a product message image
{' '} {' '}
Limited time offer
SAVE % on your upgrade

Page 1

/LVWRSDG1RYHPEHUǹǺȋǭǼȈ

Výběr nejlepších nemovitostí Selection of the best properties ȼɵɛɨɪɥɭɱɲɟɣɧɟɞɜɢɠɢɦɨɫɬɢ

Anniversary Issue

ESTATE DOPORUČUJE: BRAVOS / 628þ$61ê ã3$1ę/6.ê DESIGN

9

7 7 1 8 0 2

8 2 1 0 0 1

Z JINÉHO KOUTU SVĚTA / FROM A DIFFERENT PART OF WORLD / ǙnjǐǜǟǏǚǘ ǖǜnjǪǝǎǑǞnj NORSKO

CZK 95 € 4,50 £ 3,50 STÁHNĚTE SI

DEVELOPERSKÉ PROJEKTY: OÁZA LIBUŠ: VELKORYSÝ PROSTOR PRO VAŠE BYDLENÍ / AMPLE SPACE FOR YOUR LIVING /ǍǚǗǨǤǔǑ ǛǜǚǝǞǜnjǙǝǞǎnjǐǗǫǎnjǤǑǏǚǒǔǗǨǫ VILADŮM CHODOV: DOKONALÝ NAVENEK I UVNITŘ / PERFECT EXTERIOR AS WELL AS INTERIOR /ǛǜǑǖǜnjǝǙǧǕǔǓǙǟǞǜǔǔǝǙnjǜǟǒǔ BYDLENÍ VIDOULE / BYDLENÍ NA VÝŠI A R C H I T E C T U R E

D E S I G N

L I F E S T Y L E


let|years


LUXUSNÍ BY T Y PRAHA 6

C I J AWA R D S 2 011 C Z E C H R E P U B L I C :

THE BEST RESIDENTIAL PROJECT

B Ě L O H O R S K Á 37 16 9 0 0 P R AG U E 6 , B Ř E V N OV TEL.:

+420 233 324 324

MOB.:

+420 775 56 4 324

EMAIL:

SALES@KAJETANKA.EU

předprodej zahájen presale started

DŮM U JEZERA LAKEHOUSE

W W W. K A J E TA N K A . E U


Kvalitní postele, matrace a ložní příslušenství zvučných značek


www.natynaty.cz

Senovážné náměstí 10a, Praha 1, tel.: +420 775 566 126


6

ESTATE ISSN 1802-8217 Czech Republic CZK 95 Eurozone € 4,50 Great Britain £ 3,50 Redakce a obchodní oddělení Desk and Commercial Department Real Estate Publishing, s.r.o. Badeniho 1 160 00 Praha 6 Czech Republic T: +420 220 512 965 F: +420 220 511 943 www.estatemagazine.cz

ǹǶǬǭǸǮǨǵǰǭ 2012 Listopad / November / ǹǺȋǭǼȈ

Living ȎȐȓȤȍ

Šéfredaktor / Editor In Chief Yumi Nozaki (London, UK) nozaki@estatemagazine.cz

10

Produkce / Production Eva Jelínková jelinkova@bonafide.cz Redaktoři / Editors Helena Vavrdová redakce@estatemagazine.cz

38

30

32

Developerské projekty: ViladĤm Chodov – Dokonalý navenek i uvnitĜ

Property projects: Villahouse Chodov – Perfect exterior as well as interior ǻǼǺDZǶǾȇ ǼǬdzǮǴǾǴȋ: ǎǴǷǷǬ-ǰǺǸ Chodov – ǛǼDZǶǼǬǽǹȇǵ ǴdzǹǿǾǼǴ Ǵ ǽǹǬǼǿDzǴ 36

Jazyková redakce / Proof-copy Helena Vavrdová

38

Developerské projekty: Bydlení Vidoule – bydlení na výši ýeský design: Vizuální hravost AlžbČty Zimmerové

Czech Design: Visual Playfulness of AlžbĚta Zimmerová ǣDZȄǽǶǴǵ ǰǴdzǬǵǹ: ǎǴdzǿǬǷȈǹǬȋ ǴǯǼǴǮǺǽǾȈ njǷȈDzǭDZǾȇ ǓǴǸǸDZǼ

Překlady / Translation Viktor Horák Irina Alferovičova-Sergejeva sergejeva@bonafide.cz

40

Z jiného koutu svČta: Norsko

From a Different Part of World: Norway ǙǬ ǰǼǿǯǺǸ ǶǼǬȊ ǽǮDZǾǬ: ǙǺǼǮDZǯǴȋ

Obchodní oddělení / Commercial Section

40

Irina Alferovičova-Sergejeva sergejeva@bonafide.cz Předplatné / Subscriptions info@estatemagazine.cz Sídlo společnosti / Headquarters Real Estate Publishing, s.r.o. Václavkova 169/1 160 00 Praha 6 Czech Republic

Nemovitosti Properties ǵȍȌȊȐȎȐȔȖșȚȤ 52

Otázka pro realitní odborníky

Question for Real Estate Professionals ǎǺǻǼǺǽ ǰǷȋ ǼDZǬǷȈǹȇȁ DZǶǽǻDZǼǾǺǮ 55

Zastoupení v Londýně London Representation Kamila Vykydalová Great Chapel Street 21 W1F 8FP London United Kingdom

Nejlepší nemovitosti

Best Properties ǗǿȃȄǬȋ ǹDZǰǮǴDzǴǸǺǽǾȈ

Prague out ǷȘȈȋȈ Ȑȏ

Vydavatel ani redakce neodpovídá za obsah inzerce. Žádná část z obsahu tohoto časopisu nesmí být kopírována ani jakýmkoli způsobem rozmnožována bez písemného souhlasu vydavatele.

180

168

Novinky / News / ǹǺǮǺǽǾǴ

174

ESTATE doporuþuje: Inteligentní systém ovládání i pro váš domov s KD Elektronika

ESTATE ǼDZǶǺǸDZǹǰǺǮǬǹǹȇǵ: ǔǹǾDZǷǷDZǶǾǿǬǷȈǹǬȋ ǽǴǽǾDZǸǬ ǿǻǼǬǮǷDZǹǴȋ Ǵ ǰǷȋ ǎǬȄDZǯǺ ǰǺǸǬ ǽ KD Elektronika 180

Titulní foto MARC CAIN podzim–zima 2012/13 www.onvi.cz

Developerské projekty: Oáza Libuš – Velkorysý prostor pro vaše bydlení

Property projects: Oasis Libuš – Ample space for your living ǻǼǺDZǶǾȇ ǼǬdzǮǴǾǴȋ: ǚǬdzǴǽ ǗǴǭǿȄ – ǍǺǷȈȄǴDZ ǻǼǺǽǾǼǬǹǽǾǮǬ ǰǷȋ ǮǬȄDZǯǺ DzǴǷȈȋ

Michal Záhora redakce@estatemagazine.cz

Redakční rada / Advisory Board Martina Huclová, Radim Koliba, Petr Kouba, Michal Macek, Zdeněk Macháček, Milorad Miškovič, David Neveselý, Yumi Nozaki, Ladislav Pflimpfl, Bedřich Skalický, Pavel Velebil, Tomáš Zykán, Jaroslav Žižka

Novinky – architektura & design

News – Architecture & Design ǙǺǮǺǽǾǴ – ǬǼȁǴǾDZǶǾǿǼǬ & ǰǴdzǬǵǹ

Art Director Jitka Ticháčková jitka.tichackova@gmail.com

ESTATE doporuþuje: Bravos / souþasný španČlský design

ESTATE Recommends: Bravos / Contemporary Spanish Design ESTATE ǼDZǶǺǸDZǹǰǺǮǬǹǹȇǵ: Bravos / ǽǺǮǼDZǸDZǹǹȇǵ ǴǽǻǬǹǽǶǴǵ ǰǴdzǬǵǹ 182

ESTATE Tipy / ESTATE Tips / ESTATE

192

AdresáĜ realitních kanceláĜí a inzerce

Real Estate Agencies and Advertisements Directory ǝǻǴǽǺǶ ǬǯDZǹǾǽǾǮ ǻǺ ǹDZǰǮǴDzǴǸǺǽǾǴ Ǵ ǼDZǶǷǬǸǺǰǬǾDZǷDZǵ


Milí þtenáĜi, Dear readers, ǹȓȖȊȈ ȘȍȌȈȒȚȖȘȈ,

þíslem, které právČ držíte v rukou, oslavuje Estate

With this issue that you are now holding in your

své jubilejní pČtileté výroþí. ýasopisem za tu dobu

hands, ESTATE celebrates its 5th anniversary.

stihly projít tisíce nabídek na to nejlepší bydlení

During this period, the magazine has presented

v Praze a okolí, stovky tipĤ, jak si nápaditČ

thousands of ads for the best of living in Prague

a originálnČ zaĜídit byt þi jak netradiþnČ strávit

and vicinity, hundreds of tips on how to creatively

volný þas. PĜinesli jsme také nespoþet pĜíbČhĤ

and originally arrange a house or Àat and how to

o významných architektech a designérech, ale

spend leisure time in unusual ways.

i tČch, kteĜí se prvními krĤþky teprve vydávají na umČleckou dráhu ve šlépČjích svých uþitelĤ a mají pĜed sebou zajímavou budoucnost. Snažíme se pro vás neustále vybírat to nejlepší z pražských realit a pĜedstavovat nadČjné developerské projekty, které se mohou stát buć vaším domovem, kde budete spokojenČ trávit klidné chvíle v rodinném kruhu, nebo velmi výhodnou investicí do dalších let. I v tomto þísle nabídneme nČkolik tipĤ pro ještČ pĜíjemnČjší bydlení - v rozhovoru s Ĝeditelem spoleþnosti KD Elektronika se napĜíklad seznámíte s inteligentními systémy proslulých znaþek jako jsou Bang & Olufsen þi Lutron a dozvíte se, jak je jednoduchým zpĤsobem ovládat a vzájemnČ integrovat. DČkujeme za vaši stálou pĜízeĖ a vČĜíme, že pro vás bude Estate i nadále zdrojem inspirujících zážitkĤ.

We have also brought you countless stories of signi¿cant architects and designers as well as those who, with their ¿rst steps, set out on artistic careers in the footsteps of their teachers and have interesting futures ahead. We constantly try to select for you the best of Prague real estate and represent promising developers’ projects that can either become your home where you will spend peaceful moments of contentment with your family, or a very advantageous investment in future years. Also in this issue we offer several tips for more pleasant living – for example, you will learn from the interview with the Director of KD Elektronika

inspiring experiences for you.

ǺȈȒȎȍ Ȋ ȥȚȖȔ ȊȣȗțșȒȍ Ȕȣ ȗȘȍȌȓȖȎȐȔ ȊȈȔ ȕȍșȒȖȓȤȒȖ șȖȊȍȚȖȊ Ȍȓȧ ȒȖȔȜȖȘȚȕȖȋȖ ȎȐȓȤȧ - Ȋ ȐȕȚȍȘȊȤȦ ș ȌȐȘȍȒȚȖȘȖȔ ȒȖȔȗȈȕȐȐ «KD Elektronika» Ȋȣ șȔȖȎȍȚȍ ȗȖȏȕȈȒȖȔȐȚȤșȧ ș ȐȕȚȍȓȓȍȒȚțȈȓȤȕȣȔȐ șȐșȚȍȔȈȔȐ ȐȏȊȍșȚȕȣȝ ȔȈȘȖȒ, ȕȈȗȘȐȔȍȘ, ȚȈȒȐȝ ȒȈȒ «Bang & Olufsen» ȐȓȐ «Lutron», Ȑ țȏȕȈȍȚȍ, ȒȈȒ ȗȘȖșȚȖ ȐȔȐ țȗȘȈȊȓȧȚȤ Ȑ ȊȏȈȐȔȕȖ ȐȕȚȍȋȘȐȘȖȊȈȚȤ.

Enjoy your reading!

ǩȓȈȋȖȌȈȘȐȔ ȊȈș ȏȈ ȊȈȠȍ ȗȖșȚȖȧȕȕȖȍ ȊȕȐȔȈȕȐȍ Ȑ ȕȈȌȍȍȔșȧ, ȟȚȖ Estate Ȑ ȌȈȓȤȠȍ ȉțȌȍȚ ȧȊȓȧȚȤșȧ Ȍȓȧ ȊȈș ȐșȚȖȟȕȐȒȖȔ ȊȌȖȝȕȖȊȍȕȐȧ.

company about the intelligent systems of renowned brands such as Bang & Olufsen and Lutron and get to know how to reciprocally integrate and operate them simply. Thank you for your constant support. We believe that ESTATE will continue to be a source of

PĜíjemné þtení!

ȕȖȔȍȘ, ȒȖȚȖȘȣȑ Ȋȣ ȌȍȘȎȐȚȍ Ȋ ȘțȒȈȝ, ȦȉȐȓȍȑȕȣȑ - Estate ȗȘȈȏȌȕțȍȚ șȊȖȦ ȗȧȚțȦ ȋȖȌȖȊȡȐȕț! Ǫ ȎțȘȕȈȓȍ ȏȈ ȥȚȖ ȊȘȍȔȧ ȉȣȓȐ ȗȘȍȌșȚȈȊȓȍȕȣ ȚȣșȧȟȐ ȓțȟȠȐȝ ȗȘȍȌȓȖȎȍȕȐȑ ȕȍȌȊȐȎȐȔȖșȚȐ Ȋ ǷȘȈȋȍ Ȑ ȍȍ ȖȒȘȍșȚȕȖșȚȧȝ, șȖȚȕȐ șȖȊȍȚȖȊ Ȗ ȚȖȔ, ȒȈȒ ȚȊȖȘȟȍșȒȐ Ȑ ȖȘȐȋȐȕȈȓȤȕȖ ȖȉȖȘțȌȖȊȈȚȤ ȎȐȓȤȍ ȐȓȐ ȒȈȒ ȕȍȖȉȣȟȕȖ ȗȘȖȊȍșȚȐ șȊȖȉȖȌȕȖȍ ȊȘȍȔȧ. Ǵȣ ȚȈȒȎȍ ȖȗțȉȓȐȒȖȊȈȓȐ ȉȍșȟȐșȓȍȕȕȖȍ ȒȖȓȐȟȍșȚȊȖ ȘȈșșȒȈȏȖȊ Ȗȉ ȐȏȊȍșȚȕȣȝ ȈȘȝȐȚȍȒȚȖȘȈȝ Ȑ ȌȐȏȈȑȕȍȘȈȝ, Ȉ ȚȈȒȎȍ Ȑ Ȗ Țȍȝ, ȒȚȖ ȚȖȓȤȒȖ ȌȍȓȈȍȚ ȗȍȘȊȣȍ ȠȈȋȐ Ȋ șȊȖȍȑ ȚȊȖȘȟȍșȒȖȑ ȒȈȘȤȍȘȍ, ȐȌȧ ȗȖ șȚȖȗȈȔ șȊȖȐȝ țȟȐȚȍȓȍȑ, Ȑ ȐȔȍȍȚ ȉȖȓȤȠȐȍ ȗȍȘșȗȍȒȚȐȊȣ Ȋ ȉțȌțȡȍȔ. Ǵȣ șȚȈȘȈȍȔșȧ ȗȖșȚȖȧȕȕȖ ȊȣȉȐȘȈȚȤ Ȍȓȧ ȊȈș ȓțȟȠȐȍ ȗȘȍȌȓȖȎȍȕȐȧ ȖȚ ȗȘȈȎșȒȐȝ ȈȋȍȕȚșȚȊ ȕȍȌȊȐȎȐȔȖșȚȐ Ȑ ȗȘȍȌșȚȈȊȓȧȚȤ ȊȈȔ ȗȍȘșȗȍȒȚȐȊȕȣȍ ȌȍȊȍȓȖȗȍȘșȒȐȍ ȗȘȖȍȒȚȣ, ȒȖȚȖȘȣȍ ȔȖȋțȚ șȚȈȚȤ ȓȐȉȖ ȊȈȠȐȔ ȌȖȔȖȔ, ȋȌȍ Ȋȣ ȉțȌȍȚȍ șȟȈșȚȓȐȊȣ ȗȘȖȊȖȌȐȚȤ ȊȘȍȔȧ Ȋ ȓȦȉȧȡȍȔ ȒȘțȋț ȊȈȠȍȑ șȍȔȤȐ, ȐȓȐ ȖȟȍȕȤ ȝȖȘȖȠȍȑ ȐȕȊȍșȚȐȞȐȍȑ ȕȈ ȉțȌțȡȍȍ.

ǷȘȐȧȚȕȖȋȖ ȟȚȍȕȐȧ!

Yumi PÀimpÀ Nozaki Šéfredaktorka / Editor In Chief / ȋȓȈȊȕȣȑ ȘȍȌȈȒȚȖȘ


NOVINKY | NEWS | ǙǚǎǚǝǞǔ

news

ǙǚǎǚǝǞǔ

novinky Inspirujte se nejnovĚjšími trendy v designu a architektuŐe a spoleÿnĚ s kapkou vaší fantazie si zaŐiďte bydlení, o kterém jste vždy snili. Ty nejlepší tipy a novinky vám na svých stránkách pŐedstaví i tentokrát ÿasopis ESTATE. Let yourself be inspired by the newest trends in design and architecture and, with just a touch of your own fantasy, design your dream home. ESTATE magazine as usual introduces you to top tips and innovations on its pages.

architektura

ǛǿǽǾȈ ǎǬǽ ǮǰǺȁǹǺǮȋǾ ǻǺǽǷDZǰǹǴDZ ǾǼDZǹǰȇ Ǯ ǰǴdzǬǵǹDZ Ǵ ǬǼȁǴǾDZǶǾǿǼDZ, ǽǺDZǰǴǹǴǮ ǶǺǾǺǼȇDZ ǽ ǶǬǻǷDZǵ ǎǬȄDZǵ ȀǬǹǾǬdzǴǴ Ǯȇ ǽǸǺDzDZǾDZ ǽǺdzǰǬǾȈ DzǴǷȈDZ Ǯ ǽǾǴǷDZ ǽǮǺDZǵ ǸDZȃǾȇ! ǗǿȃȄǴDZ ǴǰDZǴ Ǵ ǹǺǮǴǹǶǴ ǾǺǷȈǶǺ ǰǷȋ ǎǬǽ ǽǹǺǮǬ ǽǾǼǬǹǴȂǬȁ DzǿǼǹǬǷǬ ESTATE.

STARONOVÁ ELEGANCE VE ŠPANęLSKÉM PODÁNÍ OLD-NEW ELEGANCE IN THE SPANISH WAY ǝǞnjǜǚ-Ǚǚǎnjǫ ǩǗǑǏnjǙǞǙǚǝǞǨ ǎ ǔǝǛnjǙǝǖǚǘ ǔǝǛǚǗǙǑǙǔǔ Západní vĚž radnice ve španĚlském mĚstĚ Huesca dostala díky rekonstrukci nový kabát. DvĚ boÿní stĚny jsou novĚ obloženy dŐevĚným obkladem s mezerami, které umožŁují prosvĚtlení interiéru. Tento druh obložení má své opodstatnĚní v historii - španĚlské rané obranné vĚže byly podobné konstrukce. Dochází tak ke kontrastu nového, jenž odkazuje k neÿemu staršímu, než je pŢvodní stavba. Interiér byl zaŐízen velmi jednoduše, ale pŐesto reprezentativnĚ, zejména díky použití kvalitního dŐeva na konstrukce a vybavení místností. The western tower of the City Hall in the Spanish city of Huesca received a new coat during reconstruction. Two side walls are now covered in wooden tiles with gaps that allow the illumination of the interior. This type of panelling has its foundation in history - the early Spanish defensive towers were of a similar design. This leads to a contrast with the new, which itself refers to something older than the original building. The interior was decorated very simply, but still traditionally, in particular due to the use of high-quality wood for the construction and Ànishes of the rooms. ǓǬǻǬǰǹǬȋ ǭǬȄǹȋ ǼǬǾǿȄǴ Ǯ ǴǽǻǬǹǽǶǺǸ ǯǺǼǺǰDZ ǟȉǽǶǬ ǭǷǬǯǺǰǬǼȋ ǼDZǶǺǹǽǾǼǿǶȂǴǴ ǻǺǷǿȃǴǷǬ ǹǺǮȇǵ ǶǺǼǻǿǽ. ǐǮDZ ǭǺǶǺǮȇȁ ǽǾDZǹȇ ǾDZǻDZǼȈ dzǬǹǺǮǺ ǻǺǶǼȇǾȇ ǰDZǼDZǮȋǹǹǺǵ ǺǭǷǴȂǺǮǶǺǵ ǽ dzǬdzǺǼǬǸǴ, ǶǺǾǺǼȇDZ ǻǺdzǮǺǷȋȊǾ ǽǮDZǾǿ ǻǼǺǹǴǶǬǾȈ Ǯ ǴǹǾDZǼȈDZǼ. ǩǾǺǾ ǾǴǻ ǺǭǷǴȂǺǮǶǴ ǴǸDZDZǾ ǽǮǺDZ ǺǽǹǺǮǬǹǴDZ Ǯ ǴǽǾǺǼǴǴ - ǰǼDZǮǹǴDZ ǴǽǻǬǹǽǶǴDZ ǺǭǺǼǺǹǴǾDZǷȈǹȇDZ ǭǬȄǹǴ ǺǭǷǬǰǬǷǴ ǬǹǬǷǺǯǴȃǹǺǵ ǶǺǹǽǾǼǿǶȂǴDZǵ. ǎ ǼDZdzǿǷȈǾǬǾDZ Ǹȇ ǮǴǰǴǸ ǶǺǹǾǼǬǽǾ ǽǾǬǼǺǯǺ Ǵ ǹǺǮǺǯǺ, ǶǺǾǺǼǺDZ Ǯ ǽǮǺȊ ǺȃDZǼDZǰȈ ǹǬǻǺǸǴǹǬDZǾ ȃǾǺǾǺ DZȅDZ ǭǺǷDZDZ ǽǾǬǼǺDZ, ȃDZǸ ǺǼǴǯǴǹǬǷȈǹǺDZ dzǰǬǹǴDZ. ǔǹǾDZǼȈDZǼ ǺȀǺǼǸǷDZǹ ǺȃDZǹȈ ǻǼǺǽǾǺ, ǹǺ Ǯ ǾǺ DzDZ ǮǼDZǸȋ ǼDZǻǼDZdzDZǹǾǬǾǴǮǹǺ, ǯǷǬǮǹȇǸ ǺǭǼǬdzǺǸ dzǬ ǽȃDZǾ ǴǽǻǺǷȈdzǺǮǬǹǴȋ ǮȇǽǺǶǺǶǬȃDZǽǾǮDZǹǹǺǯǺ ǰDZǼDZǮǬ ǰǷȋ ǴdzǯǺǾǺǮǷDZǹǴȋ ǶǺǹǽǾǼǿǶȂǴǵ Ǵ ǺȀǺǼǸǷDZǹǴȋ ǶǺǸǹǬǾ. Foto / photos / ȀǺǾǺ: © Iñaki Bergera, Decon Photo Studio

10


NOVINKY | NEWS | ǙǚǎǚǝǞǔ KVALITNÍ ARCHITEKTURA TAM, KDE BY JI NIKDO NEþEKAL QUALITY ARCHITECTURE WHERE NO ONE WOULD EXPECT IT ǖnjǣǑǝǞǎǑǙǙnjǫ njǜǡǔǞǑǖǞǟǜnj Ǟnjǘ, ǏǐǑ ǩǞǚǏǚ ǙǔǖǞǚ ǙǑ ǚǒǔǐnjǗ V Itálii dokážou dát architekti atraktivní formu také obyÿejným stavbám jako je napŐíklad vodní elektrárna v Jižním Tyrolsku. Organické tvary betonové stŐechy, která je zakrytá vrstvou zeminy, dokonale ladí s okolním svažitým terénem, do nĚhož je stavba zapuštĚna. DŐevĚné latĚ použité na obvodové stĚny vhodnĚ doplŁují harmonický ráz celé stavby. Architects in Italy can also give attractive form to ordinary buildings, such as the hydroelectric power station in South Tyrol. The organic shape of the concrete roof covered with a layer of earth perfectly harmonises with the surrounding sloping terrain into which the building is embedded. The wooden slats used on the exterior walls suitably complement the harmonious atmosphere of the whole building. ǎ ǔǾǬǷǴǴ ǬǼȁǴǾDZǶǾǺǼȇ ǸǺǯǿǾ ǰǬǮǬǾȈ ǻǼǴǮǷDZǶǬǾDZǷȈǹȇDZ Ǵ ǽǾǴǷȈǹȇDZ ȀǺǼǸȇ ǰǬDzDZ ǺǭȇȃǹȇǸ dzǰǬǹǴȋǸ, ǾǬǶǴǸ ǶǬǶ ǯǴǰǼǺȉǷDZǶǾǼǺǽǾǬǹȂǴȋ Ǯ ǪDzǹǺǸ ǞǴǼǺǷDZ. ǚǼǯǬǹǴȃDZǽǶǴDZ ȀǺǼǸȇ ǭDZǾǺǹǹǺǵ ǶǼȇȄǴ, ǻǺǶǼȇǾǺǵ ǽǷǺDZǸ dzDZǸǷǴ, ǻǼDZǶǼǬǽǹǺ ǯǬǼǸǺǹǴǼǿȊǾ ǽ ǺǶǼǿDzǬȊȅǴǸ ǻǺǷǺǯǴǸ ǷǬǹǰȄǬȀǾǺǸ, Ǯ ǶǺǾǺǼȇǵ ǮǻǴǽǬǹǺ dzǰǬǹǴDZ. ǐDZǼDZǮȋǹǹȇDZ ǻǷǬǹǶǴ, ǴǽǻǺǷȈdzǺǮǬǹǹȇDZ ǹǬ ǹǬǼǿDzǹȇȁ ǽǾDZǹǬȁ, ǻǼDZǶǼǬǽǹǺ ǰǺǻǺǷǹȋȊǾ ǯǬǼǸǺǹǴȃǹǿȊ ǬǾǸǺǽȀDZǼǿ ǮǽDZǯǺ dzǰǬǹǴȋ. Foto / photos / ȀǺǾǺ: monovolume architecture + design

SCHODIŠTę PRO PSY DOG STAIRS / ǗǑǝǞǙǔǢnj ǐǗǫ ǝǚǍnjǖ Všechny milovníky psŢ urÿitĚ potĚší nápad architektŢ z Vietnamu. Na pŐání majitele, chovatele psŢ, bylo v jeho domĚ realizováno originální dvojité schodištĚ. KromĚ bĚžného schodištĚ zde vznikly mírnĚjší a užší stupnĚ, které jsou urÿeny pouze pro psy, jimž bĚžnĚ vysoké schody dĚlají problémy. Rozdíl v délce mírnĚjšího schodištĚ je nápaditĚ využit pro koutek s televizí. All dog lovers will surely be pleased with the idea of these Vietnamese architects. At the request of the owner, a dog breeder, a unique double staircase was constructed in his house. Next to the normal staircase, a second one was created, with smaller and narrower steps intended only for dogs who normally have a problem with high steps. The difference in the size of the smaller staircase is imaginatively used as a TV corner. ǎǽDZȁ ǷȊǭǴǾDZǷDZǵ ǽǺǭǬǶ, ǹDZǽǺǸǹDZǹǹǺ, ǻǺǼǬǰǿDZǾ ǴǰDZȋ ǬǼȁǴǾDZǶǾǺǼǺǮ Ǵdz ǎȈDZǾǹǬǸǬ. ǛǺ ǻǼǺǽȈǭDZ ǮǷǬǰDZǷȈȂǬ, dzǬǮǺǰȃǴǶǬ ǽǺǭǬǶ, Ǯ DZǯǺ ǰǺǸDZ ǭȇǷǬ ǻǺǽǾǬǮǷDZǹǬ ǺǼǴǯǴǹǬǷȈǹǬȋ ǰǮǺǵǹǬȋ ǷDZǽǾǹǴȂǬ. ǖǼǺǸDZ ǺǭȇȃǹǺǵ ǷDZǽǾǹǴȂȇ ǹǬ ǹDZǵ ǼǬǽǻǺǷǺDzDZǹȇ ǭǺǷDZDZ ǻǺǷǺǯǴDZ Ǵ ǿdzǶǴDZ ǽǾǿǻDZǹǴ, ǶǺǾǺǼȇDZ ǻǼDZǰǹǬdzǹǬȃDZǹȇ ǾǺǷȈǶǺ ǰǷȋ ǽǺǭǬǶ, ǺǭȇȃǹǺ ǴǸDZȊȅǴȁ ǻǼǺǭǷDZǸȇ ǽ ǻǺǰȆDZǸǺǸ ǻǺ ǺǭȇȃǹǺǵ ǮȇǽǺǶǺǵ ǷDZǽǾǹǴȂDZ. ǜǬdzǹǴȂǬ Ǯ ǰǷǴǹDZ ǻǺǷǺǯǺǵ ǷDZǽǾǹǴȂȇ Ǵ ǺǭȇȃǹǺǵ ǾǮǺǼȃDZǽǶǴ ǴǽǻǺǷȈdzǺǮǬǹǬ ǰǷȋ ǿǯǷǬ ǽ ǾDZǷDZǮǴdzǺǼǺǸ. Foto / photos / ȀǺǾǺ: © Hiroyuki Oki, Decon Photo Studio

12


NOVINKY | NEWS | ǙǚǎǚǝǞǔ KONCEPT V HLAVNÍ ROLI CONCEPT IN THE MAIN ROLE / ǖǚǙǢǑǛǢǔǫ ǎ ǏǗnjǎǙǚǕ ǜǚǗǔ þistá forma a kombinace sklenĚných ploch s ÿástmi krytými mosazí – tak by se dalo ve zkratce popsat nové centrum umĚní v Portugalsku. Ve dne pomĚrnĚ monotónní exteriér ožívá bĚhem noci, kdy jsou mosazné panely nasvĚcovány rŢznými barvami a stává se z nich díky tomu pŢsobivé umĚlecké dílo. Interiér stavby je zaŐízen v pŐísnĚ minimalistickém duchu, stĚny vÿetnĚ stropŢ jsou bílé, bez zbyteÿných detailŢ, jedinou dekoraci tvoŐí linie osvĚtlení. Díky tomu vznikl ÿistý prostor, který vytváŐí dokonalé prostŐedí pro výstavy. Pure form and a combination of glass surfaces partly covered in brass – thus we could brieÁy describe the new Art Centre in Portugal. The rather monotonous exterior in daylight comes alive at night, when the brass panels are illuminated with different colours, thus becoming an impressive work of art. The interior of the building is decorated in a strictly minimalist spirit, the walls and ceilings are white, without any unnecessary details, the only decoration being a line of lighting. Thanks to this, a pure space was created which makes the perfect environment for exhibitions.

ǣǴǽǾǬȋ ȀǺǼǸǬ Ǵ ǶǺǸǭǴǹǬȂǴȋ ǽǾDZǶǷȋǹǹȇȁ ǻǺǮDZǼȁǹǺǽǾDZǵ ǽ ȃǬǽǾȋǸǴ, ǻǺǶǼȇǾȇǸǴ ǷǬǾǿǹȈȊ – ǾǬǶ ǸǺDzǹǺ ǶǼǬǾǶǺ ǺǻǴǽǬǾȈ ǹǺǮȇǵ ǢDZǹǾǼ ǴǽǶǿǽǽǾǮǬ Ǯ ǛǺǼǾǿǯǬǷǴǴ. ǐǹDZǸ ǰǺǮǺǷȈǹǺ ǺǰǹǺǺǭǼǬdzǹȇǵ ȉǶǽǾDZǼȈDZǼ dzǰǬǹǴȋ ǹDZǺǭȇȃǬǵǹǺ ǺDzǴǮǬDZǾ ǹǺȃȈȊ, ǶǺǯǰǬ ǷǬǾǿǹǹȇDZ ǻǬǹDZǷǴ ǻǺǰǽǮDZȃǴǮǬȊǾǽȋ ǼǬdzǹȇǸǴ ȂǮDZǾǬǸǴ Ǵ ǭǷǬǯǺǰǬǼȋ ȉǾǺǸǿ ǻǼDZǮǼǬȅǬȊǾǽȋ ǮǺ ǮǻDZȃǬǾǷȋȊȅDZDZ ǻǼǺǴdzǮDZǰDZǹǴDZ ǴǽǶǿǽǽǾǮǬ. ǔǹǾDZǼȈDZǼ dzǰǬǹǴȋ ǺȀǺǼǸǷDZǹ Ǯ ǽǾǼǺǯǺǸ ǸǴǹǴǸǬǷǴǽǾǴȃDZǽǶǺǸ ǽǾǴǷDZ, ǽǾDZǹȇ Ǵ ǻǺǾǺǷǶǴ ǭDZǷȇDZ, ǭDZdz ǷǴȄǹǴȁ ǰDZǾǬǷDZǵ, DZǰǴǹǽǾǮDZǹǹȇǸ ǿǶǼǬȄDZǹǴDZǸ ȋǮǷȋDZǾǽȋ ǷǴǹǴȋ ǺǽǮDZȅDZǹǴȋ. ǍǷǬǯǺǰǬǼȋ ȉǾǺǸǿ ǮǺdzǹǴǶǬDZǾ ȃǴǽǾǺDZ ǻǼǺǽǾǼǬǹǽǾǮǺ, ǶǺǾǺǼǺDZ ǽǺdzǰǬDZǾ ǴǰDZǬǷȈǹǿȊ ǽǼDZǰǿ ǰǷȋ ǮȇǽǾǬǮǺǶ. Foto / photos / ȀǺǾǺ: © Jose Campos, archdaily.com

14


NOVINKY | NEWS | ǙǚǎǚǝǞǔ

LIKE WATER FOR BLACK CHOCOLATE | VÝSTAVA KLÁRY VYSTRþILOVÉ LIKE WATER FOR BLACK CHOCOLATE THE EXHIBITION BY KLÁRA VYSTRþILOVÁ LIKE WATER FOR BLACK CHOCOLATE | ǎǧǝǞnjǎǖnj ǖǗnjǜǧ ǎǧǝǞǜǣǔǗǚǎǚǕ

Klára Vystrÿilová patŐí k nastupující generaci mladých umĚlcŢ vyrŢstajících z podhoubí Akademie výtvarného umĚní v Praze pod vedením doc. Vladimíra Skrepla a JiŐího Kovandy. Její pojetí svĚta se nekonzervuje do jediné formy, nýbrž se proplétá napŐíÿ rŢznými technikami od malby pŐes design a objekt až ke klasickému Őemeslu. Její práce je silná a energická, využívající inovativních technik a nezvyklých materiálŢ. PŐekraÿuje tak hranice malby a pouští se do prostoru, který vede dál. NĚkam za zrcadlo malby. Koncepce výstavy je zamĚŐena na díla, jež vznikala pŐi pobytu v Austrálii. Jedná se o obrazy vytváŐené speciální technikou, kdy autorka jednotlivé linie obrazu vyšívá bavlnou a vznikají tak šrafované plochy, které jsou v závĚru potŐeny tenkou monochromní vrstvou barvy. Autorka tak vytváŐí hornaté krajiny na pomezí snu a skuteÿnosti a nekoneÿnosti v prostoru. Na výstavĚ jsou uvedeny i obrazy, jejichž Ànální úpravou není tenká vrstva barvy, ale plátování zlatem. Projektuje se zde fascinace interiéry vesnických kostelŢ v místĚ jejího rodištĚ. Výstava se neorientuje pouze na tyto obrazy, ale probĚhne také opening nové znaÿky, kterou Klára chrání jak své obrazy, tak odĚvy z její dílny. Tyto odĚvy, vystaveny volnĚ v prostoru, autorka nepovažuje pouze za nĚmé kusy obleÿení, ale za svébytná umĚlecká díla, která by mĚla být vnímána na pomezí odĚvu a objektu. Jedná se o ruÿnĚ šité originály z kŢže, jež jsou prošity kŐišŘálovými korálky a bavlnou, která je užita již na obrazech. Tyto kožené objekty pŐedstavují svým zdobením inspirovaným liturgickými pŐedmĚty a barokní érou jakési klenoty výstavy, pŐiÿemž jsou doplnĚny o unisexové bílé šaty, inspirované knĚžskými rouchy. Klára Burianová Termín výstavy Kláry Vystrÿilové v Őíÿanské galerii Kotelna je 25. 10.–27. 11. 2012 a na celý prosinec je pŐipraven velký vánoÿní trh s umĚním. Klára Vystrÿilová ranks among the rising generation of young artists arising from the mycelium of the Academy of Fine Arts in Prague under the management of Dr. Vladimír Skrepl and Dr. JiŐí Kovanda. Her concept of the world is not reserved to only one form, but is intertwined throughout various techniques from painting over designs and objects to classical craft. Her work is strong and energetic, using innovative techniques and unusual materials. In this way, she oversteps the boundaries of painting and releases herself into a space that is continuous. Somewhere behind the mirror of painting. The concept of the exhibition focuses on works that were crafted during her stay in Australia. These paintings were created by a special technique, when the artist embroiders the individual lines of the painting in cotton, so that the shaded areas rise up and are then Ànally covered with a thin layer of monochrome colour. In this way, the artist creates hilly landscapes bordering somewhere between dream and reality and the inÀnity of space. The exhibition also shows those works which do not have the Ànal modiÀcation of a thin layer of colour, but gold plating instead. The artist’s fascination with the interiors of the rural churches in her birthplace is projected in these latter paintings. The exhibition is focused on these works, as well as on the launch of a new brand of clothing by which Klára protects her paintings as well as her clothes

16

design in her workshop. The artist does not consider these clothes, exhibited freely in the space of the gallery, as merely inanimate items of clothing, but as peculiar works of art which should be perceived on the border between clothes and objects. They are handmade originals, sewn from leather, stitched with the crystal beads and cotton which are also used in the paintings. These leather objects represent a type of jewellery in the exhibition. Their decoration is inspired by liturgical items and the Baroque era, and they are complemented by a unisex white dress, inspired by clerical vestments. Klára Burianová The Exhibition by Klára Vystrÿilová in the Kotelna Gallery in ŏíÿany will be open from 25th October–27th November, 2012. A large Christmas market with art is being prepared for the whole of December. ǖǷǬǼǬ ǎȇǽǾǼȃǴǷǺǮǬ ǺǾǹǺǽǴǾǽȋ Ƕ ǻǼǴȁǺǰȋȅDZǸǿ ǻǺǶǺǷDZǹǴȊ ǸǺǷǺǰȇȁ ȁǿǰǺDzǹǴǶǺǮ, ǮȇǼǬǽǾǬȊȅǴȁ Ǵdz ǴǽǶǺǹǹǺǵ ǺǭǴǾDZǷǴ - njǶǬǰDZǸǴǴ Ǵdzȋȅǹȇȁ ǴǽǶǿǽǽǾǮ Ǯ ǛǼǬǯDZ ǻǺǰ ǼǿǶǺǮǺǰǽǾǮǺǸ ǻǼǺȀ. ǎǷǬǰǴǸǴǼǬ ǝǶǼDZǻǷǬ Ǵ ǕǴǼDzǴ ǖǺǮǬǹǰȇ. ǑDZ ǮǴǰDZǹǴDZ ǸǴǼǬ ǹDZ dzǬǶǺǹǽDZǼǮǴǼǺǮǬǹǺ Ǯ DZǰǴǹǿȊ ȀǺǼǸǿ, ǹǺ ǽǺǾǶǬǹǺ ǽ ǻǺǸǺȅȈȊ ǼǬdzǷǴȃǹȇȁ ǾDZȁǹǴǶ, ǻǼǺȁǺǰȋȅǴȁ ǺǾ DzǴǮǺǻǴǽǴ Ƕ ǰǴdzǬǵǹǿ Ǵ ǺǭȆDZǶǾǬǸ, ǮǻǷǺǾȈ ǰǺ ǶǷǬǽǽǴȃDZǽǶǺǯǺ ǼDZǸDZǽǷǬ. ǑDZ ǼǬǭǺǾȇ ȋǮǷȋDZǾǽȋ ǽǴǷȈǹȇǸǴ Ǵ ȉǹDZǼǯǴȃǹȇǸǴ, ǽ ǴǽǻǺǷȈdzǺǮǬǹǴDZǸ ǴǹǹǺǮǬȂǴǺǹǹȇȁ ǾDZȁǹǺǷǺǯǴǵ Ǵ ǹDZǺǭȇȃǹȇȁ ǸǬǾDZǼǴǬǷǺǮ. ǚǹǬ ǮȇȁǺǰǴǾ dzǬ ǻǼDZǰDZǷȇ DzǴǮǺǻǴǽǴ Ǵ ǻǺǯǼǿDzǬDZǾǽȋ Ǯ ǻǼǺǽǾǼǬǹǽǾǮǺ, ǮDZǰǿȅDZDZ ǰǬǷȈȄDZ. ǖǿǰǬ-ǾǺ Ǯ dzǬdzDZǼǶǬǷȈDZ DzǴǮǺǻǴǽǴ… ǖǺǹȂDZǻȂǴȋ ǮȇǽǾǬǮǶǴ ǻǺǽǮȋȅDZǹǬ ǼǬǭǺǾǬǸ, ǶǺǾǺǼȇDZ ǮǺdzǹǴǶǷǴ ǮǺ ǮǼDZǸȋ ǻǼDZǭȇǮǬǹǴȋ Ǯ njǮǽǾǼǬǷǴǴ. ǩǾǺ ǶǬǼǾǴǹȇ, ǽǺdzǰǬǹǹȇDZ ǽ ǻǺǸǺȅȈȊ ǽǻDZȂǴǬǷȈǹǺǵ ǾDZȁǹǴǶǴ, ǯǰDZ ǺǾǰDZǷȈǹȇDZ ǷǴǹǴǴ ǶǬǼǾǴǹȇ ǬǮǾǺǼ ǮȇȄǴǮǬDZǾ ȁǷǺǻǶǺǸ, ǾǬǶǴǸ ǺǭǼǬdzǺǸ, ǮǺdzǹǴǶǬȊǾ dzǬȄǾǼǴȁǺǮǬǹǹȇDZ ǸDZǽǾǬ, ǶǺǾǺǼȇDZ Ǯ ǶǺǹȂDZ ǻǺǶǼȇǮǬȊǾǽȋ ǾǺǹǶǴǸ ǽǷǺDZǸ ǸǺǹǺȁǼǺǸǹǺǵ ǶǼǬǽǶǴ. ǞǬǶ ǬǮǾǺǼ ǽǺdzǰǬDZǾ ǯǺǼǹȇDZ ǻDZǵdzǬDzǴ ǹǬ ǯǼǬǹǴȂDZ ǸDZDzǰǿ ǸDZȃǾǺǵ Ǵ ǼDZǬǷȈǹǺǽǾȈȊ Ǵ ǭDZǽǶǺǹDZȃǹǺǽǾȈȊ Ǯ ǻǼǺǽǾǼǬǹǽǾǮDZ. ǙǬ ǮȇǽǾǬǮǶDZ ǸǺDzǹǺ ǹǬǵǾǴ Ǵ ǶǬǼǾǴǹȇ, ǺǶǺǹȃǬǾDZǷȈǹǺǵ ǺǾǰDZǷǶǺǵ ǶǺǾǺǼȇȁ ȋǮǷȋDZǾǽȋ ǹDZ ǾǺǹǶǴǵ ǽǷǺǵ ǶǼǬǽǶǴ, Ǭ dzǺǷǺǾǺDZ ǻǺǶǼȇǾǴDZ. ǩǾǺ ǰǬǹȈ ǮǺǽȁǴȅDZǹǴȊ ǴǹǾDZǼȈDZǼǬǸǴ ǽDZǷȈǽǶǴȁ ǶǺǽǾDZǷǺǮ ǹǬ ǼǺǰǴǹDZ ȁǿǰǺDzǹǴȂȇ. ǎȇǽǾǬǮǶǬ ǹDZ ǺǼǴDZǹǾǴǼǺǮǬǹǬ ǴǽǶǷȊȃǴǾDZǷȈǹǺ ǹǬ ȉǾǴ ǶǬǼǾǴǹȇ, ǾǬǶDzDZ Ǯ DZDZ ǼǬǸǶǬȁ ǻǼǺǵǰDZǾ ǺǾǶǼȇǾǴDZ ǹǺǮǺǵ ǸǬǼǶǴ, ǶǺǾǺǼǺǵ ǖǷǬǼǬ ǻǺǸDZȃǬDZǾ ǶǬǶ ǶǬǼǾǴǹȇ, ǾǬǶ Ǵ ǺǰDZDzǰǿ Ǵdz ǽǮǺDZǵ ǸǬǽǾDZǼǽǶǺǵ. ǘǺǰDZǷǴ, ǮȇǽǾǬǮǶǬ ǶǺǾǺǼȇȁ ǻǼǺȁǺǰǴǾ Ǯ ǻǺǸDZȅDZǹǴȋȁ ǯǬǷDZǼDZǴ, ȁǿǰǺDzǹǴȂǬ ǹDZ ǽȃǴǾǬDZǾ ǹDZǸȇǸǴ ǻǼDZǰǸDZǾǬǸǴ ǺǰDZDzǰȇ, Ǭ ǺǭǺdzǹǬȃǬDZǾ Ǵȁ ǶǬǶ ǽǮǺDZǺǭǼǬdzǹȇDZ ǻǼǺǴdzǮDZǰDZǹǴȋ ǴǽǶǿǽǽǾǮǬ, ǶǺǾǺǼȇDZ ǰǺǷDzǹȇ ǼǬǽǽǸǬǾǼǴǮǬǾȈǽȋ ǹǬ ǯǼǬǹǴȂDZ ǺǰDZDzǰȇ Ǵ ǺǭȆDZǶǾǬ. ǩǾǺ ǮǼǿȃǹǿȊ ǽȄǴǾȇDZ ǺǼǴǯǴǹǬǷȈǹȇDZ ǸǺǰDZǷǴ Ǵdz ǶǺDzǴ, ǼǬǽȄǴǾȇDZ ȁǼǿǽǾǬǷȈǹȇǸǴ ǭǿǽǴǹǬǸǴ Ǵ ȁǷǺǻǶǺǸ, ǶǺǾǺǼȇǵ ǾǬǶDzDZ ǴǽǻǺǷȈdzǿDZǾǽȋ Ǵ ǹǬ DZDZ ǶǬǼǾǴǹǬȁ. ǩǾǴ ǶǺDzǬǹȇDZ ǺǭȆDZǶǾȇ ǽǮǺǴǸ ǰDZǶǺǼǴǼǺǮǬǹǴDZǸ, ǮǰǺȁǹǺǮǷDZǹǹȇǸ ǷǴǾǿǼǯǴȃDZǽǶǴǸǴ ǻǼDZǰǸDZǾǬǸǴ Ǵ ȉǻǺȁǺǵ ǭǬǼǺǶǶǺ, ǻǼDZǰǽǾǬǮǷȋȊǾ ǽǮǺDZǺǭǼǬdzǹȇDZ ǿǶǼǬȄDZǹǴȋ ǮȇǽǾǬǮǶǴ, ǻǼǴȃDZǸ Ǵȁ ǰǺǻǺǷǹȋȊǾ ǭDZǷȇDZ ǿǹǴǽDZǶǽ-ǻǷǬǾȈȋ, ǹǬ ǽǺdzǰǬǹǴDZ ǶǺǾǺǼȇȁ ȁǿǰǺDzǹǴȂǿ ǮǰǺȁǹǺǮǴǷǴ ǺǭǷǬȃDZǹǴȋ ǽǮȋȅDZǹǹǴǶǺǮ. ǖǷǬǼǬ ǍǿǼǴǬǹǺǮǬ. ǎǼDZǸȋ ǻǼǺǮDZǰDZǹǴȋ ǮȇǽǾǬǮǶǴ Ǯ ǯǬǷDZǼDZDZ «Kotelna» Ǯ ǜDzǴȃǬǹǬȁ: 25.10.–27.11.2012, ǮDZǽȈ ǰDZǶǬǭǼȈ ǸDZǽȋȂ ǭǿǰDZǾ ǺǾǶǼȇǾǬ ǭǺǷȈȄǬȋ ǼǺDzǰDZǽǾǮDZǹǽǶǬȋ ȋǼǸǬǼǶǬ ǻǼDZǰǸDZǾǺǮ ǴǽǶǿǽǽǾǮǬ. Galerie Kotelna, Plynární 1, 251 01 ŏíÿany, www.galeriekotelna.cz


LUXURIA 180x200, BJX J JX

5.983,mČsíþnČ pĜi zaplacení ní akontace akon kontac tac ce 30% 30% 0% po dobu splácení 24 mČsícĤ 0% navýšení katalogová cena: 204.880,-


NOVINKY | NEWS | ǙǚǎǚǝǞǔ NANOVO PRÁVę OTEVŏELI NANOVO HAS JUST OPENED NANOVO ǚǞǖǜǧǗǔǝǨ ǝǙǚǎnj Jak už napovídá i samotný název, Nanovo se zamĚŐuje na vyhledávání a renovaci kvalitního designu z 60., 70. a 80. let a navštívit ho mŢžete na adrese www.nanovoshop.cz. Na jeho virtuálních pultech najdete pŐevážnĚ tradiÿní ÿeskoslovenský design od uznávaných návrháŐŢ, ale pravidelnĚ se zde objevuje také nĚkolik kouskŢ ze zahraniÿí. SouÿasnĚ svým zákazníkŢm nabízí pŐedmĚty bĚžného užívání, na které si pamatuje témĚŐ každý. As the name already suggests, Nanovo aims to Ànd and renovate quality design from the 60s, 70s and 80s. You can visit it at the address: www.nanovoshop.cz. On its virtual shelves you will Ànd primarily Czechoslovakian design by renowned designers. In addition some pieces from abroad also regularly show up here. At the same time, the shop offers customers objects in common use that almost everybody can recall. ǖǬǶ ǽǷDZǰǿDZǾ Ǵdz ǽǬǸǺǯǺ ǹǬdzǮǬǹǴȋ, ǶǺǸǻǬǹǴȋ Nanovo ǰDZǷǬDZǾ ǬǶȂDZǹǾ ǹǬ ǻǺǴǽǶDZ Ǵ ǼDZǹǺǮǬȂǴǴ ǶǬȃDZǽǾǮDZǹǹȇȁ ǻǼDZǰǸDZǾǺǮ ǰǴdzǬǵǹǬ 60 ȁ, 70 ȁ Ǵ 80 ȁ ǷDZǾ, Ǯ ȃDZǸ Ǯȇ ǽǬǸǴ ǸǺDzDZǾDZ ǿǭDZǰǴǾȈǽȋ ǻǺǽDZǾǴǮ ǽǬǵǾ ȀǴǼǸȇ www. nanovoshop.cz. ǙǬ ǮǴǼǾǿǬǷȈǹȇȁ ǻǺǷǶǬȁ ǶǺǸǻǬǹǴǴ Ǯȇ ǺdzǹǬǶǺǸǴǾDZǽȈ Ǯ ǺǽǹǺǮǹǺǸ ǽ ǾǼǬǰǴȂǴǺǹǹȇǸ ȃDZȁǺǽǷǺǮǬȂǶǴǸ ǰǴdzǬǵǹǺǸ ǺǾ ǿDzDZ ǴdzǮDZǽǾǹȇȁ ǰǴdzǬǵǹDZǼǺǮ, Ǭ ǾǬǶDzDZ ǾǬǸ ǼDZǯǿǷȋǼǹǺ ǻǺȋǮǷȋȊǾǽȋ ǽǾǴǷȈǹȇDZ ǻǼDZǰǸDZǾȇ Ǵdz-dzǬ ǼǿǭDZDzǬ. ǎ ǹǬǽǾǺȋȅDZDZ ǮǼDZǸȋ Nanovo ǻǼDZǰǷǬǯǬDZǾ ǽǮǺǴǸ ǶǷǴDZǹǾǬǸ ǮDZȅǴ ǰǷȋ ǭȇǾǺǮǺǯǺ ǴǽǻǺǷȈdzǺǮǬǹǴȋ, ǶǺǾǺǼȇDZ ǸǺDzDZǾ ǮǽǻǺǸǹǴǾȈ ǻǼǬǶǾǴȃDZǽǶǴ ǶǬDzǰȇǵ, ǶǾǺ ǴǸǴ ǻǺǷȈdzǺǮǬǷǽȋ Ǯ ǻǼǺȄǷǺǸ. nanovoshop.cz

VILLEROY ET BOCH – AMAZONIA

Tato jedineÿná Őada nádobí od Villeroy & Boch z kvalitního kostního porcelánu pŐemĚní váš domov na exotický tropický ráj. PŐedlohou pro tento výjimeÿný design se staly historické kresby od botanika Alexandra von Humboldta. DopŐejte si s touto pozoruhodnou kolekcí její nádherné barvy, buď jako kompletní servis nebo jako exkluzivní sbĚratelské kousky, které jsou dokonalými dárky. This unique tableware range from Villeroy & Boch in Premium Bone Porcelain transforms your home into an exotic tropical paradise. Historical drawings by the botanist Alexander von Humboldt form the template for this exceptional design. Set delightful colour accents with this remarkable collection, as a complete service or as exclusive collector´s pieces that are perfect for gifts. ǩǾǬ ǿǹǴǶǬǷȈǹǬȋ ǷǴǹǴȋ ǻǺǽǿǰȇ ǺǾ Villeroy & Boch, ǴdzǯǺǾǺǮǷDZǹǹǬȋ Ǵdz ǽǬǸǺǯǺ ǮȇǽǺǶǺǶǬȃDZǽǾǮDZǹǹǺǯǺ ȀǬǼȀǺǼǬ, ǻǼDZǮǼǬǾǴǾ ǮǬȄ ǰǺǸ Ǯ ȉǶdzǺǾǴȃDZǽǶǴǵ ǾǼǺǻǴȃDZǽǶǴǵ ǼǬǵ. ǘǺǰDZǷȈȊ ǰǷȋ DZDZ ǿǹǴǶǬǷȈǹǺǯǺ ǰǴdzǬǵǹǬ ǽǾǬǷǴ ǴǽǾǺǼǴȃDZǽǶǴDZ ǼǴǽǿǹǶǴ ǭǺǾǬǹǴǶǬ njǷDZǶǽǬǹǰǼǬ ȀǺǹ ǏǿǸǭǺǷȈǰǾǬ. ǛǺǰǬǼǴǾDZ ǽDZǭDZ ȉǾǿ dzǬǸDZȃǬǾDZǷȈǹǿȊ ǶǺǷǷDZǶȂǴȊ ǮǺǽȁǴǾǴǾDZǷȈǹȇȁ ȂǮDZǾǺǮ, ǶǬǶ ǻǺǷǹȇǵ ǽDZǼǮǴdz ǴǷǴ ǶǬǶ ȉǶǽǶǷȊdzǴǮǹȇDZ ǶǺǷǷDZǶȂǴǺǹǹȇDZ ǺǾǰDZǷȈǹȇDZ ǻǼDZǰǸDZǾȇ ǻǺǽǿǰȇ, ǶǺǾǺǼȇDZ ǾǬǶDzDZ ǴǰDZǬǷȈǹǺ ǻǺǰȁǺǰȋǾ ǰǷȋ ǻǺǰǬǼǶǺǮ ǰǼǿdzȈȋǸ Ǵ ǭǷǴdzǶǴǸ. RANNÝ RETAIL SHOP: Národní 37 (Platýz), Praha 1, tel: 224 235 165 RANNÝ ARCHITECTS KANCELÁŏ: Václavkova 1, Praha 6, tel: 604 730 338 www.ranny.cz

18


NOVINKY | NEWS | ǙǚǎǚǝǞǔ PERLEŗOVÉ 3D WALLPAPER – BUBBLES! NACRE 3D WALLPAPER – BUBBLES! ǛǑǜǗnjǘǟǞǜǚǎǧǑ 3D ǚǍǚǔ – BUBBLES! S novou kolekcí 3D tapet pŐicházíme i s novou variantou povrchŢ - ÿernou glazurou a perletí. ObĚ pŢsobí v instalaci snovĚ a neuvĚŐitelnĚ. PerleŘové BUBBLES a oceánské škeble ABALONY v sobĚ nesou dvojitou kŐehkost materiálu i barev. Odstíny rŢžových, modrých a šedých tónŢ posunují tyto tvary tematicky dál, do prostŐedí snu, fantazie, vzpomínek a bezÿasí. Bubliny se vyrábí v setu 7 kusŢ, cena za set od 4 500 Kÿ. We are launching a new variety of surfaces with our new collection of 3D wallpapers – black glaze and nacre. These both impress dreamily and unbelievably in any interior. Nacre BUBBLES and ABALONY sea shells bear within themselves a double fragility – that of material and colour. Shades of pink, blue and grey transport these shapes thematically further, into the environment of dream, fantasy, memory and timelessness! BUBBLES is manufactured in a 7-piece series. The price is 4,500 CZK per set. ǝ ǹǺǮǺǵ ǶǺǷǷDZǶȂǴDZǵ 3D ǺǭǺDZǮ Ǹȇ ǻǼDZǰǷǬǯǬDZǸ ǮǬǸ Ǵ ǹǺǮȇDZ ǮǬǼǴǬǹǾȇ ǻǺǮDZǼȁǹǺǽǾDZǵ – ȃDZǼǹǿȊ ȉǸǬǷȈ Ǵ ǻDZǼǷǬǸǿǾǼ. ǚǭǬ ǮǬǼǴǬǹǾǬ ǽǸǺǾǼȋǾǽȋ ǸDZȃǾǬǾDZǷȈǹǺ Ǵ ǶǼǬǵǹDZ ǹDZǮDZǼǺȋǾǹǺ. ǛDZǼǷǬǸǿǾǼǺǮȇDZ BUBBLES (ǻǿdzȇǼǴ) Ǵ ǺǶDZǬǹǴȃDZǽǶǴDZ ǼǬǶǺǮǴǹȇ ABALONY ǹDZǽǿǾ Ǯ ǽDZǭDZ ǰǮǺǵǹǿȊ ȁǼǿǻǶǺǽǾȈ – ǶǬǶ ǸǬǾDZǼǴǬǷǬ, ǾǬǶ Ǵ ȂǮDZǾǺǮ. ǚǾǾDZǹǶǴ ǼǺdzǺǮǺǯǺ, ǯǺǷǿǭǺǯǺ Ǵ ǽDZǼǺǯǺ ǾǺǹǺǮ ǿǮǺǰȋǾ ȉǾǴ ȀǺǼǸȇ ǾDZǸǬǾǴȃDZǽǶǴ ǰǬǷȈȄDZ – Ǯ ǬǾǸǺǽȀDZǼǿ ǽǹǺǮ, ǸDZȃǾȇ Ǵ ȀǬǹǾǬdzǴǴ, Ǭ ǾǬǶDzDZ ǮǺǽǻǺǸǴǹǬǹǴǵ Ǵ ǮDZȃǹǺǽǾǴ! «ǛǿdzȇǼǴ» ǴdzǯǺǾǬǮǷǴǮǬȊǾǽȋ ǶǺǸǻǷDZǶǾǺǸ Ǵdz 7 ȄǾǿǶ, ȂDZǹǬ dzǬ ǶǺǸǻǷDZǶǾ ǺǾ 4500 ǶǼǺǹ. STUDIO PIRSC PORCELAIN Dílna: NámĚstí 9, Mikulov 692 01 Vzorkovna studia : Kavárna a galerie BÜRO, Kostelní nám. 9, Mikulov www.pirsc.cz

UMęLECKÁ GALERIE MOSER MOSER ART GALLERY / ǏnjǗǑǜǑǫ ǔǝǖǟǝǝǞǎnj ǘǚǓǑǜ Moser je Őazen k nejstarším manufakturám v EvropĚ, jejichž vĚhlas je založen na vysoké umĚleckoŐemeslné úrovni zpracování, originálním designu a mimoŐádné kvalitĚ výrobkŢ. Díky tvŢrÿí spolupráci pŐedních návrháŐŢ se skláŐskými mistry Moseru vzniká dodnes Őada unikátŢ oceŁovaných v celosvĚtovém mĚŐítku. Tuto již tradiÿní spolupráci se skláŐskými výtvarníky sklárna rozšiŐuje otevŐením nové UmĚlecké galerie v Praze 1 na StaromĚstském nám. 15, ve sklepním sále prodejní galerie Moser. Galerie nabízí prostor pro výstavy umĚleckých dĚl, prezentace, workshopy a další formy umĚlecké diskuse. Prvním vystavujícím umĚlcem je legenda skláŐství, pan René Roubíÿek. Výstava pod názvem „Sklo je jako jazz“ bude probíhat od 9. Őíjna do 27. prosince 2012. Moser is considered to be one of the oldest manufactures in Europe, the fame of which is based on a high level of art and craft in the elaboration, original design and exceptional quality of its products. Thanks to the creative collaboration of top designers with glass masters in Moser, many unique items are still being created which are appreciated on a global scale. The glass factory is expanding this traditional collaboration with glass artists by the opening of a new art gallery in Prague 1, at 15 Old Town Square in the basement hall of the Moser Sales Gallery. The Gallery offers space for exhibitions of objects of art, presentations, workshops and other forms of artistic discussion. The Àrst exhibiting artist is the legend of the glass industry, Mr. René Roubíÿek. The exhibition entitled “Glass is like Jazz” will run from 9th October to 27th December 2012. «ǘǺdzDZǼ» ǽȃǴǾǬDZǾǽȋ ǺǰǹǺǵ Ǵdz ǽǾǬǼDZǵȄǴȁ ǸǬǹǿȀǬǶǾǿǼ Ǯ ǑǮǼǺǻDZ, ȃȈȋ ǼDZǻǿǾǬȂǴȋ ǺǽǹǺǮǬǹǬ ǹǬ ǮȇǽǺǶǺǸ ȁǿǰǺDzDZǽǾǮDZǹǹǺǸ Ǵ ǼDZǸDZǽǷDZǹǹǺǸ ǿǼǺǮǹDZ ǺǭǼǬǭǺǾǶǴ, ǺǼǴǯǴǹǬǷȈǹǺǸ ǰǴdzǬǵǹDZ Ǵ ǴǽǶǷȊȃǴǾDZǷȈǹǺǸ ǶǬȃDZǽǾǮDZ ǻǼǺǰǿǶȂǴǴ. ǍǷǬǯǺǰǬǼȋ ǾǮǺǼȃDZǽǶǺǸǿ ǽǺǾǼǿǰǹǴȃDZǽǾǮǿ ǮDZǰǿȅǴȁ ǰǴdzǬǵǹDZǼǺǮ ǽǺ «ǽǾDZǶǺǷȈǹȇȁ ǰDZǷ ǸǬǽǾDZǼǬǸǴ» ǶǺǸǻǬǹǴǴ «ǘǺdzDZǼ» Ǵ ǻǺ ǽDZǵ ǰDZǹȈ ȀǴǼǸǬ ǽǺdzǰǬDZǾ ǸǹǺDzDZǽǾǮǺ ǿǹǴǶǬǷȈǹȇȁ ǻǼǺǴdzǮDZǰDZǹǴǵ, ǮȇǽǺǶǺ ǺȂDZǹǴǮǬDZǸȇȁ Ǯ ǺǭȅDZǸǴǼǺǮǺǸ ǸǬǽȄǾǬǭDZ. ǩǾǺ ǾǼǬǰǴȂǴǺǹǹǺDZ ǽǺǾǼǿǰǹǴȃDZǽǾǮǺ ǽ ǸǬǽǾDZǼǬǸǴ ǻǺ ǽǾDZǶǺǷȈǹȇǸ ǼǬǭǺǾǬǸ ǮȇǷǴǷǺǽȈ Ǯ ǺǾǶǼȇǾǴDZ ǹǺǮǺǵ ȁǿǰǺDzDZǽǾǮDZǹǹǺǵ ǯǬǷDZǼDZǴ Ǯ ǛǼǬǯDZ 1 ǹǬ ǝǾǬǼǺǸDZǽǾǽǶǺǵ ǻǷǺȅǬǰǴ, ǰǺǸ 15, Ǯ ǻǺǰǮǬǷȈǹǺǸ dzǬǷDZ ǯǬǷDZǼDZǴ ǻǼǺǰǬDz «ǘǺdzDZǼ». ǖǼǺǸDZ ǾǺǯǺ, ǯǬǷDZǼDZȋ ǻǼDZǰǷǬǯǬDZǾ ǻǼǺǽǾǼǬǹǽǾǮǺ ǰǷȋ ȁǿǰǺDzDZǽǾǮDZǹǹȇȁ ǮȇǽǾǬǮǺǶ, ǻǼDZdzDZǹǾǬȂǴǵ, ǽDZǸǴǹǬǼǺǮ Ǵ ǰǼǿǯǴȁ ȀǺǼǸ ȁǿǰǺDzDZǽǾǮDZǹǹȇȁ ǰǴǽǶǿǽǽǴǵ. ǛDZǼǮȇǸ ȁǿǰǺDzǹǴǶǺǸ, ǮȇǽǾǬǮǶǬ ǶǺǾǺǼǺǯǺ ǻǼǺȁǺǰǴǾ Ǯ ǏǬǷDZǼDZDZ, ȋǮǷȋDZǾǽȋ ǷDZǯDZǹǰǬ ǽǾDZǶǺǷȈǹǺǵ ǻǼǺǸȇȄǷDZǹǹǺǽǾǴ, ǻǬǹ ǜDZǹDZ ǜǺǿǭǴȃDZǶ. ǎȇǽǾǬǮǶǬ ǻǺǰ ǹǬdzǮǬǹǴDZǸ „ǝǾDZǶǷǺ, ǶǬǶ ǰDzǬdz“ ǭǿǰDZǾ ǻǼǺȁǺǰǴǾȈ ǽ 9 ǺǶǾȋǭǼȋ ǻǺ 27 ǰDZǶǬǭǼȋ 2012 ǯǺǰǬ. 20


RANNÝ ARCHITECTS RANNÝ ARCHITECTS KANCELÁŘ: Václavkova 1, Praha 6, tel: 604 730 338, www.ranny.cz; www.rap.cz RANNÝ RETAIL SHOP: Národní 37 (Platýz), Praha 1, tel: 224 235 165

architektura | interior design | interiéry na klíč | vlastní prodej


NOVINKY | NEWS | ǙǚǎǚǝǞǔ PRO VŠECHNY, KDO CHTęJÍ OBLÉKNOUT INTERIÉR DO ZELENę FOR ALL WHO WANT TO CLOTHE THEIR INTERIORS WITH GREENERY ǐǗǫ ǎǝǑǡ, ǖǞǚ ǡǚǣǑǞ ǚǐǑǞǨ ǝǎǚǕ ǔǙǞǑǜǨǑǜ ǎǚ ǣǞǚ-Ǟǚ ǓǑǗǑǙǚǑ MOSStile® je první vertikální zahrada s nulovou údržbou. Tento „mech“, správnĚ lišejník, známý také pod názvem REINDEER MOSS (reindeer je anglicky sob, tedy volnĚ pŐeloženo sobí mech), v pŐírodĚ roste v oblasti tundry. MOSStile® je obklad z pŐírodního mechu, který se používá k obkládání interiérŢ, kde musí být garantována míra vlhkosti okolního prostŐedí minimálnĚ 50 %. Nevyžaduje zavlažování ani hnojení, nemusí být zastŐihován a mŢže být umístĚn v místnostech bez pŐírodního svĚtla. Je k dispozici ve 12 pŐírodních barvách na modulech 29,8 x 29,8 cm. MOSStile® is the Àrst vertical garden with zero maintenance. This “moss” is correctly known as LICHEN, and also as the REINDEER MOSS, which grows naturally in the tundra. MOSStile® is a wall tile of natural moss which is used to line interiors where the moisture content of the surroundings is guaranteed to be at least 50%. It does not need irrigation or fertilisation, it does not have to be trimmed and it can be installed in rooms without natural light. It is available in 12 natural colours in modules of 29.8 x 29.8 cm. MOSStile® ȉǾǺ ǻDZǼǮȇǵ ǮDZǼǾǴǶǬǷȈǹȇǵ ǽǬǰ, dzǬ ǶǺǾǺǼȇǸ ǹDZ ǹǬǰǺ ǿȁǬDzǴǮǬǾȈ. ǩǾǺǾ „ǸǺȁ“, ǮDZǼǹDZDZ ǗǔǤnjǕǙǔǖ, ǾǬǶDzDZ ǴdzǮDZǽǾǹȇǵ ǶǬǶ REINDEER MOSS (reindeer – ǻǺ-ǬǹǯǷǴǵǽǶǴ ǺǷDZǹȈ, Ǯ ǮǺǷȈǹǺǸ ǻDZǼDZǮǺǰDZ ǺǷDZǹǴǵ ǸǺȁ), Ǯ ǻǼǴǼǺǰDZ Ǻǹ ǻǼǺǴdzǼǬǽǾǬDZǾ Ǯ ǾǿǹǰǼDZ. MOSStile® - ȉǾǺ ǻǬǹDZǷǴ Ǵdz ǹǬǾǿǼǬǷȈǹǺǯǺ ǸȁǬ, ǶǺǾǺǼȇDZ ǴǽǻǺǷȈdzǿȊǾǽȋ ǰǷȋ ǺǭǷǴȂǺǮǶǴ ǴǹǾDZǼȈDZǼǬ, Ǯ ǶǺǾǺǼǺǸ ǯǬǼǬǹǾǴǼǺǮǬǹǹǺDZ ǽǺǰDZǼDzǬǹǴDZ ǮǷǬǯǴ Ǯ ǺǶǼǿDzǬȊȅDZǵ ǽǼDZǰDZ ǽǺǽǾǬǮǷȋDZǾ ǹDZ ǸDZǹDZDZ 50%. ǛǬǹDZǷǴ MOSStile® ǹDZ ǾǼDZǭǿȊǾ ǹǴ ǻǺǷǴǮǬ, ǹǴ ǿǰǺǭǼDZǹǴǵ, ǸǺȁ ǹDZ ǹǬǰǺ ǽǾǼǴȃȈ, Ǵ Ǻǹ ǸǺDzDZǾ ǭȇǾȈ ǼǬdzǸDZȅDZǹ Ǯ ǻǺǸDZȅDZǹǴȋȁ ǭDZdz DZǽǾDZǽǾǮDZǹǹǺǯǺ ǽǮDZǾǬ. ǎ ǻǼǺǰǬDzDZ 12 DZǽǾDZǽǾǮDZǹǹȇȁ ȂǮDZǾǺǮ ǹǬ ǻǬǹDZǷȋȁ-ǸǺǰǿǷȋȁ 29,8 ȁ 29,8 ǽǸ. www.aquatrade.cz

DOMUSTILE Nemá dlouhou historii, je však bohatá na nápady, jak vytvoŐit designový a funkÿní nábytek. Ten na trh dorazil v nedávné dobĚ, ale již si získal své fanoušky. Nábytek se krásnĚ hodí jak do klasického, tak i moderního interiéru. Nábytek od DOMUSTILE má velkou škálu barev, ale zákazník si podle sebe a své pŐedstavy mŢže požádat o vlastní odstín, který si zvolí dle své pŐedstavy. Nábytek mŢže být pozlacen ÿi postŐíbŐen imitací zlata i stŐíbra, pro vnímavého a exkluzivního zákazníka mŢže být rovnĚž originálnĚ pozlacen ÿi postŐíbŐen podle jeho potŐeb a pŐání. This company does not have a long history but is rich in ideas for creating functional, designer furniture. DOMUSTILEhas come on to the market just recently, but has already gained its fans. The furniture splendidly matches both classic and modern interiors. DOMUSTILE furniture comes in a large range of colours. However, the client, according to his/her own ideas and vision, may request another colour, chosen according to personal conception. The furniture can be gilded or silvered with imitation gold or silver or, for the sensitive, exclusive client, originally gilded and silvered in accordance with the customer‘s needs and wishes. ǹDZ ǴǸDZDZǾ ǭǺǷȈȄǺǵ ǴǽǾǺǼǴǴ, ǹǺ ǭǺǯǬǾǬ ǴǰDZȋǸǴ Ǯ ǽǺdzǰǬǹǴDZ ǴǹǾDZǼDZǽǹǺǵ Ǵ ȀǿǹǶȂǴǺǹǬǷȈǹǺǵ ǸDZǭDZǷǴ, ǛǺȋǮǴǮȄǴǽȈ ǹǬ ǼȇǹǶǴ ǺǾǹǺǽǴǾDZǷȈǹǺ ǹDZǰǬǮǹǺ, Domustile ǿDzDZ ǺǭǼDZǷǬ ǻǺǶǷǺǹǹǴǶǺǮ, ǸDZǭDZǷȈ ǺǾ ȉǾǺǵ ǶǺǸǻǬǹǴǴ ǷǬǶǺǹǴȃǹǬ Ǵ ǷDZǯǶǺ ǮǻǴȄDZǾǽȋ ǶǬǶ Ǯ ǶǷǬǽǽǴȃDZǽǶǴǵ ǾǬǶ Ǵ Ǯ ǽǺǮǼDZǸDZǹǹȇǵ ǴǹǾDZǼȈDZǼ. ǛǬǷǴǾǼǬ ǶǼǬǽǺǶ ǮǻDZȃǬǾǷȋDZǾ, ǶǷǴDZǹǾ ǹDZ ǾǺǷȈǶǺ ǸǺDzDZǾ ǮȇǭǼǬǾȈ Ǵdz ǴǸDZȊȅǴȁǽȋ ȂǮDZǾǺǮ, ǹǺ Ǵ dzǬǶǬdzǬǾȈ ǷȊǭǺǵ ȂǮDZǾ, ǶǺǾǺǼȇǵ DZǸǿ ǭǿǰDZǾ ǹǿDzDZǹ. ǘDZǭDZǷȈ ǺǾ Domustile ǸǺDzDZǾ ǭȇǾȈ ǻǺǶǼȇǾǬ ǶǬǶ ǴǸǴǾǬȂǴDZǵ dzǺǷǺǾǬ Ǵ ǽDZǼDZǭǼǬ, ǾǬǶ Ǵ ǽǿǽǬǷȈǹȇǸ dzǺǷǺǾǺǸ Ǵ ǽDZǼDZǭǼǺǸ ǰǷȋ ǽǬǸȇȁ ǾǼDZǭǺǮǬǾDZǷȈǹȇȁ ǶǷǴDZǹǾǺǮ. SALON NÁBYTKU MARTIN-HOME Korunní 1310/56, 120 00 Praha 2 - Vinohrady www.nabytekcz.com

22


info@aura-statenice.cz tel.: 224 256 211, 725 860 300


NOVINKY | NEWS | ǙǚǎǚǝǞǔ MONDEO PŏEDSTAVUJE LUXUSNÍ VYBAVENÍ PRO VÁŠ INTERIÉR MONDEO INTRODUCES LUXURY FITTINGS FOR YOUR INTERIOR ǖǚǘǛnjǙǔǫ «MONDEO» ǛǜǑǐǝǞnjǎǗǫǑǞ ǜǚǝǖǚǤǙǧǑ njǖǝǑǝǝǟnjǜǧ ǐǗǫ ǎnjǤǑǏǚ ǔǙǞǑǜǨǑǜnj DveŐní i okenní kliky, nábytkové úchyty a koupelnové doplŁky. Veškeré výrobky Mondeo jsou vyrobeny z mosazi, což zaruÿuje jejich vysokou kvalitu a dlouhou životnost. Zákazník si mŢže vybrat z široké palety povrchových úprav: mosaz, mĚď, chrom, ale také unikátní potah 24karátovým zlatem. Krása a originalita doplŁkŢ Mondeo spoÿívá v umĚní kombinovat nejen rŢzné povrchy (lesk, mat) a povrchové úpravy (napŐ. kombinace zlato - chrom), ale také v použití krystalŢ Swarovski, které jsou do výrobkŢ zasazené. VŐele doporuÿujeme. Door handles, window handles, furniture Àttings and bathroom accessories. All Mondeo products are made of brass that ensures their high quality and durability. A customer may choose from the wide range of surface Ànishes: brass, copper, chrome, as well as a unique coating of 24-carat gold. The beauty and originality of Mondeo accessories lies in the art of combining the various surfaces (gloss, matt) and surface modiÀcations (e.g. gold-chrome combination) as well as using Swarowski crystals which are embedded into the products. WE RECOMMEND THESE FITTINGS! ǐǮDZǼǹȇDZ ǼǿȃǶǴ, ǺǶǺǹǹȇDZ ǼǿȃǶǴ, ǸDZǭDZǷȈǹȇDZ ǼǿȃǶǴ Ǵ ǬǶǽDZǽǽǿǬǼȇ ǰǷȋ ǮǬǹǹǺǵ ǶǺǸǹǬǾȇ. ǎǽDZ ǴdzǰDZǷǴȋ Mondeo ǴdzǯǺǾǬǮǷǴǮǬȊǾǽȋ Ǵdz ǷǬǾǿǹǴ, ȃǾǺ ǺǭDZǽǻDZȃǴǮǬDZǾ Ǵȁ ǮȇǽǺǶǺDZ ǶǬȃDZǽǾǮǺ Ǵ ǰǺǷǯǺǮDZȃǹǺǽǾȈ. ǖǷǴDZǹǾȇ ǸǺǯǿǾ ǮȇǭǼǬǾȈ Ǵdz ȄǴǼǺǶǺǯǺ ǽǻDZǶǾǼǬ ǺǼǴǯǴǹǬǷȈǹȇȁ Ǵ ǾǬǶǴȁ ǼǺǽǶǺȄǹȇȁ ǮǬǼǴǬǹǾǺǮ ǺǾǰDZǷǶǴ: ǷǬǾǿǹȈ, ǸDZǰȈ, ȁǼǺǸ, Ǭ ǾǬǶDzDZ ǿǹǴǶǬǷȈǹǺDZ ǻǺǶǼȇǾǴDZ 24-ǶǬǼǬǾǹȇǸ dzǺǷǺǾǺǸ. ǖǼǬǽǺǾǬ Ǵ ǺǼǴǯǴǹǬǷȈǹǺǽǾȈ ǬǶǽDZǽǽǿǬǼǺǮ Mondeo dzǬǶǷȊȃǬDZǾǽȋ ǹDZ ǾǺǷȈǶǺ Ǯ ǴǽǶǿǽǽǾǮDZ ǶǺǸǭǴǹǴǼǺǮǬǹǴȋ ǼǬdzǷǴȃǹȇȁ ǻǺǮDZǼȁǹǺǽǾDZǵ (ǯǷȋǹȂDZǮǬȋ, ǸǬǾǺǮǬȋ) Ǵ ǺǭǼǬǭǺǾǶǴ ǻǺǮDZǼȁǹǺǽǾǴ (ǹǬǻǼǴǸDZǼ, ǽǺȃDZǾǬǹǴDZ dzǺǷǺǾǬ Ǵ ȁǼǺǸǬ), ǹǺ ǾǬǶDzDZ Ǵ Ǯ ǴǽǻǺǷȈdzǺǮǬǹǴǴ ǶǼǴǽǾǬǷǷǺǮ Swarovski, ǶǺǾǺǼȇǸǴ ǸǺDzDZǾ ǻǺȁǮǬǽǾǬǾȈǽȋ ǻǼǺǰǿǶȂǴȋ. ǜǑǖǚǘǑǙǐǟǑǘ! Jana Michaud,info@kliky-mondeo.cz, www.kliky-mondeo.cz, Mobil: +420 777 608 422 www.kliky-mondeo.cz

ZÁMECKÝ NÁBYTEK CHATEAU FURNITURE / ǘǑǍǑǗǨ ǐǗǫ Ǔnjǘǖǚǎ Jsme tím pravým partnerem pro nároÿného individualistu, který cení krásu historického stylu, masivního dŐeva a ruÿní práce. PrávĚ nyní je v trendu nejen klasický styl zaŐízení, ale též kombinace moderního interiérového designu se starožitným nábytkem a stylovými doplŁky. Nenabízíme v kopiích pouze nadÿasové klenoty rŢzných evropských epoch, nýbrž nabízíme tím i možnost zaŐídit si prostŐedí, ve kterém se budete cítit pohodlnĚ, a které bude zároveŁ vizitkou Vašeho dobrého vkusu. We are the ideal partner for the demanding individualist who appreciates the beauty of historical style, solid wood and craftsmanship. At the moment, the trend is not only for the classical style of furnishing, but also a combination of modern interior design with antique furniture and stylish accessories. In addition to imitations of timeless gems from various historical epochs, we also offer the opportunity of creating an environment in which you will feel comfortable and which will also be the showcase of your good taste. ǙǬȄǬ ǶǺǸǻǬǹǴȋ – ǽǬǸȇǵ ǻǺǰȁǺǰȋȅǴǵ ǻǬǼǾǹDZǼ ǰǷȋ ǮdzȇǽǶǬǾDZǷȈǹȇȁ ǴǹǰǴǮǴǰǿǬǷǴǽǾǺǮ, ǶǺǾǺǼȇDZ ȂDZǹȋǾ ǶǼǬǽǺǾǿ ǴǽǾǺǼǴȃDZǽǶǺǯǺ ǽǾǴǷȋ, ǾǮDZǼǰǺǵ ǰǼDZǮDZǽǴǹȇ Ǵ ǼǿȃǹǺǵ ǼǬǭǺǾȇ. ǝDZǵȃǬǽ Ǯ ǸǺǰDZ ǹDZ ǻǼǺǽǾǺ ǶǷǬǽǽǴȃDZǽǶǴǵ ǽǾǴǷȈ Ǯ ǴǹǾDZǼȈDZǼDZ, Ǭ ǶǺǸǭǴǹǬȂǴȋ ǽǺǮǼDZǸDZǹǹǺǯǺ ǰǴdzǬǵǹǬ ǽ ǬǹǾǴǶǮǬǼǹǺǵ ǸDZǭDZǷȈȊ Ǵ ǽǾǴǷȈǹȇǸǴ ǬǶǽDZǽǽǿǬǼǬǸǴ. ǙǬȄǬ ǶǺǸǻǬǹǴȋ ǻǼDZǰǷǬǯǬDZǾ ǹDZ ǾǺǷȈǶǺ ǶǺǻǴǴ ǹDZ ǻǺǰǮǷǬǽǾǹǺǵ ǮǼDZǸDZǹǴ ǰǼǬǯǺȂDZǹǹǺǵ ǸDZǭDZǷǴ ǼǬdzǷǴȃǹȇȁ DZǮǼǺǻDZǵǽǶǴȁ ȉǻǺȁ, ǹǺ Ǵ ǮǺdzǸǺDzǹǺǽǾȈ ǸDZǭǷǴǼǺǮǶǴ Ǵ ǺǼǯǬǹǴdzǬȂǴǴ ǽǮǺDZǵ ǽǺǭǽǾǮDZǹǹǺǵ ǽǼDZǰȇ, Ǯ ǶǺǾǺǼǺǵ Ǯȇ ǭǿǰDZǾDZ ȃǿǮǽǾǮǺǮǬǾȈ ǽDZǭȋ ǶǺǸȀǺǼǾǹǺ, Ǵ ǶǺǾǺǼǬȋ ǾǬǶDzDZ ǽǾǬǹDZǾ ǮǴdzǴǾǶǺǵ ǮǬȄDZǯǺ ȁǺǼǺȄDZǯǺ ǮǶǿǽǬ. ZÁMECKÝ NÁBYTEK 751 22 Osek nad Beÿvou 163, T: +420 581 793 060, M: +420 728 777 926 info@zameckynabytek.cz, www.zameckynabytek.cz 24


MY Y EA A RT H '/$Ì%$ MY EARTH Žít s přírodou a v přírodě Více inspirace: Naskenujte tento QR kód pomocí svÊho smartphonu

WWW.VILLEROY-BOCH.COM

Kreiner

TEL

E MAILMPLASIL KREINERCZ Exklusiv | KLIMENTSKà KREINER EXKLUSIV 36, PRAHA 1 | WWW.KOUPELNY-KREINER.CZ WWWKREINERCZ +LIMENTSK¸ TEL: + 420 224 811 136, E-MAIL: PRAHA1@KREINER.CZ 0RAHA

WWWKOUPELNYPROVASCZ


NOVINKY | NEWS | ǙǚǎǚǝǞǔ DLAŽBA NATURE SIDE OD VILLEROY & BOCH NATURE SIDE FLOOR TILES BY VILLEROY & BOCH ǛǗǔǞǖnj NATURE SIDE ǚǞ Ǡǔǜǘǧ VILLEROY & BOCH Nekomplikovaná, pŐírodní, estetická a se snadnou údržbou. RŢzné formáty slinuté, rektiÀkované dlažby Nature Side vytváŐejí velmi pŢsobivou dlažbu ve stylu parket. þtyŐi barvy - vápencová, béžová, šedohnĚdá a ÿervenohnĚdá - jsou módní pŐírodní tóny, které ladí s nejrŢznĚjšími styly zaŐízení. KromĚ toho je k dispozici pásková mozaika pro realizaci lícujících podlah sprch s protiskluzem R9/bosá noha A. Uncomplicated, natural, aesthetic, with easy maintenance. Various formats of sintered, rectiÀed Nature Side Áoor tiles create very impressive parquet-style tiles. Four colours—limestone, beige, grey-brown and redbrown—are the fashionable natural tones to match most varied styles of Àxtures. In addition, there is a tape mosaic available for jointing shower Áoors at R9/bare foot A slip-resistance standards. ǙǺǮǬȋ ǺǾǰDZǷȈǹǺ ǽǾǺȋȅǬȋ ǺǮǬǷȈǹǬȋ ǮǬǹǹǬ «Prime-Line Free» ǴǰDZǬǷȈǹǺ ǰǺǻǺǷǹȋDZǾ ǸǹǺǯǺǺǭǼǬdzǴDZ ǽDZǼǴǴ ǮǬǹǹ ǻǼǺǴdzǮǺǰǽǾǮǬ ǶǺǸǻǬǹǴǴ Duscholux. ǎǬǹǹǬ, ǽǮǺǭǺǰǹǺ ǼǬǽǻǺǷǺDzDZǹǹǬȋ Ǯ ǻǼǺǽǾǼǬǹǽǾǮDZ, ǻǼDZǮǼǬǾǴǾ Ǯ ǬǼȁǴǾDZǶǾǿǼǹǺ-ǻǼǴǮǷDZǶǬǾDZǷȈǹǿȊ ǷȊǭǿȊ ǮǬǹǹǿȊ ǶǺǸǹǬǾǿ. ǎǬǹǹǬ ǽǰDZǷǬǹǬ Ǵdz ǭDZǷǺǯǺ ǷǴǾǺǯǺ ǽǬǹǾDZȁǹǴȃDZǽǶǺǯǺ ǬǶǼǴǷǬ ǻǺǮȇȄDZǹǹǺǵ ǴdzǹǺǽǺǽǾǺǵǶǺǽǾǴ, ǶǺǸǻǬǶǾǹǺDZ ǽǺDZǰǴǹDZǹǴDZ DZDZ ǽ ǻDZǼDZǰǹDZǵ ǻǬǹDZǷȈȊ ǻǼDZǮǼǬȅǬDZǾ DZDZ Ǯ ǺǾǰDZǷȈǹȇǵ ǺǭȆDZǶǾ ǭDZdz ǮǽȋǶǴȁ ǮǴǰǴǸȇȁ ǽǾȇǶǺǮ. ǓǬǶǼǿǯǷDZǹǹǬȋ ǶǺǼǻǿǽǹǬȋ ǻǬǹDZǷȈ ǺǭDZǽǻDZȃǴǮǬDZǾ ǷDZǯǶǺDZ ǮȁǺDzǰDZǹǴDZ Ǯ ǮǬǹǹǿ, ǶǺǸȀǺǼǾǹȇDZ ǻǺǮDZǼȁǹǺǽǾǴ ǮǹǿǾǼDZǹǹǴȁ ǽǾDZǹǺǶ ǮǬǹǹȇ ǽǻǺǽǺǭǽǾǮǿȊǾ ǻǼǴȋǾǹǺǸǿ ǶǿǻǬǹǴȊ Ǵ ǼDZǷǬǶǽǬȂǴǴ. ǎǬǹǹǬ dzǬǹȋǷǬ ǻDZǼǮǺDZ ǸDZǽǾǺ ǹǬ ǶǺǹǶǿǼǽDZ «Red Dot Design Award 2012»! Kreiner Exklusiv, Klimentská 36, Praha 1 www.koupelny-kreiner.cz

PRIME-LINE FREE Nová oválná volnĚ stojící vana Prime-Line Free ideálnĚ doplŁuje rozmanitost Őady van vyrábĚných spoleÿností Duscholux. VolnĚ prostorová vana uÿiní každou koupelnu architektonicky atraktivní. Vana je vyrobená z jednoho kusu zesílené desky GFK z bílého sanitárního akrylátu, na ÿelní panel je napojená kompaktnĚ a vytváŐí tak solitér bez viditelných spár. Zaoblení obvodového panelu umožŁuje snazší pŐístup do vany, komfortní plochy vnitŐních stĚn vany nabízí pohodlné koupání a relaxaci. Vana získala významné ocenĚní Red Dot Design Award 2012. The Prime-Line Free new oval free-standing bathtub ideally complements the variety of the series of bathtubs manufactured by the Duscholux company. A free-standing bathtub will make every bathroom architecturally attractive. The bathtub is made of one piece of GFK reinforced slab of white sanitary acrylic. It is connected compactly to the front panel, so that it creates a solitaire without visible joints. The rounding of the encircling panel makes getting into the bathtub easier, while the comfortable surfaces of the interior walls offer restful bathing and relaxation. The bathtub won the important 2012 Red Dot Design Award! ǙǺǮǬȋ ǺǾǰDZǷȈǹǺ ǽǾǺȋȅǬȋ ǺǮǬǷȈǹǬȋ ǮǬǹǹǬ «Prime-Line Free» ǴǰDZǬǷȈǹǺ ǰǺǻǺǷǹȋDZǾ ǸǹǺǯǺǺǭǼǬdzǴDZ ǽDZǼǴǴ ǮǬǹǹ ǻǼǺǴdzǮǺǰǽǾǮǬ ǶǺǸǻǬǹǴǴ Duscholux. ǎǬǹǹǬ, ǽǮǺǭǺǰǹǺ ǼǬǽǻǺǷǺDzDZǹǹǬȋ Ǯ ǻǼǺǽǾǼǬǹǽǾǮDZ, ǻǼDZǮǼǬǾǴǾ Ǯ ǬǼȁǴǾDZǶǾǿǼǹǺ-ǻǼǴǮǷDZǶǬǾDZǷȈǹǿȊ ǷȊǭǿȊ ǮǬǹǹǿȊ ǶǺǸǹǬǾǿ. ǎǬǹǹǬ ǽǰDZǷǬǹǬ Ǵdz ǭDZǷǺǯǺ ǷǴǾǺǯǺ ǽǬǹǾDZȁǹǴȃDZǽǶǺǯǺ ǬǶǼǴǷǬ ǻǺǮȇȄDZǹǹǺǵ ǴdzǹǺǽǺǽǾǺǵǶǺǽǾǴ, ǶǺǸǻǬǶǾǹǺDZ ǽǺDZǰǴǹDZǹǴDZ DZDZ ǽ ǻDZǼDZǰǹDZǵ ǻǬǹDZǷȈȊ ǻǼDZǮǼǬȅǬDZǾ DZDZ Ǯ ǺǾǰDZǷȈǹȇǵ ǺǭȆDZǶǾ ǭDZdz ǮǽȋǶǴȁ ǮǴǰǴǸȇȁ ǽǾȇǶǺǮ. ǓǬǶǼǿǯǷDZǹǹǬȋ ǶǺǼǻǿǽǹǬȋ ǻǬǹDZǷȈ ǺǭDZǽǻDZȃǴǮǬDZǾ ǷDZǯǶǺDZ ǮȁǺDzǰDZǹǴDZ Ǯ ǮǬǹǹǿ, ǶǺǸȀǺǼǾǹȇDZ ǻǺǮDZǼȁǹǺǽǾǴ ǮǹǿǾǼDZǹǹǴȁ ǽǾDZǹǺǶ ǮǬǹǹȇ ǽǻǺǽǺǭǽǾǮǿȊǾ ǻǼǴȋǾǹǺǸǿ ǶǿǻǬǹǴȊ Ǵ ǼDZǷǬǶǽǬȂǴǴ. ǎǬǹǹǬ dzǬǹȋǷǬ ǻDZǼǮǺDZ ǸDZǽǾǺ ǹǬ ǶǺǹǶǿǼǽDZ «Red Dot Design Award 2012»! Kreiner Exklusiv, Klimentská 36, Praha 1 www.koupelny-kreiner.cz

26


NOVINKY | NEWS | ǙǚǎǚǝǞǔ

CYBORK / CYBORK / CYBORK Design kŐesílka CYBORK, které pochází z dílny Marcela Wanderse a vyrábí jej italská Àrma Magis, je opravdu originální. Spodní ÿást je vyrobena z neprŢhledného plastu, horní ÿást pak z plastu transparentního stejné barvy jako základna. PoŐídit si jej mŢžete hned v nĚkolika barevných provedeních – ÿervená, ÿerná, bílá. Cena 8.110,- Kÿ vÿ. DPH The design of the CYBORK chair, created by Marcel Wanders and manufactured by the Italian company of Magis, is truly original. The lower part is made of opaque plastic, the upper part of transparent plastic of the same colour as the base. It is available in several colour variants – red, black, white. Price 8110 CZK incl. VAT ǐǴdzǬǵǹDZǼǽǶǺDZ ǶǼDZǽǷǺ CYBORK Ǵdz ǸǬǽǾDZǼǽǶǺǵ ǘǬǼǽDZǷȋ ǎǬǹǰDZǼǽǬ (Marcel Wanders) Ǵ ǻǼǺǴdzǮǺǰǽǾǮǬ ǴǾǬǷȈȋǹǽǶǺǵ ǶǺǸǻǬǹǴǴ Magis ǰDZǵǽǾǮǴǾDZǷȈǹǺ ȋǮǷȋDZǾǽȋ ǺǼǴǯǴǹǬǷǺǸ. ǙǴDzǹȋȋ ȃǬǽǾȈ DZǯǺ ǮȇǻǺǷǹDZǹǬ Ǵdz ǹDZǻǼǺdzǼǬȃǹǺǯǺ ǻǷǬǽǾǴǶǬ, ǮDZǼȁǹȋȋ ȃǬǽǾȈ – ǹǬǺǭǺǼǺǾ, Ǵdz ǻǼǺdzǼǬȃǹǺǵ ǻǷǬǽǾǸǬǽǽȇ, ǹǺ ǾǺǯǺ DzDZ ȂǮDZǾǬ, ȃǾǺ Ǵ ǺǽǹǺǮǬǹǴDZ. ǖ ǿǽǷǿǯǬǸ ǻǺǶǿǻǬǾDZǷDZǵ ǸǺǰDZǷǴ ǼǬdzǹȇȁ ȂǮDZǾǺǮ - ǶǼǬǽǹȇǵ, ȃDZǼǹȇǵ, ǭDZǷȇǵ. ǢDZǹǬ 8110, - CZK ǮǶǷȊȃǬȋ Ǚǐǝ PRODÁVÁ / SELLER / ǛǜǚǐnjǑǞ: 3DH Interiér, s.r.o., Rohanské nábŐ. 7, Praha 8 www.3dh.cz

CARPE DIEM KoneÿnĚ je podzim a je ÿas vymĚnit vaši postel. Již dnes si mŢžete prohlédnout a vyzkoušet exkluzivní postel Vinga od známé švédské znaÿky Carpe Diem. Tato postel je plnĚ elektrická, polohovatelná s masáží a je opravdu jedineÿná. Splní každý požadavek na vaše pohodlí a je urÿena i pro ty nejnároÿnĚjší zákazníky. Povrchová matrace o výšce 9 cm má letní stranu z mĚkké bavlny a zimní stranu z teplé novozélandské vlny. Matrace je vyrobena z pŐírodního latexu, s taštiÿkovitým pružinovým systémem, rám je vyroben z borovicového dŐeva. Díky posteli Vinga bude váš spánek osvĚžujícím a blahodárným zážitkem a váš domov získá jedineÿný designový kus nábytku, který bude jeho klenotem. Finally, it is autumn and time to change your bed. Today already, you can view and try out an exclusive Vinga bed by the renowned Swedish brand of Carpe Diem. This truly distinctive bed is fully electric and adjustable with a massage function. FulÀlling every requirement for comfort, it is intended for those most demanding clients. The 9 cm top mattress has a soft cotton-Àlled summer side and certiÀed New Zealand wool-Àlled winter side. The mattress is made of natural latex, with a padded spring system, the wooden frame is of pine. Thanks to the Vinga bed, your sleep will be a refreshing and beneÀcial experience and your home will be crowned with a distinctive designer item of furniture. ǙǬǶǺǹDZȂ-ǾǺ ǮǽǾǿǻǴǷǬ Ǯ ǽǮǺǴ ǻǼǬǮǬ ǺǽDZǹȈ, Ǭ dzǹǬȃǴǾ, ǹǬǽǾǬǷǬ ǻǺǼǬ ǻǺǸDZǹȋǾȈ ǶǼǺǮǬǾȈ. ǟDzDZ ǽDZǯǺǰǹȋ Ǯȇ ǸǺDzDZǾDZ ǿǮǴǰDZǾȈ Ǵ ǻǺǻǼǺǭǺǮǬǾȈ ȉǶǽǶǷȊdzǴǮǹǿȊ ǶǼǺǮǬǾȈ Vinga ǺǾ ǴdzǮDZǽǾǹǺǯǺ ȄǮDZǰǽǶǺǯǺ ǭǼDZǹǰǬ Carpe Diem. ǩǾǬ ǶǼǺǮǬǾȈ – ǻǺǷǹǺǽǾȈȊ ȉǷDZǶǾǼǴȃDZǽǶǬȋ, ǼDZǯǿǷǴǼǿDZǸǬȋ, Ƕ ǾǺǸǿ DzDZ ǽ ȀǿǹǶȂǴDZǵ ǸǬǽǽǬDzǬ – ȋǮǷȋDZǾǽȋ ǮǺǴǽǾǴǹǿ ǿǹǴǶǬǷȈǹǺǵ. ǚǹǬ ǴǽǻǺǷǹǴǾ ǷȊǭǺDZ ǻǺDzDZǷǬǹǴDZ, ǶǬǽǬȊȅDZDZǽȋ ǮǬȄDZǯǺ ǶǺǸȀǺǼǾǬ, Ǵ ǻǼDZǰǹǬdzǹǬȃDZǹǬ ǰǷȋ ǽǬǸȇȁ ǮdzȇǽǶǬǾDZǷȈǹȇȁ ǶǷǴDZǹǾǺǮ. ǘǬǾǼǬǽ ǮȇǽǺǾǺǵ 9 ǽǸ ǴǸDZDZǾ «ǷDZǾǹȊȊ» ǽǾǺǼǺǹǿ Ǵdz ǸȋǯǶǺǯǺ ȁǷǺǻǶǬ Ǵ «dzǴǸǹȊȊ» ǽǾǺǼǺǹǿ Ǵdz ǾDZǻǷǺǵ ǹǺǮǺdzDZǷǬǹǰǽǶǺǵ ȄDZǼǽǾǴ. ǘǬǾǼǬǽ ǴdzǯǺǾǺǮǷDZǹ Ǵdz ǹǬǾǿǼǬǷȈǹǺǯǺ ǷǬǾDZǶǽǬ, ǽǺ ǽǻDZȂǴǬǷȈǹǺǵ ǻǼǿDzǴǹǹǺǵ ǽǴǽǾDZǸǺǵ, ǼǬǸǬ ǽǰDZǷǬǹǬ Ǵdz ǽǺǽǹǺǮǺǯǺ ǰDZǼDZǮǬ. ǖǼǺǮǬǾȈ Vinga ǽǰDZǷǬDZǾ ǮǬȄ ǽǺǹ ǺǽǮDZDzǬȊȅǴǸ, ǭǷǬǯǺǰǬǾǹȇǸ Ǵ ǽǻǺǶǺǵǹȇǸ, Ǵ ǭǷǬǯǺǰǬǼȋ DZǵ Ǯ ǮǬȄDZǸ ǰǺǸDZ ǻǺȋǮǴǾǽȋ ǿǹǴǶǬǷȈǹȇǵ ǻǼDZǰǸDZǾ ǰǴdzǬǵǹDZǼǽǶǺǵ ǸDZǭDZǷǴ, ǶǺǾǺǼȇǵ ǭǿǰDZǾ DZǯǺ ǹǬǽǾǺȋȅǴǸ ǿǶǼǬȄDZǹǴDZǸ. SHOWROOM : naty naty, Senovážné námĚstí 10a, Praha 1 www.natynaty.cz 28


design by Daniel Piršč

Ceny šéfredaktorů za Designblok 2012 nominace / Editors Awards Designblok 2012 nominee

3D WALLPAPER

WWW.PIRSC.CZ

Studio Pirsc Porcelain Laboratory for Art, Craft and Design

PIRSC PORCELAIN


DEVELOPERSKÉ PROJEKTY | PROPERTY PROJECTS | ǐǑǎǑǗǚǛǑǜǝǖǔǑ ǛǜǚǑǖǞǧ

OÁZA LIBUŠ DOMY CLASSIC

VELKORYSÝ PROSTOR PRO VAŠE BYDLENÍ

DevĚt Őadových domŢ Oáza Libuš Domy Classic již na první pohled zaujme svým vzhledem. Jednotlivé ÿásti domŢ vystupují a ustupují ze základní linie a vytváŐejí tak velice zajímavý ÿlenitý dojem. Barevnost a použité materiály byly navrženy tak, aby se projekt pŐirozenĚ vÿlenil do stávající zástavby, kterou však architektonicky pŐedÿí o nĚkolik dimenzí, a nastavuje tak novou úroveŁ kvality bydlení pro celou lokalitu.

The nine terraced houses of “Oasis Libuš Classic Homes“ appeal at Àrst glance by their appearance. Individual parts of the houses project and recede from the basic line, creating a very interesting dissected impression. The colours and materials used were designed to incorporate the project naturally into the existing developed area. However, they surpass it by several dimensions, setting a new level of quality in residences for the entire locality.

Bydlení v Oáze Libuš poskytuje skuteÿnĚ velkorysé prostorové Őešení a veškerý komfort. Na cca 144 m2 obytné plochy se rozprostírá bytová jednotka 5+kk se tŐemi koupelnami a dvĚma balkony. Každý dŢm má garáž pro dvĚ auta, technické zázemí a v zadní ÿásti menší zahradu. Dohromady tak mŢžete využívat prostor o užitné ploše až 225 m2.

Living in Oasis Libuš provides a truly generous spatial solution and overall comfort. The approx. 144 m2 of Áoorage make up a 5+kk residential unit with three bathrooms and two balconies. Each house has a two-car garage, technical facilities and a small back garden. The total usable area is 225 m2.

Pražská ÿtvrŘ Libuš se postupnĚ stává vyhledávanou lokalitou. Nabízí veškerou obÿanskou vybavenost, takže nákupy, zdravotní péÿe, výbĚr vhodné instituce pro vzdĚlávání ÿi volnoÿasové aktivity pro vás budou hraÿkou. Blízká ModŐanská rokle ÿi Kunraticko-Michelský les umožŁují snadný únik do pŐírody. Libuš je dopravnĚ velmi dobŐe dostupná do centra, navíc v budoucnu je zde v plánu nová trasa D pražského metra. Projekt Oáza Libuš Domy Classic je dílem developerské Àrmy KZP ideal invest a. s. Bližší informace naleznete na www.domylibus.cz.

30

Prague’s district of Libuš is gradually becoming a sought-after location. It offers all the civic amenities. Therefore, shopping, health care and the selection of a suitable educational institution and leisure-time activities will all be a breeze for you. Nearby ModŐany Ravine and Michle-Kunratice Forest provide opportunities for an easy escape into Nature. The city centre is easily accessible from Libuš. In addition, a new line D station of the Prague Metro is planned here in future. Oasis Libuš Classic Homes is the work of the KZP ideal invest a.s. development company. For further information see: www.domylibus.cz.


ǐǑǎǑǗǚǛǑǜǝǖǔǑ ǛǜǚǑǖǞǧ | PROPERTY PROJECTS | DEVELOPERSKÉ PROJEKTY ǐDZǮȋǾȈ ǰǺǸǺǮ Ǯ ǼȋǰǺǮǺǵ dzǬǽǾǼǺǵǶDZ „Oáza Libuš Domy Classic“ ǿDzDZ ǹǬ ǻDZǼǮȇǵ ǮdzǯǷȋǰ ǻǼǴǮǷDZǶǬȊǾ ǽǮǺǴǸ ǮǹDZȄǹǴǸ ǮǴǰǺǸ. ǚǾǰDZǷȈǹȇDZ ȃǬǽǾǴ ǰǺǸǬ ǮȇǽǾǿǻǬȊǾ Ǵ ǺǾǽǾǿǻǬȊǾ ǺǾ ǭǬdzǺǮǺǵ ǷǴǹǴǴ, ǽǺdzǰǬǮǬȋ ǺȃDZǹȈ ǴǹǾDZǼDZǽǹǺDZ ǮǻDZȃǬǾǷDZǹǴDZ ǻǺǰȃDZǼǶǴǮǬǹǴDZǸ ǺǾǰDZǷȈǹȇȁ ǰDZǾǬǷDZǵ. ǢǮDZǾǬ Ǵ ǴǽǻǺǷȈdzǺǮǬǹǹȇDZ ǸǬǾDZǼǴǬǷȇ ǭȇǷǴ ǻǼDZǰǷǺDzDZǹȇ ǾǬǶ, ȃǾǺǭȇ ǻǼǺDZǶǾ DZǽǾDZǽǾǮDZǹǹȇǸ ǺǭǼǬdzǺǸ ǮǻǴǽȇǮǬǷǽȋ Ǯ ǿDzDZ ǽǿȅDZǽǾǮǿȊȅǿȊ dzǬǽǾǼǺǵǶǿ, ǶǺǾǺǼǿȊ Ǻǹ ǮǽDZ DzDZ ǬǼȁǴǾDZǶǾǿǼǹǺ ǻǼDZǮǺǽȁǺǰǴǾ Ǯ ǹDZǽǶǺǷȈǶǴȁ ǻǼǺǻǺǼȂǴȋȁ, ȃDZǸ ǿǽǾǬǹǬǮǷǴǮǬDZǾ ǹǺǮȇǵ ǿǼǺǮDZǹȈ ǶǬȃDZǽǾǮǬ DzǴǷȈȋ ǮǺ ǮǽDZǸ ǼǬǵǺǹDZ. ǛǼǺDzǴǮǬǹǴDZ Ǯ «ǚǬdzǴǽDZ ǗǴǭǿȄ» - ȉǾǺ ǼǬǰǺǽǾȈ ǺǾ ǻǺ-ǹǬǽǾǺȋȅDZǸǿ ǺǾǷǴȃǹǺǯǺ ǻǼǺǽǾǼǬǹǽǾǮDZǹǹǺǯǺ ǼDZȄDZǹǴȋ Ǵ ǶǺǸȀǺǼǾǬ. ǛǼǴǭǷǴdzǴǾDZǷȈǹǺ ǹǬ 144 Ǹ2 DzǴǷǺǵ ǻǷǺȅǬǰǴ ǼǬǽǻǺǷǬǯǬDZǾǽȋ ǶǮǬǼǾǴǼǬ ǻǷǬǹǴǼǺǮǶǴ 5+kk ǽ ǾǼDZǸȋ ǮǬǹǹȇǸǴ ǶǺǸǹǬǾǬǸǴ Ǵ ǰǮǿǸȋ ǭǬǷǶǺǹǬǸǴ. ǖǬDzǰȇǵ ǰǺǸ ǴǸDZDZǾ ǯǬǼǬDz ǹǬ ǰǮDZ ǸǬȄǴǹȇ, ǾDZȁǹǴȃDZǽǶǺDZ ǺǭDZǽǻDZȃDZǹǴDZ Ǵ ǹDZǭǺǷȈȄǺǵ ǽǬǰ Ǯ dzǬǰǹDZǵ ȃǬǽǾǴ ǰǺǸǬ. ǎǽDZ ǮǸDZǽǾDZ ǽǺǽǾǬǮ-

ǷȋDZǾ ǻǼǺǽǾǼǬǹǽǾǮǺ ǴǽǻǺǷȈdzǿDZǸǺǵ DzǴǷǺǵ ǻǷǺȅǬǰǴ Ǯ ǼǬdzǸDZǼDZ 225 Ǹ2. ǛǼǬDzǽǶǴǵ ǼǬǵǺǹ ǗǴǭǿȄ ǻǺǽǾDZǻDZǹǹǺ ǽǾǬǹǺǮǴǾǽȋ ǻǺǻǿǷȋǼǹȇǸ ǸDZǽǾǺǸ. ǚǹ ǼǬǽǻǺǷǬǯǬDZǾ ǼǬdzǮǴǾǺǵ ǴǹȀǼǬǽǾǼǿǶǾǿǼǺǵ, Ǭ ǴǸDZǹǹǺ: ǸǬǯǬdzǴǹǬǸǴ, ǸDZǰǴȂǴǹǽǶǴǸ ǺǭǽǷǿDzǴǮǬǹǴDZǸ, ǮȇǭǺǼǺǸ ǻǺǰȁǺǰȋȅDZǯǺ ǿȃǼDZDzǰDZǹǴȋ ǰǷȋ ǺǭǿȃDZǹǴȋ ǴǷǴ ǰǺǽǿǯǬ - ǮǽDZ ȉǾǺ ǾǬǸ ǹǬȁǺǰǴǾǽȋ ǭǿǶǮǬǷȈǹǺ ǹǬ ǼǬǽǽǾǺȋǹǴǴ ǮȇǾȋǹǿǾǺǵ ǼǿǶǴ. ǍǷǴdzǶǴǵ ǘǺǰǼDzǬǹǽǶǴǵ ǺǮǼǬǯ - ModŐanská rokle - ǴǷǴ ǖǿǹǼǬǾǴȂǶǺ-ǘǴȁDZǷȈǽǶǴǵ ǷDZǽ ǰǬȊǾ ǮǺdzǸǺDzǹǺǽǾȈ ǷDZǯǶǺ ǺȃǿǾǴǾȈǽȋ ǹǬ ǻǼǴǼǺǰDZ. ǜǬǵǺǹ ǗǴǭǿȄ ǺǭǷǬǰǬDZǾ ǻǼDZǶǼǬǽǹȇǸ ǾǼǬǹǽǻǺǼǾǹȇǸ ǽǺǺǭȅDZǹǴDZǸ ǽ ȂDZǹǾǼǺǸ, Ǭ Ǯ ǭǿǰǿȅDZǸ dzǰDZǽȈ ǻǷǬǹǴǼǿDZǾǽȋ ǻǺǽǾǼǺǵǶǬ ǷǴǹǴǴ ǻǼǬDzǽǶǺǯǺ ǸDZǾǼǺ D. ǛǼǺDZǶǾ «Oáza Libuš Domy Classic» ȋǮǷȋDZǾǽȋ ǼǬǭǺǾǺǵ ǰDZǮDZǷǺǻDZǼǽǶǺǵ ǶǺǸǻǬǹǴǴ KZP ideal invest a.s. ǐǷȋ ǻǺǷǿȃDZǹǴȋ ǰǺǻǺǷǹǴǾDZǷȈǹǺǵ ǴǹȀǺǼǸǬȂǴǴ, ǻǺǽDZǾǴǾDZ www.domylibus.cz.

OASIS LIBUŠ CLASSIC HOMES

AMPLE SPACE FOR YOUR LIVING ǚnjǓǔǝ ǗǔǍǟǤ ǐǚǘnj CLASSIC

ǍǚǗǨǤǔǑ ǛǜǚǝǞǜnjǙǝǞǎnj ǐǗǫ ǎnjǤǑǏǚ ǒǔǗǨǫ

31


DEVELOPERSKÉ PROJEKTY | PROPERTY PROJECTS | ǐǑǎǑǗǚǛǑǜǝǖǔǑ ǛǜǚǑǖǞǧ

VILADŮM CHODOV

DOKONALÝ NAVENEK I UVNITŘ

Moderní perla zasazená do tradiÿní vilové ÿtvrti, luxusní a pŐitom neokázalá – to je novostavba Viladomu Chodov. Architektonicky vychází z meziváleÿného funkcionalismu a její jedineÿnost podtrhují špiÿkové pŐírodní materiály s dŢrazem na kvalitní druhy masivních dŐev a kamenného obložení. Uspokojí tak i ty nejnároÿnĚjší klienty.

A modern pearl embedded in a traditional residential area, luxurious and yet unpretentious – this is the newly built Villahouse Chodov. Architecturally it is based on inter-war Functionalism. Its uniqueness is highlighted by top natural materials with the emphasis on quality types of solid wood and stone cladding. Thus they will satisfy even the most demanding clients.

ViladŢm Chodov je tvoŐen osmi bytovými jednotkami s ÿistou obytnou plochou 85–134 m2 a dispozicemi 3+kk až 4+kk. Dva z bytŢ jsou mezonetové a ve tŐech podlažích nabízejí pŐes 166 m2 vÿetnĚ terasy a lodžie. V pŐízemí se vedle vstupní haly a toalety nachází obývací pokoj s biokrbem a prostorná kuchynĚ. V prvním patŐe jsou umístĚny dvĚ ložnice s vlastní koupelnou, z nichž jedna má pŐístup na lodžii a vlastní šatnu. Do tŐetího patra je situována zimní zahrada s terasou a mramorem obložená koupelna s pŐímým denním osvĚtlením.

Villahouse Chodov consists of eight housing units with a net Áoor area of 85–134 m2 and with 3 to 4 bedrooms. There are two duplex Áats, offering more than 166 m2 of space on three Áoors, including terrace and loggia. On the ground Áoor, besides the entrance hall and toilets, there is a living room with bio-hearth and spacious kitchen. The 1st Áoor comprises two bedrooms with en suite bathrooms, one of which has access to a loggia and private dressing room. A winter garden with terrace and marble-tiled bathroom with direct daylight are situated on the 3rd Áoor.

Parkovací stání jsou umístĚna v suterénním podlaží domu, které je z uliÿní úrovnĚ dostupné autovýtahem. SamozŐejmou souÿástí domu jsou i další technické prostory jako sklepní kóje ÿi místnost pro jízdní kola a koÿárky.

32

Parking spaces are situated in the basement of the building, which is accessible by car lift from the street level. Other technical areas, such as a cellar and a room for bicycles and strollers are a natural part of the building.


ǐǑǎǑǗǚǛǑǜǝǖǔǑ ǛǜǚǑǖǞǧ | PROPERTY PROJECTS | DEVELOPERSKÉ PROJEKTY

ǎǔǗǗnj-ǐǚǘ CHODOV

ǛǜǑǖǜnjǝǙǧǕ ǔǓǙǟǞǜǔ ǔ ǝǙnjǜǟǒǔ VILLAHOUSE CHODOV

PERFECT EXTERIOR AS WELL AS INTERIOR

Obyvatelé viladomu mohou obdivovat dŢmyslné detaily jakými jsou podlahy z masivního dŐeva bez lišt zapuštĚné pod sádrové omítky, bezfalcové dŐevĚné dveŐe v nadstandardní výšce, klimatizace skrytá v sádrokartonovém podhledu s odsazením od stĚn ÿi dŢstojnĚ pŢsobící kamenné prvky na fasádĚ, venkovních chodnících, obložení vstupní haly a vnitŐním schodišti.

Residents of the Villahouse can admire ingenious details such as Áoors of slatless massive wood recessed under plaster, rabbet-free wooden doors at above-average height, air conditioning hidden in plasterboard sofÀt wall indents and imposing stone elements on the facade, pavements, cladding in entrance hall and inner staircase.

þtvrŘ starého Chodova pŐedstavuje díky své klidné atmosféŐe a bezproblémovému napojení na dopravní tepny metropole ideální lokalitu pro spokojené bydlení. Nabízí perfektní dostupnost nákupŢ, kultury i sportu. K výletŢm do pŐírody láká pŐírodní památka Údolí kunratického potoka, která je souÿástí 300 hektarŢ velké zelené plochy Kunraticko-Michelského lesa. Jen chvilka cesty autem dĚlí ViladŢm Chodov od Aquapalace þestlice, pláže HostivaŐské pŐehrady ÿi Àtness centra v nedalekém OC Chodov.

With its quiet atmosphere and trouble-free connection to the transport arteries of the metropolis, the old Chodov neighbourhood represents an ideal locality for contented living. It offers perfect shopping, cultural and sports facilities. The Kunratice Brook Valley national monument, which is part of the 300-ha green area of Michle-Kunrative Forest invite excursions into the countryside. Just a quick drive by car separates Villahouse Chodov from Aquapalace þestlice, the HostivaŐ Dam beach and the gym in the nearby Chodov shopping centre.

Více informací o projektu se dozvíte na: www.viladumchodov.cz

Further information on the project can be found at: www.viladumchodov.cz

33


DEVELOPERSKÉ PROJEKTY | PROPERTY PROJECTS | ǐǑǎǑǗǚǛǑǜǝǖǔǑ ǛǜǚǑǖǞǧ ǝǺǮǼDZǸDZǹǹǬȋ DzDZǸȃǿDzǴǹǬ, ǮȇǼǺǽȄǬȋ Ǯ ǾǼǬǰǴȂǴǺǹǹǺǸ DzǴǷǺǸ ǼǬǵǺǹDZ, dzǬǽǾǼǺDZǹǹǺǸ ǮǴǷǷǬǸǴ, ǼǺǽǶǺȄǹǬȋ, ǹǺ Ǯ ǾǺ DzDZ ǮǼDZǸȋ ǻǼǺǽǾǬȋ – ȉǾǺ ǹǺǮǺǽǾǼǺǵǶǬ ǎǴǷǷǬ-ǰǺǸ ǡǺǰǺǮ. njǼȁǴǾDZǶǾǿǼǹǺ ǺǹǬ ǺǽǹǺǮȇǮǬDZǾǽȋ ǹǬ ǽǾǴǷDZ ǸDZDzǮǺDZǹǹǺǯǺ ȀǿǹǶȂǴǺǹǬǷǴdzǸǬ, Ǵ DZDZ ǿǹǴǶǬǷȈǹǺǽǾȈ ǻǺǰȃDZǼǶǴǮǬȊǾ ǻDZǼǮǺǶǷǬǽǽǹȇDZ ǹǬǾǿǼǬǷȈǹȇDZ ǸǬǾDZǼǴǬǷȇ ǽ ǬǶȂDZǹǾǺǸ ǹǬ ǶǬȃDZǽǾǮDZǹǹȇDZ ǮǴǰȇ ǸǬǽǽǴǮǹǺǯǺ ǰDZǼDZǮǬ Ǵ ǶǬǸDZǹǹȇDZ ǺǭǷǴȂǺǮǶǴ. ǎǴǰ ǰǺǸǬ ǿǰǺǮǷDZǾǮǺǼǴǾ ǰǬDzDZ ǽǬǸȇȁ ǮdzȇǽǶǬǾDZǷȈǹȇȁ ǶǷǴDZǹǾǺǮ.

ǶǺǾǺǼȇȁ ǴǸDZDZǾ ǮȇȁǺǰ ǹǬ ǷǺǰDzǴȊ Ǵ ǺǾǰDZǷȈǹǿȊ ǯǬǼǰDZǼǺǭǹǿȊ ǶǺǸǹǬǾǿ. ǙǬ ǾǼDZǾȈDZǸ ȉǾǬDzDZ ǼǬǽǻǺǷǺDzDZǹ dzǴǸǹǴǵ ǽǬǰ ǽ ǾDZǼǼǬǽǺǵ Ǵ ǺǭǷǺDzDZǹǹǬȋ ǸǼǬǸǺǼǺǸ ǮǬǹǹǬȋ ǶǺǸǹǬǾǬ ǽ ǻǼȋǸȇǸ ǰǹDZǮǹȇǸ ǺǽǮDZȅDZǹǴDZǸ.

ǎǴǷǷǬ-ǰǺǸ ǡǺǰǺǮ ǽǺǽǾǺǴǾ Ǵdz ǮǺǽȈǸǴ DzǴǷȇȁ ǶǮǬǼǾǴǼ ǽ ǺǭȅDZǵ ǻǷǺȅǬǰȈȊ 85–134 Ǹ2 Ǵ ǻǷǬǹǴǼǺǮǶǬǸǴ ǺǾ 3+kk ǰǺ 4+kk. ǐǮDZ Ǵdz ǶǮǬǼǾǴǼ – ǸDZdzǺǹDZǾȇ, Ǵ ǹǬ ǾǼDZȁ ȉǾǬDzǬȁ ǾǬǸ ǻǼDZǰǷǬǯǬDZǾǽȋ ǭǺǷDZDZ 166 Ǹ2, ǮǶǷȊȃǬȋ ǾDZǼǼǬǽȇ Ǵ ǷǺǰDzǴǴ. ǙǬ ǹǴDzǹDZǸ ȉǾǬDzDZ ǼȋǰǺǸ ǽ ǻǼǴȁǺDzDZǵ-ȁǺǷǷǺǸ Ǵ ǾǿǬǷDZǾǬǸǴ ǹǬȁǺǰǴǾǽȋ ǯǺǽǾǴǹǬȋ ǽ ǭǴǺǶǬǸǴǹǺǸ Ǵ ǻǼǺǽǾǺǼǹǬȋ Ƕǿȁǹȋ. ǙǬ ǻDZǼǮǺǸ ǹǬǰdzDZǸǹǺǸ ȉǾǬDzDZ DZǽǾȈ ǰǮDZ ǽǻǬǷȈǹǴ ǽǺ ǽǮǺǴǸǴ ǺǾǰDZǷȈǹȇǸǴ ǮǬǹǹȇǸǴ ǶǺǸǹǬǾǬǸǴ, ǺǰǹǬ Ǵdz

ǒǴǾDZǷǴ ǎǴǷǷȇ-ǰǺǸǬ ǸǺǯǿǾ ǷȊǭǺǮǬǾȈǽȋ ǻǼǺǰǿǸǬǹǹȇǸǴ ǰDZǾǬǷȋǸǴ, ǾǬǶǴǸǴ ǶǬǶ ǻǺǷȇ Ǵdz ǸǬǽǽǴǮǹǺǯǺ ǰDZǼDZǮǬ ǭDZdz ǻǷǴǹǾǿǽǺǮ, ǿǾǺǻǷDZǹǹȇDZ ǻǺǰ ȄǾǿǶǬǾǿǼǶǿ, ȄǻǿǹǾǺǮǬǹǹȇǸǴ ǰDZǼDZǮȋǹǹȇǸǴ ǰǮDZǼȋǸǴ ǹDZǽǾǬǹǰǬǼǾǹǺǯǺ ǼǬdzǸDZǼǬ, ǶǺǹǰǴȂǴǺǹDZǼǺǸ, ǽǻǼȋǾǬǹǹȇǸ Ǯ ǯǴǻǽǺǶǬǼǾǺǹǹȇǵ ǻǺǾǺǷǺǶ ǽ ǺǾǽǾǿǻǺǸ ǺǾ ǽǾDZǹ, ǴǷǴ ǻǼDZǶǼǬǽǹȇǸǴ ȉǷDZǸDZǹǾǬǸǴ ǹǬ ȀǬǽǬǰDZ, ǮǹDZȄǹǴȁ ǻDZȄDZȁǺǰǹȇȁ ǰǺǼǺDzǶǬȁ, ǺǭǷǴȂǺǮǶDZ ȁǺǷǷǬ Ǵ ǮǹǿǾǼDZǹǹDZǵ ǷDZǽǾǹǴȂDZ.

34

ǛǬǼǶǺǮǺȃǹȇDZ ǸDZǽǾǬ ǹǬȁǺǰȋǾǽȋ Ǯ ǻǺǰǮǬǷȈǹǺǸ ȉǾǬDzDZ dzǰǬǹǴȋ, ǹǬ ǶǺǾǺǼȇǵ ǽ ǿǼǺǮǹȋ ǿǷǴȂȇ ǸǺDzǹǺ ǻǺǻǬǽǾȈ ǹǬ ǬǮǾǺǷǴȀǾDZ. ǖǺǹDZȃǹǺ, ǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵ ȃǬǽǾȈȊ ǰǺǸǬ ȋǮǷȋȊǾǽȋ ǾǬǶDzDZ Ǵ ǰǼǿǯǴDZ ǾDZȁǹǴȃDZǽǶǴDZ ǻǺǸDZȅDZǹǴȋ, ǾǬǶǴDZ ǶǬǶ ǻǺǰǮǬǷ ǴǷǴ ǶǺǸǹǬǾǬ ǰǷȋ ǮDZǷǺǽǴǻDZǰǺǮ Ǵ ǶǺǷȋǽǺǶ.


ǐǑǎǑǗǚǛǑǜǝǖǔǑ ǛǜǚǑǖǞǧ | PROPERTY PROJECTS | DEVELOPERSKÉ PROJEKTY

ǝǾǬǼȇǵ ǼǬǵǺǹ ǡǺǰǺǮ ǭǷǬǯǺǰǬǼȋ DZǯǺ ǽǻǺǶǺǵǹǺǵ ǬǾǸǺǽȀDZǼDZ Ǵ ǻǼDZǶǼǬǽǹǺǸǿ ǰǺǽǾǿǻǿ Ƕ ǾǼǬǹǽǻǺǼǾǹȇǸ ǬǼǾDZǼǴȋǸ ǽǾǺǷǴȂȇ ȋǮǷȋDZǾǽȋ ǴǰDZǬǷȈǹȇǸ ǸDZǽǾǺǸ ǰǷȋ ǶǺǸȀǺǼǾǹǺǵ DzǴdzǹǴ. ǎ ǼǬǵǺǹDZ ǺǾǷǴȃǹǺ ǼǬdzǮǴǾǬȋ ǴǹȀǼǬǽǾǼǿǶǾǿǼǬ: ǹǬǷǴȃǴDZ ǸǬǯǬdzǴǹǺǮ, ǶǿǷȈǾǿǼǹȇȁ Ǵ ǽǻǺǼǾǴǮǹȇȁ ǿȃǼDZDzǰDZǹǴǵ. ǖ ǻǺDZdzǰǶǬǸ ǹǬ ǻǼǴǼǺǰǿ ǼǬǽǻǺǷǬǯǬDZǾ ǻǼǴǼǺǰǹȇǵ dzǬǻǺǮDZǰǹǴǶ «ǐǺǷǴǹǬ ǖǿǹǼǬǾǴȂǶǺǯǺ ǻǺǾǺǶǬ», ǶǺǾǺǼȇǵ ȋǮǷȋDZǾǽȋ ȃǬǽǾȈȊ 300 ǯǬ ǭǺǷȈȄǺǵ dzDZǷDZǹǺǵ ǾDZǼǼǴǾǺǼǴǴ

ǖǿǹǼǬǾǴȂǶǺ-ǘǴȁDZǷȈǽǶǺǯǺ ǷDZǽǬ. ǙDZǽǶǺǷȈǶǺ ǸǴǹǿǾ ǹǬ ǸǬȄǴǹDZ ǺǾǰDZǷȋȊǾ ǎǴǷǷǬ-ǰǺǸ ǡǺǰǺǮ ǺǾ njǶǮǬǻǬǼǶǬ ǣDZǽǾǷǴȂDZ – «Aquapalace þestlice», ǻǷȋDzDZǵ ǏǺǽǾǴǮǬǼDzǽǶǺǯǺ ǮǺǰǺȁǼǬǹǴǷǴȅǬ ǴǷǴ ȀǴǾǹDZǽ-ȂDZǹǾǼǬ Ǯ ǭǷǴdzǷDZDzǬȅDZǸ ǾǺǼǯǺǮǺǸ ȂDZǹǾǼDZ ǡǺǰǺǮ. ǍǺǷDZDZ ǻǺǰǼǺǭǹǿȊ ǴǹȀǺǼǸǬȂǴȊ Ǻ ǻǼǺDZǶǾDZ ǸǺDzǹǺ ǹǬǵǾǴ ǹǬ: www.viladumchodov.cz

35


DEVELOPERSKÉ PROJEKTY | PROPERTY PROJECTS | ǐǑǎǑǗǚǛǑǜǝǖǔǑ ǛǜǚǑǖǞǧ

BYDLENÍ VIDOULE – BYDLENÍ NA VÝŠI

TICHO, KLID, VÝHLED A ZELEŀ S LESOPARKEM V BLÍZKOSTI. BYDLENÍ VIDOULE JE JEN JEDNO. SEZNAMTE SE S NOVÝM BYTOVÝM DOMEM NA VRCHOLU KOPCE NAD PRAŽSKÝMI KOŠÍŏI.

2+kk, pŐes stŐední byty 3+kk až po vĚtší rodinné byty. Pro ty, kdo potŐebují mít dostatek prostoru pro svou rodinu, je pŐipraveno 11 bytŢ 4+kk a jeden byt 5+kk. Byty, které jsou situované ve 4. podlaží mají terasy.

Vidoule. KošíŐe, Praha 5. Od PlzeŁské ulice sem vede klikatá silniÿka klidnou vilovou ÿtvrtí, kterou proslavil kultovní Àlm Pelíšky. A až dojedete na místo, kde bude dŢm tŐeba i s vaším bytem stát, uvĚdomíte si, proÿ je tato lokalita tak výjimeÿná. Ticho, klid a zpĚv ptákŢ. Takových míst je v Praze opravdu pomálu. Toto je místo, kde stojí za to vychovávat dĚti. Na ÿerstvém vzduchu a zároveŁ kousek od škol a školek i zájmových kroužkŢ, protože hlavní mĚsto je pŐímo pod kopcem. Bydlení Vidoule má však i spoustu jiných výhod. Co by kamenem dohodil, se nachází lesopark, místo vašich procházek s rodinou nebo prostor, kam si mŢžete jít každé ráno zabĚhat. Na kole mŢžete jet kamkoli chcete, cestou z kopce najdete i tenisové kurty a squashové centrum, do Motola na golf je to kousek. Do mĚstského centra to pŐitom máte pár minut, a nezáleží na tom zda použijete veŐejnou dopravu nebo váš vŢz. Až budete stát ve vašem novém bytĚ v Bydlení Vidoule, uvĚdomíte si jak tichou a tedy i vynikající investici jste udĚlali.

PŏÍJEMNÝ STANDARD BYDLENÍ Bydlení Vidoule není jen o krásném okolí, ale tĚšit se mŢžete na kvalitní vybavení bytŢ. U bytŢ 3+kk a vĚtších oÿekávejte jako standard 2 x WC, u bytŢ 4+kk dvĚ koupeln. Interiéru bytŢ jistĚ budou slušet interiérové dveŐe se zvĚtšenou výškou 210 cm. Byty v horních patrech mají kromĚ exkluzivních výhledŢ a teras i vyšší stropy, svĚtlá výška tohot podlaží bude 280 cm. O bezpeÿí vašeho bytu se stará elektronický zabezpeÿovací system a system protipožární ochrany.

DEVELOPER

50 BYTš NEJEN PRO RODINY

Bydlení Vidoule je jedním z pŐipravovaných projektŢ spoleÿnosti Intertrade Group. Tato spoleÿnost není v developingu žádný nováÿek. Již v minulosti ve spolupráci s Metrostavem realizovala úspĚšný projekt Bydlení Cibulka se 117 byty a se soukromým parkem o výmĚre 2 hektary. Tento projekt získal 1 cenu v soutĚži Best Realty 2001. Bydlení Vidoule vyrŢstá v pŐímém sousedství tohoto ocenĚného projektu.

Bydlení Vidoule nabídne jen 50 bytŢ situovaných ve dvou domech propejených poduzemními garážemi. Byty v pŐízemí se obracejí na jižní stranu k pŐedzahrádkám, ve vyšších patrech jsou byty orientovány krásným výhledem na Prahu. Na jaké velikosti bytŢ se zde mŢžete tĚšit? Od menších bytŢ

Spoleÿnost Intertrade se také podílela na vzniku úspĚšného projektu Bydlení na Krutci. Intertrade má rovnĚž velký podíl na revitalizaci pŢvodnĚ továrního komplexu KŐižík s.p., který se nachází na pražském SmíchovĚ.

36


ǐǑǎǑǗǚǛǑǜǝǖǔǑ ǛǜǚǑǖǞǧ | PROPERTY PROJECTS | DEVELOPERSKÉ PROJEKTY

PRODEJCE Prodejcem je realitní kanceláŐ TIDE REALITY, která je na realitním trhu témĚŐ již 20 let. Její rerefence dnes zahrnují více než 25 projektŢ v Praze, jejím okolí a také na ÿeských horách. Prvním developerským projektem byl prodej jednotek v bytovém Areálu HvĚzda v Praze 6 na PetŐinách, pod nímž je podepsán architekt Vlado Miluniÿ. Mezi poslední zakázky patŐí prodej bytŢ v polyfunkÿním domĚ Jinonická vyhlídka, prodej horských apartmánŢ Klínovec Meadows a nebo prodej bytových jednotek v komornĚjších developerských projektech Rezidence ZávĚrka a Byty u statku.

kontakt: TIDE REALITY s.r.o. Ing. Pavel Bošek, tel.: 602 104 100 www.bydlenividoule.cz

37


þESKÝ DESIGN | CZECH DESIGN | ǣǑǤǝǖǔǕ ǐǔǓnjǕǙ

VIZUÁLNÍ HRAVOST

ALŽBĚTY ZIMMEROVÉ

Text | Helena Vavrdová

Do stále se rozrĤstajícího seznamu nadČjných þeských designérĤ mĤžeme pĜipsat další ženské jméno. Je jím AlžbČta Zimmerová, þeská designérka skrývající se pod znaþkou alžbČta design, jež zakonþila studium produktového designu spoluprací se špiþkovou dánskou ¿rmou Bang & Olufsen.

S tou nadále spolupracuje v rámci programu Innovation Camp, kde vede studenty prŢmyslového designu, zároveŁ potom spoluvytváŐí i s významným ÿeským umĚlcem a designérem skla Ronym Pleslem. Tvorba AlžbĚty Zimmerové vychází z jednoduchých konceptŢ, které jsou nápadité a hravé. Pracuje s klasickými materiály jako jsou porcelán, sklo i dŐevo, ale používá i corian, jehož typické vlastnosti jako je pevnost ÿi neviditelnost spojŢ materiálu umožŁují jeho takŐka neomezenou aplikaci. AlžbĚta Zimmerová jej uplatŁuje pŐi návrzích knihovny s tvarovanými dvíŐky, konferenÿních stolkŢ, radiátorového krytí, ale i vizuálnĚ mĚkkých vln knihoven. Ve své tvorbĚ také pŐichází s výbornými nápady, jako tomu bylo napŐíklad i v prŢbĚhu studijní stáže na Estonian Academy of Art v Estonsku, kde vyhrála první místo v soutĚži pro mezinárodní energetickou spoleÿnost Eesti Energia za

38

Őešení problému s grafÀti pro elektrické stanice nebo pŐi návrzích variabilní stĚny ÿi laviÿky z odpadového materiálu pro Àrmu Baltic Fence. AlžbĚta Zimmerová se dvakrát probojovala do Ànále soutĚže Absolut Elements, pŐiÿemž v roce 2007 dokonce získala první cenu za svŢj projekt Absolut Lighting Box, úložný prostor pro panákové skleniÿky, který se po jejich vsunutí do urÿených otvorŢ rozsvĚcuje a umožŁuje tak vizuálnĚ rozsvítit prostor za barem nebo vytváŐet obrazce. Jejím nejznámĚjším a svou hravostí až okouzlujícím dílem je „papírový“ set vyrobený z porcelánu, který evokuje dĚtské skládanky vÿetnĚ autentických záhybŢ. Šálky ve tvaru papírových kalíškŢ a miska ve varu loďky jsou potom dokonale stohovatelné a využitelné vícero zpŢsoby, aŘ už jako cukŐenka, mistiÿka nebo dekorace.


ǣǑǤǝǖǔǕ ǐǔǓnjǕǙ | CZECH DESIGN | þESKÝ DESIGN

ǎǔǓǟnjǗǨǙnjǫ ǔǏǜǔǎǚǝǞǨ

njǗǨǒǍǑǞǧ ǓǔǘǘǑǜ

VISUAL PLAYFULNESS OF

ALŽBęTA ZIMMEROVÁ Another woman‘s name can be added to the growing list of talented Czech designers. AlžbČta Zimmerová, Czech designer, hiding behind the brand alžbČta design, completed her study of product design by collaboration with the leading Danish company, Bang & Olufsen. With whom she still cooperates within the Innovation Camp programme in which she teaches students of Industrial Design. At present, she is also collaborating with Rony Plesl, the signiÀcant Czech artist and glass designer. The creations of AlžbĚta Zimmerová are based on simple concepts that are imaginative and playful. She works with classic materials such as porcelain, glass and wood. However, she also uses corian whose typical properties – Àrmness and invisibility of joints – enable its almost limitless application. AlžbĚta Zimmerová uses it in the design of a bookcase with shaped doors, coffee tables, a radiator cover, as well as in the visually soft waves of bookcases. She introduces excellent ideas into her work, as was also the case during her internship at the Estonian Academy of Art. She won First Prize while at the Academy of Art in a competition for the international energy company, Eesti Energia, for solving the grafÀti problem for power stations. Worth mentioning is her design of a variable wall, as well as a bench made of waste material for the Baltic Fence company. AlžbĚta Zimmerová twice made it to the Ànals of Absolut Elements, in 2007 even winning First Prize for her project of the Absolut Lighting Box – a storage space for snifters which, after their insertion into their respective slots, lights up, enabling the space behind the bar to be visually illuminated and to create patterns. Her most famous and charming work, due to its playfulness, is the “paper” set made of porcelain, which evokes children’s puzzles including authentic curves. Cups in the shape of paper cups and a bowl shaped as a boat are perfectly stackable and usable in multiple ways, either as a sugar bowl, a bowl or decoration.

ǷȖșȚȖȧȕȕȖ ȘȈșȚțȡȐȑ șȗȐșȖȒ ȚȈȓȈȕȚȓȐȊȣȝ ȟȍȠșȒȐȝ ȌȐȏȈȑȕȍȘȖȊ ȗȖȗȖȓȕȐȓșȧ ȍȡȍ ȖȌȕȐȔ ȎȍȕșȒȐȔ ȐȔȍȕȍȔ - ǨȓȤȎȉȍȚȈ ǯȐȔȔȍȘ, ȟȍȠșȒȐȑ ȌȐȏȈȑȕȍȘ, șȒȘȣȊȈȦȡȐȑșȧ ȗȖȌ ȔȈȘȒȖȑ alžbČta design, ǨȓȤȎȉȍȚȈ ȏȈȒȖȕȟȐȓȈ ȖȉțȟȍȕȐȍ ȌȐȏȈȑȕț ȗȘȖȌțȒȞȐȐ șȖȚȘțȌȕȐȟȍșȚȊȖȔ ș ȊȍȌțȡȍȑ ȌȈȚșȒȖȑ ȒȖȔȗȈȕȐȍȑ «Bang & Olufsen». C ǶǺǾǺǼǺǵ ǺǹǬ Ǵ ǰǬǷȈȄDZ ǻǼǺǰǺǷDzǬDZǾ ǼǬǭǺǾǬǾȈ Ǯ ǼǬǸǶǬȁ ǻǼǺǯǼǬǸǸȇ Innovation Camp, ǯǰDZ ǺǹǬ ǺǭǿȃǬDZǾ ǽǾǿǰDZǹǾǺǮ ǶǬȀDZǰǼȇ ǻǼǺǸȇȄǷDZǹǹǺǯǺ ǰǴdzǬǵǹǬ. ǝDZǯǺǰǹȋ ǺǹǬ ǾǬǶDzDZ ǽǺǾǼǿǰǹǴȃǬDZǾ ǽ ǮDZǰǿȅǴǸ ȃDZȄǽǶǴǸ ȁǿǰǺDzǹǴǶǺǸ Ǵ ǰǴdzǬǵǹDZǼǺǸ ǽǾDZǶǷǬ ǜǺǹǴ ǛǷDZǽǷǺǸ. ǞǮǺǼȃDZǽǾǮǺ njǷȈDzǭDZǾȇ ǓǴǸǸDZǼ ǺǽǹǺǮȇǮǬDZǾǽȋ ǹǬ ǻǼǺǽǾȇȁ ǶǺǹȂDZǻȂǴȋȁ, ǺǾǷǴȃǬȊȅǴȁǽȋ ǴdzǺǭǼDZǾǬǾDZǷȈǹǺǽǾȈȊ Ǵ ǴǯǼǴǮǺǽǾȈȊ. ǚǹǬ ǼǬǭǺǾǬDZǾ ǽ ǾǼǬǰǴȂǴǺǹǹȇǸǴ ǸǬǾDZǼǴǬǷǬǸǴ, ǾǬǶǴǸǴ ǶǬǶ ȀǬǼȀǺǼ, ǽǾDZǶǷǺ Ǵ ǰDZǼDZǮǺ, ǹǺ ǾǬǶDzDZ ǴǽǻǺǷȈdzǿDZǾ Ǵ ǶǺǼǴǬǹ, ǾǴǻǴȃǹȇDZ ǽǮǺǵǽǾǮǬ ǶǺǾǺǼǺǯǺ – ȉǾǺ ǻǼǺȃǹǺǽǾȈ Ǵ ǹDZǮǴǰǴǸǺǽǾȈ ǽǺDZǰǴǹDZǹǴǵ ǸǬǾDZǼǴǬǷǬ, ȃǾǺ ǻǺdzǮǺǷȋDZǾ DZǯǺ ǻǼǬǶǾǴȃDZǽǶǴ ǹDZǺǯǼǬǹǴȃDZǹǹǺDZ ǴǽǻǺǷȈdzǺǮǬǹǴDZ. njǷȈDzǭDZǾǬ ǓǴǸǸDZǼ ǻǼǴǸDZǹȋDZǾ DZǯǺ Ǯ ǰǴdzǬǵǹDZ ǭǴǭǷǴǺǾDZǶ ǽ ȀǴǯǿǼǹȇǸǴ ǰǮDZǼȋǸǴ, DzǿǼǹǬǷȈǹȇȁ ǽǾǺǷǴǶǺǮ, ǻǺǶǼȇǾǴǵ ǼǬǰǴǬǾǺǼǺǮ, Ǭ ǾǬǶDzDZ ǰǷȋ ǮǴdzǿǬǷȈǹǺ ǸȋǯǶǴȁ ǮǺǷǹ ǭǴǭǷǴǺǾDZǶ. ǎ ǽǮǺDZǸ ǾǮǺǼȃDZǽǾǮDZ ǺǹǬ ǺǾǷǴȃǬDZǾǽȋ ǴǹǾDZǼDZǽǹȇǸǴ ǴǰDZȋǸǴ, ǶǬǶ, ǹǬǻǼǴǸDZǼ, ȉǾǺ ǻǼǺǴdzǺȄǷǺ ǮǺ ǮǼDZǸȋ ǽǾǬDzǴǼǺǮǶǴ Ǯ ǩǽǾǺǹǽǶǺǵ njǶǬǰDZǸǴǴ ǔǽǶǿǽǽǾǮ, ǯǰDZ ǺǹǬ dzǬǮǺDZǮǬǷǬ ǻDZǼǮȇǵ ǻǼǴdz Ǯ ǶǺǹǶǿǼǽDZ ǰǷȋ ǸDZDzǰǿǹǬǼǺǰǹǺǵ ȉǹDZǼǯDZǾǴȃDZǽǶǺǵ ǶǺǸǻǬǹǴǴ «Eesti Energia» dzǬ ǼDZȄDZǹǴDZ ǻǼǺǭǷDZǸȇ ǽ ǯǼǬȀȀǴǾǴ ǰǷȋ ȉǷDZǶǾǼǺǽǾǬǹȂǴǵ, ǴǷǴ ǶǺǯǰǬ ǺǹǬ ǼǬdzǼǬǭǺǾǬǷǬ ǻǼǺDZǶǾ ǮǬǼǴǬǭDZǷȈǹǺǵ ǽǾDZǹǶǴ ǴǷǴ ǽǶǬǸDZǵǶǴ Ǵdz ǺǾȁǺǰǺǮ ǸǬǾDZǼǴǬǷǬ ǰǷȋ ǶǺǸǻǬǹǴǴ «Baltic Fence». njǷȈDzǭDZǾǬ ǓǴǸǸDZǼ ǰǮǬDzǰȇ ǰǺȁǺǰǴǷǬ ǰǺ ȀǴǹǬǷǬ ǶǺǹǶǿǼǽǬ «Absolut Elements», ǻǼǴȃDZǸ Ǯ 2007 ǯǺǰǿ ǰǬDzDZ ǮȇǴǯǼǬǷǬ ǻDZǼǮȇǵ ǻǼǴdz dzǬ ǽǮǺǵ ǻǼǺDZǶǾ Absolut Lighting Box - ǸDZǽǾǺ ǰǷȋ ȁǼǬǹDZǹǴȋ ǼȊǸǺǶ, ǶǺǾǺǼǺDZ ǻǺǽǷDZ Ǵȁ ǿǽǾǬǹǺǮǶǴ Ǯ ǻǼDZǰǹǬdzǹǬȃDZǹǹȇDZ ǰǷȋ ȉǾǺǯǺ ǺǾǮDZǼǽǾǴȋ ǺǽǮDZȅǬDZǾǽȋ Ǵ ǻǺdzǮǺǷȋDZǾ ǮǴdzǿǬǷȈǹǺ ǺǽǮDZǾǴǾȈ dzǺǹǿ dzǬ ǭǬǼǺǸ ǴǷǴ ǽǺdzǰǬǮǬǾȈ ǶǬǼǾǴǹȇ. ǑDZ ǽǬǸȇǸ ǴdzǮDZǽǾǹȇǸ Ǵ ǺȃǬǼǺǮȇǮǬȊȅǴǸ ǽǮǺDZǵ ǴǯǼǴǮǺǽǾȈȊ ǻǼǺǴdzǮDZǰDZǹǴDZǸ ȋǮǷȋDZǾǽȋ “ǭǿǸǬDzǹȇǵ” ǹǬǭǺǼ, ǴdzǯǺǾǺǮǷDZǹǹȇǵ Ǵdz ȀǬǼȀǺǼǬ, ǶǺǾǺǼȇǵ ǹǬǻǺǸǴǹǬDZǾ ǰDZǾǽǶǴDZ ǶǹǴDzǶǴ-ǼǬǽǶǷǬǰǿȄǶǴ ǽ Ǵȁ ǹǬǽǾǺȋȅǴǸǴ ǽǶǷǬǰǶǬǸǴ. ǣǬȄǶǴ Ǯ ȀǺǼǸDZ ǭǿǸǬDzǹȇȁ ǽǾǬǶǬǹȃǴǶǺǮ Ǵ ǸǴǽǶǬ Ǯ ȀǺǼǸDZ ǷǺǰǶǴ ȁǺǼǺȄǺ ǽǶǷǬǰȇǮǬȊǾǽȋ, Ǵ Ǵȁ ǸǺDzǹǺ ǴǽǻǺǷȈdzǺǮǬǾȈ ǹDZǽǶǺǷȈǶǴǸǴ ǽǻǺǽǺǭǬǸǴ, ǶǬǶ ǽǬȁǬǼǹǴȂǿ, ǸǴǽǺȃǶǿ ǴǷǴ ǰDZǶǺǼǬȂǴȊ.

39


Z JINÉHO KOUTU SVęTA | FROM DIFFERENT PART OF THE WORLD | ǔǓ ǐǜǟǏǚǏǚ ǟǏǚǗǖnj ǘǔǜnj

NORSKO Norway /ǙǺǼǮDZǯǴȋ Text| Michal Záhora, www.archiworld.cz

ŽIVOTNÍ ÚROVEŀ NORš JE VELMI VYSOKÁ, DÍKY TOMU ZDE NAJDEME MNOHO UKÁZEK KVALITNÍ A VELKORYSÉ ARCHITEKTURY. ORIENTACE NA PŏÍRODNÍ VęDY JE V TOMTO SEVERSKÉM KRAJI PLNÉM FJORDš SAMOZŏEJMOSTÍ, PROTO NIKOHO NEPŏEKVAPÍ, ŽE NEJPOUŽÍVANęJŠÍM MATERIÁLEM JE DŏEVO V RšZNÝCH OBMęNÁCH. TAKÉ SE ZDE NACHÁZÍ VELKÉ MNOŽSTVÍ SAUN, KTERÉ KROMę ZDRAVOTNÍ FUNKCE PLNÍ TAKÉ VELMI DšLEŽITOU SPOLEþENSKO-KULTURNÍ ÚLOHU.

THE STANDARD OF LIVING IN NORWAY IS VERY HIGH AND, OWING TO THIS, MANY EXAMPLES OF HIGH-QUALITY, GENEROUS ARCHITECTURE ARE TO BE FOUND HERE. ORIENTATION TOWARDS THE NATURAL SCIENCES IN THIS NORTHERN REGION OF FJORDS IS THE NORM. SO IT IS HARDLY SURPRISING THAT WOOD IN ITS VARIOUS MODIFICATIONS IS THE MATERIAL MOST USED. THERE ARE ALSO NUMEROUS SAUNAS, WHICH, IN ADDITION TO THEIR HEALTH FUNCTION, ALSO FULFIL A VERY IMPORTANT SOCIAL AND CULTURAL ROLE.

O tom, že sauna nemusí být uzavŐená vŢÿi svému okolí, svĚdÿí modernĚ pojatá stavba náležící k hotelu u Őeky ve mĚstĚ Gubrandsjuvet. Prosklená stĚna otevírá nádherný výhled do údolí pŐímo z prostoru sauny. Kombinace masivních, dále neupravených betonových stĚn v interiéru kontrastuje s dŐevĚným obložením obvodových stĚn. Stavba díky tomu ideálnĚ zapadá do svého pŐírodního okolí.

The building with a modern design belonging to the hotel by the river in the town of Gubrandsjuvet bears evidence to the fact that a sauna does not have to be closed to its surroundings. The glass wall affords a beautiful view of the valley directly from the sauna. The combination of the solid, untreated concrete walls of the interior contrasts with the wooden panelling of the exterior walls. Thanks to this, the building ideally blends into the natural environment.

Foto: Courtesy of Jensen & Skodvin Architects, archdaily.com

Photo: Courtesy of Jensen & Skodvin Architects, archdaily.com

40


ǔǓ ǐǜǟǏǚǏǚ ǟǏǚǗǖnj ǘǔǜnj | FROM DIFFERENT PART OF THE WORLD | Z JINÉHO KOUTU SVęTA

ǟǜǚǎǑǙǨ ǒǔǓǙǔ ǙǚǜǎǑǒǢǑǎ ǚǣǑǙǨ ǎǧǝǚǖ, ǛǚǩǞǚǘǟ ǎ ǙǚǜǎǑǏǔǔ ǙnjǕǐǑǞǝǫ ǘǙǚǏǚ ǛǜǔǘǑǜǚǎ ǖnjǣǑǝǞǎǑǙǙǚǕ ǔ ǝǞǔǗǨǙǚǕ njǜǡǔǞǑǖǞǟǜǧ. ǚǜǔǑǙǞnjǢǔǫ Ǚnj ǛǜǔǜǚǐǚǎǑǐǣǑǝǖǔǑ Ǚnjǟǖǔ ǎ ǩǞǚǘ ǝǑǎǑǜǙǚǘ ǜǑǏǔǚǙǑ, ǛǚǗǙǚǘ ǠǨǚǜǐǚǎ, ǫǎǗǫǑǞǝǫ ǝnjǘǚ ǝǚǍǚǕ ǜnjǓǟǘǑǪǥǑǕǝǫ, Ǟnjǖ ǣǞǚ ǙǔǖǚǏǚ ǙǑ ǟǐǔǎǔǞ, ǣǞǚ ǙnjǔǍǚǗǑǑ ǜnjǝǛǜǚǝǞǜnjǙǑǙǙǧǘ ǘnjǞǑǜǔnjǗǚǘ ǐǗǫ ǝǞǜǚǔǞǑǗǨǝǞǎnj ǓǐǑǝǨ ǫǎǗǫǑǞǝǫ ǐǜǑǎǑǝǔǙnj ǎ ǑǑ ǜnjǓǗǔǣǙǧǡ Ǡǚǜǘnjǡ. ǞnjǖǒǑ ǓǐǑǝǨ ǙnjǡǚǐǔǞǝǫ ǍǚǗǨǤǚǑ ǖǚǗǔǣǑǝǞǎǚ ǝnjǟǙ, ǖǚǞǚǜǧǑ ǎ ǐǚǛǚǗǙǑǙǔǑ ǖ ǚǓǐǚǜǚǎǔǞǑǗǨǙǚǕ ǠǟǙǖǢǔǔ ǎǧǛǚǗǙǫǪǞ ǎnjǒǙǟǪ ǝǚǢǔnjǗǨǙǚ-ǖǟǗǨǞǟǜǙǟǪ ǜǚǗǨ. ǚ ǾǺǸ, ȃǾǺ ǽǬǿǹǬ ǹDZ ǺǭȋdzǬǾDZǷȈǹǺ ǰǺǷDzǹǬ ǭȇǾȈ dzǬǶǼȇǾǺǵ ǻǺ ǺǾǹǺȄDZǹǴȊ Ƕ ǽǮǺDZǸǿ ǺǶǼǿDzDZǹǴȊ, ǽǮǴǰDZǾDZǷȈǽǾǮǿDZǾ ǽǺǮǼDZǸDZǹǹǬȋ ǶǺǹȂDZǻȂǴȋ ǻǺǽǾǼǺǵǶǴ, ǻǼǴǹǬǰǷDZDzǬȅDZǵ ǺǾDZǷȊ ǹǬ ǭDZǼDZǯǿ ǼDZǶǴ Ǯ ǹǬǽDZǷDZǹǹǺǸ ǻǿǹǶǾDZ Gubrandsjuvet. ǓǬǽǾDZǶǷDZǹǹǬȋ ǽǾDZǹǬ ǻǺdzǮǺǷȋDZǾ ǷȊǭǺǮǬǾȈǽȋ ǻǼDZǶǼǬǽǹȇǸ ǮǴǰǺǸ ǹǬ ǰǺǷǴǹǿ ǻǼȋǸǺ Ǵdz ǽǬǿǹȇ. ǝǺȃDZǾǬǹǴDZ ǸǬǽǽǴǮǹȇȁ, ǹǴȃDZǸ ǹDZ ǺǭǼǬǭǺǾǬǹǹȇȁ ǭDZǾǺǹǹȇȁ ǽǾDZǹ Ǯ ǴǹǾDZǼȈDZǼDZ ǶǺǹǾǼǬǽǾǴǼǿDZǾ ǽ ǰDZǼDZǮȋǹǹǺǵ ǺǭǷǴȂǺǮǶǺǵ ǹǬǼǿDzǹȇȁ ǽǾDZǹ. ǍǷǬǯǺǰǬǼȋ ȉǾǺǸǿ ǻǺǽǾǼǺǵǶǬ ǴǰDZǬǷȈǹǺ ǮǻǴǽȇǮǬDZǾǽȋ Ǯ ǺǶǼǿDzǬȊȅǴǵ ǷǬǹǰȄǬȀǾ. ǠǺǾǺ: Courtesy of Jensen & Skodvin Architects, archdaily.com ǘǴȀǴȃDZǽǶǴDZ ǷDZǯDZǹǰȇ Ǻ dzǸDZDZ, ǶǺǾǺǼǬȋ ǴǹǺǯǰǬ ǮȇȁǺǰǴǾ Ǵdz ǺdzDZǼǬ Ǯ ǝDZǷȈȊǼDZ (Seljord), ǸDZǽǾǹǺDZ ǽǺǺǭȅDZǽǾǮǺ ǻǺǰǰDZǼDzǬǷǺ ǽǾǼǺǴǾDZǷȈǽǾǮǺǸ ǹDZǽǶǺǷȈǶǴȁ ǹDZǭǺǷȈȄǴȁ dzǰǬǹǴǵ, Ǵdz ǶǺǾǺǼȇȁ ǺǾǶǼȇǮǬDZǾǽȋ ǶǼȇǾȇǵ ǮǴǰ ǹǬ ǻǺǮDZǼȁǹǺǽǾȈ ǮǺǰȇ. ǛǼǺDZǶǾ ǮǺdzǹǴǶ ǹǬ ǺǽǹǺǮDZ ǽǾǿǰDZǹȃDZǽǶǺǯǺ ǽDZǸǴǹǬǼǬ, dzǬǰǬȃǬ ǶǺǾǺǼǺǯǺ dzǬǶǷȊȃǬǷǬǽȈ Ǯ ǼǬdzǼǬǭǺǾǶDZ ǾǼDZȁ ǺǾǰDZǷȈǹȇȁ dzǰǬǹǴǵ ǽ ǮǴǰǺǸ ǹǬ ǺǶǼDZǽǾǹǺǽǾǴ, ǶǺǾǺǼȇDZ ǸǺǯǿǾ ǭȇǾȈ ǻǺǽǾǼǺDZǹȇ ǭDZdz ǴǽǻǺǷȈdzǺǮǬǹǴȋ ǽǺǮǼDZǸDZǹǹȇȁ ǾDZȁǹǺǷǺǯǴǵ (ǮǮǴǰǿ ǾǺǯǺ, ȃǾǺ Ǵȁ ǻǼǺǽǾǺ ǹDZǷȈdzȋ ǰǺǽǾǬǮǴǾȈ Ǯ ȉǾǺ ǸDZǽǾǺ). ǠǺǾǺ: © Dag Jenssen, archdaily.com

41


Z JINÉHO KOUTU SVęTA | FROM DIFFERENT PART OF THE WORLD | ǔǓ ǐǜǟǏǚǏǚ ǟǏǚǗǖnj ǘǔǜnj

Bájné legendy o hadovi, který se obÿas vynoŐí z jezera v Seljordu, podpoŐila místní obec výstavbou nĚkolika malých staveb, které skýtají krytý výhled na vodní hladinu. Návrh vznikl na základĚ studentského workshopu, jehož úkolem bylo navrhnout 3 separátní stavby s vyhlídkou do okolí, jež bude možné postavit bez použití moderní technologie, která se na místo nedostane.

The mythical legend of the serpent which sometimes emerges from the lake of Seljord, is supported by the local village in the construction of several small buildings which offer a covered viewpoint of the water level. The proposal was created on the basis of a students’ workshop, the task of which was to design three separate buildings with a view of the surroundings that would be possible to be constructed without using modern technologies which could not reach the site.

Foto: © Dag Jenssen, archdaily.com Photo: © Dag Jenssen, archdaily.com Za mĚstem Hjerkinn najdeme vzdĚlávací pavilon s vyhlídkou do národního parku. DŐevĚná konstrukce se plasticky vlní v prostoru a zcela tak popírá pŐirozenou tvrdost svého materiálu. V interiéru najdeme promyšlenou mozaiku dŐevĚných prvkŢ, jejíž vlny vytváŐí stupŁovité hledištĚ. Za povšimnutí stojí ÿást nosného sloupu, který je složen z napŐíÿ Őezaných hranolŢ a vytváŐí tak efektní mozaiku letokruhŢ.

On the edge of the town of Hjerkinn, an educational institution with a view of the National Park is located. The wooden construction ripples into space, absolutely denying the natural hardness of its material. In the interior, there is an elaborate mosaic of wooden elements, the waves of which create a stepped auditorium. It is worth noting the part of the supporting pole that is composed of cross-cut prisms, thus creating an impressive mosaic of growth rings.

Foto: © Ketil Jacobsen, archdaily.com Photo: © Ketil Jacobsen, archdaily.com

42


Z JINÉHO KOUTU SVęTA | FROM DIFFERENT PART OF THE WORLD | ǔǓ ǐǜǟǏǚǏǚ ǟǏǚǗǖnj ǘǔǜnj

Zhruba 85 % obyvatelstva v Norsku je luteránského vyznání, proto zde najdeme mnoho kostelŢ, jako je napŐíklad novostavba v Oslu z roku 2011. Netradiÿní asymetrický pŢdorys spolu s originálnĚ pojatými detaily vytváŐí z této stavby opravdový unikát. V interiéru najdeme také mnoho zajímavých Őešení - hlavním prvkem, kterého si návštĚvník všimne, je strop, který je zakryt plasticky proÀlovaným dŐevĚným podhledem. Na postranních stĚnách jsou osazeny dŐevĚné lamely, které zastiŁují prostor proti slunci.

Approximately 85% of Norway’s inhabitants are Lutherans, which results in many churches being found here, such as the new building in Oslo from 2011. The unconventional asymmetrical plan, together with the details conceived in an original way, create a truly distinctive object of this building. There are many interesting features in the interior – the main one noticed by visitors is the ceiling which is covered by a plastically shaped wooden sofÀt. The side walls are Àtted with wooden lamellas that shade the interior from the sun.

Foto: © Nils Petter Dale, Laila Meyrick, archdaily.com

Photo: © Nils Petter Dale, Laila Meyrick, archdaily.com

ǓǬ ǯǺǼǺǰǺǸ Hjerkinn ǼǬǽǻǺǷǺDzDZǹ ǺǭǼǬdzǺǮǬǾDZǷȈǹȇǵ ǻǬǮǴǷȈǺǹ ǽ ǮǴǰǺǸ ǹǬ ǙǬȂǴǺǹǬǷȈǹȇǵ ǻǬǼǶ. ǐDZǼDZǮȋǹǹǬȋ ǶǺǹǽǾǼǿǶȂǴȋ ǺǭǼǬdzǿDZǾ ǻǷǬǽǾǴȃǹȇDZ ǮǺǷǹȇ Ǯ ǻǼǺǽǾǼǬǹǽǾǮDZ Ǵ, ǾǬǶǴǸ ǺǭǼǬdzǺǸ, ǽǷǺǮǹǺ ǭȇ ǻǺǷǹǺǽǾȈȊ ǺǾǼǴȂǬDZǾ DZǽǾDZǽǾǮDZǹǹǿȊ ǾǮDZǼǰǺǽǾȈ ǸǬǾDZǼǴǬǷǬ, Ǵdz ǶǺǾǺǼǺǯǺ ǺǹǬ ǴdzǯǺǾǺǮǷDZǹǬ. ǎǹǿǾǼǴ, Ǯ ǴǹǾDZǼȈDZǼDZ, Ǹȇ ǹǬȁǺǰǴǸ ǽǷǺDzǹǿȊ ǸǺdzǬǴǶǿ Ǵdz ǰDZǼDZǮȋǹǹȇȁ ȉǷDZǸDZǹǾǺǮ, ǮǺǷǹȇ ǶǺǾǺǼǺǵ ǽǺdzǰǬȊǾ ǽǾǿǻDZǹȃǬǾȇǵ ǬǸȀǴǾDZǬǾǼ. ǝǾǺǴǾ ǺǾǸDZǾǴǾȈ ȃǬǽǾȈ ǺǻǺǼǹǺǯǺ ǽǾǺǷǭǬ, ǶǺǾǺǼȇǵ ǽǷǺDzDZǹ Ǵdz ǻǺǻDZǼDZȃǹǺ ǼǬdzǼDZdzǬǹǹȇȁ ǻǼǴdzǸ, ǽǺdzǰǬȊȅǴȁ ǸǺdzǬǴǶǿ ǯǺǰǴȃǹȇȁ ǶǺǷDZȂ. ǠǺǾǺ: © Dag Jenssen, archdaily.com ǛǼǴǸDZǼǹǺ 85% ǹǬǽDZǷDZǹǴȋ Ǯ ǙǺǼǮDZǯǴǴ ǷȊǾDZǼǬǹȂȇ, ǻǺȉǾǺǸǿ dzǰDZǽȈ ǮǽǾǼDZȃǬDZǾǽȋ ǸǹǺDzDZǽǾǮǺ ǶǺǽǾDZǷǺǮ, ǾǬǶǴȁ, ǶǬǶ, ǹǬǻǼǴǸDZǼ, ǹǺǮǺǽǾǼǺǵǶǬ 2011 ǯǺǰǬ Ǯ ǚǽǷǺ. ǙDZǾǼǬǰǴȂǴǺǹǹȇǵ ǬǽǴǸǸDZǾǼǴȃǹȇǵ ǻǷǬǹ dzǰǬǹǴȋ ǮǸDZǽǾDZ ǽ ǺǼǴǯǴǹǬǷȈǹȇǸǴ ǰDZǾǬǷȋǸǴ ǻǼDZǮǼǬȅǬDZǾ ȉǾǿ ǻǺǽǾǼǺǵǶǿ Ǯ ǰDZǵǽǾǮǴǾDZǷȈǹǺ ǿǹǴǶǬǷȈǹǺDZ dzǰǬǹǴDZ. ǎ ǴǹǾDZǼȈDZǼDZ ǾǬǶDzDZ ǹǬǵǰDZǾǽȋ ǸǹǺǯǺ ǴǹǾDZǼDZǽǹȇȁ ǼDZȄDZǹǴǵ: ǺǽǹǺǮǹǺǵ ȉǷDZǸDZǹǾ, ǶǺǾǺǼȇǵ dzǬǸDZȃǬDZǾ ǻǺǽDZǾǴǾDZǷȈ, ȉǾǺ ǻǺǰǮDZǽǹǺǵ ǻǺǾǺǷǺǶ, ǻǺǶǼȇǾȇǵ ǻǷǬǽǾǴȃǹȇǸ ǻǼǺȀǴǷǴǼǺǮǬǹǹȇǸ ǰDZǼDZǮǺǸ. ǍǺǶǺǮȇDZ ǽǾDZǹȇ dzǬǶǼȇǾȇ ǰDZǼDZǮȋǹǹȇǸǴ ǻǷǬǹǶǬǸǴ, ǶǺǾǺǼȇDZ ǻǺdzǮǺǷȋȊǾ ǽǺdzǰǬǮǬǾȈ ǾDZǹȈ Ǵ dzǬȅǴȅǬǾȈ ǻǼǺǽǾǼǬǹǽǾǮǺ ǺǾ ǽǺǷǹȂǬ. ǠǺǾǺ: © Nils Petter Dale, Laila Meyrick, archdaily.com

44


DOSTUPNÝ

ITALSKÝ

Kompletní zarízení ˇ bytu za

*

( )

199.000Kcˇ *

*Obrázek slouží pouze na ilustrativní účely

DESIGN

( ) K objednávce získáte sedačku zdarma nebo slevu 20%

na další objednávku v hodnotě nad 100.000,- Kč. Design, doprava a montáž jsou zahrnuty v cene. ˇ Navštivte Váš nejbližší showroom Colombini Casa a objevte možnost vytváret ˇ jedinečné interiéry: www.colombinicasa.com

Colombini Casa Prague, Rohan Centre Karlín - Rohanské nábreží 15, Praha 8, Tel: +420 234 6161 50, info@colombini.cz

Najdete nás na:

ˇ Od 1. ríjna do 30. listopadu 2012


DESIGN | DESIGN | ǐǔǓnjǕǙ Povleþení Christian Fischbacher info o cenĚ v obchodĚ www.natynaty.cz

PolštáĜky švédské znaþky Mimou cena od 1 100 Kÿ www.natynaty.cz

sweet dreams PolštáĜky švédské znaþky Mimou cena od 1 100 Kÿ www.natynaty.cz

PolštáĜky švédské znaþky Mimou cena od 1 100 Kÿ www.natynaty.cz

Povleþení Christian Fischbacher info o cenĚ v obchodĚ www.natynaty.cz

A la maison Luxusní ložní prádlo, jehož spoleÿným jmenovatelem je vysoká kvalita materiálu. www.alamaison.cz


Martin&Home

+420 776 646 650 +420 774 250 602 www.nabytekcz.com SHOWROOM Nテ。YTKU na Korunnテュ 56


KOMODA KRÁSNÁ A PRAKTICKÁ OZDOBA VAŠEHO DOMOVA

THE CHEST OF DRAWERS A BEAUTIFUL AND PRACTICAL ITEM FOR YOUR HOME

ǖǚǘǚǐ ǖǜnjǝǔǎǚǑ ǔ ǛǜnjǖǞǔǣǙǚǑ ǟǖǜnjǤǑǙǔǑ ǎnjǤǑǏǚ ǐǚǘnj

Jedním z nejkrásnĚjších a nejvelkolepĚji pŢsobících kusŢ nábytku je komoda, jejímž pŢvodním domovem byla již v 7. století slunná Itálie. Proslulejší se ale stala až pozdĚji ve Francii, kde dostala pro pohodlnost užití název commode, což pŐeloženo z francouzštiny znamená právĚ pohodlný ÿi jednoduchý.

The chest of drawers is one of the most beautiful and monumentally impressive pieces of furniture, whose original home was 7th-century sunny Italy. However, it later became more famous in France where it was given the name commode for its convenience. Translated from French, commode is “convenient” or “practical”.

Komoda, dnes ÿasto nazývaná jako prádelník, je skuteÿnĚ velmi praktickým a snadno využitelným kusem nábytku. Za dobu své existence prošla mnoha vizuálními i funkÿními zmĚnami, stala se nedílnou souÿástí interiérŢ bez ohledu na stylistická Őešení prostoru a díky své majestátnosti, která pŐitahuje pohledy, se tak ÿasto stává dominantou celého prostoru.

A chest of drawers, today often called a dresser, is really a very practical and easy-to-use item of furniture. It has undergone many visual and functional changes during its existence. It has become an integral part of the interior, regardless of the stylistic design of the space and, thanks to its magniÀcence which attracts glances, often dominates the whole area.

Komody lze používat víceúÿelnĚ – nejÿastĚji jako skŐíŁ na odĚvy, ale využít je mŢžete také v obývacích pokojích ÿi dokonce kanceláŐích, ve spojení se zrcadlem pak rovnĚž jako toaletky pro ženy. Komody bývají používány i v koupelnách jako skŐíŁka pod umyvadlo nebo pro ukládání šperkŢ, obleÿení a dalšího textilu.

Chests of drawers are multi-purpose – most often used for storing clothes, but they can also be used in living rooms or even in ofÀces, or, in combination with a mirror, also as dressing tables for women. The chest of drawers is often used in the bathroom as a small cupboard under the washbasin or for storing jewellery, clothes and other textiles.

Zpracování komod je velmi rŢznorodé. Mohou být zdobeny rŢznými druhy dŐeva, malíŐskými dekoracemi ÿi napŐíklad zdobnými úchytkami. Jaká se hodí do vašeho interiéru, je potom už jen ÿistĚ na vás a na vašem vkusu.

The manufacture of chests of drawers is very miscellaneous. They can be decorated by various types of wood, painted decorations or decorative handles. It is purely up to you and your personal taste to choose one that matches your interior.

48


ǚǰǹǴǸ Ǵdz ǽǬǸȇȁ ǶǼǬǽǴǮȇȁ Ǵ ǻǼǺǴdzǮǺǰȋȅǴȁ ǻǼDZǶǼǬǽǹǺDZ ǮǻDZȃǬǾǷDZǹǴDZ ǻǼDZǰǸDZǾǺǮ ǸDZǭDZǷǴ ȋǮǷȋDZǾǽȋ ǶǺǸǺǰ, ȃȈDZǵ ǻDZǼǮǺǹǬȃǬǷȈǹǺǵ ǼǺǰǴǹǺǵ ǿDzDZ Ǯ 7-Ǹ ǮDZǶDZ ǭȇǷǬ ǽǺǷǹDZȃǹǬȋ ǔǾǬǷǴȋ. ǙǺ ǭǺǷDZDZ ǴdzǮDZǽǾDZǹ Ǻǹ ǽǾǬǷ ǻǺdzDzDZ - ǮǺ ǠǼǬǹȂǴǴ, ǯǰDZ ǰǷȋ ǻǼǺǽǾǺǾȇ ǹǬdzǮǬǹǴȋ ǻǺǷǿȃǴǷ ǴǸȋ commode, ȃǾǺ Ǯ ǻDZǼDZǮǺǰDZ ǽ ȀǼǬǹȂǿdzǽǶǺǯǺ ǺdzǹǬȃǬDZǾ ǭȇǾȈ ǿǰǺǭǹȇǸ Ǵ ǻǼǺǽǾȇǸ.

ǖǺǸǺǰȇ ǸǺǯǿǾ ǭȇǾȈ ǴǽǻǺǷȈdzǺǮǬǹȇ Ǯ ǼǬdzǹȇȁ ȂDZǷȋȁ. ǣǬȅDZ ǮǽDZǯǺ – ǶǬǶ ȄǶǬȀ ǰǷȋ ǺǰDZDzǰȇ, ǹǺ Ǵȁ ǾǬǶDzDZ ǸǺDzǹǺ ǻǺǽǾǬǮǴǾȈ Ǯ ǯǺǽǾǴǹǺǵ ǴǷǴ ǰǬDzDZ Ǯ ǺȀǴǽDZ, Ǯ ǽǺȃDZǾǬǹǴǴ ǽ dzDZǼǶǬǷǺǸ ǶǺǸǺǰ ǻǼDZǰǽǾǬǮǷȋDZǾ ǽǺǭǺǵ DzDZǹǽǶǴǵ ǾǿǬǷDZǾǹȇǵ ǽǾǺǷǴǶ. ǖǺǸǺǰȇ ǾǬǶDzDZ ǴǽǻǺǷȈdzǿȊǾǽȋ Ǯ ǮǬǹǹȇȁ ǶǺǸǹǬǾǬȁ, ǶǬǶ ȄǶǬȀȃǴǶǴ ǻǺǰ ǿǸȇǮǬǷȈǹǴǶ ǴǷǴ ǰǷȋ ȁǼǬǹDZǹǴȋ ȊǮDZǷǴǼǹȇȁ ǴdzǰDZǷǴǵ, ǺǰDZDzǰȇ Ǵ ǰǼǿǯǴȁ ǾDZǶǽǾǴǷȈǹȇȁ ǴdzǰDZǷǴǵ.

ǖǺǸǺǰ, ǽDZǯǺǰǹȋ ȃǬǽǾǺ ǹǬdzȇǮǬDZǸȇǵ ǭDZǷȈDZǮȇǸ ȄǶǬȀǺǸ, ǹǬ ǽǬǸǺǸ ǰDZǷDZ ȋǮǷȋDZǾǽȋ ǺȃDZǹȈ ǻǼǬǶǾǴȃǹȇǸ Ǵ ǿǰǺǭǹȇǸ Ǯ ǴǽǻǺǷȈdzǺǮǬǹǴǴ ǻǼDZǰǸDZǾǺǸ ǸDZǭDZǷǴ. ǓǬ ǮǼDZǸȋ ǽǮǺDZǯǺ ǽǿȅDZǽǾǮǺǮǬǹǴȋ Ǻǹ ǻǼDZǾDZǼǻDZǷ ǸǹǺDzDZǽǾǮǺ ǮǴdzǿǬǷȈǹȇȁ Ǵ ȀǿǹǶȂǴǺǹǬǷȈǹȇȁ ǴdzǸDZǹDZǹǴǵ, ǽǾǬǮ ǹDZǺǾȆDZǸǷDZǸǺǵ ȃǬǽǾȈȊ ǴǹǾDZǼȈDZǼǬ, ǹDZdzǬǮǴǽǴǸǺ ǺǾ ǽǾǴǷǴǽǾǴȃDZǽǶǺǯǺ ǼDZȄDZǹǴȋ ǻǼǺǽǾǼǬǹǽǾǮǬ, Ǭ ǾǬǶDzDZ ǭǷǬǯǺǰǬǼȋ ǽǮǺDZǸǿ ǮDZǷǴȃǴȊ, ǶǺǾǺǼǺDZ ǻǼǴǾȋǯǴǮǬDZǾ ǮdzǯǷȋǰȇ ǹǬǽǾǺǷȈǶǺ, ȃǾǺ ǶǺǸǺǰ ȃǬǽǾǺ ǽǾǬǹǺǮǴǾǽȋ ǰǺǸǴǹǬǹǾǺǵ ȂDZǷǺǯǺ ǻǺǸDZȅDZǹǴȋ

ǘǺǰDZǷǴ ǶǺǸǺǰǺǮ ǺȃDZǹȈ ǼǬdzǹǺǺǭǼǬdzǹȇ. ǚǹǴ ǸǺǯǿǾ ǭȇǾȈ ǿǶǼǬȄDZǹȇ ǼǬdzǷǴȃǹȇǸǴ ǻǺǼǺǰǬǸǴ ǰDZǼDZǮǬ, ȁǿǰǺDzDZǽǾǮDZǹǹȇǸǴ ǰDZǶǺǼǬȂǴȋǸǴ, ǴǷǴ, ǹǬǻǼǴǸDZǼ, ǰDZǶǺǼǬǾǴǮǹȇǸǴ ǼǿȃǶǬǸǴ. ǖǬǶǺǵ Ǵdz ǹǴȁ ǭǺǷȈȄDZ ǮǻǴȄDZǾǽȋ Ǯ ǮǬȄ ǴǹǾDZǼȈDZǼ, ǻǺǷǹǺǽǾȈȊ dzǬǮǴǽǴǾ ǺǾ ǮǬǽ Ǵ ǮǬȄDZǯǺ ǮǶǿǽǬ.

SALON NÁBYTKU MARTIN&HOME Korunní 1310/56 Praha 2 - Vinohrady www.nabytekcz.com

KSENIA ULYANOVA Dekoratér, ředitel salonu nabytku “Martin&Home”

ǖǝǑǙǔǫ ǟǗǨǫǙǚǎnj ǐDZǶǺǼǬǾǺǼ, ǰǴǼDZǶǾǺǼ ǸDZǭDZǷȈǹǺǯǺ ǽǬǷǺǹǬ “Martin&Home”

49


2012

vstupenky objednávejte na www.conventia.cz

1.11. 2012 Clarion Congress Hotel Prague Nejdůležitější realitní událost roku 2012 Třetí ročník Realitního kongresu 2012 přináší odpovědi na aktuální problémy týkající se trhu s nemovitostmi v České republice. Profesionálové z oboru budou diskutovat o novinkách a aktualitách týkajících se nemovitostí. Mezi zúčastněnými budou zástupci realitních kanceláří, developerských společností, investoři, banky a další firmy působící na realitním trhu.

Součástí třetího ročníku bude vyhlášení výsledků soutěží v rámci Czech Real Estate Awards. Proběhne vyhlášení již druhého ročníku úspěšné soutěže Realitní projekt roku 2012 a novinkou bude soutěž Realitní agentura roku 2012. Generální partner:

Generální mediální partner:

Badeniho 1

CZECH REAL ESTATE

Partneři

|

160 00 Praha 6

Mediální partneři:

|

+420 220 515 102

|

info@conventia.cz

|

www.conventia.cz


NEJLEPŠÍ NEMOVITOSTI Best Properties 55 132 152 156 163 192

Prodej / 6DOHVǷȘȖȌȈȎȈ Pronájmy / 5HQWDOVǨȘȍȕȌȈ $SDUWPiQ\Y3UD]H 3UDJXH$SDUWPHQWVǨȗȈȘȚȈȔȍȕȚȣȊǷȘȈȋȍ

.RPHUþQtQHPRYLWRVWL &RPPHUFLDO3URSHUWLHVDzȖȔȔȍȘȟȍșȒȈȧȕȍȌȊȐȎȐȔȖșȚȤ

=DKUDQLþQtQHPRYLWRVWL / Foreign Properties / ȕȍȌȊȐȎȐȔȖșȚȤȏȈȘțȉȍȎȖȔ

$GUHViĜ / 'LUHFWRU\ȒȈȚȈȓȖȋ


OTĂ ZKA PRO REALITNĂ? ODBORNĂ?KY

Question For Real-Estates Professionals

ƸDzdzǴDzǾǿÇ§ÇŻČƒǾdzǨǺǏǣǯǏǾǜDzǼdzDzǹǨǧǼǏǪǏǰDzǾǜǏ

-DNĂŞRĂžHNiYiWHYĂŞYRMWUKXVE\W\YSÄœtĂŁWtPURFH" What developments do you expect next year in the housing market? ɑɏɨÉœÉľÉ¨É É˘ÉžÉšÉ&#x;ÉŹÉ&#x;ɨɏÉŞÉšÉĄÉœÉ˘ÉŹÉ˘ÉšɪɾɧɤɚÉ¤ÉœÉšÉŞÉŹÉ˘ÉŞÉ§É¨É?ɨɠɢɼɜɚÉœÉŤÉĽÉ&#x;ɞɭɸɳÉ&#x;ÉŚÉ?ɨɞɭ"

MARTIN HUĹ PAUER PDMLWHONDQFHOiĹ?H CENTURY 21 Plus+

ING. PETR SĂ?KORA jednatel CENTURY 21 Alter Ego

)XQNFLWUKXPRKRXSRGSRĹ?LWQt]Np~URNRYpVD]E\EDQNMHĂŚMVRXXKLVWRULFNpKRPLQLPD2FKRWDLQYHVWRYDWĂżLNXSRYDWE\W\VWiOHMHDSĹ?HGSRNOiGiVHLYGDOätPREGREt]D SĹ?LVSÄšQtPRĂŚQRVWtQDVWUDQÄšILQDQFRYiQtSRPRFtK\SRWpN1DEtGNDMHäLURNiVWiOHYtFH UR]KRGXMHQt]NiSRĹ?L]RYDFtFHQDQHERNYDOLWDE\WX.UHJXODFLFHQVWiOHGRFKi]tDEXGH WRLWUHQGURNX5R]KRGQÄšPŢÌHPHRĂżHNiYDWSĹ?tOHĂŚLWRVWLMDNYKRGQÄšSRĹ?tGLWE\W NE\GOHQtQHERLQYHVWLFL

3RNXGMGHWHG\RYĂŤYRMQDäHKRVHJPHQWXUHDOLWQtKRWUKXYURFH²RĂżHNiYiP PtUQĂŤUŢVWSRĂżWXWUDQVDNFtLFHONRYpKRGQRW\REMHPXREFKRGŢ9OLYEXGHPtWFHONRYiHNRQRPLFNiVLWXDFH2ĂżHNiYiQtNXSXMtFtFKDSURGiYDMtFtFKNWHUiE\ODYPLQXOpPREGREtRGVHEHGRVWLY]GiOHQiVHSRVWXSQÄšVEOLĂŚXMt9QHMEOLÌätFKPÄšVtFtFKĂżHNi WUKNRQVROLGDFHFRGRSRĂżWXSRVN\WRYDWHOŢUHDOLWQtFKVOXĂŚHE]Y\äRYiQtMHMLFKNYDOLW\ DVQtĂŚHQtYĂŤQRVQRVWLMHGQRWOLYĂŤFKWUDQVDNFt.DĂŚGiUHDOLWQtVSROHĂżQRVWEXGHNRQIURQWRYiQDVQXWQRVWtVQLĂŚRYDWVYRMHSURYR]QtQiNODG\D]Y\äRYDWSRĂżHWUHDOL]RYDQĂŤFK REFKRGQtFKSĹ?tSDGŢ7RKRMVRXGORXKRGREÄšVFKRSQpUHDOLWQtNDQFHOiĹ?HNWHUpNODGRXY\VRNĂŤGŢUD]QDRGERUQRVWDREFKRGQtGRYHGQRVWLVYĂŤFKPDNOpĹ?Ţ

The function of the market can be supported by low bank interest rates that are at historic lows. There is still a willingness to invest in or buy flats and houses and this is also expected in the following period with the aid of financing through mortgages. The choice is wide, with a low purchase cost and quality of the residence becoming increasingly decisive. The prices are still regulated and this trend will also continue in 2013. Certainly we can expect opportunities to acquire a suitable property for living or investment.

Well, as regards the development of our segment of the real estate market in 2013 – I expect a slight increase in the number of transactions and the total value of the volume of trade. The overall economic situation will have an influence. The expectations of buyers and sellers, that were quite far apart from each other in the past period, will gradually converge. In the coming months, the market will witness consolidation in the number of providers of real estate services, increasing their quality and decreasing the profitability of individual transactions. Every real estate company will be faced with the necessity to reduce its operating costs and increase the number of finalised business deals. Those real estate agencies that place great emphasis on the expertise and business skills of their agents are capable of doing this in the long term.

Ç ÇżÇšÇśČ‚Ç´ČŠ ǟȇǚǜǏ ǸǺǯǿǞ ÇťÇşÇ°Ç°ÇąÇźÇ˛ÇŹÇžČˆ ǚǴdzǜǴǹ ǭǏǚǜǺǎǽǜǴǹ ǝǟǺȂǹǚǞǚȇǹ ǽǞǏǎǜǴ ǜǺǞǺǟȇǹÇšÇŹČ ÇşÇ°Č‹ÇžÇ˝Č‹ǚǏǿǟǺǎǚǹÇ´Ç˝ÇžÇşÇźÇ´ČƒÇąÇ˝ÇśÇşÇŻÇşǸǴǚǴǸǿǸǏÇ?ÇşÇžÇşÇŽÇšÇşÇ˝ÇžČˆÇ´ÇšÇŽÇąÇ˝ÇžÇ´ÇźÇşÇŽÇŹÇžČˆ ǴǡǴÇťÇşÇśÇżÇťÇŹÇžČˆǜǎǏǟǞǴǟȇǝǺǽǞǺȋǚǚǏÇ´ǸǺDzǚǺÇťÇźÇąÇ°ÇťÇşÇˇÇşÇ˛Ç´ÇžČˆČƒÇžÇşÇŽǽǡǹǰǿȊȅǹǸǯǺǰǿ ǺǚǏ ǭǿǰǹǞ ÇźÇąÇŹÇˇÇ´ÇłÇşÇŽČ‡ÇŽÇŹÇžČˆÇ˝Č‹ ǝǟǴ ǝǺǸǺȅǴ ȀǴǚǏǚǽǴǟǺǎǏǚǴȋ dzǏ Ç˝ČƒÇąÇž Ç´ÇťÇşÇžÇąČƒÇšČ‡Č  ǜǟǹǰǴǞǺǎ ǛǟǹǰǡǺDzǹǚǴǹ Ç˛Ç´ÇˇČˆČ‹ ǚǏ ǟȇǚǜǹ ȄǴǟǺǜǺǹ Ç´ ǝǺǝǟǹDzǚǹǸǿ ǟǹȄǏȊȅǴǸ ȀǏǜǞǺǟǺǸȋǎǡȋǹǞǽȋǚǴdzǜǏȋȂǹǚǏǴǡǴÇśÇŹČƒÇąÇ˝ÇžÇŽÇşǜǎǏǟǞǴǟǚǺǯǺÇ˛Ç´ÇˇČˆČ‹ÇœÇąÇŻÇżÇˇÇ´ÇźÇşÇŽÇŹÇšÇ´Çą ȂǹǚǎǽǹǹȅǹÇťÇźÇşÇ´Ç˝Č ÇşÇ°Ç´ÇžÇ´ȉǞǺȋǎǚǺǭǿǰǹǞǞǟǹǚǰǺǸǯǺǰǏÇ–ÇşÇšÇąČƒÇšÇşǺDzǴǰǏȊǞǽȋ Č ÇşÇźÇşČ„Ç´ÇąǎǺdzǸǺDzǚǺǽǞǴǰǡȋǝǟǴǺǭǟǹǞǹǚǴȋÇťÇşÇ°Č ÇşÇ°Č‹Č…ÇąÇľǜǎǏǟǞǴǟȇǰǡȋǝǟǺDzǴǎǏǚǴȋ ǴǡǴǴǚǎǹǽǞǴȂǴǴ

ǑǽǡǴ ÇŻÇşÇŽÇşÇźÇ´ÇžČˆ Çş ǟǏdzǎǴǞǴǴ ǚǏȄǹǯǺ ǽǹǯǸǹǚǞǏ ǟȇǚǜǏ ǚǹǰǎǴDzǴǸǺǽǞǴ ÇŽ  ǯǺǰǿ ² ǺDzǴǰǏǹǞǽȋÇšÇąÇłÇšÇŹČƒÇ´ÇžÇąÇˇČˆÇšÇşÇąÇżÇŽÇąÇˇÇ´ČƒÇąÇšÇ´ÇąÇśÇşÇˇÇ´ČƒÇąÇ˝ÇžÇŽÇŹǽǰǹǡǺǜÇ´Ç´Č ǺǭȅǹǾȀǴǚǏǚǽǺǎǺǾ ǽǞǺǴǸǺǽǞǴ ǎǡǴȋǚǴǹ ǭǿǰǹǞ Ç´Ç¸ÇąÇžČˆ Ç´ ǺǭȅǏȋ Č‰ÇśÇşÇšÇşÇ¸Ç´ČƒÇąÇ˝ÇśÇŹČ‹ ǽǴǞǿǏȂǴȋǚDzǴǰǏǚǴȋ ǝǺǜǿǝǏǞǹǡǹǾÇ´ǝǟǺǰǏǎȂǺǎǜǺǞǺǟȇǹǭȇǡǴÇŽǝǟǺȄǡǺǸǯǺǰǿǭȇǡǴÇ°ÇşÇŽÇşÇˇČˆÇšÇşǰǏǡǹǜǺǰǟǿǯǺǞ ǰǟǿǯǏǝǺǽǞǹǝǹǚǚǺǽǭǡǴDzǏȊǞǽȋÇŽǭǡǴDzǏǾȄǴǹǸǹǽȋȂȇǸǺDzǚǺÇşÇ˛Ç´Ç°ÇŹÇžČˆǜǺǚǽǺǡǴǰǏȂǴǴ ǟȇǚǜǏÇŽǞǺǸČƒÇžÇşǜǏǽǏǹǞǽȋÇśÇşÇˇÇ´ČƒÇąÇ˝ÇžÇŽÇŹǝǺǽǞǏǎȅǴǜǺǎǿǽǡǿǯÇŽǽȀǹǟǹǚǹǰǎǴDzǴǸǺǽǞǴ ǝǺǎȇȄǹǚǴȋ ÇśÇŹČƒÇąÇ˝ÇžÇŽÇŹ Ç´Č  ǿǽǡǿǯ Ç´ ǽǚǴDzǹǚǴǹ ÇźÇąÇšÇžÇŹÇ­ÇąÇˇČˆÇšÇşÇ˝ÇžÇ´ ÇşÇžÇ°ÇąÇˇČˆÇšČ‡Č  ǺǝǹǟǏȂǴǾ ǖǏDzǰǺǸǿ ǏǯǹǚǞǽǞǎǿ ǚǹǰǎǴDzǴǸǺǽǞǴ ǝǟǴǰǹǞǽȋ Ç˝ÇžÇşÇˇÇśÇšÇżÇžČˆÇ˝Č‹ Ç˝ ÇšÇąÇşÇ­Č ÇşÇ°Ç´Ç¸ÇşÇ˝ÇžČˆČŠ ǽǚǴDzǹǚǴȋČ‰ÇśÇ˝ÇťÇˇÇżÇŹÇžÇŹČ‚Ç´ÇşÇšÇšČ‡Č ÇźÇŹÇ˝Č ÇşÇ°ÇşÇŽÇ´ÇżÇŽÇąÇˇÇ´ČƒÇąÇšÇ´Č‹ČƒÇ´Ç˝ÇˇÇŹÇźÇąÇŹÇˇÇ´ÇłÇşÇŽÇŹÇšÇšČ‡Č ǽǰǹǡǺǜ Ç›ÇźÇ´Ç˝ÇťÇşÇ˝ÇşÇ­Ç´ÇžČˆÇ˝Č‹ Çś ȉǞǺǸǿ ǽǝǺǽǺǭǚȇ Ǟǹ ǏǯǹǚǞǽǞǎǏ ǚǹǰǎǴDzǴǸǺǽǞǴ ǜǺǞǺǟȇǹ ǿǰǹǡȋȊǞ Ç­ÇşÇˇČˆČ„ÇşÇąǎǚǴǸǏǚǴǹǺǝȇǞÇ´ǰǹǡǺǎȇǸǚǏǎȇǜǏǸÇ˝ÇŽÇşÇ´Č ǸǏǜǡǹǟǺǎ

52


Van Santen & Van Santen Podzim–Zima 2012/13 www.fggroup.cz


$FRPSDQ\RI

3ŐHGVWDYXMHPH9iPSURMHNW=iWLät+RGNRYLÿN\HOHJDQWQtDIXQNÿQtE\GOHQtQD3UD]HYWĚVQpPVRXVHGVWYtUR]ViKOpKROHVRSDUNXQDGPDOHEQëP~GROtP=iWLäVNpKRSRWRND3ĚWNRPRUQtFKYLODGRPŢVQRYëPLE\W\MHQDYUæHQRSRGOHQHMQRYĚMätFKDUFKLWHNWRQLFNëFKWUHQGŢ'RP\VWRMtYHVYDKXPH]LXOLFHPL1DO\VLQiFKD3RGO\VLQDPLYWUDGLÿQtSUDæVNpUH]LGHQÿQtÿWYUWL+RGNRYLÿN\]QiPpVYRXSUYRUHSXEOLNRYRXYLORYRX]iVWDYERX9WĚVQpEOt]NRVWLMH]iNODGQtäNRODLPDWHŐVNiäNRONDF\NORVWH]NDQHGDOHNRMH*ROI &RXQWU\&OXE+RGNRYLÿN\DVSRUWRYQtDUHiO +$05²6SRUW1HGDOHNRMHWDNpQiNXSQtJDOHULH1RYRGYRUVNi3OD]D 3ŐLQiYUKXYäHFKSĚWLYLODGRPŢMVPHP\VOHOLQHMHQQDMHMLFKYQLWŐQtXVSRŐiGiQtE\WŢDOHLQDRGSRYtGDMtFtY\XæLWtVSROHÿQëFKÿiVWtSR]HPNX'RP\MVRXSURWRXPtVWĚQ\WDNDE\PH]LQLPL Y]QLNOVRXNURPëSURVWRUVGĚWVNëPKŐLäWĚP.OLGQëSDUÿtNSŐtVWXSQëSRX]H]MHGQRWOLYëFKGRPŢY\XæLMHWHQHMHQSURYROQpFKYtOHVGĚWPLDOHXPRæQtLSŐLUR]HQpXWYiŐHQtGREUëFKVRXVHGVNëFK Y]WDKŢNWHUpMVRXMHGQtP]GŢOHæLWëFKSŐHGSRNODGŢNRPIRUWQtKRE\GOHQt :HLQWURGXFHWKH=iWLät+RGNRYLÿN\FRPSOH[DQHOHJDQWIXQFWLRQDOUHVLGHQFHLQ3UDJXHDGMDFHQWWRWKHODUJHIRUHVWSDUNDERYHWKHSLFWXUHVTXHYDOOH\RIWKH=iWLät5LYHU)LYHLQWLPDWHYLOOD EXLOGLQJVRIQHZÁDWVDUHGHVLJQHGDFFRUGLQJWRWKHODWHVWDUFKLWHFWXUDOWUHQGV7KHEXLOGLQJVDUHVLWXDWHGRQWKHVORSHEHWZHHQ1DO\VLQiFKDQG3RGO\VLQDPL6WUHHWVLQWKHWUDGLWLRQDO+RGNRYLÿN\UHVLGHQWLDOTXDUWHUNQRZQIRULWV)LUVW5HSXEOLFYLOODGHYHORSPHQW,QWKHLPPHGLDWHYLFLQLW\DUHORFDWHGDSULPDU\VFKRRONLQGHUJDUWHQDQGELNHWUDLO,QWKHFORVHYLFLQLW\DUHDOVRWKH+RGNRYLÿN\*ROI &RXQWU\&OXEDQGWKH+$05²6SRUWVDUHD7KH1RYRGYRUVNi3OD]DVKRSSLQJDUFDGHLVQHDUE\ :KHQGHVLJQLQJWKHÀYHYLOODVZHWRRNLQWRDFFRXQWWKHLQWHULRUOD\RXWRIWKHÁDWVDVZHOODVWKHFRUUHVSRQGLQJXVDJHRIWKHVKDUHGDUHDVRIWKHSORW7KHUHIRUHWKHEXLOGLQJVDUHVLWXDWHGLQVXFK DZD\DVWRHQDEOHWKHFUHDWLRQRIDSULYDWHVSDFHZLWKDFKLOGUHQ·VSOD\JURXQG7KHTXLHWVPDOOSDUNDFFHVVLEOHRQO\IURPWKHLQGLYLGXDOEXLOGLQJVZLOOEHHQMR\HGLQ\RXUOHLVXUHWLPHZLWK\RXU children, as well as naturally creating good neighbourly relations—one of the most important preconditions of a comfortable lifestyle. ǛǼDZǰǽǾǬǮǷȋDZǸǮǬǸǻǼǺDZǶǾ©=iWLät+RGNRYLÿN\ªǽǾǴǷȈǹǺDZǴȀǿǹǶȂǴǺǹǬǷȈǹǺDZDzǴǷȈDZǮǛǼǬǯDZǮǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵǭǷǴdzǺǽǾǴǺǾǭǺǷȈȄǺǯǺǷDZǽǺǻǬǼǶǬǹǬǰDzǴǮǺǻǴǽǹǺǵǰǺǷǴǹǺǵǓǬǾǴȄǽǶǺǯǺǼǿȃȈȋ ǛȋǾȈǶǬǸDZǼǹȇȁǮǴǷǷǬǰǺǸǺǮǽǹǺǮȇǸǴǶǮǬǼǾǴǼǬǸǴǽǻǼǺDZǶǾǴǼǺǮǬǹǹȇǸǴǮǽǺǺǾǮDZǾǽǾǮǴǴǽǻǺǽǷDZǰǹǴǸǴǬǼȁǴǾDZǶǾǿǼǹȇǸǴǾDZǹǰDZǹȂǴȋǸǴǐǺǸǬǽǾǺȋǾǹǬǽǶǷǺǹDZǸDZDzǰǿǿǷǴȂǬǸǴ1DO\VLQiFKǴ3RGO\VLQDPLǮǾǼǬǰǴȂǴǺǹǹǺǸDzǴǷǺǸǼǬǵǺǹDZǛǼǬǯǴ©ǡǺǰǶǺǮǴȃǶǴªǴdzǮDZǽǾǹǺǸǽǮǺDZǵdzǬǽǾǼǺǵǶǺǵǮǼDZǸDZǹǛDZǼǮǺǵǼDZǽǻǿǭǷǴǶǴǎǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵǭǷǴdzǺǽǾǴǹǬȁǺǰȋǾǽȋǹǬȃǬǷȈǹǬȋȄǶǺǷǬǴǰDZǾǽǶǴǵǽǬǰ ǮDZǷǺǰǺǼǺDzǶǬǼȋǰǺǸǯǺǷȈȀǶǷǿǭ©*ROI &RXQWU\&OXE3RGNRYLÿN\ªǴǽǻǺǼǾǴǮǹȇǵǶǺǸǻǷDZǶǽ©+$05²6SRUWªǙDZǻǺǰǬǷDZǶǿǼǬǽǻǺǷǺDzDZǹǾǺǼǯǺǮȇǵȂDZǹǾǼ©1RYRGYRUVNi3OD]Dª ǛǼǴǻǼǺDZǶǾǴǼǺǮǬǹǴǴǮǽDZȁǻȋǾǴǮǴǷǷǬǰǺǸǺǮǸȇǰǿǸǬǷǴǹDZǾǺǷȈǶǺǺǮǹǿǾǼDZǹǹDZǵǻǷǬǹǴǼǺǮǶDZǴȁǶǮǬǼǾǴǼǹǺǴǺǹǬǰǷDZDzǬȅDZǸǴǽǻǺǷȈdzǺǮǬǹǴǴǺǭȅǴȁȃǬǽǾDZǵǿȃǬǽǾǶǺǮǐǺǸǬǻǺȉǾǺǸǿǼǬǽǻǺǷǺDzDZǹȇ ǾǬǶǴǸǺǭǼǬdzǺǸȃǾǺǭȇǸDZDzǰǿǹǴǸǴǮǺdzǹǴǶǷǺǸDZǽǾǺǰǷȋǷǴȃǹǺǯǺǻǼǺǽǾǼǬǹǽǾǮǬǽǰDZǾǽǶǺǵǻǷǺȅǬǰǶǺǵǞǴȁǴǵǻǬǼǶǮǶǺǾǺǼȇǵǸǺDzǹǺǻǺǻǬǽǾȈǾǺǷȈǶǺǴdzǹDZǶǺǾǺǼȇȁǰǺǸǺǮǸǺDzǹǺǴǽǻǺǷȈdzǺǮǬǾȈǹDZ ǾǺǷȈǶǺǰǷȋǺǾǰȇȁǬǽǰDZǾȈǸǴǹǺǴǰǷȋDZǽǾDZǽǾǮDZǹǹǺǯǺȀǺǼǸǴǼǺǮǬǹǴȋǰǺǭǼǺǽǺǽDZǰǽǶǴȁǺǾǹǺȄDZǹǴǵǶǺǾǺǼȇDZȋǮǷȋȊǾǽȋǺǰǹǺǵǴdzǮǬDzǹȇȁǻǼDZǰǻǺǽȇǷǺǶǶǺǸȀǺǼǾǹǺǯǺǻǼǺDzǴǮǬǹǴȋ

9tFHLQIRUPDFtQD0RUHLQIRUPDWLRQDWǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǺǻǼǺDZǶǾDZ ZZZKRGNRYLFN\E\W\F] 5HDOLWQtPDNOpŐ5DGLP*UXOLFKJUXOLFK#UWUHDOLW\F] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

55


ZZZHQJHOYRHONHUVFRPSUDJ

Praha 3 The majestic Prague villa

&(1$.ฤ€ 8รค,71รˆ3/2&+$P 32=(0(.P ,'12:<&;5

0

DMHVWiWQtSUDรงVNiYLODE\ODSRVWDYHQDYURFH8OLFH1D%DONiQฤ— NGHVHYLODQDFKi]tSDWล‰t]Gล›YRGXNOLGQpKRSURVWล‰HGtYEOt]NRVWL FHQWUDPฤ—VWDPH]LYรฌMLPHฤ€QpDรงiGDQpORNDOLW\Y3UD]H9URFHE\OD GRNRQฤ€HQDQiURฤ€QiUHNRQVWUXNFHDUHQRYDFHQHPRYLWRVWLVY\XรงLWtPY\VRFH NYDOLWQtFKPDWHULiOล›DVGล›UD]HPQD]DFKRYiQtSล›YRGQtFKSUYNล›DUFKLWHN WXU\,QWHULpUDYQLWล‰QtY\EDYHQtGRPXSล‰HNYDStVYRXฤ€LVWRWRXDPRGHUQtP VW\OHP3UYQtDGUXKpQDG]HPQtSRGODรงt P MVRXVSRMHQ\GRMHGLQpKR SURVWRUQpKRE\WXYODVWQtPVFKRGLรฅWฤ—P6XWHUpQ P VORXรงtSURSRWล‰HE\ ร€UHPQtKRSURYR]XDYSRGNURYt P Y]QLNODVDPRVWDWQiE\WRYiMHGQRWND 9LOXRENORSXMHNUiVQi]DKUDGDVHY]URVWORX]HOHQtSURVWRUQRXWHUDVRXDQRYฤ— SRVWDYHQRXJDUiรงtVHGYฤ—PDSDUNRYDFtPLPtVW\

58

1(-/(3ฤรŒ1(029,7267,,%(673523(57,(6,ว‚วŠวŽวฦถว–ว„ฦปฦบฦธฦฟฦฝฦฟวƒว…วˆว‰ว“

&217$&7(1*(/ 9g/.(5635$*8( &=

,002%,/,(1( 9VUR 6(129ร‰รฆ1e1ร‰035$+$ 7(/02%,/( +420 724 075 912  (0$,/karin.cossmann@engelvoelkers.com 35,&(&=. )/225$5($VTP /$1'VTP ,'12:<&;5

7KH

PDMHVWLF3UDJXHYLOODZDVEXLOWLQ1D%DONDQHVWUHHW ZKHUHWKHYLOODLVORFDWHGLVGXHWRDSHDFHIXOHQYLURQPHQWQHDU WKHFLW\FHQWHUWKHXQLTXHDQGGHVLUDEOHORFDWLRQLQ3UDJXH,QUHQRYD WLRQRIWKHSURSHUW\ZDVFRPSOHWHGXVLQJKLJKTXDOLW\PDWHULDOVZLWKDQ HPSKDVLVRQSUHVHUYLQJWKHRULJLQDODUFKLWHFWXUDOHOHPHQWV7KHLQWHULRUDQG IXUQLVKLQJRIWKHKRXVHVXUSULVHZLWKLWVFOHDQDQGPRGHUQVW\OH7KHร€UVW DQGVHFRQGรRRU VTP DUHFRPELQHGLQWRDVLQJOHVSDFLRXVDSDUWPHQW ZLWKRZQVWDLUFDVH%DVHPHQW VTP LVXVHGIRUWKHQHHGVRIEXVLQHVV RSHUDWLRQVDQGLQWKHDWWLF VTP DQLQGHSHQGHQWUHVLGHQWLDOXQLWZDV EXLOW7KHYLOODLVVXUURXQGHGE\DEHDXWLIXOJDUGHQZLWKJURZQJUHHQHU\ VSDFLRXVWHUUDFHDQGDQHZO\EXLOWJDUDJHZLWKWZRSDUNLQJVSDFHV


ZZZHQJHOYRHONHUVFRPSUDJ

Praha โ€“ vรฝchod Re s i d e n c e Pa r E xc e l l e n c e i n B ล™e z รญ

&(1$QDY\รงiGiQt OBYTNร PLOCHAP 32=(0(.P ,'12::1%

3

UYQtGRMHPGฤ—OiPQRKRDWDWRUH]LGHQFHYiPEH]SRFK\E\VHEHUHGHFK RGFKYtOHNG\Sล‰HNURฤ€tWHSUiKYVWXSQtKDO\VPDMHVWiWQtPVFKRGLรฅWฤ—P ]GREHQรฌPEDOXVWUiGRX9Sล‰t]HPtMVRXNUiVQpSURVWRU\VDORQXREรฌYDFtKR SRNRMHVNUEHPMtGHOQ\VNUEHPNXFK\Qฤ—DรฅDWQ\9SUYQtPSDWล‰HVH QDFKi]tVRXNURPpSURVWRU\SiQDGRPXYHONiORรงQLFHVNRXSHOQRX DรฅDWQRXSUDFRYQDVSROHฤ€HQVNiPtVWQRVWDGYDGฤ—WVNpSRNRMHVH VSROHฤ€QRXNRXSHOQRXDรฅDWQRX9HGUXKpPSRGODรงtMVRXGDOรฅtฤ€W\ล‰L ORรงQLFHSURKRVW\VYODVWQtNRXSHOQRXDNOLPDWL]DFt1iGKHUQรฌYรฌKOHG QD]DKUDGXSDUNRYpKRW\SXVWHQLVRYรฌPNXUWHPDVWiMtSURGYDNRQฤ— QiPGRGiYiSRFLWOX[XVQtKRGRPRYD9]GXรฅQpLQWHULpU\YSล‰t]HPt PDMtSล‰tVWXSQDVOXQQRXWHUDVXร”รงDVQpVSDVHVDXQRXY\Kล‰tYDQรฌP ED]pQHPDMDFX]]LVSHUOLฤ€NRYRXPDViรงtSล‰tPRY\]รฌYiNUHOD[DFL

&217$&7(1*(/ 9g/.(5635$*8( &=

,002%,/,(1( 9VUR 6(129ร‰รฆ1e1ร‰035$+$ 7(/02%,/( +420 724 075 912  (0$,/karin.cossmann@engelvoelkers.com 35,&(RQUHTXHVW LIVING AREAVTP /$1'VTP ,'12::1%

)

LUVWLPSUHVVLRQVFRXQWDQGWKLVUHVLGHQFHFHUWDLQO\PDNHVDEUHDWK WDNLQJLPSDFWIURPWKHPRPHQWRQHHQWHUVWKHJUDQGKDOOZD\ZLWK DPDJQLร€FHQWVWDLUFDVHDGRUQHGZLWKEDOXVWUDGHV2QWKHJURXQGรRRU WKHUHLVDEHDXWLIXODUHDRIVLWWLQJURRPZLWKร€UHSODFHGLQLQJURRPZLWK ร€UHSODFHNLWFKHQDQGGUHVVLQJURRP2QWKHVWรRRUPDVWHUVXLWHLVZLWK LWVVSDF\EHGURRPZLWKRZQEDWKURRPDQGGUHVVLQJURRPVDORQDQGWZR EHGURRPVIRUFKLOGUHQZLWKFRPPRQEDWKURRPDQGGUHVVLQJURRP2Q WKHQGรRRUWKHUHDUHIRXUJXHVWURRPVHDFKRQHZLWKSULYDWHEDWKURRP DQGDLUFRQGLWLRQLQJ6SOHQGHGYLHZRISDUNW\SHJDUGHQZLWKWHQQLV FRXUWDQGVWDEOHIRUWZRKRUVHVDGGVDVHQVHRISDODWLDOKRPH$OOWKHORIW\ LQWHULRUVRQWKHJURXQGJLYHRQWRVXQQ\WHUUDFH7KHVWXQQLQJVSDZLWK VDXQDKHDWHGSRRODQGMDFX]]LZLWKSHDUOPDVVDJHLQYLWHVWRUHOD[DWLRQ 352'(-,6$/(6,ว†ว‡ว…ฦบฦถฦปว‰วˆว–/,6723$',129(0%(5,ว„ว…ว–ฦทว‡ว“

59


SPORTALM Podzim–Zima 2012/13 www.fggroup.cz


3URGHME\WXNNP2²W\SX6XQVHWY$]DOHD3URMHNWX²0H]LWUDŘRYi3UDKD+UGORŐH]\ $SDUWPHQWNNP26XQVHWW\SHLQWKH$]DOHD3URMHFW0H]LWUDŘRYi3UDKD+UGORŐH]\ -DN Xæ VDPRWQë Qi]HY QDSRYtGi MGH R E\W SOQë VYĚWOD V GRPLQDQWQtPL SURVNOHQëPL ÿiVWPL X Y\VRNpKR REëYDFtKR SRNRMH SŐHV GYĚ SRGODæt %\W QDSOŁXMH YäHFKQ\SRæDGDYN\H[NOX]LYQtKRE\GOHQtPiRGGĚOHQRXURGLÿRYVNRXDGĚWVNRXÿiVW0DVWHUEHGURRPSUDFRYQXDJDOHULL.E\WXSDWŐtQiGKHUQĚSURVWRUQiWHUDVDRYëPĚŐHP2VYëMLPHÿQëPYëKOHGHPQDMLK6RXÿiVWtE\WXMVRXJDUiæRYpVWiQtDVNOHSQtNyMH $V WKH QDPH VXJJHVWV LW LV D ÁDW IXOO RI OLJKW ZLWK GRPLQDQW JODVV SDUWV LQ WKH KLJK OLYLQJ URRP WKDW UHDFKHV RYHU WZR ÁRRUV 7KH ÁDW IXOÀOOV DOO WKH UHTXLUHPHQWV RI H[FOXVLYH OLYLQJ LW KDV VHSDUDWH SDUHQW DQG FKLOGUHQ·V VHFWLRQV D PDVWHU EHGURRP RIÀFH DQG JDOOHU\ $Q LPSRUWDQW SDUW RI WKH ÁDW LV DZRQGHUIXOO\VSDFLRXVWHUUDFHZLWKDQDUHDRIP2DQGDQH[FHSWLRQDOYLHZWRWKHVRXWK7KHÁDWDOVRLQFOXGHVWZRJDUDJHVSDFHVDQGDFHOODU

&HQD3ULFHǢDZǹǬ.ÿYÿHWQĚ'3+&=. .55²'HYHORSPHQW %DUWRäNRYD3UDKD7VWUDNRYD#NUUF] 9tFHLQIRUPDFtNSURMHNWXQDZZZD]DOHDSURMHNWF] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

61


352'(-3521É-(0_(;./8=,91Ì%<'/(1Ì6.5É61ê09ê+/('(0 )256$/()255(17_(;&/86,9(':(//,1*:,7+$%($87,)8/9,(: ǛǜǚǐnjǒnjǛǜǚǐnjǒnj_ǩǖǝǖǗǪǓǔǎǙǚǑǒǔǗǨǑǝǛǜǑǖǜnjǝǙǧǘǎǔǐǚǘ 8QLNiWQtDSURVWRUQëVWŐHäQtSHQWKRXVHVLWXRYDQëY13QRYpKRUH]LGHQÿQtKRNRPSOH[X2VRELWiGLVSR]LFHDSURVNOHQpSORFK\SURSŢMÿXMtE\WXQH]DPĚQLWHOQRXDWPRVIpUXGtN\QLPMHQDYtF FHOë]DOLWëVYĚWOHP(OHJDQWQt]iURYHŁYäDNSRKRGOQëLQWHULpUVHY\]QDÿXMHÿLVWëPLOLQLHPLVWŐtGPëPQDGÿDVRYëPEDUHYQëPODGĚQtP%\WYQĚPæEXGHWHFKWtW]ŢVWDW6RXÿiVWtE\WXMVRXGYĚ YHONpWHUDV\VEH]NRQNXUHQÿQtPYëKOHGHP 7KLV GLVWLQFWLYH VSDFLRXV SHQWKRXVH LV VLWXDWHG RQ WKH WKWK ÁRRUV RI D QHZ UHVLGHQWLDO FRPSOH[ 2ZLQJ WR WKH RULJLQDO GHVLJQ DQG JODVV VXUIDFHV WKH ZKROH ÁDW LV VXQOLW JLYLQJ LW DQ XQPLVWDNDEOHDWPRVSKHUH7KHHOHJDQWEXWFRV\LQWHULRULVFKDUDFWHULVHGE\SXUHOLQHVDQGDPRGHVWWLPHOHVVFRORXUVFKHPH7KHDSDUWPHQW\RXZLOOZDQWWRVWD\LQ7ZRODUJHWHUUDFHVZLWK XQEHDWDEOHYLHZVDOVRIRUPSDUWRIWKHÁDW ǟǹǴǶǬǷȈǹȇǵǻǼǺǽǾǺǼǹȇǵǻDZǹǾȁǬǿǽǹǬǶǼȇȄDZǼǬǽǻǺǷǺDzDZǹǹȇǵǹǬȉǾǬDzǬȁǹǺǮǺǯǺǼDZdzǴǰDZǹǾǽǶǺǯǺǶǺǸǻǷDZǶǽǬǝǮǺDZǺǭǼǬdzǹǺDZǼǬǽǻǺǷǺDzDZǹǴDZǴdzǬǽǾDZǶǷDZǹǹȇDZǻǷǺȅǬǰǴǭǷǬǯǺǰǬǼȋ ǶǺǾǺǼȇǸ Ǯǽȋ ǻǷǺȅǬǰȈ ǶǮǬǼǾǴǼȇ dzǬǷǴǾǬ ǽǮDZǾǺǸ ǻǼǴǰǬȊǾ ǶǮǬǼǾǴǼDZ ǹDZǻǺǮǾǺǼǴǸǿȊ ǬǾǸǺǽȀDZǼǿ ǩǷDZǯǬǹǾǹȇǵ Ǵ Ǯ ǾǺ DzDZ ǮǼDZǸȋ ǿȊǾǹȇǵ ǴǹǾDZǼȈDZǼ ǺǾǷǴȃǬDZǾǽȋ ȃǴǽǾȇǸǴ ǷǴǹǴȋǸǴ ǴǿǸDZǼDZǹǹǺǵǹDZǾDZǼȋȊȅDZǵǽǮǺDZǵǬǶǾǿǬǷȈǹǺǽǾǴȂǮDZǾǺǮǺǵǯǬǸǸǺǵǩǾǺǶǮǬǼǾǴǼǬǮǶǺǾǺǼǺǵǮȇdzǬȁǺǾǴǾDZǺǽǾǬǾȈǽȋǎǶǮǬǼǾǴǼDZDZǽǾȈǰǮDZǭǺǷȈȄǴDZǾDZǼǼǬǽȇǽǮǺǽȁǴǾǴǾDZǷȈǹȇǸǮǴǰǺǸ

3URQiMHPTo rentnjǼDZǹǰǬ7ŐHERŁVNi3UDKDP2P2WHUDV\.ÿPĚVtF 3URGHM )RUVDOHǛǼǺǰǬDzǬ.ÿ 9,3+RPHV-DQiÿNRYRQiEŐHæt3UDKD7HO 62

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


3521É-(0_.20)2571Ì52',11ê'š035$+$632ŏ,/29 )255(17_&20)257$%/()$0,/<+286(35$*8(632ŏ,/29 Ǜǜǚǐnjǒnj_ǖǚǘǠǚǜǞǙǧǕǝǑǘǑǕǙǧǕǐǚǘǛǗnjǙǔǜǚǎǖǔ35$+$632ŏ,/29 0RGHUQtNRPIRUWQĚY\EDYHQëGŢPRGLVSR]LFLYNOLGQpUH]LGHQÿQtÿWYUWL.GRPXSDWŐtXGUæRYDQi]DKUDGDVMH]tUNHPDYHQNRYQtPNUEHP2WHYŐHQëNRQFHSWREëYDFtKRSRNRMHDSOQĚ Y\EDYHQpNXFK\QĚ P2 VSŐtVWXSHPQDWHUDVXD]DKUDGXORæQLFH MHGQDVHYVWXSHPQDWHUDVXYSŐt]HPtORæQLFHVHYVWXSHPQDVWŐHäQtWHUDVXVQiGKHUQëPYëKOHGHP =DKUDGD VMH]tUNHPGDOätNU\WRXWHUDVRXDRE\WQëP]DKUDGQtPGRPNHPVNUEHP]DUXÿXMtDEVROXWQtVRXNURPt 0RGHUQFRPIRUWDEO\IXUQLVKHGKRXVHZLWKDOD\RXWLQDTXLHWUHVLGHQWLDOQHLJKERXUKRRG7KHKRXVHFRPSULVHVDPDLQWDLQHGJDUGHQZLWKDODNHDQGRXWGRRUÀUHSODFH7KHUHLVDQRSHQ SODQOLYLQJURRPDQGIXOO\HTXLSSHGPñNLWFKHQZLWKH[LWRQWRDWHUUDFHDQGJDUGHQ7KHUHDUHEHGURRPV RQHRIZKLFKKDVDQH[LWRQWRDWHUUDFHRQWKHJURXQGÁRRUWKHQGEHGURRP KDVDQH[LWRQWRDURRIWHUUDFHZLWKDEHDXWLIXOYLHZ 7KHJDUGHQERDVWVDODNHDQRWKHUVKHOWHUHGWHUUDFHDQGDUHVLGHQWLDOJDUGHQKRXVHZLWKDÀUHSODFHJXDUDQWHHLQJDEVROXWHSULYDF\ ǝǺǮǼDZǸDZǹǹȇǵǽǶǺǸȀǺǼǾǺǸǺǭǺǼǿǰǺǮǬǹǹȇǵǰǺǸǻǷǬǹǴǼǺǮǶǴǮǽǻǺǶǺǵǹǺǸDzǴǷǺǸǼǬǵǺǹDZǖǰǺǸǿǺǾǹǺǽǴǾǽȋǿȁǺDzDZǹǹȇǵǽǬǰǽǻǼǿǰǺǸǴǶǬǸǴǹǺǸǹǬǺǾǶǼȇǾǺǸǮǺdzǰǿȁDZǚǾǶǼȇǾǬȋ dzǺǹǬǯǺǽǾǴǹǺǵǴǻǺǷǹǺǽǾȈȊǺǭǺǼǿǰǺǮǬǹǹǬȋǶǿȁǹȋ Ǹ2 ǽǮȇȁǺǰǺǸǹǬǾDZǼǼǬǽǿǴǮǽǬǰǽǻǬǷȈǹǴ ǺǰǹǬǽǮȇȁǺǰǺǸǹǬǾDZǼǼǬǽǿǹǬǻDZǼǮǺǸȉǾǬDzDZǽǻǬǷȈǹȋǽǮȇȁǺǰǺǸǹǬǾDZǼǼǬǽǿǹǬ ǶǼȇȄDZǽǻǼDZǶǼǬǽǹȇǸǮǴǰǺǸ ǝǬǰǽǻǼǿǰǺǸǶǼȇǾǺDZǻǬǾǴǺǴǰǼǿǯǴDZDzǴǷǺǵǽǬǰǺǮȇǵǰǺǸǴǶǽǶǬǸǴǹǺǸǯǬǼǬǹǾǴǼǿȊǾǬǭǽǺǷȊǾǹǿȊǶǺǹȀǴǰDZǹȂǴǬǷȈǹǺǽǾȈ

3URQiMHPTo rentnjǼDZǹǰǬ.ÿPĚVtF 9,3+RPHV-DQiÿNRYRQiEŐHæt3UDKD7HO 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

63


1RYRVWDYEDGRPXXĜtÿDQ1HZO\EXLOWKRXVHQHDUĜtÿDQ\ɨɠɟɛɝɨɩɪɩɬɭɫɩɠɨɨɶɤɟɩɧ 1RYRVWDYEDGRPXYREFL=ODWiXŏtÿDQE\ODGRNRQÿHQDYURFH8æLWQiSORFKDGRPXP2SR]HPHNP2.UiVQi]DKUDGDRVi]HQiPQRKDGŐHYLQDPLVNU\WëPED]pQHPVSURWLSURXGHP]DUXÿXMHSRKRGOtDUHOD[DFLQRYëPPDMLWHOŢP-HGQiVHRYHOPLSURVOXQĚQëGŢPQDMHKRæVWDYEXE\O\SRXæLW\NYDOLWQtPDWHULiO\åXORYiSUDFRYQtGHVNDYNXFK\QL]PDVLYXVWHMQĚWDN NDPHQQpGHVN\YNRXSHOQiFKNDPHQQpSDUDSHW\XHXURRNHQ.UEYREëYDFtPSRNRMLVWHSORWQtPUR]YRGHPGRSDWUD1iE\WHNQDPtUXMHQHGtOQRXVRXÿiVWLGRPX)UDQFRX]VNpGYHŐHVHYVWXSHPQDWHUDVXYLQQëVNOtSHNSRGGRPHP3RGODKRYpWRSHQtYNXFK\QLDNRXSHOQiFK'ŢPGLVSRQXMHQĚNROLNDORæQLFHPLSUDFRYQRXäDWQRX'RSRUXÿXMHPHSURURGLQQpE\GOHQtGLN\GRVWDWNX ]HOHQĚNOLGXDYëERUQpREÿDQVNpY\EDYHQRVWLYRNROt'RVWXSQRVWMDNÿHVNëFKWDNPH]LQiURGQtFKäNROREFKRG\GREUpVSRMHQtGRFHQWUDŏtÿDQY]GiOHQëFKGRNP0RæQRVWDXWREXVRYpKR QHERYODNRYpKRVSRMHQtGRFHQWUD3UDK\ 7KLVQHZKRXVHLQWKHYLOODJHRI=ODWDQHDUŏtÿDQ\ZDVFRPSOHWHGLQ7KHXVDEOHDUHDRIWKHKRXVHLVPñVLWXDWHGRQDPñSORW7KHEHDXWLIXOHVWDEOLVKHGJDUGHQZLWKPDQ\ WUHHVDQGFRYHUHGVZLPPLQJSRROZLWKFRXQWHUÁRZJXDUDQWHHFRPIRUWDQGUHOD[DWLRQWRWKHQHZRZQHUV7KHKRXVHLVH[WUHPHO\VXQOLWDQGEXLOWRITXDOLW\PDWHULDOV*UDQLWHZRUNWRSLQWKHVROLGZRRGHQNLWFKHQDVZHOODVVWRQHVODEVLQWKHEDWKURRPV7KH(XURZLQGRZVKDYHVWRQHZLQGRZVLOOV7KHÀUHSODFHLQWKHOLYLQJURRPSURYLGHVKHDWGLVWULEXWLRQWRWKHVWÁRRU7KHWDLORUHG IXUQLWXUHLVDQLQWHJUDOSDUWRIWKHKRXVH7KHUHDUH)UHQFKGRRUVZLWKDQH[LWWRDWHUUDFHDQGDZLQHFHOODULQWKHKRXVH8QGHUÁRRUKHDWLQJLQNLWFKHQDQGEDWKURRPV7KHKRXVHFRPSULVHV several bedrooms, a study and a dressing room. We recommend this house as a family dwelling, due to its abundance of greenery, tranquillity and the excellent civic amenities in the viciniW\7KHUHLVJRRGDFFHVVLELOLW\WR&]HFKDVZHOODVLQWHUQDWLRQDOVFKRROVVKRSVDQGFRQYHQLHQWWUDYHOOLQNVWRWKHFHQWUHRIŏtÿDQ\ZKLFKLVNPDZD\7KHUHLVWKHRSWLRQRIEXVRUWUDLQWUDQVport to the centre of Prague. ǙǺǮȇǵǰǺǸǮǹǬǽDZǷDZǹǹǺǸǻǿǹǶǾDZ=ODWDX5LFDQǽǾǼǺǴǾDZǷȈǽǾǮǺǭȇǷǺdzǬǮDZǼȄDZǹǺǮǯǺǰǿǒǴǷǬȋǻǷǺȅǬǰȈǰǺǸǬǸ2ǿȃǬǽǾǺǶǸ2ǎDZǷǴǶǺǷDZǻǹȇǵǽǬǰǽǭǺǷȈȄǴǸǶǺǷǴȃDZǽǾǮǺǸ ǰDZǼDZǮȈDZǮ ǽ ǶǼȇǾȇǸ ǭǬǽǽDZǵǹǺǸ ǽ ǻǼǺǾǴǮǺǾǺǶǺǸ ǺǭDZǽǻDZȃǴǾ ǹǺǮȇǸ ǮǷǬǰDZǷȈȂǬǸ ǶǺǸȀǺǼǾ Ǵ ǮǽDZ ǿǽǷǺǮǴȋ ǰǷȋ ǺǾǰȇȁǬ Ǵ ǼǬǽǽǷǬǭǷDZǹǴȋ ǚȃDZǹȈ ǽǺǷǹDZȃǹȇǵ ǰǺǸ ǻǺǽǾǼǺDZǹǹȇǵ Ǵdz ǮȇǽǺǶǺǶǬȃDZǽǾǮDZǹǹȇȁǸǬǾDZǼǴǬǷǺǮǏǼǬǹǴǾǹǬȋǽǾǺǷDZȄǹǴȂǬǮǶǿȁǹDZǴdzǸǬǽǽǴǮǹǺǵǰǼDZǮDZǽǴǹȇǬǾǬǶDzDZǶǬǸDZǹǹȇDZǻǷǴǾǶǴǮǮǬǹǹȇȁǶǺǸǹǬǾǬȁǶǬǸDZǹǹȇDZǻǬǼǬǻDZǾȇǿDZǮǼǺǺǶǺǹǖǬǸǴǹ ǮǯǺǽǾǴǹǺǵǽǻǼǴǮǺǰǺǸǾDZǻǷǺǯǺǮǺdzǰǿȁǬǹǬȉǾǬDzǘDZǭDZǷȈǹǬdzǬǶǬdzǾǺDzDZȋǮǷȋDZǾǽȋǹDZǺǾȆDZǸǷDZǸǺǵǽǾǴǷȈǹǺǵȃǬǽǾȈȊǰǺǸǬǠǼǬǹȂǿdzǽǶǴDZǰǮDZǼǴǽǮȇȁǺǰǺǸǹǬǾDZǼǼǬǽǿǮǴǹǹȇǵǻǺǯǼDZǭ ǻǺǰǰǺǸǺǸǛǺǷȇǽǻǺǰǺǯǼDZǮǺǸǹǬǶǿȁǹDZǴǮǮǬǹǹȇȁǶǺǸǹǬǾǬȁǎǰǺǸDZDZǽǾȈǹDZǽǶǺǷȈǶǺǽǻǬǷDZǹǶǬǭǴǹDZǾǯǬǼǰDZǼǺǭǹǬȋǜDZǶǺǸDZǹǰǿDZǾǽȋǰǷȋǻǼǺDzǴǮǬǹǴȋǽDZǸȈǴǴdzdzǬǸǹǺDzDZǽǾǮǬdzDZǷDZǹǴ ǽǻǺǶǺǵǽǾǮǴȋǼǬdzǮǴǾǺǵǴǹȀǼǬǽǾǼǿǶǾǿǼȇǮǺǶǼDZǽǾǹǺǽǾȋȁǙǬǷǴȃǴDZȃDZȄǽǶǺǵǴǸDZDzǰǿǹǬǼǺǰǹǺǵȄǶǺǷȇǸǬǯǬdzǴǹǺǮȁǺǼǺȄǺǽǮȋdzǬǹǽȂDZǹǾǼǺǸǯǺǼǺǰǬǜDzǴȃǬǹȇ²ǼǬǽǽǾǺȋǹǴDZǮǻǼDZǰDZǷǬȁ ǶǸǎǺdzǸǺDzǹǺǽǾȈǬǮǾǺǭǿǽǺǸǴǷǴǻǺDZdzǰǺǸǰǺǭǼǬǾȈǽȋǰǺȂDZǹǾǼǬǛǼǬǯǴ

&HQD3ULFH.ÿ&=. 0JU,YD6HLIHUWRYi3ODWQpĝVNi3UDKDWHOHPDLOLQIR#VHLIHUWUHDOF]ZZZVHLIHUWUHDOF] 64

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


/X[XVQtYLOD7XFKRPčĝLFH/X[XU\9LOODLQ7XFKRPčĝLFHɋɩɬɥɩɳɨɛɺɝɣɦɦɛɝɍɮɰɩɧɠɫɡɣɱɛɰ 0RGHUQtYLOD]URNXOHætQDSŐHNUDVQpPSR]HPNXXOHVDRUR]OR]HP28æLWQiSORFKDGRPXP2JDUiæHSURDXWDVPRæQRVWtSDUNRYDQtQDGYRŐHFFDGDOätFK²DXW]ÿHKRæ SRVN\WXMHNU\WpVWiQLSURYR]\9LODMHQDGVWDQGDUGQtVSRXæLWtPSRX]HNYDOLWQtFKPDWHULiOŢDQDEt]tURGLQQpE\GOHQtY\MtPHÿQpNYDOLW\DGHVLJQX3OQĚDXWRPDWLFNpVWDKRYiQtPDUNë]]iYĚVŢ ]iFORQHOHNWURQLFNiYUDWDDSURVNOHQëYëWDK]DUXÿXMtSRKRGOQpIXQJRYiQtGRPX&HORVNOHQĚQpVFKRGLäWĚPXSDNGRGiYiQDY\MtPHÿQRVWLDOX[XVX9SŐt]HPtGRPXMHSURSRMHQëREëYDFtSURVWRU VNXFK\QtMtGHOQRXSUDFRYQRXDKDOD&HOëSURVWRUO]HUR]GĚOLWSURVNOHQRXVWĚQRX9SDWŐHMVRXSDNORæQLFHVNRXSHOQDPLDäDWQDPL9GRPĚQDOH]QHWHYODVWQtE\WSURVOXæHEQRXYSŐt]HPtSDN WHFKQLFNRXPtVWQRVWVDXQXZKLUOSRRODM1DSR]HPNXMHYODVWQtVWXGQD]DEH]SHÿRYDFtV\VWHPVRODUQtSDQHO\WHSHOQpYUW\DGDOätYODVWQt]GURMHSRWŐHEQpSURFKRGGRPX

0RGHUQYLOODEXLOWLQRQDEHDXWLIXOP2 plot by a forest. The useable area of the house is 900 m2JDUDJHVIRUFDUVSOXVDQRWKHU²FDUVFDQSDUNLQWKHFRXUW\DUGLQFOXGLQJ 2 roofed spaces. The villa is above the standard, uses quality materials only, and offers family living of exceptional quality and design. Fully automated lowering of marquees, drapes and FXUWDLQV HOHFWURQLF JDWH DQG JOD]HG HOHYDWRU IRU FRPIRUWDEOH IXQFWLRQLQJ RI WKH KRXVH $OOJODVV VWDLUFDVH IRU DQ DGGHG VHQVH RI H[FHSWLRQDOLW\ DQG OX[XU\ 7KH JURXQG Á RRU FRQWDLQV DQ LQWHUFRQQHFWHGOLYLQJDUHDZLWKDNLWFKHQGLQLQJURRPDQGVWXG\DQGDKDOOZD\7KHDUHDFDQEHGLYLGHGZLWKDJODVVZDOO7KHXSSHUÁRRUFRQWDLQVEHGURRPVZLWKEDWKURRPVDQGGUHVVLQJ URRPV7KHUHLVDVHSDUDWHÁDWIRUWKHPDLGWKHJURXQGÁRRUKDVDXWLOLW\URRPVDXQDZKLUOSRROHWF7KHSORWKDVLWVRZQZDWHUZHOOVHFXULW\V\VWHPVRODUSDQHOVWKHUPDOERUHVDQGRWKHU own sources required for the house to operate.

ǝǺǮǼDZǸDZǹǹǬȋǮǴǷǷǬǯǺǰǬǹǬȁǺǰǴǾǽȋǹǬǻǼDZǶǼǬǽǹǺǸǿȃǬǽǾǶDZǿǷDZǽǬǽǻǷǺȅǬǰȈȊǸ2ǛǺǷDZdzǹǬȋǻǷǺȅǬǰȈǰǺǸǬǸ2ǯǬǼǬDzǹǬǸǬȄǴǹȇǮǺdzǸǺDzǹǺǽǾȈǻǬǼǶǺǮǶǴǮǺǰǮǺǼDZ DZȅDZ²ǬǮǾǺǸǺǭǴǷDZǵǴdzǹǴȁǹǬǶǼȇǾǺǵǻǬǼǶǺǮǶDZǎǴǷǷǬǴǸDZDZǾǮȇǽǺǶǴǵǽǾǬǹǰǬǼǾǮǽǾǼǺǴǾDZǷȈǽǾǮDZǭȇǷǴǴǽǻǺǷȈdzǺǮǬǹȇǾǺǷȈǶǺǮȇǽǺǶǺǶǬȃDZǽǾǮDZǹǹȇDZǸǬǾDZǼǴǬǷȇȉǾǺǮȇǽǺǶǺǶǷǬǽǽǹǺDZ DzǴǷȈDZǰǷȋǽDZǸȈǴǴǽǶǷȊȃǴǾDZǷȈǹǺǯǺǶǬȃDZǽǾǮǬǴǰǴdzǬǵǹǬǛǺǷǹǺǽǾȈȊǬǮǾǺǸǬǾǴȃDZǽǶǺDZǿǻǼǬǮǷDZǹǴDZǸǬǼǶǴdzǬǸǴǯǬǼǰǴǹǬǸǴȄǾǺǼǬǸǴȉǷDZǶǾǼǺǹǹȇDZǮǺǼǺǾǬǴǽǾDZǶǷȋǹǹȇǵǷǴȀǾǺǭDZǽǻDZȃǴǮǬDZǾ ǷDZǯǶǿȊȉǶǽǻǷǿǬǾǬȂǴȊǰǺǸǬǝǾDZǶǷȋǹǹǬȋǷDZǽǾǹǴȂǬǾǺǷȈǶǺǰǺǭǬǮǷȋDZǾǮǴǷǷDZǴǽǶǷȊȃǴǾDZǷȈǹǺǽǾǴǴǬǾǸǺǽȀDZǼȇǼǺǽǶǺȄǴǙǬǻDZǼǮǺǸȉǾǬDzDZǹǬȁǺǰǴǾǽȋǯǺǽǾǴǹǬȋǽǶǿȁǹDZǵǴǽǾǺǷǺǮǺǵǶǬǭǴǹDZǾ ǴdzǬǷǎǽDZǻǼǺǽǾǼǬǹǽǾǮǺǸǺDzDZǾǭȇǾȈǼǬdzǰDZǷDZǹǺǽǾDZǶǷȋǹǹǺǵǽǾDZǹǺǵǙǬǮDZǼȁǹDZǸȉǾǬDzDZǼǬǽǻǺǷǺDzDZǹȇǽǻǬǷȈǹǴǽǮǬǹǹȇǸǴǶǺǸǹǬǾǬǸǴǴǯǬǼǰDZǼǺǭǬǸǴǎǰǺǸDZDZǽǾȈǺǾǰDZǷȈǹǬȋǶǮǬǼǾǴǼǬ ǰǷȋǻǼǴǽǷǿǯǴǹǬǹǴDzǹDZǸȉǾǬDzDZǾDZȁǹǴȃDZǽǶǬȋǶǺǸǹǬǾǬǽǬǿǹǬǰDzǬǶǿdzǴǴǾǰǙǬǿȃǬǽǾǶDZǽǺǭǽǾǮDZǹǹȇǵǶǺǷǺǰDZȂǽǴǽǾDZǸǬǭDZdzǺǻǬǽǹǺǽǾǴǽǺǷǹDZȃǹȇDZǭǬǾǬǼDZǴǾDZǻǷǺǮȇDZǽǶǮǬDzǴǹȇǴǰǼǿǯǴDZ ǽǺǭǽǾǮDZǹǹȇDZǼDZǽǿǼǽȇǹDZǺǭȁǺǰǴǸȇDZǰǷȋȉǶǽǻǷǿǬǾǬȂǴǴǰǺǸǬ

&HQD3ULFHLQIRY5.LQIRXSRQUHTXHVWȿɩɪɣɨɯɩɫɧɝɛɞɠɨɭɬɭɝɠ 0JU,YD6HLIHUWRYi3ODWQpĝVNi3UDKDWHOHPDLOLQIR#VHLIHUWUHDOF]ZZZVHLIHUWUHDOF] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

65


2012

2012

2012

VINÁRNA ROKU

BAR ROKU

CUKRÁRNA ROKU

2012 KAVÁRNA ROKU KAVÁRNA ROKU v regionu

Celostátní soutěž Czech Gastronomy Awards je přehlídkou nejlepších gastronomických zařízení v České republice. Za cíl si klade zmapovat současný stav a kvalitu nabízených služeb a všech aspektů, které ovlivňují konečný kulinářský zážitek.

Slavnostní vyhlášení a předání cen proběhne dne 3. 12. 2012 v Praze při příležitosti gala večera Czech Gastronomy Awards.

Hlasovat můžete na stránkách www.gastronomyawards.cz

ČISTĚ

EKOLOGICKY

Conventia, s.r.o. Badeniho 290/1, 160 00 Praha 6 Tel./Fax: +420 220 515 102 IČ: 290 21 332, DIČ: CZ290 21 332 www.conventia.cz


)RFXVHGRQOX[XU\

Janáčkovo nábřeží, Praha 5 - Smíchov

prodej / sales

Byt 4+1 (198 m2) + balkon (11 m2), ve 3. patře neorenesančního domu po kompletní rekonstrukci, s panoramatickým výhledem na Vltavu a Prahu. Dubové dveře a parkety ve tvaru vídeňského kříže, kuchyňská linka zn. Poggenpohl se spotřebiči Gaggenau, alarm, 24 hod. ostraha, podíl na zahradě, sklep a 2 garážová stání. Komfortní bydlení v blízkosti Národního Divadla a Kampy. Three-bedroom apartment (198 sqm) + 11 sqm balcony on the 3rd floor of neo-renaissance building after complete reconstruction. Panoramic view to Prague and Vltava river. Oak doors and parquet with Viennese cross motif, kitchen unit Poggenpohl with Gaggenau appliances, alarm, 24/7 security, aliquot part of garden, cellar and 2 parking spaces. Luxury living in historical centre; close to the National Theater and Kampa Park.

Cena: / Price: 39 700 000 CZK Ceny jsou uvedeny včetně DPH. The prices indicated are inclusive of VAT

LEXXUS EXXUS XXUS XUS USS a.s., a.s. a.s .s., s.,., Millennium Millenn Millen Mille Mill Mil Mi M illenn lenni enniu nnium nniu nium ium um m Plaza, Pla P Plaz laza aza, za, a, V Celnici 10, 0, 110 0, 11 11 10 0 00 Praha 1 tel.: +420 420 20 0 221 21 111 11 1 11 1 922, 922 92 22, 2, www.lexxusnorton.cz, w www. www ww ww.lex ww.le w.lexx .lexx exxu xxus xusn usno sno nort orto rton ton on.c n.cz e-mail: ailil: ai ail: iill:l: info@lexxusnorton.cz iin inf info n nff


)RFXVHGRQOX[XU\

Ke Kulišce, Praha 6 - Dejvice

prodej / sales

Vila s dispozicí 6+1 je součástí komplexu Dubový mlýn, uzavřeného areálu 12ti vil s recepcí a ostrahou. Dům nabízí dostatek prostoru pro velkou rodinu na dvou nadzemních podlažích a parkování pro dva vozy v úrovni 1. PP. Interiér je proveden v exkluzivním designu, zároveň dům disponuje atraktivním vnějším vzhledem, kde fasáda je oživena použitím přírodních materiálů - obklad z kamene a dřeva. Dům je obklopen vlastní zahradou se vzrostlou zelení. Nemovitost je mimořádně atraktivní i svou dobrou dostupností do mezinárodní školy v Nebušicích. 5 bedroom villa within the Dubovy Mlyn gated estate. The villa offer ample space for a large family over her two floors plus parking for two cars on the basement level. Villa combines an attractive outlook and a facade refreshed by using natural materials, with interior is exclusively designed. Sculptured mature garden envelopes the house. Property is attractive for its proximity to International school in Nebusice and Prague British School.

Cena: / Price: 33 000 000 CZK Ceny jsou uvedeny včetně DPH. The prices indicated are inclusive of VAT

68

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

LEXXUS EXXUS XXUS XUS USS a.s., a.s a.s. .s., s.,., Millennium Millenn Millen Mille Mill M Milillenn Mi lenni enniu nnium nniu nium ium um m Plaza, Pla P Plaz laza aza, za, a, V Celnici 10, 0, 1 0, 11 110 10 1 0 00 Praha 1 tel.: +420 420 20 0 221 21 111 11 111 1 922, 922 92 22, 2, www.lexxusnorton.cz, w www. www ww ww.lex ww.le w.lexx .lexx exxu xxus xusn usno sno nort orto rton ton on.c n.cz e-mail: ailil: ai ail: iill:l: info@lexxusnorton.cz iin inf info nff n


)RFXVHGRQOX[XU\

Za Špejcharem, Horoměřice

prodej / sales

Velmi příjemný a kvalitně postavený dům v klidné části Horoměřic, nabízející klid a soukromí. Vzdušný interier - v celém domě je výška stropů 3 m - nabízí pohodu a dostatek prostoru i pro větší rodinu. Zahrada je prakticky rozdělena na květinovou - okrasnou část s parkovou úpravou a užitnou část pro relaxaci s altánem a zahradním grilem. Prostorný obývací pokoj, vybavená kuchyně, dvě pracovny, dvougaráž, sauna a velký pokoj vhodný pro kinosál, nebo fitness, hernu, apod. V patře je 5 samostatných ložnic. Dům má 3 koupelny a prostornou šatnu. Very pleasant house constructed to an high quality and located within a tranquil and private part of Horomerice. Spacious interior offers an environment even for the largest family – ceiling height 3m throughout the house! Well tendered garden, divided into decorative park-style and relaxation zone with a barbecue and gazebo. Spacious living room, fitted kitchen, 2 separate study rooms, 2 garages, storage, sauna and large fitness or home cinema room. 5 bedrooms with 3 bathrooms and accessories.

Cena na vyžádání / Price upon request LEXXUS EXXUS XXUS XUS USS a.s., a.s. a.s .s., s.,., Millennium Millenn Millen Mille Mill Mil Mi M illenn lenni enniu nnium nniu nium ium um m Plaza, Pla P Plaz laza aza, za, a, V Celnici 10, 0, 110 0, 11 11 10 0 00 Praha 1 tel.: +420 420 20 0 221 21 111 11 1 11 1 922, 922 92 22, 2, www.lexxusnorton.cz, w www. www ww ww.lex ww.le w.lexx .lexx exxu xxus xusn usno sno nort orto rton ton on.c n.cz e-mail: ailil: ai ail: iill:l: info@lexxusnorton.cz iin inf info n nff


Prodej | Praha â&#x20AC;&#x201C; zĂĄpad | 725 m2 | pozemek 5 000 m2 |FHQDQDY\çiGiQt ZĂĄmek, bazĂŠn, sauna, jacuzzi, vinnĂ˝ sklep, krb, terasa o velikosti 120 m2]DKUDGQtDOWiQVOHWQtNXFK\QtYĂŹWDKSUiGHOQDORçQLF s vlastnĂ­ koupelnou a toaletou, 3 kuchynĂŹ, 2 sĂĄly, knihovna, spoleèenskĂĄ mĂ­stnost. Budovy vznikly jako panskĂ˝ velkostatek ve druhĂŠm GHVHWLOHWtVWROHWtSDNYURFHE\OXçSURGiYiQMDNR]iPHN.RPSOHWQtUHQRYDFHSUREÄ&#x2122;KODYURFHWDNDE\]iPHN splòoval nĂĄroky modernĂ­ho bydlenĂ­. PĂšvodnĂ­ zĂĄmeckĂŠ rodinnĂŠ sĂ­dlo z roku 1720 v malebnĂŠm zĂĄkoutĂ­ malĂŠ obce uprostøed lesĂš 20 minut z centra Prahy.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

70

1(-/(3Ä?Ă&#x152;1(029,7267,,%(673523(57,(6,Ç&#x201A;Ç&#x160;Ç&#x17D;Ç?ĆśÇ&#x2013;Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;

svoboda-williams.com


Sale | Praha – západ | 725 m2 | land 5 000 m2 | price upon request Castle, swimming pool, sauna, Jacuzzi, wine cellar, fireplace, terrace of 120 m2, garden gazebo with summer kitchen, elevator, laundry room, 9 bedrooms with en-suite bathroom and toilet, 3 kitchens, 2 large ballrooms, library, lounge. The buildings were built as a manor estate in the second decade of 18th century, then in 1798 they were already sold as a castle. Complete renovation took place in 2008, so that the castle meets all the demands of modern living. Original castle built in 1720 situated on a picturesque place in a small village, surrounded by forests of and yet 20 minutes from the center of Prague.

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

71


Prodej | Praha 5 | Smรญchov | 185 + 65 m2 | 24 050 000 Kรจ %\WNNVWฤจHรฅQtWHUDVDEDONRQ\MDFX]]LNRXSHOQ\VStรงSDUNHW\DGODรงEDYHVWDYฤ™Qp~ORรงQpSURVWRU\VNOHSJDUiรงRYiSDUNRYDFtVWiQt 1DGVWDQGDUGQtE\WVQHUXรฅHQรฌPLSDQRUDPDWLFNรฌPLYรฌKOHG\QD3UDKXYSDWฤจHPRGHUQtUH]LGHQFHSiUPLQXWRGIUDQFRX]VNpKRO\FHD EHGURRPDSDUWPHQWURRIWHUUDFHEDOFRQLHVMDFX]]LEDWKURRPVSDQWU\SDUTXHWDQGWLOHIORRUVEXLOWLQZDUGUREHVFHOODUJDUDJH SDUNLQJVSDFHV+LJKVWDQGDUGDSDUWPHQWZLWKEHDXWLIXOYLHZVRI3UDJXHRQWKHWKIORRURIDPRGHUQUHVLGHQFHPLQXWHVIURP the French School.

Pro kompletnรญ nabรญdku navลกtivte / For complete property listing please visit

72

1(-/(3ฤรŒ1(029,7267,,%(673523(57,(6,ว‚วŠวŽวฦถว–ว„ฦปฦบฦธฦฟฦฝฦฟวƒว…วˆว‰ว“

svoboda-williams.com


Prodej | Praha 1 | StarĂŠ MĂŹsto | 108 m2 | 12 800 000 Kè %\WNNSUDFRYQDYHONiRNQDSDUNHW\UHSDVRYDQpLQWHULpURYpGYRXNĨtGOpGYHĨHVNOHS=UHNRQVWUXRYDQĂŹNODVLFNĂŹE\WYHSDWĨHÄ&#x20AC;LQçRYQtKR domu s vĂ˝tahem a pĂŹknĂŹ renovovanĂ˝mi vstupnĂ­mi prostory, pĂĄr krokĂš od stanice metra NĂĄmĂŹstĂ­ Republiky, v pĂŹĹĄĂ­m dosahu VĂĄclavskĂŠho a StaromĂŹstskĂŠho nĂĄmĂŹstĂ­. 2-bedroom apartment, study, large windows, parquet floors, renovated interior double doors, cellar. Centrally located reconstructed 3rd floor apartment in a residential building with lift and a beautifully renovated entrance area, a few minute walk to the Old Town Square or Wenceslas Square, steps from metro and trams at the NĂĄmĂŹstĂ­ Republiky Square.

Na PerťtýnÏ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

352'(-,6$/(6,Ç&#x2020;Ç&#x2021;Ç&#x2026;ƺƜƝÇ&#x2030;Ç&#x2C6;Ç&#x2013;/,6723$',129(0%(5,Ç&#x201E;Ç&#x2026;Ç&#x2013;ơÇ&#x2021;Ç&#x201C;

73


Prodej | Praha 10 | Benice | 308 + 33 m2 | pozemek 975 m2 | 16 476 690 Kè 9LODWHUDV\EDONyQ\ĂĽDWQ\VDPRVWDWQiNXFK\Ä&#x17E;MtGHOQDSUDFRYQDNRXSHOQ\WRDOHWDSURKRVW\NRPRUDJDUiçSUR DXWD)UDQFRX]VNiRNQDSĨtSUDYDQDNUEGYRMLWiYĂŹĂĽNDVWURSXYREĂŹYDFtPSRNRMLPQRçVWYt~ORçQpKRSURVWRUX)RWRJUDILHLQWHULpUX MVRX]HY]RURYpKRGRPX1RYĂŹURGLQQĂŹGÄŁPVH]DKUDGRXYDUFKLWHNWRQLFN\VMHGQRFHQpSÄŁVRELYpUH]LGHQÄ&#x20AC;QtORNDOLWÄ&#x2122;PLQXW od centra Prahy.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

74

1(-/(3Ä?Ă&#x152;1(029,7267,,%(673523(57,(6,Ç&#x201A;Ç&#x160;Ç&#x17D;Ç?ĆśÇ&#x2013;Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;

svoboda-williams.com


Sale | Praha 10 | Benice | 308 + 33 m2 | land 975 m2 | 16 476 690 CZK 7-bedroom villa, 2 terraces, 4 balconies, 3 walk-in closets, separate kitchen, dining room, study, 4 bathrooms, half bath, chamber, garage for two cars. French windows, preparation for fireplace, double height ceiling in the living room, ample storage space. Photos of the interior are from the show house. New family house with garden located in an architecturally unified and impressive residential area just 20 minutes from the center of Prague.

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

75


Prodej | Praha â&#x20AC;&#x201C; vĂ˝chod | Mnichovice | 600 m2 | pozemek 6 800 m2 | 25 382 000 Kè 9LODED]pQWHUDVDVOHWQtNXFK\QtILWQHVVVDXQDJROIRYpMDPN\ĂĽDWQ\NRXSHOQ\JDUiçHSURFHONHPYR]ÄŁ1DGVWDQGDUGQt rodinnĂĄ vila s velkou okrasnou bezĂşdøbovou zahradou zahradou nabĂ­zejĂ­cĂ­ velmi privĂĄtnĂ­ atmosfĂŠru a pohodlĂ­ pro rodinnĂŠ bydlenĂ­. 6-bedroom villa, swimming pool, terrace with summer kitchen, fitness, sauna, 2 holes golf course, 3 walk-in closets, 3 bathrooms, 2 garages for 10 cars. High standard family residence with matured garden offering very private atmosphere and comfort living.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

76

1(-/(3Ä?Ă&#x152;1(029,7267,,%(673523(57,(6,Ç&#x201A;Ç&#x160;Ç&#x17D;Ç?ĆśÇ&#x2013;Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;

svoboda-williams.com


Prodej | Praha 4 | Braník | 103 + 16 m2 | 8 925 000 Kè %\WNNWHUDVDNRXSHOQ\WRDOHWDSURKRVW\NRPRUDGĨHYęQpSRGODK\EH]SHĀQRVWQtYVWXSQtGYHĨHVNOHSJDUiçRYiSDUNRYDFtVWiQt YFHQę1RYìE\WVNUiVQìPYìKOHGHPYHSDWĨHQRYRVWDYE\YNOLGQpYLORYp]iVWDYEę%UDQtND EHGURRPDSDUWPHQWWHUUDFHEDWKURRPVKDOIEDWKFKDPEHUZRRGHQIORRUVVHFXULW\HQWUDQFHGRRUFHOODUJDUDJHSDUNLQJ VSDFHVLQFOXGHGLQWKHSXUFKDVHSULFH1HZDSDUWPHQWZLWKEHDXWLIXOYLHZVRQWKHrdIORRURIDQHZO\EXLOWUHVLGHQFHLQDTXLHW UHVLGHQWLDODUHDRI%UDQtN

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

77


Prodej | Praha 5 | Koťíøe | 95 + 12 m2 | 7 975 370 Kè %\WNNWHUDVDORçQLFHNRXSHOQ\ĂĽDWQDVNOHSJDUiçRYpSDUNRYDFtVWiQt1RYĂŹE\WYPRGHUQtUH]LGHQFLRENORSHQpYLODPL]SUYQt UHSXEOLN\QDEt]tSOQRXREÄ&#x20AC;DQVNRXY\EDYHQRVWDYHOPLGREUpVSRMHQtVFHQWUHP3UDK\6SRUWRYFLRFHQtWHQLVRYpDVTXDVKRYpNXUW\Ä&#x20AC;L KRUROH]HFNRXVWÄ&#x2122;QXYREODVWL]YDQp&LEXONDQHERQHGDOHNpJROIRYpKĨLĂĽWÄ&#x2122;Y0RWROH1iNXSQt]yQD$QGÄ&#x2122;OD1RYĂŹ6PtFKRYQDEt]HMt LGHiOQtSĨtOHçLWRVWLNQDNXSRYiQtD]iEDYÄ&#x2122;.XSQtFHQDE\WXMHXYHGHQDEH]'3+

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

78

1(-/(3Ä?Ă&#x152;1(029,7267,,%(673523(57,(6,Ç&#x201A;Ç&#x160;Ç&#x17D;Ç?ĆśÇ&#x2013;Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;

svoboda-williams.com


Sale | Praha 5 | Košíøe | 95 + 12 m2 | 7 975 370 Kè 2-bedroom apartment, terrace, 2 bathrooms, walk-in closet, cellar, garage parking space. New flat in a modern residence surrounded by villas from the period of the so-called First Czechoslovak Republic offers all necessary amenities and a very good connection with the center of Prague. Sport lovers will appreciate tennis and squash courts or the indoor climbing wall in the so-called Cibulka area or the golf course in Motol. The Andìl and Nový Smíchov shopping zones offer ideal opportunities for shopping and entertainment. The purchase price is subject to VAT additional.

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

79


Byt 3+kk, 91 + 19 m2, Praha 7 – Holešovice, U Uranie | 6 900 000 Kč Byt zařízený ve vyšším standardu, s terasou a parkováním ve zrevitalizované budově bývalého pivovaru, se snadnou dostupností do centra, v žádané a rychle se rozvíjející lokalitě Holešovic. Otevřený koncept obývacího pokoje s plně vybavenou kuchyní a přístupem na velkou terasu, 2 světlé ložnice, koupelna se sprchou i vanou a vstupní hala. Industriální atmosféra se zachovaným původním rázem objektu z 19. století je kombinována s požadavky rezidentů na moderní bydlení: velkoformátová okna, dřevěné podlahy, rošty z tropického dřeva na terase, vestavěné skříně, dále podzemní parkování, oddělená sklepní kóje. High-standard 2-bedroom apartment with terrace in a revitalized old brewery complex located in Holešovice, with easy access to the city center. Well proportioned apartment offers open concept of living room with fully fitted kitchen and terrace access, 2 bright bedrooms, bathroom with shower and tub, and entry hall. Wooden floors and windows, deck from tropical woods, built-in wardrobes, 1 garage parking space, 1 cellar. Industrial atmosphere of brewery complex, modern living close to the city center and Vltava waterfront.

Pro kompletní nabídku navštivte / For complete property listing please visit

80

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Prodej

Pronájem

Byt 4+kk, 106 + 4 m2, Praha 3 – Žižkov, Žerotínova | 5 990 000 Kč Designový, klimatizovaný mezonet s terasou situovaný v 7. a 8. podlaží kompletně zrekonstruovaného činžovního domu z 30-tých let. V klidné ulici se vzrostlými stromy, v docházkové vzdálenosti od parku Parukářka. První podlaží: obývací prostor s kuchyní, ložnice, koupelna. Druhé podlaží: 2 ložnice, koupelna, šatna. Masivní nášlapné vrstvy podlah v palisandrové mozaice, břidlicové velkoformátové obklady, koupelnové zařízení Duravit / Starck / Ritmonio / Hoesch, bezfalcové dveře, designové osvětlení, alarm. Z terasy panoramatický výhled. Two-storey high class apartment with a terrace situated on the 7th and 8th floor of a completely reconstructed residential building from the 1930s on a quiet street with mature trees. 1st floor: living room with open kitchen, bedroom, bathroom. 2nd floor: 2 bedrooms, bathroom, walk-in closet. Wooden floors, large slate tiles, Duravit / Starck / Ritmonio / Hoesch bathroom fittings, recessed lighting, air-conditioning, alarm. Panoramic view from the terrace.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

81


Byt 2+1, 71 m2, Praha 3 – Žižkov, Hájkova | 4 900 000 Kč Moderní světlý byt situovaný v 5. patře činžovní budovy, v klidné ulici lemované stromy a zároveň v blízkosti zastávky tramvaje. Byt nabízí otevřený koncept obývacího pokoje, zařízené kuchyně a jídelního prostoru, pracovní kout, ložnici, koupelnu a komoru. Bambusové podlahy, vestavěné skříně v ložnici, výtah. Vítkov i Parukářka v docházkové vzdálenosti, zastávka tramvaje 4 minuty chůze od domu. Bright modern apartment situated on 5th floor of residential building, in a quiet street lined with trees, close to the Vítkov and Parukářka park, 4 minute walk to tram stop. The flat offers open concept of living room with dining area, fitted open kitchen and study area, bedroom, bathroom, storage room. Bamboo floors, built-in wardrobes, lift.

Pro kompletní nabídku navštivte / For complete property listing please visit

82

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Prodej

Pronájem

Byt 2+kk, 43 m2, Praha 5 – Smíchov, Na Václavce | 3 900 000 Kč Designový dvoupokojový kompletně vybavený byt ve 3. podlaží činžovního domu po částečné rekonstrukci, v klidné ulici a v blízkosti parku Santoška. Vstupní hala, obývací prostor s otevřenou kuchyní, ložnice, šatna, koupelna a toaleta pro hosty. Plně vybavená kuchyň, nábytek na míru, designové elektroprvky a koupelnové vybavení, velkoformátové obklady v koupelně, kamenný obklad v obývacím pokoji. Rychlá dostupnost k zábavně-obchodnímu centru Anděl i do centra. Fully furnished design 2-bedroom apartment situated on the 2nd floor of residential building after partially renovation. Quiet street, close to Santoška park, easy access to the Anděl commercial zone. Interior of the flat has an entry hall, living room, open kitchen, bedroom, bathroom, walk-in closet, guest toilet. Custom made furniture, design bathroom fixtures / fittings, large format tiles, stone facing.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

83


Byt 2+1, 86 + 14 m2, Praha 8 – Karlín, Šaldova | 6 231 592 Kč Designový jednoúrovňový loft ve 3. podlaží kompletně zrevitalizovaného komplexu s výraznou architekturou a industriálním rázem. Vstupní hala s prostorem pro vestavěné skříně, otevřený centrální prostor možné rozdělit na společenskou a privátní část, lodžie, samostatná ložnice, koupelna, toaleta pro hosty. 24h recepce s ostrahou a kamerovým systémem, společná udržovaná zahrada. Pár minut chůze ke stanici metra Křižíkova, snadná dostupnost do centra. One-bedroom loft apartment situated in 2nd floor of a completely revitalized complex with industrial features and architecture. The apartment offers entry hall with space for built-in wardrobes, open concept of living area, dining area and kitchen, separate bedroom, bathroom, guest toilet. 24h reception with security and camera surveillance, common garden. Moments from Křižíkova metro station, easy access to the city center.

Pro kompletní nabídku navštivte / For complete property listing please visit

84

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Prodej

Pronájem

Rodinný dům 4+kk, 157 m2, pozemek 445 m2, Praha 10 – Benice | 7 232 200 Kč Rodinný dům se zahradou a garáží zasazený v architektonicky sjednocené rezidenční čtvrti na okraji Prahy se snadnou dostupností do centra. Přízemí: vstupní hala s šatnou, kuchyň, otevřený obývací pokoj s jídelním prostorem a přímým vstupem na terasu, technická místnost. První patro: 3 ložnice s balkóny, šatna, 2 koupelny. RD je k prodeji kompletně dokončený v nadstandardním provedení. 15 minut vozem po dálnici D1, v dosahu obchodní zóny Čestlice a občanské vybavenosti Průhonic. Family semidetached house with a garden and a garage is located in the architecturally unified and impressive residential area at the outskirts of Prague. Ground floor: entrance hall with walk-in closet, kitchen, living room with terrace, utility room. The first floor: 3 bedrooms with balconies, master bedroom with en-suite closet, 2 bathrooms. The property is offered completely finished. Good connection to Prague, within the reach of shopping area Čestlice and all public amenities in Průhonice.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

85


Rodinný dům 7+1/terasa/garáž

An exceptional family house 7+1/terrace/garage

Výjimečný rodinný dům 7+1/terasa/garáž Mirošovice (Praha – východ)

An exceptional family house 7+1/terrace/garage Mirošovice (Prague – east)

Autorský projekt architekta, energeticky úsporný, komfortně vybavený dům ve špičkové kvalitě. Přírodní materiály, nízké náklady, dostatek soukromí, absence typových domků ze satelitů, vlastní vinotéka... Technické parametry: 7+1/terasa (5 ložnic s vlastní koupelnou), samostatný byt v suterénu Obytná plocha: 370 m2 Pozemek: 1000 m2 Garáž pro 2 auta – vyhřívaná dlažba Příprava pro bazén nebo koupací jezírko u obytné terasy Podlahové vytápění v celém objektu, zdroj tepelné čerpadlo voda – vzduch Vlastní studna (kojenecká voda) Příprava pro centrální vysavač Zabezpečovací systém

Cena: 12 500 000 Kč

86

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

Architect’s authors project, energetically low-cost, comfortable equipped, top quality. Natural materials, modern technologies, low costs, enough privacy, absence of type houses from satellites, own vinotheque, bathroom for every bedroom... these are just few reasons for love at first sight. Technical parameters: Total floor area: 370 sqm Total grounds area: 1000 sqm Garage for 2 cars – warmed paving in front of the garage entrance Preparation for a swimming pool or a small bathing lagoon next to the habitable terrace Warmed flooring in the whole object, source – air-to-water heat pump Own well (baby water) Preparation for a central vacuum cleaner Alarm system

Price: 12 500 000 CZK


Designové vily Jesenice

Design villa houses Jesenice

Nadčasové vily ve špičkové kvalitě. 6+1/terasa/garáž Jesenice

Design villa houses 6+1/terrace/garage Jesenice

Ucelený soubor 18-ti nadčasových vil ve špičkové kvalitě. Přírodní materiály, energetická úspornost, dostatek soukromí, střechy připravené k zatravnění nebo osazení solárními panely. 3 varianty standardního vybavení

The18 luxury villas in timeless design, energy efficiency, designed by natural materials, optional with green roofs or solar panels. 3 variants of standards equipment

Technické parametry: Podlahová plocha: 210 m2 / Plocha pozemků: 701 – 786 m2 / Garáž – zámková dlažba / Topení – programovatelný plynový turbo kotel (konvektory v podlaze) / Bezpečnost – požární hlásič, bezpečnostní řídicí systém napojení na PCO / Mezinárodní škola a školka, supermarket, sportovní a rekreační areál, ...

Technical parametres: Total floor area: 210 sqm / Total grounds area: 701 – 786 sqm / Garage – interlocking pavement / Heating – programmable gas turbo boiler (convectors in the floor) / Security – fire detector, security control system connection to PCO / International school and kindergarden, supermarket, sport and recreation area, ...

Cena: 10 667 200 Kč

+420 605 230 131

Price: 10 667 200 CZK

www.czechbuildings.cz 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

87


201 2 r / ǺǶ Ǿȋǭ ǼȈ ŏí jen / Oct obe

: PORUČUJE ESTATE DO K E IN Č O P D O DOKONALÝ LI  TĚLA A MYS OF ON TI XA LA PERFECT RE D  IN M D AN DY BO ǔǐǑnj ǗǨǙǚǑ ǔǑ ǝǝ ǜnj ǗnjǍǗǑǙ nj ǘ Ǔǟ ǜnj ǞǑǗnj ǔ

architektura design OUTU Z JINÉHO K M O FR  SVĚTA RT PA T N RE FE IF AD nj Ǚ  D OF WORL Ǫ ǐǜǟǏǚǘ ǖǜnj E ǝǎǑǞnj: CHIL

stí ích nemovito Výběr nejlepš er ties op pr st be e th Selection of ɫɬɢ ɟɣɧɟɞɜɢɠɢɦɨ ȼɵɛɨɪɥɭɱɲ

Czech d Ǭǵǹ: dz ǣDZȄǽǶǴǵ ǰǴdzǬ

2 7 7 1 8 0

2012

1 8 2 1 0 0

M

9

Ȉ / ǺǶǾȋǭǼ October ŏíjen /

vá o r e k e S ichaela

SIGN/ ČESKÝ DeE sign/

CZK 95 € 4,50 £ 3,50 STÁHNĚTE SI

ǖǚǝǞnj ǐ

ESTATE UČUJE: R O P O D SOL COSTA DEL LF  O G L E D COSTA ǗǨǠ Ǐǚ ǚǝǞnj-ǐǑǗǨǑǗǨ ǝǚǗǨ ǖ

RSKÉ DEVELOPE TY: PROJEK VYHLÍDKA JINONICKÁ BYT VZOROVÝ OTEVŘELA AJE L O S OMY LY RODINNÉ D ,48( 1 8 DLENÍ  Ý STYL BY N ǓǙǔ Č ǔ E ǒ IN ǗǨ D E Ǟǔ J ENICE: nj ǗǨǙǧǕǝ ǖ ǔ Ǚ ǟ   * 1 AURA STAT 67 </(2)/,9, U R E I T E C T A R C H

N D E S I G

T Y L E L I F E S 27.9.2012

23:48:28

Předplatné


Property Investment

2OHQD<DNXERY\FK MHGQDWHOND 

LUXUSNĂ? BYT u vodnĂ­ kaskĂĄdy na Praze 6 6YÄ&#x161;WOĂŤ E\W VHQDFKi]t QD KUDQLFL 3UDK\  D 3UDK\   D MHYEH]SURVWĹ?HGQt EOt]NRVWL FHQWUD 1HPRYLWRVW MH VLWXRYDQi Y KLVWRULFNp EXGRYÄ&#x161; SR UHNRQVWUXNFL VYĂŤKOHGHPQDQiPÄ&#x161;VWtVIRQWiQRXDMHVSRMHQtPPRGHUQtKR GHVLJQX D QDGĂżDVRYp NODVLN\ %\W Pi YHOPL GREURX GLVSR]LFL D QDEt]t VYÄ&#x161;WOĂŤ RWHYĹ?HQĂŤ SURVWRUREĂŤYDFtKRSRNRMHVQDLQVWDORYDQRXOX[XVQtLWDOVNRXNXFK\Ĺ VNRXOLQNRX=REĂŤYDFtKRSRNRMH P2 MHYVWXSQDEDONRQ'iOHORĂŚQLFHPUDPRURYp NRXSHOQ\ MHGQDVYDQRXDGUXKiVHVSUFKRYĂŤPNRXWHP DYVWXSQtKDOX3URYHGHQtE\WXMHYOX[XVQtPVWDQGDUGX0RĂŚQRVWSURQiMPXSDUNRYDFtKRVWiQt SĹ?tPRSĹ?HGGRPHP.MHGQRWFHQDOHĂŚtVNOHS,QWHULpUMHY\]GREHQREUD]\XPÄ&#x161;OFH9ODGLPtUD9iYU\ Ă&#x2026;999$WHOLpU´ D,U\6YRERGRYp Ă&#x2026;$UWEDQND´  3UDKD'HMYLFHNNEDONRQVNOHSP2

LUXURY APARTMENT near the water cascades in Prague 6 The apartment is located at the attractive area on the border of Prague 1 and Prague 6 , in neighborhood of the city center. Historical building has the lift and is recently after complete reconstruction. A marriage of new build technology and period charm, this apartment has a good layout with a sunny light living room (50 m2): living&dining area with modern style Italian kitchen. Balcony, approachable from the living room area, offers the outstanding view to the square garden; 2 marble bathrooms (one with the bath another with the shower) and 2 bedrooms are oriented to the inside yard of the building. The parking spaces are available for renting just in front of the building in new covered garages. Interier is decorated with paintings by VladimĂ­r VĂĄvra (VVV Atelier) and Ira SvobodovĂĄ (â&#x20AC;&#x17E;Artbankaâ&#x20AC;&#x153;). Prague 6, Device / 2 bedroom apartment + balcony + cellar / 107 m2

&HQDQDY\ĂŚiGDQt Price on request 9iFODYVNpQiPÄ&#x161;VWt3UDKDĂžHVNi5HSXEOLND7HOZZZ<73,F]LQIR#\WSLF] 352'(-,6$/(6,Ç&#x2020;Ç&#x2021;Ç&#x2026;ƺƜƝÇ&#x2030;Ç&#x2C6;Ç&#x2013;/,6723$',129(0%(5,Ç&#x201E;Ç&#x2026;Ç&#x2013;ơÇ&#x2021;Ç&#x201C;

89


14 let zkušeností DSŐLEOLæQĚDNWXiOQtFKQHPRYLWRVWt

352'(-8REHFQtKRGYRUD6WDUp0ĚVWR3UDKD&=. 3URVWRUQëQDGVWDQGDUGQĚY\EDYHQëE\W P2 YSDWŐHXGUæRYDQpKRGRPXVYëWDKHPPLQXW\RG6WDURPĚVWVNpKRQiPĚVWt2EëYDFtSRNRMVIXQNÿQtPNUEHPORæQLFHRULHQWRYiQ\QDMLKRYëFKRGGRXOLFH+DäWDOVNi3OQĚY\EDYHQiNXFK\Ł.RXSHOQDVURKRYRX YDQRX WRDOHWRX D ELGHWHP 'DOät WRDOHWD ]YOiäŘ 'RVWDWHN ~ORæQpKR SURVWRUX 9\VRNp VWURS\ GYRMLWi GŐHYĚQi RNQD NOLPDWL]DFH WŐL WUH]RU\EH]SHÿQRVWQtGYHŐHDODUPVNOHS

6$/(8REHFQtKRGYRUDVWUHHW2OG7RZQ3UDJXHWZREHGURRPV&=. 6SDFLRXVOX[XULRXVDSDUWPHQWFRQVLVWLQJRIWKUHHURRPVDQGDNLWFKHQ VTP RQWKHVWÁRRURIDZHOOPDLQWDLQHGEXLOGLQJZLWK HOHYDWRUPLQXWHVZDONIURPWKH2OG7RZQ6TXDUH/LYLQJURRPZLWKIXQFWLRQDOÀUHSODFH%HGURRPVDUHIDFLQJWKHVRXWKHDVWWRWKH +DäWDOVNiVWUHHW)XOO\HTXLSSHGNLWFKHQ%DWKURRPZLWKEDWKWRLOHWDQGELGHW$QRWKHUWRLOHWLVVHSDUDWHO\3OHQW\RIVWRUDJHVSDFH +LJKFHLOLQJVGRXEOHZLQGRZVDLUFRQGLWLRQLQJWKUHHVDIHVVHFXULW\GRRUVDODUPFHOODU

www.happyhouserentals.com

.G\NROLYMVWHXQiVYtWiQL

WE OFFER THE BEST PROPERTY MANAGEMENT IN PRAGUE. CHECK IT OUT! 90

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


14 years of experience and around 1000 currently listed properties

Happy House Rentals, Ltd. -XQJPDQQRYD 110 00 Prague 1 7HO *60 LQIR#KDSS\KRXVHUHQWDOVFRP

352'(-=D'YRUHP+RURPĚŐLFH3UDKD]iSDG&=. 9HOPL KH]Në D SURVWRUQë URGLQQë GŢP  V WHUDVRX ]DKUDGRX D Y\KŐtYDQëP ED]pQHP 9 SŐt]HPt KDOD V YHVWDYĚQëPL VNŐtQĚPL NRXSHOQDNXFK\QĚVNRPRURXYHONëREëYDFtSRNRMVHYVWXSHPQD]DKUDGX9SDWŐHORæQLFVHNRXSHOQDPL1DSRGODKiFKSDUNHW\DGODæEDYSŐt]HPtGRPXY\WiSĚQiSRGODKD'YRMJDUiæVHVYĚWHOQëPLÿLGO\9EOt]NRVWLPH]LQiURGQtäNRO\GREUpDXWREXVRYpVSRMHQt QD0HWUR$'HMYLFNiDREÿDQVNiY\EDYHQRVWYPtVWĚ0RæQpLQDSURQiMHP

6$/(=D'YRUHP+RURPĚŐLFH3UDKD]iSDGVHYHQEHGURRPV&=. 9HU\QLFHDQGVSDFLRXVIDPLO\KRXVHZLWKURRPVNLWFKHQWHUUDFHJDUGHQDQGKHDWHGSRRO2QWKHJURXQGÁRRU²KDOOZLWKÀWWHG ZDUGUREHVEDWKURRPNLWFKHQZLWKVWRUDJHURRPDODUJHOLYLQJURRPZLWKDFFHVVWRWKHJDUGHQ2QWKHVWÁRRU²URRPVZLWK EDWKURRPV3DUTXHWVRQWKHÁRRUVWLOHVKHDWHGÁRRURQWKHJURXQGÁRRU'RXEOHJDUDJHZLWKOLJKWVHQVRUV1HDUE\LQWHUQDWLRQDO VFKRROVJRRGEXVFRQQHFWLRQWR0HWUR$'HMYLFNiDQGORFDODPHQLWLHVLQSODFH3RVVLEOHIRUUHQW

www.happyhouserentals.com

<RXDUHZHOFRPHWRVWRSE\DQ\WLPH

SALES | LONG TERM | MIDTERM | SHORT TERM RENTALS | OFFICES | FACILITY MANAGEMENT 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

91


SPORTALM Podzim–Zima 2012/13 www.fggroup.cz


94

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


96

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


SPORTALM Podzim–Zima 2012/13 www.fggroup.cz


Prodej 6DPRVWDWQĚVWRMtFtGŢP/KRWDX'ROQtFK%ŐHæDQP  Sale 'HWDFKHGIDPLO\KRXVHEHGURRPV/KRWDX'ROQtFK%ŐHæDQP  ǛǼǺǰǬDzǬ ǝǬǸǺǽǾǺȋǾDZǷȈǹǺǽǾǺȋȅǴǵǰǺǸǻǷǬǹǴǼǺǮǶǴ/KRWDX'ROQtFK%ŐHæDQP  6DPRVWDWQĚVWRMtFtGŢPVWHUDVRXDJDUiætQDSR]HPNXRUR]OR]HP29VWXSQtFKRGEDYHONiNRXSHOQDVHVSUFKRYëPNRXWHPYDQRXDWRDOHWRXWHFKQLFNiPtVWQRVWSURVWRUQëREëYDFtSRNRM VNUEHPDYFKRGHPQD]DKUDGXSURVWRUQiNXFK\QĚVSOQĚY\EDYHQRXNXFK\ŁVNRXOLQNRXYHOLNiSUDFRYQDVYFKRGHPQD]DKUDGXORæQLFHYSUYQtPSDWŐHGDOätORæQLFHVSĚNQëPYëKOHGHPVDPR VWDWQiWRDOHWDDYVWXSQDYHOLNRXWHUDVX1DSR]HPNXMHED]pQ]DKUDGQtGRPHNVSŐtSUDYRXQDVDXQXDDOWiQHN9UDWDQDSR]HPHNMVRXQDGiONRYpRYOiGiQt 'HWDFKHGIDPLO\KRXVHZLWKWHUUDFHDQGJDUDJHRQWKHSORWPHDVXULQJP2(QWUDQFHKDOOZD\ELJEDWKURRPZLWKVKRZHUFRUQHUEDWKWXEDQGWRLOHWWHFKQLFDOURRPVSDFLRXVOLYLQJURRPZLWK ÀUHSODFHDQGHQWUDQFHRQWRWKHJDUGHQVSDFLRXVNLWFKHQZLWKIXOO\ÀWWHGNLWFKHQOLQHELJVWXG\EHGURRPZLWKHQWUDQFHRQWRWKHJDUGHQDGGLWLRQDOEHGURRPVDQRWKHUEHGURRPRQWKHÀUVWÁRRU QLFHYLHZVHSDUDWHWRLOHWDQGHQWUDQFHRQWRDELJWHUUDFH*DUGHQKDVVZLPPLQJSRRODQGJDUGHQKRXVHSUHSDUHGIRUÀWWLQJDVDXQDWKHUH(QWUDQFHJDWHRSHQVZLWKDUHPRWHFRQWURO ǝǬǸǺǽǾǺȋǾDZǷȈǹǺǽǾǺȋȅǴǵǰǺǸǻǷǬǹǴǼǺǮǶǴǽǾDZǼǼǬǽǺǵǴǯǬǼǬDzǺǸǹǬǿȃǬǽǾǶDZǸ2ǛǼǴȁǺDzǬȋǭǺǷȈȄǬȋǮǬǹǹǬȋǶǺǸǹǬǾǬǽǰǿȄDZǮǺǵǶǬǭǴǹǺǵǮǬǹǹǺǵǴǾǿǬǷDZǾǺǸǻǺǰǽǺǭǹǺDZǻǺǸDZȅDZ ǹǴDZǻǼǺǽǾǺǼǹǬȋǯǺǽǾǴǹǬȋǽǶǬǸǴǹǺǸǴǮȇȁǺǰǺǸǮǽǬǰǻǼǺǽǾǺǼǹǬȋǶǿȁǹȋǽǻǺǷǹǺǽǾȈȊǺǭǺǼǿǰǺǮǬǹǹȇǸǶǿȁǺǹǹȇǸǯǬǼǹǴǾǿǼǺǸǭǺǷȈȄǺǵǼǬǭǺȃǴǵǶǬǭǴǹDZǾǽǮȇȁǺǰǺǸǮǽǬǰǽǻǬǷȈǹǴǹǬ ǻDZǼǮǺǸȉǾǬDzDZDZȅDZǽǻǬǷȈǹȋǽȁǺǼǺȄǴǸǮǴǰǺǸǺǾǰDZǷȈǹȇǵǾǿǬǷDZǾǴǮȁǺǰǹǬǭǺǷȈȄǿȊǾDZǼǼǬǽǿǙǬǿȃǬǽǾǶDZǼǬǽǻǺǷǺDzDZǹǭǬǽǽDZǵǹǽǬǰǺǮȇǵǰǺǸǴǶǻǺǰǯǺǾǺǮǷDZǹǹȇǵǶǿǽǾǬǹǺǮǶDZǽǬǿǹȇǴǭDZ ǽDZǰǶǬǎǺǼǺǾǬǹǬǿȃǬǽǾǺǶǺǾǶǼȇǮǬȊǾǽȋǽǻǺǸǺȅȈȊǻǿǷȈǾǬǰǴǽǾǬǹȂǴǺǹǹǺǯǺǿǻǼǬǮǷDZǹǴȋ

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF]

)$5$21UHDOLW\VUR3ROVNi3UDKDWHOLQIR#IDUDRQF] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

99


Prodej /X[XVQt5'GYRMJDUiæ.RPRŐDQ\NÿSORFKDSR]HPNXP Sale /X[XU\KRXVHGRXEOHJDUDJH.RPRŐDQ\&=.ODQGDUHDP ǛǼǺǰǬDzǬ ǜǺǽǶǺȄǹȇǵǰǺǸǻǷǬǹǴǼǺǮǶǴǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇ.RPRŐDQ\&=.ǻǷǺȅǬǰȈǿȃǬǽǾǶǬP 0RGHUQtURGLQQëGŢP[*]DKUDGDYSŐtMHPQpORNDOLWĚ3UDK\SŐtPRXOHVD.RPRŐDQ\PLQXWDXWHPRGFHQWUDPĚVWD9ëMLPHÿQpPRGHUQtE\GOHQtYHY\VRFHNYDOLWQtPURGLQQpPGRPĚ GYRMYLOD SUDNWLFNpGLVSR]LFHSŐtPRXOHVDF\NORVWH]N\DQHGDOHNREUXVODŐVNpGUiK\SRGpO9OWDY\YKRGQpSURURGLQ\VGĚWPLVSRUWRYFHLRVRE\Y\KOHGiYDMtFtNOLG]iVWDYE\YHQNRYVNpKRUi]X7HQWR5' MH]DVD]HQGRQRYpKRUH]LGHQÿQtKRSURMHNWXNWHUëSRVN\WQHYHäNHUëNRPIRUWE\GOHQtL]iNODGQtVOXæE\SŐtPRYPtVWĚ]iURYHŁLSRWŐHEQpVRXNURPt]DKUDGDDWHUDVDVYëKOHGHPQDSŐLOHKOëOHV'ŢP PiYHONëREëYDFtSRNRMVSŐLOHKORXNXFK\QtORæQLFHNRXSHOQ\GYRMJDUiæVYHONëP~ORæQëPSURVWRUHP7HUDVDP2DEDONRQYSDWŐHP2~ORæQRXPtVWQRVWP2YHGOHJDUiæH9VWXSQtEH]SHÿ QRVWQtGYHŐHGŐHYĚQiRNQDSRGODK\RENODG\DGODæE\GOHYODVWQtKRYëEĚUX.YDOLWQtPDWHULiO\DGHVLJQGRPXVSOQtRÿHNiYiQtLWĚFKQHMQiURÿQĚMätFKNOLHQWŢ 0RGHUQIDPLO\KRXVH[*JDUGHQLQDQLFHDUHDRI3UDJXHQHDUWKHZRRG.RPRŐDQ\PLQXWHVGULYHIURPWKHFLW\FHQWHU([FHSWLRQDOPRGHUQOLYLQJLQKLJKTXDOLW\IDPLO\KRXVHSUDFWLFDO GLVSRVLWLRQGLUHFWO\E\WKHZRRGVF\FOLQJDQGVNDWLQJQHDUWKHWUDFNVDORQJWKHULYHUVXLWDEOHIRUIDPLOLHVZLWKFKLOGUHQDWKOHWHVDQGSHRSOHORRNLQJIRUSHDFHEXLOGLQJUXUDOFKDUDFWHU7KHKRXVHLV VHWLQDQHZUHVLGHQWLDOSURMHFWWKDWZLOOSURYLGHDOOWKHFRPIRUWVRIKRXVLQJDQGEDVLFVHUYLFHVRQVLWHDOVRWKHQHFHVVDU\SULYDF\JDUGHQDQGWHUUDFHRYHUORRNLQJWKHDGMDFHQWIRUHVW7KHKRXVHKDV DODUJHOLYLQJURRPZLWKDGMDFHQWNLWFKHQEHGURRPVEDWKURRPVGRXEOHJDUDJHZLWKODUJHVWRUDJHVSDFHP2WHUUDFHDQGXSVWDLUVEDOFRQ\P2P2VWRUDJHURRPQH[WWRWKHJDUDJH,QSXW VHFXULW\GRRUVZRRGHQZLQGRZVÁRRUVWLOHVRI\RXUFKRLFH4XDOLW\PDWHULDOVDQGGHVLJQRIWKHKRXVHPHHWVWKHH[SHFWDWLRQVRIHYHQWKHPRVWGHPDQGLQJFOLHQWV ǝǺǮǼDZǸDZǹǹȇǵǽDZǸDZǵǹȇǵǰǺǸǻǷǬǹǴǼǺǮǶǴǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇǽǬǰǹǬȁǺǰǴǾǽȋǮȁǺǼǺȄDZǸǼǬǵǺǹDZǛǼǬǯǴǮǭǷǴdzǴǷDZǽǬǮǖǺǸǺǼDzǬǹǬȁǸǴǹǿǾǹǬǸǬȄǴǹDZǺǾȂDZǹǾǼǬǯǺǼǺǰǬ ǛǼDZǶǼǬǽǹǺDZǽǺǮǼDZǸDZǹǹǺDZDzǴǷȈDZǮǽDZǸDZǵǹǺǸǰǺǸDZǮȇǽǺǶǺǯǺǶǬȃDZǽǾǮǬ ǰǮǺǵǹǬȋǮǴǷǷǬ ǻǼǬǶǾǴȃǹǺDZǼǬǽǻǺǷǺDzDZǹǴDZǻǼȋǸǺǼȋǰǺǸǽǷDZǽǺǸǮDZǷǺǰǺǼǺDzǶǴǴǹDZǰǬǷDZǶǺǰǺǼǺDzǶǴǰǷȋǶǬǾǬ ǹǴȋǹǬǼǺǷǴǶǺǮȇȁǶǺǹȈǶǬȁǮǰǺǷȈǭǷǴdzǷDZDzǬȅDZǵǼDZǶǴǎǷǾǬǮȇDzǴǷȈDZǻǺǰȁǺǰǴǾǰǷȋǽDZǸDZǵǽǰDZǾȈǸǴǽǻǺǼǾǽǸDZǹǺǮǴǾDZȁǶǾǺǴȅDZǾdzǬǽǾǼǺǵǶǴǮǰDZǼDZǮDZǹǽǶǺǸǽǾǴǷDZǩǾǺǾǰǺǸǼǬǽǻǺǷǺDzDZǹ ǮǹǺǮǺǸǼDZdzǴǰDZǹǾǽǶǺǸǻǼǺDZǶǾDZǶǺǾǺǼȇǵǻǼDZǰǺǽǾǬǮǷȋDZǾǹDZǺǭȁǺǰǴǸȇǵǶǺǸȀǺǼǾDzǴǷȈȋǴǺǽǹǺǮǹȇDZǿǽǷǿǯǴǻǼȋǸǺǹǬǸDZǽǾDZǬǾǬǶDzDZǺǭDZǽǻDZȃǴǮǬDZǾǹDZǺǭȁǺǰǴǸǿȊǶǺǹȀǴǰDZǹȂǴǬǷȈǹǺǽǾȈ ǽǬǰǴǾDZǼǼǬǽǬǽǮǴǰǺǸǹǬǽǺǽDZǰǹǴǵǷDZǽǎǰǺǸDZDZǽǾȈǭǺǷȈȄǬȋǯǺǽǾǴǹǬȋǽǻǼǴǸȇǶǬȊȅDZǵǶǿȁǹDZǵǽǻǬǷȈǹǴǮǬǹǹȇȁǶǺǸǹǬǾȇǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇǽǭǺǷȈȄǴǸǶǺǷǴȃDZǽǾǮǺǸǸDZǽǾǰǷȋ ȁǼǬǹDZǹǴȋǮDZȅDZǵǞDZǼǼǬǽǬǸ2ǴǭǬǷǶǺǹǹǬǻDZǼǮǺǸȉǾǬDzDZǸ2ǻǺǸDZȅDZǹǴDZǰǷȋȁǼǬǹDZǹǴȋǼȋǰǺǸǽǯǬǼǬDzǺǸǸ2ǍDZdzǺǻǬǽǹȇDZǮȁǺǰǹȇDZǰǮDZǼǴǰDZǼDZǮȋǹǹȇDZǺǶǹǬǻǺǷȇǻǷǴǾǶǬǴǺǭ ǷǴȂǺǮǶǬǻǺǮǬȄDZǸǿǮȇǭǺǼǿǖǬȃDZǽǾǮDZǹǹȇDZǸǬǾDZǼǴǬǷȇǴǰǴdzǬǵǹǰǺǸǬǭǿǰDZǾǽǺǺǾǮDZǾǽǾǮǺǮǬǾȈǺDzǴǰǬǹǴȋǸǰǬDzDZǽǬǸȇȁǾǼDZǭǺǮǬǾDZǷȈǹȇȁǶǷǴDZǹǾǺǮ

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF] 100

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

)$5$21UHDOLW\VUR3ROVNi3UDKDWHOLQIR#IDUDRQF]


Prodej /X[XVQtURGLQQiYLODQDSR]HPNXP.DPHQLFH/iGYt3UDKDYëFKRG Sale /X[XU\YLOODRQODQGVTXDUHPHWHUV.DPHQLFH/iGYt3UDJXH(DVW ǛǼǺǰǬDzǬ ǜǺǽǶǺȄǹǬȋǽDZǸDZǵǹǬȋǮǴǷǷǬǻǷǬǹǴǼǺǮǶǴǹǬǿȃǬǽǾǶDZǸǮ.DPHQLFH/iGYtǛǼǬǯǬǎǺǽǾǺǶ 1DEt]tPHQiGKHUQRXYLOXQDNOLGQpPPtVWĚQDSR]HPNXP22E\WQëSURVWRUMHSURSRMHQVYHQNRYQtPVH]HQtPQDWHUDVH.XFK\ŁVNiOLQNDMHY\UREHQDQDPtUXMHY\EDYHQDYHVWDYĚQëPL VSRWŐHELÿLSURIHVLRQiOQtSO\QRYëVSRUiNVNRPELQRYDQRXWURXERXPRVD]QRXGLJHVWRŐt9SŐt]HPtQDMGHWHSURVWRUQRXYVWXSQtKDOXSRNRMSURKRVW\ORæQLFLNRXSHOQXVYDQRXDVSUFKRYëPNRXWHPVD PRVWDWQRXWRDOHWXDäDWQX'RNOLGRYp]yQ\YHGUXKpPQDG]HPQtPSRGODætVHGRVWDQHWHSRVFKRGLäWL]REëYDFtKRSRNRMH-VRX]GHORæQLFHNRXSHOQDDJDOHULHO]HOHKNRXSŐHVWDYERX]QtY\WYRŐLW GDOätSRNRMRYHOLNRVWLP.YëVWDYEĚWpWRQRYRVWDYE\E\O\SRXæLW\QDGVWDQGDUGQtPDWHULiO\9LQWHULpUXMVRXSRXæLW\GŐHYĚQpSRGODK\OHäWĚQiGODæEDQDGVWDQGDUGQt]DŐL]RYDFtSŐHGPĚW\8GRPX MHGYRXJDUiæDGDOät]SHYQĚQiVWiQt.YLOHYHGHSULYiWQtSŐtMH]GRYiFHVWD9RNROtQDMGHWHLGREUpVSRUWRYQtY\æLWtJROIRYpKŐLäWĚãWLŐtQUŢ]QRURGpWUDV\SURF\NORWXULVWLNXDWXULVWLNX0LOH9iVSŐHNYD StYHOPLQt]NpSURYR]QtQiNODG\ :HRIIHUDEHDXWLIXOYLOODLQDTXLHWORFDWLRQRQP2RIODQG7KHOLYLQJDUHDLVFRQQHFWHGWRWKHRXWGRRUVHDWLQJRQWKHWHUUDFH.LWFKHQLVPDGHWRPHDVXUHLVHTXLSSHGZLWKDSSOLDQFHV SURIHVVLRQDOJDVFRRNHUZLWKRYHQFRPELQHGEUDVVKRRG'RZQVWDLUVWKHUHLVDVSDFLRXVHQWUDQFHKDOOJXHVWURRPEHGURRPEDWKURRPZLWKEDWKDQGVKRZHUVHSDUDWHWRLOHWDQGGUHVVLQJURRP ,QWKHSHGHVWULDQ]RQHLQWKHVHFRQGÁRRUFDQEHUHDFKHGE\VWDLUVIURPWKHOLYLQJURRP7KHUHDUHEHGURRPVEDWKURRPDQGJDOOHU\FDQEHUHFRQVWUXFWHGIURPWKHOLJKWWRFUHDWHDGGLWLRQDO URRPRIP7KHFRQVWUXFWLRQRIQHZEXLOGLQJVZHUHXVHGH[WUDPDWHULDOV7KHLQWHULRULVXVHGIRUZRRGÁRRULQJSROLVKHGWLOHVSUHPLXPÀ[WXUHVDQGÀWWLQJV7KHKRXVHLVDGRXEOHJDUDJHDQG DGGLWLRQDOSDYHGSDUNLQJ7KHYLOODKDVDSULYDWHGULYHZD\OHDGV7KHVXUURXQGLQJDUHDLVDOVRJRRGVSRUWVJROIFRXUVHãWLŐtQGLYHUVHURXWHVIRUF\FOLQJDQGKLNLQJ<RX·OOEHSOHDVDQWO\VXUSULVHG E\DYHU\ORZRSHUDWLQJFRVW ǛǼDZǰǷǬǯǬDZǸǰǷȋǻǼǺǰǬDzǴǶǼǬǽǴǮǿȊǮǴǷǷǿǻǷǬǹǴǼǺǮǶǴǮǽǻǺǶǺǵǹǺǸǸDZǽǾDZǹǬǿȃǬǽǾǶDZǸ2ǏǺǽǾǴǹǬȋǽǮȋdzǬǹǬǽǸDZǽǾǺǸǰǷȋǺǾǰȇȁǬǹǬǾDZǼǼǬǽDZǖǿȁǺǹǹȇǵǯǬǼǹǴǾǿǼǮȇǻǺǷǹDZǹǹǬ dzǬǶǬdzǺǽǹǬȅDZǹǮǽǾǼǺDZǹǹǺǵǾDZȁǹǴǶǺǵǻǼǺȀDZǽǽǴǺǹǬǷȈǹǺǵǯǬdzǺǮǺǵǻǷǴǾǺǵǽǶǺǸǭǴǹǴǼǺǮǬǹǹǺǵǰǿȁǺǮǶǺǵǷǬǾǿǹǹǺǵǮȇǾȋDzǶǺǵǙǬǻDZǼǮǺǸȉǾǬDzDZDZǽǾȈǻǼǺǽǾǺǼǹǬȋǻǼǴȁǺDzǬȋǶǺǸǹǬǾǬǰǷȋ ǯǺǽǾDZǵǽǻǬǷȈǹȋǮǬǹǹǬȋǶǺǸǹǬǾǬǽǮǬǹǹǺǵǴǰǿȄDZǮǺǵǶǬǭǴǹǺǵǺǾǰDZǷȈǹȇǵǾǿǬǷDZǾǴǯǬǼǰDZǼǺǭǹǬȋǎǾǴȁǿȊdzǺǹǿǹǬǮǾǺǼǺǸȉǾǬDzDZǸǺDzǹǺǻǺǰǹȋǾȈǽȋǻǺǷDZǽǾǹǴȂDZǴdzǯǺǽǾǴǹǺǵǓǰDZǽȈǹǬȁǺǰȋǾǽȋ ǽǻǬǷȈǹǴǮǬǹǹǬȋǶǺǸǹǬǾǬǴǯǬǷDZǼDZȋ²ǻǼǴǻǺǸǺȅǴǷDZǯǶǺǵǼDZǶǺǹǽǾǼǿǶȂǴǴǾǬǸǸǺDzǹǺǽǺdzǰǬǾȈǰǺǻǺǷǹǴǾDZǷȈǹǿȊǶǺǸǹǬǾǿǼǬdzǸDZǼǺǸǸǐǷȋǽǾǼǺǴǾDZǷȈǽǾǮǬȉǾǺǯǺǹǺǮǺǯǺdzǰǬǹǴȋǭȇǷǴ ǻǼǴǸDZǹDZǹȇǸǬǾDZǼǴǬǷȇǽǬǸǺǯǺǮȇǽǺǶǺǯǺǶǷǬǽǽǬǎǴǹǾDZǼȈDZǼDZǴǽǻǺǷȈdzǺǮǬǹȇǰDZǼDZǮȋǹǹȇDZǻǺǷȇǻǺǷǴǼǺǮǬǹǹǬȋǻǷǴǾǶǬǮȇǽǺǶǺǶǷǬǽǽǹǬȋǸDZǭǷǴǼǺǮǶǬǴǺǭǺǼǿǰǺǮǬǹǴDZǎǰǺǸDZǯǬǼǬDzǹǬǰǮDZ ǸǬȄǴǹȇǴǰǺǻǺǷǹǴǾDZǷȈǹǺDZǽǻDZȂǴǬǷȈǹǺǿǶǼDZǻǷDZǹǹǺDZǸDZǽǾǺǰǷȋǻǬǼǶǺǮǶǴǖǮǴǷǷDZǮDZǰDZǾȃǬǽǾǹǬȋǻǺǰȆDZdzǰǹǬȋǰǺǼǺǯǬǎǺǶǼDZǽǾǹǺǽǾȋȁǸǹǺǯǺǸDZǽǾǻǼDZǰǹǬdzǹǬȃDZǹǹȇȁǰǷȋǽǻǺǼǾǴǮǹǺǯǺǺǾǰȇȁǬ ǻǺǷDZǰǷȋǯǺǷȈȀǬãWLŐtQǼǬdzǹǺǺǭǼǬdzǹȇDZǸǬǼȄǼǿǾȇǰǷȋǮDZǷǺǽǴǻDZǰǹȇȁǴǻDZȄǴȁǻǼǺǯǿǷǺǶǎȇǭǿǰDZǾDZǻǼǴȋǾǹǺǿǰǴǮǷDZǹȇǺȃDZǹȈǹǴdzǶǴǸǴȉǶǽǻǷǿǬǾǬȂǴǺǹǹȇǸǴǼǬǽȁǺǰǬǸǴ

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF]

)$5$21UHDOLW\VUR3ROVNi3UDKDWHOLQIR#IDUDRQF] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

101


Prodej 3URGHMVW\ORYpKRE\WXYVHFHVQtPGRPĚ%P3UDKD1RYp0ĚVWR Sale 6DOHVVW\OLVKDSDUWPHQWLQDQ$UW1RXYHDXKRXVH%P3UDJXH1HZ7RZQ ǛǼǺǰǬDzǬ ǛǼǺǰǬDzǬǽǾǴǷȈǹǺǵǶǮǬǼǾǴǼȇǮǰǺǸDZǽǾǴǷȋǸǺǰDZǼǹǻǷǬǹǴǼǺǮǶǴ%ǸǛǼǬǯǬ1RYp0ĚVWR 1DEt]tPHYHONRU\VëE\WP2YVHFHVQtPGRPĚ SRUHNRQVWUXNFL QD1RYpP0ĚVWĚ%\WLGŢPSURäO\UHNRQVWUXNFtYURFH1DSRGODKiFKMVRXGXERYpSDUNHW\YNRXSHOQĚD:&MHGODæEDVSRGODKRYëP HOHNWULFNëPWRSHQtP.SŐHGQRVWHPE\WXSDWŐtY\VRNpVWURS\SŢYRGQtäWXN\LSRUWiORYpGYHŐH9äHMH]UHNRQVWUXRYiQRVFLWHPDVFtOHP]DFKRYDWFRQHMYtFHNODVLFNëFKSUYNŢ=YHONpKDO\MHYVWXSGRNRXSHOQ\V:& VDPRVWDWQpKR:&SRNRMŢ QHSUŢFKR]tFK RULHQWRYDQëFKGRYQLWUREORNXDGRREëYDFtKRSRNRMHRULHQWRYDQpKRGRXO*RU]GRYD=QĚMMHYSUDYRYVWXSGRNXFK\QĚDYOHYRGRORæQLFHVYODVWQtäDWQRXDEDONRQHP.E\WXQiOHæt JDUiæSURDXWD7LFKëVYĚWOëE\WYFHQWUXPĚVWDNRXVHNRGQiEŐHæt9ëERUQiGRSUDYQtGRVWXSQRVW .DUORYR3DODFNpKRD-LUiVNRYRQiPĚVWt  :HRIIHUDJHQHURXVÁDWP2LQWKH$UW1RXYHDXKRXVH DIWHUUHFRQVWUXFWLRQ LQ1HZ7RZQ$SDUWPHQWDQGKRXVHUHQRYDWHGLQ7KHÁRRUVDUHRDNÁRRUVEDWKURRPDQG:&LVWLOHGZLWKXQGHUÁRRU HOHFWULFKHDWLQJ7KHDGYDQWDJHVRIWKHDSDUWPHQWLQFOXGHVKLJKFHLOLQJVRULJLQDOVWXFFRDQGWKHRULJLQDOSRUWDOGRRUV(YHU\WKLQJLVUHQRYDWHGZLWKVHQVLWLYLW\DQGLQRUGHUWRNHHSDVPDQ\RULJLQDOIHDWXUHV7KH ODUJHHQWUDQFHKDOOLVWKHEDWKURRPZLWKWRLOHWVHSDUDWHWRLOHWURRPV LPSDVVDEOH RULHQWHGWRWKHFRXUW\DUGDQGLQWRWKHOLYLQJURRPRULHQWHGWRWKHVWUHHW*RU]GRYD)URPWKHUHLWLVRQWKHULJKWHQWUDQFHWR WKHNLWFKHQDQGOHIWWKHEHGURRPZLWKLWVRZQGUHVVLQJURRPDQGEDOFRQ\7KHDSDUWPHQWKDVDJDUDJHIRUFDUV4XLHWVXQQ\DSDUWPHQWLQWKHFLW\FHQWHUDVKRUWZDONIURPWKHZDWHUIURQW([FHOOHQWWUDQVSRUW DFFHVVLELOLW\ &KDUOHV3DODFN\-LUiVNRYR6TXDUH  ǛǼDZǰǷǬǯǬDZǸǻǼǺǽǾǺǼǹǿȊǶǮǬǼǾǴǼǿǻǷǬǹǴǼǺǮǶǴǸ2ǮǰǺǸDZǽǾǴǷȋǸǺǰDZǼǹ ǻǺǽǷDZǼDZǶǺǹǽǾǼǿǶȂǴǴ ǮǙǺǮǺǸǯǺǼǺǰDZǖǮǬǼǾǴǼǬǴǰǺǸǻǼǺȄǷǴǼDZǶǺǹǽǾǼǿǶȂǴȊǮǯǺǰǿǙǬǻǺǷǬȁǰǿǭǺǮȇǵǻǬǼǶDZǾ Ǯ ǮǬǹǹǺǵ ǶǺǸǹǬǾDZ Ǵ ǾǿǬǷDZǾDZ  ǻǷǴǾǶǬ ǽ ȉǷDZǶǾǼǴȃDZǽǶǴǸ ǻǺǰǺǯǼDZǮǺǸ ǛǼDZǴǸǿȅDZǽǾǮǺ ǶǮǬǼǾǴǼȇ  ǮȇǽǺǶǴDZ ǻǺǾǺǷǶǴ ǺǼǴǯǴǹǬǷȈǹǬȋ ǷDZǻǹǴǹǬ Ǵ ǺǼǴǯǴǹǬǷȈǹȇDZ ǰǮDZǼǴǻǺǼǾǬǷ ǎǽDZ ǺǾǼDZǸǺǹǾǴǼǺǮǬǹǺ ǽȃǿǮǽǾǮǺǸǽǾǴǷȋǴǽǸǬǶǽǴǸǬǷȈǹȇǸǽǺȁǼǬǹDZǹǴDZǸǶǬǶǸǺDzǹǺǭǺǷȈȄDZǯǺǶǺǷǴȃDZǽǾǮǬǸǹǺǯǴȁǺǼǴǯǴǹǬǷȈǹȇȁǰDZǾǬǷDZǵǔdzǭǺǷȈȄǺǵǻǼǴȁǺDzDZǵǸǺDzǹǺǻǺǻǬǽǾȈǮǮǬǹǹǿȊǶǺǸǹǬǾǿǽǾǿǬǷDZǾǺǸǺǾǰDZǷȈǹȇǵ ǾǿǬǷDZǾǶǺǸǹǬǾȇ ǹDZǻǼǺȁǺǰǹȇȁ ǺǼǴDZǹǾǴǼǺǮǬǹǹȇȁǮǺǮǹǿǾǼDZǹǹǴǵǰǮǺǼǴǮǯǺǽǾǴǹǿȊǺǼǴDZǹǾǴǼǺǮǬǹǹǿȊǹǬǿǷǴȂǿ*RU]GRYDǔdzǯǺǽǾǴǹǺǵǮǻǼǬǮǺǸǺDzǹǺǻǺǻǬǽǾȈǮǶǿȁǹȊǴǹǬǷDZǮǺǮǽǻǬǷȈǹȊǽǽǺǭ ǽǾǮDZǹǹǺǵǯǬǼǰDZǼǺǭǹǺǵǴǭǬǷǶǺǹǺǸǎǶǮǬǼǾǴǼDZDZǽǾȈǯǬǼǬDzǹǬǸǬȄǴǹȇǞǴȁǬȋǽǮDZǾǷǬȋǶǮǬǼǾǴǼǬǮȂDZǹǾǼDZǯǺǼǺǰǬǮǹDZǽǶǺǷȈǶǴȁǸǴǹǿǾǬȁȁǺǰȈǭȇǺǾǹǬǭDZǼDZDzǹǺǵǚǾǷǴȃǹǺDZǾǼǬǹǽǻǺǼǾǹǺDZǽǺǺǭȅDZ ǹǴDZ ǖǬǼǷǺǮǬǛǬǷǬȂǶǺǯǺǴǕǴǼǬǽǶǺǮǬǻǷǺȅǬǰǴ 

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF] 102

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

)$5$21UHDOLW\VUR3ROVNi3UDKDWHOLQIR#IDUDRQF]


Prodej 9LODGŢPP3UDKD%UDQtN.ÿ Sale $SDUWPHQWEXLOGLQJP3UDJXH%UDQtN&=. ǛǼǺǰǬDzǬ ǎǴǷǷǬǰǺǸǸǛǼǬǯǬ%UDQtNǸǷǹǶǼǺǹ 1DEt]tPHNSURGHMLOX[XVQtYLODGŢPVHWŐHPLVDPRVWDWQëPLE\WRYëPLMHGQRWNDPLKRGtFtVHMDNRUHSUH]HQWDWLYQtÀUHPQtVtGORÿLH[NOX]LYQtUH]LGHQFH9LODNRODXGRYDQiYURFHVHQDFKi]tYDWUDN WLYQtUH]LGHQÿQtREODVWL%UDQtN-HRENORSHQDOHVHPDQDFKi]tVHQDNRSFLVYëKOHGHPQD3UDæVNëKUDGD%DUUDQGRYVNpVNiO\9SŐt]HPtQDMGHPHDSDUWPiQNNRSORäHP29H13MHPH]R QHWRYëE\WNN P2 DYH13WDNWpæPH]RQHWNNVJDOHULt P2 6SROHÿQpSURVWRU\Y33 P2 QDEt]HMtÀWQHVVVHäDWQRXD:&ED]pQVDXQXGtOQXSUiGHOQXVXäiUQXDVNOHS\ .DæGë]E\WŢPiVYpYODVWQtY\WiSĚQtSO\QRYëPNRWOHPDVYpYODVWQtPĚŐHQtHOHNWULFNpHQHUJLH'ŢP]DKUQXMHYHONpGYRXJDUiæHJDUiæSURMHGHQYŢ]DYHGYRŐHVHGiOHQDFKi]tSDUNRYDFtPtVWD &HOëREMHNWVH]DKUDGRX P2 MHRENORSHQ]GĚQëPSORWHPDY\EDYHQNDPHURYëPLDEH]SHÿQRVWQtPLV\VWpP\$XWHPGR~SOQpKRFHQWUDPLQXW0+'PLQXWGRFHQWUD9RNROtYHäNHUiREÿDQ VNiY\EDYHQRVWQiNXSQtFHQWUXPäNRO\VSRUWFHQWUXP7KRPD\HURYDQHPRFQLFHÿLåOXWpOi]QĚ :HVHOOOX[XU\DSDUWPHQWEXLOGLQJZLWKWKUHHVHSDUDWHKRXVLQJXQLWVÀWDVDUHSUHVHQWDWLYHFRUSRUDWHKHDGTXDUWHUVDQGH[FOXVLYHUHVLGHQFHV9LOODDSSURYHGLQLVORFDWHGLQDQDWWUDFWLYH UHVLGHQWLDODUHD%UDQtN,WLVVXUURXQGHGE\ZRRGVDQGLVVLWXDWHGRQDKLOOZLWKDYLHZRI3UDJXH&DVWOHDQGWKH%DUUDQGRY5RFNV2QWKHJURXQGÁRRUZHÀQGDSDUWPHQWNNP2. In 2nd ÁRRULVNNDSDUWPHQW P2 DQGWKLUGÁRRUDOVRDSDUWPHQWNNZLWK P2 &RPPRQDUHDVLQWKHVWÁRRU P2 RIIHUDÀWQHVVURRPZLWKFORDNURRPDQGWRLOHWVZLPPLQJSRRO VDXQDZRUNVKRSODXQGU\GU\LQJURRPDQGFHOODUV(DFKRIWKHDSDUWPHQWVKDVLWVRZQJDVKHDWLQJERLOHUDQGLWVRZQPHDVXUHPHQWRIHOHFWULFDOHQHUJ\7KHKRXVHFRPSULVHVODUJHGRXEOH JDUDJHJDUDJHIRURQHFDULQWKH\DUGDQGWKHUHLVDOVRDSDUNLQJVSDFHV7KHZKROHEXLOGLQJZLWKJDUGHQ P 2 LVVXUURXQGHGE\DEULFNIHQFHDQGHTXLSSHGZLWK&&79DQGVHFXULW\ V\VWHPVPLQXWHVE\FDUWRWKHFHQWHURIFLW\PLQXWHVE\SXEOLFWUDQVSRUWWRWKHFHQWHU,QQHDUDOODPHQLWLHVVKRSSLQJFHQWHUVFKRROVVSRUWVFHQWHU7KRPD\HUKRVSLWDORU<HOORZVSD ǛǼǺǰǬDZǸǼǺǽǶǺȄǹȇǵǎǴǷǷǬǰǺǸǽǾǼDZǸȋǺǾǰDZǷȈǹȇǸǴǶǮǬǼǾǴǼǬǸǴǻǺǰȁǺǰǴǾǰǷȋǻǼDZǰǽǾǬǮǴǾDZǷȈǽǶǺǵȀǴǼǸDZǹǹǺǵȄǾǬǭǶǮǬǼǾǴǼȇǴȉǶǽǶǷȊdzǴǮǹǺǵǼDZdzǴǰDZǹȂǴǴǎǴǷǷǬǻǼǺȄǷǬǻǼǴDZǸǶǿǮ ǯǺǰǿǼǬǽǻǺǷǺDzDZǹǬǮǻǼǴǮǷDZǶǬǾDZǷȈǹǺǸǼDZdzǴǰDZǹǾǽǶǺǸǼǬǵǺǹDZǍǼǬǹǴǶǚǹǬǺǶǼǿDzDZǹǬǷDZǽǬǸǴǴǼǬǽǻǺǷǺDzDZǹǬǹǬȁǺǷǸDZǽǮǴǰǺǸǹǬǛǼǬDzǽǶǴǵǏǼǬǰǴǍǬǼǼǬǹǰǺǮǽǶǴDZǽǶǬǷȇǙǬǹǴDzǹDZǸȉǾǬDzDZ ǹǬȁǺǰȋǾǽȋǶǮǬǼǾǴǼȇǶǶǻǷǺȅǬǰȈȊǸ2ǙǬȉǾǬDzDZǼǬǽǻǺǷǺDzDZǹǬǶǮǬǼǾǴǼǬǸDZdzǺǹDZǾǻǷǬǹǴǼǺǮǶǴNN Ǹ2 ǹǬǸȉǾǬDzDZǾǬǶDzDZǹǬȁǺǰǴǾǽȋǶǮǬǼǾǴǼǬǸDZdzǺǹDZǾǻǷǬǹǴǼǺǮǶǴǶǶ ǽǯǬǷDZǼDZDZǵ Ǹ2 ǎǸDZǽǾǬȁǺǭȅDZǯǺǴǽǻǺǷȈdzǺǮǬǹǴȋǹǬǸǻǺǰdzDZǸǹǺǸȉǾǬDzDZ Ǹ2 ȀǴǾǹDZǽdzǬǷǽǼǬdzǰDZǮǬǷǶǺǵǴǾǿǬǷDZǾǺǸǭǬǽǽDZǵǹǽǬǿǹǬǸǬǽǾDZǼǽǶǬȋǻǼǬȃDZȃǹǬȋǶǺǸǹǬǾǬǰǷȋǽǿȄǶǴ ǴǻǺǰǮǬǷȇǖǬDzǰǬȋǴdzǶǮǬǼǾǴǼǴǸDZDZǾǽǮǺǵǽǺǭǽǾǮDZǹǹȇǵǶǺǾDZǷǯǬdzǺǮǺǯǺǺǾǺǻǷDZǹǴȋǴǽǺǭǽǾǮDZǹǹȇDZǽȃDZǾȃǴǶǴȉǷDZǶǾǼǴȃDZǽǶǺǵȉǹDZǼǯǴǴǎǰǺǸDZǭǺǷȈȄǴȁǯǬǼǬDzǬǹǬǰǮDZǸǬȄǴǹȇǯǬǼǬDzǹǬǺǰǹǿ ǸǬȄǴǹǿǮǺǰǮǺǼDZǴDZǽǾȈǻǬǼǶǺǮǺȃǹȇȁǸDZǽǾǬǎȂDZǷǺǸdzǰǬǹǴDZǽǽǬǰǺǸ Ǹ2 ǺǶǼǿDzDZǹǺǶǴǼǻǴȃǹȇǸdzǬǭǺǼǺǸǴǺǽǹǬȅDZǹǺǽǴǽǾDZǸǺǵǮǴǰDZǺǹǬǭǷȊǰDZǹǴȋǴǽǴǽǾDZǸǺǵǭDZdzǺǻǬǽǹǺǽǾǴǛǺDZdzǰǶǬ ǹǬǸǬȄǴǹDZǰǺȂDZǹǾǼǬǯǺǼǺǰǬ²ǸǴǹǿǾǸǴǹǿǾǹǬǺǭȅDZǽǾǮDZǹǹǺǸǾǼǬǹǽǻǺǼǾDZǰǺȂDZǹǾǼǬǯǺǼǺǰǬǎǭǷǴDzǬǵȄǴȁǺǶǼDZǽǾǹǺǽǾȋȁǼǬdzǮǴǾǬȋǴǹȀǼǬǽǾǼǿǶǾǿǼǬ²ǾǺǼǯǺǮȇǵȂDZǹǾǼȄǶǺǷȇǽǻǺǼǾǴǮ ǹȇǵȂDZǹǾǼǞǺǸǬǵDZǼǺǮǬǭǺǷȈǹǴȂǬǴǷǴǒǷǿǾDZǗǬdzǹDZ ǺǾǰȇȁǺǼǬdzǮǷDZǶǬǾDZǷȈǹȇǵǶǺǸǻǷDZǶǽ 

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF]

)$5$21UHDOLW\VUR3ROVNi3UDKDWHOLQIR#IDUDRQF] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

103


TIDE REALITY s.r.o.

|

Pavel Velebil

|

Mobile: 602 269 011

|

Bydlení nad Prahou

Praha 5 - Jinonice 4+kk, 2 koupelny celková plocha 138 m2 2 garážová stání 10 614 000 Kč

Exkluzivní byt s krásnými výhledy na hraně svahu v Praze 5 - Jinonicích. Prostorný byt 4+kk se 2 balkony o celkové ploše 138 m2. Byt se skládá z obývacího pokoje s kuchyňským koutem, manželské ložnice s vlastní koupelnou, 2 dětských pokojů, druhé koupelny a komory, vnitřní podlahová plocha bytu 120 m2. Interiérové vybavení na míru, italské obklady a dlažby, kuchyňská linka Leicht v ceně bytu. V ceně 2 garážová stání. Novostavba minutu od metra!

104

Email: prodej@tide.cz

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

3 bedrooms, 2 bathrooms total area 138 m2 2 car parks included 10 614 000 CZK Exclusive 3 bedroom apartment with open views in Prague 5 - Jinonice. This new-built development is ideally located on the hill just 100 metres from metro station Jinonice. Open space living room with balcony and open views, master bedroom with en-suite bathroom, 2 bedrooms, bathroom and storage/laundery. Total area of 138 m2, inner area 120 m2. Price includes quality german kitchen, italian built-in furniture and lights throughout the apatrtment.


TIDE REALITY s.r.o.

|

Pavel Velebil

|

Mobile: 602 269 011

|

Email: prodej@tide.cz

Řadový domek pod Klínovcem

Krušné hory

Řadový domek na horách Plocha 80 m2, terasa 14 m2 2 ložnice, 1 parkovací stání 3 980 000 Kč

Druhá etapa výstavby řadových domků v komplexu Klínovec Meadows. Výjimečný horský projekt 200 metrů od sjezdovek s nádhernými výhledy na Klínovec a Oberwiesenthal. Koncepce projektu s recepcí a rozsáhlými pozemky obklopujícími domy je prozatím v Česku ojedinělá.

Inner area 80 m2, 14 m2 terrace 2 bedrooms Secure parking 3 980 000 CZK

New-built 2 bedroom chalet at Klinovec. 2nd phase of exceptional project with Scandinavian design 200 metres from the ski slopes. The new development offers round-the-year vacation attractions in popular Czech mountains near Karlovy Vary and Oberwiesenthall.

352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

105


Van Santen & Van Santen Podzimâ&#x20AC;&#x201C;Zima 2012/13 www.fggroup.cz


Realitní makléř: Šárka Šamanová Kontakt: +420 777 724 034

Z›ƒ½®ãù

E-mail: sarka.samanova@century21.cz

(;./8=,91Ì'š035$+$+267,9$ŏ (;&/86,9(+286(35$*8(+267,9$ŏ /X[XVQtGŢPRFHONRYpXæLWQpSORäHP2VHQDFKi]tY]iVWDYEĚŐDGRYëFKGRPŢQDRNUDML+RVWLYDŐH'ŢPMHNRQFLSRYiQMDNRE\GOHQtSURURGLQXO]HMHMDOHYHOPLVQDGQR SŐHVWDYĚWQDGYRXJHQHUDÿQtE\GOHQt9SŐt]HPtMHNUiVQëED]pQVHVDXQRXDIUDQFRX]VNëPRNQHPGR]DKUDG\ P2 =GHMHY\EXGRYiQRSŐtMHPQpSRVH]HQtSRGSHUJRORX 9SUYQtPSDWŐHGRPXVHQDFKi]tREëYDFtSRNRMVYHONëPNXFK\ŁVNëPNRXWHP]HNWHUpKRVHYFKi]tQDWHUDVXVYHQNRYQtPNUEHP2SDWURYëäMVRXNGLVSR]LFLVDPRVWDWQp ORæQLFHYHONiNRXSHOQDDGDOätWHUDVD9SRGNURYtGRPXMHWHUDVDVYHQNRYQtVSUFKRX6DPR]ŐHMPRVWtMHJDUiæRYpVWiQtSURGYDYR]\7HQWRGŢPMHYKRGQëMDNSURURGLQXWDN SUROX[XVQtGYRXJHQHUDÿQtE\GOHQtYHYODVWQtPGRPĚVYëERUQRXGRVWXSQRVWtGRFHQWUD $OX[XU\KRXVHZLWKXVDEOHDUHDRIPñLVORFDWHGLQDWHUUDFHGKRXVHGHYHORSPHQWRQWKHRXWVNLUWVRI+RVWLYDŐ7KHKRXVHZDVGHVLJQHGDVDIDPLO\GZHOOLQJEXWLWFDQHDVLO\EHUHVWUXFWXUHGDVDWZRJHQHUDWLRQKRPH7KHJURXQGÁRRUFRPSULVHVDEHDXWLIXOVZLPPLQJSRROZLWKDVDXQDDQG)UHQFKGRRUVOHDGLQJWRWKHJDUGHQ Pñ ZLWKSOHDVDQWVHDWLQJXQGHUDSHUJROD7KHVWÁRRUFRQVLVWVRIDOLYLQJURRPZLWKDODUJHNLWFKHQFRUQHUZLWKDQH[LWRQWRDWHUUDFHZLWKDQRXWGRRUÀUHSODFH7KHQGÁRRUFRPSULVHV VHSDUDWHEHGURRPVDELJEDWKURRPDQGDQRWKHUWHUUDFH7KHUHLVDWHUUDFHZLWKDQRXWGRRUVKRZHULQWKHDWWLFSUHPLVHVRIWKHKRXVH$SDUNLQJED\IRUWZRFDUVLVVWDQGDUG equipment. The building is suitable as a family home, as well as a luxury two-generation private dwelling with excellent travel links to the city centre. ǩǶǽǶǷȊdzǴǮǹȇDZǰǺǸǮǼȋǰǺǮǺǵdzǬǽǾǼǺǵǶDZǻǷǬǹǴǼǺǮǶǴǛǼǬǯǬ+RVWLYDŐ ǜǺǽǶǺȄǹȇǵǰǺǸǽǺǭȅDZǵǻǷǺȅǬǰȈȊǸ2ǼǬǽǻǺǷǺDzDZǹǮǼȋǰǺǮǺǵdzǬǽǾǼǺǵǶDZǹǬǺǶǼǬǴǹDZǼǬǵǺǹǬ+RVWLYDŐǐǺǸǽǻǷǬǹǴǼǺǮǬǹǶǬǶDzǴǷȈDZǰǷȋǽDZǸȈǴǹǺǸǺDzDZǾǭȇǾȈ ǷDZǯǶǺǻǼDZǺǭǼǬdzǺǮǬǹǮDzǴǷȈDZǰǷȋǰǮǿȁǻǺǶǺǷDZǹǴǵǙǬǻDZǼǮǺǸȉǾǬDzDZDZǽǾȈǻǼDZǶǼǬǽǹȇǵǭǬǽǽDZǵǹǽǽǬǿǹǺǵǴȀǼǬǹȂǿdzǽǶǴDZǰǮDZǼǴǮǽǬǰ Ǹ2 ǞǬǸǹǬȁǺǰǴǾǽȋǺǾǷǴȃǹǬȋ dzǺǹǬǺǾǰȇȁǬǻǺǰǹǬǮDZǽǺǸǙǬǻDZǼǮǺǸȉǾǬDzDZǰǺǸǬDZǽǾȈǯǺǽǾǴǹǬȋǽǭǺǷȈȄǺǵdzǺǹǺǵǶǿȁǹDZǵǴdzǯǺǽǾǴǹǺǵǮȇȁǺǰǹǬǾDZǼǼǬǽǿǽǺǾǶǼȇǾȇǸǶǬǸǴǹǺǸǙǬǽǷDZǰǿȊȅDZǸȉǾǬDzDZ ǼǬǽǻǺǷǺDzDZǹȇǺǾǰDZǷȈǹȇDZǽǻǬǷȈǹǴǭǺǷȈȄǬȋǮǬǹǹǬȋǶǺǸǹǬǾǬǴǰǼǿǯǬȋǾDZǼǼǬǽǬǎǸǬǹǽǬǼǰDZǰǺǸǬǹǬȁǺǰǴǾǽȋǾDZǼǼǬǽǬǽǰǿȄDZǸǹǬǺǾǶǼȇǾǺǸǮǺdzǰǿȁDZǖǺǹDZȃǹǺDZǽǾȈ ǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇǩǾǺǾǰǺǸǻǺǰȁǺǰǴǾǶǬǶǰǷȋǺǰǹǺǵǽDZǸȈǴǾǬǶǴǮǶǬȃDZǽǾǮDZǼǺǽǶǺȄǹǺǯǺDzǴǷȈȋǰǷȋǰǮǿȁǻǺǶǺǷDZǹǴǵǮǽǮǺDZǸǽǺǭǽǾǮDZǹǹǺǸǰǺǸDZǽǺǾǷǴȃǹȇǸ ǾǼǬǹǽǻǺǼǾǹȇǸǽǺǺǭȅDZǹǴDZǸǽȂDZǹǾǼǺǸ

&HQD3ULFHǢDZǹǬ .ÿ&=. 9tFHLQIRUPDFtQDZZZFHQWXU\F])RUPRUHLQIRUPDWLRQYLVLWZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 AZ Reality, Na Dolinách , Praha 4 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

107


Realitní makléř: Lachman Petr Kontakt: +420 725 293 616 E-mail: petr.lachman@century21.cz

›ÝãZ›ƒ½®ãù

129ê52',11ê'š08/,%(5&( 1(:)$0,/<+286(1($5/,%(5(& 5iGQDEtGQXQRYëURGLQQëGŢPYÿHWQĚGYRXJDUiæHQDPHQätPSR]HPNXPYORNDOLWĚ1RYë+DUFRY9SUYQtPSRGODætVSŐtVWXSHPSŐHVEH]SHÿQRVWQtGYHŐHVHQDFKi]t PHQätKDODV:&DNRPRURX]HNWHUpVHGRVWDQHWHGRYHOPLSURVWRUQpKRREëYDFtKRSRNRMHVYHVWDYĚQRXNXFK\ŁVNRXOLQNRXQDPtUX7RPXWRSURVWRUXGRGiYiNUiVXDSUDNWLÿQRVW QRYiSŐtURGQtNDPHQQiGODæED=REëYDFtKRSRNRMHVHGiOHGRVWDQHWHQDWHUDVX P NGHUiQRPŢæHWHSRVQtGDWYNOLGXSRYHÿHŐHWQHERSR]YDWVYpSŐiWHOHQDJULORYiQtDSŐtMHPQpSRVH]HQt3RPDVLYQtFKVFKRGHFKY\VWRXSiWHGRGUXKpKRSRGODætNGHMHQDSURWLVFKRGŢPXPtVWĚQDOX[XVQtNRXSHOQDVSROHÿQĚV:&9HGOHORæQLFHVHQDFKi]t~WXOQëDSURVWRUQëGĚWVNëSRNRM'ŢPMHYHOPLVYĚWOëDRNROtY\Et]tNHVSRUWRYQtPXY\æLWtDSŐHGHYätPUHOD[X ,WLVP\SOHDVXUHWRRIIHU\RXDQHZIDPLO\KRXVHLQFOXGLQJDJDUDJHRQDVPDOOPñSORWLQWKHORFDWLRQRI1RYë+DUFRY7KHJURXQGÁRRUZLWKVHFXULW\GRRUFRPSULVHVDVPDOOHQWUDQFHKDOOZLWK:&DQGDVWRUDJHURRPDVZHOODVDYHU\VSDFLRXVOLYLQJURRPZLWKDEXLOWLQWDLORUHGNLWFKHQXQLW7KLVURRPERDVWVQHZQDWXUDOVWRQHÁRRUWLOHVZKLFKDGGEHDXW\DQGSUDFWLFDOLW\7KHOLYLQJURRPKDVDQH[LWRQWRDPñWHUUDFHZKHUH\RXFDQIRUH[DPSOHHQMR\EUHDNIDVWLQWKHPRUQLQJDSHDFHIXOVXSSHURULQYLWHIULHQGVDURXQGIRUDEDUEHTXHRUSOHDVDQW JHWWRJHWKHU7KHVROLGVWDLUFDVHOHDGVWRWKHXSSHUÁRRUZKHUHDOX[XU\EDWKURRPZLWKDWRLOHWLVVLWXDWHGDWWKHWRSRIWKHVWDLUV1H[WWRWKHPDLQEHGURRPWKHUHLVDODUJHFRV\FKLOGUHQ·V URRP7KHKRXVHLVVXQOLWDQGWKHVXUURXQGLQJVSURYLGHÀUVWDQGIRUHPRVWDQLQYLWDWLRQWRVSRUWDQGUHFUHDWLRQ ǫǼǬǰȃǾǺȋǸǺǯǿǻǼDZǰǷǺDzǴǾȈǮǬǸǹǺǮȇǵǽDZǸDZǵǹȇǵǰǺǸǻǷǬǹǴǼǺǮǶǴǮǶǷȊȃǬȋǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇǹǬǹDZǭǺǷȈȄǺǸǿȃǬǽǾǶDZǸǮǹǬǽDZǷDZǹǹǺǸǻǿǹǶǾDZ1RYë+DUFRYǙǬ ǻDZǼǮǺǸȉǾǬDzDZǶǿǰǬǸǺDzǹǺǻǺǻǬǽǾȈǾǺǷȈǶǺȃDZǼDZdzǭDZdzǺǻǬǽǹȇDZǰǮDZǼǴǹǬȁǺǰǴǾǽȋǹDZǭǺǷȈȄǺǵȁǺǷǷǽǾǿǬǷDZǾǺǸǴǶǷǬǰǺǮǺǵǴdzȁǺǷǷǬǻǿǾȈǮDZǰDZǾǮǻǼǺǽǾǺǼǹǿȊǯǺǽǾǴǹǿȊǽǺǮǽǾǼǺDZǹǹȇǸ ǶǿȁǺǹǹȇǸǯǬǼǹǴǾǿǼǺǸǽǰDZǷǬǹǹȇǸǹǬdzǬǶǬdzǖǼǬǽǺǾǿǴǻǼǬǶǾǴȃǹǺǽǾȈȉǾǺǵǶǺǸǹǬǾȇǻǺǰȃDZǼǶǴǮǬDZǾǹǺǮǬȋǻǷǴǾǶǬǴdzǹǬǾǿǼǬǷȈǹǺǯǺǶǬǸǹȋǔdzǯǺǽǾǴǹǺǵDZǽǾȈǮȇȁǺǰǹǬǾDZǼǼǬǽǿ Ǹ  ǯǰDZǿǾǼǺǸǮȇǹǬǻǼǴǸDZǼǸǺDzDZǾDZǻǺdzǬǮǾǼǬǶǬǾȈǴǷǴǽǻǺǶǺǵǹǺǻǺǿDzǴǹǬǾȈǴǷǴǻǼǴǯǷǬǽǴǾȈǰǼǿdzDZǵǹǬǭǬǼǭDZǶȊǴǻǼǴȋǾǹȇǵǺǾǰȇȁǛǺǸǬǽǽǴǮǹǺǵǷDZǽǾǹǴȂDZǸǺDzǹǺǻǺǰǹȋǾȈǽȋǹǬǮǾǺǼǺǵ ȉǾǬDzǯǰDZǼǬǽǻǺǷǺDzDZǹǬǼǺǽǶǺȄǹǬȋǮǬǹǹǬȋǶǺǸǹǬǾǬǽǾǿǬǷDZǾǺǸǜȋǰǺǸǽǻǬǷȈǹȋǴǿȊǾǹǬȋǴǻǼǺǽǾǺǼǹǬȋǰDZǾǽǶǬȋǶǺǸǹǬǾǬǐǺǸǺȃDZǹȈǽǮDZǾǷȇǵǬǮǺǶǼDZǽǾǹǺǽǾȋȁǸǺDzǹǺǴǺǾǰǺȁǹǿǾȈǴ dzǬǹȋǾȈǽȋǽǻǺǼǾǺǸ

&HQD3ULFHǢDZǹǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Best Reality, Kubánské náměstí 1321/18, Praha 1 108

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Josef Navara Kontakt: +420 725 293 614 E-mail: josef.navara@century21.cz

›ÝãZ›ƒ½®ãù

32/29,1$'92-'208..0235$+$/,3$1<+$/)2)..6(0,'(7$&+('+286(0ñ35$*8(/,3$1< ([NOX]LYQĚVLGRYROXMHPHQDEtGQRXWNSURGHMLSRORYLQXGYRMGRPXNN3UDKD/LSDQ\1RYRVWDYED]URNXMHXPtVWĚQiYHYHOLFHNOLGQpORNDOLWĚQiNXSQtFHQWUXP YþHVWOLFtFKMHY]GiOHQRNP9SŐt]HPtVHQDFKi]tSŐtVWXSRYiKDODVH]DEXGRYDQëPäDWQtNHPWHFKQLFNiPtVWQRVWV:&DSŐtVWXSHPGR]DKUDG\'iOHMH]GHPtVWQRVWSUR ~ORæQëSURVWRU9ĚWäLQXSŐt]HPtWYRŐtRWHYŐHQëNRQFHSWREëYDFtKRMtGHOQtKRDNXFK\ŁVNpKRSURVWRUX.XFK\ŁVNiOLQNDMHSOQĚY\EDYHQDVSRWŐHELÿLDæXORYRXSUDFRYQtGHVNRX9SDWŐHMVRXWŐLORæQLFH]QLFKæMHGQDMHY\XætYiQDMDNRSUDFRYQD6RXÿiVWtSUYQtORæQLFHMHNRXSHOQD:&DäDWQD9GRPĚMHSRGODKRYpWRSHQtDEH]SHÿQRVWQtIUDQFRX]VNiRNQDVHæDOX]LHPL*DUiæMHY\WiSĚQi'ŢPMHHOHNWURQLFN\]DEH]SHÿHQYSHUIHNWQtPVWDYXDSŐLSUDYHQLKQHGNQDVWĚKRYiQt1iE\WHNMHYROLWHOQRXVRXÿiVWtSURGHMH :HDUHWKHVROHDJHQWVIRUWKHVDOHRIKDOIRIDVHPLGHWDFKHGNNKRXVHLQ3UDJXH/LSDQ\1HZO\EXLOWLQVLWXDWHGLQDYHU\SHDFHIXOORFDWLRQWKHVKRSSLQJFHQWUHLQþHVWOLFHLVNPDZD\7KHJURXQGÁRRUFRPSULVHVDQHQWUDQFHKDOOZLWKDEXLOWLQFXSERDUGWHFKQLFDOURRPZLWKDWRLOHWDQGWKHH[LWWRWKHJDUGHQ7KHUHLVDOVRDURRPVXLWDEOHIRUXVHDVD VWRUDJHURRP0RVWRIWKHJURXQGÁRRULVDQRSHQSODQOLYLQJURRPGLQLQJURRPNLWFKHQ7KHNLWFKHQXQLWLVIXOO\HTXLSSHGZLWKDSSOLDQFHVDQGDJUDQLWHZRUNWRS7KHVWÁRRUFRQVLVWV RIWKUHHEHGURRPVRQHRIZKLFKVHUYHVDVDVWXG\7KHPDLQEHGURRPKDVDQHQVXLWHEDWKURRP:&DQGGUHVVLQJURRP7KHKRXVHKDVXQGHUÁRRUKHDWLQJDQGVHFXULW\)UHQFKZLQGRZVZLWKMDORXVLHV7KHJDUDJHLVKHDWHG7KHKRXVHLVHOHFWURQLFDOO\VHFXUHGLQSHUIHFWFRQGLWLRQDQGUHDG\IRUQHZUHVLGHQWVWRPRYHLQ7KHIXUQLWXUHLVDQRSWLRQDOSDUWRIWKHVDOH ǛǺǷǺǮǴǹǬǰǮǺǵǹǺǯǺǰǺǸǬǻǷǬǹǴǼǺǮǶǴǶǶǸ2ǛǼǬǯǬ/LSDQ\ ǛǼDZǰǷǬǯǬDZǸǰǷȋǻǺǶǿǻǶǴǻǺǷǺǮǴǹǿǰǮǺǵǹǺǯǺǰǺǸǬǻǷǬǹǴǼǺǮǶǴǶǶǛǼǬǯǬǗǴǻǬǹȇǙǺǮǺǽǾǼǺǵǶǬǯǺǰǬǼǬǽǻǺǷǺDzDZǹǬǮǺȃDZǹȈǽǻǺǶǺǵǹǺǸǼǬǵǺǹDZ ǾǺǼǯǺǮȇǵȂDZǹǾǼǮþHVWOLFHǹǬȁǺǰǴǾǽȋǮǶǸǙǬǻDZǼǮǺǸȉǾǬDzDZǹǬȁǺǰǴǾǽȋǮȁǺǰǹǺǵȁǺǷǷǽǺǮǽǾǼǺDZǹǹȇǸȄǶǬȀǺǸǻǺǰǽǺǭǹǺDZǻǺǸDZȅDZǹǴDZǽǾǿǬǷDZǾǺǸǴǮȇȁǺǰǺǸ ǮǽǬǰǖǼǺǸDZǾǺǯǺDZǽǾȈǸDZǽǾǺǰǷȋȁǼǬǹDZǹǴȋǍǺǷȈȄǴǹǽǾǮǺǻDZǼǮǺǯǺȉǾǬDzǬ²ȉǾǺǺǾǶǼȇǾǬȋdzǺǹǬǯǺǽǾǴǹǺǵǽǾǺǷǺǮǺǵǴǻǼǺǽǾǼǬǹǽǾǮǬǶǿȁǹǴǖǿȁǹȋǽǯǼǬǹǴǾǹǺǵ ǽǾǺǷDZȄǹǴȂDZǵǻǺǷǹǺǽǾȈȊǺǭǺǼǿǰǺǮǬǹǬǾDZȁǹǴǶǺǵǙǬǮǾǺǼǺǸȉǾǬDzDZǹǬȁǺǰȋǾǽȋǾǼǴǽǻǬǷȈǹǴǺǰǹǬǴdzǶǺǾǺǼȇȁǴǽǻǺǷȈdzǿDZǾǽȋǮǶǬȃDZǽǾǮDZǼǬǭǺȃDZǯǺǶǬǭǴǹDZǾǬǣǬǽǾȈ ǻDZǼǮǺǵǽǻǬǷȈǹǴ²ǮǬǹǹǬȋǶǺǸǹǬǾǬǾǿǬǷDZǾǴǯǬǼǰDZǼǺǭǎǰǺǸDZDZǽǾȈǻǺǷȇǽǻǺǰǺǯǼDZǮǺǸǴǭDZdzǺǻǬǽǹȇDZȀǼǬǹȂǿdzǽǶǴDZǺǶǹǬǽDzǬǷȊdzǴǏǬǼǬDzǺǾǬǻǷǴǮǬDZǾǽȋǐǺǸ ǺǭDZǽǻDZȃDZǹǽǴǽǾDZǸǺǵȉǷDZǶǾǼǺǹǹǺǵǭDZdzǺǻǬǽǹǺǽǾǴǺǹǮǺǾǷǴȃǹǺǸǽǺǽǾǺȋǹǴǴǴǯǺǾǺǮǶǻDZǼDZDZdzǰǿǘDZǭDZǷȈǸǺDzDZǾǭȇǾȈȃǬǽǾȈȊǻǺǶǿǻǶǴ

&HQD3ULFHǢDZǹǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Best Reality, Kubánské náměstí 1321/18, Praha 1 352'(-,6$/(6,džLJDžƺƶƻljLjǖęÌ-(1,2&72%(5,DžǁljǖƷLJǓ

109


Realitní makléř: Jana Bayerová Kontakt: +420 608 338 697 E-mail: jana.bayerova@century21.cz

129267$9%$9,/<..$%81*$/298..9(/.e3ŏÌ/(3< 1(:9,//$$1'..%81*$/2:9(/.e3ŏÌ/(3< $UFKLWHNWRQLFN\FK\WŐHŐHäHQpVWDYE\YH9HONëFK3ŐtOHSHFK 3UDKD]iSDG QHGDOHNR3UDK\.YDOLWQĚSURYHGHQpVWDYE\PRGHUQtVWDYHEQtSUYN\2EDGRP\VSOŁXMtY\VRNp SRæDGDYN\QDE\GOHQtVRXÿDVQëFKURGLQ2EDLQWHULpU\MVRXY]GXäQpSURVWRUQpDREëYDFtSURVWRUQDEt]tYROQëYVWXSQD]DKUDGXSŐHVWHUDVX9LODSR]HPHNP2]DVWDYĚQiSORFKDP2GYRXJDUiæ%XQJDORYP2]DVWDYĚQiSORFKDP2GYRXJDUiæ/RNDOLWDVNRPSOHWQtREÿDQVNRXY\EDYHQRVWtDGREURXGRVWXSQRVWtGR3UDK\DQDOHWLäWĚ9iFODYD+DYOD %XLOGLQJVZLWKDFOHYHUDUFKLWHFWXUDOVROXWLRQLQ9HONp3ŐtOHS\ 3UDJXH:HVW QHDU3UDJXH7KHKRXVHVDUHRIDKLJKTXDOLW\FRQVWUXFWLRQZLWKPRGHUQEXLOGLQJIHDWXUHV%RWKKRXVHVPHHWWKHKLJKGHPDQGVIRUGZHOOLQJRIFRQWHPSRUDU\IDPLOLHV%RWKLQWHULRUVDUHDLU\VSDFLRXVZLWKWKHOLYLQJURRPSURYLGLQJIUHHDFFHVVWRWKHJDUGHQDFURVVWKHWHUUDFH9LOODPñSORWEXLOWXSDUHDRIPñGRXEOHJDUDJH%XQJDORZPñSORWEXLOWXSDUHDRIPñGRXEOHJDUDJH7KHORFDWLRQKDVFRPSOHWHFLYLFDPHQLWLHVDQG JRRGDFFHVVLELOLW\WR3UDJXHDQG3UDJXH$LUSRUW ǙDZǰǬǮǹǺǻǺǽǾǼǺDZǹǹǬȋǮǴǷǷǬǽǻǬǷDZǹǴǽǻǬǷȈǹǴǭǿǹǯǬǷǺ3ULOHS\ǟǸDZǷǺǬǼȁǴǾDZǶǾǿǼǹǺdzǰǬǹǴǵǮǎDZǷǴǶǺǵ3ŐtOHS\ ǛǼǬǯǬdzǬǻǬǰ ǹDZǰǬǷDZǶǺǺǾǛǼǬǯǴǡǺǼǺȄǺǽǰDZǷǬǹǹȇǵdzǰǬǹǴǵ ǽǺǮǼDZǸDZǹǹȇȁǽǾǼǺǴǾDZǷȈǹȇȁȉǷDZǸDZǹǾǺǮǚǭǬǰǺǸǬǺǾǮDZȃǬȊǾǮȇǽǺǶǴǸǾǼDZǭǺǮǬǹǴȋǸǽǺǮǼDZǸDZǹǹǺǯǺDzǴǷȈȋǰǷȋǽDZǸDZǵǚǭǬǴǹǾDZǼȈDZǼǻǼǺǽǾǺǼǹǺǵǻǼǺǽǾǺǼǹǺǵǯǺǽǾǴǹǺǵǴǻǼDZǰǷǬǯǬDZǾ ǭDZǽǻǷǬǾǹȇǵǰǺǽǾǿǻǮǽǬǰȃDZǼDZdzǾDZǼǼǬǽǿ9LOODǸ2ǺǽǹǺǮǬǹǴȋǻǷǺȅǬǰȈdzǬǽǾǼǺǵǶǴǸ2ǯǬǼǬDzǍǿǹǯǬǷǺǸ2dzǬǽǾǼǺDZǹǹǬȋǻǷǺȅǬǰȈǸ2ǯǬǼǬDzǜǬǽǻǺǷǺDzDZǹǴDZǽǺǮǽDZǸǴ ǿǰǺǭǽǾǮǬǸǴǴȁǺǼǺȄǴǸǰǺǽǾǿǻǺǸǶǛǼǬǯDZǴǮǬȉǼǺǻǺǼǾ

&HQD3ULFHǢDZǹǬLQIRUPDFHYNDQFHOiŐLIURPWKH5HDO(VWDWH$JHQF\ǴǹȀǺǼǸǬȂǴȋǮǬǯDZǹǾǽǾǮDZ Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Bonus Praha, Korunní 104, Praha 10 - Vinohrady 110

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Michaela Vaňousová Kontakt: +420 281 866 806 E-mail: michaela.vanousova@century21.cz

½…Ä

352'(-%<7835$+$/,%(ŀ02)256$/()/$735$*8(/,%(ŀ0ñ

%\W  V EDONRQHP D YëKOHGHP QD ŐtÿNX 5RN\WNX 2GNU\Wp UHQRYRYDQp SŢYRGQt NOHQE\ SDUNHW\ D GYHŐH NUE Y REëYDFtP SRNRML D ORæQLFL NRXSHOQD VGHVLJQRYRXVDQLWRX2ULHQWDFH]iSDGYëFKRG9ëMLPHÿQëFLWOLYĚ]UHNRQVWUXRYDQëE\WYEOt]NRVWLPHWUD3DOPRYND ÁDWZLWKDEDOFRQ\DQGYLHZRIWKH5RN\WND5LYHU8QFRYHUHGUHQRYDWHGRULJLQDODUFKHVSDUTXHWÁRRUVDQGGRRUVÀUHSODFHVLQWKHOLYLQJURRPDQGEHGURRP EDWKURRPZLWKGHVLJQHUVDQLWDU\À[WXUHV7KHÁDWIDFHV:HVWDQG(DVW([WUDRUGLQDU\VHQVLWLYHO\UHFRQVWUXFWHGÁDWLQWKHYLFLQLW\RIWKH3DOPRYND0HWURVWDWLRQ ǖǮǬǼǾǴǼǬǹǬǻǼǺǰǬDzǿǛǼǬǯǬ/LEHŁP2ǖǮǬǼǾǴǼǬǻǷǬǹǴǼǺǮǶǴǽǭǬǷǶǺǹǺǸǴǽǮǴǰǺǸǹǬǼDZǶǿǜǺǶǴǾǶǬǚǾǶǼȇǾȇDZǺǾǼDZǸǺǹǾǴǼǺǮǬǹǹȇDZ ǺǼǴǯǴǹǬǷȈǹȇDZǽǮǺǰȇǻǬǼǶDZǾǴǰǮDZǼǴǶǬǸǴǹǮǯǺǽǾǴǹǺǵǴǽǻǬǷȈǹDZǮǬǹǹǬȋǶǺǸǹǬǾǬǽǰǴdzǬǵǹDZǼǽǶǺǵǽǬǹǾDZȁǹǴǶǺǵǚǼǴDZǹǾǬȂǴȋ²dzǬǻǬǰǮǺǽǾǺǶ ǛǼDZǮǺǽȁǺǰǹǬȋǽǾǴǷȈǹǺǺǾǼDZǸǺǹǾǴǼǺǮǬǹǹǬȋǶǮǬǼǾǴǼǬǼȋǰǺǸǽǸDZǾǼǺǛǬǷǸǺǮǶǬ

&HQD3ULFHǢDZǹǬ &=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Elán, Smetanova 240, Úvaly u Prahy 352'(-,6$/(6,džLJDžƺƶƻljLjǖęÌ-(1,2&72%(5,DžǁljǖƷLJǓ

111


Realitní makléř: Tereza Tomsová Kontakt: +420 725 293 073 E-mail: tereza.tomsova@century21.cz

02'(51Ì%<7..%0235$+$58%(ã.$

/02'(510ñ)/$7..%$/&21<35$*8(58%(ã.$

1DEt]tPHPRGHUQtE\WNN%YRVREQtPYODVWQLFWYtYRE\WQpPFHONXQRYRVWDYE\5XEHäNDQD3UD]H9\VRÿDQ\XOLFH3DŐtNRYD%\WRYiMHGQRWNDRSORäHP2P2 balkon se QDFKi]tY13QRYRVWDYE\VKRGLQRYRXUHFHSFtDYëWDKHP%\WMHÿiVWHÿQĚ]DŐt]HQQRYëPDPRGHUQtPQiE\WNHPLYHäNHUëPLVSRWŐHELÿL.XFK\ŁVNiOLQNDVPUDPRURYRXGHVNRXP\ÿND WURXEDVHVNORNHUDPLFNRXGHVNRXGLJHVWRŐOHGQLFHPUD]iNYHVWDYĚQiVNŐtŁDERWQtNVYĚäiNHPYSŐHGVtQL9NRXSHOQĚYDQDXP\YDGORæHEŐtNRYëUDGLiWRUSUDÿND:&VDPRVWDWQp 3RGODK\GŐHYĚQpSDUNHW\9ëKOHG]E\WXDEDONRQXGRNOLGQëFKYQLWUREORNŢVRULHQWDFtQDVHYHUDMLKNUiVQëYëKOHG1HXVWiOiSUiFH]DKUDGQtNŢQD]NUiäORYiQtRNROQt]HOHQĚ9ëERUQi GRSUDYQtGRVWXSQRVWMHQPHWUŢQDPHWURD0+'9\VRÿDQVNi$WUDNWLYQtORNDOLWDSURE\GOHQtVYHäNHURXREÿDQVNRXY\EDYHQRVWt9EOt]NRVWL2&)pQL[SŐtURGQtSDUN3RGYLQtDF\NORVWH]N\ :HRIIHUWKLVPRGHUQNN%ÁDWLQSULYDWHRZQHUVKLSLQWKHQHZ5XEHäNDUHVLGHQWLDOEXLOGLQJLQ3DŐtNRYD6WUHHW3UDJXH²9\VRÿDQ\7KHÁDWPñLQVL]HZLWKDPñEDOFRQ\ LVORFDWHGRQWKHWKÁRRURIWKHQHZEXLOGLQJZLWKDOLIWDQGKRXU5HFHSWLRQ7KHÁDWLVSDUWLDOO\IXUQLVKHGZLWKQHZPRGHUQIXUQLWXUHDQGHTXLSSHGZLWKDOODSSOLDQFHV7KHNLWFKHQ XQLWKDVDPDUEOHZRUNWRS GLVKZDVKHURYHQZLWKJODVVFHUDPLFVWRYHWRSKRRGIULGJHIUHH]HU 7KHHQWUDQFHKDOOFRQWDLQVDEXLOWLQZDUGUREHVKRHUDFNDQGFRDWUDFN7KHEDWKURRP FRPSULVHVDEDWKWXEZDVKEDVLQODGGHUUDGLDWRUZDVKLQJPDFKLQHDQGVHSDUDWHWRLOHW:RRGHQSDUTXHWÁRRULQJ%HDXWLIXOQRUWKDQGVRXWKIDFLQJYLHZVIURPWKHÁDWDQGEDOFRQ\RYHU TXLHWFRXUW\DUGV*DUGHQHUVDUHSHUPDQHQWO\HPSOR\HGLQEHDXWLI\LQJWKHVXUURXQGLQJJUHHQHU\([FHOOHQWWUDYHOOLQNVRQO\PHWUHVIURPWKH0HWURVWDWLRQDQG9\VRÿDQVNiSXEOLF WUDQVSRUWWHUPLQXV$WWUDFWLYHUHVLGHQWLDOORFDWLRQZLWKDOOFLYLFDPHQLWLHV,QWKHLPPHGLDWHYLFLQLW\DUHWKH)pQL[VKRSSLQJFHQWUHWKH3RGYLQtQDWXUDOSDUNDQGF\FOLQJURXWHV ǛǼDZǰǷǬǯǬDZǸǽǺǮǼDZǸDZǹǹǿȊǶǮǬǼǾǴǼǿǶǶǭǬǷǶǺǹǮȃǬǽǾǹǺǵǽǺǭǽǾǮDZǹǹǺǽǾǴǮDzǴǷǺǸǶǺǻǷDZǶǽDZǹǺǮǺǽǾǼǺDZǶ©ǜǿǭDZȄǶǬªǮǼǬǵǺǹDZǛǼǬǯǬ9\VRÿDQ\ǿǷ3DŐtNRYDǖǮǬǼǾǴǼǬ ǻǷǺȅǬǰȈȊǸǸǭǬǷǶǺǹǼǬǽǻǺǷǺDzDZǹǬǹǬȉǾǬDzDZǮǹǺǮǺǸdzǰǬǹǴǴǽȃǬǽǺǮǺǵǼDZȂDZǻȄǹǴǷǴȀǾǺǸǖǮǬǼǾǴǼǬȃǬǽǾǴȃǹǺǸDZǭǷǴǼǺǮǬǹǬǹǺǮǺǵǴǽǺǮǼDZǸDZǹǹǺǵǸDZǭDZǷȈȊ ǴǻǺǷǹǺǽǾȈȊǺǽǹǬȅDZǹǬǭȇǾǺǮǺǵǾDZȁǹǴǶǺǵǖǿȁǺǹǹȇǵǯǬǼǹǴǾǿǼǽǸǼǬǸǺǼǹǺǵǽǾǺǷDZȄǹǴȂDZǵ ǻǺǽǿǰǺǸǺDZȃǹǬȋǸǬȄǴǹǬǻǷǴǾǬǽǶDZǼǬǸǴȃDZǽǶǺǵǻǺǮDZǼȁǹǺǽǾȈȊǮȇǾȋDzǶǬȁǺǷǺǰǴǷȈǹǴǶ ǸǺǼǺdzǴǷȈǹǴǶ ǮǽǾǼǺDZǹǹȇǵȄǶǬȀǮDZȄǬǷǶǬǻǺǷǶǬǰǷȋǺǭǿǮǴǮǻǼǴȁǺDzDZǵǎǮǬǹǹǺǵǶǺǸǹǬǾDZDZǽǾȈǮǬǹǹǬǿǸȇǮǬǷȈǹǴǶǺǾǺǻǴǾDZǷȈǹȇǵǼǬǰǴǬǾǺǼǽǾǴǼǬǷȈǹǬȋǸǬȄǴǹǬǾǿǬǷDZǾ ²ǺǾǰDZǷȈǹǺǛǺǷǰDZǼDZǮȋǹǹȇǵǻǬǼǶDZǾǍǬǷǶǺǹǴǺǶǹǬǶǮǬǼǾǴǼȇǮȇȁǺǰȋǾǮǾǴȁǴDZǰǮǺǼȇǽǺǼǴDZǹǾǬȂǴDZǵǹǬǽDZǮDZǼǴȊǯǴdzǶǮǬǼǾǴǼȇǺǾǶǼȇǮǬDZǾǽȋǶǼǬǽǴǮȇǵǮǴǰǛǼǺȀDZǽǽǴǺǹǬǷȈǹȇDZ ǽǻDZȂǴǬǷǴǽǾȇǻǺǺdzDZǷDZǹDZǹǴȊǼDZǯǿǷȋǼǹǺdzǬǹǴǸǬȊǾǽȋǰDZǶǺǼǴǼǺǮǬǹǴDZǸǴǺdzDZǷDZǹDZǹǴDZǸǺǶǼǿDzǬȊȅDZǵǸDZǽǾǹǺǽǾǴǚǾǷǴȃǹǺDZǾǼǬǹǽǻǺǼǾǹǺDZǽǺǺǭȅDZǹǴDZǮǽDZǯǺǸDZǾǼǺǮǰǺǸDZǾǼǺ ǴǺǽǾǬǹǺǮǶǴǺǭȅDZǽǾǮDZǹǹǺǯǺǾǼǬǹǽǻǺǼǾǬ9\VRÿDQVNiǎȇǯǺǰǹǺDZǼǬǽǻǺǷǺDzDZǹǴDZǰǷȋǻǼǺDzǴǮǬǹǴȋǽǺǮǽDZǸǴǿǰǺǭǽǾǮǬǸǴǴǼǬdzǮǴǾǺǵǴǹȀǼǬǽǾǼǿǶǾǿǼǺǵǜȋǰǺǸǹǬȁǺǰǴǾǽȋǞǺǼǯǺǮȇǵ ǢDZǹǾǼ©)pQL[ªǻǬǼǶ3RGYLQtǴǮDZǷǺǽǴǻDZǰǹȇDZǰǺǼǺDzǶǴ

&HQD3ULFHǢDZǹǬ.ÿ&=. 3.990.000 9tFHLQIRUPDFtQDZZZFHQWXU\F])RUPRUHLQIRUPDWLRQYLVLWZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Aba Reality, Paříkova 910/9, Praha 9 - Vysočany 112

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Miroslava Pirchanová Kontakt: +420 608 702 400 E-mail: miroslava.pirchanova@century21.cz

‘ã®ÊÄ

52',11ê'š0..*0232=(0(.029(/.e32329,&( /)$0,/<+286(..*0ñ0ñ3/279(/.e32329,&( 5RGLQQëGŢPYPRGHUQtPIXQNFLRQDOLVWLFNpPVW\OXMHXPtVWĚQQDNRQFLVOHSpXOLFHYH9HONëFK3RSRYLFtFKNGHVHGiOHUR]SURVWtUDMtXæMHQORXN\DOHV\'ŢPMHQDYUæHQMDNR Qt]NRHQHUJHWLFNëY\WiSĚQWHSHOQëPLÿHUSDGO\9SŐt]HPtMHSURVWRUQëREëYDFtSRNRMVNUEHP]HNWHUpKRY\MGHWHSŐtPRQDYHONRXWHUDVXGiOHäDWQDKRVWLQVNëSRNRM:& VHVSUFKRYëPNRXWHP9SDWŐHMHORæQLFHVHVRXNURPRXNRXSHOQRXURGLÿŢGĚWVNpSRNRMHDNRXSHOQDSURGĚWL'ŢPMHSRGVNOHSHQYVXWHUpQXMHJDUiæSURDXWD SURVWRUSURVDXQXNRXSHOQDWHFK]i]HPt 7KLVIDPLO\KRPHLQPRGHUQIXQFWLRQDOVW\OHLVORFDWHGDWWKHHQGRIDFXOGHVDFLQ9HONp3RSRYLFHZKHUHWKHUHDUHRQO\PHDGRZVDQGIRUHVWV7KHKRXVHKDVDORZHQHUJ\GHVLJQEHLQJKHDWHGE\KHDWSXPSV7KHJURXQGÁRRUFRPSULVHVDVSDFLRXVOLYLQJURRPZLWKDÀUHSODFHIURPZKLFK\RXH[LWGLUHFWO\RQWRWKHKXJHWHUUDFHDVZHOODV DJXHVWURRPGUHVVLQJURRP:&ZLWKVKRZHUFRUQHU7KHVWÁRRUFRQVLVWVRIDEHGURRPZLWKHQVXLWHEDWKURRPFKLOGUHQ·VURRPVDQGDFKLOGUHQ·VEDWKURRP7KHKRXse has a cellar with a two-car garage, room for a sauna, bathroom and technical facilities. ǝDZǸDZǵǹȇǵǰǺǸǻǷǬǹǴǼǺǮǶǴǶǶǯǬǼǬDzǬǸ2ǿȃǬǽǾǺǶǸ29HONp3RSRYLFHǛǼǬǯǬǮǺǽǾǺǶ ǝDZǸDZǵǹȇǵǰǺǸǮǽǺǮǼDZǸDZǹǹǺǸȀǿǹǶȂǴǺǹǬǷȈǹǺǸǽǾǴǷDZǼǬǽǻǺǷǺDzDZǹǮǶǺǹȂDZǾǿǻǴǶǺǮǺǵǿǷǴȂȇǮǹǬǽDZǷDZǹǹǺǸǻǿǹǶǾDZǎDZǷǶDZǛǺǻǺǮǴȂDZdzǬǹǴǸǻǼǺǽǾǴǼǬȊǾǽȋǶǼǬǽǴǮȇDZ ǷǿǯǬǴǷDZǽǬǐǺǸǽǻǼǺDZǶǾǴǼǺǮǬǹǶǬǶǻǺǾǼDZǭǷȋȊȅǴǵǸǬǷǺDZǶǺǷǴȃDZǽǾǮǺȉǹDZǼǯǴǴǺǾǬǻǷǴǮǬDZǾǽȋǾDZǻǷǺǮȇǸǴǹǬǽǺǽǬǸǴǙǬǹǴDzǹDZǸȉǾǬDzDZǹǬȁǺǰǴǾǽȋǻǼǺǽǾǺǼǹǬȋǯǺǽǾǴǹǬȋ ǽǶǬǸǴǹǺǸǴdzǶǺǾǺǼǺǵDZǽǾȈǮȇȁǺǰǹǬǭǺǷȈȄǿȊǾDZǼǼǬǽǿǯǬǼǰDZǼǺǭǹǬȋǯǺǽǾDZǮǬȋǶǺǸǹǬǾǬǽǬǹǿdzDZǷǽǰǿȄDZǸǙǬǺǸǹǬǰdzDZǸǹǺǸȉǾǬDzDZǹǬȁǺǰǴǾǽȋǽǻǬǷȈǹȋǽǺǾǰDZǷȈǹǺǵ ǮǬǹǹǺǵǶǺǸǹǬǾǺǵǰǷȋǼǺǰǴǾDZǷDZǵǽǻǬǷȈǹǴǰDZǾǽǶǴDZǶǺǸǹǬǾȇǴǮǬǹǹǬȋǶǺǸǹǬǾǬǰǷȋǰDZǾDZǵǎǰǺǸDZDZǽǾȈǻǺǰǮǬǷǹǬȂǺǶǺǷȈǹǺǸȉǾǬDzDZǯǬǼǬDzǹǬǸǬȄǴǹȇǸDZǽǾǺǰǷȋ ǽǬǿǹȇǮǬǹǹǬȋǶǺǸǹǬǾǬǸDZǽǾǺǰǷȋǾDZȁǹǴȃDZǽǶǺǯǺǺǭǺǼǿǰǺǮǬǹǴȋ

&HQD3ULFHǢDZǹǬ.ÿ&=. 

9tFHLQIRUPDFtQDZZZFHQWXU\F])RUPRUHLQIRUPDWLRQYLVLWZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Action, Masarykovo nábřeží 2014/2, Praha 2 - Nové Město 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

113


Realitní makléř: Ladislav Schiller Kontakt: +420 720 150 000

ě٦ù

E-mail: ladislav.schiller@century21.cz

352'(-52',11ê'š00235$+$672'š/.<)256$/()$0,/<+286(0ñ35$*8(672'š/.< 'RYROXMHPHVLYiPQDEtGQRXWSURGHMDWUDNWLYQtGYRXJHQHUDÿQtYLO\YNOLGQpÿiVWL6WRGŢOHNYXOLFL3RGRKUDGVNiSREOtæ3URNRSVNpKR~GROt9LODPiGYĚWDNŐNDLGHQWLFNpE\WRYpMHGQRWN\NDæGiRGLVSR]LFLFHONRYi SRGODKRYiSORFKDP2'RGRPXVHYVWXSXMHSŐHVUR]OHKORXSŐHGVtŁGiOHGRFKRGELÿN\]HNWHUpVHYFKi]t]YOiäŘGRSRNRMHSURKRVW\]YOiäŘGRORæQLFHDGRNXFK\QĚVREëYDFtPSRNRMHPRNRORPRGHUQĚSRMDWp NRXSHOQ\VHVSUFKRYëPNRXWHPDVDPRVWDWQëP:&3RVFKRGHFKVHY\VWXSXMHGRSDWUDNGHVH]~WXOQpFKRGELÿN\YVWXSXMHVWHMQĚMDNRYSŐt]HPtGRMHGQRWOLYëFKQHSUŢFKR]tFKSRNRMŢNRXSHOQDWDNpVHVSUFKRYëPNRXWHP:&VDPRVWDWQĚ9SRGNURYtVHQDFKi]tMHGQDRE\WQiSRGNURYQtPtVWQRVWDSURVWRUQiSŢGD]HNWHUpMHPRæQRSR~SUDYiFKY\WYRŐLWWDNpRE\WQpPtVWQRVWL'ŢPMHSRGVNOHSHQ9GRPĚMH]DYHGHQëSO\Q WRSHQtMHQDSO\QRYëNRWHOVSRUiN\YNXFK\QtFKMVRXHOHNWULFNp3ŐtSRMNDQDSHYQRXWHOHIRQQtOLQNXLLQWHUQHWMVRXVDPR]ŐHMPRVWt1DGRPĚSUREĚKODUHNRQVWUXNFHVWŐHFK\DRNHQSŐHGVHGPLOHW\3ŐHGSŐLEOLæQĚGYDFHWL OHW\E\O\QRYĚSURYHGHQ\UR]YRG\WRSHQtYRG\HOHNWŐLQ\DRGSDGŢ.GRPXSDWŐt]DKUDGDVSRVH]HQtPDJULOHPDGYRXJDUiæ1D]DKUDGĚMHVWXGQDVÿHUSDGOHPNWHUiVORXætN]DOpYiQtGŢPMHQDSRMHQQDYHŐHMQRX YRGRYRGQtVtŘ9LODVHQDFKi]tYSRNOLGQpYLORYp]iVWDYEĚYEOt]NRVWL]DVWiYN\0+'0DOi2KUDGDRGNXGMHFFDPLQXWY]GiOHQD]DVWiYNDPHWUD1RYp%XWRYLFH9\XæLMWHWpWRYHOLFH]DMtPDYpQDEtGN\YæiGDQpORNDOLWĚ :HRIIHUIRUVDOHDQDWWUDFWLYHWZRJHQHUDWLRQYLOODLQDSHDFHIXOSDUWRI6WRGŢON\LQ3RGRKUDGVNi6WUHHWQHDU3URNRSVNp~GROt7KHYLOODFRQWDLQVWZRDOPRVWLGHQWLFDOÁDWXQLWVHDFKRIWKHPZLWKDOD\RXWRI DQGDWRWDOXVDEOHDUHDRIPñ7KHKRXVHLVDFFHVVLEOHWKURXJKDYHU\ODUJHHQWUDQFHKDOOOHDGLQJWRDFRUULGRUZLWKVHSDUDWHHQWUDQFHVWRDJXHVWURRPH[WUDEHGURRPNLWFKHQDQGOLYLQJURRPDQG WRWKHPRGHUQEDWKURRPZLWKVKRZHUFRUQHUDQGVHSDUDWHWRLOHW7KHVWDLUFDVHOHDGVXSWRDFRV\FRUULGRURQWKHVWÁRRUZLWKVLPLODUVHSDUDWHHQWUDQFHVWRWKHURRPVDVRQWKHJURXQGÁRRU7KHURRPVDUH QRWLQWHUFRQQHFWHGWKHEDWKURRPDOVRKDVDVKRZHUFRUQHUDQGVHSDUDWHWRLOHW7KHDWWLFFRPSULVHVRQHURRPVXLWDEOHIRUOLYLQJDQGDODUJHORIWURRPZKLFKFDQEHUHEXLOWDIWHUVRPHPRGLÀFDWLRQVLQWRVHveral rooms suitable for living. The house has a cellar. There is a gas connection and a gas boiler for heating. The kitchen stoves are electric. There is the standard connection to the telephone and Internet. \HDUVDJRWKHKRXVHXQGHUZHQWUHFRQVWUXFWLRQRIWKHURRIDQGZLQGRZV$SSUR[LPDWHO\\HDUVDJRWKHKHDWLQJZDWHUHOHFWULFLW\DQGZDVWHZDWHUSLSHVZHUHUHSODFHGZLWKQHZSLSLQJ7KHUHLVRXWGRRU seating in the garden, a grill and double garage. There is also a well with a pump that serves for irrigation. The house is connected to the urban water supply. The villa is located in a peaceful villa developPHQWLQWKHYLFLQLW\RIWKH0DOiRKUDGDSXEOLFWUDQVSRUWVWRSZKLFKLVPLQXWHVWRWKH1RYp%XWRYLFH0HWURVWDWLRQ:HUHFRPPHQGWKLVYHU\LQWHUHVWLQJFKRLFHLQDQDWWUDFWLYHORFDOLW\ ǛǼDZǰǷǬǯǬDZǸǻǼǺǰǬDzǿǴǹǾDZǼDZǽǹǺǵǮǴǷǷȇǰǷȋǻǼǺDzǴǮǬǹǴȋǰǮǿȁǻǺǶǺǷDZǹǴǵǮǾǴȁǺǵȃǬǽǾǴǼǬǵǺǹǬǛǼǬǯǴǝǾǺǰǿǷǶǴǹǬǿǷǴȂDZ3RGRKUDGVNiǹDZǰǬǷDZǶǺǺǾǛǼǺǶǺǻǽǶǺǵǰǺǷǴǹȇ 3URNRSVNp~GROt ǎ ǮǴǷǷDZǰǮDZǻǺȃǾǴǴǰDZǹǾǴȃǹȇȁǶǮǬǼǾǴǼȇǶǬDzǰǬȋǻǷǬǹǴǼǺǮǶǴǺǭȅǬȋǻǷǺȅǬǰȈP2ǎǰǺǸǸǺDzǹǺǮǺǵǾǴȃDZǼDZdzǻǼǺǽǾǺǼǹǿȊǻǼǴȁǺDzǿȊǻǺǾǺǸȃDZǼDZdzǶǺǼǴǰǺǼȃǴǶǴdzǶǺǾǺǼǺǯǺǺǾǰDZǷȈǹȇǵǮȁǺǰ ǮDZǰDZǾǮǶǺǸǹǬǾǿǰǷȋǯǺǽǾDZǵǺǾǰDZǷȈǹǺǮǽǻǬǷȈǹȊǴǹǬǶǿȁǹȊǽǯǺǽǾǴǹǺǵǸǴǸǺǽǺǮǼDZǸDZǹǹǺǵǽǾǴǷȈǹǺǵǮǬǹǹǺǵǶǺǸǹǬǾǬǽǰǿȄDZǮǺǵǶǬǭǴǹǺǵǾǿǬǷDZǾǼǬǽǻǺǷǺDzDZǹǺǾǰDZǷȈǹǺǛǺǷDZǽǾǹǴȂDZǸǺDzǹǺ ǻǺǰǹȋǾȈǽȋǹǬǻDZǼǮȇǵȉǾǬDzǯǰDZǶǬǶǴǹǬǹǴDzǹDZǸȉǾǬDzDZǴdzǿȊǾǹǺǯǺǶǺǼǴǰǺǼȃǴǶǬǮȁǺǰǮDZǰDZǾǮǺǾǰDZǷȈǹȇDZǹDZǻǼǺȁǺǰǹȇDZǶǺǸǹǬǾȇǮǬǹǹǬȋǶǺǸǹǬǾǬǾǺDzDZǽǰǿȄDZǮǺǵǶǬǭǴǹǺǵǺǾǰDZǷȈǹȇǵǾǿǬǷDZǾǙǬ ȃDZǼǰǬǶDZǼǬǽǻǺǷǺDzDZǹǬDzǴǷǬȋǸǬǹǽǬǼǰǹǬȋǶǺǸǹǬǾǬǴǻǼǺǽǾǺǼǹǬȋǸǬǹǽǬǼǰǬǯǰDZǻǺǽǷDZǽǺǺǾǮDZǾǽǾǮǿȊȅǴȁǺǾǰDZǷǺǶǸǺDzǹǺǾǬǶDzDZDzǴǷȇDZǶǺǸǹǬǾȇǎǰǺǸDZDZǽǾȈǻǺǰǮǬǷǎǰǺǸǻǼǺǮDZǰDZǹǯǬdzǺǾǺǻǷDZǹǴDZ ǯǬdzǺǮǺDZǻǷǴǾȇǮǶǿȁǹȋȁȉǷDZǶǾǼǴȃDZǽǶǴDZǖǺǹDZȃǹǺDZǽǾȈǻǺǰǶǷȊȃDZǹǴDZǶǾDZǷDZȀǺǹǹǺǵǷǴǹǴǴǴǔǹǾDZǼǹDZǾǎǰǺǸDZǭȇǷǬǻǼǺǮDZǰDZǹǬǼDZǶǺǹǽǾǼǿǶȂǴȋǶǼȇȄǴǴǺǶǺǹǷDZǾǹǬdzǬǰǛǼǴǸDZǼǹǺǰǮǬǰȂǬǾȈǷDZǾ ǹǬdzǬǰǭȇǷǴǽǰDZǷǬǹȇǹǺǮȇDZǼǬdzǮǺǰǶǴǺǾǺǻǷDZǹǴȋǮǺǰȇȉǷDZǶǾǼǴȃDZǽǾǮǬǴǶǬǹǬǷǴdzǬȂǴǴǖǰǺǸǿǺǾǹǺǽǴǾǽȋǽǬǰǽdzǺǹǺǵǰǷȋǺǾǰȇȁǬǴǭǬǼǭDZǶȊǴǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇǎǽǬǰǿǹǬȁǺǰǴǾǽȋǶǺǷǺǰDZȂ ǽǹǬǽǺǽǺǸǶǺǾǺǼȇǵǴǽǻǺǷȈdzǿDZǾǽȋǰǷȋǻǺǷǴǮǬǽǬǸǰǺǸǻǺǰǶǷȊȃDZǹǶǽDZǾǴǺǭȅDZǽǾǮDZǹǹǺǯǺǮǺǰǺǻǼǺǮǺǰǬǎǴǷǷǬǼǬǽǻǺǷǺDzDZǹǬǮǾǴȁǺǸDzǴǷǺǸǼǬǵǺǹDZdzǬǽǾǼǺDZǹǹǺǸǮǴǷǷǬǸǴǹDZǰǬǷDZǶǺǺǾǺǽǾǬǹǺǮǶǴ ǺǭȅDZǽǾǮDZǹǹǺǯǺǾǼǬǹǽǻǺǼǾǬ0DOiRKUDGDǺǾǶǺǾǺǼǺǵǸǴǹǿǾǰǺǸDZǾǼǺ1RYp%XWRYLFHǜDZǶǺǸDZǹǰǿDZǸǺǭǼǬǾǴǾȈǮǹǴǸǬǹǴDZǹǬȉǾǺǴǹǾDZǼDZǽǹǺDZǻǼDZǰǷǺDzDZǹǴDZǮǺȃDZǹȈǻǺǻǿǷȋǼǹǺǸǼǬǵǺǹDZ

&HQD3ULFHǢDZǹǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Energy, Korunní 1167/43, Praha 2 - Vinohrady 114

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Jaroslav Nováček Kontakt: +420 720 150 000 E-mail: jaroslav.novacek@century21.cz

ě٦ù

352'(-%<78..70;*3672'š/.<8/./$8629$)256$/(..7)/$70ñ;*$5$*(35$*8(672'š/.<./$8629$675((7 +OHGiWHOLNUiVQpPRGHUQtE\GOHQtVSRMXMtFtQDGÿDVRYRVWSUDNWLÿQRVWDSŐtURGX]DGYHŐPLSDNYiVQDäHQDEtGNDE\GOHQtSŐtPRX3URNRSVNpKR~GROtQDGFKQH1DEt]tPHYiPNUiVQëVOXQFHPSURVYtFHQëE\W RGLVSR]LFLNNDYHOLNRVWLP1HMHQPLORYQtFLYHQNRYQtKRSRVH]HQtXNiY\ÿLÿDMHRFHQtSURVWRUQRXWHUDVXYiäRGSRÿLQHNWDNpXPRFQtYëKOHGGRXGUæRYDQpNOLGQp]HOHQp]DKUDG\%\WPiVYĚWOëSURVWRUQëREëYDFtSRNRMVSRMHQëVURKRYëPNXFK\ŁVNëPNRXWHP7HQYiVVSROHÿQĚVPRGHUQtNXFK\ŁVNRXOLQNRXVH]DEXGRYDQëPLVSRWŐHELÿL VNORNHUDPLFNRXGHVNRXKRUNRY]GXäQRXWURXERXP\ÿNRXOHGQLFt  DEDURYëPSXOWHPVYëPSUDNWLFNëPŐHäHQtPRKURPt2VWDWQtSRNRMHMVRXQHSUŢFKR]tNGLVSR]LFLMVRXGYĚNRXSHOQ\VWRDOHWDPL%\WMHYHYHOPLKH]NpPDXGUæRYDQpPVWDYX.E\WXQiOHætYODVWQtGYRXJDUiæ ]QtæMHNE\WXEH]EDULHURYëSŐtVWXS.URPĚYHVWDYĚQëFKVNŐtQtRGVSROHÿQRVWL:RRGIDFHDVSRXVW\~ORæQëFKSURVWRUSŐtPRYE\WĚMHNGLVSR]LFLLSURVWRUQiNRPRUDYJDUiæLMVRXQDYtFYHVWDYĚQpVNŐtQĚWDNp RGVSROHÿQRVWL:RRGIDFH8GRPXYHYQLWUREORNXMH]DKUDGDNDPPDMtSŐtVWXSSRX]HRE\YDWHOpGRPX%\WMHYHYHOPLNUiVQpDæiGDQpORNDOLWĚVYHäNHURXREÿDQVNRXY\EDYHQRVWt%\GOHQtVSOQtYDäHQiURÿQp SRæDGDYN\QDNRPIRUWQtE\GOHQtDGtN\VYpGLVSR]LFLDYHOLNRVWLMHLGHiOQtSURURGLQ\VGĚWPL%\WMHPRæQRÀQDQFRYDWK\SRWHÿQtP~YĚUHPNWHUëSURYiVUiGLMDNRERQXV]DŐtGtPH]GDUPD ,I\RXVHHNDPRGHUQGZHOOLQJFRPELQLQJWLPHOHVVQHVVDQGSUDFWLFDOLW\ZLWKWKHFRXQWU\VLGHMXVWDURXQGWKHFRUQHUWKHQ\RXZLOOEHFDSWLYDWHGE\RXUFKRLFHRIGZHOOLQJLQWKH3URNRSVNp9DOOH\ :HRIIHU\RXDEHDXWLIXOYHU\VXQOLWNNÁDWPñLQVL]H7KHVSDFLRXVWHUUDFHZLOOEHHVSHFLDOO\DSSUHFLDWHGE\RXWGRRUHQWKXVLDVWVIRUUHOD[LQJRYHUWHDRUFRIIHHHQKDQFHGE\DYLHZRIWKH ZHOOPDLQWDLQHGJDUGHQ7KHÁDWKDVDOLJKWVSDFLRXVOLYLQJURRPFRQQHFWHGWRDNLWFKHQFRUQHU7KHRWKHUURRPVDUHQRWLQWHUFRQQHFWHG*RXUPHWVDQGRWKHUVZLOOEHFDSWLYDWHGE\WKHSUDFWLFDOO\ GHVLJQHGNLWFKHQFRUQHUZLWKDPRGHUQNLWFKHQXQLWEXLOWLQDSSOLDQFHV JODVVFHUDPLFVWRYHWRSKRWDLURYHQGLVKZDVKHUIULGJH DQGDEDU7KHÁDWFRQWDLQVWZREDWKURRPVZLWKWRLOHWV7KHÁDW LVLQDYHU\ÀQHDQGZHOOPDLQWDLQHGFRQGLWLRQ7KHÁDWKDVLWVRZQGRXEOHJDUDJHZLWKEDUULHUIUHHDFFHVVIURPWKHÁDW%HVLGHVEXLOWLQFXSERDUGVE\WKH:RRGIDFHFRPSDQ\DQGVXIÀFLHQWVWRUHURRPVULJKWLQWKHÁDWWKHJDUDJHFRQWDLQVDVSDFLRXVVWRUHURRPDQGDGGLWLRQDOEXLOWLQFXSERDUGVDOVRE\WKH:RRGIDFHFRPSDQ\7KHJDUGHQLQWKHFRXUW\DUGLVUHVHUYHGVROHO\IRUUHVLGHQWVRI the building. The location is very beautiful and attractive, with all the civic amenities. This residence will meet all your demanding requirements for comfortable living and, thanks to its layout and VL]HLVLGHDOIRUIDPLOLHVZLWKFKLOGUHQ7KHSXUFKDVHRIWKHÁDWPD\EHÀQDQFHGE\DPRUWJDJHORDQZKLFKZHZLOOJODGO\DUUDQJHIRU\RXIUHHRIFKDUJHDVDERQXV ǑǽǷǴǮȇǴȅDZǾDZǶǼǬǽǴǮǺDZǽǺǮǼDZǸDZǹǹǺDZDzǴǷȈDZǽǺDZǰǴǹȋȊȅDZDZǮǽDZǭDZǮǹDZǮǼDZǸDZǹǹǺǽǾȈǻǼǬǶǾǴȃǹǺǽǾȈǴǻǼǴǼǺǰǿǻǼȋǸǺdzǬǰǮDZǼȈȊǾǺǹǬȄDZǻǼDZǰǷǺDzDZǹǴDZDzǴǷȈȋǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǼȋǰǺǸǽǛǼǺǶǺǻǽǶǺǵǰǺǷǴǹǺǵ ǻǼǴǰDZǾǽȋǎǬǸǻǺǮǶǿǽǿǘȇǻǼDZǰǷǬǯǬDZǸǎǬǸǶǼǬǽǴǮǿȊdzǬǷǴǾǿȊǽǺǷǹȂDZǸǶǮǬǼǾǴǼǿǻǷǬǹǴǼǺǮǶǴǶǶǴǼǬdzǸDZǼǺǸǸǙDZǾǺǷȈǶǺǷȊǭǴǾDZǷǴǺǾǰǺȁǹǿǾȈǹǬǺǾǶǼȇǾǺǸǮǺdzǰǿȁDZǽȃǬȄǶǺǵǶǺȀDZǴǷǴȃǬȋǻǺ ǰǺǽǾǺǴǹǽǾǮǿǺȂDZǹȋǾǻǼǺǽǾǺǼǹǿȊǾDZǼǼǬǽǿǻǼǴȃDZǸǶǬȃDZǽǾǮǺǮǬȄDZǯǺǺǾǰȇȁǬǻǺǮȇǽǴǾǴǮǴǰǹǬǿȁǺDzDZǹǹȇǵǾǴȁǴǵdzDZǷDZǹȇǵǽǬǰǎǶǮǬǼǾǴǼDZDZǽǾȈǽǮDZǾǷǬȋǻǼǺǽǾǺǼǹǬȋǯǺǽǾǴǹǬȋǺǭȆDZǰǴǹDZǹǹǬȋǽǶǿȁǹDZǵǺǽǾǬǷȈǹȇDZ ǶǺǸǹǬǾȇǹDZǻǼǺȁǺǰǹȇDZǙDZǾǺǷȈǶǺǷȊǭǴǾDZǷDZǵȁǺǼǺȄDZǵDZǰȇǹDZǺǽǾǬǮǴǾǼǬǮǹǺǰǿȄǹȇǸǻǼǬǶǾǴȃǹǬȋǿǯǷǺǮǬȋdzǺǹǬǶǿȁǹǴǽǽǺǮǼDZǸDZǹǹȇǸǶǿȁǺǹǹȇǸǯǬǼǹǴǾǿǼǺǸǽǺǮǽǾǼǺDZǹǹǺǵǾDZȁǹǴǶǺǵ ǽǾDZǶǷǺǶDZǼǬǸǴȃDZǽǶǬȋ ǻǷǴǾǬǰǿȁǺǮǶǬǽǯǺǼȋȃǴǸǮǺdzǰǿȁǺǸǻǺǽǿǰǺǸǺDZȃǹǬȋǸǬȄǴǹǬȁǺǷǺǰǴǷȈǹǴǶ ǬǾǬǶDzDZǭǬǼǹȇǵǻǿǷȈǾǎǶǮǬǼǾǴǼDZǰǮDZǮǬǹǹȇDZǶǺǸǹǬǾȇǽǾǿǬǷDZǾǬǸǴǖǮǬǼǾǴǼǬǹǬȁǺǰǴǾǽȋǮǺȃDZǹȈǶǼǬǽǴǮǺǸǴǿȁǺDzDZǹǹǺǸ ǽǺǽǾǺȋǹǴǴǖǶǮǬǼǾǴǼDZǺǾǹǺǽǴǾǽȋǽǮǺǵǽǺǭǽǾǮDZǹǹȇǵǯǬǼǬDzǹǬǸǬȄǴǹȇǮǶǺǾǺǼȇǵǸǺDzǹǺǻǺǻǬǽǾȈǴǹǬǴǹǮǬǷǴǰǹǺǵǶǺǷȋǽǶDZǖǼǺǸDZǮǽǾǼǺDZǹǹȇȁȄǶǬȀǺǮǺǾȀǴǼǸȇ:RRGIDFHǴǸǹǺDzDZǽǾǮǬǸDZǽǾǰǷȋ ȁǼǬǹDZǹǴȋǻǼȋǸǺǮǶǮǬǼǾǴǼDZDZǽǾȈǾǬǶDzDZǻǼǺǽǾǺǼǹǬȋǶǷǬǰǺǮǬȋǮǯǬǼǬDzDZǾǬǶDzDZǮǽǾǼǺDZǹǹȇDZȄǶǬȀȇǺǾȀǴǼǸȇ:RRGIDFHǟǰǺǸǬǮǺǰǮǺǼDZDZǽǾȈǽǬǰǰǺǽǾǿǻǹȇǵǾǺǷȈǶǺǰǷȋDzǴǾDZǷDZǵǰǺǸǬǖǮǬǼǾǴǼǬǹǬȁǺǰǴǾǽȋ ǮǺȃDZǹȈǶǼǬǽǴǮǺǸǴDzDZǷǬǹǹǺǸǸDZǽǾDZǽǼǬdzǮǴǾǺǵǴǹȀǼǬǽǾǼǿǶǾǿǼǺǵǒǴǷȈDZǭǿǰDZǾǽǺǺǾǮDZǾǽǾǮǺǮǬǾȈǮǽDZǸǮǬȄǴǸǾǼDZǭǺǮǬǹǴȋǸǻǼDZǰȆȋǮǷȋDZǸȇǸǶǶǺǸȀǺǼǾǹǺǽǾǴǻǼǺDzǴǮǬǹǴȋǴǭǷǬǯǺǰǬǼȋǽǮǺDZǵǻǷǬǹǴǼǺǮǶDZ ǴǼǬdzǸDZǼǬǸǴǰDZǬǷȈǹǺǻǺǰȁǺǰǴǾǰǷȋǽDZǸDZǵǽǰDZǾȈǸǴǖǮǬǼǾǴǼǿǸǺDzǹǺȀǴǹǬǹǽǴǼǺǮǬǾȈǴǻǺǾDZȃǹȇǸǶǼDZǰǴǾǺǸǶǺǾǺǼȇǵǸȇǰǷȋǮǬǽǭǿǰDZǸǼǬǰȇǺǼǯǬǹǴdzǺǮǬǾȈǭDZǽǻǷǬǾǹǺǮǶǬȃDZǽǾǮDZǭǺǹǿǽǬ

&HQD3ULFHǢDZǹǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Energy, Korunní 1167/43, Praha 2 - Vinohrady 352'(-,6$/(6,džLJDžƺƶƻljLjǖęÌ-(1,2&72%(5,DžǁljǖƷLJǓ

115


Realitní makléř: Kristýna Řezáčová Kontakt: +420 725 293 026 E-mail: kristyna.rezacova@century21.cz

9,/$6(6$81289,1É5128%$=e1(0%(52819,//$:,7+6$81$:,1(&(//$56:,00,1*322/,1%(5281

([NOX]LYQtQDEtGNDNUiVQpYLO\VHVDXQRXYLQiUQRX]LPQt]DKUDGRXDED]pQHP9LODVHQDFKi]tQDYHOPLKH]NpPPtVWĚVYëKOHGHPQD%HURXQ9SŐt]HPtREëYDFt SRNRM V NXFK\ŁVNëP NRXWHP ]LPQt ]DKUDGD NRXSHOQD äDWQD D SUiGHOQD 9 MHGQRWOLYëFK SDWUHFK ORæQLFH D GDOät SŐtVOXäHQVWYt 3RGODK\ SORYRXFt PUDPRU D GODæED WRSHQtSO\QRYp3DUNRYiQt²GYRXJDUiæ8GUæRYDQi]DKUDGDVJULOHPYHONëPED]pQHP1DSR]HPNXVHGiOHQDFKi]tQRYRVWDYEDGDOätKR5'NWHUëMHWpæVRXÿiVWtSURGHMH9HOPLKH]NpPtVWRSREOtæFHQWUDPĚVWD :HDUHWKHVROHDJHQWVIRUDEHDXWLIXOYLOODZLWKDVDXQDZLQHFHOODUZLQWHUJDUGHQDQGVZLPPLQJSRRO7KHYLOODLVORFDWHGLQDYHU\EHDXWLIXOVLWHZLWKDYLHZRI %HURXQ7KHJURXQGÁRRUFRPSULVHVDOLYLQJURRPZLWKDNLWFKHQFRUQHUZLQWHUJDUGHQEDWKURRPGUHVVLQJURRPDQGDODXQGU\7KHUHPDLQLQJÁRRUVFRQVLVWRIEHGURRPVDQGRWKHUIDFLOLWLHV)ORDWLQJÁRRUVPDUEOHDQGÁRRUWLOHV3DUNLQJ²GRXEOHJDUDJH:HOOPDLQWDLQHGJDUGHQZLWKDJULOODQGODUJHVZLPPLQJSRRO,QDGGLWLRQWKHSORW FRPSULVHVDQRWKHUQHZIDPLO\KRPHZKLFKLVDOVRLQFOXGHGLQWKHVDOH9HU\SOHDVDQWORFDWLRQQHDUWKHWRZQFHQWUH ǎǴǷǷǬ ǻǷǬǹǴǼǺǮǶǴ  ǽ ǽǬǿǹǺǵ ǮǴǹǹȇǸ ǻǺǯǼDZǭǺǸ ǭǬǽǽDZǵǹǺǸ ǍDZǼǺǿǹ ǩǶǽǶǷȊdzǴǮǹǺDZ ǻǼDZǰǷǺDzDZǹǴDZ ǶǼǬǽǴǮǺǵ ǮǴǷǷȇ ǻǷǬǹǴǼǺǮǶǴ  ǽ ǽǬǿǹǺǵ ǮǴǹǹȇǸ ǻǺǯǼDZǭǺǸǭǬǽǽDZǵǹǺǸǴdzǴǸǹǴǸǽǬǰǺǸǎǴǷǷǬǼǬǽǻǺǷǺDzDZǹǬǮǺȃDZǹȈǶǼǬǽǴǮǺǸǸDZǽǾDZǽǮǴǰǺǸǹǬǍDZǼǺǿǹǙǬǻDZǼǮǺǸȉǾǬDzDZǯǺǽǾǴǹǬȋǽdzǺǹǺǵǶǿȁǹǴdzǴǸǹǴǵǽǬǰ ǮǬǹǹǬȋǶǺǸǹǬǾǬǯǬǼǰDZǼǺǭǹǬȋǴǻǼǬȃDZȃǹǬȋǙǬǺǾǰDZǷȈǹȇȁȉǾǬDzǬȁǽǻǬǷȈǹǴǴǰǼǿǯǴDZǿǰǺǭǽǾǮǬǛǺǷȇ²ǷǬǸǴǹǬǾǸǼǬǸǺǼǴǻǷǴǾǶǬǯǬdzǺǮǺDZǺǾǺǻǷDZǹǴDZǛǬǼǶǺǮǶǬ² ǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇǟȁǺDzDZǹǹȇǵǽǬǰǽǭǬǼǭDZǶȊǭǺǷȈȄǺǵǭǬǽǽDZǵǹǙǬǿȃǬǽǾǶDZǾǬǶDzDZǹǬȁǺǰǴǾǽȋǹǺǮǺǽǾǼǺǵǶǬDZȅDZǺǰǹǺǯǺǰǺǸǬǶǺǾǺǼȇǵǾǬǶDzDZȋǮǷȋDZǾǽȋȃǬǽǾȈȊ ǻǼǺǰǬDzǴǚȃDZǹȈȁǺǼǺȄDZDZǼǬǽǻǺǷǺDzDZǹǴDZǼȋǰǺǸǽȂDZǹǾǼǺǸǯǺǼǺǰǬ

&HQD 3ULFHǢDZǹǬ .ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Reality Anděl, Ostrovského 253/3, 150 00 Praha 5 - Smíchov 116

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Václav Horák Kontakt: +420 725 293 942 E-mail: vaclav.horak@century21.cz

./$6,&.É35925(38%/,.29É9,/$35$+$+/28%ę7Ì1$&/$66,&),5675(38%/,&9,//$,135$*8(+/28%ę7Ì1 1iGKHUQiSUYRUHSXEOLNRYiYLODY3UD]H+ORXEĚWtQĚ 3RŐtÿDQVNiXOLFH 'ŢPRGSRVWDYHQtRSDWUXMtWŐLJHQHUDFHMHGQpURGLQ\NWHUiFHORXGREXGEiQD]DFKRYiQtSŢYRGQt P\äOHQN\DGXFKDVWDYE\8æLWQiSORFKDGRPXMHP2FHOëSR]HPHNPiUR]ORKXP2'ŢPVHVNOiGi]HSRGODætSRP2 GYRMJHQHUDÿQtE\GOHQtDWHFKQLFNp ]i]HPt QHY\XæLWiSŢGDP2.YLOHQiOHætGYRMJDUiæDGDOätVDPRVWDWQiJDUiæ1DGYRŐHMHSŢYRGQt]UHNRQVWUXRYDQëED]pQ 9KRGQpQHMHQSURE\GOHQtDOHQDSŐtNODGLSURSHQ]LRQQHERH[NOX]LYQtVtGORÀUP\ 7KLVLVDQDPD]LQJ)LUVW5HSXEOLFYLOODLQ3UDJXH+ORXEĚWtQ 3RŐtÿDQVNi6WUHHW 6LQFHEHLQJHUHFWHGWKHKRXVHKDVEHHQFDUHGIRUE\WKUHHJHQHUDWLRQVRIWKHVDPH IDPLO\ZKRHQVXUHGWKDWWKHRULJLQDOGHVLJQDQGDWPRVSKHUHRIWKHEXLOGLQJZHUHUHWDLQHG7KHXVDEOHDUHDRIWKHKRXVHLVP2WKHZKROHSORWVL]HLVP2. The YLOODFRQVLVWVRIÁRRUVHDFKRIP2 OLYLQJDUHDIRUWZRJHQHUDWLRQVWKHWHFKQLFDOHTXLSPHQW XQXVHGODQGRIP2. In addition, a double garage and another separate garage belong to the villa. The reconstructed original swimming pool is in the courtyard. 6XLWDEOHDVDKRPHDJXHVWKRXVHRUDQH[FOXVLYHFRPSDQ\UHVLGHQFH ǖǷǬǽǽǴȃDZǽǶǬȋǮǴǷǷǬǮǼDZǸDZǹǛDZǼǮǺǵǜDZǽǻǿǭǷǴǶǴǻǷǬǹǴǼǺǮǶǬǛǼǬǯǬ+ORXEHWLQ ǖǼǬǽǴǮǬȋǮǴǷǷǬǮǼDZǸDZǹǛDZǼǮǺǵǜDZǽǻǿǭǷǴǶǴǮǛǼǬDzǽǶǺǸǼǬǵǺǹDZǏǷǺǿǭDZǾǴǹ ǿǷ3RŐtÿDQVNi ǎǰǺǸDZǽǸǺǸDZǹǾǬDZǯǺǻǺǽǾǼǺǵǶǴǻǼǺDzǴǮǬǷǴǾǼǴǻǺǶǺǷDZǹǴȋǺǰǹǺǵ ǽDZǸȈǴǶǺǾǺǼȇDZǮǽDZȉǾǺǮǼDZǸȋǽǾǬǼǬǷǴǽȈǻǺǰǰDZǼDzǴǮǬǾȈǴǽǺȁǼǬǹȋǾȈǻDZǼǮǺǹǬȃǬǷȈǹǿȊǴǰDZȊǴǰǿȁdzǰǬǹǴȋǛǺǷDZdzǹǬȋǻǷǺȅǬǰȈǰǺǸǬǽǺǽǾǬǮǷȋDZǾǸ2ǿȃǬǽǾǺǶ ǴǸDZDZǾǻǷǺȅǬǰȈǸ2ǎǰǺǸDZȉǾǬDzǬǶǬDzǰȇǵǻǷǺȅǬǰȈȊǸ2 DzǴǷȈDZǰǷȋǰǮǿȁǮǺdzǼǬǽǾǹȇȁǻǺǶǺǷDZǹǴǵǴǾDZȁǹǴȃDZǽǶǴDZǻǺǸDZȅDZǹǴȋ ǹDZǴǽǻǺǷȈdzǺǮǬǮȄǬȋǽȋ ǼǬǹDZDZǸǬǹǽǬǼǰǬǸ2ǖǮǴǷǷDZǺǾǹǺǽǴǾǽȋǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇǴDZȅDZǺǰǴǹǺǾǰDZǷȈǹȇǵǯǬǼǬDzǎǺǰǮǺǼDZ²ǮǺǽǽǾǬǹǺǮǷDZǹǹȇǵǺǼǴǯǴǹǬǷȈǹȇǵǭǬǽǽDZǵǹ ǛǺǰȁǺǰǴǾǹDZǾǺǷȈǶǺǰǷȋDzǴǷȈȋǹǺǴǹǬǻǼǴǸDZǼǮǶǬȃDZǽǾǮDZǼDZdzǴǰDZǹȂǴǴȀǴǼǸȇǴǷǴǻǺǰǻǬǹǽǴǺǹǬǾ

&HQD 3ULFHǢDZǹǬ .ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Reality Express, Václavské nám. 56, Praha 1 - Nové Město 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

117


Realitní makléř: Marek Lerche Kontakt: +420 725 293 497 E-mail: marek.lerche@century21.cz

W½çÝ

1$'67$1'$5'1ęŏ(ã(1ê%<7..67(5$628=,01Ì=$+5$'$/8;85,286/<'(6,*1('..)/$7:,7+$7(55$&(:,17(5*$5'(1 1DGVWDQGDUGQĚŐHäHQëDSURVYĚWOHQëE\WNNRXæLWQpSORäHP2VWHUDVRX]LPQt]DKUDGRXVNOHSHPD[JDUiæRYpVWiQtYEXGRYĚ%\WMHVRXÿiVWtGHYHORSHUVNpKR SURMHNWX5LYHUORIWVYXOLFL9DUKXOtNRYp3URVWRUQëVYĚWOëE\WVNOiGDMtFtVH]HYVWXSQtKDO\NRPRU\GYRXGĚWVNëFKSRNRMŢV-=RULHQWDFtNRXSHOQ\VDPRVWDWQpWRDOHW\REëYDFtKRSRNRMHVNXFK\ŁVNëPNRXWHPRULHQWRYDQpKR69ORæQLFHVYODVWQtNRXSHOQRXYÿWRDOHW\D]LPQt]DKUDG\7HUDVDMHVLWXRYDQiGRSĚNQĚXSUDYHQpKRRSORFHQpKRYQLWUREORNXVGĚWVNëPKŐLäWĚP2EÿDQVNiY\EDYHQRVWMHYHäNHUiYPtVWĚQDSURWLGRPXVHQDFKi]tÀWQHVVVWXGLRYHäNHUpREFKRG\YÿHWQĚUHVWDXUDFtYEOt]NRVWL8GRPXMH]DVWiYNDDXWREXVXOLQN\ÿ1iGUDæt+ROHäRYLFHGRPLQXWDPHWUR9OWDYVNiFFDGRPLQXW7UDPYDMRYi]DVWiYND2UWHQRYRQiPMHY]GiOHQDFFDPLQXW /X[XULRXVO\GHVLJQHGVXQOLWNNÁDWZLWKXVDEOHDUHDRIPñZLWKDWHUUDFHZLQWHUJDUGHQFHOODUDQGWZRSDUNLQJED\VLQWKHEXLOGLQJ7KHÁDWLVSDUWRIWKH´5LYHU /RIWVµGHYHORSPHQWSURMHFWLQ9DUKXOtNRYp6WUHHW7KHVSDFLRXVVXQOLWÁDWFRPSULVHVWKHHQWUDQFHKDOOVWRUHURRPWZRFKLOGUHQ·VEHGURRPVIDFLQJ6RXWK:HVWEDWKURRP VHSDUDWHWRLOHWOLYLQJURRPZLWKDNLWFKHQFRUQHUIDFLQJ1RUWK(DVWDEHGURRPZLWKHQVXLWHEDWKURRPLQFOXGLQJWRLOHWZLQWHUJDUGHQ7KHWHUUDFHIDFHVWKHZHOOPDLQWDLQHGIHQFHGFRXUW\DUGZLWKDFKLOGUHQ·VSOD\JURXQG$OOFLYLFDPHQLWLHVDUHDYDLODEOHLQWKHDUHD7KHUHLVDJ\PRSSRVLWHWKHEXLOGLQJVKRSVDQGUHVWDXUDQWVLQWKHYLFLQLW\7KH1REXVVWRSLVQHDUWKHKRXVHWKH+ROHäRYLFH0HWURVWDWLRQLVDPLQXWHZDONDZD\DQGWKH9OWDYVNi0HWURVWDWLRQLVDSSUR[LPDWHO\PLQXWHVIURPWKHÁDW 7KH2UWHQRYRQiPWUDPVWRSLVPLQXWHVDZD\ ǎDZǷǴǶǺǷDZǻǹǺǽǻǼǺDZǶǾǴǼǺǮǬǹǹǬȋǴǻǺǷǹǬȋǽǮDZǾǬǶǮǬǼǾǴǼǬǻǷǬǹǴǼǺǮǶǴǶǶǽDzǴǷǺǵǻǷǺȅǬǰȈȊǸ2ǽǾDZǼǼǬǽǺǵdzǴǸǹǴǸǽǬǰǺǸǻǺǰǮǬǷǺǸǴǻǬǼǶǺǮǺȃǹȇǸǴ ǸDZǽǾǬǸǴ Ǯ dzǰǬǹǴǴ ǖǮǬǼǾǴǼǬ ȋǮǷȋDZǾǽȋ ȃǬǽǾȈȊ ǰDZǮDZǷǺǻDZǼǽǶǺǯǺ ǻǼǺDZǶǾǬ 5LYHU ORIWV ǹǬ ǿǷǴȂDZ ǎǬǼǯǿǷǴǶǺǮDZ ǛǼǺǽǾǺǼǹǬȋ ǽǮDZǾǷǬȋ ǶǮǬǼǾǴǼǬ ǽǺǽǾǺȋȅǬȋ Ǵdz ȁǺǷǷǬ ǻǼǴȁǺDzDZǵǶǷǬǰǺǮǺǵǰǮǿȁǰDZǾǽǶǴȁǶǺǸǹǬǾǽȊǯǺdzǬǻǬǰǹǺǵǺǼǴDZǹǾǬȂǴDZǵǮǬǹǹǺǵǶǺǸǹǬǾȇǺǾǰDZǷȈǹǺǯǺǾǿǬǷDZǾǬǯǺǽǾǴǹǺǵǽdzǺǹǺǵǶǿȁǹǴǺǼǴDZǹǾǴǼǺǮǬǹǹǺǵǹǬǝDZǮDZǼǺ ǮǺǽǾǺǶǽǻǬǷȈǹǴǽǽǺǭǽǾǮDZǹǹǺǵǮǬǹǹǺǵǴǾǿǬǷDZǾǺǸǴdzǴǸǹDZǯǺǽǬǰǬǞDZǼǼǬǽǬǮȇȁǺǰǴǾǮȁǺǼǺȄǺǺȀǺǼǸǷDZǹǹȇǵǺǯǺǼǺDzDZǹǹȇǵǰǮǺǼǽǰDZǾǽǶǺǵǻǷǺȅǬǰǶǺǵǜǬdzǮǴǾǬȋ ǴǹȀǼǬǽǾǼǿǶǾǿǼǬǹǬǻǼǺǾǴǮǰǺǸǬȀǴǾǹDZǽǽǾǿǰǴȋǮǽDZǸǬǯǬdzǴǹȇǼǬǽǻǺǷǺDzDZǹȇǼȋǰǺǸǮǾǺǸȃǴǽǷDZǼDZǽǾǺǼǬǹȇǟǰǺǸǬǹǬȁǺǰǴǾǽȋǬǮǾǺǭǿǽǹǬȋǺǽǾǬǹǺǮǶǬǷǴǹǴǴȱ ǰǺǭǼǬǾȈǽȋǰǺ1iGUDæt+ROHäRYLFHǸǺDzǹǺǸDZǹDZDZȃDZǸdzǬǸǴǹǿǾǬǰǺǸDZǾǼǺ9OWDYVNiǸDZǹDZDZȃDZǸdzǬǸǴǹǿǾǞǼǬǸǮǬǵǹǬȋǺǽǾǬǹǺǮǶǬ2UWHQRYRQiPǮǸǴǹǿǾǬȁ

&HQDYÿSURYL]H5.3ULFHLQFFRPPLVVLRQRIWKHUHDOHVWDWHDJHQF\ǮǶǷǶǺǸǴǽǽǴȊǬǯDZǹǾǽǾǮǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Plus+, Jankovcova 1596/14, Prague 17 - Holešovice 118

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Ing. Jaroslav Denemark

Z›ƒ½^›Ùò®Ý

Kontakt: +420 774 287 732 E-mail: jaroslav.denemark@century21.cz

ŏ5'../*32=035$+$%ŏ(91297(55$&(')$0,/<+286(../*0ñ3/2735$*8(%ŏ(9129 /X[XVQĚ]DŐt]HQëŐDGRYëURGLQQëGŢPSRORKRXYREODVWLSŢYRGQt]iVWDYE\URGLQQëFKGRPŢYWĚVQpPVRXVHGVWYt2ERU\+YĚ]GD-HGQiVHRWŐtSRGODæQtGŢPVGLVSR]LFtNN NG\SŐt]HPtQDEt]tNURPĚJDUiæHWHFKQLFNpPtVWQRVWLD~ORæQëFKSURVWRULGYĚPtVWQRVWLVPRæQRVWt~SUDY\QDVDPRVWDWQpNND]LPQt]DKUDGXVSŐtPëPYVWXSHPNED]pQX 3UYQtPXSDWUXGRPLQXMHSURVWRUQëREëYDFtSRNRMSURSRMHQëVMtGHOQRXDNXFK\ŁVNëPNRXWHPYHGUXKpPSDWŐHVHQDFKi]tORæQLFH9NDæGpPSDWŐHMHORGæLHRULHQWRYDQiGR]DKUDG\5RYLQDWëSR]HPHNRYëPĚŐHP2MHUR]GĚOHQQDSŐHG]DKUiGNX]DVWDYĚQRXSORFKXP2DGRNRQDOHRGVWtQĚQRXUHOD[DÿQt]DKUDGXMHMtæVRXÿiVWtMHNU\WëED]pQ 'ŢPQDEt]tSRKRGOQpDPRGHUQtE\GOHQtYtFHÿOHQQpURGLQĚ /X[XULRXVO\HTXLSSHGWHUUDFHGIDPLO\KRXVHVLWXDWHGLQDQDUHDRIIDPLO\KRPHVLQFORVHSUR[LPLW\WRWKH+YĚ]GD*DPH5HVHUYH7KLVLVDWKUHHVWRUH\KRXVHZLWKWKHOD\RXW RIURRPVNLWFKHQQRRN7KHJURXQGÁRRUFRQVLVWVRIDJDUDJHWHFKQLFDOURRPVDQGVWRUDJHDUHDVDVZHOODVWZRURRPVZLWKWKHRSWLRQRIDOWHUDWLRQLQWRDVHSDUDWH NNKRXVLQJXQLW7KHZLQWHUJDUGHQKDVGLUHFWDFFHVVWRWKHVZLPPLQJSRRO7KHVWÁRRULVGRPLQDWHGE\DVSDFLRXVOLYLQJURRPFRQQHFWHGWRWKHGLQLQJURRPDQGNLWFKHQQRRN7KHEHGURRPVDUHRQWKHQGÁRRU(DFKÁRRUKDVDORJJLDIDFLQJWKHJDUGHQ7KHOHYHOPñSORWLVGLYLGHGLQWRWKHIURQW\DUGDEXLOWXSDUHDRIPñDQG a perfectly unshaded recreational garden which includes a covered swimming pool. The house provides comfortable, modern living for a large family. ǐǺǸǮǼȋǰǺǮǺǵdzǬǽǾǼǺǵǶDZǻǷǬǹǴǼǺǮǶǴNNǷǺǰDzǴǴǿȃǬǽǾǺǶǸ2ǛǼǬǯǬ%ŐHYQRY ǜǺǽǶǺȄǹǺǸDZǭǷǴǼǺǮǬǹǹȇǵ ǰǺǸ Ǯ ǼȋǰǺǮǺǵdzǬǽǾǼǺǵǶDZǼǬǽǻǺǷǺDzDZǹǹȇǵ Ǯ ǽǼDZǰǴ ǼǬǹDZDZǻǺǽǾǼǺDZǹǹȇȁȃǬǽǾǹȇȁǰǺǸǺǮǮ ǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵǭǷǴdzǺǽǾǴǶdzǬǻǺǮDZǰǹǴǶǿ 2ERUǬ+YĚ]GDǩǾǺǾǼDZȁȉǾǬDzǹȇǵǰǺǸǽǻǷǬǹǴǼǺǮǶǺǵǶǶǹǬǻDZǼǮǺǸȉǾǬDzDZǶǼǺǸDZǯǬǼǬDzǬǻǺǰǽǺǭǹǺǯǺǻǺǸDZȅDZǹǴȋǴǸDZǽǾǰǷȋȁǼǬǹDZǹǴȋǹǬȁǺǰȋǾǽȋǰǮDZǶǺǸǹǬǾȇ ǽǮǺdzǸǺDzǹǺǽǾȈȊǽǺdzǰǬǹǴȋǺǾǰDZǷȈǹǺǵǶǮǬǼǾǴǼȇǶǶǴdzǴǸǹǴǵǽǬǰǽǻǼȋǸȇǸǮȇȁǺǰǺǸǶǭǬǽǽDZǵǹǿǹǬǻDZǼǮǺǸȉǾǬDzDZǰǺǸǴǹǴǼǿȊȅǴǸȉǷDZǸDZǹǾǺǸȋǮǷȋDZǾǽȋǻǼǺǽǾǺǼǹǬȋ ǯǺǽǾǴǹǬȋǺǭȆDZǰǴǹDZǹǹǬȋǽǺǽǾǺǷǺǮǺǵǴdzǺǹǺǵǶǿȁǹǴǹǬǮǾǺǼǺǸȉǾǬDzDZǹǬȁǺǰȋǾǽȋǽǻǬǷȈǹǴǙǬǶǬDzǰǺǸȉǾǬDzDZDZǽǾȈǷǺǰDzǴȋǽǮǴǰǺǸǹǬǽǬǰǜǬǮǹǴǹǹȇǵǿȃǬǽǾǺǶǻǷǺȅǬǰȈȊ Ǹ2ǼǬdzǰDZǷDZǹǹǬǻǬǷǴǽǬǰǹǴǶdzǬǽǾǼǺDZǹǹǿȊǻǷǺȅǬǰȈǸ2ǴǻǼDZǶǼǬǽǹȇǵǾDZǹǴǽǾȇǵǽǬǰǰǷȋǺǾǰȇȁǬǴǼDZǷǬǶǽǬȂǴǴǮǶǺǾǺǼǺǸǹǬȁǺǰǴǾǽȋǴǶǼȇǾȇǵǭǬǽǽDZǵǹǐǺǸ ǻǼDZǰǷǬǯǬDZǾǿǰǺǭǹǺDZǴǽǺǮǼDZǸDZǹǹǺDZDzǴǷȈDZǰǷȋǭǺǷȈȄǺǵǽDZǸȈǴ

Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Real servis, Koněvova 182, Praha 3 352'(-,6$/(6,džLJDžƺƶƻljLjǖęÌ-(1,2&72%(5,DžǁljǖƷLJǓ

119


Realitní makléř: Bc. Filip Sýkora Kontakt: +420 737 828 811 E-mail: filip.sykora@century21.cz

½ã›Ù¦Ê

(;./8=,91Ì%<71$.5É/296.ê&+9,12+5$'(&+(;&/86,9()/$7,1.5É/296.e9,12+5$'< /X[XVQĚ]UHNRQVWUXRYDQëQDGVWDQGDUGQĚY\EDYHQëPH]RQHWRYëE\WVGLVSR]LÿQtPŐHäHQtPYWĚVQpEOt]NRVWL5LHJURYëFKVDGŢYSUDæVNëFK.UiORYVNëFK9LQRKUDGHFKSiUPLQXWFKŢ]HRG9iFODYVNpKR QiPĚVWt6YĚWOëE\WVMLæQtRULHQWDFtVPLPRŐiGQRXSURVWRURYRXGLVSR]LFtMHVLWXRYiQYDQDG]HPQtPSRGODætNRPSOHWQĚ]UHNRQVWUXRYDQpKRGRPXVYëWDKHP]SRÿiWNXVWROHWt9HVSRGQtPSDWŐH E\WQDEt]tSŐtMHPQRXYVWXSQtKDOXVäDWQRXWHFKQLFNRXPtVWQRVWtDRWHYŐHQëNRQFHSWSŐLMtPDFtKRSRNRMHVNUEHPVDPRVWDWQRXMtGHOQXSOQĚY\EDYHQRXNXFK\ŁNRXSHOQXVHVSUFKRYëPNRXWHPDWRDOHWX 9KRUQtPSDWŐHVHQDFKi]tJDOHULHSRNRMSURKRVW\PDVWHUORæQLFHVHäDWQRXPDVWHUNRXSHOQDVPDViæQtYDQRXDVSUFKRYëPNRXWHPDNOLGQiP2WHUDVDRULHQWRYDQiGRYQLWUREORNX%\WSURäHOQiURÿQRX UHNRQVWUXNFt]DSRXæLWtSUYRWŐtGQtFKSŐtURGQtFKPDWHULiOŢ æXODGŐHYR MHSOQĚ]DŐt]HQOX[XVQtPLD]QDÿNRYëPL]DŐL]RYDFtPLSŐHGPĚW\DY\EDYHQtP(WiæRYpWRSHQtDRKŐHYYRG\MH]DMLäŘRYiQYODVWQtPSO\QRYëPNRWOHP%\WMHHOHNWURQLFN\]DEH]SHÿHQ /X[XULRXVO\UHFRQVWUXFWHGZLWKDERYHDYHUDJHPDWHULDOVWKLVPDLVRQHWWHZLWKDOD\RXWLVLQWKHLPPHGLDWHYLFLQLW\RI5LHJHU*DUGHQVLQ.UiORYVNp9LQRKUDG\LQ3UDJXHDIHZPLQXWHV¶ZDONIURP:HQFHVODV 6TXDUH7KLVLVDVXQOLW6RXWKIDFLQJPDLVRQHWWHZLWKH[WUDRUGLQDU\VSDWLDOOD\RXWVLWXDWHGRQWKHWKDQGWKÁRRUVRIDFRPSOHWHO\UHFRQVWUXFWHGEXLOGLQJIURPWKHHDUO\WKFHQWXU\ZLWKDOLIW2QWKHORZHUÁRRUWKHÁDWERDVWVDSOHDVDQWHQWUDQFHKDOOZLWKDGUHVVLQJURRPWHFKQLFDOURRPDQGDQRSHQSODQOLYLQJURRPZLWKDÀUHSODFHVHSDUDWHGLQLQJURRPIXOO\HTXLSSHGNLWFKHQEDWKURRPZLWKDVKRZHUFRUQHUDQG WRLOHW7KHXSSHUÁRRUFRPSULVHVDJDOOHU\JXHVWURRPPDVWHUEHGURRPZLWKDGUHVVLQJURRPPDVWHUEDWKURRPZLWKDPDVVDJHEDWKWXEDQGVKRZHUFRUQHUDVZHOODVDTXLHWPñWHUUDFHIDFLQJWKHFRXUW\DUG 7KHÁDWXQGHUZHQWDGLIÀFXOWUHFRQVWUXFWLRQZLWKWKHXVHRIWRSTXDOLW\QDWXUDOPDWHULDOV JUDQLWHZRRG ,WLVIXOO\IXUQLVKHGZLWKOX[XU\EUDQGHGLWHPVÀ[WXUHVDQGÀWWLQJV7KHFHQWUDOKHDWLQJDQGZDWHUKHDWLQJ DUHSURYLGHGE\DQRZQJDVERLOHU7KHÁDWLVHOHFWURQLFDOO\VHFXUHG ǩǶǽǶǷȊdzǴǮǹǬȋǶǮǬǼǾǴǼǬǮǼǬǵǺǹDZǖǺǼǺǷDZǮǽǶǴDZǎǴǹǺǯǼǬǰȇǖǮǬǼǾǴǼǬǸDZdzǺǹDZǾǻǼǺȄǷǬǼǺǽǶǺȄǹǿȊǼDZǶǺǹǽǾǼǿǶȂǴȊǴǺǭDZǽǻDZȃDZǹǬǸDZǭǷǴǼǺǮǶǺǵǴǾDZȁǹǴǶǺǵǮȇǽǺǶǺǯǺǶǷǬǽǽǬǻǷǬǹǴǼǺǮǶǬǮǭǷǴdzǴǜǴDZǯDZǼǺǮȇȁ ǽǬǰǺǮ²ǻǼǬDzǽǶǺǯǺǻǬǼǶǬǮǼǬǵǺǹDZǖǺǼǺǷDZǮǽǶǴDZǎǴǹǺǯǼǬǰȇǮǹDZǽǶǺǷȈǶǴȁǸǴǹǿǾǬȁȁǺǰȈǭȇǺǾǎǬȂǷǬǮǽǶǺǵǻǷǺȅǬǰǴǝǮDZǾǷȇDZǬǻǬǼǾǬǸDZǹǾȇǽǺǼǴDZǹǾǴǼǺǮǶǺǵǹǬȊDzǹǿȊǽǾǺǼǺǹǿǴǽǻǼDZǶǼǬǽǹǺǵǻǼǺǽǾǺǼǹǺǵǻǷǬǹǴǼǺǮǶǺǵ ǹǬȁǺǰȋǾǽȋǹǬǸǴǸȉǾǬDzǬȁǻǺǷǹǺǽǾȈȊǺǾǼDZǽǾǬǮǼǴǼǺǮǬǹǹǺǯǺǰǺǸǬǻǺǽǾǼǺǵǶǴǹǬȃǬǷǬǮDZǶǬǽǷǴȀǾǺǸǙǬǹǴDzǹDZǸȉǾǬDzDZǶǮǬǼǾǴǼȇǹǬȁǺǰǴǾǽȋǿȊǾǹȇǵȁǺǷǷǻǼǴȁǺDzǬȋǽǯǬǼǰDZǼǺǭǺǸǻǺǰǽǺǭǹȇǸǻǺǸDZȅDZǹǴDZǸ ǴǺǾǶǼȇǾǺǵdzǺǹǺǵǶǺǸǹǬǾȇǰǷȋǻǼǴDZǸǬǯǺǽǾDZǵǽǶǬǸǴǹǺǸǺǾǰDZǷȈǹǺǵǽǾǺǷǺǮǺǵǻǷȊǽǻǺǷǹǺǽǾȈȊǺǭǺǼǿǰǺǮǬǹǹǬȋǶǿȁǹȋǮǬǹǹǬȋǶǺǸǹǬǾǬǽǰǿȄDZǸǴǾǿǬǷDZǾǺǸǙǬǮDZǼȁǹDZǸȉǾǬDzDZǹǬȁǺǰǴǾǽȋǯǬǷDZǼDZȋǯǺǽǾDZǮǬȋǶǺǸǹǬǾǬ ǯǷǬǮǹǬȋ ǽǻǬǷȈǹȋ ǽ ǯǬǼǰDZǼǺǭǹǺǵ ǯǷǬǮǹǬȋ ǮǬǹǹǬȋ ǶǺǸǹǬǾǬ ǽ ǰDzǬǶǿdzǴ Ǵ ǰǿȄDZǮǺǵ ǶǬǭǴǹǺǵ ǿȊǾǹǬȋ Ǵ ǾǴȁǬȋ ǾDZǼǼǬǽǬ  Ǹ2 ǽ ǮǴǰǺǸ ǹǬ ǮǹǿǾǼDZǹǹǴǵ ǰǮǺǼ ǎ ǶǮǬǼǾǴǼDZ ǭȇǷǬ ǻǼǺǮDZǰDZǹǬ ǼDZǶǺǹǽǾǼǿǶȂǴȋ ǻǺ ǽǬǸȇǸ ǮȇǽǺǶǴǸǽǾǬǹǰǬǼǾǬǸǴǽǻǺǷȈdzǺǮǬǷǴǽȈǾǺǷȈǶǺǻDZǼǮǺǶǷǬǽǽǹȇDZǸǬǾDZǼǴǬǷȇǹǬǾǿǼǬǷȈǹȇDZǸǬǾDZǼǴǬǷȇ ǯǼǬǹǴǾǰDZǼDZǮǺ ǶǮǬǼǾǴǼǬǻǺǷǹǺǽǾȈȊǸDZǭǷǴǼǺǮǬǹǬǽǼǺǽǶǺȄǹȇǸǴǴȀǴǼǸDZǹǹȇǸǴǮDZȅǬǸǴǴǺǭǺǼǿǰǺǮǬǹǴDZǸ ǔǹǰǴǮǴǰǿǬǷȈǹǺDZǺǾǺǻǷDZǹǴDZǶǬDzǰǺǯǺȉǾǬDzǬǴǯǺǼȋȃDZDZǮǺǰǺǽǹǬǭDzDZǹǴDZǺǽǿȅDZǽǾǮǷȋDZǾǽȋǽǻǺǸǺȅȈȊǽǺǭǽǾǮDZǹǹǺǯǺǯǬdzǺǮǺǯǺǶǺǾǷǬǖǮǬǼǾǴǼǬǺǭDZǽǻDZȃDZǹǬȉǷDZǶǾǼǺǹǹǺǵǽǴǯǹǬǷǴdzǬȂǴDZǵ

&HQD 3ULFHǢDZǹǬ .ÿ&=. Více informací na ZZZFHQWXU\F] For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Alter Ego, Ocelářská , Praha 9 - Libeň 120

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Mgr. Danica Gallo Kontakt: +420 725 293 664 E-mail: danica.gallo@century21.cz

½ã›Ù¦Ê

3521É-(0/8;861Ì52',11e9,/<9./,'1e035267ŏ('Ì6(=$+5$'289ê&+2'1ę2'35$+<725(17$/8;85<9,//$,1$3($&()8/(19,5210(17:,7+*$5'(1($672)35$*8( 6DPRVWDWQĚVWRMtFtQDGVWDQGDUGQĚY\EDYHQiWŐtSRGODæQtYLODNWHUiSOQĚUHVSHNWXMHVRXÿDVQpSRæDGDYN\QDNRPIRUWDLQGLYLGXiOQtSURVWRUVHQDFKi]tYREFLŏtÿDQ\=HYVWXSQtKDO\MHSŐtVWXSGRREëYDFtKRSRNRMH DGiOHQDYHQNRYQtWHUDVX P2 =GHVHQDFKi]tUHOD[DÿQtSRVH]HQtXYHQNRYQtKRNU\WpKRED]pQX [PFPKORXEND DGDOätRGSRÿLQNRYi]yQDXYHQNRYQtKRNUEX9SŐt]HPtVHGiOHQDFKi]tSOQĚY\EDYHQiNXFK\QĚMtGHOQDDVRFLiOQt]i]HPtSURKRVW\9KRUQtPSDWŐHMVRXNGLVSR]LFLORæQLFHNDæGiVHVDPRVWDWQRXNRXSHOQRX [VSUFKD[VSUFKDDYDQD DYVWXSHPQDEDONRQ9SRG]HPtPSRGODætVHQDFKi]t SURVWRUQiJDUiæSUR²DXWD P2 WHFKQLFNiPtVWQRVWVSUDÿNRXDNRWHOQDSO\QRYëNRWHODGiOHWHFKQRORJLHSURYHQNRYQtED]pQ9\WiSĚQtYLO\MH]DMLäWĚQRUDGLiWRU\VWHUPRUHJXODÿQtPLYHQWLO\YNRXSHOQiFK DNXFK\QLMHQDYtFSRGODKRYpWRSHQt3RGODKRYiNU\WLQD²GODæEDDSORYRXFtSRGODK\'ŢPMH]DMLäWĚQDODUPHP2E\WQiSORFKDP2]DKUDGDP2. 7KLVIUHHVWDQGLQJWKUHHVWRUH\YLOODZLWKDERYHDYHUDJHIHDWXUHVZKLFKIXOO\UHVSHFWVFXUUHQWUHTXLUHPHQWVIRUFRPIRUWDQGLQGLYLGXDOVSDFHLVORFDWHGLQWKHWRZQRIŏtÿDQ\7KHHQWUDQFHKDOOOHDGVWRWKH OLYLQJURRPDQGWKHQRQWRWKHPñRXWGRRUWHUUDFH7KHUHLVUHOD[HGVHDWLQJEHVLGHDQRXWGRRUVZLPPLQJSRRO [PFPGHHS DQGDQRWKHUUHFUHDWLRQDO]RQHDWWKHRXWGRRUÀUHSODFH,QDGGLWLRQWKH JURXQGÁRRUFRQVLVWVRIDIXOO\HTXLSSHGNLWFKHQGLQLQJURRPDQGEDWKURRPIDFLOLWLHVIRUJXHVWV7KHVWÁRRUFRPSULVHVHQVXLWHEHGURRPV [VKRZHUV[VKRZHUDQGEDWKWXE DQGDQH[LWWRDEDOFRQ\7KH EDVHPHQWFRQVLVWVRIDVSDFLRXVPñJDUDJHIRU²FDUVDODXQGU\URRPZLWKDZDVKLQJPDFKLQHDQGDERLOHUURRPJDVERLOHUDVZHOODVWKHWHFKQLFDOHTXLSPHQWIRUWKHRXWGRRUVZLPPLQJSRRO7KH KHDWLQJRIWKHYLOODLVSURYLGHGE\UDGLDWRUVZLWKWKHUPRVWDWLFYDOYHV7KHEDWKURRPVDQGNLWFKHQKDYHDGGLWLRQDOXQGHUÁRRUKHDWLQJ)ORRULQJ²WLOHVDQGÁRDWLQJÁRRUV7KHKRXVHLVVHFXUHGE\DQDODUPV\VWHP7KHOLYLQJDUHDLVPñZLWKDPñJDUGHQ ǚǾǰDZǷȈǹǺǽǾǺȋȅǬȋǼǺǽǶǺȄǹǺǺǭǽǾǬǮǷDZǹǹǬȋǾǼDZȁȉǾǬDzǹǬȋǮǴǷǷǬǶǺǾǺǼǬȋǮǻǺǷǹǺǵǸDZǼDZǽǺǺǾǮDZǾǽǾǮǿDZǾǽǺǮǼDZǸDZǹǹȇǸǾǼDZǭǺǮǬǹǴȋǸǶǶǺǸȀǺǼǾǿǴǴǹǰǴǮǴǰǿǬǷȈǹǺǸǿǻǼǺǽǾǼǬǹǽǾǮǿǹǬȁǺǰǴǾǽȋǮǹǬǽDZǷDZǹǹǺǸ ǻǿǹǶǾDZŏtÿDQ\ǔdzȁǺǷǷǬǻǼǴȁǺDzDZǵǮǴǷǷȇǸǺDzǹǺǻǺǻǬǽǾȈǮǯǺǽǾǴǹǿȊǴǹǬǺǾǶǼȇǾǿȊǾDZǼǼǬǽǿ Ǹ2 ǯǰDZǹǬȁǺǰǴǾǽȋdzǺǹǬǺǾǰȇȁǬǿǶǼȇǾǺǯǺǭǬǽǽDZǵǹǬǹǬǺǾǶǼȇǾǺǸǮǺdzǰǿȁDZ ȁǸǯǷǿǭǴǹǬǽǸ ǬǾǬǶDzDZ ǰǼǿǯǬȋdzǺǹǬǺǾǰȇȁǬǽǿǷǴȃǹȇǸǶǬǸǴǹǺǸǙǬǻDZǼǮǺǸȉǾǬDzDZǼǬǽǻǺǷǺDzDZǹǬǻǺǷǹǺǽǾȈȊǺǭǺǼǿǰǺǮǬǹǹǬȋǶǿȁǹȋǽǾǺǷǺǮǬȋǴǽǬǹǿdzǷȇǰǷȋǯǺǽǾDZǵǙǬǮDZǼȁǹDZǸȉǾǬDzDZǹǬȁǺǰȋǾǽȋǽǻǬǷȈǹǴǶǬDzǰǬȋǽǺǾǰDZǷȈǹǺǵ ǮǬǹǹǺǵǶǺǸǹǬǾǺǵ [ǰǿȄDZǮǬȋǶǬǭǴǹǬ[ǮǬǹǹǬǴǰǿȄ ǴǮȇȁǺǰǺǸǹǬǭǬǷǶǺǹǎǻǺǰdzDZǸǹǺǸȉǾǬDzDZǻǼǺǽǾǺǼǹȇǵǯǬǼǬDzǹǬ²ǸǬȄǴǹȇ Ǹ2 ǻǺǰǽǺǭǹǺDZǻǺǸDZȅDZǹǴDZǽǺǽǾǴǼǬǷȈǹǺǵǸǬȄǴǹǺǵǴǶǺǾDZǷȈǹǬȋ ǽǯǬdzǺǮȇǸǶǺǾǷǺǸǬǾǬǶDzDZǸDZǽǾǺǰǷȋǾDZȁǹǴȃDZǽǶǺǯǺǺǭDZǽǻDZȃDZǹǴȋǺǾǶǼȇǾǺǯǺǭǬǽǽDZǵǹǬǚǾǺǻǷDZǹǴDZǮǴǷǷȇǻǼǺǴǽȁǺǰǴǾǽǻǺǸǺȅȈȊǼǬǰǴǬǾǺǼǺǮǽǾDZǼǸǺǼDZǯǿǷȋȂǴǺǹǹȇǸǴǮDZǹǾǴǷȋǸǴǮǮǬǹǹȇȁǶǺǸǹǬǾǬȁǴǹǬ ǶǿȁǹDZǻǺǷȇǽǻǺǰǺǯǼDZǮǺǸǙǬǻǺǷȈǹǺDZǻǺǶǼȇǾǴDZ²ǻǷǴǾǶǬǴǻǷǬǮǬȊȅǴDZǻǺǷȇǐǺǸǺǭDZǽǻDZȃDZǹǽǴǽǾDZǸǺǵǭDZdzǺǻǬǽǹǺǽǾǴǽǽǴǯǹǬǷǺǸǾǼDZǮǺǯǴǒǴǷǬȋǻǷǺȅǬǰȈǸ2ǽǬǰǸ2.

&HQD 3ULFHǢDZǹǬ .ÿPĚVtÿQĚ&=.SP Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Alter Ego, Ocelářská , Praha 9 - Libeň 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

121


Realitní makléř: Ing. Bibiána Hlaváčková Kontakt: +420 777 779 496 E-mail: bibiana.hlavackova@century21.cz

<н<ÊÄÝç½ã®Ä¦

/8;861Ì0(=21(729ê%<79%/Ì=.267,&(175$35$+</8;85<0$,621(77(,17+(9,&,1,7<2)7+(&(175(2)35$*8(

1DEt]tPHNSURGHMLOX[XVQtPH]RQHWRYëE\WRYëPĚŐHP2NWHUëMHVLWXRYiQYDQDG]HPQtPSRGODæt]UHNRQVWUXRYDQpKRGRPXVYëWDKHP 1iYUKDUHDOL]DFH~SUDYE\WXSRFKi]tRGDUFKLWHNWŢ]HVWXGLD$UFKLFUDIWDMVRX]GHSRXæLW\Y\VRFHNYDOLWQtPDWHULiO\YÿHWQĚQiE\WNXQDPtUX9SDWŐH VHQDFKi]tYVWXSQtKDODVNRXSHOQRXDäDWQRX=KDO\MHYVWXSGRSRNRMHSURKRVW\GRREëYDFtKRSRNRMHDGRNXFK\QĚVMtGHOQRX=REëYDFtKRSRNRMH YHGHVFKRGLäWĚGRSDWUDYHNWHUpPMHORæQLFHNRXSHOQDDSUDFRYQD=E\WXMHNUiVQëYëKOHGQD3UDKX9EOt]NRVWLGRPXVHQDFKi]tSDUN9tWNRYD5LHJURY\ VDG\SŐtPRSŐHGGRPHP]DÿtQiQRYiF\NORVWH]ND'ŢPSURäHOUHNRQVWUXNFtIDViG\DUR]YRGŢPpGLtURYQĚæPiQRYRXVWŐHFKX'RVWXSQRVWGRFHQWUD YëERUQi FFDPLQXWSĚäN\QD9iFODYVNpQiPĚVWt 'RSRUXÿXMLSURKOtGNX )RU6DOH$OX[XU\PDLVRQHWWHZLWKXVDEOHDUHDRIPñVLWXDWHGRQWKHWKDQGWKÁRRUVRIDUHFRQVWUXFWHGEXLOGLQJZLWKDOLIW7KHGHVLJQDQGUHDOLVDWLRQRI WKHÁDWPRGLÀFDWLRQVFRPHIURPWKH$UFKLFUDIW6WXGLRZLWKRQO\WRSTXDOLW\PDWHULDOVLQFOXGLQJWDLORUHGIXUQLWXUHEHLQJXVHG7KHHQWUDQFHKDOOOHDGLQJWRDEDWKURRP DQGGUHVVLQJURRPLVRQWKHWKÁRRU7KHHQWUDQFHKDOODOVROHDGVWRDJXHVWURRPOLYLQJURRPDQGNLWFKHQZLWKGLQLQJURRP7KHVWDLUFDVHIURPWKHOLYLQJURRPOHDGV WRWKHXSSHUÁRRUWKDWFRPSULVHVDEHGURRPEDWKURRPDQGVWXG\7KHÁDWKDVDZRQGHUIXOYLHZRI3UDJXH7KH9tWNRY3DUNDQG5LHJHU*DUGHQVDUHVLWXDWHGQHDUE\$F\FOHURXWHVWDUWVULJKWLQIURQWRIWKHEXLOGLQJ7KHEXLOGLQJXQGHUZHQWDFRPSOHWHUHFRQVWUXFWLRQRIWKHIDFDGHDQGPHGLDGLVWULEXWLRQVDQGDOVRKDVDQHZ URRI$FFHVVLELOLW\WRWKHFLW\FHQWUHLVH[FHOOHQW DSSUR[LPDWHO\PLQXWHV¶ZDONLQJGLVWDQFHWR:HQFHVODV6TXDUH :HUHFRPPHQGDYLHZLQJRIWKLVPDLVRQHWWH ǛǼǺǰǬDZǸ ǼǺǽǶǺȄǹǿȊ ǶǮǬǼǾǴǼǿ ² ǸDZdzǺǹDZǾ ǻǷǬǹǴǼǺǮǶǴ  ǻǷǺȅǬǰȈȊ  Ǹ2 ǼǬǽǻǺǷǺDzDZǹǹǿȊ ǹǬ  Ǹ Ǵ  ȉǾǬDzDZ ǺǾǼDZǸǺǹǾǴǼǺǮǬǹǹǺǯǺ dzǰǬǹǴȋ ǽǷǴȀǾǺǸǜǬdzǼǬǭǺǾǶǬǴǼDZǬǷǴdzǬȂǴȋǸǺǰǴȀǴǶǬȂǴǵǴǴǹǾDZǼȈDZǼǬǶǮǬǼǾǴǼȇǻǼǴǹǬǰǷDZDzǴǾǬǼȁǴǾDZǶǾǺǼǬǸǴdzǽǾǿǰǴǴ$UFKLFUDIWǮǶǮǬǼǾǴǼDZǭȇǷǴǴǽǻǺǷȈdzǺǮǬǹȇ ǮȇǽǺǶǺǶǬȃDZǽǾǮDZǹǹȇDZǸǬǾDZǼǴǬǷȇǮǾǺǸȃǴǽǷDZǸDZǭDZǷȈǽǰDZǷǬǹǬǹǬdzǬǶǬdzǙǬǸȉǾǬDzDZǹǬȁǺǰǴǾǽȋǮȁǺǰǹǺǵȁǺǷǷǻǼǴȁǺDzǬȋǽǮǬǹǹǺǵǶǺǸǹǬǾǺǵǴǯǬǼǰDZǼǺǭǹǺǵ ǔdzǻǼǴȁǺDzDZǵǸǺDzǹǺǻǺǻǬǽǾȈǮǶǺǸǹǬǾǿǰǷȋǯǺǽǾDZǵǯǺǽǾǴǹǿȊǴǶǿȁǹȊǽǺǽǾǺǷǺǮǺǵǔdzǯǺǽǾǴǹǺǵǷDZǽǾǹǴȂǬǮDZǰDZǾǹǬǮǾǺǼǺǵȉǾǬDzǯǰDZǹǬȁǺǰȋǾǽȋǽǻǬǷȈǹȋ ǮǬǹǹǬȋ ǶǺǸǹǬǾǬ Ǵ ǶǬǭǴǹDZǾ ǔdz ǶǮǬǼǾǴǼȇ ǺǾǶǼȇǮǬDZǾǽȋ ǻǼDZǶǼǬǽǹȇǵ ǮǴǰ ǹǬ ǯǺǼǺǰ ǜȋǰǺǸ ǽ ǰǺǸǺǸ DZǽǾȈ ǻǬǼǶ ǎǴǾǶǺǮ Ǵ ǜǴȉǯǼǺǮȇ ǽǬǰȇ ǛǼȋǸǺ ǻDZǼDZǰ ǰǺǸǺǸǹǬȃǴǹǬDZǾǽȋǹǺǮǬȋǮDZǷǺǰǺǼǺDzǶǬǟǰǺǸǬǭȇǷǺǾǼDZǸǺǹǾǴǼǺǮǬǹȀǬǽǬǰǴǻǼǺǮǺǰǶǬǬǾǬǶDzDZǺǹǴǸDZDZǾǹǺǮǿȊǶǼȇȄǿǛǼDZǮǺǽȁǺǰǹǺDZǾǼǬǹǽǻǺǼǾǹǺDZ ǽǺǺǭȅDZǹǴDZǽȂDZǹǾǼǺǸ ǺǶǺǷǺǸǴǹǻDZȄDZǵȁǺǰȈǭȇǺǾǎǬȂǷǬǮǽǶǺǵǻǷǺȅǬǰǴ ǜDZǶǺǸDZǹǰǿDZǸǻǼǺǽǸǺǾǼǹDZǰǮǴDzǴǸǺǽǾǴ &HQD3ULFHǢDZǹǬ .ÿ&=. Více informací na ZZZFHQWXU\F] For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 K+K Consulting, Sladkovského náměstí 525/1, Praha 3 - Žižkov 122

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Ing. David Votápek Kontakt: +420 725 293 221 E-mail: david.votapek@century21.cz

ŏ5'../*32=0235$+$%ŏ(91297(55$&(')$0,/<+286(../*0ñ3/2735$*8(%ŏ(9129

([NOX]LYQĚQDEt]tPHPRGHUQtNRPIRUWQĚY\EDYHQëSURVWRUQëGŢPVED]pQHPVYHONRXXGUæRYDQRX]DKUDGRXVDXWRPDWLFNëPV\VWpPHP]DYODæRYiQtDMLKR]iSDGQtRULHQWDFtRUR]OR]HP2VHY]URVWOëPLVWŐHGQĚY\VRNëPLRNUDVQëPLVWURP\D]DKUDGQtPGRPNHPYHQNRYQtWHUDVRXVSHUJRORX JDUiætDNU\WëPJDUiæRYëPVWiQtP8æLWQiSORFKDGRPXMHP2DQDEt]tYHäNHUëSRWŐHEQëNRPIRUWPRGHUQtKRE\GOHQtVDPRVWDWQëFKSURVWRUQëFK SRNRMŢREëYDFtSURVWRUVSRMHQëVMtGHOQtPNRXWHPDY\EDYHQRXNXFK\QtDGYĚNRXSHOQ\V:&'ŢPVHQDFKi]tYRNUDMRYpÿiVWLNOLGQpREFH9HONi'REUi SRXKëFKNPRG.ODGQDDNPRG3UDK\SR5QD.DUORY\9DU\NWHUiGLVSRQXMHYHäNHURXREÿDQVNRXY\EDYHQRVWt äNRODäNRONDREFKRG\UHVWDXUDFH ]GUDYRWQtVWŐHGLVNRSUDYLGHOQpDXWREXVRYpVSRMHDSRG  :HDUHWKHVROHDJHQWVIRUWKLVPRGHUQFRPIRUWDEO\HTXLSSHGVSDFLRXVKRXVHZLWKVZLPPLQJSRRODQGODUJHPDLQWDLQHGJDUGHQZLWKDXWRPDWLFLUULJDWLRQ V\VWHP7KHKRXVHIDFHVVRXWKZHVWRQDSORWRIPñLQVL]HZLWKHVWDEOLVKHGPHGLXPWDOOGHFRUDWLYHWUHHVDQGVXPPHUKRXVHRXWGRRUWHUUDFHZLWKSHUJRODJDUDJHDQGFRYHUHGSDUNLQJVSDFH7KHXWLOLW\DUHDRIWKHKRXVHLVPñRIIHULQJHYHU\QHFHVVDU\FRPIRUWIRUPRGHUQOLYLQJ7KHUHDUHVHSDUDWHVSDFLRXV URRPVWZREDWKURRPVZLWK:&DOLYLQJURRPFRQQHFWHGWRGLQLQJQRRNDQGDÀWWHGNLWFKHQ7KHKRXVHLVVLWXDWHGLQDSHULSKHUDOSDUWRIWKH9HONi'REUiFRPPXQLW\DPHUHNPIURP.ODGQRDQGNPIURP3UDJXHRQWKH5LQWKHGLUHFWLRQRI.DUORY\9DU\7KHDUHDKDVDOOWKHFLYLFDPHQLWLHV VFKRRONLQGHUJDUWHQVKRSV restaurant, medical centre, regular bus connections etc.). ǩǶǽǶǷȊdzǴǮǹǺ ǻǼDZǰǷǬǯǬDZǸ ǽǺǮǼDZǸDZǹǹȇǵ ǶǺǸȀǺǼǾǬǭDZǷȈǹǺ ǺǭǽǾǬǮǷDZǹǹȇǵ ǻǼǺǽǾǺǼǹȇǵ ǰǺǸ  ǽ ǭǬǽǽDZǵǹǺǸ ǭǺǷȈȄǴǸ ǿȁǺDzDZǹǹȇǸ ǽǬǰǺǸ ǽ ǬǮǾǺǸǬǾǴȃDZǽǶǺǵǽǴǽǾDZǸǺǵǺǼǺȄDZǹǴȋǴǺǼǴDZǹǾǬȂǴDZǵǹǬȊǯǺdzǬǻǬǰǸ2ǽǺǮdzǼǺǽǷȇǸǴǰDZǶǺǼǬǾǴǮǹȇǸǴǰDZǼDZǮȈȋǸǴǽǼDZǰǹDZǵǮȇǽǺǾȇǽǬǰǺǮȇǸ ǰǺǸǴǶǺǸǺǾǶǼȇǾǺǵǾDZǼǼǬǽǺǵǽǭDZǽDZǰǶǺǵǯǬǼǬDzǺǸǴǶǼȇǾǺǵǻǬǼǶǺǮǶǺǵǛǺǷDZdzǹǬȋǻǷǺȅǬǰȈǰǺǸǬǽǺǽǾǬǮǷȋDZǾǸ2ǮǰǺǸDZǮǽDZǹDZǺǭȁǺǰǴǸȇDZ ǿǰǺǭǽǾǮǬǰǷȋǶǺǸȀǺǼǾǹǺǵǽǺǮǼDZǸDZǹǹǺǵDzǴdzǹǴǺǾǰDZǷȈǹȇȁǻǼǺǽǾǺǼǹȇȁǶǺǸǹǬǾǯǺǽǾǴǹǬȋǽǺǭDZǰDZǹǹǺǵdzǺǹǺǵǴǺǭǺǼǿǰǺǮǬǹǹǬȋǶǿȁǹȋǰǮDZǮǬǹǹȇDZ ǶǺǸǹǬǾȇǽǾǿǬǷDZǾǬǸǴǐǺǸǼǬǽǻǺǷǺDzDZǹǹǬǺǶǼǬǴǹDZǹǬǽDZǷDZǹǹǺǯǺǻǿǹǶǾǬ9HONi'REUiǮǽDZǯǺǮǶǸǺǾǯǺǼǺǰǬǖǷǬǰǹǺǴǮǶǸǺǾǛǼǬǯǴǰǺǖǬǼǷǺǮȇȁ ǎǬǼ ǸǺDzǹǺ ǰǺǭǼǬǾȈǽȋ ǻǺ ǰǺǼǺǯDZ 5 ǜȋǰǺǸ Ǯǽȋ ǴǹȀǼǬǽǾǼǿǶǾǿǼǬ ȄǶǺǷȇ ǰDZǾǽǶǴǵ ǽǬǰ ǸǬǯǬdzǴǹȇ ǼDZǽǾǺǼǬǹȇ ǸDZǰǴȂǴǹǽǶǴǵ ȂDZǹǾǼ ǼDZǯǿǷȋǼǹȇDZ ǬǮǾǺǭǿǽȇǴǾǰ 

Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Tandem, Perlová 3, Praha 1 352'(-,6$/(6,džLJDžƺƶƻljLjǖęÌ-(1,2&72%(5,DžǁljǖƷLJǓ

123


Realitní makléř: Karel Hubáček Kontakt: +420 602 278 512

Z›ƒ½®ãù21

E-mail: karel.hubacek@century21.cz

52',11ê'š0*1$32=(0.80292%&,+251Ì%(='ę.29)$0,/<+286(*210ñ3/27,17+(9,//$*(2)+251Ì%(='ę.29 5RGLQQëGŢPRYHOLNRVWLVJDUiætYDWUDNWLYQtYLORYp]iVWDYEĚYREFL+RUQt%H]GĚNRY'ŢPVFHONRYRXSRGODKRYRXSORFKRXP2OHætQDMLæQĚRULHQWRYDQpPSR]HPNXRYHOLNRVWLP2YWĚVQpPVRXVHGVWYtOHVD-HGQiVHR]FHODYëMLPHÿQpPtVWRVDEVROXWQtPVRXNURPtPDVQiGKHUQëPYëKOHGHPGRRNROt'ŢPMHVYRMtYQLWŐQtGLVSR]LFtYKRGQëSURURGLQXVGĚWPL3Őt]HPtGRPXSRVN\WXMHPRæQRVWWUiYHQt VSROHÿQëFKFKYLOYSURVWRUQpPREëYDFtPSRNRMLVNUEHPDVHYVWXSHPQDWHUDVXVMtGHOQRXDNXFK\Qt9SDWŐHSDNQDOH]QHWHYODVWQtVRXNURPtYMHGQRP]HWŐtYHONëFKSRNRMŢ9GRPĚQHFK\EtGRVWDWHN~ORæQpKRSURVWRUXWHFKQLFNiPtVWQRVWDSURVWRUSURFYLÿHQtYHÀWQHVVPtVWQRVWL1DGäHQLEXGHWH]DMLVWp]H]DKUDG\-LæSŐLSUYQtPYVWXSXQDWHUDVXNWHUiSO\QXOHSŐHFKi]tGRY]URVWOpRNUDVQp]DKUDG\VOX[XVQtPY\KŐtYDQëPED]pQHPQDYiVGëFKQHDEVROXWQtNOLGDSRKRGD7HQWRSRFLWMHäWĚXPRFŁXMHRWHYŐHQëYëKOHGGRRNROQtSŐtURG\DWĚVQpVRXVHGVWYtVOHVHP3Őt]QLYFLJROIXMLVWĚRFHQtPRæQRVWQiYäWĚY\*ROI .OXEX%RWDQLND+RUQt%H]GĚNRYNWHUëMHY]GiOHQPLQXWRGGRPX )DPLO\KRXVHZLWKDOD\RXWDQGJDUDJHLQDQDWWUDFWLYHYLOODGHYHORSPHQWLQWKHYLOODJHRI+RUQt%H]GĚNRY7KHKRXVHZLWKDWRWDOÁRRUDUHDRIPñLVVLWXDWHGRQD6RXWKIDFLQJSORWPñLQVL]HLQWKH immediate vicinity of a forest. This is an absolutely extraordinary site with perfect privacy and a wonderful view of the surroundings. The house, due to its interior layout, is suitable for a family with children. The JURXQGÁRRUSURYLGHVDQRSSRUWXQLW\WRVSHQGIDPLO\WLPHWRJHWKHULQWKHVSDFLRXVOLYLQJURRPZLWKDÀUHSODFHWKHGLQLQJURRPDQGNLWFKHQZKLFKKDVDQH[LWRQWRDWHUUDFH7KHVWÁRRUSURYLGHVIDPLO\PHPEHUV ZLWKWKHLURZQSULYDWHVSDFHLQRQHRIWKUHHODUJHEHGURRPV7KHUHLVVXIÀFLHQWVWRUDJHVSDFHDWHFKQLFDOURRPDQGDURRPIRUDJ\P7KHKRXVHERDVWVDFDSWLYDWLQJJDUGHQ<RXZLOOIHHODVHQVHRIDEVROXWHSHDFHDQGZHOOEHLQJDOUHDG\DW\RXUÀUVWVWHSRXWRQWRWKHWHUUDFHZKLFKOHDGVHIIRUWOHVVO\WRDQHVWDEOLVKHGRUQDPHQWDOJDUGHQZLWKOX[XU\KHDWHGVZLPPLQJSRRO7KLVIHHOLQJLVHQKDQFHGE\WKHRSHQSDQRUDPLF YLHZRIWKHVXUURXQGLQJFRXQWU\VLGHDQGLPPHGLDWHERUGHULQJRQWKHIRUHVW*ROIORYHUVZLOOVXUHO\DSSUHFLDWHWKHSRVVLELOLW\RIYLVLWLQJWKH%RWDQLND*ROI&OXELQ+RUQt%H]GĚNRYZKLFKLVPLQXWHVIURPWKHKRXVH ǝDZǸDZǵǹȇǵǰǺǸǻǷǬǹǴǼǺǮǶǴǽǯǬǼǬDzǺǸǮǻǼǴǮǷDZǶǬǾDZǷȈǹǺǸDzǴǷǺǸǼǬǵǺǹDZdzǬǽǾǼǺDZǹǹǺǸǮǴǷǷǬǸǴǮǹǬǽDZǷDZǹǹǺǸǻǿǹǶǾDZǏǺǼǹǴǍDZdzǰDZǶǺǮǐǺǸǺǭȅDZǵǻǷǺȅǬǰȈȊǸ2ǼǬǽǻǺǷǺDzDZǹǹǬǺǼǴDZǹǾǴǼǺǮǬǹǹǺǸ ǮȊDzǹǿȊǽǾǺǼǺǹǿǿȃǬǽǾǶDZǼǬdzǸDZǼǺǸǸ2ǼȋǰǺǸǽǷDZǽǺǸǩǾǺǽǺǮDZǼȄDZǹǹǺǴǽǶǷȊȃǴǾDZǷȈǹǺDZǸDZǽǾǺǽǬǭǽǺǷȊǾǹǺǵǶǺǹȀǴǰDZǹȂǴǬǷȈǹǺǽǾȈȊǴǻǼDZǶǼǬǽǹȇǸǮǴǰǺǸǹǬǺǶǼDZǽǾǹǺǽǾǴǐǺǸǽǺǽǮǺDZǵǮǹǿǾǼDZǹǹDZǵ ǻǷǬǹǴǼǺǮǶǺǵǻǺǰȁǺǰǴǾǰǷȋǽDZǸDZǵǽǰDZǾȈǸǴǙǬǻDZǼǮǺǸȉǾǬDzDZǰǺǸǬǻǼDZǰǺǽǾǬǮǷȋDZǾǽȋȄǴǼǺǶǬȋǮǺdzǸǺDzǹǺǽǾȈǽǺǮǸDZǽǾǹǺǯǺǰǺǽǿǯǬǮǻǼǺǽǾǺǼǹǺǵǯǺǽǾǴǹǺǵǽǶǬǸǴǹǺǸǴǮȇȁǺǰǺǸǹǬǾDZǼǼǬǽǿǽǺǽǾǺǷǺǮǺǵ ǴǶǿȁǹDZǵǙǬǮDZǼȁǹDZǸȉǾǬDzDZDZǽǾȈǮǺdzǸǺDzǹǺǽǾȈǿDZǰǴǹDZǹǴȋǮǺǰǹǺǵǴdzǾǼDZȁǭǺǷȈȄǴȁǶǺǸǹǬǾǎǰǺǸDZǸǹǺDzDZǽǾǮǺǸDZǽǾǰǷȋȁǼǬǹDZǹǴȋǻǺǰǽǺǭǹǺDZǻǺǸDZȅDZǹǴDZǴǸDZǽǾǺǰǷȋǾǼDZǹǴǼǺǮǺǶǮȀǴǾǹDZǽdzǬǷDZǞǺȃǾǺ ǻǺǾǼȋǽǬDZǾ²ȉǾǺǽǬǰǟDzDZǻǼǴǮȁǺǰDZǹǬǾDZǼǼǬǽǿǶǺǾǺǼǬȋǻǷǬǮǹǺǻDZǼDZȁǺǰǴǾǮǻǺǰǼǺǽȄǴǵǰDZǶǺǼǬǾǴǮǹȇǵǽǬǰǯǰDZǼǬǽǻǺǷǺDzDZǹǼǺǽǶǺȄǹȇǵǭǬǽǽDZǵǹǽǻǺǰǺǯǼDZǮǺǸǮȇǸǺDzDZǾDZǻǺȃǿǮǽǾǮǺǮǬǾȈǬǭǽǺǷȊǾǹǿȊ ǾǴȄǴǹǿǴǻǺǶǺǵǩǾǺȃǿǮǽǾǮǺǿǽǴǷǴǮǬDZǾǽȋǺǾǶǼȇǾȇǸǮǴǰǺǸǹǬǺǶǼǿDzǬȊȅǿȊǻǼǴǼǺǰǿǴǭǷǴdzǶǴǸǽǺǽDZǰǽǾǮǺǸǽǷDZǽǺǸǗȊǭǴǾDZǷǴǯǺǷȈȀǬǻǺǰǺǽǾǺǴǹǽǾǮǿǺȂDZǹȋǾǮǺdzǸǺDzǹǺǽǾȈǻǺǽDZǾǴǾȈǯǺǷȈȀǶǷǿǭ©%RWDQLND +RUQt%H]GĚNRYªǶǺǾǺǼȇǵǹǬȁǺǰǴǾǽȋǮǸǴǹǿǾǬȁǺǾǰǺǸǬ

&HQD 3ULFHǢDZǹǬ LQIRY5.IURPWKH5HDO(VWDWH$JHQF\ǔǹȀǺǼǸǬȂǴȋǮǬǯDZǹǾǽǾǮDZǹDZǰǮǴDzǴǸǺǽǾǴ Více informací na ZZZFHQWXU\F] For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Reality 21, Na Poříčí 1071/17, Prague 1 124

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Jaroslav Bolina Kontakt: +420 722 504 504

Z›ƒ½®ãù21

E-mail: jaroslav.bolina@century21.cz

/8;861Ì%<735$+$/8;85<)/$735$*8( 1DEt]tPHYiPOX[XVQĚ]UHNRQVWUXRYDQëE\WNNRUR]OR]HP2YWĚVQpEOt]NRVWL7ëQVNpKRFKUiPXD6WDURPĚVWVNpKRQiPĚVWt%\WE\OYHOPLQiNODGQĚ]UHQRYRYDQëDSŐHVWDYĚQë]GLVSR]LFHGRVRXÿDVQp SRGRE\UHQRYRYDQRXVWDYHEQtÀUPRX3ŐtPRVRXÿiVWtE\WXMVRXLYHONROHSpSŐtPpYëKOHG\QDPDVLY7ëQVNpKRFKUiPXDVWŐHFK\6WDUpKR0ĚVWD=PDOpKRDYHOPLSULYiWQtKREDONRQXMHWDNpRWHYŐHQëYëKOHGYëFKRGQtP VPĚUHP-HGQiVHRRMHGLQĚOëE\WNWHUëVYRXNYDOLWRXXVSRNRMtLQiURÿQpKRNOLHQWD9ëWDKYHIi]LSURMHNWX :HRIIHU\RXDOX[XULRXVO\UHFRQVWUXFWHGNNÁDWPñLQVL]HLQWKHFORVHYLFLQLW\RI7ëQ&DWKHGUDODQGWKH2OG7RZQ6TXDUH7KHÁDWZDVYHU\H[SHQVLYHO\UHQRYDWHGDQGUHEXLOWIURPDOD\RXWLQWRLWV FXUUHQWIRUPE\DUHQRZQHGEXLOGLQJFRPSDQ\7KHVSHFWDFXODUGLUHFWYLHZVRIWKH7ëQ&DWKHGUDOVSLUHVDQG2OG7RZQURRIVDUHDKLJKOLJKWRIWKHÁDW7KHUHLVDOVRDQRSHQYLHZWRZDUGVWKH(DVWIURPDVPDOO SULYDWHEDOFRQ\7KLVLVDQH[WUDRUGLQDU\ÁDWLWVTXDOLW\ZLOOVDWLVI\HYHQWKHPRVWGHPDQGLQJFOLHQW$OLIWLVEHLQJSODQQHG ǜǺǽǶǺȄǹǬȋ ǶǮǬǼǾǴǼǬ ǛǼǬǯǬ  ǛǼDZǰǷǬǯǬDZǸ ǎǬǸ ǼǺǽǶǺȄǹǺ ǺǾǼDZǸǺǹǾǴǼǺǮǬǹǹǿȊ ǶǮǬǼǾǴǼǿ ǻǷǬǹǴǼǺǮǶǴ ǶǶ  Ǹ2 ǼȋǰǺǸ ǽ ǞȇǹǽǶǴǸ ȁǼǬǸǺǸ Ǵ ǝǾǬǼǺǸDZǽǾǽǶǺǵ ǻǷǺȅǬǰȈȊ ǎ ǶǮǬǼǾǴǼDZ ǭȇǷȇǬ ǻǼǺǮDZǰDZǹǬ ǺȃDZǹȈ ǰǺǼǺǯǬȋǼDZǶǺǹǽǾǼǿǶȂǴȋǺǹǬǭȇǷǬǻDZǼDZǽǾǼǺDZǹǬǴdzǮǽǮǺǵǹȇǹDZȄǹǴǵǮǴǰǴdzǮDZǽǾǹǺǵǽǾǼǺǴǾDZǷȈǹǺǵǶǺǸǻǬǹǴDZǵǙDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵȃǬǽǾȈȊǶǮǬǼǾǴǼȇȋǮǷȋȊǾǽȋǴǮǻDZȃǬǾǷȋȊȅǴDZǮǴǰȇǹǬdzǰǬǹǴDZǞȇǹǽǶǺǯǺǡǼǬǸǬ ǴǶǼȇȄǴǝǾǬǼǺǯǺǯǺǼǺǰǬǔdzǹDZǭǺǷȈȄǺǯǺǹǺǺȃDZǹȈǶǺǹȀǴǰDZǹȂǴǬǷȈǹǺǯǺǭǬǷǶǺǹǬǾǬǶDzDZǺǾǶǼȇǮǬDZǾǽȋǻǬǹǺǼǬǸǹȇǵǮǴǰǮǮǺǽǾǺȃǹǺǸǹǬǻǼǬǮǷDZǹǴǴǩǾǺǿǹǴǶǬǷȈǹǬȋǶǮǬǼǾǴǼǬǶǬȃDZǽǾǮǺǶǺǾǺǼǺǵǿǰǺǮǷDZǾǮǺǼǴǾǰǬDzDZǽǬǸǺǯǺ ǮdzȇǽǶǬǾDZǷȈǹǺǯǺǶǷǴDZǹǾǬǗǴȀǾǹǬȁǺǰǴǾǽȋǮǽǾǬǰǴǴǻǼǺDZǶǾǴǼǺǮǬǹǴȋ

&HQD 3ULFHǢDZǹǬ .ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Reality 21, Na Poříčí 1071/17, Prague 1 352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

125


CHIRŠ realitní kanceláře Pobočka Červený Vrch Evropská 695/73, Praha 6 Tel. 737 780 071 E-mail: cervenyvrch@chirs.cz

REALITNI KANCELARE

Prodej RD 7+kk, 185m2, Horoměřice

)RU6DOHNN)DPLO\+RXVHP2+RURPĚŐLFH ǛǼǺǰǬDzǬǽDZǸDZǵǹǺǯǺǰǺǸǬǻǷǬǹǴǼǺǮǶǴNNǸ2+RURPĚŐLFH 1DEt]tPHNSURGHMLQRYRVWDYEXGRPX GYRMGRPX YH YHOPL NOLGQp ORNDOLWĚ D QRYp ]iVWDYEĚ URGLQQëFK GRPNŢ Y+RURPĚŐLFtFK&HONRYiXæLWQiSORFKDGRPXÿLQtP2 YÿJDUiæHSURVWRUQpKREDONRQXYSDWŐH'ŢPMHYHOLFH GREŐHGLVSR]LÿQĚŐHäHQYSRGODætVHQDFKi]t]iGYHŐt GHQQt:&YHOPLSURVWRUQëREëYDFtSRNRMVSŐtPëPYVWXSHP QDWHUDVXMtGHOQtNRXWNXFK\QĚDVDPRVWDWQëSRNRM Q\Qt SUDFRYQD 9SRGODætMHWpæVLWXRYiQDJDUiæ9HSRGODæt VHQDFKi]tFHONHPORæQLFDNRXSHOQDVHVSUFKRYëPNRXWHPYDQRXD:&3R]HPHNGRPXMHYHOPLXGUæRYDQëÿLVWiSORFKD]DKUDG\ÿLQtFFDP21DSR]HPNXMHXPtVWĚQRGDOätSDUNRYDFtVWiQtSRGSHUJRORX ]DVWŐHäHQpSDUNRYDFt VWiQt  =D GRPHP VH QDFKi]t SŐtMHPQi WHUDVD =iNODGQt RULHQWDFH RNHQ MH YëFKRG D MLKR]iSDG 9\WiSĚQt ŐHäHQR SRPRFt SO\QRYpKR NRWOH V WHUPRVWDWHP NWHUë VRXÿDVQĚVORXætLSURRKŐHYWHSOpYRG\3UŢPĚUQpPĚVtÿQt SRSODWN\]DSO\QYRGXDHOHNWŐLQXPD[GR.ÿ

www.chirs.cz

:HRIIHUIRUVDOHDQHZIDPLO\KRXVH RIDVHPLGHtached house) in a very peaceful locality in a new develRSPHQWRIIDPLO\KRXVHVLQ+RURPĚŐLFH7KHWRWDOXVDEOH DUHDRIWKHKRXVHLVPñLQFOXGLQJDJDUDJHVSDFLRXV EDOFRQ\7KHKRXVHKDVDYHU\JRRGOD\RXWWKHJURXQGÁRRU consists of an entrance hall, separate WC, very spacious living room with direct exit on to a terrace, dining nook, NLWFKHQDQGDVHSDUDWHURRP QRZXVHGDVDVWXG\ 7KHUH LV DOVR D JDUDJH RQ WKH JURXQG OHYHO 7KH VW ÁRRU FRPSULVHVEHGURRPVLQWRWDODQGDEDWKURRPZLWKDVKRZHU corner, a bathtub and WC. The plot is very well maintained, WKHQHWDUHDRIWKHJDUGHQLVDSSUR[LPDWHO\Pñ7KHUH LVDFDUSRUWXQGHUDSHUJRODLQWKHJURXQGV$SOHDVDQWWHUrace is located behind the house. The windows are mainly east- and south-east-facing. The heating is provided by a gas boiler with thermostat, which also serves for water heating. The average monthly costs for gas, water and HOHFWULFLW\DUHDPD[LPXPRI&=.

ǛǼǺǰǬDzǬ ǹDZǰǬǮǹǺ ǻǺǽǾǼǺDZǹǹǺǯǺ ǰǺǸǬ ǻǺǷǺǮǴǹǬ ǰǮǺǵǹǺǯǺ ǰǺǸǬ  Ǯ ǺȃDZǹȈ ǽǻǺǶǺǵǹǺǸ ǼǬǵǺǹDZ Ǯ dzǬǽǾǼǺǵǶDZ ǽDZǸDZǵǹȇȁ ǰǺǸǺǮ Ǯ ǏǺǼǺǸDZǼDzǴȂDZ ǚǭȅǬȋ ǻǷǺȅǬǰȈ ǰǺǸǬ ǽǺǽǾǬǮǷȋDZǾ  Ǹ2 ǮǶǷ ǯǬǼǬDz ǻǼǺǽǾǺǼǹȇǵ ǭǬǷǶǺǹǹǬǻDZǼǮǺǸȉǾǬDzDZǴǹDZǭǺǷȈȄǿȊǸǬǹǽǬǼǰǿǽǷǿDzǬȅǿȊ ǸDZǽǾǺǸ ǽǶǷǬǰǴǼǺǮǬǹǴȋ ǮDZȅDZǵ  ǐǺǸ ǺȃDZǹȈ ȁǺǼǺȄǺ ǽǻǼǺDZǶǾǴǼǺǮǬǹ ǹǬ ǵ ȉǾǬDzDZ DZǽǾȈ ǾǬǸǭǿǼ ǰǹDZǮǹǺǵ ǾǿǬǷDZǾǺȃDZǹȈǻǼǺǽǾǺǼǹǬȋǯǺǽǾǴǹǬȋǽǻǼȋǸȇǸǮȇȁǺǰǺǸ ǹǬǾDZǼǼǬǽǿdzǺǹǬǽǾǺǷǺǮǺǵǴǶǿȁǹȋǺǾǰDZǷȈǹǬȋǶǺǸǹǬǾǬ ǽDZǵȃǬǽȉǾǺǼǬǭǺȃǴǵǶǬǭǴǹDZǾ ǙǬȉǾǬDzDZǾǬǶDzDZǼǬǽǻǺǷǺDzDZǹǯǬǼǬDzǙǬȉǾǬDzDZǹǬȁǺǰȋǾǽȋǽǻǬǷDZǹǴǮǬǹǹǬȋ ǶǺǸǹǬǾǬ ǽ ǰǿȄDZǮǺǵ ǶǬǭǴǹǺǵ ǮǬǹǹǺǵ Ǵ ǾǿǬǷDZǾǺǸ ǟȃǬǽǾǺǶ ǿ ǰǺǸǬ ǺȃDZǹȈ ǿȁǺDzDZǹǹȇǵ ǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺ ǻǷǺȅǬǰȈǽǬǰǬǽǺǽǾǬǮǷȋDZǾǺǶǺǷǺǸ2ǙǬǿȃǬǽǾǶDZǼǬǽǻǺǷǺDzDZǹǺDZȅDZǺǰǹǺǸDZǽǾǺǰǷȋǻǬǼǶǺǮǶǴǻǺǰǹǬǮDZǽǺǸ ǶǼȇǾǬȋ ǻǬǼǶǺǮǶǬ  ǓǬ ǰǺǸǺǸ ǹǬȁǺǰǴǾǽȋ ǿȊǾǹǬȋ ǾDZǼǼǬǽǬ ǚǽǹǺǮǹǬȋ ǺǼǴDZǹǾǬȂǴȋ ǺǶǺǹ ǹǬ ǮǺǽǾǺǶ Ǵ ȊǯǺdzǬǻǬǰ ǚǾǺǻǷDZǹǴDZǻǼǺǴǽȁǺǰǴǾǽǻǺǸǺȅȈȊǯǬdzǺǮǺǯǺǶǺǾǷǬǽǾDZǼǸǺǽǾǬǾǺǸǶǺǾǺǼȇǵǮǾǺDzDZǮǼDZǸȋǽǷǿDzǴǾǴǰǷȋǹǬǯǼDZǮǬ ǮǺǰȇǝǼDZǰǹȋȋDZDzDZǸDZǽȋȃǹǬȋǻǷǬǾǬdzǬǯǬdzǮǺǰǿǴȉǷDZǶǾǼǺȉǹDZǼǯǴȊǰǺǶǼǺǹ

&HQD3ULFHǢDZǹǬ.ÿ&=.


CHIRŠ realitní kanceláře Pobočka Červený Vrch Evropská 695/73, Praha 6 Tel. 737 780 071 E-mail: cervenyvrch@chirs.cz

REALITNI KANCELARE

Prodej RD s možností komerčního využití, 240m2, Hostivice

)RU6DOH)DPLO\KRXVHZLWKWKHRSWLRQRIFRPPHUFLDOXVHP2+RVWLYLFH ǛǼǺǰǬDZǾǽȋǰǺǸǽǮǺdzǸǺDzǹǺǽǾȈȊǶǺǸǸDZǼȃDZǽǶǺǯǺǴǽǻǺǷȈdzǺǮǬǹǴȋǸ2+RVWLYLFH 1DEt]tPHNSURGHMLYtFHJHQHUDÿQtURGLQQëGŢPQDFKi]HMtFt VHYSŐtMHPQpORNDOLWĚREFH+RVWLYLFH'ŢPVHQDFKi]tQD YHOPL XGUæRYDQpP SR]HPNX R UR]OR]H  P2 ]DKUDGD  P2 ]DVWDYĚQi SORFKD P  'ŢP MH GYRXSRGODæQt D GLVSRQXMH SŢGQtP SURVWRUHP ] MHGQp WŐHWLQ\ MH Wpæ SRGVNOHSHQ5RGLQQëGŢPQDEt]tYHONRU\VëRE\WQëSURVWRU RUR]OR]HDæP2GLVSR]LÿQĚŐHäHQëMDNR[NRXSHOQDD[:&NURGLQQpPXGRPXE\ODSŐLVWDYĚQDSURGHMQDRUR]OR]HP2.URGLQQpPXGRPXGiOHSDWŐtJDUiæ D NU\Wp SDUNRYDFt VWiQt ]iURYHŁ YMH]G GR GYRUD  D VNODGRYDFt SURVWRU\ V SŢGRX 'ŢP Pi YODVWQt VWXGQX DOH MH ]iURYHŁQDSRMHQQDPĚVWVNëYRGRYRGDNDQDOL]DFL9\WiSĚQt MH ŐHäHQR SRPRFt SO\QRYpKR NRWOH Y ]LPĚ PRæQR Y\XætW LYNRPELQDFLVNRWOHP$WPRVQDGŐHYR9GRPĚMVRXGiOH L NUERYi NDPQD 3ŐL SOQpP XætYiQt GRPX ÿLQt PĚVtÿQt QiNODG\PD[.ÿ9HäNHUiREÿDQVNiY\EDYHQRVW Y +RVWLYLFL YÿHWQĚ YHOPL GREUpKR GRSUDYQtKR VSRMHQt GR 3UDK\]DMLVWpVSOŁXMHQiURN\QDURGLQQpE\GOHQt

www.chirs.cz

We offer for sale a multi-generational family home situDWHGLQWKHSOHDVDQWDUHDRI+RVWLYLFHYLOODJH7KHKRXVH LVORFDWHGRQDYHU\ZHOOPDLQWDLQHGPñSORW JDUGHQ PñEXLOWXSDUHDPñ 7KHKRXVHFRQVLVWVRIWZR storeys and an attic premises, with a cellar under onethird of the building. The family house offers generous OLYLQJVSDFHRIPñZLWKDOD\RXW[EDWKURRPV DQG[:&V$PñVKRSKDVEHHQEXLOWDGMRLQLQJWKH house. The property also includes a garage and covered parking space with entrance to the courtyard, as well as storerooms with an attic. The building has its own well, but is also connected to the urban water and sewerage V\VWHPV+HDWLQJLVSURYLGHGE\DJDVERLOHU7KHUHLVWKH RSWLRQLQZLQWHURIXVLQJLWLQFRPELQDWLRQZLWKWKH$WPRV ERLOHU IRU ZRRG 7KH KRXVH DOVR FRPSULVHV D ÀUHSODFH VWRYH7KHPRQWKO\FRVWVDUHPD[LPDOO\&]NZLWK IXOOXVDJH$OOWKHFLYLFDPHQLWLHVLQ+RVWLYLFHLQFOXGLQJ good transport links to Prague, will surely meet the demands for family living.

ǛǼDZǰǷǬǯǬDZǸ ǰǷȋ ǻǼǺǰǬDzǴ ǽDZǸDZǵǹȇǵ ǰǺǸ ǰǷȋ ǹDZǽǶǺǷȈǶǴȁ ǻǺǶǺǷDZǹǴǵ ǼǬǽǻǺǷǺDzDZǹǹȇǵ Ǯ ǻǼDZǶǼǬǽǹǺǸ ǼǬǵǺǹDZ ǹǬǽDZǷDZǹǹǺǯǺǻǿǹǶǾǬǏǺǽǾǴǮǴȂDZǐǺǸǼǬǽǻǺǷǺDzDZǹǹǬǭǷǬǯǺǿǽǾǼǺDZǹǹǺǸǿȃǬǽǾǶDZǮǸ2 ǽǬǰ²Ǹ2dzǬǽǾǼǺDZǹǹǬȋǻǷǺȅǬǰȈP2 ǐǺǸǴǸDZDZǾǰǮǬȉǾǬDzǬǴǸǬǹǽǬǼǰǬ ǻǺǰǺǰǹǺǵǾǼDZǾȈȊǰǺǸǬ²ǻǺǰǮǬǷǎǽDZǸDZǵǹǺǸǰǺǸDZǻǼǺǽǾǺǼǹȇDZ DzǴǷȇDZ ǻǷǺȅǬǰǴ ² ȂDZǷȇȁ  Ǹ2 ǻǷǬǹǴǼǺǮǶǬ ǮǬǹǹȇDZǶǺǸǹǬǾȇǴǾǿǬǷDZǾǬǶǰǺǸǿǭȇǷǻǼǴǽǾǼǺDZǹ ǸǬǯǬdzǴǹ ǽ ǻǷǺȅǬǰȈȊ  Ǹ2 ǐǺǸ ǾǬǶDzDZ ǮǶǷȊȃǬDZǾǮǽDZǭȋǯǬǼǬDzDZǽǾȈǴǶǼȇǾǬȋǻǬǼǶǺǮǶǬ ǺǹǬǾǬǶDzDZ ȋǮǷȋDZǾǽȋǮȆDZdzǰǺǸǮǺǰǮǺǼ ǴǽǶǷǬǰǽǶǴDZǻǺǸDZȅDZǹǴȋǽȃDZǼǰǬǶǺǸǟǰǺǸǬǽǮǺȋǽǶǮǬDzǴǹǬǹǺǺǹǾǬǶDzDZǻǼǴǽǺDZǰǴǹDZǹ Ƕ ǽǴǽǾDZǸDZ ǯǺǼǺǰǽǶǺǯǺ ǮǺǰǺǽǹǬǭDzDZǹǴȋ Ǵ ǶǬǹǬǷǴdzǬȂǴǴ ǙǬǯǼDZǮ ǺǽǿȅDZǽǾǮǷȋDZǾǽȋ ǽ ǻǺǸǺȅȈȊ ǯǬdzǺǮǺǯǺ ǶǺǾǷǬ ǮdzǴǸǹǴǵǻDZǼǴǺǰǺǾǺǻǷDZǹǴDZǸǺDzDZǾǺǽǿȅDZǽǾǮǷȋǾȈǽȋǮǽǺȃDZǾǬǹǴǴǽǶǺǾǷǺǸ$WPRV ǺǾǺǻǴǾDZǷȈǹȇǵǸǬǾDZǼǴǬǷ²ǰǼDZǮDZǽǴǹǬ ǎǰǺǸDZǾǬǶDzDZDZǽǾȈǴǻDZȃǶǴǛǼǴǻǺǷǹǺǵȉǶǽǻǷǿǬǾǬȂǴǴǰǺǸǬDZDzDZǸDZǽȋȃǹȇDZǼǬǽȁǺǰȇǽǺǽǾǬǮǷȋȊǾǸǬǶǽǴǸǬǷȈǹǺȃDZȄǽǶǴȁǶǼǺǹǜǬdzǮǴǾǬȋǴǹȀǼǬǽǾǼǿǶǾǿǼǬ Ǯ ǏǺǽǾǴǮǴȂǬȁ ǮǶǷȊȃǬȋ Ǵ ǺȃDZǹȈ ȁǺǼǺȄDZDZ ǾǼǬǹǽǻǺǼǾǹǺDZ ǽǺǺǭȅDZǹǴDZǽǛǼǬǯǺǵǭDZdzǿǽǷǺǮǹǺǺǾǮDZȃǬDZǾǮǽDZǸǾǼDZǭǺǮǬǹǴȋǸǶǽDZǸDZǵǹǺǸǿDzǴǷȈȊ

&HQD3ULFHǢDZǹǬLQIRUPDFHYNDQFHOiŐLIURPWKH5HDO(VWDWH$JHQF\ǴǹȀǺǼǸǬȂǴȋǮǬǯDZǹǾǽǾǮDZ


3!,%¬¬s¬¬EXTENSIVE NEW **** SPA RESORT Ǜǜǚǐnjǒnjs ǙǚǎǧǕǖǜǟǛǙǧǕ ǝǛnjǖǟǜǚǜǞ.5.212ã( 6SDUHVRUWLQWKH.UNRQRVH0RXQWDLQVZKLFKLVKLGGHQIURPWKHEXVWOHRIFLYLOL]DWLRQLQWKHFKDUPLQJPRXQWDLQDUHD<RXDUHLQWKHFRXQWU\VLGHZKHUHKDUPRQ\KDVIRXQGLWV QDPH4XDOLW\OHYHOVSDZLWKLQGRRUDQGRXWGRRUDFWLYLWLHVLQDYLUJLQHQYLURQPHQWXQGLVFRYHUHGE\WKHPDVVHVRIWRXULVWV4XDOLW\DFFRPPRGDWLRQDQGH[FHOOHQWFXLVLQHDUH WKHUHDVRQVZK\FOLHQWVOHDYHWKHUHVRUWKRXVHVUHJHQHUDWHGDQGIHHODIHZ\HDUV\RXQJHU FRPSOH[KDVKRWHOVDQGDSDUWPHQWVZLWKDWRWDOFDSDFLW\RIEHGV

ǝǻǬǶǿǼǺǼǾǮǯǺǼǬȁǖǼǶǺǹǺȄDZǽǶǼȇǾȇǵǺǾǽǿDZǾȇȂǴǮǴǷǴdzǬȂǴǴǮǮǺǷȄDZǭǹǺǸǺǶǼǿDzDZǹǴǴǯǺǼǴǻǼǴǼǺǰȇǎǶǼǬȊǯǰDZǯǬǼǸǺǹǴȋǺǭǼDZǷǬǽǮǺDZǴǸȋǟǼǺǮDZǹȈ ǶǬȃDZǽǾǮǬǶǿǼǺǼǾǹȇȁǿǽǷǿǯǽǮǺdzǸǺDzǹǺǽǾȈȊLQGROHǴRXWGRRUǬǶǾǴǮǹǺǯǺǮǼDZǸȋǻǼǺǮǺDzǰDZǹǴȋǽǼDZǰǴǰDZǮǽǾǮDZǹǹǺǵǻǼǴǼǺǰȇǰǺǽǴȁǻǺǼǹDZǻǼǴǽǾǿǻǹǺǵǰǷȋȄǴǼǺ ǶǴȁǸǬǽǽǾǿǼǴǽǾǺǮǚǾǷǴȃǹǺDZǼǬdzǸDZȅDZǹǴDZǴǽǬǸǬȋǷǿȃȄǬȋǶǿȁǹȋ²ȉǾǺǻǼǴȃǴǹȇǻǺǶǺǾǺǼȇǸǶǷǴDZǹǾȇǿDZdzDzǬȊǾǽǶǿǼǺǼǾǬǺǭǹǺǮǷDZǹǹȇǸǴǴȃǿǮǽǾǮǿȊǾǽDZǭȋ ǹǬǹDZǽǶǺǷȈǶǺǷDZǾǸǺǷǺDzDZ9 ǶǺǸǻǷDZǶǽDZǼǬǽǻǺǷǺDzDZǹȇǺǾDZǷȋǴǬǻǬǼǾǬǸDZǹǾǺǮǽǺǭȅDZǵǮǸDZǽǾǴǸǺǽǾȈȊǸDZǽǾ


PRODEJ s Novรฝ rozsรกhlรฝ **** lรกzeลˆskรฝ resort, Krkonoลกe /i]HลVNรซUHVRUWY.UNRQRรคtFKNWHUรซMHVFKRYDQรซSลHGVKRQHPFLYLOL]DFHYSลขYDEQpPKRUVNpPSURVWลHGt-VWHYNUDMLQฤšNGHKDUPRQLHQDรคODVYpMPpQR.YDOLWQt ~URYHลOi]HลVWYtVPRรฆQRVWtLQGRRUDRXWGRRUDNWLYLWYSDQHQVNpPSURVWลHGtGRVXGQHREMHYHQpPPDVDPLWXULVWลข6NYฤšOpXE\WRYiQtDYรซERUQiJDVWURQRPLHWR MVRXGลขYRG\SURรฟNOLHQWLWRKRWRUHVRUWXRGFKi]HMtGRPลข]UHJHQHURYDQtDFtWtVHRSiUOHWPODGรคt9 NRPSOH[XQDMGHWHKRWHO\DDSDUWPiQลขVFHONRYRX NDSDFLWRXOลขรฆHN


PRODEJ s HORSKÝ HOTEL*** SUPERIOR Ǜǜǚǐnjǒnj s ǏǚǜǙǧǕǚǞǑǗǨ 683(5,25 +RUVNëKRWHO 6XSHULRUVHQDFKi]tSŐtPRYVDPpPFHQWUXãXPDY\YHYëäFHPHWUŢQDGPRŐHP9OHWQtPREGREtVHRNROtKRWHOXPĚQtQDUiMWXULVWLN\F\NORWXULVWLN\ DKRXEDŐŢY]LPĚVHRFLWQHWHYFHQWUXVMH]GRYpKRDEĚæNRYpKRO\æRYiQt&HONHPVHGPVMH]GRYHNVUŢ]QRXQiURÿQRVWtVXPĚOëP]DVQĚæRYiQtPDQRÿQtPO\æRYiQtPVHQDFKi]t YQHMEOLæätPRNROt 0RXQWDLQKRWHO 6XSHULRULVORFDWHGLQWKHKHDUWRIãXPDYD WKH%RKHPLDQ)RUHVW DWDQDOWLWXGHRIPHWHUVDERYHVHDOHYHO,QVXPPHUWKHKRWHOWXUQVLQWRDSDUDGLVH RIKLNLQJELNLQJDQGPXVKURRPSLFNHUVLQZLQWHU\RXZLOOÀQG\RXUVHOILQWKHFHQWUHRIGRZQKLOODQGFURVVFRXQWU\VNLLQJ7KHUHDUHVHYHQVNLVORSHVRIYDU\LQJGLIÀFXOW\ZLWK DUWLÀFLDOVQRZDQGQLJKWVNLLQJORFDWHGLQWKHYLFLQLW\RIWKHKRWHO

ǏǺǼǹȇǵǺǾDZǷȈ 6XSHULRUǼǬǽǻǺǷǺDzDZǹǮǽǬǸǺǸȂDZǹǾǼDZǤǿǸǬǮȇǹǬǮȇǽǺǾDZǸDZǾǼǺǮǹǬǰǿǼǺǮǹDZǸǸǺǼȋǎǷDZǾǹDZDZǮǼDZǸȋǺǶǼDZǽǾǹǺǽǾǴǺǾDZǷȋǻǼDZǮǼǬȅǬȊǾǽȋǮǼǬǵ ǰǷȋǾǿǼǴǽǾǺǮǺǹǴȁǺǼǺȄǴǰǷȋǻDZȄǴȁǻǼǺǯǿǷǺǶDZdzǰȇǹǬǮDZǷǺǽǴǻDZǰDZǴǽǭǺǼǬǯǼǴǭǺǮǮdzǴǸǹDZDZǮǼDZǸȋǮȇǺǶǬDzDZǾDZǽȈǮȂDZǹǾǼDZǯǺǼǹǺǷȇDzǹǺǯǺǽǻǺǼǾǬǴDZdzǰȇǹǬǭDZǯǺǮȇȁ ǷȇDzǬȁǎǺǭȅDZǵǽǷǺDzǹǺǽǾǴǾǬǸǽDZǸȈǯǺǼǹǺǷȇDzǹȇȁǾǼǬǽǽǽǼǬdzǹǺǵǽǾDZǻDZǹȈȊǽǷǺDzǹǺǽǾǴǽǺǭDZǽǻDZȃDZǹǴDZǸǴǽǶǿǽǽǾǮDZǹǹȇǸǽǹDZǯǺǸǴǮǺdzǸǺDzǹǺǽǾȋǸǴǹǺȃǹǺǯǺǶǬǾǬǹǴȋ ǹǬǷȇDzǬȁ²ǮǽDZǼǬǽǻǺǷǺDzDZǹǺǮǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵǭǷǴdzǺǽǾǴǺǾǺǾDZǷȋ


PRODEJ s **** HOTEL, FRANTIŠKOVY LÁZNĚ Ǜǜǚǐnjǒnjs +27(/ )5$1=(16%$' ãSLÿNRYë KRWHOXPtVWĚQëYHIUDQWLäNROi]HŁVNpKRSDUNXYOHVQtNUDMLQĚNWHUiYOHWQtPL]LPQtPREGREtY\WYiŐt~æDVQpSURVWŐHGtSURRGSRÿLQHNDUHJHQHUDFL]GUDYt 3URFKi]NDRGKRWHOXGRFHQWUD)UDQWLäNRYëFK/i]QtWUYiDVLSDWQiFWPLQXW+RWHONWHUëVHVNOiGi]HGYRXEXGRYPiNGLVSR]LFLFHONHPSRNRMŢSŐHYiæQĚGYRXOŢæNRYëFK 3HDN )UDQWLVNRY\/D]QHKRWHOORFDWHGLQDSDUNLQWKHIRUHVWODQGVFDSHLQVXPPHUDQGZLQWHUFUHDWLQJDPD]LQJHQYLURQPHQWIRUUHVWDQGUHJHQHUDWHKHDOWK :DONIURPWKHKRWHOWRWKHFHQWHU)UDQ]HQVEDGWDNHVDERXWÀIWHHQPLQXWHV7KHKRWHOZKLFKFRQVLVWVRIWZREXLOGLQJVKDYHDWRWDORIURRPVPRVWO\GRXEOH ǺǾDZǷȈ)UDQWLäNRY\/i]QĚ ǎȇǽǺǶǺǶǷǬǽǽǹȇǵ ǺǾDZǷȈǼǬdzǸDZǽǾǴǮȄǴǵǽȋǮǻǬǼǶDZǠǼǬǹǾǴȄǶǺǮȇǗǬdzǹDZǽǼDZǰǴǷDZǽǺǮǶǺǾǺǼȇDZǴǷDZǾǺǸǴdzǴǸǺǵǽǺdzǰǬȊǾǿǰǴǮǴǾDZǷȈǹǿȊǬǾǸǺǽȀDZǼǿǰǷȋ ǺǾǰȇȁǬǴǮǺǽǽǾǬǹǺǮǷDZǹǴȋdzǰǺǼǺǮȈȋǛǼǺǯǿǷǶǬǺǾǺǾDZǷȋǰǺȂDZǹǾǼǬǠǼǬǹǾǴȄǶǺǮȇȁǗǬdzǹDZǵdzǬǹǴǸǬDZǾǺǶǺǷǺǻȋǾǹǬǰȂǬǾǴǸǴǹǿǾǚǾDZǷȈǶǺǾǺǼȇǵǽǺǽǾǺǴǾǴdzǰǮǿȁ dzǰǬǹǴǵǼǬǽǽȃǴǾǬǹǹǬǹǺǸDZǼǺǮǮǺǽǹǺǮǹǺǸǰǮǿȁǸDZǽǾǹȇȁ

352'(-,6$/(6,džLJDžƺƶƻljLjǖ/,6723$',129(0%(5,DŽDžǖƷLJǓ

131


Pronájem | Na hrobci | Nové Mìsto | Praha 2 | 130 m2 | 85 000 Kè / mìsíc /8;861Ì1É%č(æ1Ì%<7NNRWHYĨHQìYìKOHGQD9\åHKUDG9OWDYXDåLURNpRNROtNRXSHOQ\EDONRQKDODåSLĀNRYpPDWHULiO\YĀ PUDPRUXDH[RWLFNpKRGĨHYDYNRXSHOQiFKDNXFK\QLY\VRNpVWURS\YHONiRNQDSDUNHW\YHVWDYęQpVNĨtQęEH]SHĀQRVWQtGYHĨHVWPtYDĀH VYęWHOWĨL7983&SUDĀNDVXåLĀND=DĨt]HQìGHVLJQRYìE\WYHSDWĨHNRPSOHWQę]UHNRQVWUXRYDQpKRĀLQçRYQtKRGRPXVYìWDKHPQD QiEĨHçt9OWDY\VYìERUQiGRSUDYQtGRVWXSQRVWt +,*+48$/,7<5,9(5%$1.$3$570(17ZRQGHUIXORSHQYLHZVRIWKH9\åHKUDG&DVWOHDQGWKH9OWDYDULYHUWZREHGURRPVWZR EDWKURRPVEDOFRQ\WRSPDWHULDOVLQFOPDUEOHDQGH[RWLFZRRGLQWKHEDWKURRPVDQGNLWFKHQSDUTXHWIORRUVKHDWHGEDWKURRPIORRUV KLJKFHLOLQJVODUJHZLQGRZVOLJKWGLPPHUVWKUHH79V83&FDEOHZDVKHUGU\HU)XOO\IXUQLVKHGIRXUWKIORRUGHVLJQDSDUWPHQWLQDIXOO\ UHIXUELVKHGWUDGLWLRQDOEXLOGLQJZLWKDOLIWZLWKYHU\JRRGWUDQVSRUWDWLRQFRQQHFWLRQV

132

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Pronรกjem | Klรกnovice | Praha 9 | 220 m2 | 80 000 Kรจ / mรฌsรญc 129ฤ…3267$9(1ร‰9,/$ORรงQLFHNRXSHOQ\WHUDV\P2SฤฃGQtSURVWRUKDODรฅDWQDVXWHUpQVQฤ™NROLNDPtVWQRVWPLSUiGHOQD VNODGRYpSURVWRU\GฤจHYฤ™QpSDUNHW\DGODรงEDNUESO\QRYpY\WiSฤ™QtYLGHRWHOHIRQDODUP*DUiรงDSDUNRYiQtQDSR]HPNX1RYiVOXQQi YLODVNUiVQฤ™XSUDYHQRX]DKUDGRXYNOLGQpUH]LGHQฤ€QtREODVWLYEOt]NRVWL.OiQRYLFNpKROHVDDJROIRYpKRKฤจLรฅWฤ™VU\FKORXGRVWXSQRVWtGR FHQWUD3UDK\ %5$1'1(:+286(IRXUEHGURRPVWKUHHEDWKURRPVWHUUDFHVP2DWWLFVSDFHKDOOZDONLQFORVHWEDVHPHQWZLWKWZRODUJH URRPVODXQGU\URRPVWRUDJHZRRGSDUTXHWIORRUVDQGWLOHVILUHSODFHJDVKHDWLQJYLGHRHQWU\SKRQHDODUP*DUDJHSOXVSDUNLQJRQWKH SORW1HZVXQQ\IDPLO\YLOODZLWKDEHDXWLIXOODQGVFDSHGJDUGHQLQDSHDFHIXOUHVLGHQWLDODUHDLQFORVHYLFLQLW\RIWKH.OiQRYLFNรฌIRUHVWDQGD JROIFRXUVHZLWKJRRGDFFHVVWR3UDJXH

Na Perลกtรฝnรฌ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

PRONรJEM I LEASE I ฦถว‡ฦปว„ฦบฦถ

LISTOPAD 2012 I NOVEMBER 2012 I ว„ว…ว–ฦทว‡ว“ 2012

133


Pronájem | æHOH]Qi | Staré Mìsto | Praha 1 | 143 m2 | 69 000 Kè / mìsíc 9ë-,0(ÿ1ë0(=21(79+,6725,&.e/2.$/,7ąNNNUiVQpYìKOHG\QD6WDUp0ęVWRD3UDçVNìKUDGNRXSHOQ\NOLPDWL]DFH GXERYpSRGODK\Y\WiSęQiGODçEDYNRXSHOQiFKIUDQFRX]VNiDWHOLpURYiDVWĨHåQtRNQDNYDOLWQtY\EDYHQt~ORçQpSURVWRU\GHVLJQRYi VYtWLGODSUDĀNDVXåLĀNDVDWHOLWYLGHRWHOHIRQ1RYìSRGNURYQtE\WYSDWĨHNRPSOHWQę]UHQRYRYDQpKRĀLQçRYQtKRGRPXVH ]DFKRYDQìPLSģYRGQtPLSUYN\DYìWDKHPSiUNURNģRG6WDURPęVWVNpKRQiPęVWt (;&(37,21$/'83/(;,1$1+,6725,&/2&$7,21EHDXWLIXOYLHZVRIWKH2OG7RZQDQGWKH3UDJXH&DVWOHWKUHHEHGURRPVWZR EDWKURRPVDLUFRQGLWLRQLQJRDNIORRUVKHDWHGWLOHVLQEDWKURRPVDWHOLHUDQG)UHQFKZLQGRZVVN\OLJKWVTXDOLW\HTXLSPHQWZDVKHUGU\HU VDWHOOLWHYLGHRHQWU\SKRQH%UDQGQHZILIWKIORRUDWWLFDSDUWPHQWLQDIXOO\UHIXUELVKHGEXLOGLQJZLWKSUHVHUYHGRULJLQDOGHWDLOVDQGDQHZ OLIWVWHSVIURPWKH2OG7RZQ6TXDUHDQGWKHSUHVWLJLRXV3DĨtçVNiVWUHHW

Pro kompletní nabídku navštivte / For complete property listing please visit

134

NEJLEPŠÍ NEMOVITOSTI I BEST PROPERTIES I ǂNJǎǏƶǖ DŽƻƺƸƿƽƿǃDžLjljǓ

svoboda-williams.com


Pronájem | U Vojanky | Košíøe | Praha 5 | 144 m2 | 38 000 Kè / mìsíc STYLOVÝ BYT 3+kk, terasy 77 m2]DKUiGNDORçQLFHNRXSHOQDWRDOHWDSURKRVW\YVWXSSĨtPR]YìWDKXGĨHYęQpSRGODK\YHVWDYęQp VNĨtQęQiE\WHNQDPtUXSURVNOHQiVWęQDIUDQFRX]VNiRNQDYLGHRWHOHIRQSO\QRYìNRWHOJDUiçRYpVWiQtVNOHS3URVWRUQìE\WVQHUXåHQìP YìKOHGHPQD]DOHVQęQìVYDKVLWXRYDQìYSDWĨHMHGLQHĀQpKRSURMHNWX9LOOD9RMDQNDNWHUìE\ORFHQęQFHQRX*UDQG3UL[DUFKLWHNWģ YU6QDGQiGRVWXSQRVWGRFHQWUD STYLISH APARTMENT, 77 m2RIWHUUDFHVJDUGHQWHUUDFHEHGURRPVEDWKURRPJXHVWWRLOHWGLUHFWHQWU\IURPWKHOLIWZRRGHQIORRUVEXLOWLQ ZDUGUREHVFXVWRPPDGHIXUQLWXUHJODVVZDOO)UHQFKZLQGRZVYLGHRHQWU\SKRQHJDVERLOHUJDUDJHSDUNLQJFHOODU6SDFLRXVDSDUWPHQWRQWKH VWIORRURIWKHXQLTXH9LOOD9RMDQNDSURMHFWDZDUGHG*UDQG3UL[RI$UFKLWHFWVLQRIIHULQJYLHZVRIWKHVXUURXQGLQJIRUHVWHGKLOOVLGHVDQG HDV\DFFHVVWRWKHFLW\FHQWUH

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

PRONÁJEM I LEASE I ƶLJƻDŽƺƶ

LISTOPAD 2012 I NOVEMBER 2012 I DŽDžǖƷLJǓ 2012

135


Pronájem | Nebušice | Praha 6 | 310 m2 | 92 000 Kè / mìsíc 0$-(67É71Ì9,/$ORçQLFHHQVXLWHNRXSHOQ\P2REìYDFtSRNRMVNUEHPNYDOLWQtPDWHULiO\D]SUDFRYiQtGXERYpDRĨHFKRYp SRGODK\GYHĨHD]iUXEQęåWXNRYiYì]GRED~ORçQpSURVWRU\SUDĀNDVXåLĀNDDODUPYLGHRWHOHIRQSęNQęXSUDYHQi]DKUDGD*DUiçSURGYD YR]\3URVWRUQiURGLQQiYLODYHVW\OXKLVWRULVPXYNOLGQpSĨtURGQtORNDOLWęYSęåtPGRVDKXPH]LQiURGQtåNRO\,63 *5$1'9,//$EHGURRPVHQVXLWHEDWKURRPVP2OLYLQJURRPZLWKDILUHSODFHKLJKTXDOLW\PDWHULDOVDQGILQLVKHVVSHFLDO DWWHQWLRQWRGHWDLORDNDQGZDOQXWIORRUVGRRUVDQGGRRUMDPEVVWXFFRRUQDPHQWVVWRUDJHZDVKHUGU\HUDODUPYLGHRHQWU\SKRQH QLFHO\ODQGVFDSHGJDUGHQ'RXEOHJDUDJH*HQHURXVIUHHVWDQGLQJKRPHLQWKHVW\OHRI+LVWRULFLVPLQDZRQGHUIXOQDWXUDODUHDZLWKLQ ZDONLQJGLVWDQFHRIWKH,QWHUQDWLRQDO6FKRRORI3UDJXH

136

NEJLEPŠÍ NEMOVITOSTI I BEST PROPERTIES I ǂNJǎǏƶǖ DŽƻƺƸƿƽƿǃDžLjljǓ


Pronájem | Kamýk | Praha 4 | 680 m2 | 200 000 Kè / mìsíc VILA S VNITØNÍM BAZÉNEM, SAUNOU A VÝTAHEM, 6+kk, 4 koupelny, 250 m2 relaxaèní zóna, 3 terasy, galerie s knihovnou, šatna, OX[XVQtY\EDYHQtYtĨLYNDSO\QRYpWRSHQtSUDĀNDVXåLĀND79VDWHOLWDODUP*DUiçSURYR]\$W\SLFNi]DĨt]HQiĀW\ĨSRGODçQtYLOD YNOLGQpYLORYpĀWYUWLYEOt]NpPGRVDKXOHVģSDUNģDĀHWQìFKVSRUWRYLåĢVGREURXGRVWXSQRVWtGRFHQWUDSiUPLQXWRGEULWVNp PH]LQiURGQtåNRO\DQiNXSQtKRFHQWUD1RYRGYRUVNi3OD]D 02'(51+286(:,7+$1,1'2256:,00,1*322/VDXQDOLIWIRXUEHGURRPVVWXG\IRXUEDWKURRPVP2 relaxation area, three WHUUDFHVWRSTXDOLW\HTXLSPHQWZKLUOSRROJDVKHDWLQJZDVKHUGU\HU79VDWHOOLWHDODUP*DUDJHSDUNLQJIRUIRXUFDUV)XOO\IXUQLVKHG YLOODLQDTXLHWUHVLGHQWLDODUHDLQFORVHYLFLQLW\RIZRRGVSDUNVDQGVSRUWVIDFLOLWLHVZLWKJRRGFRQQHFWLRQWRWKHFLW\FHQWHUPLQXWHVIURP WKH%ULWLVK,QWHUQDWLRQDO6FKRRODQGWKH´1RYRGYRUVNi3OD]DµVKRSSLQJPDOO

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

PRONÁJEM I LEASE I ƶLJƻDŽƺƶ

LISTOPAD 2012 I NOVEMBER 2012 I DŽDžǖƷLJǓ 2012

137


PronĂĄjem | TruhlåøskĂĄ | NovĂŠ MĂŹsto | Praha 1 | 107 m2 | 35 000 Kè / mĂŹsĂ­c /8;861Ă&#x152;%<7NNPRGHUQtGHVLJQNUENOLPDWL]DFHĂĽSLÄ&#x20AC;NRYpPDWHULiO\EDPEXVRYpSRGODK\Y\WiSÄ&#x2122;QiGODçEDYNRXSHOQÄ&#x2122;FHQWUiOQt SO\QRYpWRSHQtSRVXYQpSURVNOHQpLQWHULpURYpGYHĨHSUDÄ&#x20AC;NDVXĂĽLÄ&#x20AC;NDP\Ä&#x20AC;NDPLNURYOQQiWURXEDDODUPVPRçQRVWtQDSRMHQtQD3&2 YLGHRWHOHIRQNDPHURYĂŹV\VWpPYEXGRYÄ&#x2122;1RYÄ&#x2122;]UHQRYRYDQĂŹE\WYHSDWĨHFLWOLYÄ&#x2122;]UHNRQVWUXRYDQpKRKLVWRULFNpKRÄ&#x20AC;LQçRYQtKRGRPX s vĂ˝tahem v blĂ­zkosti nĂĄmĂŹstĂ­ Republiky. HIGH QUALITY APARTMENT, two bedrooms, fireplace, air-conditioning, bamboo flooring, heated tiles in the bathroom, central gas heating, sliding glass interior doors, washer, dryer, dishwasher, alarm that can be connected to a security agency, video entry phone, camera system in the building. Newly reconstructed third floor apartment in a late 19th century building, superbly renovated and retrofitted with a lift, in a quiet street steps from NĂĄmĂŹstĂ­ Republiky Square with trams and metro.

138

NEJLEPĹ Ă? NEMOVITOSTI I BEST PROPERTIES I Ç&#x201A;Ç&#x160;Ç&#x17D;Ç?ĆśÇ&#x2013; Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;


Pronájem | .ĨtçRYi_6PtFKRY_3UDKD_P |.Ā/ mìsíc /2)729ë$7(/,e5PVWĨHåQtWHUDVDVSĨHNUiVQìPYìKOHGHPQD~GROt9OWDY\DRNROtUHOD[DĀQt]i]HPtVSUDFRYQRXåDWQD NRXSHOQ\WHDNRYpSRGODK\HOHNWULFNpUROHW\QDGiONRYpRYOiGiQtåSLĀNRYpY\EDYHQtVSRWĨHELĀH0LHOHNOLPDWL]DFHY]GXFKRWHFKQLND 1RYìE\WYHVW\OXNODVLFNìFKQHZ\RUVNìFKORIWģYSDWĨHNRPSOHWQę]UHNRQVWUXRYDQpLQGXVWULiOQtEXGRY\RFHQęQpWLWXO\%HVW,QWHUQDWLRQDO 5HGHYHORSPHQWD%HVW(XURSHDQ,QWHULRU'HVLJQQHGDOHNR3URNRSVNpKR~GROt /2)767</($7(/,(5PURRIWHUUDFHZLWKEHDXWLIXOYLHZVRIWKH9OWDYDULYHUYDOOH\DQGEH\RQGRQHEHGURRPVWXG\WZREDWKURRPV ZDONLQFORVHWWHDNIORRUVHOHFWULFVKXWWHUVZLWKUHPRWHFRQWURO0LHOHDSSOLDQFHVDLUFRQGLWLRQLQJKXPLGLILHU1HZDSDUWPHQWLQWKHVW\OH RIFODVVLFDO1HZ<RUNORIWVRQWKHthIORRURIDFRPSOHWHO\UHQRYDWHGLQGXVWULDOEXLOGLQJDZDUGHG%HVW,QWHUQDWLRQDODQG%HVW(XURSHDQ UHGHYHORSPHQW,QWHULRU'HVLJQORFDWHGQHDUWKH3URNRSVNp9DOOH\

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

PRONÁJEM I LEASE I ƶLJƻDŽƺƶ

LISTOPAD 2012 I NOVEMBER 2012 I DŽDžǖƷLJǓ 2012

139


Pronájem | Pod kaštany | Bubeneè | Praha 6 | 212 m2 | 70 000 Kè / mìsíc .9$/,71Ì69ą7/ë%<7WHUDVDORçQLFHSUDFRYQDNRXSHOQ\åDWQ\SUiGHOQDVStçSDUNHW\]WURSLFNpKRGĨHYDYHVWDYęQpVNĨtQę SUDĀNDLQWHUQHWEH]SHĀQRVWQtNDPHU\SDUNRYDFtVWiQtDVNOHSYSRG]HPQtJDUiçL3URVWRUQìE\WVIUDQFRX]VNìPLRNQ\VSĨtPìP YVWXSHPQD]DKUDGXYSĨt]HPtH[NOX]LYQtUH]LGHQFH9LOOD%LDQFDYSUHVWLçQtUH]LGHQĀQtORNDOLWęVSDUN\D]DKUDGDPLVU\FKORXGRVWXSQRVWt GRFHQWUD 48$/,7<$3$570(17WHUUDFHIRXUEHGURRPVWZREDWKURRPVVWXG\WZRZDONLQFORVHWVODXQGU\SDQWU\GLUHFWDFFHVVWRWKHJDUGHQ WURSLFDOZRRGSDUTXHWIORRUVEXLOWLQZDUGUREHVZDVKHU,QWHUQHWYLGHRHQWU\SKRQHVHFXULW\FDPHUDV7ZRSDUNLQJVSDFHVDQGDSULYDWH VWRUDJHURRPLQWKHXQGHUJURXQGJDUDJH%ULJKWJURXQGIORRUDSDUWPHQWLQWKHH[FOXVLYH9LOOD%LDQFDUHVLGHQFHVXUURXQGHGE\SDUNV DQGSUHWW\YLHZVRIZHOOPDLQWDLQHGJDUGHQVLQDSUHVWLJLRXV3UDKXHQHLJKERUKRRG

140

NEJLEPŠÍ NEMOVITOSTI I BEST PROPERTIES I ǂNJǎǏƶǖ DŽƻƺƸƿƽƿǃDžLjljǓ


Pronájem | Jilská | Staré Mìsto | Praha 1 | 176 m2 | 43 000 Kè / mìsíc DESIGNOVÝ PODKROVNÍ BYT, 23 m2WHUDVDORçQLFHYHONRU\VìREìYDFtSRNRMVNXFK\QtDMtGHOQRXIUDQFRX]VNiRNQDYHGRXFtQD WHUDVXNYDOLWQtY\EDYHQtGĨHYęQpSRGODK\DVWURS\0RGHUQt]DĨt]HQìE\WYHSDWĨHKLVWRULFNpEXGRY\EH]YìWDKXYFHQWUX6WDUpKR0ęVWD YEOt]NRVWL6WDURPęVWVNpKRQiPęVWt1iURGQtWĨtG\D.DUORYDPRVWX DESIGN ATTIC APARTMENT, 23 m2WHUUDFHWZREHGURRPVJHQHURXVO\GHVLJQHGOLYLQJURRPZLWKNLWFKHQ)UHQFKZLQGRZVRSHQLQJRQWR WKHWHUUDFHKLJKTXDOLW\ILQLVKHVDQGPDWHULDOVZRRGIORRUVDQGFHLOLQJV0RGHUQIXUQLVKHGDSDUWPHQWRQWKHVHFRQGIORRURIDQKLVWRULF EXLOGLQJZLWKRXWDOLIWORFDWHGULJKWLQWKHFHQWHURIWKH2OG7RZQPRPHQWVIURPWKH2OG7RZQ6TXDUHDQG&KDUOHV%ULGJH

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

PRONÁJEM I LEASE I ƶLJƻDŽƺƶ

LISTOPAD 2012 I NOVEMBER 2012 I DŽDžǖƷLJǓ 2012

141


Byt 2+1, 73 m2, Staré Město – Praha 1, Revoluční | 25 000 Kč / měsíčně Rekonstruovaný designový byt se zachovanými původními prvky ve 4. patře funkcionalistického paláce s výtahem pár kroků od nábřeží Vltavy, pár minut chůze od stanice metra Náměstí Republiky. Obývací pokoj, 1 ložnice s koupelnou, kuchyň s jídelnou, komora, parkety, vestavěné úložné prostory, pračka, sušička, alarm. Architect designed fourth floor apartment with preserved original details in a Functionalist palace with lift, steps from the Vltava riverbank, a short walk from Náměstí Republiky metro station and the Palladium shopping mall. Living room, one bedroom with bathroom, eat-in kitchen, laundry room, parquet floors, built-in storage, washer, dryer, alarm.

Pro kompletní nabídku navštivte / For complete property listing please visit

142

NEJLEPŠÍ NEMOVITOSTI I BEST PROPERTIES I ǂNJǎǏƶǖ DŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Pronájem

Prodej

Byt 3+kk, 113 m2, Vyšehrad – Praha 2, Lumírova | 19 000 Kč / měsíčně Mezonet se 2 terasami v 1. patře rezidenčního projektu v blízkosti stanice metra Vyšehrad. Obývací pokoj s kuchyní, 2 ložnice s šatnami, koupelna s vanou, komora, dvě toalety, výhled do zeleně parku, společná zahrada ve vnitrobloku, parkety, koberce, vestavěné úložné prostory, pračka, myčka, videotelefon, sklep. Garážové stání. Split-level first floor apartment with two terraces in a residential project near the gardens of the Vyšehrad Castle and Vyšehrad metro. Living room with kitchen, two bedrooms with built-in wardrobes, bathroom with tub, two toilets, storage room, green views, shared courtyard garden, parquet floors, carpets, washer, dishwasher, video entry phone, cellar. Garage space.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

PRONÁJEM I LEASE I ƶLJƻDŽƺƶ

LISTOPAD 2012 I NOVEMBER 2012 I DŽDžǖƷLJǓ 2012

143


Byt 3+kk, 115 m2, Žižkov – Praha 3, Pod kapličkou | 23 000 Kč / měsíčně Byt s 25 m2 terasou v 6. patře rezidenčního komplexu v klidné lokalitě s množstvím zeleně a rychlou dostupností do centra, u tenisových kurtů a dětského hřiště. Obývací pokoj s kuchyní, 2 ložnice, koupelna s vanou, 2 toalety, dřevěné podlahy, francouzská okna, vestavěné skříně, pračka, internet, alarm, sklep, výtah. Parkovací stání. Sixth floor apartment with a 25 m2 terrace in a modern building in a quiet green location with quick connection to the city center, with tennis courts, a nice park and a children’s playground. Living room with kitchen, two bedrooms, bathroom with tub, two toilets, wood floors, French windows, built-in wardrobes, washer, Internet, alarm, cellar, lift. Parking included.

Pro kompletní nabídku navštivte / For complete property listing please visit

144

NEJLEPŠÍ NEMOVITOSTI I BEST PROPERTIES I ǂNJǎǏƶǖ DŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Pronájem

Prodej

Byt 3+kk, 137 m2, Střešovice – Praha 6, Parléřova | 26 000 Kč / měsíčně Zařízený podkrovní mezonet s 15 m2 terasou v 5. patře činžovního domu s výtahem v blízkosti Pražského hradu, v rychlém dosahu parku Ladronka a letiště. Obývací pokoj s kuchyní, 2 ložnice se vstupy na terasu, koupelna s masážní vanou a sprchovým koutem, toaleta pro hosty, technická komora, kvalitní nábytek, pračka, sušička, TV. Furnished 5th floor split-level attic apartment with a 15 m2 terrace in a renovated building with a lift near the Prague Castle and Ladronka Park, with quick connections to the city center and the airport. Living room with kitchen, two bedrooms with terrace access, bathroom with massage tub and shower, guest toilet, utility room, quality furniture, washer, dryer, TV.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

PRONÁJEM I LEASE I ƶLJƻDŽƺƶ

LISTOPAD 2012 I NOVEMBER 2012 I DŽDžǖƷLJǓ 2012

145


Rodinný dům 6+kk, 232 m2, Rudná – Praha západ | 38 000 Kč / měsíčně Zařízený rodinný dům se zahradou v klidné vilové čtvrti s výbornou dostupností na D5, 10 minut k metru, 15 minut na letiště. 4 ložnice, 3 koupelny, obývací pokoj s kuchyní, terasa, komora, společenská místnost, sklad, francouzská okna, plovoucí podlahy a dlažba, vestavěné skříně, pračka, myčka, TV, alarm. Garáž. Furnished family house with a garden in a green residential area convenient to the D5 highway, 10 minutes to metro, 15 minutes to the airport. Four bedrooms, three bathrooms, living room with kitchen, terrace, storage room, family room, lots of French windows, floating floors and tiles, built-in wardrobes, washer, dishwasher, TV, alarm. Garage.

Pro kompletní nabídku navštivte / For complete property listing please visit

146

NEJLEPŠÍ NEMOVITOSTI I BEST PROPERTIES I ǂNJǎǏƶǖ DŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Pronájem

Prodej

Rodinný dům 5+kk, 172 m2, Malešice – Praha 10, Malešická | 50 000 Kč / měsíčně Rodinný dům s upravenou zahradou v klidné rezidenční čtvrti 10 minut jízdy od Anglického gymnázia. Obývací pokoj s kuchyní a celoprosklenou stěnou do zahrady, 4 ložnice, 3 koupelny, 2 šatny, terasa, komora, spíž, parkety, krbová kamna, vestavěné skříně, venkovní elektrické rolety, bidetové spršky, shoz prádla, alarm. Dvě krytá stání. Family house with a landscaped garden in a quiet residential area a ten minute drive from the English College. Living room with kitchen and floor-to-ceiling windows, four bedrooms, three bathrooms, two walk-in closets, terrace, pantry, parquet floors, slow burning stove, built-in wardrobes, outdoor electric blinds, laundry chute, alarm. Covered parking.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

PRONÁJEM I LEASE I ƶLJƻDŽƺƶ

LISTOPAD 2012 I NOVEMBER 2012 I DŽDžǖƷLJǓ 2012

147


SPORTALM Podzim–Zima 2012/13 www.fggroup.cz


)RFXVHGRQOX[XU\

Švédská, Praha 5 - Smíchov

pronájem / rent

Reprezentativní byt (114 m2) se nachází ve 2. patře nového projektu Sacre Coeur v malebné lokalitě Prahy 5 - Smíchov. Byt je částečně zařízený moderním nábytkem (s možností dozařízení) a nabízí k užívání 3 ložnice, 2 koupelny, extra toaletu, obývací pokoj s plně vybaveným kuchyňským koutem a komoru. K bytu také náleží balkon (6 m2), sklep a garážové parkovací stání, které je již zahrnuto v ceně nájmu. Příjemná lokalita s dobrou dostupností do centra a francouzského lycea. Modern 3 bedroom apartment (114 sqm) situated on 2nd floor of renowned residence Sacre Coeur, Prague 5 - Smíchov. The apartment is partly furnished (with possibility to be fully furnished) and boasts 3 bedrooms, 2 bathrooms, additional WC, living room with fully equipped kitchen corner, storage room and balcony (6 sqm). Cellar and garage parking space are included in the rent. Living within easy access to the city center and French lyceum.

Měsíční nájem: / Monthly rent: 40 000 CZK LEXXUS EXXUS XXUS XUS USS a.s., a.s a.s. .s., s.,., Mille Millenn Millen Mill Mil Mi Millennium M illenn lenni enniu nnium nniu nium ium um m Plaz Pla P Plaza, laza aza, za, a, V Celnici 10, 0, 110 0, 11 1 10 1 0 00 Praha 1 tel.: +420 420 20 0 221 21 111 1 11 11 1 922, 922 92 22, 2, www.lexxusnorton.cz, www. www ww w ww.lex ww.le w.lexx .lexx exxu xxus xusn usno sno nort orto rton ton on.c n.cz e-mail: ailil: ai ail: iill:l: info@lexxusnorton.cz iinf in info nff n


)RFXVHGRQOX[XU\

Tibetská, Praha 6 - Vokovice

pronájem / rent

Luxusní penthouse (195 m2) v 6. patře moderního projektu Terasy Červený Vrch. Prostorný obývací pokoj s přístupem na 108 m2 velkou terasu s exkluzivním výhledem do přírodní rezervace Šárka, 5 ložnic, plně vybavená kuchyň, jídelna, pracovna a 2 koupelny. Vyřešené parkování pro 2 velké vozy v podzemní garáži, sklep a 24 hodinová recepce. Atraktivní orientace bytu, klidné prostředí v žádané lokalitě, výborná dostupnost centra, letiště a Mezinárodní školy ISP v Nebušicích. Luxurious brand new apartment (195 sqm) on the 6th floor of modern residence Terasy Červený Vrch, Prague 6. The apartment comprises 5 bedrooms, 2 bathrooms, additional WC, spacious living room and fully equipped kitchen with dining room. Huge adventage is large terrace (108 sqm) offering wonderful views over Prague. We strongly recommend viewing of this tranquil home orientated to the Šárka valley. Two garage spaces and cellar are included in the rent. 24/7 reception in the building. Very representative living in a quiet location offering excellent city centre connections. The airport and the local international schools are moments away.

Měsíční nájem: / Monthly rent: 60 000 CZK

150

NEJLEPŠÍ NEMOVITOSTI I BEST PROPERTIES I ǂNJǎǏƶǖ DŽƻƺƸƿƽƿǃDžLjljǓ

LEXXUS EXXUS XXUS XUS USS a.s., a.s. a.s .s., s.,., Mill Mille Mil Mi Millenn Millen M Millennium illenn lenni enniu nnium nniu nium ium um m Plaz Pla P Plaza, laza aza, za, a, V Celnici 10, 0, 11 0, 11 110 10 0 00 Praha 1 tel.: +420 420 20 0 221 21 111 11 111 1 922, 922 92 22, 2, www.lexxusnorton.cz, www. www ww www.le ww.lex w.lexx .lexx exxu xxus xusn usno sno nort orto rton ton on.c n.cz e-mail: ailil: ai ail: iilll:: info@lexxusnorton.cz iin inf info nff n


)RFXVHGRQOX[XU\

Terronská, Praha 6 - Bubeneč

pronájem / rent

Výjimečný, zařízený byt nacházející se v 1. patře moderní rezidence Charles de Gaulle na prestižní adrese Prahy 6 Bubenče. Orientace bytu je do klidného vnitrobloku s privátní zahradou a většina místností má přístup na terasu. Byt je klimatizován a skládá se ze 3 ložnic, obývacího pokoje s plně vybaveným kuchyňským koutem, 2 koupelen a extra toalety. K dispozici je také pohodlné parkování pro 2 vozy a sklep, již zahrnuté v ceně nájmu. Příjemné bydlení se snadnou dostupností do centra a mezinárodních škol. Modern 1st floor apartment offered furnished within the Charles de Gaulle Residence one of the most prestigious addresses in Prague 6 - Bubeneč. The apartment is orientated to the peaceful courtyard with private gardens. There are terraces of all main rooms. The apartment is air-conditioned and comprises 3 bedrooms, living room with fully equipped kitchen corner, 2 bathrooms and additional WC. There are 2 parking spaces and cellar included in the price. Fabulous living within easy access to the city centre and international schools.

Měsíční nájem: / Monthly rent: 40 000 CZK LEXXUS EXXUS XXUS XUS USS a.s., a.s. a.s .s., s.,., Millennium Millenn Millen Mille Mill Mil Mi Millenn lenni enniu nnium nniu nium ium um m Plaza, Pla Plaz Plaza aza, za, a, V Celnici 10, 0, 11 0, 11 110 10 0 00 Praha 1 tel.: +420 420 20 0 221 21 111 11 111 1 922, 922 92 22, 2, www.lexxusnorton.cz, www. www ww www.le ww.lex w.lexx .lexx exxu xxus xusn usno sno nort orto rton ton on.c n.cz e-mail: ailil: ai ail: iilll:: info@lexxusnorton.cz iinf in info nff n


ApartmĂĄn Urbant6CZUPWĂ&#x2C6;OĂ&#x201C;BäQSPPTPCt LLt1SBIBtPEFVSOPD "QBSUNĂ&#x2C6;OTLPNQMFUOĂ&#x201C;NTFSWJTFN EWÄŁNBMPäOJDFNJ KFEOPVLPVQFMOPVBTBNPTUBOâN8$WQBUÄżFTWâIMFEFNOB1SBäTLâ)SBE  CVEPWBTWâUBIFN1SPTUPSOâPUFWÄżFOâPCâWBDĂ&#x201C;QPLPKTKĂ&#x201C;EFMOĂ&#x201C;NTUPMFN QMOÄŁWZCBWFOPVLVDIZOĂ&#x201C; EWÄŁNBQSPTUPSOâNJMPäOJDFNJ BWFMLâNJTLMÄŁOÄŁOâNJTUÄŁOBNJBPLOZ/PWPNÄŁTUTLĂ&#x2C6;MPLBMJUBTQBNĂ&#x2C6;ULBNJ PCDIPEZB[Ă&#x2C6;CBWPV7ZCBWFOĂ&#x201C;8J'J TBUFMJUOĂ&#x201C;UFMFWJ[F TQMB[NPWPVPCSB[PWLPV %7%EPNĂ&#x2C6;DĂ&#x201C;LJOP QSBÄĄLBBOPOTUPQIPUMJOFĂ LMJEKFEOPVUâEOÄŁBWâNÄŁOBMPäOĂ&#x201C;IPQSĂ&#x2C6;EMBBSVÄĄOĂ&#x201C;LÄ°WDFOÄŁ Fully serviced two-bedroom, one bathroom apartment with view of the Prague Castle, the 5th ďŹ&#x201A;oor with lift. Large open-plan living and dining area, fully ďŹ tted kitchen, two spacious bedrooms, abundance of windows. New Town area known for sights, shopping and entertainment. Amenities: Wi-Fi Internet, satellite TV with plasma screen, DVD/home theater system, washing machine, 24-hour hotline. Weekly cleaning with change of linen and towels included in the price.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

152

NEJLEPĹ Ă? NEMOVITOSTI I BEST PROPERTIES I Ç&#x201A;Ç&#x160;Ç&#x17D;Ç?ĆśÇ&#x2013; Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;

prague-stay.com


ApartmĂĄn Royal Tower t6CZUPWĂ&#x2C6;OĂ&#x201C;BäQSPPTPCt LLt1SBIBtPEFVSOPD "QBSUNĂ&#x2C6;OTLPNQMFUOĂ&#x201C;NTFSWJTFN EWÄŁMPäOJDFBEWÄŁLPVQFMOZ QBUSPCVEPWZTWâUBIFN1SPTUPSOâPCâWBDĂ&#x201C;QPLPKTWģäĂ&#x201C; WFMLĂ&#x2C6;  QMOÄŁWZCBWFOĂ&#x2C6;LVDIZOÄŁBUFSBTBNJOVUPE4UBSĂ?IP.ÄŁTUB ÄżBEBUSBNWBKPWâDIMJOFLBNFUSPWUÄŁTOĂ?CMĂ&#x201C;[LPTUJ%BMĂ?Ă&#x201C;WZCBWFOĂ&#x201C;8J'J JOUFSOFU TBUFMJUOĂ&#x201C;UFMFWJ[FTQMB[NPWPVPCSB[PWLPV %7%EPNĂ&#x2C6;DĂ&#x201C;LJOP QSBÄĄLB OPOTUPQIPUMJOFĂ LMJEKFEOPVUâEOÄŁ WâNÄŁOBMPäOĂ&#x201C;IP QSĂ&#x2C6;EMBBSVÄĄOĂ&#x201C;LÄ°[BISOVUZWDFOÄŁ Fully serviced two-bedroom, two-bathroom apartment, 5th ďŹ&#x201A;oor with lift. Large living room completed with regal tower, open-plan fully ďŹ tted kitchen, beautiful terrace. 10 minutes from the Old Town district, various tramlines and metro nearby. Amenities: Wi-Fi, satellite TV with plasma screen, DVD/home theater, washer and 24-hour hotline. Weekly cleaning, change of linen and towels included in the price.

Na PerĹĄtĂ˝nÄ&#x203A; 2, 110 00 Praha 1, T:

+420 222 311 084

APARTMĂ NY I APARTMENTS I Ç Ć¸ĆśÇ&#x2021;Ç&#x2030;ĆżÇ&#x2021;ĆśÇ&#x2019;

LISTOPAD 2012 I NOVEMBER 2012 I Ç&#x201E;Ç&#x2026;Ç&#x2013;ơÇ&#x2021;Ç&#x201C; 2012

153


ApartmĂĄn Baroque t6CZUPWĂ&#x2C6;OĂ&#x201C;BäQSPPTPCt LLt1SBIBtPEFVSOPD -PGUPWâBQBSUNĂ&#x2C6;OTFEWÄŁNBMPäOJDFNJBLPNQMFUOĂ&#x201C;NTFSWJTFNWQPELSPWĂ&#x201C;QBUSBTWâUBIFN0UFWÄżFOĂ&#x2C6;LVDIZÄŞ QPEĂ&#x17E;SPWÄŞPWâPCâWBDĂ&#x201C;QPLPK  KĂ&#x201C;EFMOĂ&#x201C;QSPTUPS QPEĂ&#x17E;SPWÄŞPWĂ&#x2C6;IMBWOĂ&#x201C;MPäOJDF MPäOJDFWMPGUPWĂ?NTUZMV LPVQFMOB7DFMĂ?NBQBSUNĂ&#x2C6;OVKFPSJHJOĂ&#x2C6;MOĂ&#x201C;QPEMBIPWĂ?BTUSPQOĂ&#x201C;USĂ&#x2C6;NPWĂ&#x201C; -PLBMJUBOB4UBSĂ?N.ÄŁTUÄŁWPLPMĂ&#x201C;TCBSPLOĂ&#x201C;NJCVEPWBNJ PLPV[MVKĂ&#x201C;DĂ&#x201C;NJSFTUBVSBDFNJBCBSZ7ZCBWFOĂ&#x201C;8J'J TBUFMJUOĂ&#x201C;57TQMB[NPWPV PCSB[PWLPV %7%EPNĂ&#x2C6;DĂ&#x201C;LJOP QSBÄĄLBTFTVĂ?JÄĄLPV OPOTUPQIPUMJOF7DFOÄŁKF[BISOVUĂ&#x17E;LMJEBWâNÄŁOBMPäOĂ&#x201C;IPQSĂ&#x2C6;EMBKFEOPVUâEOÄŁ Fully serviced two-bedroom loft style apartment, 3rd ďŹ&#x201A;oor attic with lift. Open-plan kitchen, sunken living room, dining area, sunken master bedroom, loft style bedroom, one full bathroom. Original ďŹ&#x201A;oor and ceiling beams throughout. Located on Lesser Town Square, known for Baroque buildings, charming restaurants and bars. Amenities: Wi-Fi Internet, satellite TV with plasma screen, DVD/home theater system, washer-dryer, 24-hour hotline. Weekly cleaning with change of linen and towels included in the price.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

154

NEJLEPĹ Ă? NEMOVITOSTI I BEST PROPERTIES I Ç&#x201A;Ç&#x160;Ç&#x17D;Ç?ĆśÇ&#x2013; Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;

prague-stay.com


ApartmĂĄn Enchanting t6CZUPWĂ&#x2C6;OĂ&#x201C;BäQSPPTPCZt LLt1SBIBtPEFVSOPD ,PNQMFUOÄŁTFSWJTPWBOâBQBSUNĂ&#x2C6;OWQPELSPWĂ&#x201C;TKFEOPVMPäOJDĂ&#x201C; QBUSPTWâUBIFN PCâWBDĂ&#x201C;QPLPKTQMOÄŁWZCBWFOâNLVDIZÄŞTLâNLPVUFN  MPäOJDFTPSJHJOĂ&#x2C6;MOĂ&#x201C;NBOäFMTLPVQPTUFMĂ&#x201C; SP[LMĂ&#x2C6;EBDĂ&#x201C;HBVÄĄWPCâWBDĂ&#x201C;NQPLPKJ0CMBTU.BMĂ?4USBOZTQBNĂ&#x2C6;ULBNJ SFTUBVSBDFNJ NV[FJ  [BISBEBNJ USBNWBKPWâNJMJOLBNJ NFUSFNBUE7ZCBWFOĂ&#x201C;8J'J TBUFMJUOĂ&#x201C;UFMFWJ[F %7%EPNĂ&#x2C6;DĂ&#x201C;LJOP QSBÄĄLBTVĂ?JÄĄLBBOPOTUPQIPUMJOF Ă LMJEKFEOPVUâEOÄŁ WâNÄŁOBMPäOĂ&#x201C;IPQSĂ&#x2C6;EMBBSVÄĄOĂ&#x201C;LÄ°[BISOVUBWDFOÄŁ Fully serviced one-bedroom attic apartment, 3rd ďŹ&#x201A;oor with lift, sunken living room, open-plan fully ďŹ tted kitchen, bedroom with a custom built double bed, sofa bed in living room. Lesser Town area with sights, restaurants, museums, gardens, various tramlines, metro and more. Amenities: Wi-Fi, satellite TV with plasma screen, DVD/home theater system, washer/dryer and 24-hour hotline. Weekly cleaning, change of linen and towels included in the price.

Na PerĹĄtĂ˝nÄ&#x203A; 2, 110 00 Praha 1, T:

+420 222 311 084

APARTMĂ NY I APARTMENTS I Ç Ć¸ĆśÇ&#x2021;Ç&#x2030;ĆżÇ&#x2021;ĆśÇ&#x2019;

LISTOPAD 2012 I NOVEMBER 2012 I Ç&#x201E;Ç&#x2026;Ç&#x2013;ơÇ&#x2021;Ç&#x201C; 2012

155


Nebytový prostor | Pronájem | Václavské námìstí | Praha 1 | Nové Mìsto | 322 m2 | FHQDQDY\çiGiQt/ price upon request .DQFHOiĨVNpSURVWRU\PRGHUQtEXGRY\YFHQWUX3UDK\YEH]SURVWĨHGQtEOt]NRVWLVWDQLFHPHWUD0ģVWHN WUDVD$D% .GLVSR]LFLMVRX RGGęOHQpNDQFHOiĨHLRSHQVSDFHSURVWRU\=GYRMHQpSRGODK\PRGHUQtRVYęWOHQtNOLPDWL]DFHUHFHSFHFHORGHQQtRVWUDKD3DUNRYiQt YEOt]NRVWLEXGRY\6HUYLVQtSRSODWN\.ĀP2PęVtF&HQ\MVRXXYHGHQ\EH]'3+ 2IILFHVSDFHLQDPRGHUQEXLOGLQJLQWKHYHU\FHQWUHRI3UDJXH,QVWDQWDFFHVVWRPHWURVWDWLRQ0ģVWHN OLQHV$DQG% DQGDIHZPLQXWHZDONWR 0X]HXPPHWURVWDWLRQ OLQH& &HOOXODUDQGRSHQSODQRIILFHVDYDLODEOH$PHQLWLHVLQFOXGHUDLVHGIORRUVPRGHUQOLJKWLQJDLUFRQGLWLRQLQJUHFHSWLRQ DQGKRXUVHFXULW\([WHUQDOSDUNLQJDYDLODEOH6HUYLFHFKDUJHV&=.P2PRQWK3ULFHVDUHOLVWHGZLWKRXW9$7

156

NEJLEPŠÍ NEMOVITOSTI I BEST PROPERTIES I ǂNJǎǏƶǖ DŽƻƺƸƿƽƿǃDžLjljǓ


NebytovĂ˝ prostor | PronĂĄjem | PellĂŠova | Praha 6 | Bubeneè | 539 m2 | 390 CZK / m2 / mĂŹsĂ­c NovĂŹ zrekonstruovanĂĄ reprezentativnĂ­ vila z poèåtku 20. stoletĂ­ situovanĂĄ v exkluzivnĂ­ lokalitĂŹ v Praze 6 Bubenèi, v sousedstvĂ­ èetnĂ˝ch ]DKUDQLÄ&#x20AC;QtFKDPEDViGYSÄ&#x2122;ĂĽtPGRVDKXVWDQLFHPHWUD+UDGÄ&#x20AC;DQVNi9REMHNWXVHYHGYRXSRGODçtFKDSRGNURYtQDFKi]tFHONHP 15 mĂ­stnostĂ­. Dominantou interiĂŠru je pĂšvodnĂ­ masivnĂ­ døevĂŹnĂŠ schodiĹĄtĂŹ, nĂŹkolik mĂ­stnostĂ­ bylo zrestaurovĂĄno do pĂšvodnĂ­ho stavu. 9LOXO]HQHMOpSHY\XçtWSURSRWĨHE\DPEDViGQHERMDNRUHSUH]HQWDWLYQtVtGORILUP\&HQ\MVRXXYHGHQ\EH]'3+ 1HZO\UHQRYDWHGYLOODIURPWKHEHJLQQLQJRIWKHthFHQWXU\VLWXDWHGLQWKHSUHVWLJLRXV3UDJXHORFDWLRQRI%XEHQHÄ&#x20AC;LQWKHDUHDRIIRUHLJQ HPEDVVLHVZLWKLQZDONLQJGLVWDQFHRI+UDGÄ&#x20AC;DQVNiPHWURVWDWLRQ OLQH$ 7KHSUHPLVHVLQFOXGHWKHWRWDORIURRPVRQWZRIORRUVSOXVWKHDWWLF IORRU'RPLQDQWRULJLQDOVROLGZRRGVWDLUZD\VHYHUDOURRPVUHVWRUHGWRWKHLURULJLQDOVWDWH6XLWDEOHIRUHPEDVV\SXUSRVHVRUDVDEXVLQHVVVHDW 3ULFHVDUHOLVWHGZLWKRXW9$7

Na PerťtýnÏ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

KOMERáNĂ? NEMOVITOSTI I COMMERCIAL PROPERTIES I Ç Ç&#x2026;Ç&#x192;Ç&#x192;ĆťÇ&#x2021;Ç&#x17D;ĆťÇ&#x2C6;Ç ĆśÇ&#x2013; Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;

LISTOPAD 2012 I NOVEMBER 2012 I Ç&#x201E;Ç&#x2026;Ç&#x2013;ơÇ&#x2021;Ç&#x201C; 2012

157


NebytovĂ˝ prostor | PronĂĄjem | Antala StaĹĄka | Praha 4 | Krè | 150 â&#x20AC;&#x201C; 732 m2 | 340 CZK / m2 / mĂŹsĂ­c ModernĂ­ kancelåøe administrativnĂ­ budovy v dynamicky rozvĂ­jejĂ­cĂ­ se lokalitĂŹ s dobøe zavedenou infrastrukturou. NachĂĄzĂ­ se nedaleko VWDQLFHPHWUD%XGÄ&#x2122;MRYLFNi OLQND& 3UDçVNpKRRNUXKXLGiOQLFH'.DQFHOiĨHMVRXYQHMY\ĂĽĂĽtPPH]LQiURGQtPVWDQGDUGXMDNSR GHVLJQRYpWDNWHFKQLFNpVWUiQFH3URVWRUVRWHYĨHQRXGLVSR]LFtEXGHGRNRQÄ&#x20AC;HQGOHNRQNUpWQtFKSRçDGDYNÄŁQiMHPFH8SURVWĨHGEXGRY\MH NGLVSR]LFLQH]DVWĨHĂĽHQpDWULXPDMtGHOQD6HUYLVQtSRSODWN\.Ä&#x20AC;P2PÄ&#x2122;VtF8YHGHQpFHQ\MVRXEH]'3+ Modern office space of administrative building located in a highly dynamic location with well-developed infrastructure. It is easily accessible from WKH3UDJXH5LQJ5RDGDQG+LJKZD\'%XGÄ&#x2122;MRYLFNiPHWURVWDWLRQ OLQH& LVZLWKLQZDONLQJGLVWDQFH2IILFHVDUHDWWKHKLJKHVWLQWHUQDWLRQDO standard, both in design and technical side. Complex has an uncovered atrium in the middle of the building. There are also dining facilities on the ground floor. Service charges CZK 110/m2/month. Prices are listed without VAT.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

158

NEJLEPĹ Ă? NEMOVITOSTI I BEST PROPERTIES I Ç&#x201A;Ç&#x160;Ç&#x17D;Ç?ĆśÇ&#x2013; Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;

svoboda-williams.com


Nebytovรฝ prostor | Pronรกjem | Hanusova | Praha 4 | Michle | 355 โ€“ 1 871 m2 | 13, 50 EUR / m2 / mรฌsรญc Kancelรกรธskรฉ prostory v atraktivnรญ lokalitรฌ, v dochรกzkovรฉ vzdรกlenosti od metra Budรฌjovickรก, s perfektnรญ dostupnostรญ z dรกlnice D1. Objekt je UHDOL]RYiQMDNRSRGODรงQtEXGRYDVPRGHUQtPYรฌWDKHPฤ€iVWHฤ€Qฤ™XVWXSXMtFtPSฤจt]HPtPDVSRGNURYtPMHGQtPKODYQtPDGYฤ™PDERฤ€QtPL YFKRG\6RXฤ€iVWtSฤจt]HPtMHSURVNOHQpDWULXPNWHUpMHYKRGQpSURUHSUH]HQWDWLYQtPHHWLQJURRPQHERVKRZURRP9\VRFHNYDOLWQt VHUYURYQDYKRGQpSUR,7QHERMLQpVSROHฤ€QRVWLPDMtFtQiURฤ€QpWHFKQLFNpSRรงDGDYN\1iMHPFHQHSODWtSURYL]L 2IILFHVSDFHLQDWUDFWLYHDUHDZLWKLQZDONLQJGLVWDQFHIURPPHWUR%XGฤ™MRYLFNiZLWKH[FHOOHQWDFFHVVWRWKHKLJKZD\'VWRU\EXLOGLQJZLWK PRGHUQOLIWSDUWLDOO\UHFHVVHGJURXQGIORRUDQGDWWLFRQHPDLQDQGWZRVLGHHQWUDQFHV3DUWRIWKHJURXQGIORRULVJOD]HGLQWHUQDODWULXPVXLWDEOH IRUPHHWLQJURRPRUVKRZURRP+LJKTXDOLW\VHUYHUURRPVXLWDEOHIRU,7RUDQ\RWKHUFRPSDQ\GHPDQGLQJH[WUDWHFKQLFDOUHTXLUHPHQWV Lessee pays no commission.

Na Perลกtรฝnรฌ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

KOMERรทNร NEMOVITOSTI I COMMERCIAL PROPERTIES I วว…วƒวƒฦปว‡วŽฦปวˆวฦถว– ว„ฦปฦบฦธฦฟฦฝฦฟวƒว…วˆว‰ว“

LISTOPAD 2012 I NOVEMBER 2012 I ว„ว…ว–ฦทว‡ว“ 2012

159


Nebytový prostor | Pronájem | Štìtkova | Praha 4 | Nusle | 271 m2 | 16,70 EUR / m2 / mìsíc .DQFHOiĨVNpSURVWRU\YSDWĨHPRGHUQtKRSURMHNWXQDUR]KUDQtSUDçVNpKRFHQWUDDMHGQp]QHMY\KOHGiYDQęMåtFKREFKRGQtFKORNDOLWYSęåt GRVWXSQRVWLVWDQLFHPHWUD9\åHKUDG WUDVD& VYìERUQìPQDSRMHQtQDVLOQLĀQtDGiOQLĀQtVtĢ%XGRYDMH]GiON\GREĨHYLGLWHOQiDYåHFKQ\ WHUDV\PDMtNUiVQìYìKOHGQD3UDKX.GLVSR]LFLMVRXSRG]HPQtJDUiçHDYHQNRYQtSDUNRYiQt3URMHNWVSOĞXMHYHåNHUpPH]LQiURGQt VWDQGDUG\1iMHPFHQHSODWtSURYL]L 2IILFHVSDFHRQWKHthIORRULQQHZRIILFHSURMHFWORFDWHGLQWKHEXVLQHVVGLVWULFW([FHOOHQWDQGHDV\DFFHVVE\SXEOLFWUDQVSRUWDQGE\FDU $GMDFHQWWR9\åHKUDG0HWURVWDWLRQ OLQH& *UHDWYLVLELOLW\RIWKHSURMHFWODUJHWHUUDFHVLWPHHWVDOOFXUUHQWLQWHUQDWLRQDOVWDQGDUGV 8QGHUJURXQGJDUDJHDQGRXWVLGHSDUNLQJ2IILFHVDUHDWWKHKLJKHVWLQWHUQDWLRQDOVWDQGDUG3URMHFWPHHWVLQWHUQDWLRQDOTXDOLW\VWDQGDUGV /HVVHHSD\VQRFRPPLVVLRQ

160

NEJLEPŠÍ NEMOVITOSTI I BEST PROPERTIES I ǂNJǎǏƶǖ DŽƻƺƸƿƽƿǃDžLjljǓ


AdministrativnĂ­ budova | Prodej | RubeĹĄova | Praha 2 | Vinohrady | 3 498 m2 |FHQDQDY\çiGiQt/ price upon request $OOLDQFH&HQWUH, ,,MVRXWĨLSURSRMHQpEXGRYX]VWROHWtNWHUpSURĂĽO\UR]ViKORXUHNRQVWUXNFtYURFHDRGWpGRE\SURFKi]HMt SUDYLGHOQRX~GUçERX3ĨHGVWDYXMt]DMtPDYRXLQYHVWLÄ&#x20AC;QtSĨtOHçLWRVWYFHQWUXPÄ&#x2122;VWD]GÄŁYRGXY\VRNpPtU\REVD]HQRVWLNDQFHOiĨVNĂŹFKSURVWRU DOXNUDWLYQtSRORKRXYSĨtPpEOt]NRVWLGYRXNOtÄ&#x20AC;RYĂŹFKVWDQLFPHWUD%XGRY\GLVSRQXMtSRG]HPQtPSDUNRYLĂĽWÄ&#x2122;PDVSUiYFRYVNRXVOXçERX Alliance Centre I&II occupies three interconnected 19thFHQWXU\EXLOGLQJVZKLFKXQGHUZHQWH[WHQVLYHUHIXUELVKPHQWLQWKHs and have continued to be refurbished on a regular basis. The property represents an excellent commercial investment opportunity in the city center with prospects for good rental growth providing a stable source of income. Key investment features include a high rate of tenant occupancy, superb inner city location with 2 metro stations, underground parking, on-site asset/property management.

Na PerťtýnÏ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

KOMERáNĂ? NEMOVITOSTI I COMMERCIAL PROPERTIES I Ç Ç&#x2026;Ç&#x192;Ç&#x192;ĆťÇ&#x2021;Ç&#x17D;ĆťÇ&#x2C6;Ç ĆśÇ&#x2013; Ç&#x201E;ƝƺƸƿƽƿÇ&#x192;Ç&#x2026;Ç&#x2C6;Ç&#x2030;Ç&#x201C;

LISTOPAD 2012 I NOVEMBER 2012 I Ç&#x201E;Ç&#x2026;Ç&#x2013;ơÇ&#x2021;Ç&#x201C; 2012

161


SPORTALM Podzim–Zima 2012/13 www.fggroup.cz


Duplexy Oasis Golf v Orihuela Costa na pobŐeží Costa Blanca – ŠpanĚlsko Oasis Golf Duplexes in Orihuela Costa on the Costa Blanca – Spain ǐǿǻǷDZǶǽȇ Oasis Golf Ǯ ǚǼǴǿȉǷǬ ǖǺǽǾǬ (Orihuela Costa) ǹǬ ǻǺǭDZǼDZDzȈDZ ǖǺǽǾǬ ǍǷǬǹǶǬ – ǔǽǻǬǹǴȋ

Cena apartmánů: od 139 000 Euro Nabízíme nové, nádherné duplexy cca 40 km jižnĚ od mezinárodního letištĚ v Alicante, v tĚsné blízkosti nĚkolika golfových hŐišŘ a krásných pláží. Duplexy mají 2–3 ložnice, obývací pokoj, 2 koupelny a stŐešní solárium. Užitná plocha ÿiní 97 m2, terasa 14 m2. V urbanizaci s tropickou zahradou je velký komunální bazén. Záruka na 10 let. We offer these beautiful, new duplexes situated approximately 40km south of Alicante International Airport, in close proximity to several golf courses and amazing beaches. Each duplex consists of 2–3 bedrooms, a living room, 2 bathrooms and a roof-top solarium. The usable area is 97 m², with a terrace of 14 m². There is a large communal swimming pool in the tropical garden within the complex. The duplexes have a 10 year guarantee. ǛǼDZǰǷǬǯǬDZǸ ǹǺǮȇDZ, ǶǼǬǽǴǮȇDZ ǰǿǻǷDZǶǽȇ ǻǼǴǸDZǼǹǺ Ǯ 40 ǶǸ Ƕ Ȋǯǿ ǺǾ ǸDZDzǰǿǹǬǼǺǰǹǺǯǺ ǬȉǼǺǻǺǼǾǬ Ǯ njǷǴǶǬǹǾDZ, Ǯ ǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵ ǭǷǴdzǺǽǾǴ ǺǾ ǹDZǽǶǺǷȈǶǴȁ ǻǺǷDZǵ ǰǷȋ ǯǺǷȈȀǬ Ǵ ǻǼDZǶǼǬǽǹȇǸǴ ǻǷȋDzǬǸǴ. ǎ ǰǿǻǷDZǶǽǬȁ 2-3 ǽǻǬǷȈǹǴ, ǯǺǽǾǴǹǬȋ, 2 ǮǬǹǹȇDZ ǶǺǸǹǬǾȇ Ǵ ǽǺǷȋǼǴǵ ǹǬ ǶǼȇȄDZ. ǛǺǷDZdzǹǬȋ ǻǷǺȅǬǰȈ ǽǺǽǾǬǮǷȋDZǾ 97 Ǹ2, ǾDZǼǼǬǽǬ 14 Ǹ2. ǎ ǶǺǸǻǷDZǶǽDZ ǽ ǾǼǺǻǴȃDZǽǶǴǸ ǽǬǰǺǸ ǹǬȁǺǰǴǾǽȋ ǭǺǷȈȄǺǵ ǺǭȅDZǽǾǮDZǹǹȇǵ ǭǬǽǽDZǵǹ. ǏǬǼǬǹǾǴȋ 10 ǷDZǾ.

BRANCO REALITY Zengrova 911, 280 02, Kolín, tel.: +420 321 719 097, + 420 321 719 100, mobil: +420 737 202 802, e-mail: info.brancoreality@seznam.cz, www.brancoreality.com


L ‚Argentina Podzim–Zima 2012/13 www.fggroup.cz


4. VELETRH DÁRKŮ

prodejní akce s puncem kvality originální zboží pro všechny inspirativní dárky ze všech oborů prezentace českých výrobců a dovozců

50% SLEVA NA VSTUPNÉ U pokladny vyměňte inzerát za zlevněnou vstupenku.

www.vanocnidny.cz

6. – 9. 12. 2012


LIFESTYLE

|

prague out

168

Novinky / News / ȕȖȊȖșȚȐ

174

ESTATE doporuþuje: Inteligentní systém ovládání i pro váš domov s KD Elektronika ESTATE Recommends: ǰȕȚȍȓȓȍȒȚțȈȓȤȕȈȧ șȐșȚȍȔȈ țȗȘȈȊȓȍȕȐȧ Ȑ Ȍȓȧ ǪȈȠȍȋȖ ȌȖȔȈ ș KD Elektronika

ESTATE doporuþuje: Bravos / souþasný španČlský design

180

ESTATE Recommends: Bravos / Contemporary Spanish Design ESTATE ȘȍȒȖȔȍȕȌȖȊȈȕȕȣȑ: Bravos / șȖȊȘȍȔȍȕȕȣȑ ȐșȗȈȕșȒȐȑ ȌȐȏȈȑȕ

182

ESTATE Tipy / ESTATE Tips / ESTATE


PRAGUE OUT |

novinky | news | ǹǺǮǺǽǾǴ

SPOLEþNOST ZLAŗAKY.CZ VÁM NABÍZÍ NEJLEPŠÍ CENY INVESTIþNÍHO ZLATA A STŏÍBRA V þESKÉ REPUBLICE A TAKÉ NEJŠIRŠÍ NABÍDKU MINCÍ Z CELÉHO SVęTA! Prodáváme investiÿní slitky od renomovaných raÀnerií Argor Heraeus, P.A.M.P., Munze Osterreich ÿi Perth Mint. Z palety investiÿních zlatých a stŐíbrných mincí si lze vybrat všechny certiÀkované mince dle seznamu nejlikvidnĚjších znaÿek asociace LBMA na Londýnské burze. Dále je možné zakoupit ÿeské pamĚtní zlaté a stŐíbrné mince od þeské národní banky ÿi zahraniÿní mince emitované prestižními svĚtovými mincovnami. ZLAŗAKY.CZ COMPANY OFFERS YOU THE BEST PRICES IN INVESTMENT GOLD AND SILVER IN THE CZECH REPUBLIC AND ALSO THE WIDEST SELECTION OF INTERNATIONAL COINS! We sell investment ingots by the renowned reÀneries of Argor Heraeus, P.A.M.P., Munze Osterreich and Perth Mint. From the palette of investment gold and silver coins, it is possible to choose all the certiÀed coins according to the list of the most liquid brands of the LBMA association on the London Stock Exchange. It is also possible to purchase the Czech commemorative gold and silver coins by the Czech National Bank, as well as foreign coins issued by prestigious world mints. ǖǚǘǛnjǙǔǫ ZLAŗAKY.CZ (ǓǚǗǚǞǧǡ ǐǑǗ ǘnjǝǞǑǜnj) ǛǜǑǐǗnjǏnjǑǞ ǎnjǘ ǗǟǣǤǟǪ ǝǞǚǔǘǚǝǞǨ ǔǙǎǑǝǞǔǢǔǚǙǙǚǏǚ ǓǚǗǚǞnj ǔ ǝǑǜǑǍǜnj ǎ ǣǑǤǝǖǚǕ ǜǑǝǛǟǍǗǔǖǑ, nj ǞnjǖǒǑ ǤǔǜǚǖǔǕ njǝǝǚǜǞǔǘǑǙǞ ǘǚǙǑǞ ǔǓ ǜnjǓǙǧǡ ǝǞǜnjǙ ǘǔǜnj! ǛǼǺǰǬDzǬ ǴǹǮDZǽǾǴȂǴǺǹǹȇȁ ǽǷǴǾǶǺǮ ǺǾ dzǹǬǸDZǹǴǾȇȁ ǻDZǼDZǼǬǭǺǾȃǴǶǺǮ Argor Heraeus, P.A.M.P., Munze Osterreich ǴǷǴ Perth Mint. ǔdz ǬǽǽǺǼǾǴǸDZǹǾǬ ǴǹǮDZǽǾǴȂǴǺǹǹȇȁ dzǺǷǺǾȇȁ Ǵ ǽDZǼDZǭǼȋǹȇȁ ǸǺǹDZǾ, ǎȇ ǸǺDzDZǾDZ ǮȇǭǼǬǾȈ ǮǽDZ ǽDZǼǾǴȀǴȂǴǼǺǮǬǹǹȇDZ ǸǺǹDZǾȇ Ǯ ǽǺǺǾǮDZǾǽǾǮǴǴ ǽ ǻDZǼDZȃǹDZǸ ǹǬǴǭǺǷDZDZ ǷǴǶǮǴǰǹȇȁ ǸǬǼǺǶ njǽǽǺȂǴǬȂǴǴ LBMA ǹǬ ǗǺǹǰǺǹǽǶǺǵ ȀǺǹǰǺǮǺǵ ǭǴǼDzDZ. ǞǬǶDzDZ dzǰDZǽȈ ǸǺDzǹǺ ǶǿǻǴǾȈ ǣDZȄǽǶǴDZ ǻǬǸȋǾǹȇDZ dzǺǷǺǾȇDZ Ǵ ǽDZǼDZǭǼȋǹȇDZ ǸǺǹDZǾȇ ǺǾ ǣDZȄǽǶǺǯǺ ǹǬȂǴǺǹǬǷȈǹǺǯǺ ǭǬǹǶǬ ǴǷǴ ǸǺǹDZǾȇ ǴǹǺǽǾǼǬǹǹǺǯǺ ǻǼǺǴǽȁǺDzǰDZǹǴȋ, ǮȇǻǿȅDZǹǹȇDZ ǴdzǮDZǽǾǹȇǸǴ ǸǺǹDZǾǹȇǸǴ ǰǮǺǼǬǸǴ ǸǴǼǬ.

Obchodní centrum Sykora, þeskomoravská 183/27, Praha 9 NámĚstí Zelný trh, Zelný trh 21, Brno zlataky.cz

MOLESKINE® Italské exkluzivní zápisníky a diáŐe znaÿky Moleskine® jsou dĚdici legendárního zápisníku, který používali umĚlci a myslitelé v prŢbĚhu minulých dvou století, mezi jinými i Picasso, Hemingway nebo Van Gogh. Typickým produktem znaÿky je jednoduchý obdélníkový zápisník kapesního formátu v ÿerné barvĚ se zaoblenými rohy a gumiÿkou pŐes obálku. Vedle zápisníkŢ a diáŐŢ v rŢzných barvách a velikostech však znaÿka dodává na trh novĚ i své designové psací, cestovatelské a ÿtenáŐské potŐeby. Italian exclusive notebooks and diaries by Moleskine® are the descendants of the legendary notebook which was used by artists and philosophers throughout the past two centuries, among others Picasso, Hemingway and Van Gogh. The typical product by this brand is a simple rectangular pocket-sized notebook in black, with rounded corners and a rubber band over the cover. Besides notebooks and diaries in various colours and sizes, the brand lately also supplies the market with designer accessories for reading, writing and travel. ǴǾǬǷȈȋǹǽǶǴDZ ȉǶǽǶǷȊdzǴǮǹȇDZ ǭǷǺǶǹǺǾȇ Ǵ DZDzDZǰǹDZǮǹǴǶǴ Moleskine® – ǹǬǽǷDZǰǹǴǶǴ ǷDZǯDZǹǰǬǼǹǺǵ dzǬǻǴǽǹǺǵ ǶǹǴDzǶǴ, ǶǺǾǺǼǺǵ ǻǺǷȈdzǺǮǬǷǴǽȈ ǸǹǺǯǴDZ ȁǿǰǺDzǹǴǶǴ Ǵ ǸȇǽǷǴǾDZǷǴ ǹǬ ǻǼǺǾȋDzDZǹǴǴ ǻǺǽǷDZǰǹǴȁ ǰǮǿȁ ǽǾǺǷDZǾǴǵ, Ǯ Ǵȁ ȃǴǽǷDZ ǾǬǶDzDZ ǛǴǶǬǽǽǺ, ǡDZǸǴǹǯǿȉǵ Ǵ ǎǬǹ ǏǺǯ. ǞǴǻǴȃǹȇǸ ǻǼDZǰǽǾǬǮǴǾDZǷDZǸ ǸǬǼǶǴ ȋǮǷȋDZǾǽȋ ǻǼǺǽǾǺǵ ǻǼȋǸǺǿǯǺǷȈǹǺǵ ǭǷǺǶǹǺǾ ǶǬǼǸǬǹǹǺǯǺ ȀǺǼǸǬǾǬ ȃDZǼǹǺǯǺ ȂǮDZǾǬ ǽ dzǬǶǼǿǯǷDZǹǹȇǸǴ ǿǯǷǬǸǴ Ǵ ǼDZdzǴǹǶǺǵ ǹǬ ǺǭǷǺDzǶDZ. ǛǺǸǴǸǺ ǭǷǺǶǹǺǾǺǮ, dzǬǻǴǽǹȇȁ ǶǹǴDzDZǶ Ǵ DZDzDZǰǹDZǮǹǴǶǺǮ ǼǬdzǷǴȃǹȇȁ ȂǮDZǾǺǮ Ǵ ǼǬdzǸDZǼǺǮ, ǸǬǼǶǬ ǻǺǽǾǬǮǷȋDZǾ ǹǬ ǼȇǹǺǶ ǶǬǶ ǹǺǮȇDZ, ǾǬǶ Ǵ ǽǺǭǽǾǮDZǹǹȇDZ ǰǴdzǬǵǹDZǼǽǶǴDZ ǻǼǴǹǬǰǷDZDzǹǺǽǾǴ ǰǷȋ ǻǴǽȈǸǬ, ǻǿǾDZȄDZǽǾǮǴǵ Ǵ ǻǼDZǰǸDZǾȇ ǰǷȋ ǷȊǭǴǾDZǷDZǵ ȃǾDZǹǴȋ. Moleskine, BĚlehradská 70, Praha 2 www.moleskine.cz

168


Váš pa artner pro zdraví a krásu

OBJEVTE KOUZLO SEBEVĚDOMÍ INVESTUJTE DO SVÉ KRÁSY!

prim. MUDr. Vlastimil Víšek, CSc.

prof. MUDr. Markéta Dušková, CSc.

MUDr. Miroslav Krejča, PhD.

doc. MUDr. Miroslav Tvrdek, CSc.

VYBERTE SI SVÉHO ŠPIČKOVÉHO PLASTICKÉHO CHIRURGA A VYUŽIJTE BEZPLATNÉ KONZULTACE DO 30. 11. 2012. Klinika GHC Praha, Krakovská 8/581, 110 00 Praha 1 Tel.: +420 222 211 206 (208), E-mail: ghc@ghc.cz

www.ghc.cz


PRAGUE OUT |

novinky | news | ǹǺǮǺǽǾǴ

NÃO DO BRASIL

NÃO DO BRASIL

Obuv NÃO, zrozená ze setkání mezi Francouzem s vášní pro nová dobrodružství a brazilským Őemeslníkem se skuteÿným know-how, po tŐech letech koneÿnĚ dospĚla. PŐestože na webových stránkách mŢžete najít informace o mnoha našich produktech, rádi bychom vás pozvali do nĚkterého z našich nových obchodŢ NÃO, kde si mŢžete osobnĚ prohlédnout kompletní Őadu obuvi. Jsme si jisti, že, stejnĚ jako desetitisíce návštĚvníkŢ pŐed vámi, budete uneseni podívanou a živostí barev i prostŐedím a atmosférou, která vyzaŐuje ze všech našich bot. Pokaždé, když si koupíte pár bot NÃO, pomáháte tím zlepšit vyhlídky a situaci znevýhodnĚných BrazilcŢ žijících v chudých ÿtvrtích. Protože jsou naše boty vyrábĚny z recyklovaných nebo znovu zpracovaných materiálŢ, pomáháte zároveŁ i životnímu prostŐedí. Jednoduše doufáme, že se s vámi podĚlíme o trochu štĚstí, radosti a barev, které spoleÿnĚ dĚlají naši znaÿku, NÃO do BRASIL, tím, ÿím je…

Born out of an encounter with a Frenchman with passion for new adventures and a Brazilian craftsman with real know-how, the NÃO shoe, after 3 years in development has Ànally matured. Although this website is designed to allow you to peruse our many products, we would also like to invite you to visit one of our NÃO Stores where the complete range of shoes can be seen in person. Like tens of thousands of visitors before you, we are conÀdent you’ll be blown away by the spectacle, and vibrancy of colour along with an atmosphere and ambience that emanates from each of our shoes. Every time you purchase a pair of NÃO shoes, you are helping to contribute to the prospects and well being of a disadvantaged Brazilians living in poor neighborhoods. As our shoes are made from recycled or recovered materials you are also helping the environment too. We simply hope to share with you a bit of the happiness, joy and colour that all contribute, to make what is our brand; NÃO do BRASIL…

NÃO DO BRASIL ǚǭǿǮȈ NÃO, ǼǺǰǴǮȄǬȋǽȋ ǺǾ ǮǽǾǼDZȃǴ ȀǼǬǹȂǿdzǬ ǽǺ ǽǾǼǬǽǾȈȊ Ƕ ǹǺǮȇǸ ǻǼǴǶǷȊȃDZǹǴȋǸ Ǵ ǭǼǬdzǴǷȈǽǶǺǯǺ ǼDZǸDZǽǷDZǹǹǴǶǬ ǽ ǹǬǽǾǺȋȅǴǸ ǹǺǿ-ȁǬǿ, ǽǻǿǽǾȋ ǾǼǴ ǯǺǰǬ ǽǮǺDZǯǺ ǽǿȅDZǽǾǮǺǮǬǹǴȋ, ǹǬǶǺǹDZȂ, ǮȇǼǺǽǷǬ! ǙDZǽǸǺǾǼȋ ǹǬ ǾǺ, ȃǾǺ ǹǬ ǹǬȄDZǸ ǽǬǵǾDZ Ǯȇ ǸǺDzDZǾDZ ǹǬǵǾǴ ǴǹȀǺǼǸǬȂǴȊ Ǻ ǸǹǺǯǴȁ ǹǬȄǴȁ ǴdzǰDZǷǴȋȁ, Ǹȇ ȁǺǾDZǷǴ ǭȇ ǻǼǴǯǷǬǽǴǾȈ ǎǬǽ Ǯ ǺǰǴǹ Ǵdz ǹǬȄǴȁ ǹǺǮȇȁ ǸǬǯǬdzǴǹǺǮ NÃO, ǯǰDZ Ǯȇ ǷǴȃǹǺ ǸǺDzDZǾDZ ǿǮǴǰDZǾȈ ǻǺǷǹȇǵ ǬǽǽǺǼǾǴǸDZǹǾ ǻǼDZǰǷǬǯǬDZǸǺǵ ǺǭǿǮǴ. ǘȇ ǿǮDZǼDZǹȇ, ȃǾǺ, ǶǬǶ Ǵ ǰDZǽȋǾǶǴ Ǿȇǽȋȃ ǻǺǽDZǾǴǾDZǷDZǵ ǻDZǼDZǰ ǮǬǸǴ, Ǯȇ ǭǿǰDZǾDZ ǮǻDZȃǬǾǷDZǹȇ dzǼDZǷǴȅǹǺǽǾȈȊ Ǵ ȋǼǶǺǽǾȈȊ ȂǮDZǾǺǮ, Ǭ ǾǬǶDzDZ ǴǹǾDZǼȈDZǼǺǸ Ǵ ǬǾǸǺǽȀDZǼǺǵ Ǯ ǹǬȄǴȁ ǸǬǯǬdzǴǹǬȁ, ǶǺǾǺǼǬȋ ȋǮǷȋDZǾǽȋ ǴǽǾǴǹǹȇǸ ǺǾǼǬDzDZǹǴDZǸ ǶǺǹȂDZǻȂǴǴ ǹǬȄDZǵ ǺǭǿǮǴ. ǖǬDzǰȇǵ ǼǬdz, ǶǺǯǰǬ Ǯȇ ǻǺǶǿǻǬDZǾDZ ǻǬǼǿ ǺǭǿǮǴ NÃO, Ǯȇ ǾDZǸ ǽǬǸȇǸ ǻǺǸǺǯǬDZǾDZ ǿǷǿȃȄǴǾȈ

170

ǽǴǾǿǬȂǴȊ Ǵ ǻDZǼǽǻDZǶǾǴǮȇ ǺǭDZdzǰǺǷDZǹǹȇȁ ǭǼǬdzǴǷȈȂDZǮ, DzǴǮǿȅǴȁ Ǯ ǭDZǰǹȇȁ ǶǮǬǼǾǬǷǬȁ. nj ǻǺǾǺǸǿ ǶǬǶ ǹǬȄǴ ǶǼǺǽǽǺǮǶǴ ǽǰDZǷǬǹȇ Ǵdz ǻDZǼDZǼǬǭǺǾǬǹǹǺǯǺ ǴǷǴ ǻǺǮǾǺǼǹǺ ǴǽǻǺǷȈdzǿDZǸǺǯǺ ǸǬǾDZǼǴǬǷǬ, ȉǾǺ ǻǺǸǺǯǬDZǾ ǽǺȁǼǬǹȋǾȈ ȉǶǺǷǺǯǴȊ ǺǶǼǿDzǬȊȅDZǵ ǽǼDZǰȇ. ǔ Ǹȇ ǹǬǰDZDZǸǽȋ, ȃǾǺ ǽ ǻǺǸǺȅȈȊ ǹǬȄǴȁ ǴdzǰDZǷǴǵ Ǹȇ ǻǺǰDZǷǴǸǽȋ ǽ ǎǬǸǴ ǶǿǽǺȃǶǺǸ ǽȃǬǽǾȈȋ, ǼǬǰǺǽǾǴ Ǵ ȂǮDZǾǬ, ǶǺǾǺǼȇDZ ǮǸDZǽǾDZ ǰDZǷǬȊǾ ǹǬȄǿ ǸǬǼǶǿ NÃO do BRASIL ǾDZǸ, ȃDZǸ ǺǹǬ ȋǮǷȋDZǾǽȋ… Zlatnická 12/1130, Praha 1, www.naodobrasil.com


PRAGUE OUT |

novinky | news | ǹǺǮǺǽǾǴ

SOS OCHRAŀTE PLEŗ PŏED MRAZEM!

PROBUĎTE KRÁSNOU PLEŗ ZE ZIMNÍHO SPÁNKU

UNIKÁTNÍ KOLAGENOVÉ SÉRUM S VÝTAŽKEM Z MOŏSKÝCH BAKTERIÍ PŏINÁŠÍ OCHRANU PLETI ZKOUŠENÉ NEPŏÍZNIVÝMI VLIVY ZIMNÍHO POþASÍ. • PŐináší dlouhodobou hydrataci pleti • Vyhlazuje hluboké vrásky • ZpevŁuje kontury obliÿeje a dodává pleti hebký pocit • Pomáhá udržovat kvalitu a množství kolagenu v pokožce • Aktivuje proces obnovy kolagenních vláken • Omlazuje a osvĚžuje unavené ÿi poškozené ÿásti pleti. • Redukuje vrásky kolem oÿí

Suchý studený vzduch, vítr, poletující prach a smog – jen pár pŐíkladŢ krutých nástrah zimní pŐírody, se kterými se musí naše pleŘ vypoŐádat. V zimĚ proto pokožka snadno vysychá a ochranná vrstva proti volným radikálŢm se snižuje. Pokud hledáte kvalitní pomoc, zapomeŁte na oleje a krémy, které natropí více škody než užitku, neboŘ nenechají pleŘ volnĚ dýchat. Kosmetika Dr. Entner vyvinula jedineÿné Kolagenové sérum, ve kterém se snoubí regeneraÿní úÿinek squalenu s mimoŐádnĚ hojivým a hydrataÿním efektem výtažku z moŐských bakterií pseudomonas anctartica. TajuplnĚ znĚjící ingredience z hlubin moŐí je ve svĚtĚ špiÿkové kosmetiky ve skuteÿnosti již dobŐe známá. Laboratorní studie totiž prokázaly, že pseudomonas anctartica zvyšuje tvorbu kolagenu v kŢži o desítky procent. Protože kolagen zodpovídá za pružnost a pevnost pokožky, není divu, že podle zkušeností uživatelek séra s vysokým obsahem pseudomonas redukují vrásky kolem oÿí o 50 až 60 %.

AWAKE YOUR BEAUTIFUL COMPLEXION FROM ITS WINTER SLEEP Dry cold air, wind, Áying dust and smog – a few examples of the cruel plots of winter nature which our complexion has to cope with. That is why in winter our skin easily dries out and the protective layer against free radicals decreases. If you seek quality help, forget about oils and ointments that do more harm than good because they do not let your skin breathe freely. Laboratory Dr. Entner cosmetics has developed a unique Collagen Serum that combines the regenerative action of squalene with the extremely healing and moisturising effects of the extract of sea bacteria called pseudomonas antarctica. This mysteriously sounding ingredient from the depths of the ocean is well-known in the world of top cosmetics. Laboratory studies have proved that pseudomonas antarctica increases the production of the collagen in skin by a large percentage. Because collagen is responsible for the elasticity and Àrmness of the skin, it is not surprising that, according to our users’ experience, this serum with a high content of pseudomonas reduces wrinkles around the eyes by 50 to 60%.

ǛǟǝǞǨ ǎnjǤnj ǖǜnjǝǔǎnjǫ ǖǚǒnj ǛǜǚǍǟǐǔǞǝǫ ǚǞ ǓǔǘǙǑǏǚ ǝǙnj ǝǿȁǺǵ ȁǺǷǺǰǹȇǵ ǮǺdzǰǿȁ, ǮDZǾDZǼ, ǷDZǾǬȊȅǬȋ ǻȇǷȈ Ǵ ǽǸǺǯ – ȉǾǺ ǮǽDZǯǺ ǷǴȄȈ ǹDZǽǶǺǷȈǶǺ ǻǼǴǸDZǼǺǮ ǬǯǼDZǽǽǴǮǹǺǯǺ ǮǷǴȋǹǴȋ ǺǶǼǿDzǬȊȅDZǵ ǽǼDZǰȇ, ȁǬǼǬǶǾDZǼǹȇȁ ǰǷȋ dzǴǸǹDZǯǺ ǻDZǼǴǺǰǬ, ǽ ǶǺǾǺǼȇǸǴ ǰǺǷDzǹǬ ǽǻǼǬǮǷȋǾȈǽȋ ǹǬȄǬ ǶǺDzǬ. ǛǺȉǾǺǸǿ Ǯ dzǴǸǹDZDZ ǮǼDZǸȋ ǶǺDzǬ ȃǬǽǾǺ ǽǾǬǹǺǮǴǾǽȋ ǽǿȁǺǵ, Ǭ DZDZ ǽǷǺǵ, dzǬȅǴȅǬȊȅǴǵ ǺǾ ǽǮǺǭǺǰǹȇȁ ǼǬǰǴǶǬǷǺǮ, ǿǸDZǹȈȄǬDZǾǽȋ. ǑǽǷǴ Ǯȇ ȁǺǾǴǾDZ ǹǬǵǾǴ ǶǬȃDZǽǾǮDZǹǹǿȊ ǻǺǸǺȅȈ, ǾǺ dzǬǭǿǰȈǾDZ Ǻ ǸǬǽǷǬȁ Ǵ ǶǼDZǸǬȁ, ǶǺǾǺǼȇDZ ǴǹǺǯǰǬ ǻǼǴǹǺǽȋǾ ǭǺǷȈȄDZ ǮǼDZǰǬ, ȃDZǸ ǻǺǷȈdzȇ, ǻǺǾǺǸǿ ȃǾǺ ǹDZ ǻǺdzǮǺǷȋȊǾ ǶǺDzDZ ǽǮǺǭǺǰǹǺ ǰȇȄǬǾȈ. ǖǺǽǸDZǾǴǶǬ «Dr. Entner» ǽǺǰDZǼDzǴǾ ǿǹǴǶǬǷȈǹǿȊ ǽȇǮǺǼǺǾǶǿ, ǼǬdzǼǬǭǺǾǬǹǹǿȊ ǽǻDZȂǴǬǷǴǽǾǬǸǴ, Ǯ ǹDZǵ ǽǺȃDZǾǬȊǾǽȋ ǼDZǯDZǹDZǼǴǼǿȊȅǴDZ ǽǮǺǵǽǾǮǬ ǽǶǮǬǷDZǹǬ ǽ ǻǼDZǶǼǬǽǹȇǸ ǼǬǹǺdzǬDzǴǮǷȋȊȅǴǸ Ǵ ǿǮǷǬDzǹȋȊȅǴǸ ǰDZǵǽǾǮǴDZǸ ȉǶǽǾǼǬǶǾǬ Ǵdz ǸǺǼǽǶǴȁ ǭǬǶǾDZǼǴǵ «Pseudomonas anctartica». ǞǬǴǹǽǾǮDZǹǹǺ dzǮǿȃǬȅDZDZ ǹǬdzǮǬǹǴDZ ǴǹǯǼDZǰǴDZǹǾǺǮ Ǵdz ǯǷǿǭǴǹ ǸǺǼDZǵ ǹǬ ǽǬǸǺǸ ǰDZǷDZ ȁǺǼǺȄǺ ǴdzǮDZǽǾǹǺ Ǯ ǸǴǼDZ ǮȇǽǺǶǺǶǷǬǽǽǹǺǵ ǶǺǽǸDZǾǴǶǴ. ǗǬǭǺǼǬǾǺǼǹȇDZ ǴǽǽǷDZǰǺǮǬǹǴȋ ǻǺǶǬdzǬǷǴ, ȃǾǺ Pseudomonas anctartica ǿǮDZǷǴȃǴǮǬDZǾ ǻǼǺǴdzǮǺǰǽǾǮǺ ǶǺǷǷǬǯDZǹǬ Ǯ ǶǺDzDZ ǹǬ ǰDZǽȋǾǶǴ ǻǼǺȂDZǹǾǺǮ. nj ǻǺǾǺǸǿ ǶǬǶ ǶǺǷǷǬǯDZǹ ǺǾǮDZȃǬDZǾ dzǬ ȉǷǬǽǾǴȃǹǺǽǾȈ Ǵ ǿǻǼǿǯǺǽǾȈ ǶǺDzǴ, ǾǺ ǹDZ ǿǰǴǮǴǾDZǷȈǹǺ, ȃǾǺ ǻǺ ǺǻȇǾǿ ǻǺǷȈdzǿȊȅǴȁǽȋ ǻǼǺǰǿǶǾǬǸǴ ǽ DZǯǺ ǽǺǰDZǼDzǬǹǴDZǸ, ǽȇǮǺǼǺǾǶǬ ǽ pseudomonas ǿǸDZǹȈȄǬDZǾ ǸǺǼȅǴǹȇ ǮǺǶǼǿǯ ǯǷǬdz ǹǬ 50 - 60%. www.drentner.cz www.facebook.com/KosmetikaDrENTNER Balení 30 ml. Cena: 3091 Kÿ

172


SPORTALM Podzim–Zima 2012/13 www.fggroup.cz


ESTATE DOPORUþUJE | RECOMMENDS ESTATE | ǜǑǖǚǘǑǙǐǟǑǞ ESTATE

INTELIGENTNÍ SYSTÉM OVLÁDÁNÍ I PRO VÁŠ DOMOV S KD ELEKTRONIKA S.R.O.

ǔǙǞǑǗǗǑǖǞǟnjǗǨǙnjǫ ǝǔǝǞǑǘnj ǟǛǜnjǎǗǑǙǔǫ ǔ ǐǗǫ ǎnjǤǑǏǚ ǐǚǘnj ǝ KD ELEKTRONIKA S.R.O. STISKEM JEDINÉHO TLAþÍTKA NA OVLADAþI ZTLUMÍTE SVęTLA, ZATÁHNETE ŽALUZIE þI OVLÁDÁTE HLASITOST ŠPIþKOVÝCH ELEKTRONICKÝCH PŏÍSTROJš V CELÉM VAŠEM DOMę. HUDBA BUDOUCNOSTI? ŠÉF SPOLEþNOSTI KD ELEKTRONIKA S.R.O., KTERÁ JE VÝHRADNÍM DISTRIBUTOREM SVęTOZNÁMÝCH ZNAþEK JAKO JE NAPŏ. BANG & OLUFSEN, PAN VLADIMÍR DZURENDA, VÁS V ROZHOVORU PŏIPRAVENÉM PRO ESTATE PŏESVęDþÍ O TOM, ŽE MODERNÍ INTEGROVANÉ SYSTÉMY A JEJICH FUNKþNOST VÁS JEDNODUŠE NADCHNOU.

ǙnjǒnjǞǔǑǘ ǚǐǙǚǕ ǖǙǚǛǖǔ Ǚnj ǛǟǗǨǞǑ ǐǔǝǞnjǙǢǔǚǙǙǚǏǚ ǟǛǜnjǎǗǑǙǔǫ ǟǘǑǙǨǤǔǞǑ ǔǙǞǑǙǝǔǎǙǚǝǞǨ ǚǝǎǑǥǑǙǔǫ, ǓnjǖǜǚǑǞǑ ǒnjǗǪǓǔ ǔǗǔ ǚǞǜǑǏǟǗǔǜǟǑǞǑ Ǔǎǟǖ ǛǑǜǎǚǖǗnjǝǝǙǧǡ ǩǗǑǖǞǜǚǙǙǧǡ ǟǝǞǜǚǕǝǞǎ ǎ ǢǑǗǚǘ ǐǚǘǑ. ǘǟǓǧǖnj ǍǟǐǟǥǑǏǚ? ǜǟǖǚǎǚǐǔǞǑǗǨ ǖǚǘǛnjǙǔǔ «KD ELEKTRONIKA S.R.O.», ǫǎǗǫǪǥǑǕǝǫ ǩǖǝǖǗǪǓǔǎǙǧǘ ǐǔǝǞǜǔǍǨǪǞǚǜǚǘ ǎǝǑǘǔǜǙǚ ǔǓǎǑǝǞǙǧǡ ǘnjǜǚǖ, ǙnjǛǜǔǘǑǜ, Ǟnjǖǔǡ ǖnjǖ «BANG & OLUFSEN», Ǐ-Ǚ ǎǗnjǐǔǘǔǜ ǐǓǟǜǑǙǐnj, ǎ ǔǙǞǑǜǎǨǪ ǐǗǫ «ESTATE» ǟǍǑǐǔǞ ǎnjǝ ǎ Ǟǚǘ, ǣǞǚ ǝǚǎǜǑǘǑǙǙǧǑ ǔǙǞǑǏǜǔǜǚǎnjǙǙǧǑ ǝǔǝǞǑǘǧ ǔ ǔǡ ǠǟǙǖǢǔǚǙnjǗǨǙǚǝǞǨ ǓnjǝǗǟǒǔǎnjǪǞ ǎnjǤǑǏǚ ǎǙǔǘnjǙǔǫ ǔ ǎǚǝǡǔǥǑǙǔǫ.

MŢžete ÿtenáŐŢm ESTATE pŐedstavit spoleÿnost KD ELEKTRONIKA s.r.o. a pŐiblížit, v ÿem je na ÿeském trhu ojedinĚlá?

ǛǼDZǰǽǾǬǮȈǾDZ, ǻǺDzǬǷǿǵǽǾǬ, ǹǬȄǴǸ ȃǴǾǬǾDZǷȋǸ ǶǺǸǻǬǹǴȊ KD ELEKTRONIKA s.r.o. Ǵ ǼǬǽǽǶǬDzǴǾDZ Ǻ ǾǺǸ, ǻǺȃDZǸǿ ǺǹǬ ȋǮǷȋDZǾǽȋ ǿǹǴǶǬǷȈǹǺǵ ǹǬ ȃDZȄǽǶǺǸ ǼȇǹǶDZ?

KD ELEKTRONIKA s.r.o. je výjimeÿná svým portfoliem nabízených výrobkŢ a služeb. Zastupujeme v þeské republice takové Àrmy jako je Bang & Olufsen – výrobce exkluzivní elektroniky, LUTRON – specialista na ovládání svĚtel a vnitŐní stínĚní, Kaleidescape – systém uložištĚ pro DVD, Blu-Ray a CD s distribucí do neomezeného poÿtu místností a CINEAK – dodavatele domácích kinosálŢ.

KD ǩǗǑǖǞǜǚǙǔǖnj ǿǹǴǶǬǷȈǹǬ Ǯ ǺǾǹǺȄDZǹǴǴ ǽǮǺDZǯǺ ǻǼDZǰǷǺDzDZǹǴȋ ǻǼǺǰǿǶȂǴǴ Ǵ ǿǽǷǿǯ. KD ǩǗǑǖǞǜǚǙǔǖnj s.r.o. ǻǼDZǰǽǾǬǮǷȋDZǾ ǹǬ ǼȇǹǶDZ ǣDZȄǽǶǺǵ ǜDZǽǻǿǭǷǴǶǴ ǾǬǶǴDZ ȀǴǼǸȇ ǶǬǶ Bang&Olufsen – ǻǼǺǴdzǮǺǰǴǾDZǷȋ ȉǶǽǶǷȊdzǴǮǹǺǵ ȉǷDZǶǾǼǺǹǴǶǴ, ǶǺǸǻǬǹǴȊ LUTRON – ǽǻDZȂǴǬǷǴdzǴǼǿȊȅǿȊǽȋ ǹǬ ǿǻǼǬǮǷDZǹǴǴ ǮǹǿǾǼDZǹǹǴǸ ǺǽǮDZȅDZǹǴDZǸ Ǵ ǽǴǽǾDZǸǬǸǴ dzǬǾDZǹDZǹǴȋ, Kaleidescape – ǽǴǽǾDZǸȇ ȁǼǬǹDZǹǴȋ ǰǷȋ DVD, Blu-Ray Ǵ CD ǽ ǼǬǽǻǼDZǰDZǷDZǹǴDZǸ Ǯ ǹDZǺǯǼǬǹǴȃDZǹǹǺDZ ǶǺǷǴȃDZǽǾǮǺ ǶǺǸǹǬǾ Ǵ CINEAK – ȀǴǼǸǬ-ǻǺǽǾǬǮȅǴǶ ǰǺǸǬȄǹǴȁ ǶǴǹǺǾDZǬǾǼǺǮ.

174


ǜǑǖǚǘǑǙǐǟǑǞ ESTATE | RECOMMENDS ESTATE | ESTATE DOPORUþUJE

Toto portfolio výrobkŢ a spolupráce s dalšími Àrmami v oblasti inteligentních systémŢ ovládání domŢ a bytŢ, vÿetnĚ mĚŐení a regulace, nám umožŁuje zajistit pro naše zákazníky komplexní služby od projektu až po realizaci na klíÿ. Propojení špiÿkových Àrem z rŢzných oblastí, které zastupujeme, našich odborných znalostí a dovedností je garancí vysoké kvality a spolehlivosti našich systémŢ. Myslím si, že právĚ naše portfolio výrobcŢ a naše komplexní služby jsou na ÿeském trhu ojedinĚlé. KD ELEKTRONIKA s.r.o. nabízí produkty svĚtoznámých znaÿek, které nĚkdy zákazníci ve snaze ušetŐit nakupují pŐes neoÀciální dodavatele. Jaké výhody mŢžete jako oÀciální distributor klientŢm nabídnout? UrÿitĚ se to obÿas stává. NĚkdy zájemci o naše výrobky s pŐedstavou Ànanÿní úspory rezignují na kvalitní službu. NeuvĚdomují si, že my jsme garantem, že jejich výrobek bude odbornĚ nainstalovaný, naprogramovaný a že dostanou potŐebné informace o jeho ovládání od našich technikŢ. Velkou výhodu je technik na telefonu, pŐipravený poradit a posloužit.

ǩǾǺ ǻǺǼǾȀǺǷǴǺ ǻǼǺǰǿǶȂǴǴ Ǵ ǽǺǾǼǿǰǹǴȃDZǽǾǮǺ ǽ ǰǼǿǯǴǸǴ ǶǺǸǻǬǹǴȋǸǴ Ǯ ǺǭǷǬǽǾǴ ǴǹǾDZǷǷDZǶǾǿǬǷȈǹȇȁ ǽǴǽǾDZǸ ǿǻǼǬǮǷDZǹǴȋ ǰǺǸǬǸǴ Ǵ ǶǮǬǼǾǴǼǬǸǴ, ǮǶǷȊȃǬȋ ǴdzǸDZǼDZǹǴDZ Ǵ ǶǺǹǾǼǺǷȈ, ǻǺdzǮǺǷȋDZǾ ǹǬǸ ǻǼDZǰǺǽǾǬǮǷȋǾȈ ǹǬȄǴǸ ǶǷǴDZǹǾǬǸ ǻǺǷǹȇǵ ǽǻDZǶǾǼ ǿǽǷǿǯ – ǺǾ ǻǼǺDZǶǾǴǼǺǮǬǹǴȋ ǰǺ ǴǽǻǺǷǹDZǹǴȋ ǻǺǰ ǶǷȊȃ. ǚǭȆDZǰǴǹDZǹǴDZ ǻǼDZǰǽǾǬǮǷȋDZǸȇȁ ǹǬǸǴ ǮDZǰǿȅǴȁ ǶǺǸǻǬǹǴǵ Ǵdz ǼǬdzǷǴȃǹȇȁ ǺǭǷǬǽǾDZǵ, ǹǬȄDZǯǺ ǻǼǺȀDZǽǽǴǺǹǬǷȈǹǺǯǺ ǺǻȇǾǬ Ǵ ǹǬǮȇǶǺǮ ȋǮǷȋDZǾǽȋ ǯǬǼǬǹǾǴDZǵ ǮȇǽǺǶǺǯǺ ǶǬȃDZǽǾǮǬ Ǵ ǹǬǰDZDzǹǺǽǾǴ ǹǬȄǴȁ ǽǴǽǾDZǸ. ǫ ǰǿǸǬȊ, ȃǾǺ ǹǬȄDZ ǻDZǼDZȃDZǹȈ ǻǼǺǴdzǮǺǰǴǾDZǷDZǵ Ǵ ǹǬȄǴ ǶǺǸǻǷDZǶǽǹȇDZ ǿǽǷǿǯǴ ȋǮǷȋȊǾǽȋ ǿǹǴǶǬǷȈǹȇǸǴ ǹǬ ȃDZȄǽǶǺǸ ǼȇǹǶDZ. KD ELECTRONICS s.r.o. ǻǼDZǰǷǬǯǬDZǾ ǻǼǺǰǿǶȂǴȊ ǸǴǼǺǮȇȁ ǸǬǼǺǶ, ǶǺǾǺǼǿȊ ǹDZǶǺǾǺǼȇDZ ǶǷǴDZǹǾȇ Ǯ ǽǾǼDZǸǷDZǹǴǴ ǽȉǶǺǹǺǸǴǾȈ ǴǹǺǯǰǬ ǻǺǶǿǻǬȊǾ ǿ ǹDZǺȀǴȂǴǬǷȈǹȇȁ ǻǺǽǾǬǮȅǴǶǺǮ. nj ǶǬǶǴDZ ǻǼDZǴǸǿȅDZǽǾǮǬ Ǯȇ, ǶǬǶ ǺȀǴȂǴǬǷȈǹȇǵ ǰǴǽǾǼǴǭȈȊǾǺǼ, ǸǺDzDZǾDZ ǻǼDZǰǷǺDzǴǾȈ ǶǷǴDZǹǾǬǸ? ǐǬ, ǾǬǶǺDZ ǴǹǺǯǰǬ ǽǷǿȃǬDZǾǽȋ. ǔǹǺǯǰǬ ǷȊǰǴ dzǬǴǹǾDZǼDZǽǺǮǬǹǹȇDZ Ǯ ǹǬȄDZǵ ǻǼǺǰǿǶȂǴǴ ǽǾǼDZǸȋǾǽȋ ǽȉǶǺǹǺǸǴǾȈ ȀǴǹǬǹǽǺǮȇDZ ǽǼDZǰǽǾǮǬ Ǵ ǻǺǾǺǸǿ ǹDZǰǺǺȂDZǹǴǮǬȊǾ ǶǬȃDZǽǾǮǺ ǺǭǽǷǿDzǴǮǬǹǴȋ. ǚǹǴ ǹDZ ǻǺǹǴǸǬȊǾ, ȃǾǺ Ǹȇ ǾǺǷȈǶǺ ǹǬȄǬ ǶǺǸǻǬǹǴȋ ǯǬǼǬǹǾǴǼǿDZǾ ǾǺ, ȃǾǺ ǶǿǻǷDZǹǹǺDZ ǴǸǴ ǴdzǰDZǷǴDZ ǭǿǰDZǾ ǻǼǺȀDZǽǽǴǺǹǬǷȈǹǺ ǿǽǾǬǹǺǮǷDZǹǺ, dzǬǻǼǺǯǼǬǸǸǴǼǺǮǬǹǺ, Ǵ ȃǾǺ ǺǹǴ ǻǺǷǿȃǬǾ ǮǽȊ ǹDZǺǭȁǺǰǴǸǿȊ ǴǹȀǺǼǸǬȂǴȊ Ǻ DZǯǺ ǼǬǭǺǾDZ ǺǾ ǹǬȄǴȁ ǾDZȁǹǴǶǺǮ-ǽǻDZȂǴǬǷǴǽǾǺǮ. ǍǺǷȈȄǴǸ ǻǼDZǴǸǿȅDZǽǾǮǺǸ ǹǬȄDZǯǺ ǺǭǽǷǿDzǴǮǬǹǴȋ ȋǮǷȋDZǾǽȋ ǾDZȁǹǴȃDZǽǶǴǵ ǽǻDZȂǴǬǷǴǽǾ, ǽ ǶǺǾǺǼȇǸ ǸǺDzǹǺ ǰǷȋ ǽǺǮDZǾǬ ǴǷǴ ǻǺǸǺȅǴ ǹDZǸDZǰǷDZǹǹǺ ǽǮȋdzǬǾȈǽȋ ǻǺ ǾDZǷDZȀǺǹǿ.

175


ESTATE DOPORUþUJE | RECOMMENDS ESTATE | ǜǑǖǚǘǑǙǐǟǑǞ ESTATE

Proslulá znaÿka Bang & Olufsen má pomĚrnĚ bohatou tradici. Jaké produkty lze v jejím sortimentu nalézt a v ÿem podle vás spoÿívá jejich úspĚch? Bang & Olufsen má již skoro 90letou tradici. Sortiment Bang & Olufsen zahrnuje celou Őadu televizorŢ s uhlopŐíÿkou obrazovky od 32‘‘ do 103“ v rŢzných barevných provedeních s nepŐeberným množstvím stojanŢ a držákŢ a také celou škálu aktivních reproduktorŢ od nejmenších po nejvĚtší s výkonem až 5000W/pár. Dále také rŢzné audio zaŐízení a od letošního roku novou znaÿku BeoPlay, zamĚŐenou na tzv. digitální populaci. KD ELEKTRONIKA s.r.o. nabízí také velice zajímavý systém, pŐispívající ke znaÿnému komfortu bydlení, a sice tzv. inteligentní dŢm. MŢžete pŐiblížit, o co se jedná a jaké jsou výhody takového systému? Nejedná se o jeden systém. Vždy pracujeme se zákazníkem na jeho individuálních potŐebách. NĚkdo chce jenom jediný ovladaÿ ke svým audio/video zaŐízením. To je velice jednoduché standardní Őešení od Bang & Olufsen, které existuje již 20 let. Jiný zákazník chce ovládat i svĚtla a pŐípadnĚ rolety, žaluzie nebo závĚsy stejným ovladaÿem. PŐidáme LUTRON a i toto na pohled složité zadání je vyŐešené. Dálkový ovladaÿ od Bang & Olufsen Beo6 to zvládne. NejnároÿnĚjší zákazníci požadují úplnou integraci všech domácích systémŢ vÿetnĚ topení, chlazení, závlahy a dalších zaŐízení. V tom pŐípadĚ používáme ÿeský výrobek Foxtrot, velmi robustní procesor, který zvládá i velké prŢmyslové objekty. Ten umožŁuje kompletní integraci a ovládání všech procesŢ za pomoci iPad, iPhone nebo dotykového panelu.

176

ǔdzǮDZǽǾǹǬȋ ǸǬǼǶǬ Bang&Olufsen ǽǷǬǮǴǾǽȋ ǽǮǺǴǸǴ ǾǼǬǰǴȂǴȋǸǴ. ǖǬǶǴDZ ǴdzǰDZǷǴȋ ǻǼDZǰǽǾǬǮǷDZǹȇ Ǯ DZDZ ǬǽǽǺǼǾǴǸDZǹǾDZ Ǵ Ǯ ȃDZǸ, ǻǺ ǎǬȄDZǸǿ ǸǹDZǹǴȊ, ǺǹǬ ȋǮǷȋDZǾǽȋ ǿǽǻDZȄǹǺǵ? ǘǬǼǶDZ Bang&Olufsen ǻǺȃǾǴ 90 ǷDZǾ. njǽǽǺǼǾǴǸDZǹǾ ǶǺǸǻǬǹǴǴ Bang&Olufsen ǮǶǷȊȃǬDZǾ Ǯ ǽDZǭȋ ȄǴǼǺǶǴǵ ǽǻDZǶǾǼ ǾDZǷDZǮǴdzǺǼǺǮ ǽ ǰǴǬǯǺǹǬǷȈȊ ǺǾ 32 “ǰǺ 103” ǼǬdzǷǴȃǹȇȁ ȂǮDZǾǺǮȇȁ ǸǺǰDZǷDZǵ ǽ ǭǺǷȈȄǴǸ ǶǺǷǴȃDZǽǾǮǺǸ ǽǾǺDZǶ Ǵ ǰDZǼDzǬǾDZǷDZǵ. ǞǬǶDzDZ Ǯ ǹDZǯǺ ǮȁǺǰǴǾ ȄǴǼǺǶǬȋ ȄǶǬǷǬ ǬǶǾǴǮǹȇȁ ǼDZǻǼǺǰǿǶǾǺǼǺǮ - ǺǾ ǽǬǸȇȁ ǸǬǷDZǹȈǶǴȁ ǰǺ ǽǬǸȇȁ ǶǼǿǻǹȇȁ – ǽ ǸǺȅǹǺǽǾȈȊ ǰǺ 5000W/ǻǬǼǬ. ǐǺǭǬǮǴǸ Ƕ ȉǾǺǸǿ Ǵ ǼǬdzǷǴȃǹȇDZ ǬǿǰǴǺ-ǿǽǾǼǺǵǽǾǮǬ, Ǭ Ǯ ȉǾǺǸ ǯǺǰǿ ǿ ǹǬǽ ǻǺȋǮǴǷǽȋ ǹǺǮȇǵ ǭǼDZǹǰ BeoPlay, ǹǬȂDZǷDZǹǹȇǵ ǹǬ ǾǬǶ ǹǬdzȇǮǬDZǸǿȊ ȂǴȀǼǺǮǿȊ ǻǺǻǿǷȋȂǴȊ. KD ǩǗǑǖǞǜǚǙǔǖnj s.r.o. ǾǬǶDzDZ ǻǼDZǰǷǬǯǬDZǾ ǺȃDZǹȈ ǴǹǾDZǼDZǽǹȇDZ ǽǴǽǾDZǸȇ, ǽǿȅDZǽǾǮDZǹǹǺ ǻǺǮȇȄǬȊȅǴDZ ǶǺǸȀǺǼǾǹǺǽǾȈ DzǴǷȈȋ - ǾǬǶ ǹǬdzȇǮǬDZǸȇǵ «ǿǸǹȇǵ ǰǺǸ». ǘǺDzDZǾDZ ǷǴ Ǯȇ ǺǭȆȋǽǹǴǾȈ, Ǻ ȃDZǸ ǴǰDZǾ ǼDZȃȈ, Ǵ ǶǬǶǺǮȇ ǻǼDZǴǸǿȅDZǽǾǮǬ ǾǬǶǺǵ ǽǴǽǾDZǸȇ? ǘȇ ǯǺǮǺǼǴǸ ǹDZ Ǻǭ ǺǰǹǺǵ ǽǾǬǹǰǬǼǾǹǺǵ ǽǴǽǾDZǸDZ. ǘȇ ǮǽDZǯǰǬ ǼǬǭǺǾǬDZǸ ǽ ǴǹǰǴǮǴǰǿǬǷȈǹȇǸǴ ǻǺǾǼDZǭǹǺǽǾȋǸǴ dzǬǶǬdzȃǴǶǬ. ǖǾǺ-ǾǺ ȁǺȃDZǾ ǴǸDZǾȈ ǺǰǴǹ ǻǿǷȈǾ ǰǷȋ ǿǻǼǬǮǷDZǹǴȋ ǽǮǺDZǵ ǬǿǰǴǺ- Ǵ ǮǴǰDZǺ- ǾDZȁǹǴǶǺǵ. ǩǾǺ ǽǬǸǺDZ ǻǼǺǽǾǺDZ ǭǬdzǺǮǺDZ ǻǼDZǰǷǺDzDZǹǴDZ ǺǾ Bang&Olufsen, ǶǺǾǺǼǺDZ ǽǿȅDZǽǾǮǿDZǾ ǹǬ ǼȇǹǶDZ ǮǺǾ ǿDzDZ 20 ǷDZǾ. nj, ǹǬǻǼǴǸDZǼ, ǰǼǿǯǺǵ ǶǷǴDZǹǾ ȁǺȃDZǾ ǿǻǼǬǮǷȋǾȈ ǺǽǮDZȅDZǹǴDZǸ Ǵ, ǮǺdzǸǺDzǹǺ, ǼǺǷǷDZǾǬǸǴ ǴǷǴ DzǬǷȊdzǴ ǴǷǴ ǰǼǿǯǺǵ ǻǺǰǮDZǽǹǺǵ ǽǴǽǾDZǸǺǵ – Ǵ ǮǽDZ ȉǾǺ ǽ ǻǺǸǺȅȈȊ ǺǰǹǺǯǺ ǻǿǷȈǾǬ ǿǻǼǬǮǷDZǹǴȋ. ǘȇ ǰǺǭǬǮǷȋDZǸ LUTRON Ǵ, ǹǬ ǻDZǼǮȇǵ ǮdzǯǷȋǰ ǽǷǺDzǹǬȋ, dzǬǰǬȃǬ ǼDZȄDZǹǬ. ǛǿǷȈǾ ǰǴǽǾǬǹȂǴǺǹǹǺǯǺ ǿǻǼǬǮǷDZǹǴȋ ǺǾ Bang&Olufsen «Beo6» ǷDZǯǶǺ ǽǻǼǬǮǴǾǽȋ ǽ ȉǾǺǵ ǻǼǺǭǷDZǸǺǵ. ǝǬǸȇDZ ǮdzȇǽǶǬǾDZǷȈǹȇDZ ǶǷǴDZǹǾȇ ǾǼDZǭǿȊǾ ǻǺǷǹǺǵ ǴǹǾDZǯǼǬȂǴǴ ǮǽDZȁ ǽǴǽǾDZǸ, Ǯ ǾǺǸ ȃǴǽǷDZ ǺǾǺǻǷDZǹǴȋ ǰǺǸǬ, ǺȁǷǬDzǰDZǹǴȋ, ǿǮǷǬDzǹDZǹǴȋ Ǵ ǰǼǿǯǴȁ ǿǽǾǼǺǵǽǾǮ. ǎ ȉǾǺǸ ǽǷǿȃǬDZ Ǹȇ ǴǽǻǺǷȈdzǿDZǸ ȃDZȄǽǶǴǵ ǻǼǺǰǿǶǾ Foxtrot, ȉǾǺ ǺȃDZǹȈ ǹǬǰDZDzǹȇǵ ǻǼǺȂDZǽǽǺǼ, ǶǺǾǺǼȇǵ ǽǻǼǬǮǷȋDZǾǽȋ Ǵ ǽ ǭǺǷȈȄǴǸǴ ǻǼǺǸȇȄǷDZǹǹȇǸǴ ǺǭȆDZǶǾǬǸǴ. ǝ DZǯǺ ǻǺǸǺȅȈȊ ǮǺdzǸǺDzǹǬ ǻǺǷǹǬȋ ǴǹǾDZǯǼǬȂǴȋ Ǵ ǶǺǹǾǼǺǷȈ ǮǽDZȁ ǻǼǺȂDZǽǽǺǮ ǽ ǻǺǸǺȅȈȊ iPad, iPhone ǴǷǴ ǽDZǹǽǺǼǹǺǵ ǻǬǹDZǷǴ.


ǜǑǖǚǘǑǙǐǟǑǞ ESTATE | RECOMMENDS ESTATE | ESTATE DOPORUþUJE Americká Àrma Kaleidescape, jejíž produkty rovnĚž distribuujete, nabízí DVD pŐehrávaÿe a servery. V ÿem spoÿívá dŢmyslnost softwaru této znaÿky?

njǸDZǼǴǶǬǹǽǶǬȋ ǶǺǸǻǬǹǴȋ Kaleidescape, ǻǼǺǰǿǶȂǴȊ ǶǺǾǺǼǺǵ ǎȇ ǾǬǶDzDZ ǼǬǽǻǼǺǽǾǼǬǹȋDZǾDZ, ǻǼDZǰǷǬǯǬDZǾ DVD-ǻǷDZDZǼȇ Ǵ ǽDZǼǮDZǼȇ. ǎ ȃDZǸ ǴdzǺǭǼDZǾǬǾDZǷȈǹǺǽǾȈ ǻǼǺǯǼǬǸǸǹǺǯǺ ǺǭDZǽǻDZȃDZǹǴȋ ȉǾǺǵ ǸǬǼǶǴ?

Kaleidescape se vyznaÿuje pŐedevším velmi jednoduchým ovládáním. DVD, Blu-Ray a CD se importuje do uložištĚ za pomoci mechaniky v plném rozlišení. Systém si naÿte veškeré informace o importovaném Àlmu nebo hudbĚ. Uživatel si velmi jednoduše dokáže vybrat Àlm nebo hudbu na obrazovce za pomoci dálkového ovladaÿe nebo na iPadu. V nejbližší dobĚ bude možné poŐídit si Àlmy a hudbu pŐímo od Àrmy Kaleidescape. V USA se pŐipravuje zahájení on line prodeje.

Kaleidescape ǺǾǷǴȃǬDZǾǽȋ Ǯ ǺǽǹǺǮǹǺǸ ǺȃDZǹȈ ǻǼǺǽǾȇǸ ǿǻǼǬǮǷDZǹǴDZǸ. DVD, BluRay Ǵ CD ǴǸǻǺǼǾǴǼǿDZǾǽȋ Ǯ ǸDZǽǾǺ ȁǼǬǹDZǹǴȋ ǽ ǻǺǸǺȅȈȊ ǸDZȁǬǹǴǶǴ Ǯ ǻǺǷǹǺǸ ǼǬdzǼDZȄDZǹǴǴ. ǝǴǽǾDZǸǬ ǸǺDzDZǾ ǻǼǺȃǴǾǬǾȈ ǮǽȊ ǴǹȀǺǼǸǬȂǴȊ Ǻǭ ǴǸǻǺǼǾǴǼǺǮǬǹǹȇȁ ȀǴǷȈǸǬȁ ǴǷǴ ǸǿdzȇǶDZ. ǛǺǷȈdzǺǮǬǾDZǷȈ ǷDZǯǶǺ ǮȇǭDZǼDZǾ ȀǴǷȈǸ ǴǷǴ ǸǿdzȇǶǿ ǹǬ ȉǶǼǬǹDZ ǽ ǻǺǸǺȅȈȊ ǻǿǷȈǾǬ ǰǴǽǾǬǹȂǴǺǹǹǺǯǺ ǿǻǼǬǮǷDZǹǴȋ ǴǷǴ ǹǬ iPad. ǎ ǭǷǴDzǬǵȄDZDZ ǮǼDZǸȋ ǸǺDzǹǺ ǭǿǰDZǾ ǻǼǴǺǭǼDZǽǾǴ ȀǴǷȈǸȇ Ǵ ǸǿdzȇǶǿ ǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺ ǺǾ ǶǺǸǻǬǹǴǴ Kaleidescape. ǎ ǝǤnj ǯǺǾǺǮǴǾǽȋ dzǬǻǿǽǶ ǺǹǷǬǵǹ-ǻǼǺǰǬDz.

Další spoleÿnost, kterou v þesku zastupujete, je pŐední výrobce Őídicích systémŢ osvĚtlení ÿi zastínĚní, americká spoleÿnost Lutron. Dochází v pŐípadĚ užívání takového systému k významnĚjší úspoŐe energie?

ǑȅDZ ǺǰǹǬ ǶǺǸǻǬǹǴȋ, ǶǺǾǺǼǿȊ ǎȇ ǻǼDZǰǽǾǬǮǷȋDZǾDZ Ǯ ǣDZȄǽǶǺǵ ǜDZǽǻǿǭǷǴǶDZ, ȋǮǷȋDZǾǽȋ ǮDZǰǿȅǴǸ ǻǼǺǴdzǮǺǰǴǾDZǷDZǸ ǽǴǽǾDZǸ ǿǻǼǬǮǷDZǹǴȋ ǺǽǮDZȅDZǹǴDZǸ Ǵ dzǬǾDZǹDZǹǴDZǸ, ȉǾǺ ǬǸDZǼǴǶǬǹǽǶǬȋ ǶǺǸǻǬǹǴȋ Lutron. ǛǺǷǿȃǬDZǾǽȋ ǷǴ ǻǼǴ ǴǽǻǺǷȈdzǺǮǬǹǴǴ ǾǬǶǺǵ ǽǴǽǾDZǸȇ dzǹǬȃǴǾDZǷȈǹǬȋ ȉǶǺǹǺǸǴȋ ȉǹDZǼǯǴǴ?

Ano, dochází k úspoŐe energie, ale jsem pŐesvĚdÿený pŐedevším o tom, že hlavní pŐedností systému LUTRON je uživatelské pohodlí a intuitivní ovládání. Jedním tlaÿítkem zmĚníte scénu v obývacím pokoji, bazénĚ, na zahradĚ a tŐeba pŐi odchodu z domu nebo bytu vypnete jedním tlaÿítkem všechny svĚtla, pŐípadnĚ i nĚkteré zásuvky. Popis scén na podsvícených tlaÿítkách je uživatelsky dokonale jednoduchý.

ǐǬ, ȉǹDZǼǯǴȋ, ǹDZǽǺǸǹDZǹǹǺ, ǼǬǽȁǺǰǿDZǾǽȋ ȉǶǺǹǺǸǹǺ, ǹǺ ǻǼDZDzǰDZ ǮǽDZǯǺ ȋ ǿǮDZǼDZǹ Ǯ ǾǺǸ, ȃǾǺ ǯǷǬǮǹȇǸ ǻǼDZǴǸǿȅDZǽǾǮǺǸ ǽǴǽǾDZǸȇ LUTRON ȋǮǷȋDZǾǽȋ ǿǰǺǭǽǾǮǺ ǻǺǷȈdzǺǮǬǾDZǷȋ Ǵ ǴǹǾǿǴǾǴǮǹǺDZ ǿǻǼǬǮǷDZǹǴDZ. ǚǰǹǺǵ ǶǹǺǻǶǺǵ ǎȇ ǸǺDzDZǾDZ ǴdzǸDZǹǴǾȈ «ǽȂDZǹǿ» Ǯ ǯǺǽǾǴǹǺǵ, ǭǬǽǽDZǵǹDZ, ǽǬǰǿ Ǵ, ǹǬǻǼǴǸDZǼ, ǿȁǺǰȋ Ǵdz ǰǺǸǬ ǴǷǴ ǶǮǬǼǾǴǼȇ, ǺǰǹǺǵ ǶǹǺǻǶǺǵ ǸǺDzǹǺ ǮȇǶǷȊȃǴǾȈ ǮǽDZ ǴǽǾǺȃǹǴǶǴ ǽǮDZǾǬ, ǴǷǴ ǰǬDzDZ ǺǭDZǽǾǺȃǴǾȈ ǹDZǶǺǾǺǼȇDZ ǼǺdzDZǾǶǴ. ǚǻǴǽǬǹǴDZ «ǽȂDZǹ» ǹǬ ǺǾǰDZǷȈǹȇȁ ǶǷǬǮǴȄǬȁ ǽ ǻǺǰǽǮDZǾǶǺǵ ȋǮǷȋDZǾǽȋ ǰǷȋ ǻǺǷȈdzǺǮǬǾDZǷȋ ǻǺǹȋǾǹȇǸ Ǵ ǻǼǺǽǾȇǸ.

177


ESTATE DOPORUþUJE | RECOMMENDS ESTATE | ǜǑǖǚǘǑǙǐǟǑǞ ESTATE

NemŢže se tedy stát, že by si zákazník s ovládáním inteligentního systému nevĚdĚl rady?

ǙDZ ǭǿǰDZǾ ǷǴ ǴǹǺǯǰǬ ǿǻǼǬǮǷDZǹǴDZ ȉǾǴǸǴ ǴǹǾDZǷǷDZǶǾǿǬǷȈǹȇǸǴ ǽǴǽǾDZǸǬǸǴ ǰǷȋ ǻǺǷȈdzǺǮǬǾDZǷȋ ǽǷǴȄǶǺǸ ǽǷǺDzǹȇǸ?

Zmínil jsem se již, že s každým zákazníkem tvoŐíme individuálnĚ systém dle jeho potŐeb a pŐání. Našim cílem je spokojený zákazník. Proto s klientem diskutujeme o jeho pŐedstavách, potŐebách a pŐáních, abychom navrhli systém na míru, který bude vyhovovat všem ÿlenŢm rodiny.

ǫ ǿDzDZ ǯǺǮǺǼǴǷ, ȃǾǺ ǽ ǶǬDzǰȇǸ ǶǷǴDZǹǾǺǸ Ǹȇ ǼǬdzǼǬǭǬǾȇǮǬDZǸ ǴǹǰǴǮǴǰǿǬǷȈǹǿȊ ǽǴǽǾDZǸǿ Ǯ ǽǺǺǾǮDZǾǽǾǮǴǴ ǽ DZǯǺ ǻǺǾǼDZǭǹǺǽǾȋǸǴ Ǵ ǻǺDzDZǷǬǹǴȋǸǴ. ǙǬȄǬ ǯǷǬǮǹǬȋ ȂDZǷȈ - ǰǺǮǺǷȈǹȇǵ ǶǷǴDZǹǾ. ǛǺȉǾǺǸǿ Ǹȇ ǽ ǶǷǴDZǹǾǺǸ ǺǭǽǿDzǰǬDZǸ DZǯǺ ǴǰDZǴ, ǻǺǾǼDZǭǹǺǽǾǴ Ǵ ǻǺDzDZǷǬǹǴȋ, ȃǾǺǭȇ ǼǬdzǼǬǭǺǾǬǾȈ «ǻǺǰ ǶǷȊȃ» ǾǬǶǿȊ ǽǴǽǾDZǸǿ, ǶǺǾǺǼǬȋ ǿǰǺǮǷDZǾǮǺǼǴǾ ǮǽDZȁ ȃǷDZǹǺǮ ǽDZǸȈǴ.

Nároky na estetickou stránku produktu jsou v dnešní dobĚ témĚŐ srovnatelné s nároky na špiÿkovou kvalitu a funkÿnost produktŢ. Jak se Àrmy staví k tĚmto požadavkŢm? Estetika je velmi dŢležitá pro všechny naše dodavatele. Co ale odlišuje tŐeba Bang & Olufsen od jiných výrobcŢ A/V techniky, není jen nadÿasovost designu, ale i kontinuita v kompatibilitĚ jednotlivých výrobkŢ. U Bang & Olufsen je propojení nových a starších výrobkŢ a jeden ovladaÿ pro všechny výrobky standardem. Jsem pŐesvĚdÿený, že ovládací prvky od Àrmy LUTRON, jejich tiché rolety, škála motorizovaných žaluzií a motorizované Őímské rolety splŁují všechny požadavky na estetiku. Domácí kinosál od Àrmy CINEAK s velkým výbĚrem kŐesel a akustických panelŢ uspokojí i nejnároÿnĚjší zákazníky.

178

ǞǼDZǭǺǮǬǹǴȋ Ƕ ȉǽǾDZǾǴȃǹǺǸǿ ǮǴǰǿ ǻǼǺǰǿǶȂǴǴ Ǯ ǹǬǽǾǺȋȅDZDZ ǮǼDZǸȋ ǻǼǬǶǾǴȃDZǽǶǴ ǽǺǻǺǽǾǬǮǴǸȇ ǽ ǮȇǽǺǶǴǸǴ ǾǼDZǭǺǮǬǹǴȋǸǴ Ƕ DZDZ ǶǬȃDZǽǾǮǿ Ǵ ȀǿǹǶȂǴǺǹǬǷȈǹǺǽǾǴ. ǖǬǶ ǻǼDZǰǽǾǬǮǷȋDZǸȇDZ ǎǬǸǴ ǶǺǸǻǬǹǴǴ ǺǾǹǺǽȋǾǽȋ Ƕ ȉǾǴǸ ǻǺDzDZǷǬǹǴȋǸ? ǩǽǾDZǾǴǶǬ ǺȃDZǹȈ ǮǬDzǹǬ ǰǷȋ ǮǽDZȁ ǹǬȄǴȁ ǻǺǽǾǬǮȅǴǶǺǮ. ǙǺ ȃǾǺ ǺǾǷǴȃǬDZǾ Bang&Olufsen ǺǾ ǰǼǿǯǴȁ ǻǼǺǴdzǮǺǰǴǾDZǷDZǵ ǬǿǰǴǺ- Ǵ ǮǴǰDZǺ – ǾDZȁǹǺǷǺǯǴǵ – ȉǾǺ ǹDZ ǾǺǷȈǶǺ ǹDZ ǽǾǬǼDZȊȅǴǵ ǰǴdzǬǵǹ, ǹǺ ǻǼDZDZǸǽǾǮDZǹǹǺǽǾȈ Ǵ ǽǺǮǸDZǽǾǴǸǺǽǾȈ ǺǾǰDZǷȈǹȇȁ ǻǼǺǰǿǶǾǺǮ. ǟ Bang&Olufsen ǹǬǷǴȃDZǽǾǮǿDZǾ ǻǺǽǾǺȋǹǹǬȋ ǮdzǬǴǸǺǽǮȋdzȈ ǹǺǮȇȁ Ǵ ǽǾǬǼȇȁ ǻǼǺǰǿǶǾǺǮ, Ǭ ǺǰǴǹ ǻǿǷȈǾ ǿǻǼǬǮǷDZǹǴȋ ǰǷȋ ǮǽDZȁ ȋǮǷȋDZǾǽȋ ǻǼǴǮȇȃǹȇǸ ǽǾǬǹǰǬǼǾǺǸ. ǫ ǿǭDZDzǰDZǹ, ȃǾǺ ǿǻǼǬǮǷȋȊȅǴDZ ȉǷDZǸDZǹǾȇ ǺǾ ȀǴǼǸȇ LUTRON, Ǵȁ ǾǴȁǴDZ ǼǺǷǷDZǾȇ, ȄǴǼǺǶǬȋ ȄǶǬǷǬ ǸǺǾǺǼǴdzǴǼǺǮǬǹǹȇȁ DzǬǷȊdzǴ Ǵ ǸǺǾǺǼǴdzǴǼǺǮǬǹǹȇȁ ǼǴǸǽǶǴȁ ȄǾǺǼ ǺǾǮDZȃǬDZǾ ǮǽDZǸ ǾǼDZǭǺǮǬǹǴȋǸ ȉǽǾDZǾǴǶǴ. ǐǺǸǬȄǹǴǵ ǶǴǹǺǾDZǬǾǼ ǺǾ ǶǺǸǻǬǹǴǴ CINEAK ǽ ǭǺǷȈȄǴǸ ǮȇǭǺǼǺǸ ǽǴǰDZǹǴǵ Ǵ ǬǶǿǽǾǴȃDZǽǶǴȁ ǻǬǹDZǷDZǵ Ǵ ǿǰǺǮǷDZǾǮǺǼǴǾ ǰǬDzDZ ǽǬǸȇȁ ǮdzȇǽǶǬǾDZǷȈǹȇȁ ǶǷǴDZǹǾǺǮ.


ǜǑǖǚǘǑǙǐǟǑǞ ESTATE | RECOMMENDS ESTATE | ESTATE DOPORUþUJE

Je možné nabízené systémy využít pouze pro rezidenÿní nebo i pro komerÿní úÿely?

ǘǺDzǹǺ ǷǴ ǴǽǻǺǷȈdzǺǮǬǾȈ ǻǼDZǰǷǬǯǬDZǸȇDZ ǎǬȄDZǵ ǶǺǸǻǬǹǴDZǵ ǽǴǽǾDZǸȇ ǰǷȋ ǼDZdzǴǰDZǹȂǴǵ ǴǷǴ ǶǺǸǸDZǼȃDZǽǶǴȁ ȂDZǷDZǵ?

KD ELEKTRONIKA s.r.o. se zamĚŐuje pŐedevším na rezidenÿní objekty. Jsme ale dodavatelem ovládání svĚtel systémem LUTRON pro komerÿní projekt VELAA PRIVATE ISLAND na Maledivách. Systém LUTRON bude v 54 domech rŢzné velikosti a v nĚkolika restauracích. Realizovali jsme i nĚkolik restaurací s reproduktory Bang & Olufsen a ovládáním svĚtel od Àrmy LUTRON. Systém LUTRON využívá ve svých prodejnách po celém svĚtĚ taky Louis Vuitton a další obchody, restaurace, hotely apod. Televizory Bang & Olufsen jsme dodávali pro Pražský 5* hotel Buddha Bar.

KD ǩǗǑǖǞǜǚǙǔǖnj s.r.o. ǬǶȂDZǹǾǴǼǿDZǾ ǽǮǺDZ ǮǹǴǸǬǹǴDZ Ǯ ǺǽǹǺǮǹǺǸ ǹǬ ǼDZdzǴǰDZǹǾǽǶǴȁ ǺǭȆDZǶǾǬȁ. ǙǺ Ǹȇ ǾǬǶDzDZ ȋǮǷȋDZǸǽȋ ǻǺǽǾǬǮȅǴǶǺǸ ǽǴǽǾDZǸ ǿǻǼǬǮǷDZǹǴȋ ǺǽǮDZȅDZǹǴDZǸ LUTRON ǰǷȋ ǶǺǸǸDZǼȃDZǽǶǺǯǺ ǻǼǺDZǶǾǬ VELAA PRIVATE ISLAND ǹǬ ǘǬǷȈǰǴǮǬȁ. ǞǬǸ ǽǴǽǾDZǸȇ LUTRON ǭǿǰǿǾ ǼǬdzǸDZȅDZǹȇ Ǯ 54 ǰǺǸǬȁ ǼǬdzǹȇȁ ǼǬdzǸDZǼǺǮ Ǵ Ǯ ǹDZǽǶǺǷȈǶǴȁ ǼDZǽǾǺǼǬǹǬȁ. ǞǬǶDzDZ Ǹȇ ǿǽǾǬǹǺǮǴǷǴ ǼDZǻǼǺǰǿǶǾǺǼȇ Bang&Olufsen Ǵ ǿǻǼǬǮǷDZǹǴDZ ǺǽǮDZȅDZǹǴDZǸ ǺǾ ǶǺǸǻǬǹǴǴ LUTRON Ǯ ǹDZǽǶǺǷȈǶǴȁ ǼDZǽǾǺǼǬǹǬȁ. ǝǴǽǾDZǸȇ LUTRON ǴǽǻǺǷȈdzǿDZǾ Ǯ ǽǮǺǴȁ ǸǬǯǬdzǴǹǬȁ, ǹǬȁǺǰȋȅǴȁǽȋ ǻǺ ǮǽDZǸǿ ǸǴǼǿ, ǶǺǸǻǬǹǴȋ Louis Vuitton, Ǭ ǾǬǶDzDZ Ǵ ǰǼǿǯǴDZ ǶǷǴDZǹǾȇ - ǸǬǯǬdzǴǹȇ, ǼDZǽǾǺǼǬǹȇ, ǺǾDZǷǴ Ǵ Ǿ.ǰ. ǘȇ ǻǺǽǾǬǮǷȋǷǴ ǾDZǷDZǮǴdzǺǼȇ Bang&Olufsen Ǯ ǴdzǮDZǽǾǹȇǵ ǻǼǬDzǽǶǴǵ 5 * ǺǾDZǷȈ «Buddha Bar».

179


ESTATE DOPORUþUJE | RECOMMENDS ESTATE | ǜǑǖǚǘǑǙǐǟǑǞ ESTATE

BRAVOS / SOUČASNÝ ŠPANĚLSKÝ DESIGN BRAVOS / CONTEMPORARY SPANISH DESIGN ǝǚǎǜǑǘǑǙǙǧǕ ǔǝǛnjǙǝǖǔǕ ǐǔǓnjǕǙ

2. ŏÍJNA –25. LISTOPADU 2012 VÝSTAVNÍ SÁL UPM Stone Designs, Guerrilla Containers , variabilní úložné prostory, 2006, producent: RS Life, ©UPM

ÚSTŏEDNÍM TÉMATEM TÉTO VÝSTAVY VęNOVANÉ LIDEM, NIKOLI PŏEDMęTšM, JE NEJMLADŠÍ GENERACE NADęJNÝCH TVšRCš Z OBLASTI PRODUKTOVÉHO DESIGNU. V DNEŠNÍ DOBę, KTEROU CHARAKTERIZUJE NEUSTÁLÝ TLAK ZE STRANY MÉDIÍ, JE STŏEDEM POZORNOSTI TVšRCE. Rukopis, kreativita a ego, které tradiÿnĚ náležely do svĚta umĚní, módy a architektury, zasahují také pŐedmĚty každodenní potŐeby. Jestliže se španĚlský design ve 20. století vyjadŐoval prostŐednictvím pŐedmĚtŢ, ve 21. století se vyjadŐuje skrze autory. Tato výstava proto prezentuje jednotlivé tvŢrce pomocí portrétŢ vynikajícího fotografa Rafaela Vargase, které odrážejí jeho osobní pohled na nĚ. Dnes již mŢžeme tvrdit, že španĚlský design pŐedstavuje nepopiratelnou realitu. Design ve ŠpanĚlsku postupnĚ zakoŐenil a rozvinul se do svébytné podoby, která nyní prochází intenzivním procesem promĚn. Již nejde o onen pŢvodní, tradiÿní design, nýbrž o jeho svobodnĚjší, promĚnlivĚjší a samostatnĚjší variantu. Design 21. století je v rukou nové generace designérŢ. A pŐedevším v jejich hlavách. Pro takové jako jsou oni, má španĚlština výraz „bravos“ – skvĚlí, udatní, divocí, stateÿní… www.upm.cz

ǢǑǙǞǜnjǗǨǙnjǫ ǞǑǘnj ǩǞǚǕ ǎǧǝǞnjǎǖǔ, ǛǚǝǎǫǥǑǙǙǚǕ ǗǪǐǫǘ, nj ǙǑ ǛǜǑǐǘǑǞnjǘ, - ǩǞǚ ǝnjǘǚǑ ǘǚǗǚǐǚǑ ǛǚǖǚǗǑǙǔǑ ǛǑǜǝǛǑǖǞǔǎǙǧǡ ǡǟǐǚǒǙǔǖǚǎ ǔǓ ǚǍǗnjǝǞǔ ǐǔǓnjǕǙnj ǛǜǚǐǟǖǢǔǔ. ǎ ǙnjǝǞǚǫǥǑǑ ǎǜǑǘǫ, ǚǞǗǔǣnjǪǥǑǑǝǫ ǛǚǝǞǚǫǙǙǧǘ ǐnjǎǗǑǙǔǑǘ ǝǚ ǝǞǚǜǚǙǧ ǝǜǑǐǝǞǎ ǘnjǝǝǚǎǚǕ ǔǙǠǚǜǘnjǢǔǔ, ǎ ǢǑǙǞǜǑ ǎǙǔǘnjǙǔǫ ǙnjǡǚǐǔǞǝǫ ǡǟǐǚǒǙǔǖ. ǜǿǶǺǻǴǽǹǺDZ Ǵ ǾǮǺǼȃDZǽǶǺDZ ǮȇǼǬDzDZǹǴDZ, Ǭ ǾǬǶDzDZ ȉǯǺ, ǶǺǾǺǼȇDZ ǾǼǬǰǴȂǴǺǹǹǺ ǻǼǴǹǬǰǷDZDzǬǷǴ Ƕ ǸǴǼǿ ǴǽǶǿǽǽǾǮǬ, ǸǺǰȇ Ǵ ǬǼȁǴǾDZǶǾǿǼȇ, ǽDZǵȃǬǽ ǼǬǽǻǼǺǽǾǼǬǹȋDZǾǽȋ Ǵ ǹǬ ǻǼDZǰǸDZǾȇ DZDzDZǰǹDZǮǹǺǯǺ ǿǻǺǾǼDZǭǷDZǹǴȋ. ǑǽǷǴ ǴǽǻǬǹǽǶǴǵ ǰǴdzǬǵǹ Ǯ 20-Ǹ ǮDZǶDZ ǮȇǼǬDzǬǷ ǽDZǭȋ ȃDZǼDZdz ǺǭȆDZǶǾȇ, ǾǺ Ǯ 21-Ǹ ǮDZǶDZ Ǻǹ ǮȇǼǬDzǬDZǾǽȋ ȃDZǼDZdz ǬǮǾǺǼǺǮ. ǩǾǬ ǮȇǽǾǬǮǶǬ, ǾǬǶǴǸ ǺǭǼǬdzǺǸ, ǻǼDZǰǽǾǬǮǷȋDZǾ ǺǾǰDZǷȈǹȇȁ ǾǮǺǼȂǺǮ ǽ ǻǺǸǺȅȈȊ ǻǺǼǾǼDZǾǺǮ ǿǹǴǶǬǷȈǹǺǯǺ ȀǺǾǺǯǼǬȀǬ ǜǬȀǬȉǷȋ ǎǬǼǯǬǽǬ, ǶǺǾǺǼȇDZ ǮȇǼǬDzǬȊǾ DZǯǺ ǷǴȃǹȇǵ ǮdzǯǷȋǰ ǹǬ ǹǴȁ. ǝDZǯǺǰǹȋ Ǹȇ ǸǺDzDZǸ ǽǶǬdzǬǾȈ, ȃǾǺ ǴǽǻǬǹǽǶǴǵ ǰǴdzǬǵǹ ȋǮǷȋDZǾǽȋ ǭDZǽǽǻǺǼǹǺǵ ǼDZǬǷȈǹǺǽǾȈȊ. ǐǴdzǬǵǹ Ǯ ǔǽǻǬǹǴǴ ǻǺǽǾDZǻDZǹǹǺ ǿǶǺǼDZǹǴǷǽȋ Ǵ ǼǬdzǮǴǷǽȋ Ǯ ǽǮǺDZǺǭǼǬdzǹȇDZ ȀǺǼǸȇ, ǶǺǾǺǼȇDZ Ǯ ǹǬǽǾǺȋȅDZDZ ǮǼDZǸȋ ǻǼǺȁǺǰȋǾ ǻǼǺȂDZǽǽ ǴǹǾDZǹǽǴǮǹǺǯǺ ǴdzǸDZǹDZǹǴȋ. ǜDZȃȈ ǭǺǷȈȄDZ ǹDZ ǴǰDZǾ Ǻǭ ǺǼǴǯǴǹǬǷȈǹǺǸ, ǾǼǬǰǴȂǴǺǹǹǺǸ ǰǴdzǬǵǹDZ, Ǭ ǽǶǺǼDZDZ Ǻ DZǯǺ ǭǺǷDZDZ ǽǮǺǭǺǰǹǺǸ, ǭǺǷDZDZ ǻDZǼDZǸDZǹȃǴǮǺǸ Ǵ ǹDZdzǬǮǴǽǴǸǺǸ ǮǬǼǴǬǹǾDZ. ǐǴdzǬǵǹ 21ǮDZǶǬ Ǯ ǼǿǶǬȁ ǹǺǮǺǯǺ ǻǺǶǺǷDZǹǴȋ ǰǴdzǬǵǹDZǼǺǮ. ǔ, ǻǼDZDzǰDZ ǮǽDZǯǺ, Ǯ Ǵȁ ǯǺǷǺǮǬȁ. ǐǷȋ ǾǬǶǴȁ, ǶǬǶ ǺǹǴ, Ǯ ǴǽǻǬǹǽǶǺǸ ȋdzȇǶDZ ǽǿȅDZǽǾǮǿDZǾ ǮȇǼǬDzDZǹǴDZ „bravos“ – «ǭǼǬǮǺ!» – ǺǾǷǴȃǹǺ, ǽǸDZǷǺ, ǭǷDZǽǾȋȅDZ, ǺǽǾǼǺ… www.upm.cz

180


ǜǑǖǚǘǑǙǐǟǑǞ ESTATE | RECOMMENDS ESTATE | ESTATE DOPORUþUJE Ramón Úbeda, Cul de Luxe, stoliÿka, 2008, producent: ABR, ©UPM

THE CENTRAL THEME OF THIS EXHIBITION, DEDICATED TO PEOPLE, NOT OBJECTS, IS THE YOUNGEST GENERATION OF PROMISING ARTISTS FROM THE FIELD OF PRODUCT DESIGN. IN THE PRESENT TIME, CHARACTERISED BY CONSTANT MEDIA PRESSURE, THE ATTENTION IS FOCUSED ON THE CREATOR. Originality, creativity and ego that traditionally belonged to the world of art, fashion and architecture, have also spread to everyday objects. If Spanish design expressed itself through objects in the 20th century, in the 21st century it expresses itself through the designers. This exhibition therefore presents individual creators through portraits by the great photographer, Rafael Vargas, which reÁect his personal view of them. We can say today that Spanish design is an undeniable reality. Design in Spain gradually took root and developed into a distinct form which is now undergoing an intensive process of change. It is no longer about the original, traditional design, but about its freer, more variable and independent variant. Design of the 21st century is in the hands of a new generation of designers. And, above all, in their minds. For such as they are, the Spanish have the word, “Bravos” – meaning the excellent, courageous, wild, brave… www.upm.cz

Ernest Perera, Aurea; objekty pro uložení talíŐŢ, hrníÿkŢ a lahví; 2008, producent: Delica, ©UPM

Martí Guixé, Xarxa, sedací polštáŐe, 2008, producent: Danese, ©UPM

El Último Grito, Mico , víceúÿelový objekt, 2006, producent: Magis, ©UPM

181


DIANA KRALL SE VRACÍ PO TŘECH LETECH ZPĚT DO PRAHY RETURNS TO PRAGUE AFTER THREE YEARS ǝǛǟǝǞǫ Ǟǜǔ Ǐǚǐnj ǐnjǕnjǙnj ǖǜǚǗǗ ǎǚǓǎǜnjǥnjǑǞǝǫ ǎ ǛǜnjǏǟ 12. 11. 2012, 19 hodin, Kongresové centrum Praha 4 12th November, 2012, 19:00, Prague Congress Centre, Prague 4 12. 11. 2012, 19.00, ǖǺǹǯǼDZǽǽ-ȂDZǹǾǼ ǛǼǬǯǬ 4 Diana Krall, pŐední jazzová pianistka, skladatelka a zpĚvaÿka pŐedstavuje vrchol jazzového umĚní souÿasné doby. Tuto kanadskou umĚlkyni hudební svĚt oznaÿuje za „Sinatru v sukních“. Na kontĚ má nespoÿet vyprodaných koncertŢ a témĚŐ za každé její album byla Diana Krall nominována na prestižní cenu Grammy. Dvakrát také tuto cenu získala. Její poslední album „Quiet Nights“ je ovlivnĚno stylem bossa nova a baladami. Diana Krall vystoupí v þeské republice již po tŐetí. Poprvé to bylo v prosinci roku 2004 v holešovické T-mobile arénĚ, poté v listopadu 2009 v Kongresovém centru, kdy byl její koncert beznadĚjnĚ vyprodán, a letos vystoupí na témže místĚ a to 12. listopadu. Diana Krall, a prominent Jazz pianist, composer and singer, represents the top of the current Jazz art. The musical world calls this Canadian artist “Sinatra in Skirts”. Many of her concerts have been sold out and she has been nominated for the prestigious Grammy Award for nearly all her albums. She has also won this award twice. Her latest album, “Quiet Nights”, is inÁuenced by ballads and the Bossa Nova style of music.

182

Diana Krall will perform in the Czech Republic for the third time. She performed for the Àrst time in December 2004 in the T-Mobile Arena in Holešovice, then in November 2009 in the Congress Centre, where her concert was totally sold out. This year, she is going to perform in the same venue on the 12th November. ǐǬǵǬǹǬ ǖǼǺǷǷ, ǮDZǰǿȅǬȋ ǰDzǬdzǺǮǬȋ ǻǴǬǹǴǽǾǶǬ, ǶǺǸǻǺdzǴǾǺǼ Ǵ ǻDZǮǴȂǬ ǹǬȁǺǰǴǾǽȋ ǹǬ ǮDZǼȄǴǹDZ ǰDzǬdzǺǮǺǯǺ ǴǽǶǿǽǽǾǮǬ ǽǺǮǼDZǸDZǹǹǺǽǾǴ. ǩǾǿ ǶǬǹǬǰǽǶǿȊ ǻǼDZǰǽǾǬǮǴǾDZǷȈǹǴȂǿ ǾǮǺǼȃDZǽǶǴȁ ǻǼǺȀDZǽǽǴǵ Ǯ ǸǿdzȇǶǬǷȈǹǺǸ ǸǴǼDZ ǹǬdzȇǮǬȊǾ «ǝǴǹǬǾǼǬ Ǯ ȊǭǶDZ”. ǚǹǬ ǽǺǭǴǼǬDZǾ dzǬǷȇ ǹǬ ǭDZǽȃǴǽǷDZǹǹȇȁ ǶǺǹȂDZǼǾǬȁ, Ǵ ǻǼǬǶǾǴȃDZǽǶǴ ǶǬDzǰȇǵ DZDZ ǬǷȈǭǺǸ ǹǺǸǴǹǴǼǺǮǬǹ ǹǬ ǻǼDZǽǾǴDzǹǿȊ ǻǼDZǸǴȊ ǏǼȉǸǸǴ. ǛǼǴȃDZǸ ǺǹǬ ǿDzDZ ǰǮǬDzǰȇ ǻǺǷǿȃǴǷǬ ȉǾǿ ǹǬǯǼǬǰǿ. ǙǬ DZDZ ǻǺǽǷDZǰǹǴǵ ǬǷȈǭǺǸ “Quiet Nights” ǻǺǮǷǴȋǷǴ ǭǬǷǷǬǰȇ Ǵ ǽǾǴǷȈ «ǭǺǽǽǬ-ǹǺǮǬ» (Ǯ ǻDZǼDZǮǺǰDZ ǽ ǻǺǼǾǿǯǬǷȈǽǶǺǯǺ «ǹǺǮǺDZ ǿǮǷDZȃDZǹǴDZ»). ǐǬǵǬǹǬ ǖǼǺǷǷ ǮȇǽǾǿǻǴǾ Ǯ ǣDZȄǽǶǺǵ ǼDZǽǻǿǭǷǴǶDZ ǿDzDZ Ǯ ǾǼDZǾǴǵ ǼǬdz. ǛDZǼǮȇǵ ǼǬdz DZDZ ǶǺǹȂDZǼǾ ǽǺǽǾǺȋǷǽȋ Ǯ ǰDZǶǬǭǼDZ 2004 ǯǺǰǬ ǹǬ ǻǷǺȅǬǰǶDZ «T-Mobile Arena» Ǯ ǏǺǷDZȄǺǮǴȂǬȁ, dzǬǾDZǸ Ǯ ǹǺȋǭǼDZ 2009 ǯǺǰǬ Ǯ ǖǺǹǯǼDZǽǽ-ȂDZǹǾǼDZ ǛǼǬǯǴ (ǹǬ ȉǾǺ ǮȇǽǾǿǻǷDZǹǴDZ ǭȇǷǴ ǼǬǽǶǿǻǷDZǹȇ ǮǽDZ ǭǴǷDZǾȇ), Ǯ ȉǾǺǸ ǯǺǰǿ 12 ǹǺȋǭǼȋ ǺǹǬ ǭǿǰDZǾ ǮȇǽǾǿǻǬǾȈ ǹǬ ǾǺǸ DzDZ ǸDZǽǾDZ.


“Tma je pro ošklivé lidi” Světlovody Lightway přivedou zdarma zdravé denní světlo do míst, kde přes den musí svítit žárovka či zářivka. Snižte svoje účty za elektřinu.

www.lightway.cz


PRVNÍ UNIKÁTNÍ BUTIK ZNAČKY HUNTER S NÁZVEM JUST YOUR FRIEND... OTEVŘEN V PRAZE NA ÚJEZDĚ THE FIRST DISTINCTIVE BOUTIQUE BY THE HUNTER BRAND “JUST YOUR FRIEND...” HAS OPENED IN ÚJEZD, PRAGUE ǛǑǜǎǧǕ ǟǙǔǖnjǗǨǙǧǕ ǍǟǞǔǖ ǘnjǜǖǔ «HUNTER» Ǜǚǐ ǙnjǓǎnjǙǔǑǘ «JUST YOUR FRIEND...» ǚǞǖǜǧǗǝǫ ǎ ǛǜnjǏǑ Ǚnj ǟǑǓǐǑ Nový butik Just your friend... s kompletním sortimentem produktŢ, které uspokojí i ty nejnároÿnĚjší pŐedstavy o dokonalé péÿi o ÿtyŐnohé pŐátele, je otevŐen v centru Prahy, na ÚjezdĚ 35. Nádherné ruÿnĚ šité obojky a vodítka z té nejlepší kŢže, pohodlné pelíšky, invenÿní hraÿky, kartáÿe, šampóny, módní a funkÿní psí obleÿky nejrŢznĚjších rozmĚrŢ a provedení... Nechybí ani pamlsky z domácí pekárny. Praha má tak koneÿnĚ místo, které majitelé psŢ a koÿek dosud našli jen v tĚch nejvĚtších svĚtových metropolích jako je Londýn ÿi New York. V nabídce butiku je zastoupena pŐedevším prestižní nĚmecká znaÿka Hunter. ZamĚŐení prodejny Just your friend... na zboží prvotŐídní kvality do znaÿné míry odráží ÀlozoÀi a priority této respektované znaÿky. The new ”Just your friend...” boutique with a complete selection of products to satisfy even the most demanding ideas for the perfect care of our four-footed friends, has opened in the centre of Prague, at Újezd 35. Beautifully handmade collars and leashes sewn from the best leather, comfortable beds, inventive toys, brushes, shampoos, fashionable and functional dog clothes in various sizes and styles... There are also homemade delicacies from a home bakery. Prague has Ànally got the store which dog- and cat-owners have only been able to Ànd in the largest global metropolises such as London and New

184

York. Hunter, the prestigious German brand, is primarily represented in the boutique’s selection. The orientation of the “Just your friend...” boutique on premium quality products reÁects in large measure the philosophy and priorities of this respected brand. ǙǺǮȇǵ ǭǿǾǴǶ «Just your friend...» ǽ ǻǺǷǹȇǸ ǬǽǽǺǼǾǴǸDZǹǾǺǸ ǻǼǺǰǿǶȂǴǴ, ǽǻǺǽǺǭǹǺǵ ǿǰǺǮǷDZǾǮǺǼǴǾȈ ǰǬDzDZ ǽǬǸȇDZ ǾǼDZǭǺǮǬǾDZǷȈǹȇDZ ǻǺDzDZǷǬǹǴȋ ǻǺ ǴǰDZǬǷȈǹǺǸǿ ǿȁǺǰǿ dzǬ ȃDZǾǮDZǼǺǹǺǯǴǸǴ ǰǼǿdzȈȋǸǴ, ǺǾǶǼȇǷǽȋ Ǯ ȂDZǹǾǼDZ ǛǼǬǯǴ, ǻǺ ǬǰǼDZǽǿ: Újezd, 35. ǎǺǽȁǴǾǴǾDZǷȈǹȇDZ, ǽȄǴǾȇDZ ǮǼǿȃǹǿȊ ǺȄDZǵǹǴǶǴ Ǵ ǻǺǮǺǰǶǴ Ǵdz ǽǬǸǺǵ ǷǿȃȄDZǵ Ǵ ǮȇǽǺǶǺǶǬȃDZǽǾǮDZǹǹǺǵ ǶǺDzǴ, ǿǰǺǭǹȇDZ ǻǺǽǾDZǷȈǶǴ, ǴdzǺǭǼDZǾǬǾDZǷȈǹȇDZ ǴǯǼǿȄǶǴ, ȅDZǾǶǴ, ȄǬǸǻǿǹǴ, ǸǺǰǹǬȋ Ǵ ȀǿǹǶȂǴǺǹǬǷȈǹǬȋ ǺǰDZDzǰǬ ǰǷȋ ǽǺǭǬǶ ǼǬdzǹȇȁ ǼǬdzǸDZǼǺǮ Ǵ ǶǺǹǽǾǼǿǶȂǴǵ ... ǑǽǾȈ ǾǬǶDzDZ ǷǬǶǺǸǽǾǮǬ Ǵdz ǰǺǸǬȄǹDZǵ ǻDZǶǬǼǹǴ. ǙǬǶǺǹDZȂ, Ǵ Ǯ ǛǼǬǯDZ DZǽǾȈ ǸDZǽǾǺ, ǻǺǰǺǭǹǺDZ ǾDZǸ, ǶǺǾǺǼȇDZ ǮǷǬǰDZǷȈȂȇ ǽǺǭǬǶ Ǵ ǶǺȄDZǶ ǰǺ ǽǴȁ ǻǺǼ ǹǬȁǺǰǴǷǴ ǾǺǷȈǶǺ Ǯ ǶǼǿǻǹDZǵȄǴȁ ǯǺǼǺǰǬȁ ǸǴǼǬ, ǾǬǶǴȁ ǶǬǶ ǗǺǹǰǺǹ ǴǷǴ ǙȈȊ-ǕǺǼǶ. ǎ ǻǼDZǰǷǺDzDZǹǴǴ ǭǿǾǴǶǬ ǻǼDZǰǽǾǬǮǷDZǹǬ Ǯ ǺǽǹǺǮǹǺǸ ǻǼDZǽǾǴDzǹǬȋ ǹDZǸDZȂǶǬȋ ǸǬǼǶǬ Hunter. njǶȂDZǹǾ ǸǬǯǬdzǴǹǬ «Just your friend...» ǹǬ ǻDZǼǮǺǶǷǬǽǽǹǺDZ ǶǬȃDZǽǾǮǺ ǻǼǺǰǿǶȂǴǴ Ǯ dzǹǬȃǴǾDZǷȈǹǺǵ ǸDZǼDZ ǺǾǼǬDzǬDZǾ ȀǴǷǺǽǺȀǴȊ Ǵ ǻǼǴǺǼǴǾDZǾȇ ȉǾǺǯǺ ǿǮǬDzǬDZǸǺǯǺ ǭǼDZǹǰǬ. www.justyourfriend.cz


„Luxus není o ceně, ale o jedinečnosti.”

Mít doma svůj šperk Art Deco Original Jedinečná prodejní galerie Art Deco nábytku, obrazová galerie a interierové doplňky ve stylu 20. - 30. let.

Art Deco & Antiques Galerie a showroom - Husitská 22, Praha 3 Galerie - Art Deco Shop - Kozí 9, Praha 1 e-mail: info@galerie22.cz, www.galerie22.cz

SPORTALM Podzim–Zima 2012/13 www.fggroup.cz


LIFESTYLE | LIFESTYLE | ǝǞǔǗǨ ǒǔǓǙǔ Dámská kabelka Louis Vuitton www.louisvuitton.com

pietro ¿lipi dámské kotníkové boty na podpatku z kolekce podzim zima 2012/2013 www.pietro-filipi.com

Limitovaná vánoþní kolekce vonných svíþek Diptyque Arabian Nights Rubínově rudá Oud Ambré vyzařuje nezaměnitelné temné, zemité a kouřové aroma vzácného agarového dřeva prozářené teplým ambrovým akordem. Cena 1 250 Kč. www.simpleconcept.cz

for you inspiration Louis Vuitton – kultovní kabelka Petit Noé Z kůže Epi v nových kouzelných barvách. Cena verze tricolor 27 000 Kč. www.louisvuitton.com

Vertu – Constellation Quest Blue Nový model telefonu, limitovaný počtem 77 kusů! Tělo telefonu je ručně vyrobené z leštěné ultra-tvrdé PVD nerezové oceli, má vklady z modrého karbonového vlákna a klávesnici z modře kovového safírového křišťálu. Kůže je vyvedená ve dvou tónech modré barvy a je pogumovaná. Cena 215 700 Kč s daní. www.vertu.com

Pánské polobotky Louis Vuitton www.louisvuitton.com 186

Crabtree & Evelyn Noël sada tĜí menších svíþek Svíčky jsou prezentovány v krásných skleněných obalech v sytých barvách Vánoc. Ideální sestava, kterou můžete rozmístit po celém domě. Cena 1250 Kč. www.crabtree-evelyn.cz

Veuve Clicquot La Grande Dame Rosé 2004 – dáma v rĤžovém Víno ideální jako aperitiv a společník předkrmů z korýšů, ryb, uzeného nebo soleného masa. Podává se při teplotě 10 až 12°C a je určeno ke konzumaci do roku 2025. Cena 6 800 Kč. www.veuve-clicquot.com


3Ĺ?t 3Ĺ?tPĂŤGRYR]FHVW\ORYpKRQiE\WNX 5XĂżQÄ&#x161;Y\Ĺ?H]iYDQĂŤVWDURĂŚLWQĂŤD]iPHFN\QiE\WHN]PDVLYXYäHFKVW\OŢ 5X 800 m2SURGHMQtSORFK\YtFHQHĂŚSRORĂŚHNLKQHGNRGEÄ&#x161;UX]DEH]NRQNXUHQĂżQtFHQ\ 80 =DĹ?L]XMHPHWpĂŚ]iPN\KLVWRULFNpREMHNW\OHWQtVtGODUHVWDXUDFHDSRG =D Maloobchod Ma i velkoobchod.

â&#x20AC;&#x17E;Ĺ irokĂ˝ sortiment exkluzivnĂ­ch, podle originĂĄlnĂ­ch SĹ?HGORKUXĂżQÄ&#x161;Y\Ĺ?H]iYDQĂŤFK]SUDFRYiQtPDPDWHULiOHP  RGRULJLQiOXWpPÄ&#x161;Ĺ?QHUR]H]QDWHOQĂŤFKNRSLtVW\ORYpKRQiE\WNX´ â&#x20AC;&#x153;A wide range of exclusive copies of stylish furniture, hand-crafted according to the originals, almost indistinguishable from them.â&#x20AC;? Ă&#x2026;ǤǴǟǺǜǴǾÇŽČ&#x2021;ǭǺǟČ&#x2030;ǜǽǜǡČ&#x160;dzǴǎǚǺǾǿǜǟǏČ&#x201E;ǹǚǚǺǾǟǿČ&#x192;ǚǺǾǟǹdzČ&#x2C6;ǭǺǾǝǺǺǟǴǯǴǚǏǡČ&#x2C6;ÇšČ&#x2021;ǸǸǺǰǹǡČ&#x2039;Ǹ ǽǎǺǹǾǺǭǟǏǭǺǞǜǺǾÇ´ǸǏǞǹǟǴǏǡǺǸǝǺČ&#x192;ǞǴǚǹǺǞǡǴČ&#x192;ǴǸǺǾǺǞǺǟǴǯǴǚǏǡǏǜǺǝǴǾǽǞǴǡČ&#x2C6;ǚǺǾǸǹǭǹǡǴ´

Di Direct importer of stylish furniture Hand-crafted solid wood antique and chateau furniture in all styles Ha 800 m² sales area we offer over 1,500 items for immediate delivery 80 at unbeatable prices We also furnish chateaux, historical premises, summer homes etc. W Re Retail and wholesale

Ç&#x203A;ÇźČ&#x2039;ǸǺǾǴǸǝǺǟǞǹǟǽǞǴǡČ&#x2C6;ǚǺǾǸǹǭǹǡǴ Ç&#x153;ǹdzǚǏČ&#x2039;ǟǿČ&#x192;ǚǺǾǟǏǭǺǞČ&#x2021;ǏǚǞǴǜǎǏǟǚǏČ&#x2039;Ç´dzǏǸǜǺǎǏČ&#x2039;ǸǹǭǹǡČ&#x2C6;ÇŽÇ˝ÇąČ ǽǞǴǡǹǾ Ǹ2ǞǺǟǯǺǎǺǾǝǡǺČ&#x2026;ÇŹÇ°Ç´ǸČ&#x2021;ǝǟǹǰǡǏǯǏǹǸǭǺǡǹǹ1500 ǚǏǴǸǹǚǺǎǏǚǴǾǸǹǭǹǡǴǝǺǿǚǴǜǏǡČ&#x2C6;ÇšČ&#x2021;ǸČ&#x201A;ǹǚǏǸ Ç&#x2DC;ǹǭǡǴǟǿǹǸdzǏǸǜǴǴǽǞǺǟǴČ&#x192;ǹǽǜǴǹǺǭČ&#x2020;ǹǜǞČ&#x2021;ǡǹǞǚǴǹǿǽǏǰČ&#x2C6;Ç­Č&#x2021;ǴǞǰ Ç&#x153;ǺdzǚǴČ&#x192;ǚǏČ&#x2039;Ç´ǺǝǞǺǎǏČ&#x2039;ǞǺǟǯǺǎǡČ&#x2039;

www.zameckynabytek.cz w ZĂĄ ZĂĄmeckĂ˝ NĂĄbytek Â&#x2021;2VHNQDG%HĂżYRXÂ&#x2021;  Â&#x2021;LQIR#]DPHFN\QDE\WHNF]


Text | Zuzana Prokopová Foto | © JiŐí Havran

Galerie Jaroslava Fragnera

www.gjf.cz

JIŘÍ HAVRAN: FROM ARCHITECTURE NORSKÁ ARCHITEKTURA SE OPęT PŏEDSTAVÍ V PRAŽSKÉ GALERII JAROSLAVA FRAGNERA. TENTOKRÁT SE ALE NEBUDE JEDNAT O PREZENTACI REALIZACÍ SEVERSKÝCH AUTORš, ALE O FOTOGRAFIE ARCHITEKTURY þESKÉHO EMIGRANTA JIŏÍHO HAVRANA PšSOBÍCÍHO V OSLU TAKŏKA þTYŏICET LET.

NORWEGIAN ARCHITECTURE ONCE AGAIN WILL BE INTRODUCED IN PRAGUE’S JAROSLAV FRAGNER GALLERY. HOWEVER, THIS TIME IT WILL NOT BE A PRESENTATION OF IMPLEMENTATIONS BY NORDIC CREATORS, BUT PHOTOGRAPHS OF ARCHITECTURE BY CZECH EMIGRANT, JIŏÍ HAVRAN, WHO HAS WORKED IN OSLO FOR ALMOST 40 YEARS.

þeské publikum mĚlo pŐíležitost setkat se s jeho tvorbou v této galerii již dvakrát v rámci jiných projektŢ dokumentující norskou architekturu (martin.roubík.architekt|SNØHETTA.ROM.ARFO, 2009; Souÿasná norská architektura #7, 2012). Od 26. Őíjna budou mít návštĚvníci možnost poznat i další odvĚtví bohaté tvorby tohoto vyhledávaného fotografa architektury.

Czech audiences have had the opportunity to view his work in this Gallery twice already within other projects documenting Norwegian architecture (martin. roubík.architekt | SNØHETTA.ROM.ARFO, 2009; Contemporary Norwegian Architecture #7, 2012). From 26th October, visitors will also have the opportunity to see another sphere of the rich creative activity of this sought-after architectural photographer.

JiŐí Havran odešel do Norska v roce 1974, kde si bĚhem dvaceti let vybudoval velké renomé coby fotograf architektury. Ve své tvorbĚ se zabývá rŢznorodými tématy, dokumentoval napŐ. chatky v zahrádkáŐských koloniích a lidovou tvoŐivost, která se na nich v prŢbĚhu doby podepsala, norský i ÿeský brutalismus, železniÿní stavby inspirované düsseldorfskou fotograÀckou školou, ale samozŐejmĚ také tradiÿní severské dŐevostavby ÿi neuvĚŐitelnĚ pŢsobivé a velmi funkÿní stavby v divoké pŐírodĚ - Národní turistické trasy v Norsku.

188

JiŐí Havran left for Norway in 1974, where during 20 years he built a great reputation for himself as an architectural photographer. He deals with diverse topics in his work. For example, he has documented cottages in gardening colonies and the folk creativity which left its traces in them over time, Norwegian and Czech brutalism, railway constructions inspired by the Düsseldorf School of Photography, as well as, of course, the traditional Nordic wooden houses and incredibly impressive and very functional buildings in the wilds of the Norwegian national tourist routes.


ǙǚǜǎǑǒǝǖnjǫ njǜǡǔǞǑǖǞǟǜnj ǍǟǐǑǞ ǎǙǚǎǨ ǛǜǑǐǝǞnjǎǗǑǙnj ǎ ǛǜnjǒǝǖǚǕ ǏnjǗǑǜǑǑ ǫǜǚǝǗnjǎnj ǠǜnjǏǙǑǜnj. Ǚǚ Ǚnj ǩǞǚǞ ǜnjǓ ǜǑǣǨ ǙǑ ǔǐǑǞ ǚ ǛǜǑǓǑǙǞnjǢǔǔ ǜǑnjǗǔǓnjǢǔǕ ǝǑǎǑǜǙǧǡ njǎǞǚǜǚǎ, ǛǚǝǑǞǔǞǑǗǔ ǝǘǚǏǟǞ ǟǎǔǐǑǞǨ ǠǚǞǚǏǜnjǠǔǔ njǜǡǔǞǑǖǞǟǜǧ ǣǑǤǝǖǚǏǚ ǩǘǔǏǜnjǙǞnj Ǖǔǜǒǔ ǏnjǎǜnjǙnj, ǜnjǍǚǞnjǪǥǑǏǚ ǎ ǚǝǗǚ ǛǚǣǞǔ ǝǚǜǚǖ ǗǑǞ. ǣDZȄǽǶǬȋ ǻǿǭǷǴǶǬ ǴǸDZǷǬ ǮǺdzǸǺDzǹǺǽǾȈ ǺdzǹǬǶǺǸǴǾȈǽȋ ǽ DZǯǺ ǾǮǺǼȃDZǽǾǮǺǸ Ǯ ȉǾǺǵ ǯǬǷDZǼDZDZ ǿDzDZ ǰǮǬDzǰȇ Ǯ ǼǬǸǶǬȁ ǰǼǿǯǴȁ ǻǼǺDZǶǾǺǮ, ǰǺǶǿǸDZǹǾǴǼǿȊȅǴȁ ǹǺǼǮDZDzǽǶǿȊ ǬǼȁǴǾDZǶǾǿǼǿ (martin.roubík.architekt|SNØHETTA.ROM.ARFO, 2009; Souÿasná norská architektura #7, 2012). ǝ 26 ǺǶǾȋǭǼȋ ǻǺǽDZǾǴǾDZǷǴ ǭǿǰǿǾ ǴǸDZǾȈ ǮǺdzǸǺDzǹǺǽǾȈ ǻǺdzǹǬǶǺǸǴǾȈǽȋ Ǵ ǽ ǰǼǿǯǴǸǴ ǺǾǮDZǾǮǷDZǹǴȋǸǴ ǺǭȄǴǼǹǺǯǺ ǾǮǺǼȃDZǽǾǮǬ ȉǾǺǯǺ ǻǺǻǿǷȋǼǹǺǯǺ ȀǺǾǺǯǼǬȀǬ ǬǼȁǴǾDZǶǾǿǼȇ. ǕǴǼDzǴ ǏǬǮǼǬǹ ǿDZȁǬǷ Ǯ ǙǺǼǮDZǯǴȊ Ǯ 1974 ǯǺǰǿ, ǾǬǸ Ǯ ǾDZȃDZǹǴDZ ǰǮǬǰȂǬǾǴ ǷDZǾ ǽǺdzǰǬǷ ǽDZǭDZ ǺǾǷǴȃǹǿȊ ǼDZǻǿǾǬȂǴȊ Ǯ ǶǬȃDZǽǾǮDZ ȀǺǾǺǯǼǬȀǬ ǬǼȁǴǾDZǶǾǿǼȇ. ǎ ǽǮǺDZǸ ǾǮǺǼȃDZǽǾǮDZ Ǻǹ ǼǬǽǽǸǬǾǼǴǮǬDZǾ ǼǬdzǷǴȃǹȇDZ ǾDZǸȇ, ǹǬǻǼǴǸDZǼ, ǾǬǶǴDZ ǶǬǶ ǰǺǶǿǸDZǹǾǬǷȈǹǺDZ ǺǾǺǭǼǬDzDZǹǴDZ ǽǬǰǺǮȇȁ ǰǺǸǴǶǺǮ Ǯ ǰǬȃǹȇȁ ǻǺǽDZǷǶǬȁ Ǵ ǺǾǼǬdzǴǮȄDZǯǺǽȋ Ǯ ǹǴȁ ǹǬǼǺǰǹǺǯǺ ǾǮǺǼȃDZǽǾǮǬ –ǽǻǿǾǹǴǶǬ ǮǼDZǸDZǹǴ, Ǯ ǶǺǾǺǼǺǸ ǺǹǴ ǮǺdzǹǴǶǷǴ, ǹǺǼǮDZDzǽǶǴǵ Ǵ ȃDZȄǽǶǴǵ ǭǼǿǾǬǷǴdzǸ, DzDZǷDZdzǹǺǰǺǼǺDz-

ǹȇDZ ǻǺǽǾǼǺǵǶǴ, ǮǰǺȁǹǺǮǷDZǹǹȇDZ ǐȊǽǽDZǷȈǰǺǼȀǽǶǺǵ ȄǶǺǷǺǵ ȀǺǾǺǯǼǬȀǴǴ, ǹǿ, Ǵ ǶǺǹDZȃǹǺ, ǾǼǬǰǴȂǴǺǹǹȇDZ ǽDZǮDZǼǹȇDZ ǰDZǼDZǮȋǹǹȇDZ ǻǺǽǾǼǺǵǶǴ ǴǷǴ ǹDZǮDZǼǺȋǾǹǺ ǮǻDZȃǬǾǷȋȊȅǴDZ Ǵ ǺȃDZǹȈ ȀǿǹǶȂǴǺǹǬǷȈǹȇDZ ǻǺǽǾǼǺǵǶǴ Ǯ ǰǴǶǺǵ ǻǼǴǼǺǰDZ – ǙǬȂǴǺǹǬǷȈǹȇDZ ǾǿǼǴǽǾǴȃDZǽǶǴDZ ǸǬǼȄǼǿǾȇ Ǯ ǙǺǼǮDZǯǴǴ. ǍǺǷȈȄǿȊ ȃǬǽǾȈ DZǯǺ ǼǬǭǺǾ ǽǺǽǾǬǮǷȋȊǾ ȁǿǰǺDzDZǽǾǮDZǹǹȇDZ ȀǺǾǺǯǼǬȀǴǴ, Ǯ ǶǺǾǺǼȇȁ ǽǹǺǮǬ ǺǾǼǬDzǬDZǾǽȋ ǾDZǸǬ ǬǼȁǴǾDZǶǾǿǼȇ, Ǭ ǾǬǶDzDZ ǼǬǭǺǾȇ ǽ ȀǴǯǿǼǺǵ Ǵ ǰǼǿǯǴǸǴ ǽȊDzDZǾǬǸǴ. ǙDZ ǸDZǹDZDZ ǮǬDzǹȇǸ ǾǮǺǼȃDZǽǶǴǸ ǻǼǺȋǮǷDZǹǴDZǸ ǰDZȋǾDZǷȈǹǺǽǾǴ ǕǴǼDzǴ ǏǬǮǼǬǹǬ ȋǮǷȋDZǾǽȋ ǴdzǰǬǾDZǷȈǽǾǮǺ ǶǹǴǯ Ǯ ǼǬǸǶǬȁ ǴdzǰǬǾDZǷȈǽǾǮǬ Ǵ ȀǺǾǺǽǾǿǰǴǴ ARFO, ǶǺǾǺǼȇDZ Ǻǹ ǺǽǹǺǮǬǷ ǽǺǮǸDZǽǾǹǺ ǽ ǬǼȁǴǾDZǶǾǺǼǺǸ ǘǬǼǾǴǹǺǸ ǜǺǿǭǴǶǺǸ (Snøhetta, ROM) Ǯ 1996 ǯǺǰǿ. ǖǼǿǻǹǺȀǺǼǸǬǾǹȇDZ ǴdzǺǭǼǬDzDZǹǴȋ ǕǴǼDzǴ ǏǬǮǼǬǹǬ ǭǿǰǿǾ ǮȇǽǾǬǮǷDZǹȇ Ǯ ǏǬǷDZǼDZDZ ǫǼǺǽǷǬǮǬ ǠǼǬǯǹDZǼǬ ǰǺ 9 ǰDZǶǬǭǼȋ 2012 ǯǺǰǬ. ǖ ǮȇǽǾǬǮǶDZ ǭȇǷ ǴdzǰǬǹ ǺǭȄǴǼǹȇǵ ȃDZȄǽǶǺ-ǬǹǯǷǴǵǽǶǴǵ ǶǬǾǬǷǺǯ. ǕǴǼDzǴ ǏǬǮǼǬǹ ǼǺǰǴǷǽȋ Ǯ 1953 ǯǺǰǿ Ǯ ǞDZǻǷǴȂDZ. ǝ 1974 ǯǺǰǬ Ǻǹ DzǴǮDZǾ Ǯ ǙǺǼǮDZǯǴǴ, ǯǰDZ dzǬǼDZǶǺǸDZǹǰǺǮǬǷ ǽDZǭȋ ǶǬǶ ǺǰǴǹ Ǵdz ǮDZǰǿȅǴȁ ȀǺǾǺǯǼǬȀǺǮ ǬǼȁǴǾDZǶǾǿǼȇ. ǚǹ ǿȃǬǽǾǮǺǮǬǷ Ǯ ǮǺdzǹǴǶǹǺǮDZǹǴǴ ǼȋǰǬ ǸǹǺǯǺȃǴǽǷDZǹǹȇȁ ǻǿǭǷǴǶǬȂǴǵ ǻǺ ǮǺǻǼǺǽǬǸ ǽǺǮǼDZǸDZǹǹǺǵ Ǵ ǹǬǼǺǰǹǺǵ ǬǼȁǴǾDZǶǾǿǼȇ. ǑǯǺ ǼǬǭǺǾȇ ǮȇǽǾǬǮǷȋǷǴǽȈ ǹǬ ǸǹǺǯǴȁ ǴǹǰǴǮǴǰǿǬǷȈǹȇȁ Ǵ ǯǼǿǻǻǺǮȇȁ ǮȇǽǾǬǮǶǬȁ Ǯ ǙǺǼǮDZǯǴǴ Ǵ dzǬ ǼǿǭDZDzǺǸ, ǾǬǶDzDZ ǻǼDZǰǽǾǬǮǷDZǹȇ Ǯ ǹDZǽǶǺǷȈǶǴȁ ǶǺǷǷDZǶȂǴȋȁ. ǠǺǾǺǯǼǬȀǴDZǵ ǬǼȁǴǾDZǶǾǿǼȇ ǴǹǾDZǹǽǴǮǹǺ dzǬǹǴǸǬDZǾǽȋ, ǹǬȃǴǹǬȋ ǽ ǶǺǹȂǬ 80-ȁ ǷDZǾ. ǚǹ DzǴǮDZǾ Ǵ ǼǬǭǺǾǬDZǾ Ǯ ǚǽǷǺ.

189


Velkou ÿást jeho díla tvoŐí rovnĚž umĚlecké fotograÀe, ve kterých se opĚt odráží téma architektury, ale také práce s Àgurou a dalšími námĚty. NeménĚ významnou tvŢrÿí aktivitou JiŐího Havrana je vydávání knih v rámci nakladatelství a fotostudia ARFO, které spoluzakládal v roce 1996 s architektem Martinem Roubíkem (Snøhetta, ROM). Velkoformátové snímky JiŐího Havrana budou v Galerii Jaroslava Fragnera vystaveny až do 9. prosince. K výstavĚ je vydán i obsáhlý ÿesko-anglický katalog.

A large part of his work is also artistic photography, which again reÁects the theme of architecture, but also work with Àgures and other themes. An equally important part of the creativity of JiŐí Havran is the publication of books in the ARFO publishing house and photo studio, which he co-founded in 1996 with architect Martin Roubík (Snøhetta, ROM). Large-format photographs by JiŐí Havran will be exhibited in the Jaroslav Fragner Gallery until 9th December. The exhibition is accompanied by an extensive Czech-English catalogue.

JiŐí Havran se narodil v roce 1953 v Teplicích. V Norsku žije od roku 1974, kde se etabloval jako jeden z pŐedních fotografŢ architektury. Podílel se na vzniku Őady publikací o moderní i lidové architektuŐe. Vystavoval na mnoha samostatných a skupinových výstavách v Norsku i zahraniÿí, rovnĚž je zastoupen v nĚkolika sbírkách. Fotografování architektury se intenzivnĚ vĚnuje od konce 80. let. Žije a pracuje v Oslu.

JiŐí Havran was born in 1953 in Teplice. He has lived in Norway since 1974, where he established himself as a leading architectural photographer. He has participated in the creation of numerous publications on modern and folk architecture. He has exhibited in many individual and group exhibitions in Norway and abroad, and is also represented in several collections. He has been intensively engaged in the photography of architecture since the late 1980s. He lives and works in Oslo.

190


Adresáø realitních kanceláøí

Pøipravili jsme pro vás pøehledný seznam adres a kontaktù, které by vás mohly zajímat. We have prepared a comprehensive list of addresses and contacts that might interest you.

Real Estate Agencies Directory

ESTATE doporuÿuje / ESTATE Recommends / ESTATE ǼDZǶǺǸDZǹǰǺǮǬǹǹȇǵ AUSCH REAL ESTATE, Zborovská 49, 150 00

Praha 5, Tel.: +420 739 830 300, Fax: +420 222 251 564, E-mail: info@ausch.eu, www.ausch.eu •

BRANCO REALITY, Zengrova 911, 280 02 Kolín, Tel.: +420 321 719 097, Tel.: +420 321 719 100, Mob.: +420 737 202 802, E-mail: info.brancoreality@seznam.cz, www. brancoreality.com • CENTURY 21 Aba Reality, Paříkova 910/9, 190 00 Praha 9 - Vysočany, Tel.: +420 246 035 393, E-mail: abareality@century21.cz, www.century21.cz • CENTURY 21 Action, Masarykovo nábřeží 2, 120 00 Praha 2 - Nové Město, Tel.: +420 777 702 300, E-mail: action@century21.cz, www.century21.cz • CENTURY 21 Alter Ego, Ocelářská 1354/35, 190 00 Praha 9 – Libeň , Tel.: +420 284 080 177, E-mail: alterego@century21.cz, www.century21.cz • CENTURY 21 AZ Reality, Na Dolinách 1276/43, 140 00 Praha 4, Tel.: +420 244 472 027, E-mail: azreality@century21.cz, www.century21.cz • CENTURY 21 Best Reality, Kubánské náměstí 1321/18, 100 00 Praha 10, Tel.: +420 725 293 620, E-mail: robert.sejpka@century21.cz, www.century21.cz • CENTURY 21 Bonus Praha, Korunní 104, 100 00

Praha 10 - Vinohrady, Tel.: +420 246 090 246, E-mail: bonuspraha@century21.cz,

www.century21.cz • CENTURY 21 Elán, Smetanova 240, 250 82 Úvaly, Tel.: +420 281 866 806, E-mail: elan@century21.cz, www.century21.cz • CENTURY 21 Energy, Korunní 1167/43,120 00 Praha 2 - Vinohrady, Tel.: +420 720 150 000, E-mail: energy@century21.cz, www.century21.cz • CENTURY 21 K+K Consulting Praha, Sladkovského náměstí 525/1, 130 00 Praha 3, Tel.: +420 222 741 850, E-mail: kkpraha@century21.cz, www.century21.cz • CENTURY 21 Plus+, Jankovcova 1596/14, 170 00 Praha 7, Tel.: +420 725 293 500 , E-mail: plus@century21.cz, www.century21.cz • CENTURY 21 Real servis, Koněvova 182, 130 00 Praha 3, Tel.: +420 222 542 103, E-mail: realservis@century21.cz, www.century21.cz • CENTURY 21 Reality 21, Na Poříčí 1071/17, 110 00 Praha 1, Tel.: +420 271 122 711, E-mail: info.reality21@century21.cz, www.century21.cz • CENTURY 21 Reality Anděl, Ostrovského 253/3, 150 00 Praha 5, Tel.: +420 257 220 224, E-mail: realityandel@century21.cz, www.century21.cz • CENTURY 21 Reality Express, Václavské nám. 56, 110 00 Praha 1 - Nové Město, Tel.: +420 608 300 600, E-mail: realityexpress@century21.cz, www.century21.cz • CENTURY 21 Tandem, Perlová 3, 110 00 Praha 1, Tel.: +420 224 267 544, E-mail: tandem@century21.cz, www.century21.cz • Czech Buildings, s.r.o., Ostrovského 23 , 150 00 Praha 5 , Tel.: +420 605 230 131, E-mail: info@czechbuildings.cz, www.czechbuildings.cz • Engel & Völkers Prague, s.r.o., Senovážné nám. 19, 110 00 Praha 1, tel.: +420 222 240 304, www.engelvoelkers.com/prag • FARAON reality, s.r.o., Polská 26, 120 00 Praha 2 - Vinohrady, Tel.: +420 224 829 322, Fax: +420 222 310 484, hotline: 800 400 407, E-mail: info@faraon.cz, www.faraon.cz • Happy House Rentals, Jungmannova 30, 110 00 Praha 1, Tel.: +420 224 947 623, Fax: +420 224 947 624, E-mail: info@happyhouserentals.com, www.happyhouserentals.com • CHIRŠ realitní kanceláře, Pobočka Červený Vrch, Evropská 695/73, Praha 6, Tel.: +420 737 780 071, E-mail: cervenyvrch@chirs.cz, www.chirs.cz • IMMOINVEST Group s.r.o., Mánesova 57, 120 00

Praha 2 - Vinohrady, Tel.: +420 246 090 090, Fax:

+420 246 090 099, E-mail: info@immo-invest.cz, www.immoinvest-group.cz • KRR – Development, a.s., Bartoškova 26, 140 00 Praha 4, Tel.: 734 581 221, E-mail: info@azaleaprojekt.cz, www.krr-development.cz • LEXXUS a.s., Millenium Plaza, V Celnici 10, 110 00 Praha 1, Tel.: + 420 221 111 999, E-mail: info@lexxus.cz, www.lexxus.cz • Real-Treuhand Reality a.s., Dlouhá 29, 110 00 Praha 1, tel.: +420 224 816 893, www.rt-reality.cz • Seifert Real, Platnéřská 88/9, 110 00 Praha 1, Tel.: +420 724 800 291, E-mail: info@seifert-real.cz , www.seifert-real.cz • Svoboda & Williams s.r.o., Na Perštýně 2, 110 00 Praha 1, Tel.: +420 257 328 281, E-mail: info@svoboda-williams.com, www.svoboda-williams.com • TIDE REALITY s.r.o., Svobodova 9, 128 00 Praha 2, Tel.: +420 224 914 914, Tel.: +420 224 920 073, Fax: +420 224 920 680, E-mail: info@tide.cz, www.tide.cz •VIP Homes s.r.o., Janáčkovo nábřeží 33, 150 00 Prague 5, Tel.: +420 257 311 227, Mob.: +420 606 731 973, E-mail: viphomes@viphomes.cz, www.viphomes.cz • Y&T Property Investment s.r.o., Václavské náměstí 55, 110 00 Praha 1, Tel: +420 224 282 506, E-mail: info@ytpi.cz, www.YTPI.cz • ZFP developer, s.r.o., Bohdalecká 8, 101 00 Praha 10, Tel.: +420 777 277 377, Fax: +420 272 650 210, E-mail: info@zfpdeveloper.cz, www.bertoluccidesign.cz

Adresáø inzerce ARTA, spol. s r.o., Korunní 41/1166, Praha 2, tel.: +420 226 539 540, e-mail: info@prague-lofts.cz • penShop.cz, Na Záhonech 7, Praha 4, tel.: +420 241 402 925, www.penshop.cz • Bang & Olufsen, Jáchymova 4, Praha 1, tel.: +224 811 234, www.kd-elektronika.cz • 3D H. Interiér, s.r.o., showroom: Rohanské nábř. 7/657, Praha 8, tel.: +420 222 719 541, www.3dh.cz • Conventia, s.r.o., Václavkova 169/1, Praha 6, tel./fax: +420 220 515 102, e-mail: konference@bonafide.cz, www.conventia.cz • Living plus s.r.o., Jankovcova 8, Praha 7, tel: +420 252 544 272, e-mail: info@livingplus.cz, www.livingplus.cz • Century 21 (centrála), Korunní 104, Praha 10, tel: +420 272 651 480, e-mail: centrala@century21.cz, www.century21.cz • MANGHI Czech Republic s.r.o., Pařížská 68/9, Praha 1, tel: +420 224 256 210, e-mail: info@manghi.cz, www.manghi.cz • V Invest CZ, a.s., Na Vidouli 1/1, Praha 5, tel.: +420 233 353 116, e-mail: vinvest@vinvest.cz, www.vinvest.cz • Martin-home, Korunní 1310/56, Praha 2, tel.: +420 776 646 650, +420 774 250 602, e-mail: Nabytekcz@gmail.com, www.nabytekcz.com • RANNÝ ARCHITECTS, Václavkova 1, Praha 6, tel: +420 604 730 338, e-mail: info@ranny.cz, www.ranny.cz • CP Praha s.r.o, Pitterova 2855/13, Praha 3, tel: +420 221 199 999, e-mail: info@centralparkpraha.cz, www.centralparkpraha.cz • Lightway s.r.o., showroom: Hostivická 13/22, Praha 5, tel: +420 235 300 694, e-mail: info@lightway.cz, www.lightway.cz • SATPO Development s.r.o., Plzeňská 3217/16, Praha 5, tel.: 800 800 010, www.satpo.cz • Zámecký Nábytek, Osek nad Bečvou 163, tel. +420 581 793 060, mob: +420 728 777 926, e-mail: info@zameckynabytek.cz, www.zameckynabytek.cz • Vágner Design s.r.o., Vinohradská 33/1420, Praha 2, tel.: +420 222 254 292, www.vagnerdesign.cz • Kreiner, spol. s r.o., Klimentská 36, Praha 1, tel.: 224 811 136, e-mail: praha1@kreiner.cz, www.kreiner.cz • Naty-naty, Senovážné náměstí 10a, Praha 1, tel.: +420 775 566 126, e-mail: pavlina.rosendahl@natynaty.cz, www.natynaty.cz • Bozner, s.r.o., Bělohorská 37, Praha 6, tel.: +420 233 324 324, email: sales@kajetanka.eu, www.kajetanka.eu • Studio Pirsc Porcelain, Husova 332/6, Mikulov, e-mail: info@pirsc.cz, www.pirsc.cz • Klinika GHC Praha, Krakovská 8/581, Praha 1, tel.: +420 222 211 206 (8), e-mail.: ghc@ghc.cz, www.ghc.cz • SEDLÁK INTERIER s.r.o., Vinohradská 10, Praha 2, tel.: +420 224 217 817, e-mail: info@sedlakinterier.cz, www.sedlakinterier.cz • GALERIE 22, Husitská 22, Praha 3, tel: +420 222 717 633, e-mail: info@galerie22.cz, www.galerie22.com • Expatria spol. s r.o., Dlouhá 36, Praha 1, tel: +420 222 321 631, www.boknas.cz


6YÄ?WRYiMHGQLÄ&#x20AC;ND v realitĂĄch

8

6

9

7 1 2

3

10 5

26 .$1&(/Ă&#x2030;ÄĄĂ&#x152;V PRAZE 150 352'(-ÄŠ0Ä&#x17D;6Ă&#x152;Ăż1Ä&#x17D; 4 200 0$./eÄĄÄŠ 5300 1(029,7267Ă&#x152;

1

CENTURY 21 Reality Express 9iFODYVNpQiPÄ?VWt3UDKD WHO

10

CENTURY 21 K + K Consulting 6ODGNRYVNpKRQiPÄ?VWt3UDKD WHO

19

2

CENTURY 21 Tandem 3HUORYD3UDKD WHO

11

CENTURY 21 Real Servis .RQÄ?YRYD3UDKD WHO

CENTURY 21 Reality /HWHQVNpQiPÄ?VWt3UDKD WHO

20

3

CENTURY 21 Reality 21 1D3RĢtÄ&#x20AC;t3UDKD WHO

12

CENTURY 21 City +YÄ?]GRYD3UDKD WHO

CENTURY 21 Master 6RNRORYVNi3UDKD WHO

21

4

CENTURY 21 Action 0DVDU\NRYRQiEĢHçt3UDKD WHO

13

CENTURY 21 For Life %UDQLFNi3UDKD WHO

CENTURY 21 Aba Reality 3DĢtNRYD3UDKD WHO

22

5

CENTURY 21 Energy .RUXQQt3UDKD WHO

14

CENTURY 21 Lightbringer

6OXQHÄ&#x20AC;QtQiPÄ?VWt$3UDKD WHO

CENTURY 21 Alter Ego 2FHOiĢVNi3UDKD WHO

23

6

CENTURY 21 Europe Property 97ÄŞQtFK3UDKD WHO

15

&(1785<5HDOLW\$QGÄ?O 5DGOLFNiH3UDKD WHO

CENTURY 21 Best Reality .XEiQVNpQiPÄ?VWt3UDKD WHO

24

7

CENTURY 21 Realitcentrum 9\ĂĽHKUDGVNi3UDKD WHO

16

CENTURY 21 Victory 'HMYLFNi3UDKD WHO

CENTURY 21 Bonus Praha .RUXQQt3UDKD WHO

8

CENTURY 21 Vomastek /D]DUVNi3UDKD WHO

17

CENTURY 21 Goldberger 1D2YÄ&#x20AC;LQiFK3UDKD WHO

25

CENTURY 21 Singa Real .RQRMHGVNi3UDKD WHO

9

CENTURY 21 Archa 0LOHĂĽRYVNi3UDKD WHO

18

CENTURY 21 Plus+ -DQNRYFRYDD3UDKD WHO

26

CENTURY 21 ElĂĄn +XVRYDĂ&#x201D;YDO\X3UDK\ WHO

WWW.CENTURY21.CZ


Profile for Conventia Events s.r.o.

Estate The Prague Magazine 11/2012  

Estate The Prague Magazine 11/2012

Estate The Prague Magazine 11/2012  

Estate The Prague Magazine 11/2012

Advertisement