuddin,kepada media ini, Jum'at (20/4) di ruang kerjanya kantor Pusat Bank Aceh yang terletak di Jalan Tgk.Daud beureueh, Banda Aceh. Menurutnya, menjadikan Bank Aceh sebagai bank devisa bukanlah sesuatu yang memberatkan. "Menuju kesana gampang,tinggal sewa konsultan, tiga bulan selesai.Namun, sebagaimana kita ketahui, eksportir Aceh lebih memilih pelabuhan Belawan daripada pelabuhan di Aceh," demikian alasannya.(TM) Siswa yang terkait kasus hukum sedang melaksanakan UN di Mapolsek Simpang Kiri

Terkait Kasus Jambret, Dua Siswa Terpaksa UN di Mapolsek Subulussalam BN Dua siswa masing-masing berinisial JM siswa kelas III SMA Negeri 1 Simpang Kiri dan DSB Siswa kelas III MAS Penanggalan terpaksa mengikuti UN bertempat di Kantor Polsek Kecamatan Simpang Kiri Subulussalam terkait dengan kasus kejahatan yang dilakukan siswa tersebut dengan menjambret perhiasan warga Kampong Makmur Jaya Bakal Buah beberapa minggu lalu, sehingga harus berurusan dengan hokum dan ditahan di Mapolres Aceh Singkil. Sekretaris Dinas Pendidikan Subulussalam Asmial mengatakan walaupun kedua siswa tersebut dalam proses tahanan karena pelanggaran hukum (menjambret), kepolisian tetap mengijinkan mereka

untuk mengikuti UN atas permohonan Disdikbudpora Kota Subulussalam, namun tegas Asmial semula kedua siswa tersebut hanya diperbolehkan pihak kepolisian mengkuti UN di Mapolres aceh Singkil karena keduanya ditahan di sana, tapi karena mengingat jarak dari Kota Subulussalam ke Aceh Singkil mencapai 85 KM sehingga sangat memakan waktu karena mereka adalah siswa Kota Subulussalam akhirnya pihak Kepolisian mengijinkan merkea mengikuti UN di Mapolsek Simpang Kiri bertempat di ruang kerja Polsek dengan pengawasan pihak kepolisian dan juga mendapat pendampingan hokum dari LembagaAdvokasi perempuan danAnak (Lampuan) Kota Subulussalam.

Semengara itu Kapolres Aceh Singkil melalui Kapolsek Kecamatan Simpang Kiri AKP Rahman Manurungmengatakanpihaknyatetapmemberikanhakhak siswa walaupun tersangkut kasus hukum untuk mengikuti UN, karena kalau itu tidak kita berikan sedangkan kedua siswa tersebut sudah menjalani kelas III dan untuk mengikuti UN tersebut pun kita laksanakan sesuai dengan ketentuan sehingga mereka tidak tertekan dan grogi untuk mengisi jawaban pungkas Manurung. PantauanwartawandiMapolsekSimpangKirikedua siswa yang berstatus tahanan tersebut berada di ruang Polsek Simpang Kiri tanpa pengawalan dan mereka pun nampak sedang mengisi soal ujian sepertinya tanpa masalah. (RB)

Wakil Walikota Tinjau Pelaksanaan UN Subulussalam. BN Ujan Nasional (UN) tingkat SMA/MA sederajat diikuti Jumlah siswa / siswi Kelas III di seluruh wilayah Kota Subulussalam sebanyak 1710 orang berjalan lancar dan tertip. Wakil Walikota Subulussalam didampingi Kadisdikbudpora Nurhayat dan staf ahli Drh. Jalaluddin meninjau hari pertama pelaksanaan UN tersebut untuk melihat secara langsung apakah pelaksanaannya tidak ada maslaah dan kendala di sekolah masing-masing. Kunjungan di awali dari SMA Negeri 1 Simpang Kiri di sekolah tersebut rombongan diterima Kepala Sekolah Drs. Sahmudin Padang didampingi Dewan Guru, setelah berbincang-bincang sejenak sambil menanyakan hal-hal kendala pelaksanaan UN disekolah, dan Kepalah sekolah mengatakan tidak ada kendala, H. Affan Alfian Bintang langsung menuju ruuang tempat siswa ujian dan menyempatkan waktu memberi nasihat kepada salah seorang peserta siswa peserta UN agar hatihati and tidak grogi untuk mengisi jawaban, santai saja namun pasti agar jawaban yang ditulis benar, juga meminta kepada agar jangan percaya apabiala ada jawaban yang diberikan orang lain, karena itu bisa bohong, percayailah diri sendiri apa yang kamu

Wakil Walikota H. Affan Alfian Bintang, SE sedang meninjau ruangan siswa/I peserta UN di SMA Simpang Kiri.

pelajari tiga tahun silam agar kamu lulus pungkas Bintang. Disisi lain saat BN menanyakan kepada Kepala Sekolah jumlah murid kelas tiga, Sahmudin mengatakan jumlah seluruh 148 orang sedangkan yang mengikuti UN 147 orang satu orang tidak hadir tanpa alasan, dan menyinggung target kelulusan kepala sekolah mengatakan bisa sseperti kelulusan tahun 2011 lalu yaitu 100%.

Sedangkan rombongan Wakil Walikota melanjudkan kunjungan ke SMK Negeri Simpang Kiri dan seterusnya MAN Penanggalan dan SMK Negeri Penanggalan. Sebagaimana diketahui pelaksanaan UN berlangsung selama 4 hari diawali pada hari senin 16/4 s/d Kamis 19/4-2012 dengan materi ujian Bahasa Indonesia, Bahasa Inggris, Fisika, Matematika, Kimia dan Biologi. (RB)

Elimen Sipil Sesalkan Bidan Luar Banyak Lulus Verifikasi Aceh Tmir,BN Para bidan pegawai tidak tetap(PTT) di kabupaten Aceh Timur menyatakan Protes atas pengumuman atas hasil kelulusan verifikasi,data 42 orang bidan PTT Kabupaten Aceh Timur yang lolos merupakan bidan yang bertugas di luar kabupaten Aceh Timur bahkan ada yang

dari sumatera utara.meskinpun penetuan lulus verifikasi dari pusat,seharusnya Dinas kesehatan Aceh Timur jeli melihat tenaga bidan lokal yang sudah bakti dipustu dan pukesmas di kabupaten setempatdugaan ada permainan di lingkungan dinas kesehatan Aceh Timur,demikian laporan yang diterima dari

ketuaLSM Cakro Donya Aceh Sofyan Suri,S.Sos,Kamis,(19/04) kepada Bongkarnews ia menghimbau kepada Pj Bupati Aceh Timur supaya minijau ulang data yang di sampaikan dinas kesehatan yang menyebabkan banyak bidan luar daerah yang lolos verifikasi telah merugikan bidan lokal.(Mus)

Langsa,BN Pj. Bupati Aceh Timur, Ir. Nasrullah Muhammad, M.Si, MT senin, (16/04) lalu bertempat di Pendopo Buptai Aceh Timur Langsa, melepas keberangkatan tim sepak bola Aceh Timur atau PERSIDI yang akan melanjutkan pertandingan putaran kedua divisi I IPL di Asahan.Tim beserta pelatih dan official yang berjumlah 25 orang ini dijadwalkan akan bertanding melawan Medan Jaya, tim Aceh Selatan dan PS Asahan dimana pertandingan dijadwalkan akan berlangsung tiga hari mulai tanggal delapan belas sampai dengan tanggal duapuluih satu nanti.Sekretaris PERSIDI, Saiful Bahri dihadapan Pj. Bupati Aceh Timur mengatakan,

keikutan serta Persidi pada putaran kedua divisi I ini berkat kerja keras seluruh pemain, pelatih dan manager, sebab untuk putaran pertama lalu persidi berhasil menjadi raunner up grup. Sementara itu saat ini persidi sendiri masih kesulitan mengenai dana yang sangat minim, dimana untuk tahun 2012 ini hanya mendapatkan suntukan dana dari APBK seratus juta lebih dan hampir sama dengan jumlah APBK tahun yang lalu.Sementara itu Pj. Bupati Aceh Timur, Ir. Nasrullah Muhammad, M. Si, MT kepada Bongkarnews mengatakan meskipun dengan dana yang sangat minim namun kita tunjukan kebolehan kita di dalam kancah persepak bolaan dengan menujukan sportivitas yang tinggi serta berusaha semaksimal mungkin dengan menargetkan

menjadi juara meskipun nanti tidak mendapatklan juara, akan tetapi kita harus bertekad bisa menjadi yang terbaik agar bisa terus berkiprah di divisi utama nantinya, namun harus diingat kita harus menjunjung tinggi sportivitas sebab bukan hanya nama persidi yang dipertaruhkan akan tetapi nama daerah dan seluruh masyarakat Aceh Timur juga turut dipertaruhkan karena kalian bermain membawa nama daerah” ujarnya.Sementara itu ia juga mengingatkan untuk terus memperbaiki kelemahan-kelemahan dan mengevaluasi permainan agar tampi menjadi yang terbaik, kalau mengenai dana nanti akan kita pikirkan kembali namun yang jelas menyangkut masalah dana itu merupakan urusan pengurus persidi” lanjutnya lagi.(Mus)

Pj. Bupati Aceh Timur Lepas Pemain Persidi

Kelompok Tani Cipta Mandiri Akan Terbentuk di Kecamatan Langsa Baro LANGSA,BN Kelompok Tani yang menampung berbabgai kkeluhan petani dalam meningkatkan penghasilan usaha taninnya maka ada beberapa orang yang peduli tentang nasip petani yang ada dikecamata langsa Baro,akan membentu kelopmpok yang lebih baik dari yang ada sekarang,banyak kelompok tani yang dirikan

sekarang ini tidakk berbadan hukum dan hanya bersifat biasa saja.Maka kedepan akan ada kelopmpok Tani yang berbadan hukum. Salah seorang patani Bapak Muhammad Jamil mengungkapan kepada Bongkarnews,jum'at(20/04) di rumahnya,ia menyatakan bahwa pentingnya kelompok Tani berbadan Hukum agar pemerintah dapat

mengakuinya dalam menjalankan kegiatan kelompok tani serta para petani dapat menerima berbagai informasi tentang pertanian baik dari daerah maupun nasional. Kelompok Tani akan diberi nama Cipta Mandiri yang berkedudukan di kecamatan Langsa Baro kota Langsa dan semua petani dapat bergabung dalam kelompok tani ini secara sukarela tanpa ada paksaan.(Mus)

Siswa SMP ikut Seleksi Porseni Tingkat UPTD-PK Jambo Aye ACEH UTARA, BN Menanti panggilan ke provinsi, sejumlah siswa/i tingkat Sekolah Menengah Pertama (SMP), se-Unit Pelaksana Tugas Dinas (UPTD-PK) Tanah Jambo Aye, Aceh Utara, Sabtu (21/4) mengikuti seleksi Porseni (Pekan Olahraga Seni)diberbagai cabang olahraga dan cabang kesenian siswa khusus kelas satu dan kelas dua. Acara seleksi tersebut dilaksanakan di SMPN- 2 Tanah Jambo Aye, dan cabang-cabang yang akan diterapkan dalam seleksi ini antara lain Bola Kaki, Volly Mini Putra/i, Bulutangkis Putra/i, Tenis meja Putra/i, Atletik Putra/i, Karate Putra/i, Pencatsilat Putra/i, Catur Putra/i, MTQ Putra/i, dan Seni karya serta Vokal Group, yang dibina oleh ketua pelaksana Muhammad, M.pd dan dibantu oleh koordinator kegiatan, M.Nasir, S.pd. Kepala sekolah SMPN- 2 Tanah Jambo Aye, Hasbi, S.pd. M.pd mengatakan, Pihaknya lebih memilih ditempatkan acara itu di SMPN- 2, Karena, kata Hasbi, disekolahnya sudah dilengkapi perlengkapan lapangan seleksi pertandingan,“Kita harap sejumlah siswa kita yang akan diseleksi ini nantinya dapat membuah hasil bagi kabupaten Aceh Utara, adapun jadwal pertandingan setelah hasil seleksi selanjutnya dipastikan pada tanggal 28,29,30 dikabupaten Aceh Utara” Ungkap Hasbi.(sf)

Sepakbola Pelajar Sekdakab Aceh Timur Iv

Juara Bertahan SMAN Idi Tumbang, Ditekuk SMA Ranto Peureulak 2-0 PEUREULAK BARAT,BN Juara Bertahan, SMA Negeri 1 Idi menelan pil pahit setelah ditumbangkan lawannya SMA Negeri Ranto Peureulak Aceh Timur pada laga perdana Turnamen sepakbola pelajar Piala Sekdakab Aceh Timur ke 4 di Lapangan bolakaki Gampong Beusa Seuberang Peureulak, Barat, Kamis (19/4) petang. Dua gol untuk kemenangan SMA Ranto Peureulak dalam partai yang dipimpin wasit Bahtiar dicetak oleh Gunawan dimenit ke 18 dan 50. Sekda Aceh Timur,Syaifannur SH MM saat membuka event ini mengharapkan agar para pelajar tampil maksimal dan sportif. Junjung tinggi sportifitas dan fair play. Event ini sebagai ajang mencari bakat handal sepakbola khususnya pelajar SLTA se Aceh Timur sebutnya. Sementara itu, sebelum laga kedua tim, juga diadakan laga pembuka antara tim eksekutif Setdaklab Aceh Timur yang diperkuat Sekda ,Syaifannur SH MM berhadapan dengan tim Dinas Pendidikan (Disdik) dan para "cek gu" atau guru yang dikapteni oleh Kadisdik H Agussalim SH MH . Partai ini berakhir imbang 0-0 meskipun sebelumnya satu gol yang dilesakkan tim cek gu melalui Agussalim dianulir wasit. Partai eksekutif ini di buka oleh Asisten II Setdakab Ir M Yasin dan cukup menghibur penonton.(MUS)

Skala Proritas PT PIM Dalam Membantu Kebutuhan Masyarakat di Desa Binaan LHOKSEUMAWE, BN Kebutuhan masyarakat didesa binaan PT Pupuk Iskandar Muda,secara terus menerus membantu kebutuhan masyarakat,diantaranya sarana dan prasarana yang dibutuhkan oleh masyarakat didesa,baik itu Inprasuktur tempat tinggal,pendidikan,Kesehatan maupun kebutuhan sosial lainya.Ungkap Kepala Departemen Humas PT PIM Mustafa Tahir,disela-sela mendampingi Direktur Utama PT PIM, Drs Mashudiato MM dan beberapa Direktur lainnya,saat mengunjungi pembangunan Meunasah Paloh Gadeng kecamatan Dewantara beberapa saat yang lalu. Menurut Mustafa setiap tahunya PT PIM mengalokasikan dana untuk membantu kebutuhan masyarakat disekitar perusahaan dan ini terus berjalan sesuai dengan mekanisme yang berlaku. PT PIM tidak hanya membantu masyarakat didesa binaan saja akan tetapi diluar desa-desa diluar desa binaan juga menjadi perhatian perusahaan,apalagi masyarakat yang tertimpa musibah ini juga menjadi skala proritas perusahaan untuk membantu masyarakat yang tertimpa musibah.seperti yang terjadi Banjir Bandang di Tangse kabupaten Pidie, musibah banjir beberapa waktu yang lalu mengenangi sebahgian Aceh Utara dan beberapa kabupaten lain yang ada di Aceh, “ Sebut mustafa”. Seluruh masyarakat desa Paloh Gadeng dusun satu sudah sangat lama mendambakan meunasah yang layak dan permanen, agar segala aktifitas pedesaan bisa dijalankan di meunasah. Menurut beberapa sember yang ditemui menyebutkan, bahwa sebelumnya Meunasah induk desa Paloh Gadeng dusun satu yang didi-

rikan diatas tanah pinjam pakai milik PT PIM, namun tanah milik perusahaan boleh digunakan sampai memiliki tanah milik desa untuk membangun meunasah permanen. Setelah melalui rentan waktu yang panjang,akhirnya pembangunan Meunasah Paloh gandeng dusun satu terwujud juga yang dibangun diatas tahan Wakaf pinjam pakai milik salah satu perusahan di daerah itu. Geuchik Gampoeng desa Paloh Gadeng Abubakar H. Usman,yang ditemui usai menerima kunjungan Direktur Utama PT Pupuk Iskandar Muda Drs Mashudianto,MM ,juga turut didampingi oleh Direktur Teknik dan Pengembangan, Ir Lili DJadjuli,juga dihadiri Direktur Komersil Husni Ahmad Zaki dan Diruktur SDM dan Umum, Ir Usman Mahmud MM, juga turut dihadiri Kepala Departemen Humas Mustafa Tahir. Para Pimpinan PT PIM langsung mengunjungi pembangunan meunasah paloh gadeng. Kunjungan dilakukan setelah para pimpinan PT PIM melakukan Pencoblosan TPS dari nomor 25 sampai 31 dilapangan sepak bola paloh gadeng. Kunjungan tersebut disambut disambut oleh Geuchik paloh gadeng Abubakar H usman, dan para tokoh masyarakat serta seluruh para panitia pembangunan meunasah. Abubakar H Usman juga menyebutkan,bahwa Pembangunan meunasah kami sudah dimulai sejak bulan Juni 2011 sampai sekarang dan realisasinya sudah mencapai 50 %,pembangunan meunasah berkontruksi 2 lantai. Pembangunan ini terwujud berkad bantuan dari berbagai donatur dan juga partisifasi dari PT PIM,karena desa kami merupakan desa binaan

Perusahaan.bantuan yang diberikan PT PIM berupa bantuan dana pembangunan meunasah sebanyak Rp 397.750.000 yang disalurkan secara tiga tahap diantaranya tahap pertama 100 juta,tahap II Rp 125 juta dan tahap III Rp 145 juta,dan bantuan dari Yaz BDI Rp 12.750.000,bantuan pada Hut PIM 15 juta. kunjungan pimpinan PT PIM untuk melihat langsung hasil yang telah dibangun, “ Sebut Abubakar ”. Ketika berbincang-bincang dengan panitia pembangunan yang terekam media ini, Direktur Utama PT PIM, Drs Mashudianto MM, berjanji juga akan membantu pemasanganKeramik lantai atas, keramik akan disalurkan apabila selesai pemasangan atap dan plaster dinding, “sebut Mashudianto”. Abubakar H Usman menambahkan, Bantuan untuk pembangunan Meunasah Paloh Gadeng juga datang dari Ketua Komisi D DPRK Aceh Utara T Junaidi Budiman, yang mengalokasikan dana dariAspiratif dewan tahun 2012, sebesar Rp 50 juta, karena T Junaidi Budiman merupakan putra daerah juga merupakan Dapil Paloh Gadeng. Bantuan juga datang dari Aspiratif Dewan DPRA Rp 110 juta, bantuan juga datang dari Dinas Syariat Islam Aceh Utara Rp 5 juta, termasuk bantuan dari swadaya masyarakat setempat. Lebih lanjut Geuchik gampoeng desa Paloh Gadeng Abubakar H. Usman mengatakan,desa paloh gadeng sangat luas yang terdiri dari 5 dusun, desa kami letaknya diatas perbukitan secara Giografisnya didaerah perbukitan sangat kesulitan air bersih. Maka Semua masyarakat desa Paloh Gadeng sangat membutuhkan sumur bor karena kami menemui kendala untuk mem-

bangun sumur cicin,karena kondisi daerah kami yang berbukit sangat tidak mungkin dan juga mendapat kedala membuat sumur cicin yang ketika digali kedalamannya mencapai 18 hingga 20 meter.alternatif lain untuk memenuhi kebutuhan air bersih hanya dengan cara membuat sumur bor. Saat ini yang sangat dibutuhkan oleh masyarakat adalah, Listrik,Air bersih dan jalan desa.dari ketiga unsur itu dua unsur sudah terpenuhi sebahagia. Untuk kebutuhan Listrik sudah dipasok oleh PT PIM,sedangkan untuk sarana air Besih telah dibantu oleh Yayasan Amal Zakat Badan Dakwah Iskandar Muda ( YAZ BDI). BDI setiap tahun membantu pembangunan sumur Bor di desa kami sesuai dengan kebutuhan. BDI tidak hanya membantu sumur bor,akan tetapi Yaz BDI setiap tahun juga membantu membangun Rumah Dhuafa didesa kami, rumah yang dibangun tipe 36 Permane, pembangunan rumah dhuafa menurut kebutuhan yang diusul oleh pihak desa kepada BDI, proses pembangunan rumah juga melalui study kelayakan langsung kelapangan oleh tim BDI,dengan mendatangi penerima mamfaat rumah tersebut “sebutnya”. Sementara itu untuk jalan desa tahun ini juga akan dibangun jalan aspal Hotmix,pembangunan jalan pemukiman Lhok Wieng sepanjang 2,3 kilometer yang bersumber dari APBA tahun 2012. Kita berharap jalanjalan yang ada didesa kami juga dapat dibangun,baik yang bersumber dari APBD kabupaten Aceh Utara maupun dari APBA dan sumber-sumber lain “ Ungkap Abubakar ”. ( M.Fauzi)

16-23 APRIL 2012 | EDISI 311| THN KE-VII

Jangan Membeli Rumah di Lahan Eks HGU PTPN 2 Medan, BN Ratusan massa yang bergabungan dalam Kelompok Tani mengimbau masyarakat khususnya warga Medan dan Deliserdang agar tidak membeli rumah atau properti di areal eks HGU PTPN 2 yang masih dalam konflik dan proses hukum. Imbauan itu mereka sampaikan melalui aksi damai di Bundaran Majestik dan di lahan seluas 74 hektare di Pasar IV Desa Helvetia Kecamatan Labuhan Deli Kabupaten Deliserdang, belum lama ini. Massa berasal dari Kelompok Tani 71-79 HPPLKN, Kelompok Tani Selambo Jas Merah, Kelompok Tani Bandar Rejo Bersatu dan Kelompok Tani Maju Bersama Rakorba. Mereka menerbitkan alas hak yang digunakan developer berdasarkan Surat Keterangan tentang pembagian dan penerimaan sawah/ladang SKPT/ SL tahun 1954 tidak berlaku lagi alias palsu. Sebagaimana Surat Penjelasan Badan Pertanahan Nasional (BPN) kepada Pansus DPR

RI No. 540-1/1138 tanggal 10 Mei 2004 dan penjelasan Badan Pertanahan Propinsi Sumatera Utara kepada PTPN-2 Nomor 570-528 tanggal 21 April 2009 yang menerangkan Surat SKPT SL tidak berlaku lagi. Selain itu dua orang penggunaan surat itu telah ditangkap Poldasu yakni Misran Sasmita dan Sudarsono serta telah dijatuhi hukuman oleh hakim. Areal tersebut secara Yuridis milik Gubsu sesuai SK BPN Pusat Nomor 42 tahun 2002 dan peralihan kepada pengembang akan dijadikan bukti ke KPK juga disebutkan areal itu berstatus stanvas sebagaimana surat DPRD Sumut No. 1543/18/Sekr tanggal 20 Juli 2011 dan Surat DPRD Deliserdang No. 640/817 tanggal 23 Juli 2011. Di mana BPN tidak pernah dan menerbitkan surat apapun di atas tanah itu, sementara itu di areal eks HGU PTPN 2 di Pasar IV Desa Helvetia Kecamatan Labuhan Deli Kabupaten Deliserdang. Massa pun merobohkan tembok pagar di atas lahan 74 hektar serta mereka mengatakan status

hukum tanah itu belum Inckrah dan bersertifikat. Massa juga memproses pembongkaran Masjid yang sebelumnya dibangun masyarakat serta mematok lahan perkuburan Islam dan Kristen seluas 5 hektar yang terdapat di areal itu. “Masjid dihancurkan, begitu juga tanah dan rumah kami. Jadi kami menuntut agar semuanya dikembalikan,” kata Kusrinaldi, SE selaku Kordinator Aksi kepada Wartawan. Sementara pemimpin aksi Sulistijo mengatakan aksi mereka murni dan tidak ditunggangi ormas dan OKP. “Kami semua yang hadir di sini masyarakat yang menuntut hak untuk dikembalikan,” tegasnya. Sulistijo didampingi Sekretaris perkuburan HM Marwan Bugis menjelaskan Masjid di lokasi itu telah berdiri sejak tahun 2001 dan diwakafkan oleh masyarakat ditambahkan pula oleh Marwan, hingga kini seluas 74 hektar itu masih dalam pengawasan negara, yakni Gubsu dan bukan milik Mafia Tanah tidak ada hak mereka. (AHMAD)

kekuatan politik pemerintahan. Tujuannya untuk menuju suatu perubahan pemerintahan yang baik dan bersih dalam mengimplementasikan Undang-Undang Pemerintah Aceh No 11 Tahun 2006, bagi terwujudnya kesejahteraan seluruh rakyat Aceh, sesuai amanah Memorandum of Understanding (MoU). Tapi beberapa mantan pejabat di jajaran Setda Aceh, yang pernah dilengser dari jabatannya hingga dihadiahi nonjob, tetap bersikeras mengedepankan sikap netralitasnya. Meskipun, secara kekhususan oknum mantan pejabat itu sangat mendukung dan berterimakasih atas terpilihnya Zaini-Muzakir sebagai Gubernur/Wakil Gubernur Aceh. “Saya selaku pribadi, sangat bangga dan berterimakasih kepada rakyat Aceh atas terpilihnya pak Zaini-Muzakir untuk memimpin Aceh lima tyahun mendatang. Dan, kedepan Aceh akan lebih baik dari tahun sebelumnya,” ungkap sumber tadi. Menurut sumber itu, dirinya menjadi salah satu korban politik dari sejumlah oknum pejabat lainnya. Dia juga mengaku, pelengseran dirinya ke sebuah daerah saat itu, akibat adanya pergaulan dengan kalangan politisi Partai Aceh. “Kalau semua lini diseret ke politik, bagaimana upaya kita membangun Aceh. Bagi saya bermitra dengan siapa saja itu hak seseorang, namun, apa yang bisa saya buat saya dilempar dan tercampakkan akibat dari itu,” imbuhnya. Diutarakan dia, sejak pesta demokrasi keyakinan pasangan Zaini-Muzakir sudah diprediksikan sebelumnya. Pasalnya, Partai Aceh kalau bisa dikatakan mempunyai mesin politik paling ampuh di Aceh, Jakarta maupun manca negara. “Dengan kemenangan ini, saya pikir Aceh akan lebih

baik dimasa mendatang. Ya, kalau bagi PNS yang kurang mendukung kehadiran Doto (Sapaan Zaini) dan Mualem (Sapaan Muzakir), itu terserah mereka. Intinya, harapan saya, sudah terkabulkan, Aceh di masa lima tahun mendatang dipimpin oleh pasangan idola saya,” katanya. Evaluasi Sementara, salah seorang tokoh masyarakat, Muktar, meminta Gubernur/Wakil Gubernur Aceh terpilih, ZainiMuzakir, untuk segera mungkin melakukan evaluasi terhadap kinerja para Pegawai Negeri Sipil (PNS) di jajarannya, terutama mereka yang selama dengan tingkat kedisplinan yang rendah, sehingga pelayanan publik terhadap masyarakat tidak berjalan maksimal. “Tingkat kedisplinan, kepatuhan dan penunaian kewajiban yang ditunjukkan sementara PNS di lingkungan Setda Aceh akhir-akhir ini tidak sebanding dengan fasilitas dan hak yang telah diberikan oleh pemerintah kepada mereka, seperti halnya tunjangan prestasi kerja (TPK) yang jumlahnya dinilai terbesar di Indonesia,” pintanya. Selain itu, tambah dia, sikap netralitas yang hampir setiap hari disampaikan Penjabat Gubernur Aceh, Tarmizi A Karim, sering terabaikan. Bahkan, ada juga kalangan oknum pejabat yang memprediksikan pasangan Zikir tidak akan terpilih sebagai Gubernur/ Wakil Gubernur Aceh periode 2012-2017. “Sebenarnya, untuk apa mereka (PNS) mengurus politik. Sehingga, terkesan, larangan hanya untuk diabaikan oleh abdi negara. Mungkin, mereka menganggap kalau terpilih pasangan idolanya itu, jabatan empuk masih berpeluang, begitu,” seloroh Muktar. Isu yang berkembang pasca terpilihnya Zaini-Muzakir, setelah pelantikan sebagai Gubernur/Wakil Gubernur Aceh, dipastikan akan nada perombakan birokrasi Satuan Kerja Pemerintah Aceh (SKPA). (TIM)

Alfian Bintang, SE bersama Kabag Kepegawaian Gembira Bancin, SH, Polres Kompol Ali Mirwan dan staf ahli drh Jalaluddin serta Kasman, S.Sos melakukan inspeksi mendadak, belum lama ini. Ketika melintas di salah satu instansi, Affan terkejut karena menemukan kantor kosong melompong. Berang atas sikap instansi tersebut, Affan Alfian langsung

memeriksa absensi dan mencatat bagi PNS yang tidak hadir. Terbukti, banyak PNS dan honorer yang tidak masuk kerja. Atas kejadian tersebut H. Affan Alfian Bintang, SE sangat kesal dan marah kepada PNS dan honorer karena tidak disiplin dan akan diberikan teguran keras berupa peringatan tertulis PP. 53 Tahun 2010. (RB)

uang, dengan bunyi titipan sementara yang akan dibayar kembali setelah selesai pulang haji. Namun setelah pulang dari menunaikan haji dan sampai sekarang, haji Ludin belum juga membayarkan uang pinjaman tersebut. Sementara Akhiruddi selaku penerima uang yang penanda tangan kwitansi serah terima uang terkesan tidak acuh terhadap kasus yang selama ini terjadi. Setelah berbagai upaya dilakukan pelapor untuk menuntut haknya tidak berhasil, akhirnya pelapor mengadukan persoalan ini ke pihak berwajib pada tahun 2005 lalu. Akhirddin yang diperiksa pihak penyidik tanpak hadir ke Polres sekitar pukul 10.00 WIB sebelum umat Muslim menunaikan ibadah Sholat Jumat dan berakhir sekitar pukul 16.00 WIB. Akhiruddin sempat sembayang di Mesjid Mapolres. Menggunakan baju koko berwarna biru yang di padu dengan celana keper hitam, Akhirudin berhadapan langsung dengan petugas pemeriksa Aipda Masril diruanngan penyidik. Tampak wakil rakyat itu menjawab pertanyaan petugas yang langsung mengetiknya diatas laptop. Akhirudin duduk tertegun saat mengetahui para awak media menyoroti proses pemeriksaannya dari pingtu masuk dan juga jendela luar. Ekspresi wajahnya tetap dingin dan fokus mendengarkan pertanyaan pemeriksa terkait kasus yang membelit

oknum penyambung lidah rakyat itu. Kapolres Pelalawan, AKBP Guntur Aryo Tejo yang ditemui wartawan menjelaskan, pemeriksaan oknum anggota dewan itu masih sebagai saksi dalam perosalan utang yang dilaporkan Basarudin. Guntur berjanji akan menjalankan proses hukum sebagaimana mestinya seperti warga kebanyakan. Namun status tergugat sebagai anggota DPRD, memiliki prosedur khusus untuk melakukan pemanggilan dan pemeriksaan. "Jika ia bersalah, akan kita jalankan hukum sebagaimana mestinya tanpa pandang bulu. Seperti masyarakat biasa. Tetapi jabatan dia mengharuskan kita untuk meminta izin dari Gubernur dalam proses pemeriksaan dan pemanggilan. Saat ini dia masih berstatus sebagai saksi dan belum ada peninggkatan," ujarnya. Dikatakan Guntur, pihaknya telah memenuhi prosedur pemeriksaan anggota dewan sesuai aturan di Undang-undang. Permohonan pemenggilan dan pemeriksaan kepada Akhirudin telah dikirimkan ke Gubernur Riau melalui Polda awal bulan lalu. Surat izin pemeriksaan dari Gubri turun awal pekan lalu dan mengizinkan Polres Pelalawan untuk menjalankan mekanisme hukum kepada Akhirudin. Sampai berita ini diturunkan, politisi muda itu masih diperiksa dan belum keluar dari ruangan. (RINGO)

Sejumlah.. berhak ditetapkan sebagai Gubernur dan wakil Gubernur Aceh periode 2012 – 2017. Tak ayal, kemenangan Zikir yang tak tak lain kemenangan Rakyat Aceh ini menjadi boomerang bagi segelintir pejabat di tanah Serambi Mekkah ini. Malah, ada yang sudah kasak-kusuk dan ‘kepanasan’ atas pemimpin baru Aceh tersebut. Artinya, mungkin semasa gubernur dijabat Irwandi Yusuf, pejabat setingkat Kepala Satuan Kerja Pemerintah Aceh (SKPA) bisa duduk tenang, tanpa kerutan kening di dahi. Namun setelah terpilihnya Zaini-Muzakir Manaf, bakal terjadi perubahan secara besar-besaran. Informasi diperoleh BN di lapangan, kelesuan dan kekhawatiran wajah oknum PNS yang kontra dengan pasangan Zaini-Muzakir, terbungkus erat dalam melaksanakan tugasnya. Ini juga akibat sikap kenetralan PNS diabaikan oknum tersebut, sehingga kekhawatirannya untuk menduduki jabatan pucuk pimpinan di SKPA kian menghantui kalangan PNS itu selama ini. “Kita pasrah saja, apakah nanti masih dipercaya atau tidak untuk menduduki jabatan struktural dibirokrasi Pemerintah Aceh, sebagai Kepala SKPA, ketika setelah pelantikan Gubernur/Wakil Gubernur Aceh yang baru. Tapi, memang tidak menjadi suatu persoalan yang rumit,” ungkap salah seorang Kepala SKPA, yang enggan namanya ditulis, saat ditemui BN, belum lama ini. Kota Banda Aceh, yang merupakan pusat Ibukota Provinsi Aceh, termasuk daerah yang mayoritas dihuni sejumlah PNS, mengalami suara untuk pasangan ZainiMuzakir, sedikit yang memilih pasangan perdamaian dan perjuangan ini yaitu 22,181 suara atau 25,75 persen. Sehingga, secara tidak langsung banyak PNS di jajaran Setda Aceh enggan mendukung Gubernur/Wakil Gubernur Aceh terpilih ini. Karena itu, panggung politik Pemerintah Aceh berkemas-kemas terhadap adanya pergeseran

164 PNS.

LMR-RI :

Dari Halaman 1

kesalahan bagi kedua bendahara terlibat hanya kesalahan menjalankan administrasi pelaksanaan proyek,”pinta Amin Sari. Munurut Amin Sari, selama dalam persidangan yang telah berjalan di PN Tipikor Medan terlihat hanya dua orang bendahara yakni Zulfansyah dan Alfan Batubara saja yang ditumbalkan, sementara dalam persidangan sejumlah saksi-saksi yang memberikan keterangan mengakui ada menerima uang proyek.?? Ironisnya lagi,dari hasil di persidangan adanya sejumlah oknum pelaksana proyek yang terlihat ikut serta terlibat dalam pengunaan anggaran uang negara dan bahkan mengakui turut serta menikmati, tapi dari hasil penyidikan Kejari Binjai hanya membuat Okumoknum tersebut sebagai saksi di persidangan.?? “Kan Pejabat Pembuat Komitmen (Pimpro-red) di persidangan secara terang-terangan mengakui ada menerima uang bersama sejumlah pengawas juga menerima uang sebagai uang imbalan dalam proyek fiktif, tapi kenapa hanya sekedar saksi dan belum ada tindakan yang berarti,” ujarnya. Dari hasil persidangan,bendahara Alfan Batubara akirnya divonis satu tahun satu bulan kurungan dalam kasus tersebut. Sementara itu untuk Zulfansyah masih dalam proses persidangan yang akan masuk pada tahap tuntutan dari Jaksa Penuntut Umum (JPU) Kejari Binjai,ada apa semuanya ini. Amin Sari selaku Ketua LMR-RI Sumbagut minta kepada Instansi terkait,khususnya di Kejati Sumut maupun Kejagung agar segera melakukan pemeriksaaan kepada oknum penyidik dalam penaganan kasus proyek Swakelola APBD 2010 di PU Binjai yang terduga kuat sengaja menyetel atau pun merekayasa Berita Acara Pemeriksaan (BAP) untuk memebaskan para PPK atau pun Pimpro bersama Dirtek serta pengawas dari Jerat Hukum.?? Dirinya pun sangat prihatin dalam penaganan kasus tersebut. Bahkan, katanya lagi, pada persidangan terlihat Majelis Hakim sangat terhenyut mendengar kesaksian terdakwa Zulfansya yang telah dijadikan korban. Tak hanya itu, Majelis Hakim juga meminta kepada Junaidi Lubis,SH selaku JPU agar kasus ini dapat dikembangkan untuk membidik para tersangka lainya.?? “Dari sudut padang Kita,bahwa penyidikan tersebut ada unsur rekayasa,sebab Tim penyidiknya langsung di tagani oleh Kasi Intel Junaidi Lubis,SH yang konon turut serta melibatkan diri selaku Tim Jaksa Penuntut Umum selama berjalanya Persidangan di PN Tipikor Medan. Sedangkan Kasi Pidsus Kejari Binjai FKJ.Sembiring dari awal penyidikan dalam kasus tersebut hingga di persidangan terkesan tidak dilibatkan,” akhirinya. (MR/MSTP)

TERCECER Telah tercecer satu buah Surat Tanah sekitar jalan raya Medan-TebingTinggi. Surat SK Tanah atas nama Selamat No. Register Desa Sei Buluh 590/16/SB/VIII/2006 tanggal 28 Agustus 2006 Kades Ishak Lubis. Dan No. Register Camat Teluk Mengkudu 592.2/065/SGR/06 tanggal 15-09-2006 Camat Teluk Mengkudu Menutur Parulian Naibaho, S.Sos NIP. 010233988 Siapa yang menemukan surat tersebut mohon agar dapat menghubungi nama SELAMAT alamat Desa Sei Buluh Payanibung 1 No.HP 081396023743. Dan tidak akan dituntut, justru akan diberi hadiah sepantasnya, terima kasih.

Dusun Masih

Dari Halaman 1

saja, PNS abdi negara tersebut sepertinya menyepelekan apa yang disampaikan Walikota. Sehingga di jam-jam kerja sering dijumpai para PNS ngumpul dan ngobrol di warung-warung. Terungkapnya 164 orang tenaga PNS dan honorer yang tidak disiplin tersebut berawal saat Wakil Walikota H Affan

Terkait Utang.. pertama kali dan wakil rakyat tersebut langsung datang ke Mapolres dan menemui petugas penyidik. Surat pemanggilan yang dikirimkan pada Rabu (18/4) lalu, langsung ke pribadi Akhirudin dan memberikan tembusan ke intansi Legislatif Pelalawan. Pemeriksaan Akhirudin yang telah ditunggu-tunggu, setelah kasus utang ini dilaporkankan penggugat, Basarudin pada tahun 2005 lalu. Dalam pemeriksaan kali ini, Akhiruddin diperiksa sebagai saksi hutang piutang dengan pelapor, Basyaruddin. Kasus ini sebenarnya sudah sejak lama berlangsung, namun baru kali pihak penyidik melakukan pemanggilan terhadap saksi, Akhiruddin karena menunggu surat izin dari Gubernur Riau. Kasus ini berawal, dari persoalan hutang piutang orang tua Akhiruddin yaitu Haji Luddin. Saat itu saksi, Akhiruddin mendatangi pelapor (Basyaruddin, red) di tokonya Jalan Lintas Timur, Pangkalan Kerinci untuk meminjam uang sebesar Rp 15 juta dengan untuk biaya naik haji orang tua saksi (Luddin, red). Peristiwa tersebut terjadi sekitar tahun 2002 lalu. Setelah kesepakatan antara dua belah pihak, Ludin pulang ke rumah dan beberapa minggu setelah itu, Akhiruddin kembali menemui Basyaruddin (pelapor) untuk mengambil uang sebesar Rp 15 juta dengan menandatangani kwitansi penerimaan

Inspektorat

Dari Halaman 1

Kata Idrawan, sejauh pantauan LSM-nya, masyarakat menilai kasus ini seolah ada indikasi pihak terkait memperlambat proses pemeriksaan terhadap yang bersangkutan. “Kita juga melihat kinerja Inspektorat Kabupaten Deliserdang jalan di tempat dalam melakukan pemeriksaan kasus Agus Siswanto,” ucapnya. Sementara itu di tempat terpisah, Sekretaris Inspektorat A Hasibuan mengatakan, hingga kini kasus tersebut masih sebatas pengumpulan berkas dan belum melaporkan ke tingkat atas.“Semuanya sedang diproses,” singkatnya. Menyahuti pernyataan A Hasibuan, masyarakat Patumbak I pun berang. Tertuang dari S Panjaitan, dirinya sangat kesal atas ucapan Sekretaris Inspektorat Deliserdang tersebut. Pasalnya, kasus yang menimpa Agus Siswanto telah terjadi sejak 2011 lalu. Tapi hingga kini masih dalam tahap proses. “Kalau terus menerus masih dalam tahap proses, pemeriksaan selama ini sama saja ‘nol’ Sebab, tak ada hasilnya. Pastinya, warga Patumbak I menangih proses berkelanjutan, bukan jalan di tempat. Ini sama saja pembohongan karena belum disikapi secara tegas. Artinya, kami selaku warga Patumbak I hanya bisa menunggu, menunggu dan menunggu,” tegas Panjaitan. Bahkan, katanya lagi, kelambatan pemrosesan kasus Agus Siswanto mengindikasikan bahwa ada pihak-pihak tertentu yang menjadi ‘pembeking’ Sekdes Pantumbak I tersebut. “Bupati dipilih oleh warga, jadi kami minta Bupati jangan remehkan laporan warga. Ini menyangkut kemajemukan dan kemajuan warga Patumbak I,” tukasnya.; Seperti diberitakan, persoalan yang sangat mencemarkan citra pemerintahan ini adalah salah seorang Sekdes Patumbak I atas nama Agus Siswanto diduga telah menyalahi aturan dalam pengangkatan dirinya menjadi Sekretaris Desa yang tidak sesuai dengan PP45 Tahun 2007 tentang pengangkatan dan pemberhentian Sekretaris Desa. Atas dasar itulah masyarakat meminta Bupati Deliserdang serius menindak bawahanya dalam menjalankan peraturan karena hal ini mungkin saja akan berdampak buruk bagi penegakan hukum. (TIM)

tersebut. Padahal seperti di Saipar Dolok Hole, banyak sumber daya alam yang diperoleh. Misalnya, Minyak Nilam, Kopi Ateng, Kopi Robusta, Karet dan Kemenyan serta lainnya. Malah, untuk menikmati listrik, warga Dusun Lobu, Sungai Pinang, Silangkitang,Tambiski terpaksa berlentarakan lampu teplok dan sebagian lagi menggunakan mesin genset. Camat Saipar Dolok Hole, Muhammad Syarif Pane SH, ketika dijumpai di Kantor Dinas Pendapatan Tapsel beberapa waktu yang lalu mengharapkan Pemerintah Pusat agar memperhatikan daerahnya. Bahkan, bergulir informasi bahwa akan dibangun PLTMH (Pembangkit Listrik tenaga mikro hidro) di Dusun Mandalasena. Rencananya akan dibangun di Aek Bara ,Heat Ketinggian 132 Meter setelah diukur tim pertambangan Pusat diperkirakan kekuatan 6 Mega Wat atau 8.000 Kilo Wat dan juga Parasoran Sitabo-tabo Aek Mandudu Heat 175 Meter. Parahnya lagi, lanjut Muhammad Syarif, ada dusun yang terisolir tidak ada jalan menuju yaitu Silangkitang Tambiski padahal banyak hasil bumi namun selama ini banyak hasil tapi berat diongkos sehingga tidak seimbang penjualan hasil dengan pengeluaran. Berbagai kekayaan alam di SDH seperti Emas di Rahuning Julu, Desa Pintu Padang Mandalasena, Desa Silangkitang Tambiski sumber BBM (Gas) dan Dusun Sayurmatua sudah pernah di Survey tih dari Luar Negeri Australia. Pemekaran Tak Berarti Kepedihan atas tak adanya aliran listrik, juga diungkapkan Parulian Berutu warga Lae Mbalno Kecamatan Salak, Kabupaten Pakpak Bharat. Kata lelaki berusia 37 tahun itu, setelah sembilan tahun dimekarkan dari Kabupaten Dairi, warga belum juga menikmati arti pemekaran. “Sehingga untuk masalah listrik ini kami warga Lae Mbalno sangat mengharapkan listrik segera masuk ke desa kami,” ujarnya kepada BN. Hal senada diungkapkan Parni Berutu (65). “Sungguh suatu kondisi yang ironi di tengah era globalisasi dan informasi dewasa ini, kami warga Lae Mbalno belum juga menikmati penerangan listrik, sehingga kami sangat mengharapkan perhatian Pemkab Pakpak Bharat agar desa kami segera diperhatikan, bagaimana anak-anak kami dapat maju mengikuti perkembangan jaman, belajar saja anak kami kesulitan sementara dimalam hari kami hanya memiliki lampu teplok, sementara listrik merupakan kebutuhan utama bagi kami selain sandang dan pangan belum tersedia,” imbuhnya. (KS-04/PB.007)

Ubi Raksasa

Dari Halaman 1

Ketika ditanya umur ubi dan cara pengelolaanya. Beliau menjelaskan, umur ubi yang biasanya sekitar 6 bulan dengan besar rata-rata sebesar mangga. Sementara ubi yang kita tanam ini umurnya sekitar 7 bulan. Mengenai proses penanaman sampai produksi adalah secara alami tanpa menggunakan pupuk kimia. Hanya saja dalan hal ini yang utama adalah proses pengeloaan struktur tanahnya. Ditambahkan sebelum ditanam dilakukan dulu pembusukan jenis daunan kemudian ditimbun dengan jenis tanah liat. Setelah dua bulan bibit siap ditanam selanjutnya menunggu hasilnya. Sementara ini masih tahap eksperimen,dimana hasil ubi yang sekarang dimamfaatkan masih untuk makanan ternak babi dan lainnya belum siap panen. Namun demikian setelah melihat hasilnya berukuran ubi jumbo,kedepan kita akan tanam lebih banyak dan akan dibudidayakan. Menuruitnya, The Eksperience Is The Best Teacher adalah modal utama bidang pertanian yang arahnya menjadikan produk pertanian nantinya bebas dari kimia sehingga antara tanah dan tanaman terjadi Simbiosis Mutualisme. Disamping itu dia memperlihatkan Pestisida Alami yang diproduksinya sendiri dari beberapa jenis daunan dan telah dipraktekkan kebeberapa jenis tanaman sekitar setahun ini sambil menunjukkan stoknya sekitar 35 liter siap pakai dan memberikan Merk percobaan dengan Pestisida Jaya Humbang. Dikatakannya, sejauh ini Dinas Pertanian Humbahas telah datang ke lokasi produknya di Desa Aeknauli dan sempel telah dibawa satu liter yang nantinya akan diberikan Kadis ke Bupati Humbahas sebagai produk yang layak dikembangkan. Kemudian dia hanya mengharapkan masukan dari berbagai pihak untuk menyempurnakan eksperimennya dan ubi jumbonya kelak dapat mengharumkan Humbang ke luar daerah. (*)

CMY K

CMY K

23 - 30 APRIL 2012 | EDISI 312 | THN KE-VII

Plt Gubsu Serahkan SK Mendagri Pemberhentian Bupati Palas Ali Sutan Dilantik Jadi Plt Bupati Medan,BN Pelaksana Tugas (Plt) Gubernur Sumatera Utara (Sumut) Gatot Pujo Nugroho secara resmi memberikan Surat Keputusan (SK) Menteri Dalam Negeri (Mendagri) tentang pemberhentian Bupati Padang Lawas (Palas) Basyrah Lubis dan Penunjukan Wakil Bupati Ali Sutan Harahap (TSO) sebagai Pelaksana Tugas Bupati di Kantor Gubernur Sumut Lt 10, Jalan Pangeran Diponegoro, Medan,Jumat (20/04). Dengan demikian secara resmi Ali Sutan Harahap sudah sah menjabatsebagai Pelaksana tugas (Plt) Bupati Palas untuk menjalankan tugas danfungsinya sebagai bupati. “Surat itu intinya adalah pemberhentian atas nama Pak Basyrah sebagai bupati dan menunjuk Ali Sutan Harahap (TSO) sebagai pelaksana bupati untuk menjalankan tugas dan fungsi sebagai bupati,” terang Gatot kepada wartawan. Dalam kesempatan tersebut, Gatot mengingatkan agar segenap unsur pemerintah maupun DPRD dapat menjaga situasi kondusif di Palas. Disampig itu, tugas utama yang diemban Plt Bupati bersama DPRD adalah mengesahkan APBD 2012 secepatnya sehingga program pembangunan dapat segera dilaksanakan. Ali Sutan Harahap saat itu hadir langsung bersama Wakil Ketua DPRD Palas Syahwil Nasution dan 15 anggota DPRD lainnya. Sedangkan Basyrah Lubis dan Ketua DPRD Palas berhalangan hadir. Mengenai kemungkinan adanya pro dan kontra yang terjadi pascapelimpahan tugas dan kewenangan Bupati Palas tersebut, diakui langsung oleh Ketua Badan Kehormatan (BK) DPRD Palas Syarifuddin Hasibuan yang turut hadir mendampingi. “Itu barangkali ada-ada saja. Yang jelas pro dan kontra itu ada dan nantilah kita selesaikan,” kata Syarifuddin. Namun dia berharap ke depan tidak sampai menimbulkan polemik baru di Palas. Meskipun Ketua dan 13 anggota DPRD lainnya tidak ikut dalam menyaksikan penyerahan SK Mendagri tersebut. Gatot juga mensinyalir bakal ada penolakan dari isi SK Mendagritersebut. Seperti hal yang sama juga dialaminya sendiri saat menerima jabatan sebagai Plt Gubernur Sumut. Namun dia yakin semua itu bisa diselesaikan den-

FOTO BERSAMA: Bupati Padang Lawas (Palas), Ali Sutan Harahap (TSO) sebagai Pelaksana Tugas Bupati foto bersama dengan Plt Gubsu Gatot Pudjo Nugroho, ST di Kantor Gubernur Sumut Lt 10, Jalan Pangeran Diponegoro, Medan,Jumat (20/04).

gan baik jika mengedepankan kearifan lokal. “Sedikit case-nya (kasusnya) seperti kami (Pemprov Sumut) lah. Tapi saya yakin dengan kearifan lokal unsur DPRD dan pemerintah daerah bisa menyelesaikannya” ujarnya. Gatot juga menyampaikan alasan ketidakhadiran Basyrah Lubis dan Ketua DPRD Palas yang sebelumnya dijadwalkan Kamis (19/4) lalu. Saat itu baik bupati maupun Ketua DPRD Palas mengirimkan surat pemberitahuan berhalangan hadir karena ada rapat kerja. “Lalu kami undang lagi atas dasar sesuatu dan lain hal tidak bisa datang dan saat ini beliau (Basyrah Lubis) sedang mempertanyakan ke Mendagri terkait Peninjauan Kembali (PK) yang diajukannya,” kata Gatot. Persoalan PK yang diajukan Basyrah menurut Gatot sudah disampaikannya ke Mendagri Gamawan Fauzi saat silaturahmi ke Sumut beberapa waktu lalu. Saat itu Mendagri hanya menyampaikan persoalan itu akan menjadi pertimbangannya. Pertanyaan juga kembali diajukan Gatot sesaat setelah Sk Mendagri di-

terima oleh Sekda Sumut Nurdin Lubis. Melalui Dirjen Otonomi Daerah (Otda) dia menanyakan apakah eksekusi dari surat tersebut bisa dilaksanakan meskipun sedang proses PK ? Saat itu juga dijawab bahwa proses PK tidak akan menghalangi eksekusi dari isi surat tersebut. Selain itu, usai menyerahkan SK Mendagri tersebut, sesuai dengan surat dari Mendagri cq Dirjen Otda, tindaklanjutnya dilakukan kemudian dengan menggelar sidang paripurna. Gatot berharap kondusifitas di Palas tetap menjadi perhatian utama dan menyegerakan penyelesaian pembahasan APBD 2012. Sebelumnya Kepala Pusat Penerangan (Kapuspen) Kemendagri Reydonnyzar Moenek mengatakan isi Surat Kepmendagri No 131.12-243/2012 yaitu padapoin pertama disebutkan memberhentikan Bupati Padanglawas Basyrah Lubis masa bakti 2009-2014 karena terbukti melakukan pelanggaran pidana sesuai dengan keputusan Mahkamah Agung (MA) yang sudah berkekuatan hukum tetap.

Lalu pada poin kedua disebutkan, menunjuk Wakil Bupati Padanglawas Ali Sutan Harahap untuk melaksanakan tugas dan kewajiban bupati sampaiadanya keputusan lebih lanjut. Keputusan lebih lanjut yang dimaksudkan menurutnya merupakan hasil dari konsultasi dan koordinasi Kemendagridengan MA pada 30 Maret lalu. Artinya jika ada pengajuan Peninjauan Kembali (PK) oleh Basyrah Lubis,maka tidak akan menunda eksekusi pemberhentiannya. Sebab telah dilaksanakan dan telah memiliki kekuatan hukum tetap. “Ini kan sudah kasasi ditolak maka ini keputusan hukum tetap,” ujar Donny. Namun ketika ditanya apakah Basyrah Lubis bisa menjabat kembali sebagai bupati jika PK diterima, Dony mengungkapkan itulah yang dimaksud dengan keputusan lebih lanjut pada poin kedua. Artinya, Mendagri harus mengembalikan hak dan kedudukannya sebagai bupati jikamemangbenar PK tersebut akhirnya diterima.(Ndo/Hza)

Tim Penegakan Perda IMB Pakpak Bharat Lakukan Peninjauan Lapangan Pakpak Bharat, BN Demi tegaknya Peraturan Daerah (Perda) dan juga untuk merespon pengaduan masyarakat, pada hari Kamis (12/4), Tim Penegakan Perda Izin Mendirikan Bangunan (IMB) yang terdiri dari Kantor Pelayanan Perizinan Satu Pintu dan Penanaman Modal (KP2SP-PM) yang dipimpin oleh Ka. KP2SP-PM, Jannes Berutu, SE, Satpol PP Pakpak Bharat yang didalamnya juga turut serta Kasat Pol PP, Albert Samosir, SE serta pihak Dinas Pekerjaan Umum dan Bagian Humas. Dalam peninjauan lapangan ini

mereka menemukan bangunan bermasalah yaitu sebuah toko grosir milik “M” yang terletak disekitar Pasar Salak. Selain bangunan tersebut tidak memiliki IMB, bangunan tersebut juga menyalahi persyaratan pendirian bangunan khususnya jarak bangunan tersebut dengan jalan umum. Ketika tim tersebut melakukan pengukuran, terlihat jarak tersebut tidak mencapai batas minimal yang disyaratkan yaitu 3,40 meter. Untuk itu tim melakukan himbauan kepada pemilik bangunan agar mengurus perizinan sesuai ketentuan serta merubah bagian bangunan yang bermasalah

tersebut. Pada kesempatan tersebut Jannes Berutu menjelaskan, bahwa untuk saat ini Tim masih melakukan himbauan kepada masyarakat yang memiliki bangunan bermasalah. “Penegakan Perda IMB adalah bagian dari tanggung jawab kami selaku abdi negara kepada masyarakat. Jangan diartikan bahwa Penegakan Perda adalah untuk mencari-cari kesalahan masyarakat, tetapi harus diingat bahwa apa yang didapatkan dari Penegakan Perda ini semuanya demi kesejahteraan masyarakat. Ini juga sejalan dengan arahan Bupati Pakpak Bharat

Remigo Y Berutu yang sering beliau sampaikan yaitu agar semua kita bertindak dan bekerja berdasarkan peraturan perundang-undangan demi menghindari kesalahan prosedur”, terangnya. Sebelum menutup pembicaraan Ka. Kantor Pelayanan Perijinan Satu Pintu Jannes Berutu, SE, mengatakan bahwa pada masa yang akan datang penegakan peraturan ini akan disertai penindakan sehingga timbul efek jera bagi yang melanggar peraturan dan menambah kondusifitas ditengah-tengah masyarakat. (pb.007/tim)

Mulai Senin Siswa SMP Ikuti UN Medan,BN Sebanyak 246.428 Siswa SMP sederajat di Sumut akan mengikuti ujian nasional (UN) yang akan dilaksanakan serentak di seluruh Indonesia mulai, Senin hingga Kamis (21-26/4). "Tahun ini jumlah peserta ujian nasional tingkat SMP sebanyak 199.546 siswa, MTs (46.882) dan SMPLB 12 sehingga total seluruh yang ikut ujian adalah sebanyak 246.428 siswa masing-masing berasal dari 1.887 sekolah SMP dan 716 MTs," kata Ketua Panitia Ujian Nasional Dinas Pendidikan Sumatera Utara, Hendri Siregar, di ruang kerjanya Jalan Teuku Cik Ditiro Nomor 1-D Medan, Jumat (20/4). Saat ini, lanjut dia, proses pendistribusian soal sedang berlangsung ke kabupaten/kota dari gudang penyimpanan di Jalan Bilal Medan. Berdasarkan jadwal, paling lambat Sabtu (21/4) pendistribusian sudah selesai. Sesuai rencana, pendistribusian naskah soal UN ke kabupaten/kota dilaksanakan empat hari dari mulai Rabu hingga Sabtu (18-21 April). Untuk hari pertama tujuan pendistribusian adalah Nias, Gunung Sitoli, Nias Utara, Nias Barat dan Nias Selatan. Selanjutnya hari kedua bahan ujian akan dikirimkan ke Padang Sidempuan, Tapsel, Madina, Padang Lawas Utara, Padang Lawas, Sibolga dan Tapteng. Kemudian hari ketiga naskah akan didistribusikan ke Batubara, Asahan, Tanjung Balai, Labuhan Batu Utara, Labuhan Batu, Labuhan Batu Selatan, Toba Samosir, Tapanuli Utara, Humbang Hasundutan dan Samosir. Sementara pada hari terakhir, Sabtu (21/4) bahan ujian akan dikirimkan ke kabupaten/kota terdekat seperti Karo, Dairi, Pakpak Bharat, Pematang Siantar, Simalungun, Binjai, Langkat, Deli Serdang, Serdang Bedagai, Tebing Tinggi dan Medan. "Rencana pendistribusian ini sudah cukup matang, dan daerah terjauh merupakan prioritas karena selain ketepatan waktu, keamananan soal harus sangat diperhatikan," katanya. Panitia Pelaksana Ujian Nasional (UN) Sumatera Utara (Sumut) siap melaksanakan UN tingkat Sekolah Menengah Pertama (SMP) yang akan dilaksanakan mulai 23-26 April mendatang. 12 Kabupaten/ Kota Sudah Menerima Naskah Hingga kemarin,12 kabupaten/ kota sudah menerima naskah soal UN.Ke-12 daerah itu yakni Nias,Gunung Sitoli,Nias Utara,Nias Barat,Nias Selatan, Padangsidimpuan, Tapanuli Selatan (Tapsel), Mandailing Natal (Madina), Padanglawas Utara (Paluta), Padanglawas (Palas), Sibolga dan Tapanuli Tengah (Tapteng). "Besok kami distribusikan terakhir untuk yang terdekat Medan," ujar Ketua Pelaksana UN Dinas Pendidikan (Disdik) Sumut Henri Siregar kemarin di Kantornya Jalan Cik Ditiro Medan,kemarin. Henri menuturkan, peserta UN tingkat SMP/MTS/SMPLB tahun ini berjumlah 246.428 peserta. Rinciannya, siswa SMP sebanyak 198.409 orang, MTS berjumlah 46.866 orang serta SMPLB berjumlah 12 orang. "Untuk jumlah sekolah penyelenggara di Sumut berjumlah 1.887 sekolah,"ujarnya. Untuk pengawasan ruang kelas, panitia UN menggunakan guru dengan sistem silang. Jumlahnya menjadi tanggung jawab kabupaten/kota masingmasing. Sekretaris Panitia Pelaksana UN Disdik Pemko Medan Taruli Simanullang menyatakan, siswa peserta UN SMP di Medan sebanyak 37.399 orang ditambah 4.438 siswa untuk MTs. Sedangkan jumlah sekolah penyelenggara untuk SMP sebanyak 316 sekolah dan MTS sebanyak 52 sekolah. "Untuk pengawas ruang, kami menyediakan sebanyak 4.064 orang untuk SMP dan 506 orang untuk MTs. Setiap kelas diawasi dua orang pengawas," tuturnya. Taruli menyatakan,seluruh persiapan untuk pelaksanaan UN SMP sudah rampung.Panitia hanya tinggal menunggu pendistribusian naskah dari provinsi ke Disdik Pemko Medan yang direncanakan disalurkan hari ini. Sedangkan untuk UN SMA, seluruh lembar jawaban komputer (LJK) sudah tiba di Universitas Negeri Medan (Unimed) dan sedang dalam proses pemindaian. Saat ini, yang sedang dalam proses pemindaian yakni Kota Binjai dan Serdangbedagai (Sergai). (r.ndo)

Peredaran Ikan Impor Makin Marak Belawan,BN Pasaran harga ikan lokal yang terbilang tinggi rata-rata Rp 20 ribu/ Kg ternyata kalah saing dengan harga ikan impor yang lebih murah ratarata Rp15 ribu/Kg ternyata mengancam minimnya penghasilan dari penjualan ikan milik nelayan bahkan bisa mengancam bangkrutnya usaha penangkapan ikan.Apalagi saat ini sudah banyak kalangan pengusaha perikanan yang beralih mengimpor ikan ketimbang melautkan kapal ikan dengan resiko serta biaya operasional yang tinggi. Kekhawatiran itu disampaikan sejumlah nelayan lokal yang ditemui di seputaran gedung TPI Pelabuhan Samudera Belawan (PPSB) Gabion, Sabtu (21/04) menyikapi kian maraknya peredaran ikan impor berkedok untuk kebutuhan coolstroge serta pemindangan, namun nyatanya pasokan ikan impor yang tembus ke sejumlah pasar sulit terdekteksi maupun diawasi pihak PSDKP stasiun Belawan, terbukti kian banyaknya ikan kotakan impor dirubah menjadi ikan lokal dengan harga yang murah dibandingkan ikan hasil tangkapan nelayan. Rusli As selaku penggurus dari Himpunan Pedagang Ikan Gabioan (HIPIGAB) dan Ketua Forum Taruna Nelayan Indonesia (FTNI) Kota Medan tak menampik adanya ancaman ikan impor yang dapat merusak bisnis pasaran ikan lokal hasil tangkapan nelayan. Ia menilai Indonesia khususnya Sumut belum siap menghadapi pasar global dari masuknya ikan impor, ia berharap pembatasan kuota serta ada pengawasan ketat terhadap masuknya ikan impor agar harga ikan lokal nelayan tak terganggu. Menurut salah seorang pedagang ikan di pasar tradisional di Pasar Pagi Belawan bernama Misno (40), kenaikan harga ikan lokal terjadi karena banyaknya permintaan akan ikan di tengah musim hujan dan berombak ini, harga ikan lokal wajar naik ditambah lagi banyaknya permintaan ikan di pasar belakangan ini,"tuturnya.(San)

Pemprovsu dan USU Sepakat Me-mangrove-kan Seluruh Pantai Medan, BN Pemerintah Provinsi Sumut (Pemprovsu) bersinerji dengan Universitas Sumatera Utara (USU) me-mangrove-kan seluruh pantai dan pulau di provinsi ini. Gerakan tersebut dimulai dari Pulau Sembilan Kabupaten Langkat oleh Plt Gubsu H Gatot Pujo Nugroho ST diwakili Sekdaprovsu H Nurdin Lubis SH MM, Kamis (19/4) bersama Rektor USU Prof Dr H Sjahril Pasaribu. Pencanangan gerakan dipusatkan di lima kabupaten dengan kegiatan puncak direncanakan di Kecamatan Perut Kabupaten Deliserdang yang dijadwalkan dihadiri langsung Plt Gubsu H Gatot Pujo Nogroho ST. Kebijakan menghijaukan pantai dan laut bersih ini distimulasikan melalui Gerakan Menoleh ke Laut dengan kegiatan Gerakan Bersih Pantai, Penanaman Mangrove (bakau) dan Pengobatan Gratis. Seluruh kegiatan terkait HUT ke-64 Provinsi Sumut dan Dies Natalis ke-60 USU ini sepenuhnya kolaborasi aparatur Pemprovsu, dosen dan mahasiswa USU serta masyarakat desa pantai yang bahu CMY K

membahu menanam mangrove, membersihkan pantai dan menata ekosistem. Rombongan Sekdaprov dan Rektor USU disambut masyarakat secara antusias dan hangat diiringi prosesi adat dengan tepak sirih selamat datang. Sekdaprovsu yang juga Ketua Umum Dies ke-60 USU turun ke Pulau Sembilan bersama Kadis Perikanan dan Kelautan Sumut H OK Zulkarnain SH MSi, Kepala Badan Lingkungan Hidup Sumut DR Hj Hidayati MSi, Kepala Badan Promosi dan Penanaman Modal H Salman Ginting SH MM, Kepala Badan Perpustakaan H Nurdin Pane SE, Plt Kadis Kominfo HM Ayub dan sejumlah pejabat Pemprovsu seperti DR HM Arsyad Lubis, Drs H Eddy Syofian MAP dan H Bahar Siagian SH MSi yang Kepala UPT Samsat Medan Utara. Sementara Rektor USU turun bersama PR V Prof HM Yusuf, Kepala LPPM Prof Dr Edison Purba dan Sekretaris Umum Dies Prof DR Hj Irmawati Psikologi, Juga turun Sekda Langkat Drs Surya Djahisa MSi dan pengusaha H Syarifuddin Siba SH.

Kegiatan diisi dengan penyerahan bibit mangrove, pengobatan gratis, penyerahan buku dan peralatan kebersihan. Juga dilakukan penyuluhan dan dialog antara sivitas akademika dan masyarakat desa. Rektor USU menyempatkan diri memotivasi dan mendorong anakanak desa Pulau Sembilan untuk diupayakan kuliah di USU sesuai proporsional dan mekanisme memungkinkan serta program beasiswa. Sekdaprovsu, Rektor USU maupun Kadis Perikanan dan Kelautan H OK Zulkarnain SH MSi mengakui gerakan ini menjadi stimulan untuk memotivasi dan mendorong masyarakat bahwa pelestarian hutan bakau adalah tanggung jawab bersama. "Masyarakat akan lebih sadar bahwa efek dari kerusakan hutan mangrove sangat mengkhawatirkan. Masyarakat akan lebih sadar bahwa jika mangrove tumbuh berkembang dan lestari juga bermanfaat bagi masyarakat, baik secara ekonomis maupun pelestarian lingkungan," ujarnya. Diharapkan dengan gerakan ini

masyarakat khususnya di kawasan pantai dan pulau-pulau senakin sadar pentingnya hutan mangrove bagi nilai ekonomis maupun pelestarian lingkungan.

Sekdaprovsu mengemukakan gerakan menoleh ke laut terus digencarkan secara simultan. Untuk ini akan dilakukan penajaman program memangrove-

kan seluruh pantai dan pulau di Sumut dengan Pilot Projet di Kabupaten Langkat atas kerjasama Pemprovsu, USU dan Pemkab Langkat.(ndo) CMY K


Koran bongkar NEws edisi 312