Page 1


PAˇRÍŽSK Á 204/21 PRAHA 1 MYSLBEK NA P ˇRÍKOP ˇE 19-21 W W W.ESCADA.COM

PRAHA 1


Roberto Coin Boutique Christy Turlington wears Bollicine Collection Via Vittoria 9, Roma - Tel. 06 32652439


robertocoin.com

robertocoin.com Christy Turlington wears Ipanema Collection


+420 602 226 156 www.orco.cz


GENERÁLNÍ PARTNER

Rezidence Mostecká 21 představuje jedinečnou příležitost vlastnit byt v historickém jádru Prahy. Jen pár desítek metrů od Karlova mostu a Malostranského náměstí.


I T A L I A N

F A S H I O N

S T O R E

Butik JAM Couture: Jungmannovo nรกm. 1, Praha 1, tel.: +420 602 624 049, www.jamcouture.cz, www.herno.it


ESTATE ISSN 1802-8217 Czech Republic CZK 95 Eurozone â‚Ź 4,50 Great Britain ÂŁ 3,50



Redakce a obchodnĂ­ oddÄ›lenĂ­ Desk and Commercial Department BonaďŹ de Publishing, s.r.o. VĂĄclavkova 169/1 160 00 Praha 6 Czech Republic T: +420 220 512 965 F: +420 220 511 943 www.estatemagazine.cz

ǚǜǏǭǸǎǨǾǰǭ 2012 Duben / April / ÇŒÇťÇźÇąÇˇČˆ

Ĺ ĂŠfredaktor / Editor In Chief Yumi Nozaki (London, UK) nozaki@estatemagazine.cz Art Director Alena VavrdovĂĄ vavrdova@bonaďŹ de.cz



Produkce / Production Iveta PĂ­saříkovĂĄ pisarikova@bonaďŹ de.cz RedaktoĹ™i / Editors Helena VavrdovĂĄ redakce@estatemagazine.cz Michal ZĂĄhora redakce@estatemagazine.cz JazykovĂĄ redakce / Proof-copy Helena VavrdovĂĄ



/LYLQJ



ÇŽČ?ȓȤČ?



1RYLQN\DUFKLWHNWXUD GHVLJQ1HZV$UFKLWHFWXUH 'HVLJQ



ǾȖȊȖșȚČ?ČˆČ˜Č?Č?ČšČ?Č’ČšČ›Č˜Čˆ ČŒČ?Č?ČˆČ‘Č•







,QVSLUDFH+DUPRQLHDVRXGUĂĽQRVW$UQHKR-DFREVHQD



,QVSLUDWLRQ$UQH-DFREVHQ+DUPRQ\DQG&RKHVLRQ



ÇŞČŒČ–Č?Č•Č–ČŠČ?Č•Č?Č?ÇŤČˆČ˜Č”Č–Č•Č?ȧČ?Č?ČŒČ?ȕșȚȊȖÇ¨Č˜Č•Č?ȇȒȖȉșČ?Č•Čˆ





'HVLJQPÄŒVtFH3ÄœLUR]HQĂŞPLQLPDOLVPXV0DXUD/LSSDULQLKR



'HVLJQRIWKHPRQWK1DWXUDO0LQLPDOLVPRI0DXUR/LSSDULQL



ÇŹČ?Č?ČˆČ‘Č•Č”Č?Č™Č§ČžČˆǭșȚČ?șȚȊČ?Č•Č•ČŁČ‘Č”Č?Č•Č?Č”ČˆČ“Č?Č?Č”Ç´ČˆČ›Č˜Č–ÇłČ?Č—Č—ČˆČ˜Č?Č•Č?



Ă˝HVNĂŞGHVLJQ6YÄŒĂĽtYtWUYSRUFHOiQX2QGÄœHM%DWRXĂŁHN

Překlady / Translation Viktor Horåk



&]HFK'HVLJQ2QGÄœHM%DWRXĂŁHN$%UHDWKRI)UHVK$LULQ&HUDPLFV



ÇżČ?Č Č™Č’Č?Č‘ČŒČ?Č?ČˆČ‘Č•ǚȊČ?ČŽČ?Č?Č?ČŒČ?Č?ČŠČœČˆČ˜ČœČ–Č˜Č?ÇśČ•ČŒČ˜ČŽČ?Č‘ÇŠČˆČšČ–Č›Č Č?Č’

Irina AlferoviÄ?ova-Sergejeva sergejeva@bonaďŹ de.cz



=MLQpKRNRXWXVYÄŒWD$XVWUiOLH

ObchodnĂ­ oddÄ›lenĂ­ / Commercial Section Irina AlferoviÄ?ova-Sergejeva sergejeva@bonaďŹ de.cz PĹ™edplatnĂŠ / Subscriptions info@estatemagazine.cz



SĂ­dlo spoleÄ?nosti / Headquarters BonaďŹ de Publishing, s.r.o. VĂĄclavkova 169/1 160 00 Praha 6 Czech Republic



)URPD'LIIHUHQW3DUWRI:RUOG$XVWUDOLD



ÇľČˆČŒČ˜Č›Č‹Č–Č”Č’Č˜ČˆČŚșȊČ?ČšČˆÇ¨ČŠČ™ČšČ˜ČˆČ“Č?ȧ

 

1HPRYLWRVWL 3URSHUWLHV



ÇľČ?ČŒČŠČ?ČŽČ?ȔȖșȚȤ



1HMOHSĂŁtQHPRYLWRVWL%HVW3URSHUWLHVdzțČ&#x;Č ČˆČ§Č•Č?ČŒČŠČ?ČŽČ?ȔȖșȚȤ



Zastoupení v Londýně London Representation Kamila Vykydalovå Great Chapel Street 21 W1F 8FP London United Kingdom

Vydavatel ani redakce neodpovĂ­dĂĄ za obsah inzerce. ŽådnĂĄ Ä?ĂĄst z obsahu tohoto Ä?asopisu nesmĂ­ bĂ˝t kopĂ­rovĂĄna ani jakĂ˝mkoli zpĹŻsobem rozmnoĹžovĂĄna bez pĂ­semnĂŠho souhlasu vydavatele. RedakÄ?nĂ­ rada / Advisory Board Martina HuclovĂĄ, Radim Koliba, Petr Kouba, Michal Macek, ZdenÄ›k MachĂĄÄ?ek, Milorad MiĹĄkoviÄ?, David NeveselĂ˝, Yumi Nozaki, Ladislav Pimp, BedĹ™ich SkalickĂ˝, Pavel Velebil, TomĂĄĹĄ ZykĂĄn, Jaroslav Ĺ˝iĹžka





3UDJXHRXW



ÇˇČ˜ČˆČ‹Čˆ2XW



(67$7(WLS\(67$7(WLSV(67$7(Č˜Č?Č’Č–Č”Č?Č•ČŒČ›Č?Čš



2]QDĂžFH:KLUOSRRO&RUSRUDWLRQYHVWRSiFKĂžDVX



$ERXWEUDQG:KLUOSRRO&RUSRUDWLRQLQ7UDFHVRI7LPH



Č–Č”ČˆČ˜Č’Č?:KLUOSRRO&RUSRUDWLRQČ—Č–Č™ČšČ–Č—ČˆČ”ČŠČ˜Č?Č”Č?Č•Č?



(67$7(GRSRUXĂžXMH$QGUHDV+%LWHVQLWFK'HHSHU6KDGHV



1HZ<RUN(67$7(5HFRPPHQGV$QGUHDV+%LWHVQLWFK



'HHSHU6KDGHV1HZ<RUN(67$7(Č&#x2DC;Č?Č&#x2019;Č&#x2013;Č&#x201D;Č?Č&#x2022;Č&#x152;Č&#x203A;Č?Č&#x161;



ǨČ&#x2022;Č&#x152;Č&#x2DC;Č?Č&#x2C6;Č&#x2122;ǽNJČ?Č&#x161;Č?Č&#x2122;Č&#x2022;Č?Č&#x161;Č&#x;ÇŤČ&#x201C;Č&#x203A;Č&#x2030;Č&#x2013;Č&#x2019;Č?Č?Č&#x2013;Č&#x161;Č&#x161;Č?Č&#x2022;Č&#x2019;Č?ǾȤȌÇąČ&#x2013;Č&#x2DC;Č&#x2019;



(67$7(GRSRUXĂžXMH$GROI:|OĂ&#x20AC;L6WYRÄ&#x153;LWHO8QLYHUVD



(67$7(5HFRPPHQGV$GROI:|OĂ&#x20AC;L&UHDWRURIWKH8QLYHUVH



(67$7(Č&#x2DC;Č?Č&#x2019;Č&#x2013;Č&#x201D;Č?Č&#x2022;Č&#x152;Č&#x203A;Č?Č&#x161;ǨČ&#x152;Č&#x2013;Č&#x201C;ȤČ&#x153;ǪȨČ&#x201C;ȤČ&#x153;Č&#x201C;Č?ÇšČ&#x2013;Č?Č&#x152;Č&#x2C6;Č&#x161;Č?Č&#x201C;ȤÇŞČ&#x2122;Č?Č&#x201C;Č?Č&#x2022;Č&#x2022;Č&#x2013;Č&#x2018;



$GUHViÄ&#x153;UHDOLWQtFKNDQFHOiÄ&#x153;tDLQ]HUFH



5HDO(VWDWH$JHQFLHVDQG$GYHUWLVHPHQWV'LUHFWRU\



ÇšČ&#x2014;Č?Č&#x2122;Č&#x2013;Č&#x2019;Č&#x2C6;Č&#x2039;Č?Č&#x2022;Č&#x161;Č&#x2122;Č&#x161;Č&#x160;Č&#x2014;Č&#x2013;Č&#x2022;Č?Č&#x152;Č&#x160;Č?Č&#x17D;Č?Č&#x201D;Č&#x2013;Č&#x2122;Č&#x161;Č?Č?Č&#x2DC;Č?Č&#x2019;Č&#x201C;Č&#x2C6;Č&#x201D;Č&#x2013;Č&#x152;Č&#x2C6;Č&#x161;Č?Č&#x201C;Č?Č&#x2018;


0LOtþWHQiĜL

'HDUUHDGHUV

ǹdzǶǪǨǸǭǬǨDzǺǶǸǨ

WHSOpSRþDVtXGHĜLORYSOQpVtOHDOiNiQiVN

7KHZDUPZHDWKHUKDVDUULYHGLQIXOOIRUFH

ȚȍȗȓȈȧȗȖȋȖȌȈȕȈȒȖȕȍȞȊșȚțȗȐȓȈȊșȊȖȐ

þDVWČMãtPXSRE\WXQDþHUVWYpPY]GXFKX.

HQWLFLQJXVWRVWD\RXWLQWKHIUHVKDLUPRUH

ȗȘȈȊȈȊȗȖȓȕȖȑșȐȓȍȐȏȖȊȍȚȕȈșȟȈȡȍȉȣȊȈȚȤ

SRVH]HQtXGREUpNiY\QD]DKUiGNiFKþLWHUDViFK

RIWHQ:KHQVLSSLQJDJRRGFXSRIFRIIHHLQWKH

ȕȈșȊȍȎȍȔȊȖȏȌțȝȍǹȐȌȧșȝȖȘȖȠȐȔȒȖȜȍȕȈ

DEDONyQHFKYDãLFKGRPĤVHYåG\KRGtPtWQČFR

JDUGHQRURQWKHWHUUDFHRUEDOFRQ\RI\RXUKRPH

ȚȍȘȘȈșȍȉȈȓȒȖȕȍȐȓȐȊȊȍșȍȕȕȍȔșȈȌțȘȧȌȖȔ

SĜtMHPQpKRNHþWHQtDSURWRYČĜtPHåHVSROHþQRVW

LWDOZD\VFRPHVLQXVHIXOWRKDYHVRPHWKLQJ

șȌȖȔȖȔȊȌȖȉȈȊȖȒȝȖȟȍȚșȧȕȈșȓȈȌȐȚȤșȧ

YSRGREČþDVRSLVX(67$7(YiVDQLWHQWRNUiW

SOHDVDQWWRUHDGDQGWKHUHIRUHZHEHOLHYHWKDWWKH

ȗȘȐȧȚȕȣȔȟȚȍȕȐȍȔȐȔȣȕȈȌȍȍȔșȧȟȚȖ

QH]NODPH

DFFRPSDQLPHQWLQWKHIRUPRI(67$7(PDJD]LQH

ȒȖȔȗȈȕȐȧȊȊȐȌȍȎțȘȕȈȓȈ©(67$7(ªȕȍ

ZLOODOVRQRWGLVDSSRLQW\RXWKLVWLPH

ȘȈȏȖȟȈȘțȍȚȊȈșȐȊȥȚȖȚȘȈȏ

9WRPWRþtVOHYiPMLåWUDGLþQČSĜHGVWDYtPH WRQHMOHSãt]GHVLJQRYêFKLDUFKLWHNWRQLFNêFK

ǪȥȚȖȔȊȣȗțșȒȍȔȣȚȘȈȌȐȞȐȖȕȕȖ

QRYLQHNQDFHOpPVYČWČDYVHULiOXRE\GOHQtY

ȗȖȏȕȈȒȖȔȐȔȊȈșșȓțȟȠȐȔȐȌȐȏȈȑȕȍȘșȒȐȔȐ

FL]LQČWHQWRNUiWQDKOpGQHPHGRGDOHNp$XVWUiOLH 3ĜLEOtåtPHYiPWDNpMHGQ\]QHMYê]QDPQČMãtFK SRVWDYDUFKLWHNWXU\DGHVLJQXGiQVNpKRXPČOFH $UQHKR-DFREVHQDDLWDOVNpKRPLQLPDOLVWX0DXUD /LSSDULQLKRMHMLFKåGtOD]DQHFKiYDMtYKLVWRULL XPČQtQHVPD]DWHOQRXVWRSX6H]QiPtPHYiV URYQČåVþHVNRXQDGČMtYREODVWLGHVLJQXNHUDPLN\ DSRUFHOiQX2QGĜHMHP%DWRXãNHPDGRSRUXþtPH XQLNiWQtE\WRYpGRSOĖN\MHMLFKåMHGLQHþQêGHVLJQ YiV]DMLVWpQDGFKQH

,QWKLVLVVXHZHLQWURGXFHWKHEHVWRIWUDGLWLRQDO GHVLJQDQGDUFKLWHFWXUDOLQQRYDWLRQVWKURXJKRXW WKHZRUOG,QWKHVHULHVRQOLYLQJLQIRUHLJQ FRXQWULHVZHWDNHDSHHNDWGLVWDQW$XVWUDOLD :HDOVRLQWURGXFHWZRRIWKHPRVWVLJQL¿FDQW SHUVRQDOLWLHVLQ$UFKLWHFWXUHDQG'HVLJQ'DQLVK DUWLVW$UQH-DFREVHQDQG,WDOLDQPLQLPDOLVW 0DXUR/LSSDULQLZKRVHZRUNVKDYHOHIWDQ LQGHOLEOHPDUNRQ$UW+LVWRU\,QDGGLWLRQZH IDPLOLDULVH\RXZLWK2QGĜHM%DWRXãHNWKH&]HFK KRSHLQFHUDPLFVDQGSRUFHODLQGHVLJQDVZHOODV UHFRPPHQGVRPHGLVWLQFWLYHKRPHDFFHVVRULHV ZKRVHXQLTXHGHVLJQZLOOVXUHO\HQFKDQW\RX

3ĜtMHPQpþWHQt

ȐȈȘȝȐȚȍȒȚțȘȕȣȔȐȕȖȊȐȕȒȈȔȐȔȐȘȈȈ ȊșȍȘȐȈȓȍȗȖșȊȧȡȍȕȕȖȔȗȘȖȎȐȊȈȕȐȦȏȈ ȘțȉȍȎȖȔȕȈȥȚȖȚȘȈȏȗȘȍȌȖșȚȈȊȓȧȍȚșȧ ȊȖȏȔȖȎȕȖșȚȤȏȈȋȓȧȕțȚȤȊȌȈȓȍȒțȦ ǨȊșȚȘȈȓȐȦǴȣȗȖȏȕȈȒȖȔȐȔȊȈșșȖȌȕȐȔȐ ȐȏșȈȔȣȝȊȈȎȕȣȝȜȐȋțȘȊȔȐȘȍȌȐȏȈȑȕȈȐ ȈȘȝȐȚȍȒȚțȘȣ±ȌȈȚșȒȐȔȝțȌȖȎȕȐȒȖȔǨȘȕȍ ȇȒȖȉșȍȕȖȔȐȐȚȈȓȤȧȕșȒȐȔȔȐȕȐȔȈȓȐșȚȖȔ ǴȈțȘȖdzȐȗȗȈȘȐȕȐ±ȐȝȘȈȉȖȚȣȖșȚȈȊȐȓȐ ȕȍȐȏȋȓȈȌȐȔȣȑșȓȍȌȊȐșȚȖȘȐȐȐșȒțșșȚȊȈ ǴȣȚȈȒȎȍȗȘȍȌșȚȈȊȐȔȊȈȔȕȈȌȍȎȌț ȟȍȠșȒȖȋȖȌȐȏȈȑȕȈȊȖȉȓȈșȚȐȒȍȘȈȔȐȒȐȐ ȜȈȘȜȖȘȈǶȕȌȘȎȍȧǩȈȚȖțȠȒțȐȘȍȒȖȔȍȕȌțȍȔ țȕȐȒȈȓȤȕȣȍȈȒșȍșșțȈȘȣȌȓȧȌȖȔȈțȚȖȕȟȍȕȕȣȑ ȌȐȏȈȑȕȒȖȚȖȘȣȝȊȈșȉȍȏțșȓȖȊȕȖȊȗȍȟȈȚȓȐȚ

(QMR\\RXUUHDGLQJ

ǷȘȐȧȚȕȖȋȖȟȚȍȕȐȧ

<XPL3ÀLPSÀ1R]DNL âpIUHGDNWRUND(GLWRU,Q&KLHIȋȓȈȊȕȣȑȘȍȌȈȒȚȖȘ

10


129,1.<_1(:6_DŽDžƸDžLjljƿ

129,1.<1(:6

þDVRSLV(67$7(SURYiVY\EUDOQĚNROLNQRYLQHN]REODVWLDUFKLWHNWXU\DGHVLJQXNWHUp9iVDQLY]LPQtFKPĚ VtFtFK QHQHFKDMt FKODGQëPL 3RWŐHEXMHWH ]SHVWŐLW VYŢM SŐtE\WHNRULJLQiOQtP GHVLJQRYëP NRXVNHP QHER YiV ]DMtPDMtQHMQRYĚMät]DMtPDYRVWLPRGHUQtDUFKLWHNWXU\"=DÿWĚWHVHGRQDäLFKWLSŢDQHFKWHVHMLPLLQVSLURYDW (67$7(EULQJV\RXDVKRUWVHOHFWLRQRIQRYHOWLHVLQDUFKLWHFWXUHDQGGHVLJQWKDWZRQ·WOHDYH\RXFROGRQWKHVH ZLQWHUGD\V1HHGWROLYHQXSWKDWKRPHZLWKDQRULJLQDOGHVLJQHUSLHFHRUMXVWLQWHUHVWHGLQWKHODWHVWDWWUDF WLRQVRIPRGHUQDUFKLWHFWXUH"7KHQUHDGRXUWLSVDQGEHLQVSLUHG ǒǿǼǹǬǷ(67$7(ǮȇǭǼǬǷǰǷȋǮǬǽǽǬǸȇDZǴǹǾDZǼDZǽǹȇDZǹǺǮǺǽǾǴǴdzǺǭǷǬǽǾǴǬǼȁǴǾDZǶǾǿǼȇǴǰǴdzǬǵǹǬǶǺǾǺǼȇDZ ǿDzǾǺȃǹǺǽǺǯǼDZȊǾǎǬǽǮȁǺǷǺǰǹȇDZdzǴǸǹǴDZǸDZǽȋȂȇǡǺǾǴǾDZǷǴǎȇǻǼǴǺǭǼDZǽǾǴǺǼǴǯǴǹǬǷȈǹȇDZǻǼǺǴdzǮDZǰDZǹǴȋ ǰǴdzǬǵǹDZǼǺǮ ǴǷǴ ǴǹǾDZǼDZǽǿDZǾDZǽȈ ǻǺǽǷDZǰǹǴǸǴ ǹǺǮǴǹǶǬǸǴ ǽǺǮǼDZǸDZǹǹǺǵ ǬǼȁǴǾDZǶǾǿǼȇ Ƕ ǎǬȄǴǸ ǿǽǷǿǯǬǸ ǹǬȄǴǙǚǎǔǙǖǔǰǷȋǻǺǴǽǶǬǴǮǰǺȁǹǺǮDZǹǴȋ

$5&+,7(.785$ 9,/$78*(1'+$7-(23ę727(9ŏ(1$3529(ŏ(-1267 9,//$78*(1'+$75(23(16727+(38%/,& ǎǔǗǗnjǞǟǏǑǙǐǡnjǞǝǙǚǎnjǚǞǖǜǧǞnjǐǗǫ ǛǚǝǑǥǑǙǔǫǚǍǥǑǝǞǎǑǙǙǚǝǞǔ 1HM]QiPĚMät EUQĚQVNi YLOD 7XJHQGKDW QĚPHFNpKR DUFKLWHNWD 0LHVH YDQ GHU5RKHKRE\ODSRGYRXOHWpUHNRQVWUXNFLRSĚWRWHYŐHQDYHŐHMQRVWL.RP SOHWQtREQRYRXSURäODMDNVDPRWQiYLODDMHMtWHFKQLFNpY\EDYHQtWDNSŐL OHKOi]DKUDGD3RNXGPiWHRSURKOtGNX]iMHPPŢæHWHVLY\EUDW]QĚNROLND QDEt]HQëFKRNUXKŢSŐtVWXSQëMHLQWHULpUYLO\WHFKQLFNpSRGODætVGRERYëP WHFKQRORJLFNëP]DŐt]HQtPD]DKUDGD]QtæVHRWHYtUiRNRX]OXMtFtYëKOHGQD %UQR3RÿtWHMWHYäDNVWtPæHYVRXÿDVQRVWLMHRSURKOtGNXYLO\7XJHQGKDW YHONë]iMHPDWHUPtQ\MVRXUH]HUYRYiQ\DæQDQĚNROLNWëGQŢGRSŐHGX

12

7KHPRVWIDPRXVYLOODLQ%UQR9LOOD7XJHQGKDWGHVLJQHGE\*HUPDQDUFKL WHFW0LHVHYDQGHU5RKHKDVEHHQUHRSHQHGWRWKHSXEOLFDIWHUDWZR\HDU UHFRQVWUXFWLRQ7KH9LOODDQGLWVWHFKQLFDOHTXLSPHQWDVZHOODVWKHDGMD FHQWJDUGHQXQGHUZHQWFRPSOH[UHFRQVWUXFWLRQ7KHLQWHUHVWLQYLVLWLQJWKH 9LOODLVHQRUPRXVWRXUVEHLQJUHVHUYHGVHYHUDOZHHNVLQDGYDQFH,I\RX ZRXOGOLNHWRYLVLWWKH9LOOD\RXFDQFKRRVHIURPVHYHUDORIIHUHGWRXUV² RSWLRQVDUHWKHLQWHULRURIWKH9LOODWKHWHFKQLFDOÁRRUZLWKFRQWHPSRUDU\ WHFKQLFDOHTXLSPHQWDQGWKHJDUGHQIURPZKLFKWKHUHDUHEUHDWKWDNLQJ YLHZVRI%UQR


129,1.<_1(:6_DŽDžƸDžLjljƿ ǝǬǸǬȋ ǴdzǮDZǽǾǹǬȋ ǮǴǷǷǬ ǞǿǯDZǹǰȁǬǾ Ǯ ǍǼǹǺ ǻǺǽǾǼǺDZǹǹǬȋ ǻǺ ǻǼǺDZǶǾǿ ǹDZǸDZȂǶǺǯǺ ǬǼȁǴǾDZǶǾǺǼǬ ǘǴǽǬ ǮǬǹ ǰDZǼ ǜǺȉ ǭȇǷ ǻǺǽǷDZ ǰǮǿȁ ǷDZǾ ǼDZǶǺǹǽǾǼǿǶȂǴǴ ǺǾǶǼȇǾǬ ǰǷȋ ǻǺǽDZȅDZǹǴȋ ǺǭȅDZǽǾǮDZǹǹǺǽǾǴ ǛǺǷǹǿȊ ǼDZǶǺǹǽǾǼǿǶȂǴȊ ǻǼǺȄǷǬ ǶǬǶ ǽǬǸǬ ǮǴǷǷǬ ǾǬǶ Ǵ DZDZ ǾDZȁǹǴȃDZǽǶǺDZ ǺǽǹǬȅDZǹǴDZǬǾǬǶDzDZǻǼǴǷDZǯǬȊȅǴǵǶǹDZǵǽǬǰǔǹǾDZǼDZǽǶȉǶǽǶǿǼǽǴȋǸǻǺ ǮǴǷǷDZǹǬǽǾǺǷȈǶǺǮDZǷǴǶȃǾǺǮǼDZǸȋdzǬǭǼǺǹǴǼǺǮǬǹǺǹǬǹDZǰDZǷȊǮǻDZǼDZǰ ǛǺǽDZǾǴǾDZǷǴ ǸǺǯǿǾ ǮȇǭǼǬǾȈ Ǵdz ǹDZǽǶǺǷȈǶǴȁ ȉǶǽǶǿǼǽǴǵ ǐǺǽǾǿǻǹȇ ǰǷȋ ǻǼǺǽǸǺǾǼǬ ǴǹǾDZǼȈDZǼ ǮǴǷǷȇ ǾDZȁǹǴȃDZǽǶǴǵ ȉǾǬDz ǽ ǾDZȁǹǺǷǺǯǴȃDZǽǶǴǸ ǺǭǺǼǿǰǺǮǬǹǴDZǸǾǺǯǺǮǼDZǸDZǹǴǴǽǬǰǴdzǶǺǾǺǼǺǯǺǺǾǶǼȇǮǬDZǾǽȋȃǿǰDZǽǹȇǵ ǮǴǰǹǬǍǼǹǺ =GURMDIRWRVRXUFHDQGSKRWRVǴǽǾǺȃǹǴǶǴȀǺǾǺ6WXGLMQtDGRNXPHQWDÿQtFHQWUXPYLO\7XJHQGKDW%UQR    'DYLGåLGOLFNë

72.,2=Ì6.$/2129ê6<0%2/0ę67$ 72.<2*$,16$1(:&,7<6<0%2/ ǞǚǖǔǚǛǚǗǟǣǔǗǙǚǎǧǕǝǔǘǎǚǗǏǚǜǚǐnj 9-DSRQVNXGRNRQÿLOLVWDYEXPUDNRGUDSX7RN\R6N\7UHHNWHUëVHVWDOVH VYëPLPHWU\QHMY\äätYĚætVYĚWD=iURYHŁMGHRGUXKRXQHMY\äätVWDYEX QDVYĚWĚYŢEHF9ĚæREVDKXMHNURPĚY\VtODÿHWDNpGYĚY\KOtGNRYpSORäLQ\ UHVWDXUDFLDNDQFHOiŐH=DMtPDYëMHWYDUSOiäWĚEXGRY\NWHUëPiYSŐt]HPt SŢGRU\VWURM~KHOQtNXVHVWRXSDMtFtYëäNRXVHDOHSRVWXSQĚPĚQtQDNUXKR YëSUŢŐH]NWHUëQHMOpSHRGROiYiSŢVREHQtYĚWUX-DSRQFLYLGtYHYĚæLV\PERO QRYpKRUR]YRMH]HPĚSRORŁVNpP]HPĚWŐHVHQt 7KH-DSDQHVHVN\VFUDSHUFRQVWUXFWLRQKDVEHHQFRPSOHWHG7KHPHW UHWDOO7RN\R6N\7UHHKDVEHFRPHWKHWDOOHVWWRZHULQWKHZRUOGDQGDWWKH VDPHWLPHWKHVHFRQGKLJKHVWEXLOGLQJHYHUFRQVWUXFWHG%HVLGHVDWUDQV PLWWHUWKHWRZHUDOVRFRQWDLQVWZRREVHUYDWLRQSODWIRUPVUHVWDXUDQWVDQG RIÀFHV7KHVKDSHRIWKHWRZHULVDOVRLQWHUHVWLQJ,WIRUPVDWULDQJOHRQWKH JURXQGÁRRUKRZHYHUDWDQLQFUHDVHGKHLJKWWKHIRUPFKDQJHVWRDFLUFOH ZKLFKLVEHVWUHVLVWDQWWRZLQG7KH-DSDQHVHVHHLQWKHEXLOGLQJDV\PERO RIQHZGHYHORSPHQWLQWKHFRXQWU\DIWHUODVW\HDU·VHDUWKTXDNH ǎ ǫǻǺǹǴǴ dzǬǮDZǼȄDZǹǺ ǽǾǼǺǴǾDZǷȈǽǾǮǺ ǹDZǭǺǽǶǼDZǭǬ ©7RN\R 6N\ 7UHHª ǶǺǾǺǼȇǵ ǽǺ ǽǮǺǴǸǴ  ǸDZǾǼǬǸǴ ǽǾǬǷ ǽǬǸǺǵ ǮȇǽǺǶǺǵ ǭǬȄǹDZǵ Ǯ ǸǴǼDZ ǛǼǴȃDZǸ ȉǾǺ DZȅDZ ǮǾǺǼǺDZ ǽǬǸǺDZ ǮȇǽǺǶǺDZ dzǰǬǹǴDZ ǶǺǯǰǬǷǴǭǺ ǻǺǽǾǼǺDZǹǹǺDZ Ǯ ǸǴǼDZ ǖǼǺǸDZ ǻDZǼDZǰǬǾȃǴǶǬ ǹǬ ǭǬȄǹDZ ǹǬȁǺǰȋǾǽȋ ǰǮDZ ǽǸǺǾǼǺǮȇDZǻǷǺȅǬǰǶǴǼDZǽǾǺǼǬǹȇǴǺȀǴǽȇǔǹǾDZǼDZǽǹǬȀǺǼǸǬǶǺǼǻǿǽǬ dzǰǬǹǴȋ ǴǸDZȊȅǬȋ ȀǺǼǸǿ ǾǼDZǿǯǺǷȈǹǴǶǬ ǹǬ ǿǼǺǮǹDZ ǹǴDzǹDZǯǺ ȉǾǬDzǬ ǛǺ ǸDZǼDZ ǮǺdzǼǬǽǾǬǹǴȋ ȀǺǼǸǬ ǸDZǹȋDZǾǽȋ ǹǬ ǶǼǿǯǺǮǺDZ ǽDZȃDZǹǴDZ ǻǺǾǺǸǿ ȃǾǺ ǾǬǶǭǬȄǹȋǷǿȃȄDZǻǼǺǾǴǮǺǽǾǺǴǾǮDZǾǼǬǸǫǻǺǹȂȇǮǴǰȋǾǮǭǬȄǹDZǽǴǸǮǺǷ ǹǺǮǺǯǺǼǬdzǮǴǾǴȋǽǾǼǬǹȇǻǺǽǷDZdzDZǸǷDZǾǼȋǽDZǹǴȋǮǻǼǺȄǷǺǸǯǺǰǿ =GURMDIRWRVRXUFHDQGSKRWRVǴǽǾǺȃǹǴǶǴȀǺǾǺZZZZLNLSHGLDRUJ

13


129,1.<_1(:6_DŽDžƸDžLjljƿ /$85(É735,7=.(529<&(1<35252.%</2'7$-1ę1 /$85($72)7+(35,7=.(5$:$5'5(9($/(' ǗnjǟǜǑnjǞǛǜǑǘǔǔǛǜǔǞǢǖǑǜnjǎǏǚǐǟǍǧǗǜnjǝǝǑǖǜǑǣǑǙ 3UHVWLæQt3ULW]NHURYXFHQXNWHUiVHNDæGRURÿQĚXGĚOXMHQHMYë]QDPQĚMätP RVREQRVWHP ] REODVWL DUFKLWHNWXU\ ]tVNDO SUR WHQWR URN ÿtQVNë DUFKLWHNW :DQJ6KXNWHUëYþtQĚVSROXVHVYRXPDQæHONRX]DORæLODWHOLpU$PDWHXU $UFKLWHFWXUH6WXGLR:DQJ6KXMH]QiPëSŐHGHYätPVYëPLRVRELWëPLQiYUK\ NQLKRYHQPX]HtDE\WRYëFKGRPŢNWHUpPDMtY]WDKNæLYRWQtPXSURVWŐHGt 7KH SUHVWLJLRXV 3ULW]NHU $ZDUG DQQXDOO\ JUDQWHG WR WKH PRVW VLJQLÀFDQW SHUVRQDOLW\LQWKHÀHOGRI$UFKLWHFWXUHZDVZRQWKLV\HDUE\WKH&KLQHVHDU FKLWHFW:DQJ6KXZKRZLWKKLVZLIHHVWDEOLVKHGWKH$PDWHXU$UFKLWHFWX UH6WXGLRLQ&KLQD:DQJ6KXLVZHOONQRZQLQSDUWLFXODUIRUKLVXQXVXDO SURSRVDOVIRUOLEUDULHVPXVHXPVDQGDSDUWPHQWKRXVHVWKDWDUHUHODWHG WRWKHOLYLQJHQYLURQPHQW ǛǼDZǽǾǴDzǹǿȊ ǻǼDZǸǴȊ ǛǼǴǾȂǶDZǼǬ DZDzDZǯǺǰǹǺ ǮǼǿȃǬDZǸǿȊ ǹǬǴǭǺǷDZDZ ǺǾǷǴȃǴǮȄǴǸǽȋǮǺǭǷǬǽǾǴǬǼȁǴǾDZǶǾǿǼȇǮȉǾǺǸǯǺǰǿǮȇǴǯǼǬǷǶǴǾǬǵǽǶǴǵ ǬǼȁǴǾDZǶǾǺǼ ǎǬǹǯ Ǥǿ ǮǸDZǽǾDZ ǽǺ ǽǮǺDZǵ DzDZǹǺǵ ǺǽǹǺǮǬǮȄǴǵ Ǯ ǖǴǾǬDZ ǽǾǿǰǴȊ ©$PDWHXU $UFKLWHFWXUH 6WXGLRª ǎǬǹǯ Ǥǿ ǴdzǮDZǽǾDZǹ ǽǮǺǴǸ ǺǼǴǯǴǹǬǷȈǹȇǸǰǴdzǬǵǹǺǸǭǴǭǷǴǺǾDZǶǸǿdzDZDZǮǴDzǴǷȇȁdzǰǬǹǴǵǶǺǾǺǼȇDZ ǴǸDZȊǾǺǾǹǺȄDZǹǴDZǶǺǶǼǿDzǬȊȅDZǵǽǼDZǰDZ )RWRSKRWRVȀǺǾǺ/X:HQ\X/Y+HQJ]KRQJ/DQJ6KXLORQJ

Å0e1ę-(9Ì&(´91ę0(&.e032-(7Ì ´/(66,6025(µ,17+(*(50$1$3352$&+ ©ǘǑǙǨǤǑǓǙnjǣǔǞǍǚǗǨǤǑªǎǙǑǘǑǢǖǚǕǖǚǙǢǑǛǢǔǔ 0LQLPDOLVWLFNiYLOD'QDMLKX1ĚPHFNDE\ODQDYUæHQDVRKOHGHPQDPD [LPiOQtSURSRMHQtVRNROQtPWHUpQHP3Őt]HPQtEXGRYDVSURVNOHQëPLVWĚ QDPLY]GiOHQĚSŐLSRPtQiDPHULFNë)DUQVZRUWK+RXVH*DUiæMHXPtVWĚQD SRG~URYQtGRPXDMHRGGĚOHQDRGRNROtY\VRNRX]iVWĚQRX1LFWDNQHUXät YHYëKOHGX]LQWHULpUXGRPXGR]DKUDG\ 7KH0LQLPDOLVW9LOOD'LQ6RXWK*HUPDQ\ZDVGHVLJQHGZLWKUHJDUGWR WKH PD[LPXP FRQQHFWLRQ ZLWK WKH VXUURXQGLQJ WHUUDLQ 7KH JURXQGOHYHO EXLOGLQJZLWKJODVVHGZDOOVLVUHPLQLVFHQWRIWKH$PHULFDQ)DUQVZRUWK+RX VH7KHJDUDJHLVVLWXDWHGEHQHDWKWKHOHYHORIWKHKRXVHDQGLVVHSDUDWHG IURPWKHVXUURXQGLQJDUHDE\DKLJKSDUWLWLRQZDOO7KHUHIRUHQRWKLQJGLV WXUEVWKHYLHZRIWKHJDUGHQIURPWKHLQWHULRURIWKHKRXVH ǘǴǹǴǸǬǷǴǽǾǽǶǴǵ ǮǴǷǷǬ ©'ª ǹǬ ȊǯDZ ǏDZǼǸǬǹǴǴ ǭȇǷ ǽǻǼǺDZǶǾǴǼǺǮǬǹǬ ǾǬǶ ȃǾǺǭȇ ǸǬǶǽǴǸǬǷȈǹǺ ǴǹǾDZǯǼǴǼǺǮǬǷǬǽȈ Ǯ ǺǶǼǿDzǬȊȅǿȊ ǸDZǽǾǹǺǽǾȈ ǚǰǹǺȉǾǬDzǹǺDZdzǰǬǹǴDZǽǺǽǾDZǶǷȋǹǹȇǸǴǽǾDZǹǬǸǴǺǾǰǬǷDZǹǹǺǹǬǻǺǸǴǹǬDZǾ ǬǸDZǼǴǶǬǹǽǶǴǵ ©)DUQVZRUWK +RXVHª ǏǬǼǬDz ǼǬǽǻǺǷǺDzDZǹ ǻǺǰ ǰǺǸǺǸ Ǵ ǺǾǰDZǷDZǹǺǾǺǶǼDZǽǾǹǺǽǾDZǵǮȇǽǺǶǺǵǻDZǼDZǯǺǼǺǰǶǺǵǙǴȃǾǺǹDZǸDZȄǬDZǾǮǴǰǿ ǴdzǴǹǾDZǼȈDZǼǬǰǺǸǬǮǽǬǰ =GURMDIRWRVRXUFHDQGSKRWRVǴǽǾǺȃǹǴǶǴȀǺǾǺZZZGH]HHQFRP

14


KUCHYNĚ TRVALÉ HODNOTY

Kuchyně Eggersmann vybavujeme spotřebiči Siemens

NĚMECKÉ KUCHYNĚ EGGERSMANN KVALITA ZARUČENÁ 100 LETOU TRADICÍ AKČNÍ MODELY KUCHYNÍ OD 290 000 KČ SEDLÁK INTERIER s.r.o. | Vinohradská 10, Praha 2 | tel.: +420 224 217 817 | e-mail: info@sedlakinterier.cz | www.sedlakinterier.cz Otevřeno: Pondělí – Pátek 9.00 – 18.00, Sobota 10.00 – 14.00 | Parkování pro zákazníky před prodejnou zdarma


129,1.<_1(:6_DŽDžƸDžLjljƿ

)5(('20(.67</29e%<'/(1Ì3521É52þ1e )5((+286(67</,6++286,1*)257+('(0$1',1* )5(('20(. ǝǞǔǗǨǙǚǑ ǒǔǗǨǑ ǐǗǫ ǝnjǘǧǡ ǞǜǑǍǚǎnjǞǑǗǨǙǧǡ ǖǗǔǑǙǞǚǎ )5(('20(.VSOŁXMHSŐHGVWDYXRLGHiOQtPE\GOHQt²MHMHGQRGXFKëSUDN WLFNë HNRORJLFNë D VNëWi YHäNHUp SRKRGOt D NRPIRUW 9\QLNi RULJLQiOQtP GHVLJQHPDPŢæHEëW]FHODQH]iYLVOëQDLQæHQëUVNëFKVtWtFK=DY]QLNHP XQLNiWQtKR)5(('20.8VWRMt]QiPëÿHVNëDUFKLWHNW0DUHNãWĚSiQD]ODW QtN-LŐt%URVFK3UH]HQWDÿQt)5(('20.<VLPŢæHWHSURKOpGQRXWY%UQĚQD .UDYtKRŐHY3UD]H0DOHäLFtFKDQDIUHHORXFHY3HUQROFLX7DFKRYD )5(('20(.  )5(( +286( PHHWV WKH FRQFHSW RI LGHDO KRXVLQJ ² LW LV VLPSOH SUDFWLFDO HQYLURQPHQWDOO\ IULHQGO\ DQG RIIHUV HYHU\ FRPIRUW DQG FRQYHQLHQFH,WIHDWXUHVDXQLTXHGHVLJQZKLFKLVFRPSOHWHO\LQGHSHQGHQW RIXWLOLW\QHWZRUNV)DPRXV&]HFKDUFKLWHFW0DUHNãWĚSiQDQGJROGVPLWK -LŐt%URVFKDUHEHKLQGWKHHPHUJHQFHRIWKHXQLTXH)5(('20(.<RXFDQ VHHWKH)5((+286(6SUHVHQWDWLRQLQ%UQR.UDYtKRUDLQ3UDJXH0DOH äLFHDQGRQWKHRSHQPHDGRZLQ3HUQROHFQHDU7DFKRY )5(('20(.ǺǾǮDZȃǬDZǾǮǽDZǸǻǺDzDZǷǬǹǴȋǸǺǭǴǰDZǬǷȈǹǺǵǶǺǹȂDZǻȂǴǴDzǴǷȈȋ ǺǹǻǼǺǽǾǺǵǻǼǬǶǾǴȃǹȇǵȉǶǺǷǺǯǴȃǹȇǵǴǻǼDZǰǷǬǯǬDZǾǺǾǷǴȃǹȇDZǿǰǺǭǽǾǮǬ ǴǶǺǸȀǺǼǾ)5(('20(.ǺǭǷǬǰǬDZǾǿǹǴǶǬǷȈǹȇǸǰǴdzǬǵǹǺǸǴǸǺDzDZǾǭȇǾȈ ǻǺǷǹǺǽǾȈȊ ǹDZdzǬǮǴǽǴǸȇǸ ǺǾ ǴǹDzDZǹDZǼǹȇȁ ǶǺǸǸǿǹǴǶǬȂǴǵ ǟǹǴǶǬǷȈǹȇǵ )5(('20(. ǻǼǴǰǿǸǬǷǴ Ǵ ǽǻǼǺDZǶǾǴǼǺǮǬǷǴ ǴdzǮDZǽǾǹȇǵ ȃDZȄǽǶǴǵ ǬǼȁǴǾDZǶǾǺǼ ǘǬǼDZǶ ǤǾDZǻǬǹ Ǵ ȊǮDZǷǴǼ ǕǼDzǴ ǍǼǺȄ ǛǼDZdzDZǹǾǬȂǴǺǹǹȇDZ ©ǠǼǴǰǺǸǴǶǴªǸǺDzǹǺǿǮǴǰDZǾȈǮǍǼǹǺǹǬǸDZǽǾDZ.UDYtKRUDǮǛǼǬǯDZ³Ǯ ǼǬǵǺǹDZǘǬǷDZȄǴȂDZǴǹǬǿȃǬǽǾǶDZǮǛDZǼǹǺǷȂDZǿǞǬȁǺǮǬ 3HUQROHFX7DFKR YD  =GURMDIRWRVRXUFHDQGSKRWRVǴǽǾǺȃǹǴǶǴȀǺǾǺZZZIUHHGRPN\F]-LŐt3DŐt]HN$57,6+2&.VUR     SUH]HQWDÿQt)5(('20(.%UQR².UDYtKRUD

16


129,1.<_1(:6_DŽDžƸDžLjljƿ å,'/(6(5,(6 7+(6(5,(6&+$,5 ǝǞǟǗ©ǝǑǜǔǫª

'(6,*1

åLGOH6HULHVMHMHGQRX]QHMSURGiYDQĚMätFKæLGOtYKLVWRULLQiE\WNX9URFH MLGiQVNëGHVLJQpUDDUFKLWHNW$UQH-DFREVHQQDYUKQXOSURÀUPX)ULW] +DQVHQDRGWpGRE\VHVWDODGHVLJQRYRXLNRQRX'+,QWHULpU9iPGR  SŐL QiNXSX ÿW\Ő VWRKRYDWHOQëFK æLGOt Y OLERYROQpP SURYHGHQt QDEt]t GĚWVNRXæLGOLÿNX6HULHV]GDUPD 7KH6HULHVFKDLULVRQHRIWKHEHVWVROGLQWKHKLVWRU\RIIXUQLWXUH'DQLVK GHVLJQHU DQG DUFKLWHFW $UQH -DFREVHQ GHVLJQHG LW IRU WKH )ULW] +DQVHQ FRPSDQ\LQDQGVLQFHWKHQLWKDVEHFRPHDGHVLJQLFRQ8QWLOWK $SULO'+,QWHULpURIIHUV\RXDFKLOGUHQ·V6HULHVFKDLUIUHHRIFKDUJH ZLWKWKHSXUFKDVHRIIRXUVWDFNDEOHFKDLUVRIDQ\PDNH ǝǾǿǷ ©ǝDZǼǴȋ ª  ǺǰǴǹ Ǵdz ǽǬǸȇȁ ǻǼǺǰǬǮǬDZǸȇȁ Ǯ ǴǽǾǺǼǴǴ ǸDZǭDZǷǴ ǎ ǯǺǰǿǰǬǾǽǶǴǵǬǼȁǴǾDZǶǾǺǼǴǰǴdzǬǵǹDZǼnjǼǹDZǫǶǺǭǽDZǹǼǬdzǼǬǭǺǾǬǷDZǯǺ ǰǴdzǬǵǹǰǷȋǶǺǸǻǬǹǴǴ©)ULW]+DQVHQªǴǽǾDZȁǻǺǼǽǾǿǷǺǽǾǬDZǾǽȋǭǿǶǮǬǷȈǹǺ ǰǴdzǬǵǹDZǼǽǶǺǵǴǶǺǹǺǵǣDZȄǽǶǬȋǶǺǸǻǬǹǴȋ©'+,QWHULpUªǰǺǬǻǼDZǷȋ  ǯǺǰǬ ǻǼǴ ǻǺǶǿǻǶDZ ǽǶǷǬǰȇǮǬȊȅǴȁǽȋ Ǯ ©ǯǺǼǶǿª ȃDZǾȇǼDZȁ ǽǾǿǷȈDZǮ ǷȊǭǺǯǺǺȀǺǼǸǷDZǹǴȋǻǼDZǰǷǬǯǬDZǾǰDZǾǽǶǴǵǽǾǿǷȈȃǴǶ©ǝDZǼǴȋªǬǭǽǺǷȊǾǹǺ ǭDZǽǻǷǬǾǹǺ 6+2:5220 '+,QWHULpUVUR 5RKDQVNpQiEŐHæt 3UDKDWHO ZZZGKF]

25,*,1É/-(-(1-('(1 7+(5(,621/<21(25,*,1$/ ǚǜǔǏǔǙnjǗǎǝǑǏǐnjǞǚǗǨǖǚǚǐǔǙ )DVFLQXMtFtSODVWLNDÅ7ŐLPXæLQDVRID´RGYëWYDUQtND9ODGLPtUD9ĚWURYVNpKR SRYëätHVWHWLNXDHOHJDQFLPRGHUQtKRLQWHULpUXRSUYHNQHRSDNRYDWHOQpKR XPĚOHFNpKRGtOD2ULJLQiOQtSODVWLNDRUR]PĚUHFK[[FPMHRGOLWD ]DFU\VWDOXDEDUHYQĚMHRSDWŐHQDPHWDOLFNëPQiVWŐLNHPRULJLQiOQtPDO ERXDNU\OHPDQĚNROLNDYUVWYDPLODNXÿtPæVHGRVDKXMHKORXEN\EDUHYD Y\VRNpKROHVNX &HQD.ÿ $IDVFLQDWLQJVFXOSWXUH´7KUHH0HQRQWKH6RIDµE\DUWLVW9ODGLPtU9ĚW URYVNëHOHYDWHVWKHDHVWKHWLFVDQGHOHJDQFHRIWKHPRGHUQLQWHULRUWRWKH HOHPHQWRIDXQLTXHZRUNRIDUW7KLVRULJLQDOVFXOSWXUHPHDVXULQJ[ [FPLVFDVWLQDFU\VWDODQGÀQLVKHGZLWKDFRORXUIXOPHWDOOLFFRD WLQJRULJLQDODFU\OLFSDLQWLQJVDQGVHYHUDOOD\HUVRIYDUQLVKZLWKZKLFKLW UHDFKHVDGHSWKRIFRORXUDQGKLJKJORVV 3ULFH&=. ǛǺǾǼȋǽǬȊȅǬȋ ǻǺ ǽǮǺDZǸǿ ǮǴdzǿǬǷȈǹǺǸǿ ǮǺdzǰDZǵǽǾǮǴȊ ǽǶǿǷȈǻǾǿǼǬ ǞǼǺDZ ǹǬ ǰǴǮǬǹDZ ǺǾ ǬǮǾǺǼǬ ǎǷǬǰǴǸǴǼǬ ǎDZǾǼǺǮǽǶǺǯǺ ȋǮǹǺ ǿǮDZǷǴȃǴǾ ȉǽǾDZǾǴǶǿǴȉǷDZǯǬǹǾǹǺǽǾȈǽǺǮǼDZǸDZǹǹǺǯǺǴǹǾDZǼȈDZǼǬǬǾǬǶDzDZǿǶǼǬǽǴǾDZǯǺ ǹDZǻǺǮǾǺǼǴǸȇǸ ǻǼǺǴdzǮDZǰDZǹǴDZǸ ǴǽǶǿǽǽǾǮǬ ǚǼǴǯǴǹǬǷȈǹǬȋ ǽǶǿǷȈǻǾǿǼǬ ǼǬdzǸDZǼȁȁǽǸ ǺǾǷǴǾǬǴdzǬǶǼǴǷǺǮǺǵǽǸǺǷȇ©DFU\VWDOªǴǰǷȋ ǻǼǴǰǬǹǴȋ ȂǮDZǾǬ ǻǺǶǼȇǾǬ ǸDZǾǬǷǷǴdzǴǼǺǮǬǹǹǺǵ ǶǼǬǽǶǺǵ ǺǼǴǯǴǹǬǷȈǹǺǵ ǬǶǼǴǷǺǮǺǵ ǼǬdzǼǴǽǺǮǶǺǵ Ǵ ǻǺǶǼȇǾǬ ǹDZǽǶǺǷȈǶǴǸǴ ǽǷǺȋǸǴ ǷǬǶǬ ȃǾǺ ǻǼǴǰǬDZǾDZǵǯǷǿǭǴǹǿȂǮDZǾǬǴǯǷȋǹDZȂǩǶǽǶǷȊdzǴǮǹǺǮ©*DOHULH.RWHOQDª ǢDZǹǬ&=. 6+2:5220 *DOHULH.RWHOQD 3O\QiUQtŏtÿDQ\ ZZZJDOHULHNRWHOQDF]

18


129,1.<_1(:6_DŽDžƸDžLjljƿ -(',1(þ1É.2/(.&(2'69ę72=1É0ê&+,7$/6.ê&+1É95+Éŏš 81,48(&2//(&7,212)$:25/')$0286,7$/,$1'(6,*1(56 ǟǙǔǖnjǗǨǙnjǫǖǚǗǗǑǖǢǔǫǚǞǎǝǑǘǔǜǙǚǔǓǎǑǝǞǙǧǡ ǔǞnjǗǨǫǙǝǖǔǡǐǔǓnjǕǙǑǜǚǎ 6KUGRVWtYiPSŐHGVWDYXMHPHPLPRŐiGQRXNROHNFLRGVYĚWRYĚSURVOXOëFK LWDOVNëFKQiYUKiŐŢ1DYëEĚUMHäLURNiSDOHWDH[NOX]LYQtFKKRGLQR]GREQD ]HďYĚäiNŢ]UFDGHOUiPHÿNŢQDIRWRJUDÀHDGDOätKR]ERæt .DæGëYëUREHNMHY\WYRŐHQUXÿQĚDPŢæHVHVWiWVRXÿiVWtQHYäHGQtKRLQWH ULpUXYDäHKRGRPRYDUHVWDXUDFHEDUXQHERKRWHOX-HGREUpYĚGĚWæHX QiVVLNDæGëQĚFRQDMGHQHERŘRULJLQDOLWDQDätQDEtGN\MHVNXWHÿQĚH[WUpP Qt-VPHÅ02'(51$576+23´ :HDUHSURXGWRSUHVHQW\RXWKHXQLTXHFROOHFWLRQRIDZRUOGIDPRXVLWDOLDQ GHVLJQHUV7KHUHLVDZLGHYDULHW\RIH[FOXVLYHFORFNVZDOOKDQJHUVPLUURU VSKRWRIUDPHVDQGHWF(DFKSURGXFWLVKDQGPDGHDQGFDQEHDSDUW RI \RXU XQXVXDO LQWHULHU RI \RXU KRPHUHVWDXUDQWEDU RU KRWHO ,W LV JRRG WRNQRZWKDWZHKDYHVRPHWKLQJIRUHYHU\ERG\DQGDWWKHVDPHWLPHWKH RULJLQDOLW\RIRXULWHPVLVUHDOO\XQLTXH:HDUH02'(51$576+23 ǘȇǽǯǺǼǰǺǽǾȈȊǻǼDZǰǽǾǬǮǷȋDZǸǮǬǸǹDZǺǭȇȃǹǿȊǶǺǷǷDZǶȂǴȊǺǾǮǽDZǸǴǼǹǺ ǴdzǮDZǽǾǹȇȁ ǴǾǬǷȈȋǹǽǶǴȁ ǰǴdzǬǵǹDZǼǺǮ ǤǴǼǺǶǴǵ ǽǻDZǶǾǼ ȉǶǽǶǷȊdzǴǮǹȇȁ ȃǬǽǺǮǹǬǽǾDZǹǹȇȁǿǶǼǬȄDZǹǴǵǮDZȄǬǷǺǶdzDZǼǶǬǷǼǬǸǰǷȋȀǺǾǺǯǼǬȀǴǵǴ ǰǼǿǯǴȁǰǴdzǬǵǹDZǼǽǶǴǴǹǾDZǼDZǽǹȇȁǾǺǮǬǼǺǮǖǬDzǰǺDZǴdzǰDZǷǴDZǴdzǯǺǾǺǮǷDZǹǺ ǮǼǿȃǹǿȊ ǻǺ ǺǽǺǭǺǵ ǾDZȁǹǺǷǺǯǴǴ Ǵ ǸǺDzDZǾ ǽǾǬǾȈ ȃǬǽǾȈȊ ǿǹǴǶǬǷȈǹǺǯǺ ǴǹǾDZǼȈDZǼǬ ǮǬȄDZǯǺ ǰǺǸǬ ǼDZǽǾǺǼǬǹǬ ǭǬǼǬ ǴǷǴ ǯǺǽǾǴǹǴȂȇ ǔ ǿDz ǾǺȃǹǺ dzǰDZǽȈ ǶǬDzǰȇǵ ǹǬǵǰDZǾ ȃǾǺǾǺ ǰǷȋ ǽDZǭȋ ǻǺǾǺǸǿ ȃǾǺ ǺǼǴǯǴǹǬǷȈǹǺǽǾȈ ǻǼDZǰǷǺDzDZǹǴȋȋǮǷȋDZǾǽȋǰDZǵǽǾǮǴǾDZǷȈǹǺǴǽǶǷȊȃǴǾDZǷȈǹǺǵǘȇǹǬǽǾǺȋȅǴǵ Å02'(51$576+23´ 6+2:5220 0DODãWXSDUWVNi3UDKD HPDLOYHOL]DU#\DKRRFRP WHO

6.9ę/e'1<=$þÌ1$-Ì-,å912&,.9$/,71Ì063É1.(0 *5($7'$<6$/5($'<%(*,1:,7+1,*+762)48$/,7<6/((3 ǡǚǜǚǤǔǕǐǑǙǨǙnjǣǔǙnjǑǞǝǫǝǖnjǣǑǝǞǎnjǙǚǣǙǚǏǚǝǙnj 3ŐHGQtäYpGVNëSURGXFHQWSRVWHOt&DUSH'LHPMHSRYĚVWQëVYRXNYDOLWRX QDGÿDVRYëP GHVLJQHP D Y\XæLWtP WĚFK QHMOHSätFK SŐtURGQtFK PDWHULiOŢ 6SROHÿQRVWVL]DNOiGiQDY\VRNëFKVWDQGDUGHFKNWHUpMVRXSURGREUëVSi QHNQXWQpDVQDætVHMHVNU]HVYpSRVWXS\QDSOQLW3RVWHOHDGRSOŁN\VSR OHÿQRVWL&DUSH'LHPVHWĚätREOLEĚSRFHOpPVYĚWĚDSŐLQiäHMtWHQSUDYë VSiQHNNWHUëMH]DSRWŐHEtNUHJHQHUDFLI\]LFNëFKDSV\FKLFNëFKVLO &DUSH'LHPWKHOHDGLQJ6ZHGLVKEHGPDQXIDFWXUHULVNQRZQIRULWVTXD OLW\WLPHOHVVGHVLJQDQGXVHRIWKHÀQHVWQDWXUDOPDWHULDOV7KHFRPSDQ\ SULGHVLWVHOIRQWKHKLJKVWDQGDUGVWKDWDUHQHFHVVDU\IRUJRRGVOHHSDQG WULHVWRIXOÀOWKHPWKURXJKLWVSURFHVVHV%HGVDQGDFFHVVRULHVE\WKH&DU SH'LHPFRPSDQ\DUHYHU\SRSXODUDURXQGWKHZRUOGSURYLGLQJWKHFRU UHFWVOHHSZKLFKLVQHFHVVDU\IRUWKHUHJHQHUDWLRQRISK\VLFDODQGPHQWDO VWUHQJWK ǎDZǰǿȅǴǵ ȄǮDZǰǽǶǴǵ ǻǼǺǴdzǮǺǰǴǾDZǷȈ ǻǺǽǾDZǷDZǵ ©&DUSH 'LHPª ǴdzǮDZǽǾDZǹ ǽǮǺǴǸǶǬȃDZǽǾǮǺǸǮǹDZǮǼDZǸDZǹǹȇǸǰǴdzǬǵǹǺǸǴǴǽǻǺǷȈdzǺǮǬǹǴDZǸǷǿȃȄǴȁ ǹǬǾǿǼǬǷȈǹȇȁǸǬǾDZǼǴǬǷǺǮǖǺǸǻǬǹǴȋǺǾǷǴȃǬDZǾǽȋǽǺǭǷȊǰDZǹǴDZǸǮȇǽǺǶǴȁ ǽǾǬǹǰǬǼǾǺǮ ǹDZǺǭȁǺǰǴǸȇȁ ǰǷȋ ȁǺǼǺȄDZǯǺ ǽǹǬ Ǵ ǽǾǬǼǬDZǾǽȋ ǻǺǽǾǺȋǹǹǺ ǻǼDZǰǻǼǴǹǴǸǬǾȈǹǺǮȇDZȄǬǯǴǮȉǾǺǸǹǬǻǼǬǮǷDZǹǴǴǖǼǺǮǬǾǴǴǬǶǽDZǽǽǿǬǼȇ ǶǺǸǻǬǹǴǴ ©&DUSH 'LHPª ǺȃDZǹȈ ǻǺǻǿǷȋǼǹȇ ǮǺ ǮǽDZǸ ǸǴǼDZ ǻǺǾǺǸǿ ȃǾǺ ǯǬǼǬǹǾǴǼǿȊǾ ǶǬȃDZǽǾǮDZǹǹȇǵ ǽǺǹ ǹDZǺǭȁǺǰǴǸȇǵ ǰǷȋ ǮǺǽǽǾǬǹǺǮǷDZǹǴȋ ȀǴdzǴȃDZǽǶǴȁǴǰǿȄDZǮǹȇȁǽǴǷ 6+2:5220 QDW\QDW\ 6HQRYiæQpQiPĚVWtD3UDKD ZZZQDW\QDW\F]

19


129,1.<_1(:6_DŽDžƸDžLjljƿ .))3ŏ('67$98-(129,1.< .))35(6(1761(:6 .))ǛǜǑǐǝǞnjǎǗǫǑǞǙǚǎǔǙǖǔǏǚǐnj (UJRQRPLFN\GRNRQDOëQiE\WHN]QDÿN\.))]DNRXStWHH[NOX]LYQĚYVKRZUR RPX6HGOiN,QWHULHU9SRUWIROLXQDOH]QHWHMDNVHGDFtQiE\WHNYKRGQëGR LQWHULpUXLH[WHULpUXWDNLäLURNpVSHNWUXPVWROŢRGMtGHOQtFKDæSRNRQIH UHQÿQtPRGHO\2GERUQtFLYiP]GHURYQĚæSRUDGtMDNëW\S]DŐt]HQtMHSUR YDäL SRWŐHEX QHMYKRGQĚMät 6 QiE\WNHP .)) RFHQtWH NYDOLWX QĚPHFNpKR YëUREFH]DGRVWXSQRXFHQX <RXFDQSXUFKDVHWKHHUJRQRPLFDOO\SHUIHFW.))EUDQGIXUQLWXUHH[FOXVLYH O\IURPWKH6HGOiN,QWHULHUVKRZURRP7KHSRUWIROLRLQFOXGHVERWKIXUQLWXUH VXLWDEOHIRULQWHULRUDQGH[WHULRUVHDWLQJDVZHOODVDZLGHUDQJHRIWDEOHV IURPGLQLQJURRPWRFRQIHUHQFHPRGHOV+HUHH[SHUWVZLOODOVRDGYLVH\RX RQZKDWW\SHRIIXUQLWXUHLVEHVWVXLWHGWR\RXUQHHGV:LWK.))IXUQLWXUH \RXFDQDSSUHFLDWHWKHTXDOLW\RI*HUPDQPDQXIDFWXULQJDWDQDIIRUGDEOH SULFH ǩǼǯǺǹǺǸǴȃǹǿȊǴǽǺǮDZǼȄDZǹǹǿȊǸDZǭDZǷȈǸǬǼǶǴ.))ǸǺDzǹǺǻǼǴǺǭǼDZǽǾǴ ǴǽǶǷȊȃǴǾDZǷȈǹǺ Ǯ ǽǬǷǺǹDZ ©6HGOiN ,QWHULpUª ǎ ǶǺǷǷDZǶȂǴǴ ǸDZǭDZǷȈ ǰǷȋ ǽǴǰDZǹǴȋ ǻǺǰȁǺǰȋȅǬȋ ǶǬǶ ǰǷȋ ǴǹǾDZǼȈDZǼǬ ǾǬǶ Ǵ ǰǷȋ ȉǶǽǾDZǼȈDZǼǬ ȄǴǼǺǶǴǵǽǻDZǶǾǼǽǾǺǷǺǮ²ǺǾǺǭDZǰDZǹǹȇȁǰǺǶǺǹȀDZǼDZǹȂǸǺǰDZǷDZǵǞǬǶDzDZ dzǰDZǽȈ ǸǺDzǹǺ ǻǺǷǿȃǴǾȈ ǴǽȃDZǼǻȇǮǬȊȅǿȊ ǶǺǹǽǿǷȈǾǬȂǴȊ ǽǻDZȂǴǬǷǴǽǾǬ ǻǺ ǮǺǻǼǺǽǿ ǶǬǶǺǵ ǾǴǻ ǸDZǭDZǷǴ ǷǿȃȄDZ ǮǽDZǯǺ ǻǺǰȁǺǰǴǾ ǴǸDZǹǹǺ ǎǬǸ ǘDZǭDZǷȈ.))²ȉǾǺǮǺdzǸǺDzǹǺǽǾȈǺȂDZǹǴǾȈǮȇǽǺǶǺDZǶǬȃDZǽǾǮǺǹDZǸDZȂǶǺǯǺ ǻǼǺǴdzǮǺǰǴǾDZǷȋǻǺǰǺǽǾǿǻǹǺǵȂDZǹDZ 6+2:5220 6('/É.,17(5,(5 9LQRKUDGVNi3UDKD ZZZVHGODNLQWHULHUF]

7528%$%$8.1(&+7%/3037 %$8.1(&+7%/3037+27$,529(1 ǐǟǡǚǎǚǕǤǖnjǠ%$8.1(&+7%/3037 8VQDGQLWD]SŐtMHPQLWFKYLON\NWHUpWUiYtWHXSHÿHQtYiPQ\QtXPRæQtS\ UROLWLFNi KRUNRY]GXäQi WURXED %DXNQHFKW %/30 37 MHæ GLVSRQXMH PQRKD IXQNFHPL D Y\OHSäHQtPL 3DPĚŘRYi IXQNFH WHSORWQt VRQGD ÿL LQ WHOLJHQWQtUR]YRGQëV\VWpP1R3UHKHDWGtN\NWHUpPXVHYëUD]QĚ]NUDFXMH GREDSŐHGHKŐtYiQtYiPXVQDGQtSUiFLYNXFK\QLDGtN\QDGÿDVRYpPXGH VLJQXVNODYNRPELQDFLVXäOHFKWLORXRFHOtVHKRGtMDNGRPRGHUQtFKWDNL WUDGLÿQtFKNXFK\Qt 7KHS\UROLWLF%DXNQHFKW%/3037KRWDLURYHQZKLFKLVPXOWLIXQFWL RQDOKDVLPSURYHPHQWVWRIDFLOLWDWHDQGVKRUWHQEDNLQJWLPH<RXUZRUNLQ WKHNLWFKHQLVVLPSOLÀHGE\WKHPHPRU\IXQFWLRQWHPSHUDWXUHVHQVRUDQG 1R3UHKHDWLQWHOOLJHQWGLVWULEXWLRQV\VWHPZKLFKVLJQLÀFDQWO\UHGXFHVSUH KHDWLQJWLPH7KHWLPHOHVVGHVLJQRIJODVVFRPELQHGZLWKKLJKJUDGHVWHHO LVVXLWDEOHIRUERWKPRGHUQDQGWUDGLWLRQDONLWFKHQV ǚǭǷDZǯȃǴǾȈ ǼǬǭǺǾǿ Ǵ ǽǰDZǷǬǾȈ ǻǼǴȋǾǹȇǸ ǮǼDZǸȋ ǻǼǺǮǺǰǴǸǺDZ ǿ ǻǼǴǯǺǾǺǮǷDZǹǴȋǻǴȅǴǾDZǻDZǼȈǻǺdzǮǺǷǴǾǰǿȁǺǮǬȋǻDZȃȈ%/3037%DXN QHFKWǺǽǹǬȅDZǹǹǬȋǸǺȅǹǺǵǽǴǽǾDZǸǺǵǻǴǼǺǷǴǾǴȃDZǽǶǺǵǺȃǴǽǾǶǴǬǾǬǶDzDZ ǴǸDZȊȅǬȋ ǸǹǺǯǺ ȀǿǹǶȂǴǵ Ǵ ǿǽǺǮDZǼȄDZǹǽǾǮǺǮǬǹǴǵ ǠǿǹǶȂǴȋ ǻǬǸȋǾǴ dzǺǹǰǰǬǾȃǴǶǾDZǸǻDZǼǬǾǿǼȇǴǷǴ©ǿǸǹǬȋªǼǬǽǻǼDZǰDZǷǴǾDZǷȈǹǬȋǽǴǽǾDZǸǬ©1R 3UHKHDWªǭǷǬǯǺǰǬǼȋǶǺǾǺǼǺǵdzǹǬȃǴǾDZǷȈǹǺǽǺǶǼǬȅǬDZǾǽȋǮǼDZǸȋǻǼǺǯǼDZǮǬ ǺǭǷDZǯȃǴǾǎǬȄǿǼǬǭǺǾǿǹǬǶǿȁǹDZǐǿȁǺǮǬȋǻDZȃȈ%DXNQHFKWǺǭǷǬǰǬDZǾǹDZ ǮȇȁǺǰȋȅǴǸ Ǵdz ǸǺǰȇ ǰǴdzǬǵǹǺǸ ©ǽǾDZǶǷǺ ǻǷȊǽ ǹDZǼDzǬǮDZȊȅǬȋ ǽǾǬǷȈª Ǵ ǻǺǰȁǺǰǴǾǶǬǶǰǷȋǽǺǮǼDZǸDZǹǹȇȁǾǬǶǴǰǷȋǶǷǬǽǽǴȃDZǽǶǴȁǶǿȁǺǹȈ =GURMDIRWRVRXUFHDQGSKRWRVǴǽǾǺȃǹǴǶǴȀǺǾǺZZZZKLUOSRROF]

20


129,1.<_1(:6_DŽDžƸDžLjljƿ /200(5(92/8&(9(63$1Ì /200(7+(5(92/87,21,66/((3,1* /200(ǜǑǎǚǗǪǢǔǫǎǚǝǙǑ 'HVLJQRYiSRVWHO]QDÿN\/RPPHGRVWDODMHGHQ]QHMSŐLUR]HQĚMätFKSŐtURG QtFKWYDUŢRYiO3RVWHOSŐLSRPtQDMtFtYHMFHMHYHYQLWŐGRSOQĚQDRLQVWDODFL Y\VRFHVYtWLYëFK/('GLRGNWHUpY\WYiŐtEDUHYQRXVW\OL]DFLDWtPRYOLYŁXMt FHONRYpGXäHYQtUR]SRORæHQt2FKUDQQëYHMÿLWëREDOQDYtFÀOWUXMHRNROQtKOXN D]DŐtGtYiPWDNNOLGQĚMätVSiQHN3RNXGQDRSDNUiGLXVtQiWHSŐLKXGEĚ SRVORXætYiP]DEXGRYDQëL3RG 7KH/RPPHEUDQGGHVLJQHUEHGKDVEHHQJLYHQRQHRIWKHPRVWQDWXUDO VKDSHV³WKHRYDO7KHEHGZKLFKLVUHPLQLVFHQWRIDQHJJLVFRPSOHPHQ WHGE\WKHLQVWDOODWLRQRIKLJKEULJKWQHVV/('VLQWKHLQWHULRUFUHDWLQJD FRORXUVW\OLVDWLRQDQGWKXVDIIHFWLQJWKHRYHUDOOVWDWHRIPLQG0RUHRYHU WKH SURWHFWLYH RYRLG FRDW ÀOWHUV RXW EDFNJURXQG QRLVH DQG HQVXUHV \RXU SHDFHIXOVOHHS&RQYHUVHO\LI\RXOLNHIDOOLQJDVOHHSZKLOHOLVWHQLQJWRPX VLFDEXLOWLQL3RGLVDW\RXUVHUYLFH

‹ORPPH

ǖǼǺǮǬǾȈ ǸǬǼǶǴ /RPPH ǺǭǷǬǰǬDZǾ ǺǰǹǺǵ Ǵdz ǽǬǸȇȁ DZǽǾDZǽǾǮDZǹǹȇȁ ǻǼǴǼǺǰǹȇȁ ȀǺǼǸ  ǺǮǬǷȈǹǺǵ ǖǼǺǮǬǾȈ ǹǬǻǺǸǴǹǬȊȅǬȋ ȋǵȂǺ ǮǹǿǾǼǴ ǽǹǬǭDzDZǹǬ ǽǮDZǾǺǰǴǺǰǬǸǴ ǮȇǽǺǶǺǵ ȋǼǶǺǽǾǴ ǶǺǾǺǼȇDZ ǽǺdzǰǬȊǾ ȂǮDZǾǹǿȊ ǽǾǴǷǴdzǬȂǴȊ Ǵ ǽǺǺǾǮDZǾǽǾǮDZǹǹǺ ǮǷǴȋȊǾ ǹǬ ǹǬǽǾǼǺDZǹǴDZ ǓǬȅǴǾǹǬȋ ȋǵȂDZǮǴǰǹǬȋ ǺǭǺǷǺȃǶǬ ȀǴǷȈǾǼǿDZǾ ǺǶǼǿDzǬȊȅǴǵ ȄǿǸ Ǵ ǾǬǶǴǸ ǺǭǼǬdzǺǸ ǽǻǺǽǺǭǽǾǮǿDZǾ ǽǻǺǶǺǵǹǺǸǿ ǽǹǿ ǔ ǹǬǺǭǺǼǺǾ DZǽǷǴ Ǹȇ ǽ ǿǰǺǮǺǷȈǽǾǮǴDZ dzǬǽȇǻǬDZǸǻǺǰǸǿdzȇǶǿǾǺǻǼǴǯǺǰǴǾǽȋǮǽǾǼǺDZǹǹȇǵǮǶǼǺǮǬǾȈL3RG =GURMDIRWRVRXUFHDQGSKRWRVǴǽǾǺȃǹǴǶǴȀǺǾǺZZZORPPHFRP

‹ORPPH

67Ì129e()(.7<93ŏ('67$9ę720$',;21$ 6+$'2:())(&76,1,17(535(7$7,21%<720',;21 ǞǑǙǑǎǧǑǩǠǠǑǖǞǧǎǛǜǑǐǝǞnjǎǗǑǙǔǔǞǚǘnjǐǔǖǝǚǙnj $WPRVIHULFNpKUDYpVWtQ\QDEt]tQRYiVYtWLOQDRGSURVOXOpKREULWVNpKRGH VLJQpUD7RPD'L[RQD-HMtVWUXNWXUDMHWYRŐHQDQHSUDYLGHOQëPLSĚWL~KHOQtN\ D KOLQtNRYëPL æLONDPL VNU]H NWHUp SURWODÿXMH YHONi æiURYND VYp VYĚWHOQp SDSUVN\MHæQiVOHGQĚY\WYiŐtXQLNiWQtVWtQRYpREUD]FH 7KLVQHZODPSE\UHQRZQHG%ULWLVKGHVLJQHU7RP'L[RQSURYLGHVSOD\IXO DWPRVSKHULFVKDGRZV,WVVWUXFWXUHLVFRPSRVHGRILUUHJXODUSHQWDJRQV DQGDOXPLQLXPYHLQVWKURXJKZKLFKWKHODUJHEXOEH[WUXGHVLWVOLJKWUD\V LQWXUQFUHDWLQJXQLTXHVKDGRZ\SDWWHUQV njǾǸǺǽȀDZǼǿ ǴǯǼǴǮȇȁ ǾDZǹDZǵ ǸǺDzǹǺ ǺǭǹǬǼǿDzǴǾȈ ǿ ǹǺǮǺǵ ǷǬǸǻȇ ǺǾ ǴdzǮDZǽǾǹǺǯǺ ǭǼǴǾǬǹǽǶǺǯǺ ǰǴdzǬǵǹDZǼǬ ǞǺǸǬ ǐǴǶǽǺǹǬ ǑDZ ǽǾǼǿǶǾǿǼǬ ǽǺǽǾǺǴǾ Ǵdz ǻȋǾǴǿǯǺǷȈǹǴǶǺǮ ǹDZǻǼǬǮǴǷȈǹǺǵ ȀǺǼǸȇ ǽ ǬǷȊǸǴǹǴDZǮȇǸǴ ǻǼǺDzǴǷǶǬǸǴǽǶǮǺdzȈǶǺǾǺǼȇDZǻǼǺȁǺǰȋǾǷǿȃǴǽǮDZǾǬǺǾǭǺǷȈȄǺǵǷǬǸǻǺȃǶǴ ȃǾǺǮǽǮǺȊǺȃDZǼDZǰȈǽǺdzǰǬDZǾǿǹǴǶǬǷȈǹȇǵǼǴǽǿǹǺǶǾDZǹDZǵ =GURMDIRWRVRXUFHDQGSKRWRVǴǽǾǺȃǹǴǶǴȀǺǾǺZZZWRPGL[RQQHW

21


,163,5$&(_,163,5$7,21_ƸƺDžnjDŽDžƸƻDŽƿƻ

+DUPRQLHDVRXGU]QRVW A

   $UQHKR-DFREVHQD

22

WH[W+HOHQD9DYUGRYi IRWRZZZIULW]KDQVHQFRP

$UQH-DFREVHQ+DUPRQ\DQG&RKHVLRQ ƹǣǴǰDzDZǬȃǬǨǧǬDZǵǶǥDzƶǴDZǨǖǮDzǤǵǨDZǣ


,163,5$&(_,163,5$7,21_ƸƺÇ&#x2026;Ç&#x152;Ç&#x201E;Ç&#x2026;ƸƝÇ&#x201E;ƿƝ 1DGĂżDVRYRVWHOHJDQFHIXWXULVWLFNpSUYN\DOHLOiVNDNSĹ?tURGÄ&#x161;7YRUED MHGQRKR]QHMYĂŤ]QDPQÄ&#x161;MätFKGiQVNĂŤFKXPÄ&#x161;OFŢVWROHWt$UQHKR-DFRE VHQDVHGiFKDUDNWHUL]RYDWPQRKDYĂŤUD]\VWHMQÄ&#x161;MDNRMHMtUR]OLĂżQRVW$ DĂżNROLMH]QiPVStäHSURVYpGHVLJQRYpYĂŤUREN\VYRXQHOLERVWtYŢÿLR]QD ĂżHQtGHVLJQpUE\OSURVOXOĂŤDViPVHEHSRYDĂŚRYDOSĹ?HGHYätP]DDUFKLWHNWD $UQH-DFREVHQVHQDURGLOYURFHY.RGDQLDMLĂŚYUDQpPYÄ&#x161;NXVNOt]HO ]DVYpQiYUK\YĂŤ]QDPQiRFHQÄ&#x161;Qt-DNRVWXGHQWDUFKLWHNWXU\QD'iQVNp NUiORYVNp XQLYHU]LWÄ&#x161; ]tVNDO QD SDĹ?tĂŚVNpP YHOHWUKX GHNRUDWLYQtKR XPÄ&#x161;Qt Y URFH  VWĹ?tEUQRX PHGDLOL ]D GHVLJQ ĂŚLGOH -HäWÄ&#x161; ]D VWXGLt VH Y\GDO URYQÄ&#x161;ĂŚGR%HUOtQDNGHVHVH]QiPLOVSUYN\W]YUDFLRQiOQtDUFKLWHNWXU\ NWHUp]iVDGQÄ&#x161;RYOLYQLO\MHKRUDQpSUiFH=DVYŢMDEVROYHQĂżQtSURMHNWQi YUKGHVLJQXSURXPÄ&#x161;OHFNRXJDOHULLSDN]tVNDOGRNRQFH]ODWRXPHGDLOL

Timelessness, elegance, futuristic elements, as well as the love of Nature. The diversity in the creations of one of Denmarkâ&#x20AC;&#x2122;s most important artists of the 20th century, Arne Jacobsen, can be described by just as many diverse expressions. And although he is known more for his design products, he was renowned for his abhorrence against the designer label and considered himself primarily an architect. Arne Jacobsen was born in 1902 in Copenhagen and, already at an early age, harvested signiďŹ cant awards for his proposals. As a student of Architecture at the Royal University of Denmark, he won a Silver medal for the design of a chair at the Paris Exhibition of Decorative Arts in 1925. During his studies, he also went to Berlin, where he got to know the elements of â&#x20AC;&#x153;rational architectureâ&#x20AC;? which signiďŹ cantly inďŹ&#x201A;uenced his early works. For his graduation project, the proposal for the design of an art gallery, he even won a gold medal.

23


,163,5$&(_,163,5$7,21_ƸƺDžnjDŽDžƸƻDŽƿƻ ǎǹDZǮǼDZǸDZǹǹǺǵ ǰǴdzǬǵǹ ȉǷDZǯǬǹǾǹǺǽǾȈ ȀǿǾǿǼǴǽǾǴȃDZǽǶǴDZ ȉǷDZǸDZǹǾȇ Ǵ ǮǸDZǽǾDZ ǽ ǾDZǸ  ǷȊǭǺǮȈ Ƕ ǻǼǴǼǺǰDZ ǞǮǺǼȃDZǽǾǮǺ ǺǰǹǺǯǺ Ǵdz ǽǬǸȇȁ ǴdzǮDZǽǾǹȇȁ ȁǿǰǺDzǹǴǶǺǮ ǐǬǹǴǴ ǰǮǬǰȂǬǾǺǯǺ ǽǾǺǷDZǾǴȋ njǼǹDZ ǫǶǺǭǽDZǹǬ ǸǺDzǹǺ ǺȁǬǼǬǶǾDZǼǴdzǺǮǬǾȈ ǽ ǻǺǸǺȅȈȊ ǸǹǺǯǴȁ ǮȇǼǬDzDZǹǴǵ ǮǻǼǺȃDZǸ ǶǬǶǴDZǯǺǼǬdzǹǺǺǭǼǬdzǴDZǚǹǭǺǷȈȄDZǴdzǮDZǽǾDZǹǽǮǺǴǸǴǰǴdzǬǵǹDZǼǽǶǴǸǴ ǴdzǰDZǷǴȋǸǴ ǹǺ ǹDZǽǸǺǾǼȋ ǹǬ ȉǾǺ Ǻǹ ǻǴǾǬDZǾ ǹDZǷȊǭǺǮȈ Ƕ ǽǷǺǮǿ ©ǰǴdzǬǵǹDZǼªǴǽȃǴǾǬDZǾǽDZǭȋǻǼDZDzǰDZǮǽDZǯǺǬǼȁǴǾDZǶǾǺǼǺǸ

njǼǹDZǫǶǺǭǽDZǹǼǺǰǴǷǽȋǮǯǺǰǿǮǖǺǻDZǹǯǬǯDZǹDZǴǿDzDZǮǸǺǷǺǰǺǸ ǮǺdzǼǬǽǾDZ ǻǺǷǿȃǬǷ dzǬ ǽǮǺǴ ǻǼDZǰǷǺDzDZǹǴȋ ǴdzǮDZǽǾǹȇDZ ǹǬǯǼǬǰȇ ǍǿǰǿȃǴ ǽǾǿǰDZǹǾǺǸ ǬǼȁǴǾDZǶǾǿǼȇ Ǯ ǖǺǼǺǷDZǮǽǶǺǸ ǿǹǴǮDZǼǽǴǾDZǾDZ ǐǬǹǴǴ Ǯ  ǯǺǰǿǺǹǻǺǷǿȃǴǷǽDZǼDZǭǼȋǹǿȊǸDZǰǬǷȈdzǬǰǴdzǬǵǹǽǾǿǷȈDZǮǹǬǻǬǼǴDzǽǶǺǵ ǮȇǽǾǬǮǶDZ ǰDZǶǺǼǬǾǴǮǹǺǯǺ ǴǽǶǿǽǽǾǮǬ  ǎǺ ǮǼDZǸȋ ǿȃDZǭȇ ǫǶǺǭǽDZǹ ǻǺǭȇǮǬǷǮǍDZǼǷǴǹDZǯǰDZǺdzǹǬǶǺǸǴǷǽȋǽȉǷDZǸDZǹǾǬǸǴǾǬǶǹǬdzȇǮǬDZǸǺǵ ǼǬȂǴǺǹǬǷȈǹǺǵ ǬǼȁǴǾDZǶǾǿǼȇ ǶǺǾǺǼȇDZ dzǹǬȃǴǾDZǷȈǹǺ ǻǺǮǷǴȋǷǴ ǹǬ DZǯǺ ǼǬǹǹǴDZǼǬǭǺǾȇǓǬǽǮǺǵǮȇǻǿǽǶǹǺǵǰǴdzǬǵǹǻǼǺDZǶǾǰǷȋȁǿǰǺDzDZǽǾǮDZǹǹǺǵ ǯǬǷDZǼDZǴǺǹǰǬDzDZdzǬǮǺDZǮǬǷdzǺǷǺǾǿȊǸDZǰǬǷȈ

3RDEVROYRYiQtVWXGLtVL-DFREVHQ]DORæLOYODVWQtNDQFHOiŐDGRSRYĚGRPt GiQVNp YHŐHMQRVWL VH YHSVDO SŐHGHYätP PRGHUQtP SŐtPRŐVNëP NRPSOH [HP Y .ODPSHQERUJX %ĚKHP GUXKp VYĚWRYp YiON\ DOH ]QDÿQĚ SRNOHVOD SRSWiYNDSRDUFKLWHNWRQLFNpSUiFLDREHFQĚLSŐtVXQNRQVWUXNÿQtKRPD WHULiOX'iQVNRE\ORQDYtFRNXSRYiQRQDFLVW\D-DFREVHQMDNRåLGUDGĚML RGHäHOQDGYDURN\GRäYpGVNpKRH[LOXNGHQDYUKRYDOWH[WLOLHDWNDQLQ\ 3RQiYUDWXGRURGQpKR'iQVNDYURFHE\ORSRWŐHEDQRYëFKGRPŢD YHŐHMQëFKEXGRYDWDNVH-DFREVHQXMtPiKQHGQĚNROLNDQiYUKŢDÿNROLMH MDVQpæHSULPWHQWRNUiWKUDMHVStäHU\FKORVWDMHGQRGXFKRVWVWDYE\QHæ MHMtY]H]ŐHQt.H[SHULPHQWRYiQtVQiYUK\EXGRYVHYUDFtDæYSUŢEĚKX OHW NG\ VH ]iURYHŁ ]DÿtQi YtFH ]DMtPDW R GHVLJQ YëURENŢ 1iVOHGXMH OH JHQGiUQtæLGOH$QWNWHUiVHVWDQHMHGQtP]QHMREOtEHQĚMätFKGHVLJQRYëFK QiE\WNŢVWROHWtDMHMtSR]GĚMätVpULHMHæURYQĚæMDNR$QWY\FKi]t] SŐHGVWDY\PRGHUQtKROHKNpKRDVQDGQRVNODGRYDWHOQpKRQiE\WNX

24


,163,5$&(_,163,5$7,21_ƸƺÇ&#x2026;Ç&#x152;Ç&#x201E;Ç&#x2026;ƸƝÇ&#x201E;ƿƝ

After graduation, he established his own ofďŹ ce, called Jacobsen, and won recognition from the Danish public, in particular for the modern seaside complex in Klampenborg. However, during the Second World War, the demand for architectural work and generally also the supply of construction materials decreased. Moreover, Denmark was occupied by the Nazis and Jacobsen, a Jew, went instead into exile for two years in Sweden, where he designed textiles and fabrics. After returning to his native Denmark in 1945, new houses and public buildings were needed, therefore Jacobsen took charge of several proposals, although it was clear that this time priority was rather for the speed and simplicity of construction than for appearance. He returned to experimentation with the design of buildings only during the 50s, when he also began to be more interested in product design. He created the legendary Ant chair, which was to become one of the most popular designer furniture items of the 20th century, and its successor, the Series 7 which, like the Ant, was also based on the idea of modern, light and easily storable furniture.

Ç&#x203A;Ǻǽǡǹ ǺǜǺǚČ&#x192;ǏǚǴČ&#x2039; ǴǚǽǞǴǞǿǞǏ ǍǜǺǭǽǹǚ ǺǞǜǟČ&#x2021;ǡ ǽǎǺČ&#x160; Č&#x20AC;ǴǟǸǿ ÇŹ ǽǟǹǰǴ ǰǏǞǽǜǺǾ ǺǭČ&#x2026;ǹǽǞǎǹǚǚǺǽǞǴ ǝǟǺǽǡǏǎǴǡǽČ&#x2039; ǝǟǹDzǰǹ ǎǽǹǯǺ ǽǎǺǴǸ ǝǟǺǹǜǞǺǸǝǟǴǸǺǟǽǜǺǯǺǜǺǸǝǡǹǜǽǏÇŽÇ&#x2013;ǡǏǸǝǹǚǭǺǟǯǹÇ&#x17D;ÇşǎǟǹǸČ&#x2039;Ç&#x17D;ǞǺǟǺǾ ǸǴǟǺǎǺǾ ǎǺǾǚČ&#x2021; ǽǝǟǺǽ ǚǏ ÇŹÇźČ Ç´ÇžÇąÇśÇžÇżÇźÇšČ&#x2021;Çą ǟǏǭǺǞČ&#x2021; Ç´ ǺǭČ&#x2026;ÇżČ&#x160; ǰǺǽǞǏǎǜǿ ǸǏǞǹǟǴǏǡǏǰǡČ&#x2039;ǜǺǚǽǞǟǿǜČ&#x201A;Ç´ÇľdzǚǏČ&#x192;ǴǞǹǡČ&#x2C6;ǚǺǽǚǴdzǴǡǽČ&#x2039;Ç&#x2013;ǟǺǸǹǞǺǯǺÇ?ǏǚǴČ&#x2039; Ç­Č&#x2021;ǡǏ ǺǜǜǿǝǴǟǺǎǏǚǏ Č&#x20AC;ÇŹČ&#x201E;ǴǽǞǏǸǴ Ç´ ǜǏǜ ǹǎǟǹǾ ǍǜǺǭǽǹǚ ǝǟǹǰǝǺČ&#x192;ǹǡ ǺǞǝǟǏǎǴǞČ&#x2C6;Ç˝Č&#x2039;ǚǏÇ°ÇŽÇŹǯǺǰǏÇŽǴdzǯǚǏǚǴǹÇŽǤǎǹČ&#x201A;Ç´Č&#x160;ÇŻÇ°ÇąǺǚǟǏdzǟǏǭǏǞČ&#x2021;ǎǏǡ ǰǴdzǏǾǚǞǹǜǽǞǴǡČ&#x2039;Ç´ǞǜǏǚǹǾ

Ç&#x203A;Ǻǽǡǹ ǎǺdzǎǟǏČ&#x2026;ǹǚǴČ&#x2039; ÇŽ ǟǺǰǚǿČ&#x160; Ç?ǏǚǴČ&#x160; ÇŻÇ°Çą ÇŽ  ǯǺǰǿ ǎǺdzǟǺǽǡǏ ǝǺǞǟǹǭǚǺǽǞČ&#x2C6; ÇŽ ǚǺǎČ&#x2021;Č  Ç°ÇşÇ¸ÇŹČ  Ç´ ǺǭČ&#x2026;ǹǽǞǎǹǚǚČ&#x2021;Č  dzǰǏǚǴČ&#x2039;Č  ǍǜǺǭǽǹǚ ǝǟǴǚǴǸǏǹǞ ǚǹǽǜǺǡČ&#x2C6;ǜǺ ǝǟǹǰǡǺDzǹǚǴǾ Č ÇşÇžČ&#x2039; Č&#x2039;ǽǚǺ Č&#x192;ǞǺ ǞǺǯǰǏ ǴǸǹǡǏ dzǚǏČ&#x192;ǹǚǴǹ ǽǜǺǟǹǹ ǽǜǺǟǺǽǞČ&#x2C6; ǽǞǟǺǾǜǴ Ç´ ǝǟǺǽǞǺǞǏ ǜǺǚǽǞǟǿǜČ&#x201A;Ç´Ç´ Č&#x192;ǹǸ ǹǹ ǺǭǡǴǜÇ&#x2013;Č&#x2030;ǜǽǝǹǟǴǸǹǚǞǏǸÇ˝ǰǴdzǏǾǚǺǸdzǰǏǚǴǾǺǚǎǹǟǚǹǞǽČ&#x2039;ÇŽÇąǯǺǰČ&#x2021; ǜǏǜǟǏdzǞǺǯǰǏǜǺǯǰǏǹǯǺǚǏČ&#x192;ǏǡǴǚǞǹǟǹǽǺǎǏǞČ&#x2C6;ǰǴdzǏǾǚǝǟǺǰǿǜǞǺǎÇ&#x203A;ǺǞǺǸ ǝǺǽǡǹǰǿǹǞ ǡǹǯǹǚǰǏǟǚČ&#x2021;Çľ ǽǞǿǡ Š$QWÂŞ ǜǺǞǺǟČ&#x2021;Çľ ǽǞǏǚǹǞ ǺǰǚǴǸ Ç´Çł ǽǏǸČ&#x2021;Č  ǝǺǝǿǡČ&#x2039;ǟǚČ&#x2021;Č ÇŽǰǴdzǏǾǚǹǟǽǜǺǾǸǹǭǹǡǴǽǞǺǡǹǞǴČ&#x2039;ÇŹdzǏǞǹǸǟǏdzǟǏǭǺǞǜǏ ŠÇ?ǹǟǴǴÂŞ ǜǺǞǺǟǏČ&#x2039; ǞǏǜ Dzǹ ǜǏǜ Ç´ Š$QWÂŞ ǺǽǚǺǎǏǚǏ ǚǏ ǜǺǚČ&#x201A;ǹǝČ&#x201A;Ç´Ç´ ǽǺǎǟǹǸǹǚǚǺǾǿǰǺǭǚǺǾÇ´ǡǹǯǜǺǽǜǡǏǰČ&#x2021;ǎǏǹǸǺǾǸǹǭǹǡǴ

26


67$57<285 &/$66,& &2//(&7,21

3RŒLĶWHVLRULJLQiOOHJHQGiUQtKRNŒHVOD(** .ŒHVOR(**QDYUKOURNX$UQH-DFREVHQSUR5R\DO+RWHOY.RGDQL 2EMHGQHMWHVLWXWRGHVLJQRYRXLNRQXGRYOiWFH)$0( ]DQHXYĹŒLWHOQŢFK.ĴYĴ'3+ VWDQGDUGQtFHQDMH.ĴYĴ'3+  3ŒLUHJLVWUDFLQDVWUiQNiFKIULW]KDQVHQFRPP\UHSXEOLF]tVNiWHGHVHWLOHWRX]iUXNX

3D H. Interiér, s.r.o., showroom: Rohanské nábř. 7/657, 186 00 Praha 8, tel.: +420 222 719 541, po – pá 9 – 18, so 10 – 14 h, www.3dh.cz


'(6,*10ý6Ì&(_'(6,*12)7+(0217+_ƺƿƾƶǀDŽǃƻLjǖǍƶ

PŘIROZENÝ MINIMALISMUS MAURA LIPPARINIHO WH[W+HOHQD9DYUGRYi IRWRZZZPDXUROLSSDULQLFRP

ƻǵǶǨǵǶǥǨDZDZǿǭǰǬDZǬǰǣǯǬǫǰǃǣǷǴDzǂǬdzdzǣǴǬDZǬ

28


'(6,*10ý6Ì&(_'(6,*12)7+(0217+_ƺƿƾƶǀDŽǃƻLjǖǍƶ

-HKRVW\OMH]DORæHQQDMHGQRGXFKëFKIRUPiFKDÿLVWëFKYëUD]QëFKOLQLtFK ]iURYHŁ VH YäDN QHERMt YROQĚ QDNOiGDW V RUJDQLFNëPL WYDU\ ÿL EDUYDPL 0LQLPDOLVPXVYMHKRSRMHWtWDNUR]äLŐXMHVYpPRæQRVWLDY\WYiŐtQRYpSR GRE\3ŐHGVWDYXMHPHYiPKODYQtKRSŐHGVWDYLWHOHDLQRYiWRUDSŐLUR]HQpKR PLQLPDOLVPXLWDOVNpKRGHVLJQpUD0DXUD/LSSDULQLKR

+LVVW\OHLVEDVHGRQVLPSOHIRUPVDQGFOHDQGLVWLQFWOLQHVEXWDOVRKHLV QRWDIUDLGWRGLVSRVHIUHHO\RIRUJDQLFVKDSHVDQGFRORXUV0LQLPDOLVPLQ KLVFRQFHSWLRQWKXVH[WHQGVLWVSRVVLELOLWLHVDQGFUHDWHVQHZIRUPV:H DUHLQWURGXFLQJWKHPDLQUHSUHVHQWDWLYHDQGLQQRYDWRURI1DWXUDO0LQL PDOLVP,WDOLDQGHVLJQHU0DXUR/LSSDULQL

0DXUR/LSSDULQLVHQDURGLOYWRVNiQVNpPPĚVWHÿNX*URVHWWRYURFH DY\VWXGRYDODUFKLWHNWXUXQDXQLYHU]LWĚYH)ORUHQFLLNGHYSR]GĚMätGREĚ SŢVRELO L MDNR SURIHVRU -HKR MPpQR E\OR QĚNROLNUiW RYĚQÿHQR PH]LQi URGQtPLFHQDPLMPHQXMPHQDSŐtNODG<RXQJ 'HVLJQHU0LODQRÿL,QWHU QDWLRQDO 'X 3RQW $ZDUG /LSSDULQLKR äLURNp VSHNWUXP WYRUE\ ]DKUQXMH SUŢP\VORYëGHVLJQYUiPFLNWHUpKRWYRŐtNDQFHOiŐVNëLGRPiFtQiE\WHN DWH[WLOQtSURGXNW\DURYQĚæDUFKLWHNWXUXDLQWHULpURYëGHVLJQ=GHVH/LS SDULQLVRXVWŐHGtQDSURMHNW\VRXNURPëFKLYHŐHMQëFKEXGRYVKRZURRPŢ PHQätFKREFKRGŢDYëVWDY'DOät]ÿLQQRVWt/LSSDULQLKRVWXGLDNWHUpYHGH VSROHÿQĚVHVYRXPDQæHONRX0LFKHOOH5LFKWHUMVRXLQiYUK\DUHDOL]DFH FHONRYpLPDJHDYL]XiOQtKRVW\OXÀUHP

0DXUR/LSSDULQLZDVERUQLQWKH7XVFDQWRZQRI*URVHWWRLQDQG VWXGLHG$UFKLWHFWXUHDWWKH8QLYHUVLW\RI)ORUHQFHZKHUHKHODWHUOHFWXUHG DVD3URIHVVRU+LVQDPHZDVFURZQHGZLWKVHYHUDOLQWHUQDWLRQDODZDUGV DPRQJ WKHP OHW XV QDPH IRU H[DPSOH WKH <RXQJ  'HVLJQHU 0LODQR DQG,QWHUQDWLRQDO'X3RQW$ZDUG/LSSDULQL·VZLGHUDQJHRIFUHDWLYLW\LQ FOXGHV LQGXVWULDO GHVLJQ ZLWKLQ ZKLFK KH FUHDWHV RIÀFH DQG KRPH IXU QLWXUHDQGWH[WLOHSURGXFWVDVZHOODVDUFKLWHFWXUHDQGLQWHULRUGHVLJQ +HUH/LSSDULQLIRFXVHVRQSURMHFWVRISULYDWHDVZHOODVSXEOLFEXLOGLQJV VKRZURRPVVPDOOHUVKRSVDQGH[KLELWLRQV$QRWKHUDFWLYLW\RI/LSSDULQL·V VWXGLRZKLFKKHPDQDJHVMRLQWO\ZLWKKLVZLIH0LFKHOOH5LFKWHUDUHWKH SURSRVDOVDQGLPSOHPHQWDWLRQVRIWKHRYHUDOOLPDJHDQGYLVXDOVW\OHRI FRPSDQLHV

Natural Minimalism of Mauro Lipparini

29


'(6,*10ý6Ì&(_'(6,*12)7+(0217+_ƺƿƾƶǀDŽǃƻLjǖǍƶ ǑǯǺ ǽǾǴǷȈ ǺǽǹǺǮǬǹ ǹǬ ǻǼǺǽǾȇȁ ȀǺǼǸǬȁ Ǵ ȃǴǽǾȇȁ ǮȇǼǬdzǴǾDZǷȈǹȇȁ ǷǴǹǴȋȁ ǹǺ Ǯ ǾǺ DzDZ ǮǼDZǸȋ Ǻǹ ǹDZ ǭǺǴǾǽȋ ǽǮǺǭǺǰǹǺ ǼǬǽǻǺǼȋDzǬǾȈǽȋ ǺǼǯǬǹǴȃDZǽǶǴǸǴȀǺǼǸǬǸǴǴǷǴȂǮDZǾǬǸǴǞǬǶǴǸǺǭǼǬdzǺǸǸǴǹǴǸǬǷǴdzǸ Ǯ DZǯǺ ǶǺǹȂDZǻȂǴǴ ǼǬǽȄǴǼȋDZǾ ǽǮǺǴ ǮǺdzǸǺDzǹǺǽǾǴ ǽǺdzǰǬǮǬȋ ǹǺǮȇDZ ǺǭǼǬdzȇǛǼDZǰǽǾǬǮǷȋDZǸǎǬǸǺǽǹǺǮǹǺǯǺǷǴǰDZǼǬǴǹǺǮǬǾǺǼǬǮǺǭǷǬǽǾǴ DZǽǾDZǽǾǮDZǹǹǺǯǺ ǸǴǹǴǸǬǷǴdzǸǬ  ǴǾǬǷȈȋǹǽǶǺǯǺ ǰǴdzǬǵǹDZǼǬ ǘǬǿǼǺ ǗǴǻǻǬǼǴǹǴ

ǘǬǿǼǺ ǗǴǻǻǬǼǴǹǴ ǼǺǰǴǷǽȋ Ǯ ǾǺǽǶǬǹǽǶǺǸ ǯǺǼǺǰDZ ǏǼǺǽDZǾǾǺ Ǯ  ǯǺǰǿ ǴdzǿȃǬǷ ǬǼȁǴǾDZǶǾǿǼǿ Ǯ ǿǹǴǮDZǼǽǴǾDZǾDZ ǠǷǺǼDZǹȂǴǴ ǯǰDZ ǻǺdzDzDZ ǼǬǭǺǾǬǷǮǶǬȃDZǽǾǮDZǻǼǺȀDZǽǽǺǼǬǑǯǺǴǸȋǭȇǷǺǿǮDZǹȃǬǹǺǹDZǽǶǺǷȈǶǴǸǴ ǸDZDzǰǿǹǬǼǺǰǹȇǸǴǹǬǯǼǬǰǬǸǴǽǼDZǰǴǹǴȁǾǬǶǴDZǶǬǶ©<RXQJ 'HVLJQHU 0LODQRªǴǷǴ©,QWHUQDWLRQDO'X3RQW$ZDUGªǤǴǼǺǶǴǵǽǻDZǶǾǼǾǮǺǼȃDZǽǾǮǬ ǗǴǻǻǬǼǴǹǴǮǶǷȊȃǬDZǾǮǽDZǭȋǻǼǺǸȇȄǷDZǹǹȇǵǰǴdzǬǵǹǮǼǬǸǶǬȁǶǺǾǺǼǺǯǺ Ǻǹ ǽǺdzǰǬDZǾ ǺȀǴǽǹǿȊ Ǵ ǰǺǸǬȄǹȊȊ ǸDZǭDZǷȈ Ǭ ǾǬǶDzDZ ǾDZǶǽǾǴǷȈǹǿȊ ǻǼǺǰǿǶȂǴȊ ǬǼȁǴǾDZǶǾǿǼǹȇǵ ǰǴdzǬǵǹ Ǵ ǰǴdzǬǵǹ ǴǹǾDZǼȈDZǼǺǮ Ǯ ǶǺǾǺǼǺǸ ǗǴǻǻǬǼǴǹǴ ǽǺǽǼDZǰǺǾǬȃǴǮǬDZǾǽȋ ǹǬ ǻǼǺDZǶǾȇ ȃǬǽǾǹȇȁ Ǵ ǺǭȅDZǽǾǮDZǹǹȇȁ dzǰǬǹǴǵ ȄǺǿǼǿǸǺǮ ǹDZǭǺǷȈȄǴȁ ǸǬǯǬdzǴǹǺǮ Ǵ ǮȇǽǾǬǮǺǶ ǐǬǷȈǹDZǵȄǴǸ ǻǼǴǷǺDzDZǹǴDZǸ ǾǮǺǼȃDZǽǶǴȁ ǿǽǴǷǴǵ ǽǾǿǰǴǴ ǗǴǻǻǬǼǴǹǴ ǼǬǭǺǾǬDZǾ ǽǺǮǸDZǽǾǹǺ ǽǺ ǽǮǺDZǵ DzDZǹǺǵ ǘǴȄDZǷȈ ǜǴȁǾDZǼ ȋǮǷȋDZǾǽȋ ǼǬdzǼǬǭǺǾǶǬ Ǵ ǼDZǬǷǴdzǬȂǴȋǺǭȅDZǯǺǴǸǴǰDzǬǴǮǴdzǿǬǷȈǹǺǯǺǽǾǴǷȋǶǺǸǻǬǹǴǵ

6WXGLRPiQDVYpPNRQWĚQĚNROLNYë]QDPQëFKSURMHNWŢ-HGQtP]QLFKMHL PXOWLIXQNÿQtNRPSOH['HPDYHPĚVWĚ&HUWDOGRQHGDOHNR)ORUHQFLHNWHUë MHFKDUDNWHULVWLFNëNRYRYëPPŐtæRYtPREHStQDMtFtPFHOëNRPSOH[7HQWR W\SLFNëSUYHNRGND]XMtFtNIDUPiŐVNëPEXGRYiPWDNY\WYiŐtSRXWRPH]L EXGRYRX D RNRX]OXMtFtP WRVNiQVNëP SURVWŐHGtP 8QLNiWQtP SURMHNWHP MVRXURYQĚæ.UiORYVNp]DKUDG\YþtQĚNRPSOH[\VWiYDMtFtVH]HGYRXGUX KŢEXGRYRENORSHQëFKSŐtURGQtPLSUYN\MDNRMVRXSDUN\ÿLYRGQtSORFK\ +ODYQtP\äOHQNRXSURMHNWXE\ORY\WYRŐHQtUH]LGHQÿQtRi]\NWHUiSRVN\WQH VYëPRE\YDWHOŢPGRVWDWHÿQpVRXNURPtDOH]iURYHŁMLPGRYROtYpVWNYDOLW QtDSŐtMHPQëVSROHÿHQVNëæLYRW 0DXUR/LSSDULGiOHQDYUKOPQRKRKRWHORYëFKDREFKRGQtFKLQWHULpUŢ]H MPpQD Y URGQp ,WiOLL D -DSRQVNX D VSROXSUDFXMH V PQRKD GHVLJQRYëPL VSROHÿQRVWPL-PHQXMPH]DYäHFKQ\DOHVSRŁ]QDÿNX%RQDOGRNWHUiMHN GRVWiQtLYÿHVNëFKREFKRGHFKDVNUëYiSRGVHERXWDQHMSUHVWLæQĚMätGH VLJQpUVNiMPpQD/LSSDULKRQHMQRYĚMätYëUREHNSRGVSROHÿQRVWt%RQDOGR VHGDFtVRXSUDYDVRULJLQiOQtPQDVWDYLWHOQëPRSĚUDGOHP9LWD6RIDEXGH NGRVWiQtMHäWĚYSUŢEĚKXWRKRWRURNX

30


Äæã”áãØÙæâl”ÝâèÙæÝcæ ©¤”áãØÙàŽ ÙìßàéîÝêâl×ܔßæ֎ îâÕaßí

”ØÙçÝÛâšêæãÖՔ¸ãáÝâÝåéٔ½áÖÙæè

ìÓåæáçâ×àj’âäá’!Ä ÇÙáÕ×ã”ç¢æ¢ã¢ ÄãØdÖæÕØçßX”¥¥ ”ÄæÕÜՔ­ èÙࢮ”¦¬¨¤¥¥ªªª ”ÚÕ쮔¦¬¨¤¥¥ªª« çÙáÕ×ã´çÙáÕ×ã¢âÙè ëëë¢Úã×éç¡×æÙÕèÝãâ¢×ãá


'(6,*10ý6Ì&(_'(6,*12)7+(0217+_ƺƿƾƶǀDŽǃƻLjǖǍƶ 7KH VWXGLR KDV ZRUNHG RQ VHYHUDO VLJQLÀFDQW SURMHFWV 2QH RI WKHP LV WKH PXOWLIXQFWLRQDO 'HPD FRPSOH[ LQ &HUWDOGR QHDU )ORUHQFH ZKLFK LV FKDUDFWHULVHGE\DPHWDOODWWLFHDURXQGWKHHQWLUHFRPSOH[7KLVW\SLFDO HOHPHQW UHIHUULQJ WR IDUP EXLOGLQJV WKXV FUHDWHV D ERQG EHWZHHQ WKH EXLOGLQJ DQG WKH FKDUPLQJ 7XVFDQ HQYLURQPHQW $QRWKHU XQLTXH SUR MHFW LV WKH 5R\DO *DUGHQV LQ &KLQD FRPSOH[HV FRQVLVWLQJ RI WZR W\SHV RI EXLOGLQJV VXUURXQGHG E\ QDWXUDO HOHPHQWV VXFK DV SDUNV DQG ZDWHU DUHDV7KHPDLQLGHDRIWKHSURMHFWZDVWRFUHDWHDUHVLGHQWLDORDVLVWKDW ZLOO SURYLGH LWV UHVLGHQWV ZLWK VXIÀFLHQW SULYDF\ ZKLOH DOORZLQJ WKHP WR KDYHDTXDOLW\DQGHQMR\DEOHVRFLDOOLIH 0DXUR/LSSDULQLKDVDOVRGHVLJQHGPDQ\KRWHODQGFRPPHUFLDOLQWHULRUV HVSHFLDOO\ LQ KLV QDWLYH ,WDO\ DQG LQ -DSDQ DQG FROODERUDWHV ZLWK PDQ\ GHVLJQFRPSDQLHV/HWXVDWOHDVWPHQWLRQWKH%RQDOGREUDQGZKLFKLV DYDLODEOH LQ &]HFK VKRSV DQG FRQFHDOV WKH PRVW SUHVWLJLRXV GHVLJQHU QDPHV/LSSDULQL·VODWHVWSURGXFWXQGHUWKHFRPSDQ\RI%RQDOGRWKH9LWD 6RIDDVRIDZLWKDQRULJLQDODGMXVWDEOHEDFNUHVWZLOODOUHDG\EHDYDLODEOH LQWKHFRXUVHRIWKLV\HDU

ǝǾǿǰǴȋ ǸǺDzDZǾ ǻǺȁǮǬǽǾǬǾȈǽȋ ǼǬǭǺǾǺǵ ǹǬǰ ǹDZǽǶǺǷȈǶǴǸǴ ǶǼǿǻǹȇǸǴ ǻǼǺDZǶǾǬǸǴ ǚǰǹǴǸ Ǵdz ǹǴȁ ȋǮǷȋDZǾǽȋ ǸǹǺǯǺȀǿǹǶȂǴǺǹǬǷȈǹȇǵ ǶǺǸǻǷDZǶǽ ©'HPDª Ǯ ǯǺǼǺǰDZ ǣDZǼǾǬǷȈǰǺ ǹDZǰǬǷDZǶǺ ǺǾ ǠǷǺǼDZǹȂǴǴ ȁǬǼǬǶǾDZǼǹȇǵ ǸDZǾǬǷǷǴȃDZǽǶǺǵ ǼDZȄDZǾǶǺǵ ǺǭǾȋǯǴǮǬȊȅDZǵ ȂDZǷȇǵ ǶǺǸǻǷDZǶǽ ǩǾǺǾ ǾǴǻǴȃǹȇǵ ȉǷDZǸDZǹǾ ǹǬǻǺǸǴǹǬȊȅǴǵ Ǻ ȀDZǼǸDZǼǽǶǴȁ ǰǺǸǬȁ ǽǺdzǰǬDZǾ ǽǮȋdzȈ ǸDZDzǰǿ dzǰǬǹǴDZǸ Ǵ ǺȃǬǼǺǮǬǾDZǷȈǹȇǸ ǾǺǽǶǬǹǽǶǴǸ ǺǶǼǿDzDZǹǴDZǸ ǟǹǴǶǬǷȈǹȇǸǻǼǺDZǶǾǺǸǾǬǶDzDZȋǮǷȋȊǾǽȋǖǺǼǺǷDZǮǽǶǴDZǽǬǰȇǮǖǴǾǬDZ² ǶǺǸǻǷDZǶǽȇǽǺǽǾǺȋȅǴDZǴdzǰǮǿȁǾǴǻǺǮdzǰǬǹǴǵǺǶǼǿDzDZǹǹȇȁǻǼǴǼǺǰǹȇǸǴ ȉǷDZǸDZǹǾǬǸǴ ǾǬǶǴǸǴ ǶǬǶ ǻǬǼǶǴ Ǵ ǮǺǰǺDZǸȇ ǚǽǹǺǮǹǬȋ ǴǰDZȋ ǻǼǺDZǶǾǬ dzǬǶǷȊȃǬǷǬǽȈ Ǯ ǽǺdzǰǬǹǴǴ DzǴǷǺǯǺ ǺǬdzǴǽǬǼDZdzǴǰDZǹȂǴǴ ǶǺǾǺǼǬȋ ǻǼDZǰǺǽǾǬǮǷȋDZǾ ǽǮǺǴǸ DzǴǾDZǷȋǸ ǰǺǽǾǬǾǺȃǹǺ ȃǬǽǾǹǺǯǺ ǻǼǺǽǾǼǬǹǽǾǮǬ ǹǺ ǮǸDZǽǾDZ ǽ ǾDZǸ ǻǺdzǮǺǷȋDZǾ ǴǸ ǮDZǽǾǴ ǶǬȃDZǽǾǮDZǹǹǿȊ Ǵ ǻǼǴȋǾǹǿȊ ǺǭȅDZǽǾǮDZǹǹǿȊDzǴdzǹȈ ǘǬǿǼǺ ǗǴǻǻǬǼǴǹǴ ǾǬǶDzDZ ǼǬdzǼǬǭǺǾǬǷ ǸǹǺǯǺ ǶǺǸǸDZǼȃDZǽǶǴȁ Ǵ ǯǺǽǾǴǹǴȃǹȇȁǴǹǾDZǼȈDZǼǺǮǺǽǺǭDZǹǹǺǮDZǯǺǼǺǰǹǺǵǔǾǬǷǴǴǴǫǻǺǹǴǴǺǹ ȃǬǽǾǺǽǺǾǼǿǰǹǴȃǬDZǾǽǺǸǹǺǯǴǸǴǰǴdzǬǵǹDZǼǽǶǴǸǴǶǺǸǻǬǹǴȋǸǴ

ǝǼDZǰǴ ǮǽDZȁ ȁǺȃDZǾǽȋ ǮȇǰDZǷǴǾȈ ǸǬǼǶǿ ©%RQDOGRª ǶǺǾǺǼǿȊ ǸǺDzǹǺ ǻǼǴǺǭǼDZǽǾǴ Ǵ Ǯ ȃDZȄǽǶǴȁ ǸǬǯǬdzǴǹǬȁ Ǵ ǻǺǰ ǹǬdzǮǬǹǴDZǸ ǶǺǾǺǼǺǵ ǽǶǼȇǾȇ ǽǬǸȇDZ ǻǼDZǽǾǴDzǹȇDZ ǰǴdzǬǵǹDZǼǽǶǴDZ ǴǸDZǹǬ ǙǺǮDZǵȄǴǵ ǻǼǺǰǿǶǾ ǗǴǻǻǬǼǴǹǴ Ǯ ǶǺǸǻǬǹǴǴ ©%RQDOGRª  ǰǴǮǬǹ ǽ ǺǼǴǯǴǹǬǷȈǹǺǵ ǼDZǯǿǷǴǼǿDZǸǺǵǽǻǴǹǶǺǵ©9LWD6RIDªǸǺDzǹǺǭǿǰDZǾǶǿǻǴǾȈǮǣDZȁǴǴǿDzDZǮ ǾDZȃDZǹǴDZȉǾǺǯǺǯǺǰǬ

32


BE FREE IN STYLE W W W. F R E E D O M K Y. C Z

FREE ART OF LIVING EVERYWHERE

Důmyslně koncipovaný FREEDOMEK sleduje nejnovější trendy v ekologickém i stylovém bydlení.

The FREEDOMEK is a well-conceived smart living solution and follows the latest trends in ecological housing.

Vyniká promyšlenou organizací prostoru,

With the advantage of well organized space,

kvalitou provedení a moderním designem. Díky luxusnímu vybavení skýtá veškerý komfort i pro nejnáročnější uživatele. FREEDOMEK může být zcela nezávislý na inženýrských sítích.

quality construction and modern design it provides all comfort and is able to meet the needs of the most demanding users. The FREEDOMEK can be completely independent of local utilities.


÷(6.ĩ'(6,*1_&=(&+'(6,*1_ǎƻǏLjǁƿǀƺƿƾƶǀDŽ IRWR$UFKLY9683

Svěží vítr v porcelánu: Ondřej Batoušek Ondřej Batoušek: A Breath of Fresh Air in Ceramics LjǥǨǪǬǨǬǧǨǬǥǸǣǴǸDzǴǨDžDZǧǴǪǨǭƷǣǶDzǷǼǨǮ WH[W+HOHQD9DYUGRYi IRWRZZZEDWRXVHNF]

34


÷(6.ĩ'(6,*1_&=(&+'(6,*1_ǎƻǏLjǁƿǀƺƿƾƶǀDŽ

0ODGëGHVLJQpU2QGŐHM%DWRXäHNMHMHGQRX]YëUD]QëFKSRVWDYÿHVNpKR GHVLJQXNHUDPLN\DSRUFHOiQX9HVYpWYRUEĚVHQHFKiYiLQVSLURYDWMDN EĚæQRXNDæGRGHQQRVWtWDNKLVWRULtNWHUpVYpPSURSRMHQtY\WYiŐtSRGNODG SURVYĚætGtOD0H]LWDQHM]QiPĚMätSDWŐt%OHVNRYN\GRVHEH]DSDGDMtFt SRUFHOiQRYpYi]\LQVSLURYDQpOLQLtEOHVNXGiOHEDURNL]XMtFtYi]\6DQWLQL MHMLFKæY]RUHPE\OWYDUNDSOHYHåďiUXQDG6i]DYRXÿLYWLSQpGHNRUDFH RYHÿN\%HHYHWYDUXNYĚWiNX

IRWR*HLVEDFKHURYD <RXQJGHVLJQHU2QGŐHM%DWRXäHNLVRQHRIWKHGLVWLQFWLYHSHUVRQDOLWLHVLQ &]HFKFHUDPLFDQGSRUFHODLQGHVLJQ,QKLVZRUNKHLVLQVSLUHGERWKE\ HYHU\GD\OLIHDQGKLVWRU\WKHFRQQHFWLRQRIZKLFKFUHDWHVWKHEDVLVIRU IUHVKZRUNV+LVEHVWNQRZQZRUNVLQFOXGH%OHVNRYN\ /LJKWQLQJ)ODVKHV  LQWHUORFNLQJSRUFHODLQYDVHVLQVSLUHGE\WKHÁDVKRIOLJKWQLQJDVZHOODV WKH%DURTXHHVTXH6DQWLQLYDVHVPRGHOOHGDIWHUWKHVKDSHRIWKHFKDSHO LQåďiUQDG6i]DYRXDQGWKHKXPRURXVGHFRUDWLRQVRI%HH6KHHSLQWKH VKDSHRIDFDXOLÁRZHU

ǘǺǷǺǰǺǵ ǰǴdzǬǵǹDZǼ ǚǹǰǼDzDZǵ ǍǬǾǺǿȄDZǶ ȋǮǷȋDZǾǽȋ ǺǰǹǺǵ Ǵdz ǮȇǼǬdzǴǾDZǷȈǹȇȁ ȀǴǯǿǼ ȃDZȄǽǶǺǯǺ ǰǴdzǬǵǹǬ ǶDZǼǬǸǴǶǴ Ǵ ȀǬǼȀǺǼǬ ǎ ǽǮǺDZǸ ǾǮǺǼȃDZǽǾǮDZ Ǻǹ ǮǰǺȁǹǺǮǷȋDZǾǽȋ ǶǬǶ ǶǬǼǾǴǹǬǸǴ ǻǺǮǽDZǰǹDZǮǹǺǵ DzǴdzǹǴǾǬǶǴǴǽǾǺǼǴDZǵǺǭȆDZǰǴǹȋȋǴȁǺǹǻǺǷǿȃǬDZǾǺǽǹǺǮǿǰǷȋǹǺǮȇȁ ǼǬǭǺǾ ǝǼDZǰǴ ǹǬǴǭǺǷDZDZ ǴdzǮDZǽǾǹȇȁ © %OHVNRYN\ª ǸǺǷǹǴǴ   ǮȁǺǰȋȅǴDZ ǺǰǹǬ Ǯ ǰǼǿǯǿȊ ȀǬǼȀǺǼǺǮȇDZ ǮǬdzȇ ǮǰǺȁǹǺǮǷDZǹǹȇDZ ȀǺǼǸǺǵ ǸǺǷǹǴǵ ǮǬdzȇǮǽǾǴǷDZǭǬǼǺǶǶǺ©6DQWLQLªǽǺdzǰǬǹǹȇDZǮȀǺǼǸDZȃǬǽǺǮǹǴǮǯǺǼǺǰDZ ǒǰȋǼǹǬǰǝǬdzǬǮǺǵ ǴǷǴ ȊǸǺǼǴǽǾǴȃDZǽǶǴDZ ǿǶǼǬȄDZǹǴȋ  ǺǮDZȃǶǬ %HH Ǯ ȀǺǼǸDZȂǮDZǾǹǺǵǶǬǻǿǽǾȇ

35


Austrálie

$XVWUDOLD ƶǥǵǶǴǣǯǬȃ

1DUR]GtORGRVWDWQtFK]HPtYHVYĚWĚQHPXVt$XVWUiOLHŐHäLWSUREOpP\ V QHGRVWDWNHP SURVWRUX +XVWRWD ]DOLGQĚQt ]GH GRVDKXMH SRX]H  RE\YNP VYĚWRYëSUŢPĚUMHRE\YNP 'RYHONëFKPHWURSROtVH VRXVWŐHďXMH YĚWäLQD RE\YDWHO ]DWtPFR Y QHMEOLæätP RNROt YHONRPĚVW MH SRX]H QHREëYDQi SXVWLQD 'tN\ WRPX GRFKi]t N RGGĚOHQt NXOWXU Y MHGQRWOLYëFKPĚVWHFKDGRFKi]tWDNNUR]GtOŢPNWHUpO]HSŐLURYQDWNH NRQWUDVWXPH]LMHGQRWOLYëPLVWiW\Y(YURSĚ 9 URFH  QDYUKOL DUFKLWHNWL ] +DVVHOO 6WXGLR VWDYEX NRPXQLWQtKR FHQWUD +DUULQJWRQ *URYH &RXQWU\ &OXE 6YëP WYDUHP D YëUD]QĚ SŐHYLV ORXVWŐHFKRXWURFKXSŐLSRPtQiVWDYE\MDSRQVNpDUFKLWHNWXU\SŐLEOLæätP SRKOHGXMVRXDOHSDWUQpPRGHUQtPDWHULiO\DRULJLQiOQĚŐHäHQpGHWDLO\ 3ŐHYLVOiVWŐHFKD]DVWLŁXMHLQWHULpUNWHUëGtN\SURVNOHQëPVWĚQiPXPRæ ŁXMH QHUXäHQë YëKOHG GR ]HOHQĚ Y H[WHULpUX 9 RNROt VWDYE\ VH QDFKi]t WHUpQQtDPÀWHiWUDED]pQVGDOätPLVSRUWRYLäWL )RWR+DVVHOO6WXGLRDUFKGDLO\FRP

36

WH[W0LFKDO=iKRUD



=-,1e+2.287869ý7$_)520$',))(5(173$572)7+(:25/'_DŽƶƺLJNJƹDžǃǁDžDŽǍƻLjƸƻljƶ


=-,1e+2.287869ý7$_)520$',))(5(173$572)7+(:25/'_DŽƶƺLJNJƹDžǃǁDžDŽǍƻLjƸƻljƶ &RQWUDU\WRRWKHUFRXQWULHVLQWKHZRUOG$XVWUDOLDGRHVQRWQHHGWR GHDOZLWKWKHSUREOHPVRIDODFNRIVSDFH3RSXODWLRQGHVWLQ\KHUH UHDFKHVRQO\SHUVRQVSHUVTXDUHNLORPHWUH WKHZRUOGDYHUDJHLV SHUVRQVSHUNP 0RVWLQKDELWDQWVOLYHLQELJPHWURSROLVHVZKLOH WKHUHLVXQLQKDELWDEOHZDVWHODQGLQFORVHSUR[LPLW\WRWKHFLWLHV$OVR GXH WR WKLV IDFW FXOWXUHV LQ LQGLYLGXDO FLWLHV EHFRPH VHSDUDWHG DQG WKHGLIIHUHQFHVZKLFKDULVHFDQEHFRPSDUHGWRWKHFRQWUDVWEHWZHHQ LQGLYLGXDO(XURSHDQFRXQWULHV ,QWKHDUFKLWHFWVRI+DVVHOO6WXGLRGHVLJQHGWKHFRQVWUXFWLRQRI WKH FRPPXQLW\ FHQWUH RI WKH +DUULQJWRQ *URYH &RXQWU\ &OXE :LWK LWV VKDSH DQG GLVWLQFWLYHO\ RYHUKDQJLQJ URRI LW LV UHPLQLVFHQW RI -DSDQH VH DUFKLWHFWXUH +RZHYHU FORVHU LQVSHFWLRQ UHYHDOV PRGHUQ PDWHULDOV DQGRULJLQDOO\ÀQLVKHGGHWDLOV7KHRYHUODSSLQJURRIVKLHOGVWKHLQWHULRU ZKLFKWKDQNVWRWKHJODVVHGZDOOVSURYLGHVDQXQGLVWXUEHGYLHZRIWKH H[WHULRUJUHHQHU\7KHDPSKLWKHDWUHVZLPPLQJSRRODQGRWKHUVSRUWLQJ JURXQGVDUHORFDWHGLQWKHYLFLQLW\ 3KRWR+DVVHOO6WXGLRDUFKGDLO\FRP

ǎǺǾǷǴȃǴDZǺǾǰǼǿǯǴȁǽǾǼǬǹǸǴǼǬnjǮǽǾǼǬǷǴȋǹDZǺdzǬǭǺȃDZǹǬǻǼǺǭǷDZǸǺǵ ǹDZȁǮǬǾǶǴ ǻǼǺǽǾǼǬǹǽǾǮǬ ǛǷǺǾǹǺǽǾȈ ǹǬǽDZǷDZǹǴȋ dzǰDZǽȈ ǽǺǽǾǬǮǷȋDZǾ ǮǽDZǯǺ  DzǴǾDZǷDZǵǶǸ ǽǼDZǰǹDZǸǴǼǺǮǺǵ ǻǺǶǬdzǬǾDZǷȈ ǽǺǽǾǬǮǷȋDZǾ ȃDZǷǺǮDZǶǶǸ ǎǶǼǿǻǹȇȁǯǺǼǺǰǬȁǽǶǺǹȂDZǹǾǼǴǼǺǮǬǹǬǭǺǷȈȄǬȋ ȃǬǽǾȈ ǹǬǽDZǷDZǹǴȋ Ǯ ǾǺ ǮǼDZǸȋ ǶǬǶ Ǯ ǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵ ǭǷǴdzǺǽǾǴ ǺǾ ǸDZǯǬǻǺǷǴǽǺǮ  ǾǺǷȈǶǺ ǹDZǺǭǴǾǬDZǸǬȋ ǻǿǽǾǺȄȈ ǎ ǼDZdzǿǷȈǾǬǾDZ ǻǼǺǴǽȁǺǰǴǾǼǬdzǰDZǷDZǹǴDZǶǿǷȈǾǿǼǮǼǬdzǹȇȁǯǺǼǺǰǬȁǬȉǾǺǻǼǴǮǺǰǴǾ Ƕ ǼǬdzǷǴȃǴȋǸ ǶǺǾǺǼȇDZ ǸǺDzǹǺ ǽǼǬǮǹǴǾȈ ǽ ǶǺǹǾǼǬǽǾǬǸǴ ǸDZDzǰǿ ǺǾǰDZǷȈǹȇǸǴǽǾǼǬǹǬǸǴǮǑǮǼǺǻDZ

ǎ  ǯǺǰǿ ǬǼȁǴǾDZǶǾǺǼȇ Ǵdz ©+DVVHOO 6WXGLRª ǻǼDZǰǷǺDzǴǷǴ ǻǼǺDZǶǾ ǽǾǼǺǴǾDZǷȈǽǾǮǬǺǭȅǴǹǹǺǯǺȂDZǹǾǼǬ©+DUULQJWRQ*URYH&RXQWU\&OXEªǑǯǺ ȀǺǼǸǬǴǮȇǼǬdzǴǾDZǷȈǹǺǹǴǽǻǬǰǬȊȅǬȋǶǼȇȄǬǹDZǸǹǺǯǺǹǬǻǺǸǴǹǬȊǾ ǻǺǽǾǼǺǵǶǴ ȋǻǺǹǽǶǺǵ ǬǼȁǴǾDZǶǾǿǼȇ ǻǼǴ ǭǷǴDzǬǵȄDZǸ ǼǬǽǽǸǺǾǼDZǹǴǴ ǺǰǹǬǶǺ ǮǴǰǹȇ ǽǺǮǼDZǸDZǹǹȇDZ ǸǬǾDZǼǴǬǷȇ Ǵ ǺǼǴǯǴǹǬǷȈǹȇDZ ǰDZǾǬǷǴ ǙǴǽǻǬǰǬȊȅǬȋ ǶǼȇȄǬ dzǬǾDZǹȋDZǾ ǴǹǾDZǼȈDZǼ Ǵdz ǶǺǾǺǼǺǯǺ ǭǷǬǯǺǰǬǼȋ ǽǾDZǶǷȋǹǹȇǸǽǾDZǹǬǸǺǾǶǼȇǮǬDZǾǽȋǹǬǮDZǮǬȊȅǴǵǻǺǶǺǵǮǴǰǹǬdzDZǷDZǹȇDZ ǺǶǼDZǽǾǹǺǽǾǴǓǰǬǹǴDZǼǬǽǻǺǷǺDzDZǹǺǼȋǰǺǸǽǺǾǶǼȇǾȇǸǬǸȀǴǾDZǬǾǼǺǸ ǽǭǬǽǽDZǵǹǺǸǴǰǼǿǯǴǸǴǽǻǺǼǾǴǮǹȇǸǴǽǺǺǼǿDzDZǹǴȋǸǴ ǠǺǾǺ+DVVHOO6WXGLRDUFKGDLO\FRP

37


=-,1e+2.287869ý7$_)520$',))(5(173$572)7+(:25/'_DŽƶƺLJNJƹDžǃǁDžDŽǍƻLjƸƻljƶ =iNODGQtPVWDYHEQtPSUYNHPY$XVWUiOLLMHYROQĚVWRMtFtURGLQQëGŢP NWHUë MH ÿDVWR ]FHOD L]RORYiQ RG GDOät ]iVWDYE\ 7\SLFNëP SŐtNODGHP MH6W$QGUHZV%HDFK+RXVHRG6HDQ*RGVHOO$UFKLWHFWV]URNX 'ŢPMHY\YëäHQëQDGRNROQtWHUpQDYHY]QLNOpPSURVWRUXSRGGRPHP VHQDFKi]tPtVWRSURDXWR=DMtPDYRVWtMHQĚNROLNDYUVWYëSOiäŘ]UŢ]QëFK PDWHULiOŢNWHUpPLQLPDOL]XMtYOLYYHQNRYQtFKWHSORWQDWHSHOQRXSRKRGX YLQWHULpUX )RWRZRUOGDUFKLWHFWXUHQHZVFRP

.UiVQRXXNi]NRXWRKRæHLRE\ÿHMQiOiYNDSURSĚätPŢæHEëWNYDOLWQt DUFKLWHNWXURXMH:HE%ULGJHY'RFNODQGVNWHUëQDYUKO'HQWRQ&RUNHU 0DUVKDOO3URVWRURYiSDYXÿLQDVHREWiÿtNROHPFKRGQtNXDY\WYiŐtWDN DWUDNWLYQtREiONXNWHUiMHQDYtFYQRFLSRGSRŐHQDHIHNWQtPQDVYtFHQtP )RWRKWWSLDPZD\ZHQZRUGSUHVVFRP

7KH EDVLF EXLOGLQJ XQLW LQ $XVWUDOLD LV WKH IUHHVWDQGLQJ IDPLO\ KRXVH ZKLFKLVRIWHQHQWLUHO\LVRODWHGIURPDQ\RWKHUEXLOWXSDUHD$W\SLFDO H[DPSOH LV 6W $QGUHZV %HDFK +RXVH GHVLJQHG E\ 6HDQ *RGVHOO $U FKLWHFWVLQ7KHKRXVHLVHOHYDWHGDERYHWKHVXUURXQGLQJWHUUDLQ OHDYLQJVSDFHIRUDFDULQWKHDUHDFUHDWHGXQGHUWKHKRXVH$PDWWHU RILQWHUHVWLVWKHPXOWLOD\HUHGVXUIDFHRIGLIIHUHQWPDWHULDOVWKDWPLQL PLVHVWKHLPSDFWRIH[WHUQDOWHPSHUDWXUHVRQWKHWHPSHUDWXUHFRPIRUW RIWKHLQWHULRU 3KRWRZRUOGDUFKLWHFWXUHQHZVFRP

:HE%ULGJHLQ'RFNODQGVGHVLJQHGE\'HQWRQ&RUNHU0DUVKDOOLVDVWUL NLQJH[DPSOHWKDWHYHQDQRUGLQDU\IRRWEULGJHFDQEHDTXDOLW\DUFKL WHFWXUDOZRUN7KHVSDFLRXVZHEHQFLUFOHVWKHIRRWSDWKWKXVFUHDWLQJDQ DWWUDFWLYHFRYHUZKLFKLVDGGLWLRQDOO\HPSKDVLVHGE\HIIHFWLYHOLJKWLQJ DWQLJKW 3KRWRKWWSLDPZD\ZHQZRUGSUHVVFRP

ǚǽǹǺǮǹǺǵ ǽǾǼǺǴǾDZǷȈǹȇǵ ȉǷDZǸDZǹǾ Ǯ njǮǽǾǼǬǷǴǴ  ǽǮǺǭǺǰǹǺ ǽǾǺȋȅǴǵ ǽDZǸDZǵǹȇǵǰǺǸǶǺǾǺǼȇǵdzǬȃǬǽǾǿȊǻǺǷǹǺǽǾȈȊǴdzǺǷǴǼǺǮǬǹǺǾǰǼǿǯǺǵ dzǬǽǾǼǺǵǶǴǞǴǻǴȃǹȇǸǻǼǴǸDZǼǺǸȋǮǷȋDZǾǽȋ©6W$QGUHZV%HDFK+RXVHª ǯ ǺǾǽǾǿǰǴǴ©6HDQ*RGVHOO$UFKLWHFWVªǐǺǸǻǼǴǻǺǰǹȋǾǹǬǰ ǺǶǼǿDzǬȊȅDZǵǸDZǽǾǹǺǽǾȈȊǬǻǺǰǰǺǸǺǸDZǽǾȈǸDZǽǾǺǰǷȋǬǮǾǺǸǺǭǴǷȋ ǔǹǾDZǼDZǽǹǺȃǾǺǶǺǼǻǿǽdzǰǬǹǴȋǽǺǽǾǺǴǾǴdzǹDZǽǶǺǷȈǶǴȁǽǷǺǮǼǬdzǷǴȃǹȇȁ ǸǬǾDZǼǴǬǷǺǮ ǶǺǾǺǼȇDZ ǸǴǹǴǸǴdzǴǼǿȊǾ ǮǷǴȋǹǴDZ ǾDZǸǻDZǼǬǾǿǼȇ ǺǶǼǿDzǬȊȅDZǵǽǼDZǰȇǹǬǾDZǻǷǺǮǺǵǶǺǸȀǺǼǾǮǰǺǸDZ ǠǺǾǺZRUOGDUFKLWHFWXUHQHZVFRP

ǛǼDZǶǼǬǽǹȇǵ ǻǼǴǸDZǼǺǸ ǾǺǯǺ ȃǾǺ ǰǬDzDZ Ǻǭȇȃǹȇǵ ǻDZȄDZȁǺǰǹȇǵ ǸǺǽǾ ǸǺDzDZǾǭȇǾȈȁǺǼǺȄǴǸǻǼǴǸDZǼǺǸǶǬȃDZǽǾǮDZǹǹǺǵǬǼȁǴǾDZǶǾǿǼȇȋǮǷȋDZǾǽȋ ǸǺǽǾ©:HE%ULGJHªǮǐǺǶǷǬǹǰǽDZǼǬdzǼǬǭǺǾǬǹǹȇǵǐDZǹǾǺǹǺǸǖǺǼǶDZǼǺǸ ǘǬǼȄǬǷǷǺǸ ǛǼǺǽǾǼǬǹǽǾǮDZǹǹǬȋ ǻǬǿǾǴǹǬ ǺǭǮǴǮǬȋ ǻDZȄDZȁǺǰǹȇǵ ǻDZǼDZȁǺǰ ǽǺdzǰǬDZǾ ǻǼǴǮǷDZǶǬǾDZǷȈǹǿȊ ©ǿǻǬǶǺǮǶǿª ǶǺǾǺǼǬȋ Ƕ ǾǺǸǿ DzDZ ǮǻDZȃǬǾǷȋȊȅDZǽǮDZǾǴǾǽȋǹǺȃȈȊ ǠǺǾǺKWWSLDPZD\ZHQZRUGSUHVVFRP

38


=-,1e+2.287869ý7$_)520$',))(5(173$572)7+(:25/'_DŽƶƺLJNJƹDžǃǁDžDŽǍƻLjƸƻljƶ

1HMUR]ViKOHMätEXGRYRX$XVWUiOLHMHNRPSOH[NDQFHOiŐVNëFKEXGRYEDQ N\$1=NWHUëY\URVWOY0HOERXUQHYURFH%XGRYDPiP SRGODKRYp SORFK\ V NDQFHOiŐHPL =HMPpQD NYŢOL HNRORJLFNëP RSDWŐH QtPGtN\NWHUëPEXGRYDXäHWŐtDæHQHUJLtSRWŐHEQëFKSURMHMtSUR YR]]tVNDODWDWRVWDYEDQĚNROLNRFHQĚQt )RWR:LNLSHGLDRUJZZZFRQWUDFWÀUHFRPDX

7KHODUJHVW$XVWUDOLDQEXLOGLQJLVDFRPSOH[RIRIÀFHSUHPLVHVRIWKH $1=EDQNZKLFKDURVHLQ0HOERXUQHLQ7KHEXLOGLQJSURYLGHV PRIÁRRUDUHDIRURIÀFHV7KHFRPSOH[KDVZRQVHYHUDODZDUGV HVSHFLDOO\IRUHFRORJLFDOSURYLVLRQVRZLQJWRWKHIDFWWKDWWKHEXLOGLQJ VDYHVXSWRRIWKHHQHUJ\QHFHVVDU\IRULWVRSHUDWLRQ 3KRWR:LNLSHGLDRUJZZZFRQWUDFWÀUHFRPDX

ǝǬǸǺDZ ǶǼǿǻǹǺDZ dzǰǬǹǴDZ Ǯ njǮǽǾǼǬǷǴǴ  ǶǺǸǻǷDZǶǽ ǺȀǴǽǹȇȁ dzǰǬǹǴǵ ǭǬǹǶǬ$1=ǶǺǾǺǼȇǵǮȇǼǺǽǮǘDZǷȈǭǿǼǹDZǮǯǺǰǿǎdzǰǬǹǴǴ ǶǮǬǰǼǬǾǹȇȁǸDZǾǼǺǮǻǷǺȅǬǰǴǰǷȋǺȀǴǽǺǮǎǺǸǹǺǯǺǸǭǷǬǯǺǰǬǼȋ ȉǶǺǷǺǯǴȃDZǽǶǴǸ ǸDZǼǬǸ ǺǭDZǽǻDZȃǴǮǬȊȅǴǸ ǾǺ ȃǾǺ dzǰǬǹǴDZ ǸǺDzDZǾ ǽǺȁǼǬǹȋǾȈ ǰǺ  ȉǹDZǼǯǴǴ ǹDZǺǭȁǺǰǴǸǺǵ ǰǷȋ DZǯǺ ȉǶǽǻǷǿǬǾǬȂǴǴ ǶǺǸǻǷDZǶǽǻǺǷǿȃǴǷǹDZǽǶǺǷȈǶǺǹǬǯǼǬǰ ǠǺǾǺ:LNLSHGLDRUJZZZFRQWUDFWÀUHFRPDX

40


/1,'/ยฉ5618<#รฉ17<'0ยฅ/$#47

10<#.+6ยน58รท6.'/,'0241/รท

/ 1 * 7 6 0 ยฅ $ # 5 ; - 6 ' 4 ยฅ  / รท & 1 5 6# 0 1 7

, ' & + 0 ยน  $ # 4  0 #  5 8 รท 6 รท   - & '  / # , ยฉ * ' & 8ย $ 0 ยฅ  2 1 . j 6ย ฤฎ '

0 ' , , ' & 0 1 & 7 j j ยฉ  < 2 ล‚ 5 1 $   , # -  5 ' 6# /  & 1 5 6#6

6 # & ;  - 1 0 รฉ ยฉ  #  < # รฉ ยฉ 0 ย  / ล‚ ,  & ' 0

8;681ฤฎ6'5+58ล‚,8.#560ยฉ<#-17ฤฎ'0ยน,#<<18ยน-.7$2QOลƒzGXยฝO UVร‰OVGNGXK\G$GQ8KUKQPMVGTยฝLGMOยฝPร‰UGCFQMQPEGKURCNEQXQW QDTC\QXMQW0GEJVGUGWPร…UV\XWMGOMVGTร™FQMยฝzGDร™VVCMJNWDQMร™zGXยฝURQJNVร‰ 7zร‰XGLVGUKJQMFGMQNKXEJEGVGCUXQLKFWwKXG\OรธVGPCOร‰UVCRQMVGTร™EJVQWzร‰ 2ฤฏKLรฌVGFQPCwGJQQDEJQFWQDLGXKVLCM

Bang & Olufsen, Jรกchymova 4, Praha 1, telefon 224 811 234 www.kd-elektronika.cz


1iSDGLWŢGHVLJQ]iŒLYpEDUY\DYWLSQiP\ŖOHQND²WRYŖHVHVNUŢYiYRULJLQiOQtFKGRSOŋFtFKNWHUpYiP]SŒtMHPQtNDŦGŢGHQ ,PDJLQDWLYHGHVLJQEOD]LQJFRORXUVDQGZLWW\LGHDV²DOOWKHVHDUHFRQFHDOHGLQWKHRULJLQDODFFHVVRULHVWKDWPDNHHYHU\GD\SOHDVXUDEOH ƿDZǶǨǴǨǵDZǿǭǧǬǫǣǭDZȃǴǮǬǨǺǥǨǶǣǬǫǣǤǣǥDZǿǨǬǧǨǬȁǶDzǥǵǨǵǮǴǿǥǣǨǶǵȃǥDzǴǬǦǬDZǣǯȀDZǿǹǣǮǵǨǵǵǷǣǴǣǹǮDzǶDzǴǿǨǵǧǨǯǣȂǶdzǴǬȃǶDZǿǰǮǣǪǧǿǭǧǨDZȀ

3UĤKOHGQiQiGRENDQDPêGOR VPêGORYêPLEXEOLQNDPL PRGHO%XEEOHV FP[FP[FPSODVW 27272 &HQDQDY\åiGiQt www.ototodesign.com

playful .DQFHOiĜVNpVSRQN\YHWYDUXVDUGLQHN YNUDELþFHÄQDVDUGLQN\³ PRGHO6DUGLQHV 2EVDKXMHNDQFHOiĜVNêFKVSRQHN 27272 &HQDQDY\åiGiQt

%LUG&DIp 0RGHUQtNUPtWNRSURSWiN\VHVQtPDWHOQêP NU\WHPSURMHGQRGXFKpGRSOĖRYiQt [[FPSODVWVNOR 80%5$ &HQDNþ www.homein.cz

@AV¥GK

www.ototodesign.com

%DUHYQêPHWUYHWYDUXãQHND

PRGHO,QFK6QDLOV 2EVDKXMHPČUQRXMHGQRWNXMDNFHQWLPHWUĤWDNLSDOFĤ FP[FP[FP[FP 27272 &HQDQDY\åiGiQt www.ototodesign.com

.HUDPLFNpVWRMDQ\SURYiãMtGHOQtVWĤO PRGHO7DEOH5LQJV ,GHiOQtVWRMDQ\SURYDMtþNDWiFN\SRGKUQFHKUQtþN\ GUåiN\QDXEURXVN\þtQVNpKĤON\ 6HWNHUDPLFNêFKVWRMDQĤ FP[FP[FPNHUDPLND 27272 &HQDQDY\åiGiQt www.ototodesign.com

42


%DUHYQp]iWN\QDYtQR PRGHO%RWWOH6FUHZV 6DG\SRNXVHFK FP[FP[FPVLOLNRQ 27272 &HQDFFDNþ www.ototodesign.com

.RYRYiVSLUiORYLWiPtVDQDRYRFHPRGHO3RLQJ FP[FP[PNRY 27272 &HQDFFDNþ www.ototodesign.com

ýDMRYpVtWNRYHWYDUXSRQRUN\PRGHO7HD6XE FP[FP[FPVLOLNRQEDUYDåOXWi 27272 &HQDFFDNþ www.ototodesign.com

6DGDSĜtERUĤPDVDOiWPRGHO-XPSLQ¶-DFNV -HGLQHþQêGRSOQČNSURYiãMtGHOQtVWĤO FP[FP[FPSODVW 27272 &HQDQDY\åiGiQt www.ototodesign.com

$NYiULXP)LVKKRWHO 1HWUDGLþQtVNOHQČQpDNYiULXP VSODVWRYêPYQČMãtPREDOHPEtOpEDUY\ DNYiULDO]HVWRKRYDWDY\WYRĜLWHIHNWE\WX [[FPEtOpSODVWVNOR 80%5$ &HQDNþ www.maxidesign.cz

43


Nejlepší nemovitosti Best Properties 

3URGHM6DOHVǷȘȖȌȈȎȈ



3URQiMP\5HQWDOVǨȘȍȕȌȈ



$SDUWPiQ\Y3UD]H 3UDJXH$SDUWPHQWVǨȗȈȘȚȈȔȍȕȚȣȊǷȘȈȋȍ 



.RPHUþQtQHPRYLWRVWL &RPPHUFLDO3URSHUWLHVDzȖȔȔȍȘȟȍșȒȈȧȕȍȌȊȐȎȐȔȖșȚȤ



$GUHViĜ'LUHFWRU\ȒȈȚȈȓȖȋ


0$;,0$5($/,7< :DVKLQJWRQRYD  0X]HXP  3UDKD

3UDKD6WDUp0čVWR9.RONRYQč ([NOX]LYQtQDEtGNDYëMLPHÿQpKRE\WXQDQHMSUHVWLæQĚMätPPtVWĚY 3UD]HMHYUFKROQëPGtOHPHYURSVNpDUFKLWHNWXU\SURRVREQRVWLVY\ VRNëPLQiURN\QDNXOWXUXE\GOHQt3URVWRURYĚYHONRU\ViUH]LGHQFH VUR]ORKRXPVLWXRYDQiYVHFHVQtPURKRYpPGRPĚVYëKOH GHPQDQiPĚVWtY]QLNOpPVRXEĚKHPXOLF9.RONRYQĚD9Ě]HŁVNp Y\QLNiPLPRŐiGQĚVYĚWOëPDSURVOXQĚQëPLQWHULpUHP)DVFLQXMtFt DWPRVIpUDDH[NOX]LYLWDPtVWD NOLGPDOHEQRVWNRQWDNWVNOHQRW\ SUDæVNpSDPiWNRYpUH]HUYDFH SŐtPRLQVSLUXMtNY\WYRŐHQtNXOWLYRYD QpKRUHSUH]HQWDWLYQtKRE\GOHQt-VRX]GH]DFKRYDOiSŢYRGQtäWX NRYiYë]GREDVHFHVQtVNHOQtYëSOQĚNRYiQtDGDOätVW\ORYpSUYN\ 9ëWDK%\WVHQDFKi]tYHQDG]HPQtPSRGODæt'LVSR]LFHMH VHNRXSHOQDPL[:&äDWQRXDFHQWUiOQtKDORXNWHUiÿOHQtE\W QDVSROHÿHQVNRXDLQWLPQt]yQX9REëYDFtPSRNRML P MHDUNëŐ VMHGLQHÿQëPYëKOHGHPPRæQRVWLQVWDODFHNUEX

3UDJXH²2OG7RZQ9.RONRYQč ([FOXVLYH RIIHU RI H[FHSWLRQDO ÁDW LQ WKH PRVW SUHVWLJLRXV ORFDWLRQ LQ 3UDJXH7KLVLVDPDVWHUSLHFHRI(XURSHDQDUFKLWHFWXUHLQWHQGHGIRU WKRVH SHUVRQV ZLWK KLJK GHPDQGV IRU WKHLU OLIHVW\OH 7KH JHQHURXVO\ VSDFLRXVUHVLGHQFHZLWKDQDUHDRIPñLVORFDWHGLQWKH$UW1RX YHDXFRUQHUKRXVHRYHUORRNLQJWKHVTXDUHIRUPHGE\9.RONRYQĚDQG 9Ě]HŁVNi6WUHHWV$KLJKOLJKWLVWKHH[WUHPHO\EULJKWDQGVXQQ\LQWHULRU 7KHIDVFLQDWLQJDQGH[FOXVLYHDWPRVSKHUHRIWKHDUHD TXLHWSLFWXUHV TXHFRQWDFWZLWKWKHMHZHOVRI3UDJXH·VSUHVHUYHGKLVWRULFDOFHQWUH LV DGHÀQLWHLQVSLUDWLRQIRUWKHFUHDWLRQRIFXOWLYDWHGWUDGLWLRQDOKRXVLQJ )HDWXUHVDUHZHOOSUHVHUYHGRULJLQDOVWXFFRGHFRUDWLRQ$UW1RXYHDX JODVVSDQHOVÀWWLQJVDQGRWKHUVW\OLVKHOHPHQWV/LIW7KHDSDUWPHQWLV ORFDWHGRQWKHQGÁRRU7KHOD\RXWLVZLWKEDWKURRPVWRLOHWV GUHVVLQJURRPDQGFHQWUDOKDOOZKLFKGLYLGHVWKHÁDWLQWRVRFLDODQG LQWLPDWH ]RQHV ,Q WKH OLYLQJ URRP  Pñ  WKHUH LV DQ DOFRYH ZLWK D XQLTXHYLVWD7KHUHLVWKHRSWLRQRIDÀUHSODFHLQVWDOODWLRQ

&HQD3ULFH&=. , Q J  , Y H W D 6 P H W D Q R Y i  U H D O L W Q t P D N O p Ő  7 H O                       (  P D L O  L  V P H W D Q R Y D # P D [ L P D  F ] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

47


/X[XVQtYLOD7XFKRPčĝLFH/X[XU\9LOODLQ7XFKRPčĝLFHɋɩɬɥɩɳɨɛɺɝɣɦɦɛɝɍɮɰɩɧɠɫɡɣɱɛɰ 0RGHUQtYLOD]URNXOHætQDSŐHNUDVQpPSR]HPNXXOHVDRUR]OR]HP8æLWQiSORFKDGRPXPJDUiæHSURDXWDVPRæQRVWtSDUNRYDQtQDGYRŐH FFDGDOätFK²DXW]ÿHKRæSRVN\WXMHNU\WpVWiQLSURYR]\9LODMHQDGVWDQGDUGQtVSRXæLWtPSRX]HNYDOLWQtFKPDWHULiOŢDQDEt]tURGLQQpE\GOHQtY\MtPHÿQpNYDOLW\D GHVLJQX3OQĚDXWRPDWLFNpVWDKRYiQtPDUNë]]iYĚVŢ]iFORQHOHNWURQLFNiYUDWDDSURVNOHQëYëWDK]DUXÿXMtSRKRGOQpIXQJRYiQtGRPX&HORVNOHQĚQpVFKRGLäWĚPXSDN GRGiYiQDY\MtPHÿQRVWLDOX[XVX9SŐt]HPtGRPXMHSURSRMHQëREëYDFtSURVWRUVNXFK\QtMtGHOQRXSUDFRYQRXDKDOD&HOëSURVWRUO]HUR]GĚOLWSURVNOHQRXVWĚQRX9SDWŐH MVRXSDNORæQLFHVNRXSHOQDPLDäDWQDPL9GRPĚQDOH]QHWHYODVWQtE\WSURVOXæHEQRXYSŐt]HPtSDNWHFKQLFNRXPtVWQRVWVDXQXZKLUOSRRODM1DSR]HPNXMHYODVWQt VWXGQD]DEH]SHÿRYDFtV\VWHPVRODUQtSDQHO\WHSHOQpYUW\DGDOätYODVWQt]GURMHSRWŐHEQpSURFKRGGRPX 0RGHUQYLOODEXLOWLQRQDEHDXWLIXOPSORWE\DIRUHVW7KHXVHDEOHDUHDRIWKHKRXVHLVPJDUDJHVIRUFDUVSOXVDQRWKHUFDUVFDQSDUNLQWKH FRXUW\DUGLQFOXGLQJURRIHGVSDFHV7KHYLOODLVDERYHWKHVWDQGDUGXVHVTXDOLW\PDWHULDOVRQO\DQGRIIHUVIDPLO\OLYLQJRIH[FHSWLRQDOTXDOLW\DQGGHVLJQ)XOO\DXWRPD WHGORZHULQJRIPDUTXHHVGUDSHVDQGFXUWDLQVHOHFWURQLFJDWHDQGJOD]HGHOHYDWRUIRUFRPIRUWDEOHIXQFWLRQLQJRIWKHKRXVH$OOJODVVVWDLUFDVHIRUDQDGGHGVHQVHRI H[FHSWLRQDOLW\DQGOX[XU\7KHJURXQGÁRRUFRQWDLQVDQLQWHUFRQQHFWHGOLYLQJDUHDZLWKDNLWFKHQGLQLQJURRPDQGVWXG\DQGDKDOOZD\7KHDUHDFDQEHGLYLGHGZLWKD JODVVZDOO7KHXSSHUÁRRUFRQWDLQVEHGURRPVZLWKEDWKURRPVDQGGUHVVLQJURRPV7KHUHLVDVHSDUDWHÁDWIRUWKHPDLGWKHJURXQGÁRRUKDVDXWLOLW\URRPVDXQD ZKLUOSRROHWF7KHSORWKDVLWVRZQZDWHUZHOOVHFXULW\V\VWHPVRODUSDQHOVWKHUPDOERUHVDQGRWKHURZQVRXUFHVUHTXLUHGIRUWKHKRXVHWRRSHUDWH

ǝǺǮǼDZǸDZǹǹǬȋ ǮǴǷǷǬ   ǯǺǰǬ ǹǬȁǺǰǴǾǽȋ ǹǬ ǻǼDZǶǼǬǽǹǺǸ ǿȃǬǽǾǶDZ ǿ ǷDZǽǬ ǽ ǻǷǺȅǬǰȈȊ  Ǹ ǛǺǷDZdzǹǬȋ ǻǷǺȅǬǰȈ ǰǺǸǬ  Ǹ ǯǬǼǬDz ǹǬ  ǸǬȄǴǹȇ ǮǺdzǸǺDzǹǺǽǾȈ ǻǬǼǶǺǮǶǴ ǮǺ ǰǮǺǼDZ DZȅDZ  ǬǮǾǺǸǺǭǴǷDZǵ Ǵdz ǹǴȁ  ǹǬ ǶǼȇǾǺǵ ǻǬǼǶǺǮǶDZ ǎǴǷǷǬ ǴǸDZDZǾ ǮȇǽǺǶǴǵ ǽǾǬǹǰǬǼǾ Ǯ ǽǾǼǺǴǾDZǷȈǽǾǮDZ ǭȇǷǴ ǴǽǻǺǷȈdzǺǮǬǹȇ ǾǺǷȈǶǺ ǮȇǽǺǶǺǶǬȃDZǽǾǮDZǹǹȇDZ ǸǬǾDZǼǴǬǷȇ ȉǾǺ ǮȇǽǺǶǺǶǷǬǽǽǹǺDZ DzǴǷȈDZ ǰǷȋ ǽDZǸȈǴ ǴǽǶǷȊȃǴǾDZǷȈǹǺǯǺ ǶǬȃDZǽǾǮǬ Ǵ ǰǴdzǬǵǹǬ ǛǺǷǹǺǽǾȈȊ ǬǮǾǺǸǬǾǴȃDZǽǶǺDZ ǿǻǼǬǮǷDZǹǴDZ ǸǬǼǶǴdzǬǸǴ ǯǬǼǰǴǹǬǸǴ ȄǾǺǼǬǸǴ ȉǷDZǶǾǼǺǹǹȇDZ ǮǺǼǺǾǬ Ǵ ǽǾDZǶǷȋǹǹȇǵ ǷǴȀǾ ǺǭDZǽǻDZȃǴǮǬDZǾ ǷDZǯǶǿȊ ȉǶǽǻǷǿǬǾǬȂǴȊ ǰǺǸǬ ǝǾDZǶǷȋǹǹǬȋ ǷDZǽǾǹǴȂǬ  ǾǺǷȈǶǺ ǰǺǭǬǮǷȋDZǾ ǮǴǷǷDZǴǽǶǷȊȃǴǾDZǷȈǹǺǽǾǴǴǬǾǸǺǽȀDZǼȇǼǺǽǶǺȄǴǙǬǻDZǼǮǺǸȉǾǬDzDZǹǬȁǺǰǴǾǽȋǯǺǽǾǴǹǬȋǽǶǿȁǹDZǵǴǽǾǺǷǺǮǺǵǶǬǭǴǹDZǾǴdzǬǷǎǽDZǻǼǺǽǾǼǬǹǽǾǮǺǸǺDzDZǾǭȇǾȈǼǬdzǰDZǷDZǹǺ ǽǾDZǶǷȋǹǹǺǵǽǾDZǹǺǵǙǬǮDZǼȁǹDZǸȉǾǬDzDZǼǬǽǻǺǷǺDzDZǹȇǽǻǬǷȈǹǴǽǮǬǹǹȇǸǴǶǺǸǹǬǾǬǸǴǴǯǬǼǰDZǼǺǭǬǸǴǎǰǺǸDZDZǽǾȈǺǾǰDZǷȈǹǬȋǶǮǬǼǾǴǼǬǰǷȋǻǼǴǽǷǿǯǴǹǬǹǴDzǹDZǸ ȉǾǬDzDZǾDZȁǹǴȃDZǽǶǬȋǶǺǸǹǬǾǬǽǬǿǹǬǰDzǬǶǿdzǴǴǾǰǙǬǿȃǬǽǾǶDZǽǺǭǽǾǮDZǹǹȇǵǶǺǷǺǰDZȂǽǴǽǾDZǸǬǭDZdzǺǻǬǽǹǺǽǾǴǽǺǷǹDZȃǹȇDZǭǬǾǬǼDZǴǾDZǻǷǺǮȇDZǽǶǮǬDzǴǹȇǴǰǼǿǯǴDZ ǽǺǭǽǾǮDZǹǹȇDZǼDZǽǿǼǽȇǹDZǺǭȁǺǰǴǸȇDZǰǷȋȉǶǽǻǷǿǬǾǬȂǴǴǰǺǸǬ

&HQD3ULFH&=. 0JU,YD6HLIHUWRYi3ODWQpĝVNi3UDKDWHOHPDLOLQIR#VHLIHUWUHDOF]ZZZVHLIHUWUHDOF] 48

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


9ëMLPHÿQëE\WP3UDKD([FHSWLRQDOPDSDUWPHQW3UDJXHɃɬɥɦɹɲɣɭɠɦɷɨɛɺɥɝɛɫɭɣɫɛɧɊɫɛɞɛ %\WVWHUDVRXPD~æDVQëPYëKOHGHPQDFHORX3UDKXYÿHWQĚ1DURGQtKRPX]HD3UDæVNpKRKUDGXD3HWŐtQX%\WMHVLWXRYiQYSDWŐHGRPXVYëWDKHPDMHKRUR]ORKD ÿLQtP'LVSR]LFHE\WXKDODNXFK\ŁMtGHOQDREëYDFtSRNRMSDUQtOi]HŁSUDFRYQD[ORæQLFH[NRXSHOQDÿOHQLWiWHUDVDRKURPQëVNODGRYDFtSURVWRU]DNXFK\Ł VNRXOLQNRXYHVWDYĚQpVNŐtQĚäDWQD7HQWRE\WSDWŐtPH]L723QHPRYLWRVWLSUiYĚGtN\DUFKLWHNWRQLFN\ŐHäHQpPXSURVWRUXVHVP\VOHPSURGHWDLO9HäNHUpVSRWŐHELÿHMVRX ]QDÿN\0LHOHYëVXYQiQHUH]GLJHVWRŐ[OHGQLFHVPUD]iNHP[YLQRWpNDNiYRYDUSDUQtWURXEDSHÿLFtWURXEDPLNURYOQQiWURXEDVNORNHUDPLFNiGHVNDYHVWDYĚQi JULORYDFtSORFKDQDKŐtYDÿ9E\WĚE\O\SRXæLW\XäOHFKWLOpPDWHULiO\MDNëPLMVRXQHUH]RFHOPDVLYQtGŐHYLQ\NDPHQQiSUDFRYQtGHVNDDM%\WGtN\VYpSROR]HYFHQWUX3UDK\ D]iURYHŁDEVROXWQtPXNOLGXVSOŁXMHSRWŐHE\QiURÿQëFKNOLHQWŢ $SDUWPHQWZLWKDPWHUUDFHDQGZRQGHUIXOYLHZVRIDOORI3UDJXHLQFOXGLQJWKH1DWLRQDO0XVHXP3UDJXH&DVWOHDQG3HWŐLQ7KHDSDUWPHQWLVRQWKHWKÁRRURID EXLOGLQJZLWKDQHOHYDWRUDQGLVPODUJH7KHOD\RXWKDOOZD\NLWFKHQGLQLQJURRPOLYLQJURRPVWHDPEDWKVWXG\EHGURRPVEDWKURRPVVWUXFWXUHGWHUUDFH KXJHVWRUDJHDUHDEHKLQGWKHNLWFKHQXQLWEXLOWLQZDUGUREHVGUHVVLQJURRP7KHDSDUWPHQWUDQNVDPRQJ723UHDOHVWDWHGXHWRLWVDUFKLWHFWXUDOO\WUHDWHGLQWHULRUZLWK DVHQVHRIGHWDLO$OOWKHDSSOLDQFHVDUH0LHOHWKHVOLGLQJVWDLQOHVVVWHHOKRRGIULGJHVZLWKIUHH]HUVZLQHEDUVFRIIHHPDFKLQHVWHDPRYHQEDNLQJRYHQPLFURZDYH RYHQJODVVFHUDPLFSODWHEXLOWLQJULOOHSODWHKHDWHU7KHDSDUWPHQWLVIXUQLVKHGZLWKKLJKJUDGHPDWHULDOVVXFKDVVWDLQOHVVVWHHOPDVVLYHZRRGVVWRQHZRUNWRSHWF 7KDQNVWRLWVORFDWLRQLQFHQWUDO3UDJXHWKDWLVDEVROXWHO\TXLHWWKHDSDUWPHQWPHHWVWKHQHHGVRIGHPDQGLQJFOLHQWV7KHSORWKDVLWVRZQZDWHUZHOOVHFXULW\V\VWHP VRODUSDQHOVWKHUPDOERUHVDQGRWKHURZQVRXUFHVUHTXLUHGIRUWKHKRXVHWRRSHUDWH ǖǮǬǼǾǴǼǬǸǽǾDZǼǼǬǽǺǵǴǻǼDZǶǼǬǽǹȇǸǮǴǰǺǸǹǬǛǼǬǯǿǮǾǺǸȃǴǽǷDZǹǬǙǬȂǴǺǹǬǷȈǹȇǵǸǿdzDZǵǛǼǬDzǽǶǴǵǏǼǬǰǴǛDZǾǼDzǴǹǖǮǬǼǾǴǼǬǼǬǽǻǺǷǺDzDZǹǬǹǬǸȉǾǬDzDZ ǰǺǸǬǽǷǴȀǾǺǸǴǻǷǺȅǬǰȈȊǸǛǷǬǹǴǼǺǮǶǬǶǮǬǼǾǴǼȇȁǺǷǷǶǿȁǹȋǽǾǺǷǺǮǬȋǯǺǽǾǴǹǬȋǻǬǼǹǬȋǼǬǭǺȃǴǵǶǬǭǴǹDZǾǽǻǬǷȈǹǴǮǬǹǹȇDZǶǺǸǹǬǾȇǼDZǷȈDZȀǹǬȋ ǾDZǼǼǬǽǬ ǭǺǷȈȄǴDZ ǽǶǷǬǰǽǶǴDZ ǻǺǸDZȅDZǹǴȋ dzǬ ǷǴǹǴDZǵ ǶǿȁǹǴ ȄǶǬȀȇǶǿǻDZ ǯǬǼǰDZǼǺǭǹǬȋ ǩǾǬ ǶǮǬǼǾǴǼǬ ȋǮǷȋDZǾǽȋ ǺǰǹǴǸ Ǵdz ǷǿȃȄǴȁ ǻǼDZǰǷǺDzDZǹǴǵ ǹDZǰǮǴDzǴǸǺǽǾǴ ǭǷǬǯǺǰǬǼȋǹDZǺǭȇȃǬǵǹǺǾǺǹǶǺǸǿǬǼȁǴǾDZǶǾǿǼǹǺǸǿǼDZȄDZǹǴȊǻǼǺǽǾǼǬǹǽǾǮǬǎǽDZǺǭǺǼǿǰǺǮǬǹǴDZǸǬǼǶǴ0LHOHǮȇǰǮǴDzǹǬȋǶǿȁǺǹǹǬȋǮȇǾȋDzǶǬǴdzǹDZǼDzǬǮDZȊȅDZǵǽǾǬǷǴ ȁǺǷǺǰǴǷȈǹǴǶǬǽǸǺǼǺdzǴǷȈǹǴǶǺǸǮǴǹǺǾDZǶǴǶǺȀDZǮǬǼǶǬǻǬǼǺǮǬȋǻDZȃȈǰǿȁǺǮǶǬǸǴǶǼǺǮǺǷǹǺǮǬȋǻDZȃȈǮǬǼǺȃǹǬȋǻǬǹDZǷȈǽǾDZǶǷǺǶDZǼǬǸǴǶǬǮǽǾǼǺDZǹǹȇǵǯǼǴǷȈ ǻǺǰǺǯǼDZǮǬǾDZǷȈǎǴǹǾDZǼȈDZǼDZǴǽǻǺǷȈdzǺǮǬǹȇǭǷǬǯǺǼǺǰǹȇDZǸǬǾDZǼǴǬǷȇǾǬǶǴDZǶǬǶǹDZǼDzǬǮDZȊȅǬȋǽǾǬǷȈǾǮDZǼǰǺDZǰDZǼDZǮǺǶǬǸDZǹǹȇǵǼǬǭǺȃǴǵǽǾǺǷǴǰǼǿǯǴDZǍǷǬǯǺǰǬǼȋ ǽǮǺDZǸǿǼǬǽǻǺǷǺDzDZǹǴȊǮȂDZǹǾǼDZǯǺǼǺǰǬǴǮǾǺDzDZǮǼDZǸȋǬǭǽǺǷȊǾǹǺDZǽǻǺǶǺǵǽǾǮǴȊǼǬǵǺǹǬǶǮǬǼǾǴǼǬǺǾǮDZȃǬDZǾǻǺǾǼDZǭǹǺǽǾȋǸǽǬǸȇȁǮdzȇǽǶǬǾDZǷȈǹȇȁǶǷǴDZǹǾǺǮ

&HQD3ULFH&=. 0JU,YD6HLIHUWRYi3ODWQpĝVNi3UDKDWHOHPDLOLQIR#VHLIHUWUHDOF]ZZZVHLIHUWUHDOF] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

49


3TAVBAÒZAHJENAÒÒÒ

50

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


BYTY NA PRODEJ SOUKROMÁ ZAHRADA | PODZEMNÍ PARKING | SKLEPY "YTOVČÒ DĊMÒ 6Ò -EZIHOĉ–Ò JEÒ VÒ KAÞD”MÒ DETAILUÒ PEāLIVăÒ PROMYÛLENČÒPROJEKTÒMODERN–HOÒBYDLEN–Ò$–KYÒSV”ÒµLOZOµIÒ KLIENTĊMÒNAB–DNEÒZAÒSTEJNOUÒCENUÒMNOHEMÒV–CEÒNEÞÒJEÒ OBVYKL”ÒUÒVăTÛINYÒEXISTUJ–C–CHÒSROVNATELNČCHÒPROJEKTĊ

 ++ÒODÒÒÒÒ+ā  ++ÒODÒÒÒÒ+ā  ++ÒODÒÒÒÒ+ā  ++ÒODÒÒÒÒ+ā #ENYÒJSOUÒVāETNăÒ$0(

7 7 76 -%: ) ( / 2 )  # : 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

51


    



352'(-/X[XVQt]DMtPDYĹDUFKLWHNWRQLFN\DGHVLJQRYĹŒHŖHQiUH]LGHQFH0QLFKRYLFH3UDKDYŢFKRG 6$/(/X[XULRXVLQWHUHVWLQJDQGDUFKLWHFWXUDOO\GHVLJQHGUHVLGHQFHLQ0QLFKRYLFH3UDJXH(DVW džLJDžƺƶƽƶLJDzǵǮDzǼDZDzǭǬǬDZǶǨǴǨǵDZDzǭǵǶDzǻǮǬǫǴǨDZǬȃǣǴǹǬǶǨǮǶǷǴǿǬǧǬǫǣǭDZǣǴǨǫǬǧǨDZǺǬǬǃDZǬǹDzǥǬǺǨdžǴǣǦǣǥDzǵǶDzǮ

Cena / Price: 31.000.000 Kč /X[XVQtUH]LGHQFHDWULXPMtGHOQD[NRXSHOQDVWRDOHWRX[:&[äDWQDNUE]LPQt]DKUDGDDSRVLORYQDVDXQDZKLUSRRO[EDONRQWHUDVDOHWQtNXFK\ŁYHQNRYQt ED]pQP GpOND VEURX]GDOLäWĚPVSUFKRXEH]~GUæERYi]DKUDGDVHVDPR]DYODæRYDFtPV\VWpPHPSDUNVRVYĚWOHQtPGĚWVNëPKŐLäWĚP[JUHHQJDUiæSURDXWVDPR VWDWQiYGRPĚVNOHS PtVWQRVWL 3R]HPHNPXæLWQiSORFKDFFDP$WUDNWLYQtY\KOHGiYDQiORNDOLWDPDOHEQiSŐtURGDYEOt]NRVWLOHVŢYRNROtSRX]H]iVWDYED URGLQQëFKGRPŢDYLOY\QLNDMtFtGRSUDYQtGRVWXSQRVWtGRPHWURSROH9]GiOHQRVW]FHQWUD3UDK\NP /X[XU\UHVLGHQFHDWULXPGLQLQJURRP[EDWKURRPVZLWK:&V[VHSDUDWH:&V[GUHVVLQJURRPVKHDUWKZLQWHUJDUGHQDQGJ\PVDXQDZKLUOSRRO[EDOFRQLHV WHUUDFHVXPPHUNLWFKHQPORQJRXWGRRUVZLPPLQJSRROZLWKSDGGOLQJSRROVKRZHUPDLQWHQDQFHIUHHJDUGHQZLWKDXWRPDWLFLUULJDWLRQV\VWHPLOOXPLQDWHGSDUNFKLOGUHQ·V SOD\JURXQG[ODZQVFDUJDUDJHVHSDUDWHJDUDJHLQWKHEXLOGLQJURRPHGFHOODUPñSORWXWLOLW\DUHDRIDSSUR[Pñ$WWUDFWLYHVRXJKWDIWHUORFDOLW\ZLWK SLFWXUHVTXHODQGVFDSHQHDUIRUHVWV2QO\IDPLO\KRXVHVDQGYLOODVLQWKHYLFLQLW\([FHOOHQWWUDQVSRUWDFFHVVLELOLW\WRPHWURSROLVNPIURPWKHFHQWUHRI3UDJXH ǜǺǽǶǺȄǹǬȋ ǼDZdzǴǰDZǹȂǴȋ   ǬǾǼǴǿǸ ǽǾǺǷǺǮǬȋ  ǮǬǹǹȇDZ ǶǺǸǹǬǾȇ ǽ ǾǿǬǷDZǾǺǸ  ǾǿǬǷDZǾǬ  ǯǬǼǰDZǼǺǭǬ ǶǬǸǴǹ dzǴǸǹǴǵ ǽǬǰ Ǵ ǾǼDZǹǬDzDZǼǹȇǵ dzǬǷ ǽǬǿǹǬ ǰDzǬǶǿdzǴ  ǭǬǷǶǺǹǬǾDZǼǼǬǽǬǷDZǾǹȋȋǶǿȁǹȋǺǾǶǼȇǾȇǵǭǬǽǽDZǵǹ ǰǷǴǹǬǸ ǽǰDZǾǽǶǴǸ©ǷȋǯǿȄǬǾǹǴǶǺǸªǰǿȄDZǸǽǬǰǹDZǾǼDZǭǿȊȅǴǵǺǭǽǷǿDzǴǮǬǹǴȋǽǽǴǽǾDZǸǺǵǽǬǸǺǿǮǷǬDzǹDZǹǴȋ ǻǬǼǶǽǺǽǮDZȅDZǹǴDZǸǰDZǾǽǶǺǵǻǷǺȅǬǰǶǺǵdzDZǷDZǹȇȁǯǬdzǺǹǬǯǬǼǬDzǹǬǸǬȄǴǹǺǾǰDZǷȈǹȇǵǮǰǺǸDZǻǺǰǮǬǷ ǶǺǸǹǬǾȇ ǟȃǬǽǾǺǶǸDzǴǷǬȋǻǷǺȅǬǰȈǸ ǛǼǴǮǷDZǶǬǾDZǷȈǹǺDZ Ǵ ǻǺǷȈdzǿȊȅDZDZǽȋ ǻǺǻǿǷȋǼǹǺǽǾȈȊ ǸDZǽǾǺ DzǴǮǺǻǴǽǹǬȋ ǻǼǴǼǺǰǬ ǼȋǰǺǸ ǾǺǷȈǶǺ dzǬǽǾǼǺǵǶǬ ǽDZǸDZǵǹȇǸǴ ǰǺǸǬǸǴ Ǵ ǮǴǷǷǬǸǴ ǺǾǷǴȃǹǺDZ ǾǼǬǹǽǻǺǼǾǹǺDZ ǽǺǺǭȅDZǹǴDZǽǯǺǼǺǰǺǸǜǬǽǽǾǺȋǹǴDZǺǾȂDZǹǾǼǬǯǺǼǺǰǬǶǸ

Real Estate & Life, s.r.o. Hybernská 24, 110 00 Praha 1, info@estateandlife.cz tel. + 420 222 125 286, + 420 602 285 064 52

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


352'(-1DGVWDQGDUGQtSURVWRUQŢE\WNN7PVJDUiŦtDVNOHSHP3UDKD0D]DQND 6$/($ERYHVWDQGDUGVSDFLRXVNN7PîÁDWZLWKJDUDJHDQGFHOODU3UDJXH0D]DQND džLJDžƺƶƽƶǮǥǣǴǶǬǴǣǥǿǵDzǮǬǹǵǶǣDZǧǣǴǶDzǥǮǮǶǨǴǴǣǵǣǰǵǦǣǴǣǪDzǰǬdzDzǧǥǣǯDzǰǴǣǭDzDZdžǴǣǦǣǃǣǫǣDZǮǣ

&HQD3ULFHǢDZǹǬ.ÿ 1DGVWDQGDUGQtSURVWRUQëDVOXQQëE\W29NNP VYHONRX]DVWŐHäHQRXWHUDVRXP MHXPtVWĚQGRQSFLKORYpKRGRPX VYëWDKHP VLWXRYDQpKRYSŐtMHPQpDNOLGQpORNDOLWĚY]HOHQLYHÿWYUWL URGLQQëFKGRPNŢD]DKUDG%\WRYëNRPSOH[E\OSRVWDYHQYUÿHVNRNDQDGVNRXÀUPRX9ëERUQiGRSUDYQtGRVWXSQRVW PHWUR&/iGYtFFDPLQYROQRXFKŢ]t YHäNHUiREÿY\EDYHQRVW REFKRG\ NDYiUQ\NLQRVOXæE\YPtVWĚ9EH]SURVWŐHGQtEOt]NRVWLVHQDFKi]täNRONDDäNROD9RNROtMHŐDGDNUiVQëFKPtVWYKRGQëFKNWUiYHQtYROQpKRÿDVX²SDUN\ĎiEOLFNëOHVNRXSDOLäWĚ6WtUND&HOëREMHNWMH SHÿOLYĚVSUDYRYiQDMH]GHKRGLQRYiRVWUDKD%\WMH]DMtPDYĚDUFKLWHNWRQLFN\ŐHäHQVGRVWDWNHP~ORæQpKRSURVWRUX-VRX]GHEH]SHÿQRVWQtGYHŐH(=6GŐHYĚQpSDUNHW\YSRNRMtFK9\EDYHQRQRYRX NXFKOLQNRX6DPRVWDWQpHWiæRYpY\WiSĚQt.E\WXQiOHætJDUiæDVNOHSYSRG]HPtGRPX%\WQDEt]tNYDOLWQtE\GOHQtYKRGQpSURURGLQXVGĚWPL 



7KLVDERYHVWDQGDUGVSDFLRXVDQGVXQQ\SULYDWHO\RZQHGPñÁDWNNZLWKODUJHPñHQFORVHGWHUUDFHRQWKHVWÁRRURIDVWRUH\HGEULFNEXLOGLQJ ZLWKOLIW LVVLWXDWHGLQDSOHDVDQWWUDQTXLO VHWWLQJDPLGVWJUHHQHU\LQDQHLJKERXUKRRGRIIDPLO\KRXVHVDQGJDUGHQV7KLVEORFNRIÁDWVZDVEXLOWE\D&]HFK&DQDGLDQFRPSDQ\LQ([FHOOHQWWUDQVSRUWDFFHVVLELOLW\ DSSUR[PLQXWH ZDONWR0HWUR&/iGYtVWDWLRQ QHDUDOOFLYLFDPHQLWLHV VKRSVFDIpVFLQHPDVHUYLFHV $NLQGHUJDUWHQDQGHOHPHQWDU\VFKRRODUHLQWKHLPPHGLDWHYLFLQLW\7KHUHDUHPDQ\EHDXWLIXOOHLVXUHVSRWV QHDUE\SDUNVĎiEOLFNëKiMRDNIRUHVW6WtUNDVZLPPLQJSRRO7KHZKROHEXLOGLQJLVFDUHIXOO\PDQDJHGDQGWKHUHLVDKRXUVHFXULW\JXDUG7KHDUFKLWHFWXUDOO\LQWHUHVWLQJDSDUWPHQWLVGHVLJQHGZLWK SOHQW\RIVWRUDJHVSDFH6HFXULW\GRRUVLQWUXVLRQGHWHFWLRQZRRGHQÁRRUVLQWKHURRPV(TXLSSHGZLWKDQHZNLWFKHQXQLW,QGHSHQGHQWÁRRUKHDWLQJ7KHÁDWKDVDJDUDJHDQGFHOODUDQGRIIHUVTXDOLW\ KRXVLQJVXLWDEOHIRUDIDPLO\ZLWKFKLOGUHQ ǛǼǺǽǾǺǼǹǬȋǴǽǮDZǾǷǬȋǶǮǬǼǾǴǼǬǽǬǸȇȁǮȇǽǺǶǴȁǽǾǬǹǰǬǼǾǺǮȃǬǽǾǹǬȋǽǺǭǽǾǮDZǹǹǺǽǾȈ 29 ǶǶǸǽǭǺǷȈȄǺǵǶǼȇǾǺǵǾDZǼǼǬǽǺǵǸǹǬȁǺǰǴǾǽȋǹǬȉǾǬDzDZȁȉǾǬDzǹǺǯǺǶǴǼǻǴȃǹǺǯǺǰǺǸǬ ǽ ǷǴȀǾǺǸ ǼǬǽǻǺǷǺDzDZǹǹǺǯǺǮǾǴȁǺǸǸDZǽǾDZdzDZǷDZǹȈǼǬǵǺǹǽDZǸDZǵǹȇȁǶǺǾǾDZǰDzDZǵǴǽǬǰǺǮǒǴǷǺǵǶǺǸǻǷDZǶǽǭȇǷǻǺǽǾǼǺDZǹǮǯǺǰǿȃDZȄǽǶǺǶǬǹǬǰǽǶǺǵȀǴǼǸǺǵǚǾǷǴȃǹǬȋǾǼǬǹǽǻǺǼǾǹǬȋǰǺǽǾǿǻǹǺǽǾȈ ǸDZǾǼǺ&ǽǾǬǹȂǴȋǗǬǰǮǴǻǼǴǸDZǼǹǺǮǸǴǹǿǾǬȁǽǻǺǶǺǵǹǺǵȁǺǰȈǭȇ ȁǺǼǺȄǬȋǴǹȀǼǬǽǾǼǿǶǾǿǼǬ ǸǬǯǬdzǴǹȇǶǬȀDZǶǴǹǺǼǬdzǷǴȃǹȇDZǿǽǷǿǯǴ ǎǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵǭǷǴdzǺǽǾǴǹǬȁǺǰȋǾǽȋȄǶǺǷǬǴ ǰDZǾǽǶǴǵǽǬǰǎǺǶǼDZǽǾǹǺǽǾȋȁǸǹǺǯǺǶǼǬǽǴǮȇȁǸDZǽǾǰǷȋǻǼǺǮDZǰDZǹǴȋǽǮǺǭǺǰǹǺǯǺǮǼDZǸDZǹǴǻǬǼǶǴǐȈȋǭǷǴȂǶǴǵǷDZǽǸDZǽǾǺǰǷȋǶǿǻǬǹǴȋǝǾǴǼǶǬǓǰǬǹǴDZǴǸDZDZǾǽǮǺDZȁǺdzȋǵǽǾǮDZǹǹǺDZǿǻǼǬǮǷDZǹǴDZǴ ǶǼǿǯǷǺǽǿǾǺȃǹǿȊǺȁǼǬǹǿǖǮǬǼǾǴǼǬǮDZǽȈǸǬǴǹǾDZǼDZǽǹǬǮǬǼȁǴǾDZǶǾǿǼǹǺǸǺǾǹǺȄDZǹǴǴǶǼǺǸDZǾǺǯǺǴǸDZDZǾǭǺǷȈȄǺDZǶǺǷǴȃDZǽǾǮǺǸDZǽǾǰǷȋȁǼǬǹDZǹǴȋǮDZȅDZǵdzǬȅǴǾǹȇDZǰǮDZǼǴȉǷDZǶǾǼǺǹǹǿȊǽǴǽǾDZǸǿ ǭDZdzǺǻǬǽǹǺǽǾǴǰDZǼDZǮȋǹǹȇǵǻǬǼǶDZǾǮǶǺǸǹǬǾǬȁǙǺǮǬȋǶǿȁǹȋǙDZdzǬǮǴǽǴǸǺDZǺǾǺǻǷDZǹǴDZȉǾǬDzDZǵǖǶǮǬǼǾǴǼDZǺǾǹǺǽǴǾǽȋǯǬǼǬDzǴǻǺǰǮǬǷǮǰǺǸDZǖǬȃDZǽǾǮDZǹǹǺDZDzǴǷȈDZǻǺǰȁǺǰȋȅDZDZǰǷȋǽDZǸDZǵǽ ǰDZǾȈǸǴ

Real Estate & Life, s.r.o. Hybernská 24, 110 00 Praha 1, info@estateandlife.cz tel. + 420 222 125 286, + 420 602 285 064 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

53


kzp

352'(-=EXGRYVNi3UDKD²/LEXäP.ÿ 6$/(=EXGRYVNi3UDJXH²/LEXäP&=. Ǜǜǚǐnjǒnj=EXGRYVNiǛǼǬǯǬ/LEXäǸǶǼǺǹ ŏDGRYpURGLQQpGRP\2i]D/LEXäMVRXFKDUDNWHULVWLFNpVYëPYHONRU\VëPSURVWRURYëPŐHäHQtP9HWŐHFKSRGODætFKY]QLNODE\WRYiMHGQRWNDNNVJDUiætSURGYĚDXWDGYĚPD EDONRQ\WHUDVRX'RSRG]HPQtKRSRGODætE\ODXPtVWĚQDJDUiæDWHFKQLFNp]i]HPtGRPX9SUYQtPSDWŐHVHQDFKi]tSŐtMHPQiYVWXSQtKDODREëYDFtSRNRMVNXFK\ŁVNëPNRXWHP VDPRVWDWQëSRNRMY\XæLWHOQëMDNRSUDFRYQDQHERSRNRMSURKRVW\WRDOHWDDNRXSHOQDVHVSUFKRYëPNRXWHP'UXKpQDG]HPQtSRGODætVORXætMDNRVRXNURPi]yQDGRPX²MVRX]GHWŐL SRNRMHSURVWRUQiNRXSHOQDVRNQHPYDQRX:&ELGHWHPVSUFKRYëPNRXWHPDGYĚPDXP\YDGO\DNMHGQp]ORæQLFQiOHætFtPHQätNRXSHOQDVWRDOHWRXXP\YDGOHPDVSUFKRYëP NRXWHP 7KHWHUUDFHGIDPLO\KRXVHVRI2DVLV/LEXäDUHFKDUDFWHULVHGE\DJHQHURXVVSDWLDOGHVLJQ7KHURRPHGKRXVLQJXQLWZLWKNLWFKHQQRRNGRXEOHJDUDJHEDOFRQLHVDQGWHUUDFH ZDVFUHDWHGRQWKUHHÁRRUV7KHJDUDJHDQGWHFKQLFDOHTXLSPHQWRIWKHKRXVHDUHVLWXDWHGLQWKHEDVHPHQW7KHSOHDVDQWHQWUDQFHKDOOLVVLWXDWHGRQWKHJURXQGÁRRUWRJHWKHU ZLWKOLYLQJURRPDQGNLWFKHQQRRNDVHSDUDWHURRPVXLWDEOHIRUXVHDVDVWXG\RUJXHVWURRPWRLOHWDQGEDWKURRPZLWKVKRZHUFRUQHU7KHVWÁRRUVHUYHVDVWKHSULYDWH]RQHRI WKHKRXVH²WKHUHDUHWKUHHEHGURRPVDVSDFLRXVEDWKURRPZLWKZLQGRZEDWKWXE:&ELGHWVKRZHUFRUQHUDQGWZRZDVKEDVLQVDQGRQHRIWKHEHGURRPVDOVRKDVDVPDOOHUHQ VXLWHEDWKURRPZLWKWRLOHWZDVKEDVLQDQGVKRZHUFRUQHU ǝDZǸDZǵǹȇDZǰǺǸǬǼȋǰǺǮǺǵdzǬǽǾǼǺǵǶǴǻǼǺDZǶǾǬ2i]D/LEXäȁǬǼǬǶǾDZǼǴdzǿDZǾȁǺǼǺȄǬȋǻǼǺǽǾǼǬǹǽǾǮDZǹǹǬȋǻǷǬǹǴǼǺǮǶǬǙǬǾǼDZȁȉǾǬDzǬȁǹǬȁǺǰǴǾǽȋǶǮǬǼǾǴǼǬǶǶǽǯǬǼǬDzǺǸǹǬǰǮDZ ǸǬȄǴǹȇǰǮǿǸȋǭǬǷǶǺǹǬǸǴǴǾDZǼǼǬǽǺǵǎǻǺǰǮǬǷDZǯǬǼǬDzǴǾDZȁǹǴȃDZǽǶǺDZǺǭǺǼǿǰǺǮǬǹǴDZǰǺǸǬǙǬǻDZǼǮǺǸȉǾǬDzDZǹǬȁǺǰǴǾǽȋǶǼǬǽǴǮȇǵȁǺǷǷǯǺǽǾǴǹǬȋǽdzǺǹǺǵǶǿȁǹǴǺǾǰDZǷȈǹǬȋ ǶǺǸǹǬǾǬǶǺǾǺǼǬȋǸǺDzDZǾǴǽǻǺǷȈdzǺǮǬǾȈǽȋǶǬǶǼǬǭǺȃǴǵǶǬǭǴǹDZǾǴǷǴǶǺǸǹǬǾǬǰǷȋǯǺǽǾDZǵǾǿǬǷDZǾǴǮǬǹǹǬȋǶǺǸǹǬǾǬǽǰǿȄDZǮǺǵǶǬǭǴǹǺǵǙǬǮǾǺǼǺǸȉǾǬDzDZȃǬǽǾǹǬȋdzǺǹǬǰǺǸǬ ǾǼǴǽǻǬǷȈǹǴǻǼǺǽǾǺǼǹǬȋǮǬǹǹǬȋǶǺǸǹǬǾǬǽǺǶǹǺǸǮǬǹǹǺǵǾǿǬǷDZǾǺǸǭǴǰDZǰǿȄDZǮǺǵǶǬǭǴǹǺǵǴǰǮǿǸȋǼǬǶǺǮǴǹǬǸǴǶǺǰǹǺǵǴdzǽǻǬǷDZǹǺǾǹǺǽǴǾǽȋǸDZǹȈȄǬȋǮǬǹǹǬȋǶǺǸǹǬǾǬ ǽǾǿǬǷDZǾǺǸǼǬǶǺǮǴǹǺǵǴǰǿȄDZǮǺǵǶǬǭǴǹǺǵ

3URNRPSOHWQtQDEtGNXQDYäWLYWHZZZGRP\OLEXVF] 0HWHRURORJLFNi3UDKD 54

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


kzp

352'(-8.RORQLH3UDKD²&KRGRYP.ÿ 6$/(8.RORQLH3UDJXH²&KRGRYP&=. Ǜǜǚǐnjǒnj8.RORQLHǛǼǬǯǬ&KRGRYǸǶǼǺǹ 9LODGŢP&KRGRYQDEt]tRVPH[NOX]LYQtFKMHGQRWHNDPH]LQLPLWDNpGYDQiGKHUQpPH]RQHWRYpE\W\.HNDæGpPX]E\WŢSDWŐtQDYtFVHGPGHViWLPHWURYi]DKUDGDSURVWRUQëVNOHSD SDUNRYiQtSURGYDYR]\9SŐt]HPtVHYHGOHYVWXSQtKDO\DWRDOHW\QDFKi]tREëYDFtSRNRMDSURVWRUQiNXFK\QĚ9SUYQtPSDWŐHMVRXXPtVWĚQ\GYĚORæQLFHREĚVYODVWQtNRXSHOQRXVH VSUFKRYëPNRXWHPMHGQDQDYtFVSŐtVWXSHPQDORGæLLDYODVWQtäDWQRX'RWŐHWtKRSDWUDE\ODXPtVWĚQDNRXSHOQDVYDQRXD]LPQt]DKUDGDQDNWHURXQDYD]XMHSĚWDGYDFHWLPHWURYi WHUDVD7DNpYQLWŐQtY\EDYHQtYHNWHUpPQHFK\EtPDVLYQtGŐHYĚQpSRGODK\EH]HVSDUiNHUDPLFNiGODæEDPDVLYQtEH]IDOFRYpGYHŐHÿLNOLPDWL]DFHVHäWĚUELQRYRXY\~VWNRXGiYi WXäLWæHVHMHGQiRE\GOHQtWpQHMY\äätNYDOLW\ &KRGRY9LOODKRXVHRIIHUVHLJKWH[FOXVLYHXQLWVDQGDPRQJWKHPDOVRWZREHDXWLIXOPDLVRQHWWHÁDWV,QDGGLWLRQHDFKRIWKHÁDWVLQFOXGHVDPñJDUGHQVSDFLRXVFHOODUDQGSDU NLQJED\IRUWZRFDUV7KHJURXQGÁRRUFRPSULVHVDQHQWUDQFHKDOODQGWRLOHWOLYLQJURRPDQGVSDFLRXVNLWFKHQ7KUHHEHGURRPVDUHVLWXDWHGRQWKHVWÁRRUHDFKZLWKDQHQVXLWH EDWKURRPLQFOXGLQJVKRZHUFRUQHU2QHDOVRKDVDSULYDWHGUHVVLQJURRPDQGDFFHVVWRWKHORJJLD7KHQGÁRRUFRQWDLQVDEDWKURRPZLWKEDWKWXEDQGDZLQWHUJDUGHQOHDGLQJRQ WRDPñWHUUDFH7KHLQWHULRUÀ[WXUHVLQFOXGLQJVROLGZRRGHQÁRRUVVHDPOHVVFHUDPLFWLOLQJVROLGQRQUHEDWHGGRRUVDQGDLUFRQGLWLRQLQJZLWKVORWWHGLQGXFWLRQXQLWDOOUHYHDO WKDWWKLVLVWRSTXDOLW\KRXVLQJ ǎǴǷǷǬǰǺǸ ©&KRGRYª ǻǼDZǰǷǬǯǬDZǾ ǮǺǽDZǸȈ ȉǶǽǶǷȊdzǴǮǹȇȁ ǶǮǬǼǾǴǼ ǽǼDZǰǴ ǶǺǾǺǼȇȁ ǰǮDZ ǶǼǬǽǴǮȇȁ ǰǮǿȁȉǾǬDzǹȇȁ ǶǮǬǼǾǴǼȇ ǖ ǶǬDzǰǺǵ ǶǮǬǼǾǴǼDZ ǺǾǹǺǽǴǾǽȋ ǾǬǶDzDZ Ǹ ǽǬǰǺǮǺǯǺ ǿȃǬǽǾǶǬǻǼǺǽǾǺǼǹȇǵǻǺǰǮǬǷǴǻǬǼǶǺǮǶǬǰǷȋǰǮǿȁǬǮǾǺǸǺǭǴǷDZǵǙǬǻDZǼǮǺǸȉǾǬDzDZǼȋǰǺǸǽȁǺǷǷǺǸǴǾǿǬǷDZǾǬǸǴǹǬȁǺǰǴǾǽȋǯǺǽǾǴǹǬȋǴǻǼǺǽǾǺǼǹǬȋǶǿȁǹȋǙǬǮǾǺǼǺǸȉǾǬDzDZǰǮDZ ǽǻǬǷȈǹǴǶǬDzǰǬȋǽǺǾǰDZǷȈǹǺǵǮǬǹǹǺǵǶǺǸǹǬǾǺǵǴǰǿȄDZǮǺǵǶǬǭǴǹǺǵǺǰǹǬǽǰǺǻǺǷǹǴǾDZǷȈǹȇǸǮȁǺǰǺǸǹǬǷǺǰDzǴȊǴǯǬǼǰDZǼǺǭǺǸǙǬǮǾǺǼǺǸȉǾǬDzDZǮǬǹǹǬȋǶǺǸǹǬǾǬǽǮǬǹǹǺǵ ǴdzǴǸǹǴǵǽǬǰǽǮȇȁǺǰǺǸǹǬǸDZǾǼǺǮǿȊǾDZǼǼǬǽǿǖǼǺǸDZǾǺǯǺǮǴǹǾDZǼȈDZǼDZǰDZǼDZǮȋǹǹȇDZǻǺǷȇǭDZǽȄǺǮǹǬȋǶDZǼǬǸǴȃDZǽǶǬȋǻǷǴǾǶǬǰǮDZǼǴǴdzȂDZǷȈǹǺǯǺǸǬǽǽǴǮǬǭDZdzȀǬǷȈȂǬ ǶǺǹǰǴȂǴǺǹDZǼǽǺȅDZǷDZǮȇǸǰǴȀȀǿdzǺǼǺǸ³ǮǽDZȉǾǺǺǾǹǺǽǴǾǽȋǶDzǴǷȈȊǽǬǸǺǯǺǮȇǽǺǶǺǯǺǶǬȃDZǽǾǮǬ

3URNRPSOHWQtQDEtGNXQDYäWLYWHZZZYLODGXPFKRGRYF] 0HWHRURORJLFNi3UDKD 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

55


ZZZHQJHOYRHONHUVFRPSUDJ

Praha-východ The timeless designed villa - Klokočná

&(1$.þ 2%<71È3/2&+$P 32=(0(.P ,'12:-7-<

1

DGþDVRYêDUFKLWHNWRQLFNêVW\OYLO\NNQDYUåHQpUHQRPRYDQêP DUFKLWHNWRQLFNêPVWXGLHP3+$'ĤPE\O]NRODXGRYiQYURFH 9LODQDEt]tPDMLWHOLDFHOpURGLQČYHãNHUêNRPIRUWUR]OHKOpKR SURVWRUXSOQpKRVYČWODVSROHþHQVNpKRåLYRWDYREêYDFtPSRNRML VNUEHPLNOLGQêRGSRþLQHNYHYHONRU\VHĜHãHQêFKVYČWOêFKORåQLFtFK 9HONiIUDQFRX]VNiRNQDYiPXPRåQt]NDåGpPtVWQRVWLYVWXSGR]DKUDG\ VSURVWRUQRXWHUDVRX&HOiNRQFHSFHGRPXXPRåĖXMHPD[LPiOQtY\XåLWt GHQQtKRVYČWODSĜLNDåGRGHQQtþLQQRVWLÒORåQpDWHFKQLFNpPtVWQRVWL VWHMQČMDNRJDUiåHMVRXSĜtVWXSQpMDN]GRPXWDNSĜtPêPYFKRGHP]H ]DKUDG\1D]DKUDGČMHSRþtWiQRVHVWDYERXED]pQX9LODQDYUåHQiSUR NUiVQpDIXQNþQtE\GOHQtVHQDFKi]tYSĜtMHPQpDNOLGQpYLORYp]iVWDYEČ VYHONêPLSR]HPN\

56

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

&217$&7(1*(/ 9g/.(5635$*8( &=

,002%,/,(1( 9VUR 6(129Èä1e1È035$+$ 7(/02%,/( (0$,/DQGUHDGORXKD#HQJHOYRHONHUVFRP 35,&(&=. )/225$5($VTP 3/272)/$1'VTP ,'12:-7-<

7

KHWLPHOHVVVW\OHRIWKLVNNYLOODGHVLJQHGE\WKHUHQRZQHGDUFKL WHFWXUDOVWXGLR3+$7KHEXLOGLQJZDVDSSURYHGDV¿WIRURFFXSDQF\ LQ7KHYLOODRIIHUVWKHRZQHUDQGWKHZKROHIDPLO\DOOWKHFRPIRUWRIDQ H[WHQVLYHVSDFHIXOORIOLJKWVRFLDOOLIHLQWKHOLYLQJURRPZLWKD¿UHSODFHDQG GHHSUHOD[DWLRQLQWKHJHQHURXVO\GLPHQVLRQHGEHGURRPV/DUJH)UHQFK ZLQGRZVZLOODOORZ\RXHQWU\LQWRHDFKURRPIURPWKHJDUGHQZLWKDVSD FLRXVWHUUDFH7KHHQWLUHFRQFHSWRIWKHKRXVHSURYLGHVIRUPD[LPXPXVH RIGD\OLJKWLQHYHU\GD\DFWLYLWLHV7KHVWRUHURRPVDQGXWLOLW\URRPVDQG WKHJDUDJHVDUHDFFHVVLEOHIURPWKHKRXVHRUGLUHFWO\IURPWKHJDUGHQ &RQVWUXFWLRQRIDVZLPPLQJSRROLVHQYLVLRQHGLQWKHJDUGHQ'HVLJQHG IRUHQMR\DEOHDQGIXQFWLRQDOOLYLQJWKHYLOODLVVLWXDWHGLQDSOHDVDQWDQG SHDFHIXOUHVLGHQWLDOGLVWULFWZLWKODUJHSORWVRIODQG


ZZZHQJHOYRHONHUVFRPSUDJ

Praha 1 Apartment in gothic house at Kampa

&(1$.þ 2%<71È3/2&+$P ,'12:8$;

(

[NOX]LYQtQDEtGNDMHGLQHþQČVLWXRYDQpKRE\WXPYKLVWR ULFNpPSĤYRGQČJRWLFNpPGRPČQD.DPSČ-HKR]iNODG\VHGDWXMt GRURNXVRXþDVQRXEDURNQtSRGREX]tVNDOYVWROHWt9FHOpP GRPČMVRXSRX]HE\WRYpMHGQRWN\YSRGNURYtMHDWHOLpU%\W]DEtUi FHOpSDWURMHSĜHGNRPSOHWQtUHNRQVWUXNFtPiNUiVQRXSURVNOHQRX SDYODþVRMHGLQČOêPYêKOHGHPQD.DUOĤYPRVWýHUWRYNXDQHVþHWQp PQRåVWYtVWDURPČVWVNêFKYČåLþHN9URFHE\O\YGRPČNRPSOHWQČ ]UHNRQVWUXRYiQ\UR]YRG\DRGSDG\VWĜHFKDDNURY\=GRPXMHSĜtPê YVWXSNýHUWRYFHNE\WXQiOHåtVNOHSQtSURVWRU\3UĤþHOtGRPX]GREt SDPiWNRYČFKUiQČQêRULJLQiOPDGRQ\DKLVWRULFNpOXFHUQ\URYQČå RULJLQiO\9SURVWRUiFKGRPXLYE\WČMVRXGRGQHVXFKRYiQ\ RULJLQiOQtKLVWRULFNpGHWDLO\

&217$&7(1*(/ 9g/.(5635$*8( &=

,002%,/,(1( 9VUR 6(129Èä1e1È035$+$ 7(/02%,/( (0$,/DQGUHDGORXKD#HQJHOYRHONHUVFRP 35,&(&=. )/225$5($VTP ,'12:8$;

(

[FOXVLYHRIIHURIDVTPÀDWLQWKHXQLTXHORFDWLRQRIDKLV WRULFRULJLQDOO\JRWKLFKRXVHDW.DPSD,WVIRXQGDWLRQVZHUHODLGLQ WKH\HDUDQGLWVSUHVHQWGD\DSSHDUDQFHGDWHVIURPWKHWKFHQWXU\ 7KHUHDUHRQO\WKUHHKRXVLQJXQLWVLQWKHKRXVHZLWKDVWXGLRLQWKHORIW 7KHÀDWFRYHUVDOORIWKHQGÀRRULVWREHIXOO\UHIXUELVKHGKDVD¿QH ORRNLQJJODVVIURQWHGFRXUW\DUGJDOOHU\ZLWKDXQLTXHYLHZRI&KDUOHV %ULGJHýHUWRYNDDQGFRXQWOHVVFKXUFKVWHHSOHVLQWKH2OG7RZQ$OOWKH GLVWULEXWLRQFRQGXLWVDQGZDVWHIDFLOLWLHVDQGWKHURRIVZHUHUHQRYDWHGLQ 7KHUHLVGLUHFWDFFHVVWRýHUWRYNDIURPWKHKRXVH7KHKRXVHKDV DFHOODUXQGHUQHDWKDQRULJLQDOOLVWHG0DGRQQDGHFRUDWHVWKHIDoDGHSOXV KLVWRULFDOODQWHUQVDOVRRULJLQDOV2ULJLQDOKLVWRULFDOGHWDLOVDUHSUHVHUYHG LQVLGHWKHKRXVHDQGWKHÀDW

352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

57


58

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

59


3URGHM3UDKD0DOi6WUDQDP.ÿ 6DOH3UDJXH0DOi6WUDQDP&=. ǛǼǺǰǬDzǬǛǼǬǯǬǘǬǷǬǝǾǼǬǹǬǸ&=.

/X[XVQtE\WNNPMHVLWXRYiQYHSDWŐHYEDURNQtPSDOiFL%HHWKRYHQ]URNX3UDKD0DOi6WUDQDXOLFH/i]HŁVNi9WpWREXGRYĚSŢVRELOYVWROHWtQĚMDNëÿDV/XGZLJ YDQ%HHWKRYHQ&HONRYiUHNRQVWUXNFHSUREĚKODYURFHVH]DFKRYiQtPSŢYRGQtFKEDURNQtFKSUYNŢ%\WVHVNOiGi]SURVWRUQpKRREëYDFtKRSRNRMHPRGHUQtSOQĚY\EDYHQpNXFK\QĚ VMtGHOQtPNRXWHPSURVWRUQpORæQLFHYHONpSŐHGVtQĚ1DSRGODKiFKMVRXPDVLYQtGŐHYĚQpSRGODK\9NRXSHOQĚMHNUiVQiYDQDDVSUFKD:&MH]YOiäŘ1DVWURSHFKMVRX]DFKRYiQ\SŢYRGQt äWXN\9HOPLDWUDNWLYQtPtVWRSURE\GOHQtDLQYHVWLFLVQt]NëPLPĚVtÿQtPLQiNODG\9ëERUQpVSRMHQtGRFHQWUDPLQXWQDPHWUR0DORVWUDQVNiPLQXWDRG.DUORYDPRVWXPLQXW FKŢ]HN3UDæVNpPXKUDGX /X[XULRXVDSDUWPHQWNNPLVORFDWHGRQWKHQGÁRRULQDEDURTXHSDODFHRI%HHWKRYHQIURP3UDJXH0DOi6WUDQD/D]HŁVNiVWUHHW/XGZLJYDQ%HHWKRYHQOLYHG IRUVRPHWLPHLQWKHEXLOGLQJLQWKHWKFHQWXU\7RWDOUHQRYDWLRQWRRNSODFHLQNHHSLQJWKHRULJLQDO%DURTXHHOHPHQWV7KHDSDUWPHQWFRQVLVWVRIVSDFLRXVOLYLQJURRP PRGHUQIXOO\HTXLSSHGNLWFKHQZLWKGLQLQJDUHDVSDFLRXVEHGURRPODUJHKDOO7KHÁRRUVDUHZRRGHQ7KHEDWKURRPKDVDEHDXWLIXOEDWKWXEDQGVKRZHUWRLOHWLVVHSDUDWH7KH FHLOLQJVSUHVHUYHGWKHRULJLQDOVWXFFR$YHU\DWWUDFWLYHSODFHIRUOLYLQJDQGLQYHVWPHQW&ORVHWRWKHFHQWHUPLQXWHVWRPHWUR0DORVWUDQVNiPLQXWHWRWKH&KDUOHV%ULGJH PLQXWHZDONWR3UDJXH&DVWOH ǜǺǽǶǺȄǹǬȋǶǮǬǼǾǴǼǬǶǶǸǼǬǽǻǺǷǺDzDZǹǬǹǬǵȉǾǬDzDZǮǭǬǼǺȃǹǺǸǰǮǺǼȂDZ©ǍDZǾȁǺǮDZǹªǻǺǽǾǼǺǵǶǴǯǛǼǬǯǬǘǬǷǬǝǾǼǬǹǬǿǷ/i]HŁVNiǎȉǾǺǸdzǰǬǹǴǴǹDZǶǺǾǺǼǺDZ ǮǼDZǸȋǹǬȁǺǰǴǷǽȋǮǸǮDZǶDZǗȊǰǮǴǯǮǬǹǍDZǾȁǺǮDZǹǖǺǸǻǷDZǶǽǹǬȋǼDZǶǺǹǽǾǼǿǶȂǴȋǻǼǺȄǷǬǮǯǺǰǿǻǼǴȉǾǺǸǭȇǷǴǽǺȁǼǬǹDZǹȇǺǼǴǯǴǹǬǷȈǹȇDZȉǷDZǸDZǹǾȇǮǽǾǴǷDZǭǬǼǺǶǶǺ ǖǮǬǼǾǴǼǬǽǺǽǾǺǴǾǴdzǻǼǺǽǾǺǼǹǺǵǯǺǽǾǴǹǺǵǽǺǮǼDZǸDZǹǹǺǵǻǺǷǹǺǽǾȈȊǺǭǺǼǿǰǺǮǬǹǹǺǵǶǿȁǹǴǽǺǽǾǺǷǺǮǺǵǻǼǺǽǾǺǼǹǺǵǽǻǬǷȈǹǴǭǺǷȈȄǺǯǺȁǺǷǷǬǛǺǷȇǴdzǾǮDZǼǰǺǯǺǰDZǼDZǮǬǎ ǮǬǹǹǺǵǶǺǸǹǬǾDZDZǽǾȈǶǼǬǽǴǮǬȋǮǬǹǹǬȋǴǰǿȄǾǿǬǷDZǾǺǾǰDZǷȈǹǺǙǬǻǺǾǺǷǶǬȁǽǺȁǼǬǹǴǷǴǽȈǺǼǴǯǴǹǬǷȈǹȇDZȄǾǿǶǬǾǿǼǶǴǚȃDZǹȈǻǼǴǮǷDZǶǬǾDZǷȈǹǺDZǸDZǽǾǺǰǷȋDzǴdzǹǴǴǴǹǮDZǽǾǴȂǴǵ ǽǹǴdzǶǴǸDZDzDZǸDZǽȋȃǹȇǸǼǬǽȁǺǰǺǸǙDZǰǬǷDZǶǺǺǾȂDZǹǾǼǬǸǴǹǿǾǰǺǸDZǾǼǺnj³ǽǾǬǹȂǴȋǘǬǷǺǽǾǼǬǹǽǶǬȋǸǴǹǿǾǬǺǾǖǬǼǷǺǮǬǸǺǽǾǬǸǴǹǿǾǻDZȄǶǺǸǰǺǛǼǬDzǽǶǺǯǺǏǼǬǰǬ

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF] 60

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

)$5$21UHDOLW\VUR3ROVN¾3UDKDWHOLQIR#IDUDRQF]


3URGHM3UDKDP.ÿ 6DOH3UDJXHP&=. ǛǼǺǰǬDzǬǛǼǬǯǬP&=.

1DEt]tPHQiGKHUQëOX[XVQtE\WNNYURKRYpPGRPĚYXOLFL9DOHQWLQVNiYMHGQp]QHMOHSätFKORNDOLWYFHQWUX3UDK\7HQWRVW\ORYëDSURVWRUQëE\WRRE\WQpSORäHPVHQDFKi]tYHSDWŐHFLKORYpEXGRY\D QDEt]tUHSUH]HQWDWLYQtE\GOHQtYKLVWRULFNpPFHQWUX3UDK\%\WMHY\EDYHQPRGHUQtNXFK\ŁVNRXOLQNRXVH]DEXGRYDQëPLVSRWŐHELÿLDYHOPLSĚNQëPQiE\WNHP=SURVWRUQpKDO\MHSŐtVWXSQëYHONëREëYDFtSRNRMV NXFK\ŁVNëPNRXWHPVSLætUQRXDSUiGHOQRXDVDPRVWDWQpORæQLFH9KODYQtORæQLFLMHäDWQDVYHONëP~ORæQëPSURVWRUHP9E\WĚMHGiOHNRXSHOQDVYDQRXLVSUFKRYëPNRXWHPDWRDOHWRX'UXKiVDPRVWDWQi WRDOHWDVHQDFKi]tYKDOH3RGODK\MVRXGŐHYĚQpDGODæED2NQDORæQLFVPĚŐXMtGRWLFKpKRYQLWUREORNXVRULHQWDFtQDMLKRYëFKRG9GRPĚMHYëWDK9\QLNDMtFtGRSUDYQtGRVWXSQRVWVWDQLFHPHWUD$²6WDURPĚVWVNi VHQDFKi]tSŐtPRXGRPXWUDPYDMRYi]DVWiYNDPHWUŢ6WDURPĚVWVNpQiPĚVWtSRXKëFKPRGGRPX 7KLVLVDYHU\OX[XULRXVDQGODUJHDSDUWPHQWPLQVL]H,WLVVLWXDWHGRQWKHWKÁRRUDQGDOVRKDVDEDOFRQ\,WRIIHUVOX[XULRXVOLYLQJLQWKHKLVWRULFDOFLW\FHQWHURI3UDJXHZLWKWKH2OG7RZQVTXDUH EHLQJRQO\DPLQZDON PDZD\ DQGZHOONQRZQSXEVDQGUHVWDXUDQWVMXVWDIHZVWHSVDZD\7KHDSDUWPHQWKDVDYHU\VSDFLRXVOLYLQJURRPZLWKDQDGMRLQLQJODUJHNLWFKHQ7KHNLWFKHQLVIXUQLVKHG ZLWKDOOWKHPRGHUQXWLOLWLHVDQGDOVRKDVDQDWWDFKHGSDQWU\URRPIRUVWRUDJH7KHUHDUHODUJHEHGURRPVDEDWKURRPZLWKEDWKVKRZHUDQGWRLOHW7KHPDLQEHGURRPDOVRKDVDZDONLQZDUGUREHIXOO\ ÀWWHGZLWKVKHOYHV7KHUHLVDJXHVWWRLOHWLQWKHKDOODQGDXWLOLW\URRPIRUNHHSLQJWKHZDVKLQJPDFKLQHDQGRWKHUGHYLFHV7KHEXLOGLQJLVÀWWHGZLWKDOLIWDQGKDVUHFHQWO\EHHQH[WHQVLYHO\UHQRYDWHG7KH KRXVHDOVRKDVH[FHOOHQWWUDQVSRUWDWLRQOLQNV7KH0HWURVWDWLRQLVMXVWRSSRVLWHWKHKRXVHDQGWKHWUDPFRQQHFWLRQVDUHDOVRDYDLODEOHMXVWURXQGWKHFRUQHU,WLVHDV\WRUHDFKE\FDUGXHWRMXVWEHLQJRQH VWUHHWDZD\IURPWKHPDLQURDG ǛǼDZǮǺǽȁǺǰǹǬȋǴǼǺǽǶǺȄǹǬȋǶǮǬǼǾǴǼǬǶǶǮǹǺǮǺǸǰǺǸDZǹǬǿǷǴȂDZ9DOHQWLQVNiǮǺǰǹǺǸǴdzǷǿȃȄǴȁǼǬǵǺǹǺǮǮȂDZǹǾǼDZǯǺǼǺǰǬǩǾǬǽǾǴǷȈǹǬȋǴǻǼǺǽǾǺǼǹǬȋǶǮǬǼǾǴǼǬǽDzǴǷǺǵǻǷǺȅǬǰȈȊǸ ǼǬǽǻǺǷǺDzDZǹǬǹǬǸȉǾǬDzDZǶǴǼǻǴȃǹǺǯǺdzǰǬǹǴȋǴǻǼDZǰǽǾǬǮǷȋDZǾǽǺǭǺǵDzǴǷȈDZǻǼDZǰǽǾǬǮǴǾDZǷȈǽǶǺǯǺǶǷǬǽǽǬǻǼǺDzǴǮǬȊȅǴȁǮǴǽǾǺǼǴȃDZǽǶǺǸȂDZǹǾǼDZǛǼǬǯǴǛǼǬǯǴǖǮǬǼǾǴǼǬǺǭǺǼǿǰǺǮǬǹǬǽǺǮǼDZǸDZǹǹǺǵ ǶǿȁǹDZǵǽǺǮǽǾǼǺDZǹǹǺǵǾDZȁǹǴǶǺǵǴǺȃDZǹȈȁǺǼǺȄDZǵǸDZǭDZǷȈȊǔdzǻǼǺǽǾǺǼǹǺǯǺȁǺǷǷǬǸǺDzǹǺǻǺǻǬǽǾȈǮǭǺǷȈȄǿȊǯǺǽǾǴǹǿȊǽǶǿȁǹDZǵǬǾǬǶDzDZǶǷǬǰǺǮǿȊǴǻǼǬȃDZȃǹǿȊǴǮǺǾǰDZǷȈǹȇDZǽǻǬǷȈǹǴǎǯǷǬǮǹǺǵ ǽǻǬǷȈǹDZDZǽǾȈǯǬǼǰDZǼǺǭǹǬȋǽǭǺǷȈȄǴǸǻǼǺǽǾǼǬǹǽǾǮǺǸǰǷȋȁǼǬǹDZǹǴȋǮDZȅDZǵǎǶǮǬǼǾǴǼDZǾǬǶDzDZǮǬǹǹǬȋǶǺǸǹǬǾǬǽǮǬǹǹǺǵǴǰǿȄDZǸǴǾǿǬǷDZǾǺǸǎǾǺǼǺǵǾǿǬǷDZǾǼǬǽǻǺǷǺDzDZǹǮȁǺǷǷDZǛǺǷȇǴdzǰDZǼDZǮǬ ǴǻǷǴǾǶǴǚǶǹǬǽǻǬǷDZǹǮȇȁǺǰȋǾǮǾǴȁǴǵǰǮǺǼǺǼǴDZǹǾǬȂǴȋǹǬȊǯǺǮǺǽǾǺǶǎǰǺǸDZDZǽǾȈǷǴȀǾǚǾǷǴȃǹȇDZǻǺǰȆDZdzǰǹȇDZǻǿǾǴǽǾǬǹȂǴȋǸDZǾǼǺnj³ǝǾǬǼǺǸDZǽǾǽǶǬȋǼǬǽǻǺǷǺDzDZǹǬǻǼȋǸǺǼȋǰǺǸǽǰǺǸǺǸ ǾǼǬǸǮǬǵǹǬȋǺǽǾǬǹǺǮǶǬǮǸDZǾǼǬȁǓǹǬǸDZǹǴǾǬȋǝǾǬǼǺǸDZǽǾǽǶǬȋǻǷǺȅǬǰȈǮǽDZǯǺǮǸDZǾǼǬȁǺǾǰǺǸǬ

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF]

)$5$21UHDOLW\VUR3ROVN¾3UDKDWHOLQIR#IDUDRQF] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

61


3URGHM3UDKD6PtFKRYPH]RQHWP.ÿ 3URGHM3UDJXH6PtFKRYP&=. ǛǼǺǰǬDzǬǛǼǬǯǬ6PtFKRYǸDZdzǺǹDZǾǸ&=.

.UiVQëVYĚWOëPH]RQHWRSORäHPYSDWŐHÿLQæRYQtKRGRPXQDUR]KUDQt6PtFKRYDD0DOp6WUDQ\%\WMHSRVWDYHQMDNRQRYRVWDYEDQDGRPĚMVRX]GHNRPSOHWQĚQRYpVDPRVWDWQpUR]YRG\'LVSR]LFHMHWYRŐHQDSŐt]HPtP E\WXNGHVHQDFKi]tYHONëREëYDFtSURVWRUMHKRæVRXÿiVWtMHNXFK\QĚLSUDFRYQDVIXQNÿQtPNUEHPGiOHSŐHGVtŁ:&D~ORæQiNRPRUD2EëYDFtSURVWRUO]HVQDGQRUR]GĚOLWQDGYĚVDPRVWDWQpSURVWRUQpPtVWQRVWLVHYVWXSHP] SŐHGVtQĚSURVYĚWOHQpVWŐHäQtPLLNODVLFNëPLRNQ\%\WMHVStäHYKRGQëSURQiURÿQĚMätSiUNWHUëXPtRFHQLWSURVWRUQHæSURURGLQXVGĚWPL1DGREëYDFtPSRNRMHPVHQDFKi]tJDOHULH]HNWHUpMHYVWXSGRORæQLFHVRXVHGtFtVSĚNQRX NRXSHOQRXVYDQRXVSUFKRYëPNRXWHPD:&=ORæQLFHMHYëVWXSQDWHUDVXNWHUiMHVLWXRYDQiGRWLFKpKRYQLWUREORNXPH]LGRP\.E\WXMHGiOHNXætYiQtYHONiVWŐHäQtWHUDVD]HNWHUpMHQiGKHUQëYëKOHGQDFHORX3UDKX9VWXSQDQL MH]GRPRYQtFKRGE\WHUDVXPRKRXY\XætYDWE\W\YSRVOHGQtPSDWŐH9E\WĚMVRXSRXæLW\NYDOLWQtPDWHULiO\PDVLYQtGŐHYĚQpSDUNHW\NHUDPLFNiGODæEDYNRXSHOQĚD:&NXFK\ŁVNiOLQND]ŢVWiYi9GRPĚMHQRYëYëWDKYVWXSGR E\WXMHQDGVWDQGDUGQĚ]DEH]SHÿHQ9EH]SURVWŐHGQtPRNROtMVRXNGLVSR]LFLYäHFKQ\VOXæE\WUDPYDMRYi]DVWiYNDMHSRXKpPLQXW\FKŢ]H9RNROtO]HSURQDMPRXWJDUiæRYiVWiQt3ŐtMHPQpDNOLGQpE\GOHQtYVDPpPFHQWUX3UDK\

%HDXWLIXOEULJKWDSDUWPHQWZLWKDQDUHDRIPLQWKHWKÁRRURIDQEORFNRIÁDWVDWWKHGLYLGLQJOLQHEHWZHHQ6PtFKRYDQG0DOi6WUDQD /HVVHU7RZQ 7KHDSDUWPHQWFRQVLVWVRIJURXQGÁRRUDSDUWPHQWZKHUHWKHUHLV DODUJHOLYLQJDUHDZKLFKLQFOXGHVDNLWFKHQDQGDVWXG\ZLWKIXQFWLRQDOÀUHSODFHDVZHOODVDKDOOWRLOHWDQGVWRUDJHFKDPEHU7KHOLYLQJDUHDFDQEHHDVLO\GLYLGHGLQWRWZRVSDFLRXVURRPVZLWKVHSDUDWHHQWUDQFHIURPWKH KDOO7KHDSDUWPHQWLVPRUHVXLWDEOHIRUWKHFRXSOHZKRFDQDSSUHFLDWHWKHVSDFHWKDQIRUDIDPLO\ZLWKFKLOGUHQ$ERYHWKHOLYLQJURRPWKHUHLVDJDOOHU\IURPZKLFKLVWKHHQWUDQFHWRWKHEHGURRPQH[WWRDQLFHEDWKURRP ZLWKWXEVKRZHUDQGWRLOHW7KHHQWUDQFHWRWKHWHUUDFHLVIURPWKHEHGURRPZKLFKLVVLWXDWHGLQWRWKHTXLHWFRXUW\DUG7KHUHLVDSRVVLELOLW\WRXVHWKHODUJHURRIWHUUDFHZLWKPDJQLÀFHQWYLHZRI3UDJXH$FFHVVLVIURPWKH KRXVHFRUULGRUWHUUDFHFDQEHXVHGE\UHVLGHQWVRIWRSÁRRUDSDUWPHQWV,QWKHDSDUWPHQWZHUHXVHGTXDOLW\PDWHULDOVVROLGZRRGÁRRUVFHUDPLFWLOHVLQWKHEDWKURRPDQGWRLOHW7KHKRXVHKDVDQHZHOHYDWRU7KHUH DUHDOOIDFLOLWLHVDQGWKHSRVVLELOLW\WRUHQWDJDUDJHLQWKHQHLJKERUKRRGDWUDPVWRSLVRQO\PLQXWHVZDON3OHDVDQWDQGSHDFHIXOOLYLQJLQWKHFLW\FHQWHU

ǖǼǬǽǴǮǬȋǽǮDZǾǷǬȋǶǮǬǼǾǴǼǬǸDZdzǺǹDZǾǻǷǺȅǬǰȈȊǸǹǬǸȉǾǬDzDZDzǴǷǺǯǺǰǺǸǬǹǬǯǼǬǹǴȂDZǼǬǵǺǹǺǮǝǸǴȁǺǮǴǘǬǷǬǝǾǼǬǹǬǖǮǬǼǾǴǼǬǹǺǮǺǽǾǼǺǵǶǬǹǬȁǺǰǴǾǽȋǶǬǶǹǬǰǽǾǼǺǵǶǬǹǬdzǰǬǹǴǴǮǹDZǵǽǺǮDZǼȄDZǹǹǺ ǹǺǮȇDZǶǺǸǸǿǹǴǶǬȂǴǴǴǻǼǺǮǺǰǶǬǛǷǬǹǴǼǺǮǶǬǽǺǽǾǺǴǾǴdzǻǼǺǽǾǼǬǹǽǾǮǬǹǬǻDZǼǮǺǸȉǾǬDzDZǯǰDZDZǽǾȈǭǺǷȈȄǬȋǯǺǽǾǴǹǬȋǶǺǾǺǼǬȋǮǶǷȊȃǬDZǾǮǽDZǭȋǶǿȁǹȊǴǼǬǭǺȃǴǵǶǬǭǴǹDZǾǽȀǿǹǶȂǴǺǹǬǷȈǹȇǸǶǬǸǴǹǺǸǬǾǬǶDzDZ ȁǺǷǷǾǿǬǷDZǾǴǶǺǸǹǬǾǬǰǷȋȁǼǬǹDZǹǴȋǮDZȅDZǵǏǺǽǾǴǹǿȊǸǺDzǹǺǷDZǯǶǺǼǬdzǰDZǷǴǾȈǹǬǰǮDZǽǬǸǺǽǾǺȋǾDZǷȈǹȇDZǻǼǺǽǾǺǼǹȇDZǶǺǸǹǬǾȇǽǺǾǰDZǷȈǹȇǸǮȁǺǰǺǸǴdzǻǼǴȁǺDzDZǵǻǼǺǽǮDZǾǷDZǹǹǺǵǸǬǹǽǬǼǰǹȇǸǴǴǾǼǬǰǴȂǴǺǹǹȇǸǴ ǺǶǹǬǸǴǖǮǬǼǾǴǼǬǭǺǷȈȄDZǻǺǰȁǺǰǴǾǰǷȋǾǼDZǭǺǮǬǾDZǷȈǹȇȁǶǷǴDZǹǾǺǮǿǸDZȊȅǴȁǺȂDZǹǴǾȈǺǭǴǷǴDZǻǼǺǽǾǼǬǹǽǾǮǬȃDZǸǰǷȋǽDZǸȈǴǽǰDZǾȈǸǴǙǬǰǯǺǽǾǴǹǺǵDZǽǾȈǯǬǷDZǼDZȋǶǺǾǺǼǬȋȋǮǷȋDZǾǽȋǮȁǺǰǺǸǮǽǻǬǷȈǹȊǼȋǰǺǸǽ ǶǺǾǺǼǺǵǶǼǬǽǴǮǬȋǮǬǹǹǬȋǶǺǸǹǬǾǬǽǮǬǹǹǺǵǰǿȄDZǮǺǵǶǬǭǴǹǺǵǴǾǿǬǷDZǾǺǸǎǽǻǬǷȈǹDZDZǽǾȈǮȇȁǺǰǹǬǾDZǼǼǬǽǿǶǺǾǺǼǬȋǹǬȁǺǰǴǾǽȋǮǾǴȁǺǸǰǮǺǼDZǰǺǸǬǖǶǮǬǼǾǴǼDZǺǾǹǺǽǴǾǽȋǭǺǷȈȄǬȋǾDZǼǼǬǽǬǹǬǶǼȇȄDZǽǶǺǾǺǼǺǵ ǺǾǶǼȇǮǬDZǾǽȋ ǮDZǷǴǶǺǷDZǻǹȇǵ ǮǴǰ ǹǬ ǮǽȊ ǛǼǬǯǿ ǎȁǺǰ ǹǬ ǹDZDZ Ǵdz ǶǺǼǴǰǺǼǬ ǰǺǸǬ ǾDZǼǼǬǽǺǵ ǸǺǯǿǾ ǻǺǷȈdzǺǮǬǾȈǽȋ  ǶǮǬǼǾǴǼȇ ǹǬ ǻǺǽǷDZǰǹDZǸ ȉǾǬDzDZ ǎ ǶǮǬǼǾǴǼDZ ǴǽǻǺǷȈdzǺǮǬǹȇ ǶǬȃDZǽǾǮDZǹǹȇDZ ǸǬǾDZǼǴǬǷȇ ǻǬǼǶDZǾ Ǵdz ǾǮDZǼǰǺǯǺǰDZǼDZǮǬǶDZǼǬǸǴȃDZǽǶǬȋǻǷǴǾǶǬǮǮǬǹǹǺǵǴǾǿǬǷDZǾDZǶǿȁǺǹǹǬȋǸDZǭDZǷȈǺǽǾǬDZǾǽȋǎǰǺǸDZǹǺǮȇǵǷǴȀǾǮȁǺǰǮǶǮǬǼǾǴǼǿǺǭDZǽǻDZȃDZǹdzǬȅǴǾǺǵǻǺǮȇǽǺǶǴǸǽǾǬǹǰǬǼǾǬǸǎǽDZǹDZǺǭȁǺǰǴǸȇDZǰǷȋǻǼǺDzǴǮǬǹǴȋǿǽǷǿǯǴǮ ǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵǭǷǴdzǺǽǾǴǾǼǬǸǮǬǵǹǬȋǺǽǾǬǹǺǮǶǬǮǽDZǯǺǮǸǴǹǿǾǬȁȁǺǰȈǭȇǘǺDzǹǺǬǼDZǹǰǺǮǬǾȈǯǬǼǬDz ǛǼǴȋǾǹǺDZǴǽǻǺǶǺǵǹǺDZǻǼǺDzǴǮǬǹǴDZǻǼȋǸǺǮȂDZǹǾǼDZǯǺǼǺǰǬ

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF] 62

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

)$5$21UHDOLW\VUR3ROVN¾3UDKDWHOLQIR#IDUDRQF]


3URGHM3UDKD6XFKGROPSR]HPHNP.ÿ 6DOH3UDJXH6XFKGROPSORWP&=. ǛǼǺǰǬDzǬǛǼǬǯǬ6XFKGROǸǿȃǬǽǾǺǶP&=.

+OHGiWHPRGHUQtE\GOHQtYGREUpGRVWXSQRVWLGRFHQWUDSŐHVWRDOHY]HOHQLDSŐtURGĚQDGRVDK"1HQHFKWHVLXMtWYëMLPHÿQRXQDEtGNXOX[XVQtYLO\NWHUi9iP]DMLVWtQDGVWDQGDUGQtE\GOHQt9SŐt]HPtGRPXVHQDFKi]tSURVWRUQë REëYDFtSRNRMVPRGHUQtQĚPHFNRXNXFK\ŁVNRXOLQNRXVYHVWDYĚQëPL]QDÿNRYëPLVSRWŐHELÿL0LHOH6DPR]ŐHMPRVWtNXFK\ŁVNpOLQN\MH]DEXGRYDQiP\ÿNDDOHGQLFH1DGVWDQGDUGHPMHäSLÿNRYëNiYRYDUGtN\NWHUpPXVLSŐLSUDYtWH Y\QLNDMtFtNiYX9REëYDFtPSRNRMLMHXPtVWĚQGHVLJQRYëNUE+:$0NWHUë9iP]SŐtMHPQtGORXKp]LPQtYHÿHU\V9DätURGLQRX9SŐt]HPtGRPXMHWDNpVDPRVWDWQp:&DSRNRMSURKRVW\NGHMHPRæQpY\EXGRYDWVDPRVWDWQRX NRXSHOQX'RSUYQtKRSDWUDYHGHGŐHYĚQpVFKRGLäWĚ9SDWŐHMVRXVDPRVWDWQpSRNRMHSURVWRUQiNRXSHOQDVYDQRXVSUFKRXD:&DNRPRUD-HGHQ]SRNRMŢMHY\XætYiQMDNRäDWQD'UXKëSRNRMPiVDPRVWDWQRXNRXSHOQXVH VSUFKRYëPNRXWHPDYODVWQtPSŐtVWXSHPQDSURVWRUQRXWHUDVXVPĚŐXMtFtQDVHYHU=EëYDMtFtGYDSRNRMHPDMtVSROHÿQëEDONyQNWHUëMHRULHQWRYiQQDMLæQtVWUDQX9GRPĚMHäYpGVNiGŐHYĚQiSRGODKDYNRXSHOQiFKVDQLWD/DXIHQ LWDOVNiGODæEDDRENODG\GŐHYĚQiHXURRNQD'ŢPMHY\EDYHQDODUPHPWHOHIRQHPDGDWRYëPLNDEHO\6RXÿiVWtGRPXMHJDUiæQDGYĚDXWDYHGYRŐHMVRXGDOätSDUNRYDFtVWiQt.GRPXQiOHætYHONi]DKUDGDRUR]OR]HP VQiGKHUQëPYëKOHGHPGRSŐtURG\.OLGQiORNDOLWDSRXKëFKPLQXWQDPHWUR$²'HMYLFNi'RSRUXÿXMHPHSURKOtGNX $UH\RXORRNLQJIRUDPRGHUQKRXVLQJZLWKDJRRGDFFHVVWRWKHFHQWUHRI3UDJXHEXWDOVRQHDUE\WKHQDWXUH"'RQRWPLVVWKHH[FHSWLRQDORIIHURIOX[XU\YLOODZKLFKZLOOSURYLGH\RXZLWKOX[XU\OLYLQJ7KHUHLVDVSDFLRXV OLYLQJURRPZLWKDPRGHUQNLWFKHQ0LHOHLQWKHJURXQGÁRRU2IFRXUVHWKHUHLVDEXLOWLQNLWFKHQGLVKZDVKHUDQGUHIULJHUDWRU([WUDRUGLQDU\LVWKHFRIIHHPDFKLQHWKDWKHOSV\RXSUHSDUHDQH[FHOOHQWFRIIHH,QWKHOLYLQJ URRPLVORFDWHGDÀUHSODFH+:$0GHVLJQWKDWPDNHVORQJZLQWHUHYHQLQJVPRUHSOHDVDQW7KHUHLVDOVRDVHSDUDWHWRLOHWDQGDJXHVWURRPLQWKHJURXQGÁRRUZLWKWKHSRVVLELOLW\WREXLOGDVHSDUDWHEDWKURRP7RWKHÀUVW ÁRRUOHDGVWKHZRRGHQVWDLUV7KHUHDUHVHSDUDWHURRPVDVSDFLRXVEDWKURRPZLWKWXEVKRZHUWRLOHWDQGVWRUDJHURRPXSVWDLUV2QHURRPLVXVHGDVDFORDNURRP7KHVHFRQGURRPKDVDVHSDUDWHEDWKURRPZLWKVKRZHU DQGRZQDFFHVVWRWKHVSDFLRXVWHUUDFHIDFLQJQRUWK7KHRWKHUWZRURRPVVKDUHDEDOFRQ\ZKLFKLVIRFXVHGRQWKHVRXWKVLGH)ORRUVLQWKHKRXVHDUHPDGHRIDVZHGLVKZRRG,QEDWKURRPVLVXVHGD/DXIHQVVDQLWDU\ DQGWKH\DUHWLOHGZLWK,WDOLDQWLOHV7KHKRXVHKDVZRRGHQZLQGRZV7KHYLOODLVHTXLSSHGZLWKDQDODUPWHOHSKRQHDQGGDWDFDEOHV7KHKRXVHKDVDJDUDJHIRUWZRFDUVLQWKH\DUGDUHPRUHSDUNLQJVSDFHVLQIURQWRI WKHKRXVH7KHYLOODKDVDODUJHJDUGHQZLWKDQDUHDRIVTXDUHPHWHUVZLWKVSHFWDFXODUYLHZVRIWKHFRXQWU\VLGH4XLHWORFDWLRQMXVWPLQXWHVE\WKHPHWUR'HMYLFNi:HUHFRPPHQG\RXWRYLHZWKLVVSHFLDOYLOOD ǔȅDZǾDZǽǺǮǼDZǸDZǹǹǺDZDzǴǷȈDZǽȁǺǼǺȄǴǸǰǺǽǾǿǻǺǸǶȂDZǹǾǼǿǯǺǼǺǰǬǹǺǮdzDZǷDZǹǺǸǸDZǽǾDZǴǼȋǰǺǸǽǻǼǴǼǺǰǺǵ"ǙDZǿǻǿǽǾǴǾDZǴǽǶǷȊȃǴǾDZǷȈǹǺDZǻǼDZǰǷǺDzDZǹǴDZǼǺǽǶǺȄǹǺǵǮǴǷǷȇǶǺǾǺǼǬȋǻǼDZǰǺǽǾǬǮǴǾǮǬǸǼǺǽǶǺȄǹǺDZ DzǴǷȈDZ ǙǬ ǻDZǼǮǺǸ ȉǾǬDzDZ ǻǼǺǽǾǺǼǹǬȋ ǯǺǽǾǴǹǬȋ ǽ ǽǺǮǼDZǸDZǹǹǺǵ ǹDZǸDZȂǶǺǵ ǶǿȁǹDZǵ Ǵ ǮǽǾǼǺDZǹǹȇǸ ǺǭǺǼǿǰǺǮǬǹǴDZǸ ǸǬǼǶǴ 0LHOH Ǯ ǾǺǸ ȃǴǽǷDZ ǽǺ ǮǽǾǼǺDZǹǹǺǵ ǻǺǽǿǰǺǸǺDZȃǹǺǵ ǸǬȄǴǹǺǵ Ǵ ȁǺǷǺǰǴǷȈǹǴǶǺǸ Ǭ ǾǬǶDzDZ ǻDZǼǮǺǶǷǬǽǽǹǺǵǶǺȀDZǮǬǼǶǺǵǯǺǾǺǮȋȅDZǵǻǼDZǮǺǽȁǺǰǹȇǵǶǺȀDZǎǯǺǽǾǴǹǺǵǹǬȁǺǰǴǾǽȋǰǴdzǬǵǹDZǼǽǶǴǵǶǬǸǴǹ+:$0ǶǺǾǺǼȇǵǽǶǼǬǽǴǾǰǺǷǯǴDZdzǴǸǹǴDZǮDZȃDZǼǬǎǬȄDZǵǽDZǸȈǴǙǬǻDZǼǮǺǸȉǾǬDzDZǰǺǸǬǺǾǰDZǷȈǹȇǵǾǿǬǷDZǾ ǴǶǺǸǹǬǾǬǰǷȋǯǺǽǾDZǵǯǰDZǸǺDzǹǺǽǰDZǷǬǾȈǺǾǰDZǷȈǹǿȊǮǬǹǹǿȊǶǺǸǹǬǾǿǙǬǮǾǺǼǺǵȉǾǬDzǮDZǰDZǾǰDZǼDZǮȋǹǹǬȋǷDZǽǾǹǴȂǬǙǬǮǾǺǼǺǸȉǾǬDzDZǼǬǽǻǺǷǺDzDZǹȇǺǾǰDZǷȈǹȇȁǶǺǸǹǬǾȇǻǼǺǽǾǺǼǹǬȋǮǬǹǹǬȋǶǺǸǹǬǾǬǽǮǬǹǹǺǵ ǰǿȄDZǸǾǿǬǷDZǾǺǸǴǶǷǬǰǺǮǬȋǚǰǹǬǶǺǸǹǬǾǬǴǽǻǺǷȈdzǿDZǾǽȋǶǬǶǯǬǼǰDZǼǺǭǹǬȋǎǾǺǼǬȋǶǺǸǹǬǾǬǴǸDZDZǾǺǾǰDZǷȈǹǿȊǮǬǹǹǿȊǶǺǸǹǬǾǿǽǰǿȄDZǮǺǵǶǬǭǴǹǺǵǴǽǺǭǽǾǮDZǹǹȇǵǮȁǺǰǹǬǻǼǺǽǾǺǼǹǿȊǾDZǼǼǬǽǿǽǮǴǰǺǸǹǬǽDZǮDZǼ ǐǮDZǰǼǿǯǴȁǶǺǸǹǬǾȇǴǸDZȊǾǽǺǮǸDZǽǾǹȇǵǭǬǷǶǺǹǺǼǴDZǹǾǴǼǺǮǬǹǹȇǵǹǬȊDzǹǿȊǽǾǺǼǺǹǿǎǰǺǸDZȄǮDZǰǽǶǴǵǰDZǼDZǮȋǹǹȇǵǻǺǷǮǮǬǹǹȇȁǽǬǹǾDZȁǺǭǺǼǿǰǺǮǬǹǴDZ/DXIHQǴǾǬǷȈȋǹǽǶǬȋǻǷǴǾǶǬǴǺǭǷǴȂǺǮǶǬǰDZǼDZǮȋǹǹȇDZ ǺǶǹǬǐǺǸǺǭǺǼǿǰǺǮǬǹǽǴǽǾDZǸǺǵǽǴǯǹǬǷǴdzǬȂǴǴǾDZǷDZȀǺǹǺǸǴǴǹȀǺǼǸǬȂǴǺǹǹȇǸǴǶǬǭDZǷȋǸǴǎǰǺǸDZǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇǮǺǰǮǺǼDZDZȅDZǻǬǼǶǺǮǺȃǹȇȁǸDZǽǾǬǖǰǺǸǿǺǾǹǺǽǴǾǽȋǭǺǷȈȄǺǵǽǬǰǻǷǺȅǬǰȈȊǸ ǽǻǼDZǶǼǬǽǹȇǸǮǴǰǺǸǹǬǻǼǴǼǺǰǿǞǴȁǺDZǸDZǽǾǺǮǽDZǯǺǮǸǴǹǿǾǬȁǹǬǸDZǾǼǺǐDZǵǮǴȂǶǬǚǭȋdzǬǾDZǷȈǹǺǼDZǶǺǸDZǹǰǿDZǸǻǺǽǸǺǾǼDZǾȈǰǺǸ

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF]

)$5$21UHDOLW\VUR3ROVN¾3UDKDWHOLQIR#IDUDRQF] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

63


&=(&+*$6752120<

CelostĂĄtnĂ­ soutÄ&#x203A;Ĺž Czech Gastronomy Awards je pĹ&#x2122;ehlĂ­dkou nejlepĹĄĂ­ch gastronomickĂ˝ch zaĹ&#x2122;Ă­zenĂ­ v Ä&#x152;eskĂŠ republice. Za cĂ­l si klade zmapovat souÄ?asnĂ˝ stav a kvalitu nabĂ­zenĂ˝ch sluĹžeb a vĹĄech aspektĹŻ, kterĂŠ ovlivĹ&#x2C6;ujĂ­ koneÄ?nĂ˝ kulinĂĄĹ&#x2122;skĂ˝ zĂĄĹžitek. SlavnostnĂ­ vyhlĂĄĹĄenĂ­ a pĹ&#x2122;edĂĄnĂ­ prestiĹžnĂ­ch cen probÄ&#x203A;hne dne 13.12. 2012 v Praze pĹ&#x2122;i pĹ&#x2122;Ă­leĹžitosti galaveÄ?era Czech Gastronomy Awards.

E-mail: info@conventia.cz / Tel.: +420 220 515 102 KATEGORIE: Restaurace roku CelkovĂ˝ vĂ­tÄ&#x203A;z â&#x20AC;˘ NejlepĹĄĂ­ obsluha â&#x20AC;˘ InteriĂŠr roku â&#x20AC;˘ Menu roku

2012

2012

2012

2012

RESTAURACE ROKU

RESTAURACE ROKU

RESTAURACE ROKU

RESTAURACE ROKU

absolutnĂ­ vĂ­tÄ&#x203A;z abs z

VĂ?TÄ&#x161;Z KATEGORIE VĂ?T E

VĂ?TÄ&#x161;Z KATEGORIE VĂ?T E

VĂ?TÄ&#x161;Z KATEGORIE VĂ?T E

NEJLEPĹ Ă? OBSLUHA NEJ

NEJLEPĹ Ă? OBSLUHA NEJ

INTERIĂ&#x2030;R ROKU IN

MENU ROKU M

TOP 10 KavĂĄren â&#x20AC;˘ CukrĂĄren â&#x20AC;˘ BarĹŻ â&#x20AC;˘ VinĂĄren

top 10

top 10

top 10

top 10

2012

2012

2012

2012

VINĂ RNA ROKU

BAR ROKU

CUKRĂ RNA ROKU

KAVĂ RNA ROKU KAVĂ RNA ROKU v regionu

*HQHUiOQtSDUWQHU

3DUWQHU

&RQYHQWLDVUR9iFODYNRYD3UDKD7HO)D[,á',áZZZFRQYHQWLDF]


3URGHM/LERP\äOX%HURXQDPSR]HPHNP.ÿ 6DOH/LERP\äOX%HURXQDPSORWP&=. ǛǼǺǰǬDzǴ/LERP\äOǺǶǺǷǺ%HURXQǸSR]HPHNP&=.

1t]NRHQHUJHWLFNëURGLQQëGŢPNNVYëNRQQëPWHSHOQëPÿHUSDGOHPSDUFHODPVSDUNRYiQtP/LERP\äOX%HURXQD1t]NRHQHUJHWLFNëYHONëOX[XVQtURGLQQëGŢPNNRXæLWQpSORäHPMHSRVWDYHQë QDSUDYLGHOQpURYLQQpDVOXQQpSDUFHOHPYPDOHEQpNUDMLQĚYREFL/LERP\äOX%HURXQD1DYëVWDYEXE\O\SRXæLWpSUYRWŐtGQtSŐtURGQtPDWHULiO\NUiVQiOHäWĚQiLQGLFNiæXODGŐHYĚQpSRGODK\GHVLJQRYi NHUDPLNDDPR]DLNDYHIHNWQtFKRGVWtQHFK=QDÿNRYpWHSHOQpÿHUSDGOR]DMLäŘXMHWHSORDWHSORXYRGXYGRPĚVPLQLPiOQtPLQiNODG\3UDYëNUEXPRFQtLG\OLFNRXURGLQQRXSRKRGX2EëYDFtSRNRMMtGHOQDLRSUDYGX NUiVQiSOQĚY\EDYHQiNXFK\ŁVNiOLQNDMVRXSURSRMHQ\IUDQFRX]VNëPLRNQ\VWHUDVRXDVOXQQRX]DKUDGRX)UDQFRX]VNiRNQD]ORæQLFYHGRXQDEDONyQ]HNWHUpKRMHNUiVQëYëKOHGGRRNROQtNUDMLQ\.UiVQiÿLVWi SŐtURGD]DOHVQĚQpNRSFHSURWpNDMtFtŐtÿND/LWDYNDUiPXMtRNROtVFLWHPSRVWDYHQëFKURGLQQëFKGRPŢ'ŢPPiPQRKR~ORæQëFKSURVWRUäDWQXNRPRUXRGGĚOHQRXSUiGHOQX6DPR]ŐHMPRVWtMVRXNDEHORYpUR]YRG\ SURWHOHYL]LWHOHIRQLLQWHUQHW9\EDYHQRVWREFHDYëERUQpGRSUDYQtVSRMHQtSR'GR3UDK\LGR3O]QĚDSŐLWRPQiGKHUQiSŐtURGDNROHPMHXUÿHQDSURW\NWHUëP]iOHætQD]GUDYpPE\GOHQt /RZHQHUJ\KRXVHNNZLWKDSRZHUIXOKHDWSXPSSORWPSDUNLQJLQWKHYLOODJH/LERP\äOQHDU%HURXQ/RZHQHUJ\VSDFLRXVOX[XU\IDPLO\KRXVHNNZLWKÁRRUDUHDRIPLVEXLOWRQWKH UHJXODUÁDWDQGVXQQ\SORWRIPLQWKHSLFWXUHVTXHFRXQWU\VLGHLQWKHYLOODJH/LERP\äOQHDU%HURXQ7KHUHZHUHXVHGÀUVWFODVVQDWXUDOPDWHULDOVEHDXWLIXOSROLVKHG,QGLDQJUDQLWHZRRGÁRRUVFHUD PLFDQGPRVDLFGHVLJQLQVSHFWDFXODUVKDGHVLQWKHKRXVH%UDQGHGKHDWSXPSSURYLGHVKHDWDQGKRWZDWHULQWKHKRXVHZLWKPLQLPDOFRVW7KHÀUHSODFHHQKDQFHVWKHLG\OOLFIDPLO\FRPIRUW/LYLQJURRP GLQLQJURRPDQGUHDOO\EHDXWLIXOIXOO\HTXLSSHGNLWFKHQDUHOLQNHGZLWK)UHQFKZLQGRZVDQGDVXQQ\SDWLRJDUGHQ)UHQFKZLQGRZVOHDGIURPWKHEHGURRPWRWKHEDOFRQ\ZKLFKKDVDEHDXWLIXOYLHZRYHU WKHVXUURXQGLQJFRXQWU\VLGHEHDXWLIXOSXUHQDWXUHIRUHVWHGKLOOVÁRZLQJULYHU7KHKRXVHKDVDORWRIVWRUDJHVSDFHFORDNURRPVWRUHURRPVHSDUDWHODXQGU\URRPFDEOHGLVWULEXWLRQV\VWHPVIRUWHOHYLVLRQ WHOHSKRQHDQGLQWHUQHW3XEOLFIDFLOLWLHVDQGH[FHOOHQWWUDQVSRUWWR3UDJXHRUWR3LOVHQDQG\HWEHDXWLIXOQDWXUHDURXQGLVIRUWKRVHZKRFDUHDERXWKHDOWK\OLYLQJ ǙǴdzǶǺȉǹDZǼǯDZǾǴȃDZǽǶǴǵǼǺǽǶǺȄǹȇǵǽDZǸDZǵǹȇǵǶǺǾǾDZǰDzǶǶǽDzǴǷǺǵǻǷǺȅǬǰȈȊǸǻǺǽǾǼǺDZǹǹǬǻǷǺǽǶǺǸǴǽǺǷǹDZȃǹǺǸǿȃǬǽǾǶDZǸǻǼǬǮǴǷȈǹǺǵȀǺǼǸȇǮDzǴǮǺǻǴǽǹǺǵǸDZǽǾǹǺǽǾǴǮǻǺǽDZǷǶDZ ǗǴǭǺǸȇȄǷǿǍDZǼǺǿǹǬǐǷȋǽǾǼǺǴǾDZǷȈǽǾǮǬǭȇǷǴǴǽǻǺǷȈdzǺǮǬǹȇǮȇǽǺǶǺǶǬȃDZǽǾǮDZǹǹȇDZǹǬǾǿǼǬǷȈǹȇDZǸǬǾDZǼǴǬǷȇǶǼǬǽǴǮȇǵǻǺǷǴǼǺǮǬǹǹȇǵǴǹǰǴǵǽǶǴǵǯǼǬǹǴǾǰDZǼDZǮȋǹǹȇDZǻǺǷȇǰǴdzǬǵǹDZǼǽǶǬȋǶDZǼǬǸǴǶǬ ǴǸǺdzǬǴǶǬȉȀȀDZǶǾǹȇȁǺǾǾDZǹǶǺǮǞDZǻǷǺǮǺǵǹǬǽǺǽǴdzǮDZǽǾǹǺǵǸǬǼǶǴǽǸǴǹǴǸǬǷȈǹȇǸǴdzǬǾǼǬǾǬǸǴǺǭDZǽǻDZȃǴǮǬDZǾǾDZǻǷǺǴǯǺǼȋȃǿȊǮǺǰǿǮǰǺǸDZǙǬǽǾǺȋȅǴǵǶǬǸǴǹǽǺdzǰǬDZǾǽDZǸDZǵǹǿȊǴǰǴǷǷǴȃDZǽǶǿȊ ǬǾǸǺǽȀDZǼǿǏǺǽǾǴǹǬȋǽǾǺǷǺǮǬȋǴǺȃDZǹȈǶǼǬǽǴǮǬȋǻǺǷǹǺǽǾȈȊǺǭǺǼǿǰǺǮǬǹǹǬȋǶǿȁǹȋǽǺDZǰǴǹDZǹȇȀǼǬǹȂǿdzǽǶǴǸǴǺǶǹǬǸǴǽǾDZǼǼǬǽǺǵǴǽǬǰǺǸǠǼǬǹȂǿdzǽǶǴDZǺǶǹǬǴdzǽǻǬǷDZǹǮDZǰǿǾǹǬǭǬǷǶǺǹǽǶǺǾǺǼǺǯǺ ǺǾǶǼȇǮǬDZǾǽȋ ǻǼDZǶǼǬǽǹȇǵ ǮǴǰ ǹǬ ǺǶǼǿDzǬȊȅǴǵ ǷǬǹǰȄǬȀǾ ǖǼǬǽǴǮǬȋ ȃǴǽǾǬȋ ǻǼǴǼǺǰǬ ǷDZǽǴǽǾȇDZ ȁǺǷǸȇ ǻǼǺǾDZǶǬȊȅǬȋ ǼDZȃǶǬ ǗǴǾǬǮǶǬ ǺǭǼǬǸǷȋȊǾ ǺǶǼDZǽǾǹǺǽǾǴ ǽǺ ǮǶǿǽǺǸ ǻǺǽǾǼǺDZǹǹȇȁ ǽDZǸDZǵǹȇȁ ǶǺǾǾDZǰDzDZǵǎǰǺǸDZDZǽǾȈǸǹǺǯǺǸDZǽǾǰǷȋȁǼǬǹDZǹǴȋǯǬǼǰDZǼǺǭǶǷǬǰǺǮǶǬǺǾǰDZǷȈǹǬȋǻǼǬȃDZȃǹǬȋǜǬdzǿǸDZDZǾǽȋDZǽǾȈǶǬǭDZǷȈǹȇDZǽDZǾǴǰǷȋǾDZǷDZǮǴǰDZǹǴȋǾDZǷDZȀǺǹǬǴǔǹǾDZǼǹDZǾǬǚǾǷǴȃǹǬȋǴǹȀǼǬǽǾǼǿǶǾǿǼǬǴ ǻǼDZǶǼǬǽǹǺDZǾǼǬǹǽǻǺǼǾǹǺDZǽǺǺǭȅDZǹǴDZǻǺǾǼǬǽǽDZ'ǰǺǛǼǬǯǴǴǛǷȈdzDZǹǴǻǼǴǾǺǸǮǺǶǼǿǯȃǴǽǾǬȋǻǼǴǼǺǰǬǰǷȋǾDZȁǶǾǺdzǬǭǺǾǴǾǽȋǺdzǰǺǼǺǮǺǸǺǭǼǬdzDZDzǴdzǹǴ

)RUFRPSOHWHSRUWIROLRRUUHDOHVWDWHVYLVLWZZZIDUDRQF]

)$5$21UHDOLW\VUR3ROVN¾3UDKDWHOLQIR#IDUDRQF] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

65


Všehrdova, Praha 1 - Malá Strana

Romantický byt na Kampě je rozložen ve dvou podlažích a svým charakterem se jedná o bydlení v historickém domě z roku 1786 s menší zahradou. Výška stropů a přiznané trámoví zaručují vzdušnost a originalitu prostoru, přiléhající zahrada zase různé možnosti využití či relaxace. Spodní patro je věnované společenskému zázemí s prostornou kuchyní, navazující jídelnou a obývacím pokojem s funkčním krbem. Horní patro je privátní. Orientace do tří světových stran zaručuje dostatek oslunění ve všech místnostech. A light and spacious romantic apartment full of original character and charm. Comprising two floors of this historical house dating from 1786. The apartment features high ceilings a bijou garden. The lower floor is devoted to social facilities with a spacious kitchen, drawing dining and living room with an open fireplace. Upper floor is dedicated to private purposes - two bedrooms and shower. The orientation of the three cardinal points provides adequate sunlight in all rooms.

Cena: / Price: 27 900 000 CZK Ceny jsou uvedeny včetně DPH. The prices indicated are inclusive of VAT

66

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

LEXXUS a.s., Millennium Plaza, V Celnici 10, 110 00 Praha 1 tel.: +420 221 111 922, www.lexxusnorton.cz, e-mail: info@lexxusnorton.cz


Janáčkovo nábřeží, Praha 5 - Smíchov

Byt 4+1 (198 m2) + balkon (11 m2), ve 3. patře neorenesančního domu po kompl. rekonstrukci, s panoramatickým výhledem na Vltavu a Prahu. Dubové dveře a parkety ve tvaru vídeňského kříže, kuchyňská linka zn. Pogenpohl se spotřebiči Gaggenau, nábytek zn. Baker, alarm, 24 hod. ostraha, podíl na zahradě, sklep a 2 garážová stání. Komfortní bydlení v blízkosti Národního Divadla a Kampy. Three-bedroom apartment (198 sqm) + 11 sqm balcony on the 3rd floor of neo-renaissance building after complete reconstruction. Panoramic view to Prague and Vltava river. Oak doors and parquet with Viennese cross motif, kitchen unit Pogenpohl with Gaggenau appliances, furniture by Baker, alarm, 24/7 security, aliquot part of garden, cellar and 2 parking spaces. Luxury living in historical centre; close to the National Theater and Kampa Park.

Info v RK / Info upon request Ceny jsou uvedeny včetně DPH. The prices indicated are inclusive of VAT

LEXXUS a.s., Millennium Plaza, V Celnici 10, 110 00 Praha 1 tel.: +420 221 111 922, www.lexxusnorton.cz, e-mail: info@lexxusnorton.cz






PĹ&#x2122;ihlaste svĹŻj developerskĂ˝ rezidenÄ?nĂ­ projekt do 2. roÄ?nĂ­ku ĂşspÄ&#x203A;ĹĄnĂŠ soutÄ&#x203A;Ĺže! VyhlĂĄĹĄenĂ­ vĂ­tÄ&#x203A;zĹŻ v kaĹždĂŠm kraji Ä&#x152;eskĂŠ republiky.

Tel.: +420 220 515 102

E-mail: info@conventia.cz

REALITNĂ? PROJEKT ROKU 2012 mapuje aktuĂĄlnĂ­ developerskĂŠ rezidenÄ?nĂ­ projekty na ĂşzemĂ­ Ä&#x152;eskĂŠ Republiky. Jeho cĂ­lem je pĹ&#x2122;edstavit veĹ&#x2122;ejnosti novĂŠ projekty rezidenÄ?nĂ­ho bydlenĂ­. VĂ­tÄ&#x203A;zi bude poskytnuto oznaÄ?enĂ­ â&#x20AC;&#x17E;REALITNĂ? PROJEKT ROKU 2012â&#x20AC;&#x153;. SlavnostnĂ­ vyhlĂĄĹĄenĂ­ vĂ­tÄ&#x203A;znĂ˝ch projektĹŻ a pĹ&#x2122;edĂĄnĂ­ prestiĹžnĂ­ch cen probÄ&#x203A;hne dne 25. 10. 2012 v Praze.

*HQHUiOQtSDUWQHU

0HGLiOQtSDUWQHU

&RQYHQWLDVUR9iFODYNRYD3UDKD7HO)D[,á',áZZZFRQYHQWLDF]


Kesnerka Living, Praha 5 - Košíře

Kesnerka Living nabízí kvalitní bydlení v reprezentativním domě s celkovým počtem 9 bytů. Dům se vznáší nad svahem a jeho skleněná fasáda umožňuje nádherný výhled na Prahu. Dispozice bytů ve třetím podlaží je flexibilní a umožňuje propojení bytů do originálně a velkoryse řešených celků. Každý byt má velkou terasu, garážové stání a sklep. Kesnerka Living offers high quality living in a representative and exclusive modern residence that comprises only 9 apartments. The building appears to float above the slope, its dominant glass façade commands beautiful views over Prague. In addition, the layout of the upper level apartments is flexible and can be tailored to the buyer’s specifications. Each apartment boasts a large terrace, underground garage and cellar, the internal design is thoughtfully conceived and arranged to ensure the optimal quality of living.

Ceny od: / Prices from: 6 074 467 CZK Ceny jsou uvedeny včetně DPH. The prices indicated are inclusive of VAT

LEXXUS a.s., Millennium Plaza, V Celnici 10, 110 00 Praha 1 tel.: +420 221 111 922, www.lexxusnorton.cz, e-mail: info@lexxusnorton.cz


TIDE REALITY s. r. o.

I

Pavel Velebil

I

Mobile: 602 269 011

I

Email: prodej@tide.cz

È·¾·ʻƑÈ·ÄċÁƑË¿¹»ź¿Äžȷº»ÃƭÈ·½Ë»ʻƯÈ·ÄċÁƑź¿Äžȷº»ÃÉÊÈ»»Êƭ ȤəɉɌɉʻƖȖəɉɖɑɓƑɜɔƔź¿Äžȷº»Ã 3ORFKDPWHUDVDP ORæQLFH *DUiæRYpVWiQt

,QQHUDUHDPWHUUDFHP EHGURRP &DUSDUNLQXQGHUJURXQGSDUNLQJ

ǛǷǺȅǬǰȈǸǾDZǼǼǬǽǬǸ ǽǻǬǷȈǹȋ ǯǬǼǬDz

.ÿ

&=.

ǶǼǺǹ

3URGHMVYĚWOpKRE\WXNNVWHUDVRXYQRYRVWDYEĚNRPRUQtKRE\WRYpKRGRPXYNOLGQpXOLFLQDG%UDQLFNëPGLYDGOHP%\WYHSRGODætVWHUDVRXD äDWQRXVDPRVWDWQpY\WiSĚQt SO\QRYëNRWHO EH]IDOFRYpGYHŐHWŐtYUVWYpGŐHYĚQpSRGODK\ %UDQGQHZDSDUWPHQWLQTXLHWORFDWLRQDW3UDJXH%UDQtN1HZO\ÀQLVKHGEXLOGLQJFRPSULVHVDSDUWPHQWV+LJKTXDOLW\ÀQLVKHVRIDSDUWPHQWV DQGFRPPRQDUHDVVHFXUHXQGHUJURXQGSDUNLQJ2QHEHGURRPDSDUWPHQWRQUGÁRRUKDVEHDXWLIXOWHUUDFHZLWKZRRGHQGHFNLQJ

ǛǼǺǰǬDzǬǽǮDZǾǷǺǵǶǮǬǼǾǴǼȇǶǶǽǾDZǼǼǬǽǺǵǮǹǺǮǺǽǾǼǺǵǶDZDzǴǷǺǯǺǰǺǸǬǶǬǸDZǼǹǺǯǺǾǴǻǬǹǬǾǴȁǺǵǿǷǴȂDZǹǬǰǾDZǬǾǼǺǸǍǼǬǹǴǶǖǮǬǼǾǴǼǬ ǹǬȁǺǰǴǾǽȋǹǬǸȉǾǬDzDZǾDZǼǼǬǽǬǯǬǼǰDZǼǺǭǺǾǰDZǷȈǹǺDZǺǾǺǻǷDZǹǴDZ ǯǬdzǺǮȇǵǶǺǾDZǷ ǭDZdzȀǬǷȈȂDZǮȇDZǰǮDZǼǴǾǼDZȁǽǷǺǵǹȇDZǰDZǼDZǮȋǹǹȇDZǻǺǷȇ 70

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


TIDE REALITY s. r. o.

I

Pavel Velebil

I

Mobile: 602 269 011

I

Email: prodej@tide.cz

ÒÄÉÁšº»É¿½ÄÌì»ÉÁš¹¾¾ÅÈÒ¹¾ƑÈËŀÄó¾ÅÈÏƭ·Ä¿É¾º»É¿½Ä·Êл¹¾ÃÅËÄÊ·¿ÄÉƑÈËŀÄóÃÅËÄÊ·¿ÄÉƭ șɉɛɚɓɑɒɍɑɐɉɒɖɋɠɎɡɚɓɑɞɌɗəɉɞƑÈËŀÄó ÅÈÏ ŏDGRYëGRPHNQDKRUiFK 3ORFKDPWHUDVDP ORæQLFHSDUNRYDFtVWiQt

,QQHUDUHDPPWHUUDFH EHGURRPV 6HFXUHSDUNLQJ

ǐǺǸǮǼȋǰǺǮǺǵdzǬǽǾǼǺǵǶDZǮǯǺǼǬȁ ǛǷǺȅǬǰȈǸǾDZǼǼǬǽǬǸ ǽǻǬǷȈǹǴǻǬǼǶǺǮǺȃǹǺDZǸDZǽǾǺ

.ÿ

&=.

ǶǼǺǹ

ŏDGRYëGRPHN]HWDS\YëVWDYE\DUHiOX.OtQRYHF0HDGRZV9ëMLPHÿQëKRUVNëSURMHNWPHWUŢRGVMH]GRYHNVQiGKHUQëPLYëKOHG\QD.OtQRYHFD 2EHUZLHVHQWKDO.RQFHSFHSURMHNWXVUHFHSFtDUR]ViKOëPLSR]HPN\RENORSXMtFtPLGRP\MHSUR]DWtPYþHVNXRMHGLQĚOi 1HZEXLOWEHGURRPFKDOHWDW.OLQRYHFQGSKDVHRIH[FHSWLRQDOSURMHFWZLWK6FDQGLQDYLDQGHVLJQPHWUHVIURPWKHVNLVORSHV7KHQHZGHYHORS PHQWRIIHUVURXQGWKH\HDUYDFDWLRQDWWUDFWLRQVLQSRSXODU&]HFKPRXQWDLQVQHDU.DUORY\9DU\DQG2EHUZLHVHQWKDOO ǙDZǰǬǮǹǺǻǺǽǾǼǺDZǹǹȇǵǰǮǿȁǶǺǸǹǬǾǹȇǵǰǺǸǴǶǮǺdzǷDZǖǷǴǹǺǮȂǬǛǼǺDZǶǾǽǿǹǴǶǬǷȈǹȇǸǽǶǬǹǰǴǹǬǮǽǶǴǸǰǴdzǬǵǹǺǸǹǬȁǺǰǴǾǽȋǹǬǮǾǺǼǺǸȉǾǬǻDZǰǺǸ ǼǬǽǻǺǷǺDzDZǹǮǸDZǾǼǬȁǺǾǯǺǼǹǺǷȇDzǹȇȁǽǶǷǺǹǺǮǙǺǮǺǽǾǼǺǵǶǬǶǼǿǯǷǺǯǺǰǴȃǹǺǺǭDZǽǻDZȃǴǾǼǬdzǹȇDZǮǴǰȇǺǾǰȇȁǬǮȃDZȄǽǶǴȁǯǺǼǬȁǹDZǰǬǷDZǶǺǺǾ ǻǺǻǿǷȋǼǹȇȁǶǿǼǺǼǾǺǮǖǬǼǷǺǮȇǎǬǼȇǴǚǭDZǼǮǴdzDZǹǾǬǷȈ 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

71


PRODEJ • HOTEL PRAHA 1 Ǜǜǚǐnjǒnj•ǚǞǑǗǨǛǜnjǏnj %RXWLTXH'HVLJQDQG6W\OH+RWHOQDEt]tQHMY\äätOX[XVXE\WRYiQtYSRNRMtFKYEOt]NRVWL3UDæVNpKR+UDGX+LVWRULFNRXEXGRYX]HVWROHWt]GREtYëKUDGQĚQHMNYDOLWQĚMätPD WHULiO\DSUiFHäSLÿNRYëFKDUFKLWHNWŢDGHVLJQHUŢ+RWHOOHætYSĚätY]GiOHQRVWLRGQHM]QiPĚMätFKSDPiWHN.DUOŢYPRVW6WDURPĚVWVNpQiPĚVWt1RYp0ĚVWRD9iFODYVNpQiPĚVWt %RXWLTXH'HVLJQDQG6W\OH+RWHORIIHUVWKHXOWLPDWHOX[XU\DFFRPPRGDWLRQLQURRPVFORVHWR3UDJXH&DVWOH7KHKLVWRULFEXLOGLQJIURPWKHWKFHQWXU\GHFRUDWHGZLWKRQO\ WKHKLJKHVWTXDOLW\PDWHULDOVDQGWKHZRUNRIWRSDUFKLWHFWVDQGGHVLJQHUV7KHKRWHOLVZLWKLQZDONLQJGLVWDQFHIURPWKHPRVWIDPRXV3UDJXHSODFHV&KDUOHV%ULGJH2OG7RZQ 6TXDUH2OG7RZQDQG:HQFHVODV6TXDUH

ǚǾDZǷȈǾǴǻǬ©%RXWLTXH'HVLJQDQG6W\OH+RWHOªǻǼDZǰǷǬǯǬDZǾǽǬǸȇDZǼǺǽǶǺȄǹȇDZǹǺǸDZǼǬ ǶǺǸǹǬǾ ǹDZǰǬǷDZǶǺǺǾǛǼǬDzǽǶǺǯǺǏǼǬǰǬǔǽǾǺǼǴȃDZǽǶǺDZdzǰǬǹǴDZǻǺǽǾǼǺǵǶǴ ǯǺǮDZǶǬǿǶǼǬȄǬȊǾǾǺǷȈǶǺǷǿȃȄǴDZǸǬǾDZǼǴǬǷȇǴǼǬǭǺǾȇǽǬǸȇȁǴdzǮDZǽǾǹȇȁǬǼȁǴǾDZǶǾǺǼǺǮǴǰǴdzǬǵǹDZǼǺǮǚǾDZǷȈǹǬȁǺǰǴǾǽȋǮǹDZǽǶǺǷȈǶǴȁǸǴǹǿǾǬȁȁǺǰȈǭȇǺǾ ǽǬǸȇȁǴdzǮDZǽǾǹȇȁǻǬǸȋǾǹǴǶǺǮǖǬǼǷǺǮǸǺǽǾǝǾǬǼǺǸDZǽǾǽǶǬȋǻǷǺȅǬǰȈǝǾǬǼȇǵǯǺǼǺǰǴǎǬȂǷǬǮǽǶǬȋǻǷǺȅǬǰȈ


PRODEJ • Špičkový **** hotel • PRAHA 1 Ǜǜǚǐnjǒnj•ǛǑǜǎǚǖǗnjǝǝǙǧǕǚǞǑǗǨ •ǛǜnjǏnj 1DEt]tPHNSURGHML'HVLJQDQG6W\OH+RWHOSRVN\WXMtFtOX[XVQtXE\WRYiQtNWHUëVHQDFKi]tQD0DOp6WUDQĚY3UD]H+LVWRULFNRXEXGRYX]URNX]GREtYëKUDGQĚ QHMNYDOLWQĚMätPDWHULiO\]GtOQ\äSLÿNRYëFKDUFKLWHNWŢDGHVLJQHUŢ+RWHOOHætYSĚätY]GiOHQRVWLRGQHM]QiPĚMätFKSDPiWHN.DUOŢYPRVW6WDURPĚVWVNpQiPĚVWt1RYp 0ĚVWRD9iFODYVNpQiPĚVWt )RUVDOH'HVLJQDQG6W\OH+RWHORIIHULQJOX[XU\DFFRPPRGDWLRQORFDWHGLQ0DOD6WUDQD3UDJXH7KHKLVWRULFDOEXLOGLQJEXLOWLQGHFRUDWHGH[FOXVLYHO\WKHEHVW PDWHULDOVIURPWKHZRUNVKRSRIOHDGLQJDUFKLWHFWVDQGGHVLJQHUV7KHKRWHOLVZLWKLQZDONLQJGLVWDQFHIURPWKHPRVWIDPRXVPRQXPHQWV&KDUOHV%ULGJH2OG7RZQ 6TXDUH2OG7RZQDQG:HQFHVODV6TXDUH ǛǼDZǰǷǬǯǬDZǸǹǬǻǼǺǰǬDzǿǺǾDZǷȈǾǴǻǬ©'HVLJQDQG6W\OHªǽǼǺǽǶǺȄǹȇǸǴǹǺǸDZǼǬǸǴǼǬǽǻǺǷǺDzDZǹǹȇǵǮǼǬǵǺǹDZǘǬǷǬǝǾǼǬǹǬǮǛǼǬǯDZǔǽǾǺǼǴȃDZǽǶǺDZdzǰǬǹǴDZ ǻǺǽǾǼǺDZǹǹǺDZǮǯǺǰǿǿǶǼǬȄǬȊǾǽǬǸȇDZǷǿȃȄǴDZǴǶǬȃDZǽǾǮDZǹǹȇDZǸǬǾDZǼǴǬǷȇǴdzǸǬǽǾDZǼǽǶǴȁǮDZǰǿȅǴȁǬǼȁǴǾDZǶǾǺǼǺǮǴǰǴdzǬǵǹDZǼǺǮǚǾDZǷȈǹǬȁǺǰǴǾǽȋǮ ǹDZǽǶǺǷȈǶǴȁǸǴǹǿǾǬȁȁǺǰȈǭȇǺǾǽǬǸȇȁǴdzǮDZǽǾǹȇȁǻǬǸȋǾǹǴǶǺǮǖǬǼǷǺǮǸǺǽǾǝǾǬǼǺǸDZǽǾǽǶǬȋǻǷǺȅǬǰȈǙǺǮȇǵǯǺǼǺǰǴǎǬȂǷǬǮǽǶǬȋǻǷǺȅǬǰȈ


PRODEJ • PODNIKATELSKY ÚSPĚŠNÝ HOTEL V KRKONOŠÍCH • KRKONOŠE Ǜǜǚǐnjǒnj•ǟǝǛǑǤǙǧǕǍǔǓǙǑǝǚǞǑǗǨǎǏǚǜnjǡǖǜǖǚǙǚǤǑ•ǖǜǖǚǙǚǤǑ 9HOPL]DMtPDYëKRWHO²SHQVLRQYHOPLGREŐHSURYR]RYDQëDSRGQLNDWHOVN\~VSĚäQë1DFKi]tVHNPRGFHQWUD-DQVNëFK/i]Qt&HOp~GROtPiFKDUDNWHUNOLGQĚMätORNDOLW\YNUiVQp SŐtURGĚ.UNRQRäVNpKR1iURGQtKR3DUNXVH]DPĚŐHQtPYOHWQtFKPĚVtFtFKQDWXULVWLNXDF\NORWXULVWLNXDY]LPQtFKPĚVtFtFKQDVMH]GRYpO\æRYiQtDEĚæN\

9HU\LQWHUHVWLQJKRWHOYHU\ZHOOUXQSHQVLRQDQGEXVLQHVVVXFFHVV6LWXDWHGRQO\NPIURPWKHFHQWHURI-iQVNp/i]QĚ7KHHQWLUHYDOOH\KDVDFKDUDFWHURITXLHWORFDWLRQLQWKH EHDXWLIXOFRXQWU\VLGHRI.UNRQRäH1DWLRQDO3DUNZLWKDIRFXVLQWKHVXPPHUPRQWKVIRUKLNLQJDQGELNLQJDQGLQWKHZLQWHUPRQWKVGRZQKLOOVNLLQJDQGFURVVFRXQWU\VNLLQJ

ǛǼDZǰǷǬǯǬDZǸǺȃDZǹȈȁǺǼǺȄǴǵǻDZǹǽǴǺǹ ǯǺǽǾDZǮǺǵǰǺǸ ǽǶǼǬǽǴǮȇǸȀǿǹǶȂǴǺǹǴǼǿȊȅǴǸǴǾǬǷȈȋǹǽǶǴǸǼDZǽǾǺǼǬǹǺǸǴǻǴȂȂDZǼǴDZǵǏǬǽǾǼǺǹǺǸǴȃDZǽǶǺDZǺǭǺǼǿǰǺǮǬǹǴDZ ǼDZǽǾǺǼǬǹǬǺǾǮDZȃǬDZǾǮǽDZǸǽǺǮǼDZǸDZǹǹȇǸǾǼDZǭǺǮǬǹǴȋǸǴǽǾǬǹǰǬǼǾǬǸ+&&3ǛDZǹǽǴǺǹǴǸDZDZǾǻȋǾȈǰǮǿȁǸDZǽǾǹȇȁǴǾǼDZȁǸDZǽǾǹȇȁǹǺǸDZǼǺǮǽǭǬǷǶǺǹǺǸǴǺǰǹǴ ȉǶǽǶǷȊdzǴǮǹȇDZǬǻǬǼǾǬǸDZǹǾȇǔǽǶǷȊȃǴǾDZǷȈǹǺȁǺǼǺȄǬȋǴǹǮDZǽǾǴȂǴȋ


PRODEJ

PENZION SE STYLOVOU RESTAURACÍ

PRAHA

Ǜǜǚǐnjǒnj•ǛǑǙǝǔǚǙǝǚǝǞǔǗǨǙǧǘǜǑǝǞǚǜnjǙǚǘ•ǛǜnjǏnj 1DEt]tPHNSURGHMLYHOPLSĚNQëSHQ]LRQVNUiVQRX]DYHGHQRXLWDOVNRXUHVWDXUDFtDSL]]HULt*DVWURQRPLFNp]DŐt]HQtMHPRGHUQtDRGSRYtGiYäHP VWDQGDUGŢP+&&33HQ]LRQPiSĚWGYRXDWŐtOŢæNRYëFKSRNRMŢVEDONRQHPDMHGHQH[NOX]LYQtDSDUWPiQ0LPRŐiGQiLQYHVWLFH $YHU\QLFHJXHVWKRXVHZLWKEHDXWLIXO HVWDEOLVKHG,WDOLDQUHVWDXUDQWDQGSL]]HULDIRUVDOH*DVWURQRPLFHTXLSPHQWLVPRGHUQDQGFRPSOLHVZLWKDOO+$&&3VWDQGDUGV *XHVWKRXVHKDVÀYHGRXEOHDQGWULSOHURRPVZLWKEDOFRQ\DQGRQHH[FOXVLYHVXLWH([FHOOHQWLQYHVWPHQW ǛǼDZǰǷǬǯǬDZǸǺȃDZǹȈȁǺǼǺȄǴǵǻDZǹǽǴǺǹ ǯǺǽǾDZǮǺǵǰǺǸ ǽǶǼǬǽǴǮȇǸȀǿǹǶȂǴǺǹǴǼǿȊȅǴǸǴǾǬǷȈȋǹǽǶǴǸǼDZǽǾǺǼǬǹǺǸǴǻǴȂȂDZǼǴDZǵǏǬǽǾǼǺǹǺǸǴȃDZǽǶǺDZǺǭǺǼǿǰǺǮǬǹǴDZ ǼDZǽǾǺǼǬǹǬǺǾǮDZȃǬDZǾǮǽDZǸǽǺǮǼDZǸDZǹǹȇǸǾǼDZǭǺǮǬǹǴȋǸǴǽǾǬǹǰǬǼǾǬǸ+&&3ǛDZǹǽǴǺǹǴǸDZDZǾǻȋǾȈǰǮǿȁǸDZǽǾǹȇȁǴǾǼDZȁǸDZǽǾǹȇȁǹǺǸDZǼǺǮǽǭǬǷǶǺǹǺǸǴǺǰǹǴ ȉǶǽǶǷȊdzǴǮǹȇDZǬǻǬǼǾǬǸDZǹǾȇǔǽǶǷȊȃǴǾDZǷȈǹǺȁǺǼǺȄǬȋǴǹǮDZǽǾǴȂǴȋ


3URGHM_3UDKD_2ฤจHFKRYND_P_SR]HPHNP_FHQDQDY\รงiGiQt_SULFHXSRQUHTXHVW 9LODNNWHUDVD]DKUDGDEDONRQ\NUEรฅDWQ\ILWQHVVNXFK\Qฤ™RWHYฤจHQiGLVSR]LFHREรฌYDFtKRSRNRMHDMtGHOQ\ORรงQLFNRXSHOQ\ WRDOHWDSURKRVW\JDUiรงSURYR]\1RYฤ™]UHNRQVWUXRYDQiฤจDGRYiYLODVLWXRYDQiYH[NOX]LYQtUH]LGHQฤ€Qtฤ€WYUWL2ฤจHFKRYNDXPRรงฤžXMtFt GYRXJHQHUDฤ€QtE\GOHQtVGฤฃUD]HPQDVRXGREpSRรงDGDYN\PRGHUQtKRE\GOHQt EHGURRPYLOODWHUUDFHJDUGHQEDOFRQLHVILUHSODFHZDONLQFORVHWVILWQHVVNLWFKHQVRSHQVSDFHOLYLQJDQGGLQLQJDUHD EDWKURRPVKDOIEDWKJDUDJHIRUFDUV1HZO\UHFRQVWUXFWHGWRZQKRXVHORFDWHGLQWKHKHDUWRIWKHH[FOXVLYHDQGKLJKO\VRXJKWDIWHU UHVLGHQWLDOQHLJKERUKRRGRI2ฤจHFKRYND

3URNRPSOHWQtQDEtGNXQDYรฅWLYWH)RUFRPSOHWHSURSHUW\OLVWLQJSOHDVHYLVLW

76

1(-/(3ฤรŒ1(029,7267,,%(673523(57,(6,ว‚วŠวŽวฦถว–ว„ฦปฦบฦธฦฟฦฝฦฟวƒว…วˆว‰ว“

VYRERGDZLOOLDPVFRP


3URGHM_3UDKD_7URMD_P_SR]HPHNP_FHQDQDY\çiGiQt_SULFHXSRQUHTXHVW 9LODNUEED]pQVDXQDWHUDVDYLQQìVNOHSÃ¥DWQ\ORçQLFNRXSHOQ\GXERYpSRGODK\SRGODKRYpWRSHQtYFHOpPGRPÄ&#x2122;1RYRVWDYED URGLQQpYLO\YHYHOPLçiGDQpNOLGQpORNDOLWÄ&#x2122;7URMLYWÄ&#x2122;VQpPVRXVHGVWYtSĨtURGQtUH]HUYDFH9HONi6NiOD EHGURRPYLOODILUHSODFHVZLPPLQJSRROVDXQDWHUUDFHZLQHFHOODUZDONLQFORVHWVEDWKURRPVRDNIORRULQJXQGHUIORRUKHDWLQJ WKURXJKRXWWKHKRXVH1HZO\EXLOWIDPLO\YLOODLQDTXLHWVRXJKWDIWHUORFDWLRQRI7URMDFORVHWRWKH9HONi6NiOD1DWXUH5HVHUYH

1D3HUÃ¥WìQÄ&#x2122;3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

352'(-,6$/(6,Ç&#x2020;Ç&#x2021;Ç&#x2026;ƺƶƻÇ&#x2030;Ç&#x2C6;Ç&#x2013;'8%(1,$35,/,ƶÇ&#x2020;Ç&#x2021;Æ»Ç&#x201A;Ç&#x201C;

77


3URGHM_3UDKD_0DOi6WUDQD_P_FHQDQDY\çiGiQt_SULFHXSRQUHTXHVW 0ęåĢDQVNìGģPY]URVWOi]DKUDGDNUEåDWQDNRXSHOQ\SRNRPSOHWQtUHNRQVWUXNFL]DFKRYiQ\GRERYpSUYN\SDUNRYDFtVWiQt 3ģVRELYìGģP]URNXVLWXRYDQìSiUNURNģRG.DPS\D.DUORYDPRVWX EHGURRPWRZQKRXVHZHOONHSWJDUGHQILUHSODFHZDONLQFORVHWEDWKURRPVDIWHUFRPSOHWHUHFRQVWUXFWLRQRULJLQDOIHDWXUHV SUHVHUYHGSDUNLQJVSDFHV,PSUHVVLYHKRXVHIURPVLWXDWHGMXVWVWHSVIURPWKH.DPSDLVODQGDQGWKH&KDUOHV%ULGJH

3URNRPSOHWQtQDEtGNXQDYåWLYWH)RUFRPSOHWHSURSHUW\OLVWLQJSOHDVHYLVLW

78

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

VYRERGDZLOOLDPVFRP


3URGHM_3UDKD_'HMYLFH_P_]DKUDGDP_.ฤ€ 9LODNNNUEWHUDVDVDXQDรฅDWQ\ORรงQLFHNRXSHOQ\JDUiรงSURYR]ฤฃGฤจHYฤ™QpSRGODK\EH]SHฤ€QRVWQtรงDOX]LH1RYฤ™SRVWDYHQi WฤจtSRGODรงQtYLOD VRXฤ€iVWGYRMYLO\ VLWXRYDQiYNOLGQpPSURVWฤจHGtSฤจtURGQtUH]HUYDFH7LFKiรคiUNDVGREUรฌPGRSUDYQtPVSRMHQtPGRFHQWUD LQDOHWLรฅWฤ™ EHGURRPYLOODILUHSODFHWHUUDFHVDXQDZDONLQFORVHWVEDWKURRPVJDUDJHIRUFDUVZRRGHQIORRUVVHFXULW\EOLQGV%UDQGQHZ WKUHHVWRU\VHPLGHWDFKHGYLOODLQDTXLHWDUHDRI7LFKiรคiUNDQDWXUHSUHVHUYHRIIHULQJWKHFRQYHQLHQFHVRIWKHFLW\DVZHOODVWKHSOHDVXUHV RIWKHFRXQWU\VLGH

1D3HUรฅWรฌQฤ™3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

352'(-,6$/(6,ว†ว‡ว…ฦบฦถฦปว‰วˆว–'8%(1,$35,/,ฦถว†ว‡ฦปว‚ว“

79


3URGHM_3UDKD_0DOi6WUDQD_P_FHQDQDY\çiGiQt_SULFHXSRQUHTXHVW 0ęåĢDQVNìGģPFHQWUiOQtGYģUEDURNQtSUYN\NRPELQDFHKLVWRULFN\FKUiQęQìFKĀiVWtREMHNWXDLQGXVWULiOQtFKSURVWRUVSDYODĀtNWHUp QHMVRXSĨHGPęWHPSDPiWNRYpSpĀH,QYHVWLĀQtSĨtOHçLWRVWVYDULDELOQtPPRGHOHPEXGRXFtKRY\XçLWtLSRGRE\SURVWRUPLQXWRG.DPS\ D.DUORYDPRVWXSĨHVWRVWUDQRXRGUXåQìFKXOLĀHNDWXULVWLFNìFKWUDV %XUJKHU·VKRXVHFHQWUDOFRXUWEDURTXHIHDWXUHVFRPELQDWLRQRIKLVWRULFDOO\SURWHFWHGSDUWVRIWKHEXLOGLQJDQGLQGXVWULDOVSDFHV QRWSDUWRIWKHFRQVHUYDWLRQ 8QLTXHLQYHVWPHQWRSSRUWXQLW\ZLWKDYDULDEOHPRGHOIRUIXWXUHXVHVRIVSDFHVDPLQXWHZDONWR &KDUOHV%ULGJHDQGWKH.DPSDLVODQGRXWRIWKHEXV\VWUHHWVDQGWRXULVWQRLVH

3URNRPSOHWQtQDEtGNXQDYåWLYWH)RUFRPSOHWHSURSHUW\OLVWLQJSOHDVHYLVLW

80

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

VYRERGDZLOOLDPVFRP


3URGHM_8QKRåĢ_1RX]RY_P_SR]HPHNP_.Ā 9LODNN]DKUDGDPOHVQtSR]HPHNPDEVROXWQtVRXNURPtLGHiOQtRULHQWDFHQDMLKDYìFKRG]DKUDGQtGRPHNJDUiçSUR YR]\SDUNRYiQtQDSR]HPNXSURYR]ģ3UYRUHSXEOLNRYiYLODLQVSLURYDQiKROO\ZRRGVNìPLKDFLHQGDPLVQiGKHUQìPYHOPLUR]ViKOìP SR]HPNHPSĨHFKi]HMtFtPGROHVDDRKUDQLĀHQìSRWRNHP EHGURRPYLOODJDUGHQPIRUHVWPDEVROXWHSULYDF\LGHDOVRXWKDQGHDVWRULHQWDWLRQJDUGHQJXHVWKRXVHJDUDJH IRUFDUVSDUNLQJRQWKHODQGIRUFDUV+ROO\ZRRGLQVSLUHGCVYLOODZLWKDEHDXWLIXOODUJHODQGRQWKHHGJHRIDIRUHVWDQG ERUGHUHGE\DVWUHDP

1D3HUåWìQę3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

81


3URGHM_3UDKD_.RåtĨH_P_SR]HPHNP_.Ā 5RGLQQìGģPNNWHUDVDåDWQDSOQęY\EDYHQiNXFK\ĞVSRWĨHELĀL3RJJHQSRKOGĨHYęQpSRGODK\YHåNHUiVDQLWD9LOOHUR\ %RFKGĨHYęQi IUDQFRX]VNiRNQDSDUNRYDFtVWiQt1DGVWDQGDUGQęĨHåHQìQt]NRHQHUJHWLFNìĨDGRYìGģPVYìKOHGHPQDQHGDOHNìOHVVHVNYęORXGRVWXSQRVWt GRFHQWUD EHGURRPIDPLO\KRXVHWHUUDFHZDONLQFORVHWIXOO\HTXLSSHGNLWFKHQZLWK3RJJHQSRKODSSOLDQFHVZRRGHQIORRULQJ9LOOHUR\ %RFKVDQLWDU\ ZDUHZRRG)UHQFKZLQGRZVSDUNLQJVSDFH$ERYHVWDQGDUGGHVLJQHGORZHQHUJ\WHUUDFHGKRXVHZLWKDYLHZRIQHDUE\IRUHVWDQGH[FHOOHQW DFFHVVWRWKHFLW\FHQWHU

3URNRPSOHWQtQDEtGNXQDYåWLYWH)RUFRPSOHWHSURSHUW\OLVWLQJSOHDVHYLVLW

82

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

VYRERGDZLOOLDPVFRP


3URGHM_3UDKD_9RNRYLFH_P_FHQDQDY\รงiGiQt_SULFHXSRQUHTXHVW 9LODNNWHUDV\PQRรงVWYt~ORรงQpKRSURVWRUXGฤจHYฤ™QpSRGODK\IUDQFRX]VNiRNQDJDUiรงRYiSDUNRYDFtVWiQt6DPRVWDWQฤ™VWRMtFtYLOD ]DVD]HQiGRMHGQRWQpKRXUEDQLVWLFNpKRNRPSOH[XVWHQLVRYรฌPLNXUW\DUHOD[FHQWUHPQDMLรงQtPVYDKXPH]LYLORYRX]iVWDYERXDSฤจtURGQt FKUiQฤ™QRXREODVWtY3UD]H EHGURRPYLOODWHUUDFHVDPSOHRIVWRUDJHVSDFHZRRGHQIORRUV)UHQFKZLQGRZVJDUDJHSDUNLQJVSDFHV)UHHVWDQGLQJYLOODLQDQ XQLTXHXUEDQFRPSOH[ZLWKWHQQLVFRXUWVDQGDUHOD[DWLRQFHQWHUVLWXDWHGRQWKHVRXWKHUQKLOOEHWZHHQWKHRULJLQDOYLOODGHYHORSPHQWDQG DQDWXUDOSUHVHUYHLQ3UDJXH

1D3HUรฅWรฌQฤ™3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

352'(-,6$/(6,ว†ว‡ว…ฦบฦถฦปว‰วˆว–'8%(1,$35,/,ฦถว†ว‡ฦปว‚ว“

83


3URGHM_3UDKD_6WDUp0ฤ™VWR_P_FHQDQDY\รงiGiQt_SULFHXSRQUHTXHVW 3HQWKRXVHNNWHUDVDNUENOLPDWL]DFHV\VWpPLQWHOLJHQWQtGRPiFQRVWL%WLFLQRNRXSHOQ\Y\EDYHQpVDQLWiUQtWHFKQLNRX .HUDPDJ&DWDODQRDREORรงHQpSฤจtURGQtPNDPHQHPNXFK\ฤžVNiOLQND9DUHQQDVYHVWDYฤ™QรฌPLVSRWฤจHELฤ€L0LHOHYHVWDYฤ™QpVNฤจtฤžฤ™ YNDรงGpPtVWQRVWLSฤจtPรฌYVWXS]YรฌWDKXVNOHSJDUiรงRYiSDUNRYDFtVWiQt([NOX]LYQtSHQWKRXVHVSURVWRUQRXWHUDVRX DQiGKHUQรฌPYรฌKOHGHPQD6WDUp0ฤ™VWRYSDWฤจHNRPSOHWQฤ™]UHNRQVWUXRYDQpUH]LGHQFHYKLVWRULFNpPFHQWUXMHQSiUNURNฤฃ RG6WDURPฤ™VWVNpKRQiPฤ™VWt

3URNRPSOHWQtQDEtGNXQDYรฅWLYWH)RUFRPSOHWHSURSHUW\OLVWLQJSOHDVHYLVLW

84

1(-/(3ฤรŒ1(029,7267,,%(673523(57,(6,ว‚วŠวŽวฦถว–ว„ฦปฦบฦธฦฟฦฝฦฟวƒว…วˆว‰ว“

VYRERGDZLOOLDPVFRP


6DOH_3UDKD_6WDUp0Ä&#x2122;VWR_P_SULFHXSRQUHTXHVW EHGURRPSHQWKRXVHWHUUDFHILUHSODFHDLUFRQGLWLRQLQJ%WLFLQRLQWHOOLJHQWKRPHV\VWHPEDWKURRPVHTXLSSHGZLWK.HUDPDJ &DWDODQRVDQLWDU\IL[WXUHVDQGOLQHGZLWKQDWXUDOVWRQH9DUHQQDNLWFKHQZLWK0LHOHDSSOLDQFHVEXLOWLQZDUGUREHVLQHDFKURRP GLUHFWDFFHVVIURPWKHHOHYDWRUFHOODUJDUDJHSDUNLQJVSDFHV([FOXVLYHSHQWKRXVHZLWKDVSDFLRXVWHUUDFHDQGEHDXWLIXOYLHZV RIWKH2OG7RZQRQWKHWKIORRURIDFRPSOHWHO\UHFRQVWUXFWHGUHVLGHQFHLQWKHKLVWRULFFHQWHURI3UDJXHMXVWDIHZVWHSVIURP WKH2OG7RZQ6TXDUH

1D3HUÃ¥WìQÄ&#x2122;3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

352'(-,6$/(6,Ç&#x2020;Ç&#x2021;Ç&#x2026;ƺƶƻÇ&#x2030;Ç&#x2C6;Ç&#x2013;'8%(1,$35,/,ƶÇ&#x2020;Ç&#x2021;Æ»Ç&#x201A;Ç&#x201C;

85


Realitní makléř: Šárka Kováčová Kontakt: +420 281 866 806 E-mail: sarka.kovacova@century21.cz

1É95+'208$5&+'2&-É1675&8/$8/9,/$3$5.=',%<+286(6$/($5&+'2&-É1675&8/$9,/$3$5.675((7=',%< ([NOX]LYQĚQDEt]tPHEH]EDULpURYëURGLQQëGŢPNNJDUiæPRE\WQiSORFKDP3URVWRUGRPXXPRFŁXMHYNDæGpPSRNRMLSURVNOHQiVWĚQDVYëFKRGHPGR]DKUDG\ DSRKOHGHPQDY]URVWOpVWURP\]DÿtQDMtFtKROHVD3R]HPHNPVWHUpQQtYOQRX]DUXÿXMHQDSURVWpVRXNURPtDVOXQFHSRFHOëGHQ9GRPĚVHRGUiætQDGÿDVRYRVWFRæMHW\SLFNpSUR SUiFL'RF,QJ$UFK-iQD6WUFXOL3K'6OHSiXOLFHRWLGRPHFKVWHMQpKRW\SXSŐtMHPQtDEH]SUREOpPRYtVRXVHGpMLæGRNRQÿHQiYëVWDYEDYRNROt6WDYHEQtSRYROHQtDVOHYDQD9iPL Y\EUDQëED]pQ7HFKQLFNëSRSLVGRPXSRXæLWëPDWHULiOEHWRQGŐHYRVNORRE\WQiÿiVWDNRXSHOQDSRGODKRYpY\WiSĚQtHOHNWULFNp9LQWHULpUXSŐL]QDQpGŐHYĚQpQRVQpWUiP\'OH SURMHNWXDUHIHUHQFHVRXVHGŢQDSURVWRQt]NRQiNODGRYpDIXQNÿQtE\GOHQt/RNDOLWDQiGKHUQiNUDMLQD9OWDYVNpKR~GROtQHGDOHNRFKUiQĚQiSŐtURGQtREODVW'ROQt3RYOWDYtF\NORVWH]N\ SURFKi]N\%\GOHQtYSŐtURGĚSiUNURNŢRGFLYLOL]DFHPLQFHQWUXP3UDK\PLQDXWREXVHPQDPHWUR.RE\OLV\3URYtFHLQIRUPDFtQHYiKHMWHNRQWDNWRYDWPDNOpŐH :HDUHWKHVROHDJHQWVIRUWKLVEDUULHUIUHHKRXVHNNJDUDJHPñZLWKDOLYLQJDUHDRIPñ7KHVSDFHRIWKHKRXVHLVHQKDQFHGE\DJODVVHGZDOOLQHDFKURRPIDFLQJWKH JDUGHQZLWKDYLHZRIWKHHVWDEOLVKHGWUHHVRQWKHHGJHRIWKHIRUHVW7KHPñSORWZLWKWHUUDLQZDYHJXDUDQWHHVDEVROXWHSULYDF\DQGVXQWKURXJKRXWWKHGD\7KHKRXVHUHÁHFWV WLPHOHVVQHVVZKLFKLVW\SLFDORIWKHZRUNRI'RF,QJ$UFK-iQ6WUFXOD3K',QDFXOGHVDFZLWKKRXVHVRIWKHVDPHW\SHSOHDVDQWWURXEOHIUHHQHLJKERXUVDOUHDG\FRPSOHWHGGH YHORSPHQWLQWKHVXUURXQGLQJDUHD%XLOGLQJSHUPLVVLRQIRUDVZLPPLQJSRROGLVFRXQWRQ\RXUVHOHFWHGVZLPPLQJSRRO7HFKQLFDOGHVFULSWLRQRIWKHKRXVH0DWHULDOVXVHG²FRQ FUHWHZRRGJODVVOLYLQJDUHDDQGEDWKURRP²HOHFWULFXQGHUÁRRUKHDWLQJ$SSURYHGZRRGHQEHDULQJWLPEHUVLQWKHLQWHULRU$FFRUGLQJWRWKHSURMHFWDQGUHIHUHQFHRIWKHQHLJKERXUV WKLVLVORZFRVWIXQFWLRQDOKRXVLQJ/RFDOLW\EHDXWLIXOODQGVFDSHRIWKH9OWDYDYDOOH\'ROQt3RYOWDYtSURWHFWHGQDWXUDOSDUNQHDUE\F\FOLQJKLNLQJURXWHV+RXVLQJLQWKHFRXQWU\VLGHD IHZVWHSVIURPFLYLOLVDWLRQPLQWRWKHFHQWUHRI3UDJXHPLQE\EXVWR.RE\OLV\0HWURVWDWLRQ)RUPRUHLQIRUPDWLRQGRQRWKHVLWDWHWRFRQWDFWWKH$JHQW ǔǝǖǗǪǣǔǞǑǗǨǙǧǕǐǚǘǔǥǑǞǔǝǖǗǪǣǔǞǑǗǨǙǧǡǎǗnjǐǑǗǨǢǑǎ ǩǶǽǶǷȊdzǴǮǹȇǵ ǽǺǮǼDZǸDZǹǹȇǵ ǽDZǸDZǵǹȇǵ ǰǺǸ ǻǺǽǷDZǰǹǴǵ Ǵdz ǰDZǮȋǾǴ ǴǹǾDZǼDZǽǹȇȁ ǰǺǸǺǮ Ǯ ǴdzǮDZǽǾǹǺǸ ǎǴǷǬǻǬǼǶDZ ǓǰǴǭȇ ǍǿǰǿȅǴǸ ǮǷǬǰDZǷȈȂǬǸ ǺǭDZǽǻDZȃDZǹǬ  ǶǺǹȀǴǰDZǹȂǴǬǷȈǹǺǽǾȈ9,3ǽǺǽDZǰǴǴǶǼǬǽǴǮȇǵDzǴǷǺǵǼǬǵǺǹǼDZdzǴǰDZǹȂǴǵǚǰǹǺȉǾǬDzǹȇǵǰǺǸǻǷǬǹǴǼǺǮǶǬNNǸǺǭǺǼǿǰǺǮǬǹǺǴǰǷȋǴǹǮǬǷǴǰǺǮǏǺǽǾǴǹǬȋdzǬǷǮǬǹǹǬȋ ǶǺǸǹǬǾǬǮǶǺǾǺǼǺǵȉǷDZǶǾǼǴȃDZǽǶǴDZǾDZǻǷǺǮǺǰǹȇDZǻǺǷȇǽǻǺǰǺǯǼDZǮǺǸǮǽǻǬǷȈǹDZǴǶǬǭǴǹDZǾDZǭǬǾǬǼDZǴǐDZǼDZǮȋǹǹȇDZǭDZdzǺǻǬǽǹȇDZǺǶǹǬdzǬȅǴǾǹȇDZǮȁǺǰǹȇDZǰǮDZǼǴǴǽǴǽǾDZǸǬ ǭDZdzǺǻǬǽǹǺǽǾǴǒǴǷȈDZǽǹǴdzǶǴǸǻǺǾǼDZǭǷDZǹǴDZǸȉǹDZǼǯǴǴǐǺǸǴǽǬǰǺǼǴDZǹǾǴǼǺǮǬǹȇǹǬȊǯǺdzǬǻǬǰǏǬǼǬDz³ȃǬǽǾȈǰǺǸǬǟȃǬǽǾǺǶǸǽǿȁǺDzDZǹǹȇǸǯǬdzǺǹǺǸǩǶǽǶǷȊdzǴǮǹǺDZ DzǴǷȈDZǰǷȋǽǬǸȇȁǮdzȇǽǶǬǾDZǷȈǹȇȁǛǼǺDzǴǮǬǹǴDZǼȋǰǺǸǽDzǴǮǺǻǴǽǹǺǵǻǼǴǼǺǰǺǵǮǹDZǽǶǺǷȈǶǴȁȄǬǯǬȁǺǾȂǴǮǴǷǴdzǬȂǴǴǮǰǺǷǴǹDZǎǷǾǬǮȇǮǺdzǷDZǺȁǼǬǹȋDZǸǺǯǺǻǼǴǼǺǰǹǺǯǺdzǬǻǺǮDZǰǹǴǶǬ ©'ROQt3RYOWDYtªǚǾǹǺǽǴǾǽȋǶǻǺǽDZǷǶǿ=GLE\ǔǽǶǷȊȃǴǾDZǷȈǹȇǵǰǺǸDzǰDZǾǽǮǺǴȁǴǽǶǷȊȃǴǾDZǷȈǹȇȁǮǷǬǰDZǷȈȂDZǮ

Cena / Price / ǢDZǹǬ: 7.690.000 Kč / CZK 7,690,000 Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Elán, Smetanova 240, Úvaly 86

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Miroslava Pirchanová Kontakt: +420 608 702 400 E-mail: miroslava.pirchanova@century21.cz

129267$9%$..9(/.e32329,&(35$+$9ê&+2'1(:)$0,/<+286(.,7&+(1122.9(/.e32329,&(35$*8(($67 1RYRVWDYEDURGLQQpKRGRPXMHXPtVWĚQDQDPDOHEQpPYUäNXRKUDQLÿHQpPOHVHP]HVHYHUQtVWUDQ\'ŢPRSRGODKRYpSORäHPVWRMtQDSR]HPNXRYHOLNRVWL PDMHFHOëSRGVNOHSHQ9SŐt]HPtVHQDFKi]tSURVWRUQëREëYDFtSRNRMVNUEHPKRVWLQVNëSRNRMVNRXSHOQRXäDWQD9SUYQtPSDWŐHMVRXGĚWVNpSRNRMHV PRGHUQtNRXSHOQRXDSURVWRUQiORæQLFHVHVRXNURPRXNRXSHOQRXSURURGLÿH9VXWHUpQXYJDUiæL]DSDUNXMHWHDXWDDQDYtFMH]GHGtOQDDWHFKQLFNp]i]HPt'ŢP MHSRVWDYHQ]SŐtURGQtFKPDWHULiOŢ²NiPHQGŐHYRFLKODDMHQt]NRHQHUJHWLFNëY\WiSĚQWHSHOQëPLÿHUSDGO\

7KLVQHZO\EXLOWIDPLO\KRXVHLVVLWXDWHGRQDSLFWXUHVTXHKLOOVXUURXQGHGE\IRUHVWRQRQHVLGH7KHKRXVHZLWKDÁRRUDUHDRIPñLVVLWXDWHGRQDPñSORW DQGFRQWDLQVDFHOODU7KHJURXQGÁRRUFRPSULVHVDVSDFLRXVOLYLQJURRPZLWKKHDUWKDQGDJXHVWURRPZLWKEDWKURRPDQGGUHVVLQJURRP7KHVWÁRRUFRPSULVHV FKLOGUHQ·VEHGURRPVZLWKPRGHUQEDWKURRPDQGDVSDFLRXVPDLQEHGURRPZLWKHQVXLWHEDWKURRP3DUNLQJIRUFDUVLQWKHEDVHPHQWJDUDJHZKLFKDOVRFRQWDLQV WKHWHFKQLFDOHTXLSPHQW7KHKRXVHLVFRQVWUXFWHGIURPQDWXUDOPDWHULDOV²VWRQHZRRGDQGEULFN,WRIIHUVORZHQHUJ\FRQVXPSWLRQ²KHDWLQJLVE\KHDWSXPSV

ǙǚǎǚǝǞǜǚǕǖnjǖǖ9(/.e32329,&(ǛǜnjǏnjǎǚǝǞǚǖ ǙǺǮǺǽǾǼǺǵǶǬǽDZǸDZǵǹȇǵǶǺǾǾDZǰDzǼǬǽǻǺǷǺDzDZǹǹǬDzǴǮǺǻǴǽǹǺǸȁǺǷǸDZǽǺǰǹǺǵǽǾǺǼǺǹȇǺǶǼǿDzDZǹǷDZǽǺǸǚǭȅǬȋǻǷǺȅǬǰȈdzǰǬǹǴȋǽǺǽǾǬǮǷȋDZǾǸǻǺǽǾǼǺDZǹ ǹǬǿȃǬǽǾǶDZǸǻǺǰȂDZǷȇǸǰǺǸǺǸǻǺǰǮǬǷȈǹȇDZǻǺǸDZȅDZǹǴȋǙǬǻDZǼǮǺǸȉǾǬDzDZǻǼǺǽǾǺǼǹǬȋǯǺǽǾǴǹǬȋǽǶǬǸǴǹǺǸǯǺǽǾDZǮǬȋǶǺǸǹǬǾǬǽǮǬǹǹǺǵǯǬǼǰDZǼǺǭ ǙǬǮǾǺǼǺǸȉǾǬDzDZǶǺǸǹǬǾȇǰǷȋǰDZǾDZǵǽǽǺǮǼDZǸDZǹǹǺǵǮǬǹǹǺǵǶǺǸǹǬǾǺǵǴǻǼǺǽǾǺǼǹǬȋǽǻǬǷȈǹȋǽǺǾǰDZǷȈǹǺǵǮǬǹǹǺǵǶǺǸǹǬǾǺǵǰǷȋǼǺǰǴǾDZǷDZǵǎǻǺǰǮǬǷȈǹǺǸ ǻǺǸDZȅDZǹǴǴǴǮǯǬǼǬDzDZǸǺDzǹǺdzǬǻǬǼǶǺǮǬǾȈǬǮǾǺǸǺǭǴǷȋǶǼǺǸDZǾǺǯǺǾǬǸǹǬȁǺǰǴǾǽȋǸǬǽǾDZǼǽǶǬȋǴǾDZȁǹǴȃDZǽǶǺDZǺǭǺǼǿǰǺǮǬǹǴDZǐǺǸǻǺǽǾǼǺDZǹǴdzǹǬǾǿǼǬǷȈǹȇȁ ǸǬǾDZǼǴǬǷǺǮǶǬǸǹȋǰDZǼDZǮǬǶǴǼǻǴȃǬǴȋǮǷȋDZǾǽȋǻǺǽǾǼǺǵǶǺǵǽǸǬǷȇǸǻǺǾǼDZǭǷDZǹǴDZǸȉǹDZǼǯǴǴ³ǺǾǬǻǷǴǮǬDZǾǽȋǽǻǺǸǺȅȈȊǾDZǻǷǺǮǺǯǺǹǬǽǺǽǬ &HQD3ULFHǢDZǹǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Action, Masarykovo nábřeží 2, Praha 2 - Nové Město 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

87


Realitní makléř: Bc. Pavel Soldátek Kontakt: +420 775 703 200 Realitní makléř: Roman Šenigla E-mail: pavel.soldatek@century21.cz Kontakt: +420 725 293 491 E-mail: roman.senigla@century21.cz

Bonus Praha

/2)729ê%<76*$5Éå29ê067É1Ì09$75$.7,91Ì/2.$/,7ę35$+</2)7)/$7:,7+3$5.,1*%$<,1$775$&7,9(/2&$/,7<2)35$*8( 352'(-/8;861Ì9,/<6.5<7ê0%$=e1(0%5$1'ê61$'/$%(06$/(2)/8;85<9,//$:,7+&29(5('6:,00,1*322/%5$1'ê61$'/$%(0 1DEt]tPHH[NOX]LYQĚOX[XVQtYLOXXæLWQiSORFKDP]DVWDYĚQiPSORFKDSDUFHO\PY%UDQGëVHQDG/DEHPXO=iU\EVNi9SŐt]HPtGRPX]HYVWXSQt FKRGE\YFKi]tPHGRNXFK\QĚSURSRMHQpVMtGHOQRXDREëYDFtPSRNRMHPDQiVOHGQĚGRSURVNOHQpKRDWULD=FKRGE\MH]iURYHŁYVWXSGRUHOD[DÿQtKRFHQWUDVED]pQHP9 =DMtPDYëSURVWRUQëE\WORIWRYpKRW\SXY3DOiFL%HOZLF]SŐtPRYFHQWUX3UDK\QHGDOHNR9iFODYVNpKRQiPĚVWtUR]GĚOHQëGRGYRX~URYQtRSORäHÿWYHUHÿQtFKPHWUŢ9H SUYQtPSDWŐHGRPXMHRE\WQiÿiVWREVDKXMtFtÿW\ŐLSRNRMHDYJDOHULLGRPXMHXPtVWĚQDSUDFRYQD9HYäHFKSRNRMtFKMVRXNOLPDWL]DÿQtMHGQRWN\9HVNOHSĚGRPXMVRXWHFK VSRGQtÿiVWLVHQDFKi]tNXFK\ŁVNëNRXWVSOQĚY\EDYHQRXOX[XVQtNXFK\ŁVNRXOLQNRXREëYDFtSRNRMDMtGHOQDVHYVWXSHPQDWHUDVXVYëKOHGHPGR]DKUDG\KRWHOX.HPSLQ QLFNpPtVWQRVWLDGYRMJDUiæ6DPR]ŐHMPRVWtMHDODUPVPRæQRVWtQDSRMHQtQDSXOWFHQWUiOQtRFKUDQ\9LODE\ODNRODXGRYiQDYURFHDE\ODVWDYĚQDGOHQiYUKXDUFKLWHNWD VNL'iOHPHQätNRXSHOQDVHVSUFKRYëPNRXWHPDWRDOHWRXYHVWDYĚQpVNŐtQĚPtVWQŢVWNDQDSUDÿNXDVNODGRYDFtNRPRUD1DJDOHULLMHORæQLFHDYHONiNRXSHOQDVURKRYRX ,QJDUFK6DUDOMLÿH3R]HPHNMHURYLQDWëRVi]HQëMLæY]URVWORX]HOHQtDY\EDYHQ]DYODæRYDFtP]DŐt]HQtP YDQRXVSUFKRYëPNRXWHPDWRDOHWRX.E\WXQiOHætVNOHSQtNyMH%\WMHPRæQpXSUDYLWQD...GLVSR]LFLMHKRGLQRYiUHFHSFHDVHFXULW\VHUYLFH ,QWHUHVWLQJVSDFLRXVORIWW\SHÁDWLQ%HOZLF]3DODFHLQWKHYHU\FHQWUHRI3UDJXHFORVHWR:HQFHVODV6TXDUHGLYLGHGLQWRWZROHYHOVRIVTXDUHPHWUHVHDFK7KHORZHUOHYHOFRQWDLQV :HRIIHUDQH[FOXVLYHOX[XU\YLOODZLWKXWLOLW\DUHDRIPñEXLOWXSDUHDRIPñRQDPñSORWLQ=iU\EVNi6WUHHW%UDQGëVQDG/DEHP)URPWKHHQWUDQFHKDOORQWKH DNLWFKHQQRRNZLWKIXOO\HTXLSSHGOX[XU\NLWFKHQXQLWOLYLQJURRPDQGGLQLQJURRPZLWKH[LWWRWKHWHUUDFHZLWKDYLHZRIWKH.HPSLQVNL+RWHOJDUGHQ7KHUHLVDOVRDVPDOOHUEDWKURRP JURXQGÁ RRURQHHQWHUVWKHNLWFKHQFRQQHFWHGWRWKHGLQLQJURRPDQGOLYLQJURRPDQGVXEVHTXHQWO\WRDJODVVHGLQDWULXP)URPWKHHQWUDQFHKDOOLWLVDOVRSRVVLEOHWRHQWHUWKHHQ ZLWKVKRZHUFRUQHUDQGWRLOHWEXLOWLQZDUGUREHVDVPDOOODXQGU\DQGVWRUDJHVSDFH7KHJDOOHU\FRPSULVHVDEHGURRPDQGODUJHEDWKURRPZLWKFRUQHUEDWKWXEVKRZHUFRUQHUDQG WHUWDLQPHQWFHQWUHZLWKVZLPPLQJSRRO7KHUHVLGHQWLDOSDUWRQWKHÀUVWÁRRUFRQVLVWVRIIRXUURRPVZLWKDVWXG\VLWXDWHGLQWKHORJJLD7KHUHDUHDLUFRQGLWLRQLQJXQLWVLQDOOWKHURRPV WRLOHW7KHÁDWLQFOXGHVFHOODUVSDFH,WLVSRVVLEOHWRDGMXVWWKHÁDWWRURRPVNLWFKHQQRRN5HFHSWLRQDQGVHFXULW\VHUYLFHVDUHDYDLODEOHKRXUVDGD\ 7KHEDVHPHQWFRQWDLQVWHFKQLFDOURRPVDQGDGRXEOHJDUDJH7KHUHLVDQDODUPGHYLFHZLWKWKHSRVVLELOLW\RIFRQQHFWLRQWRDFHQWUDOL]HGSURWHFWLRQXQLW7KHYLOODZDVDSSURYHGLQ DQGEXLOWDFFRUGLQJWRWKHSURSRVDORIDUFKLWHFW,QJDUFK6DUDOMLÿ7KHJDUGHQLVRQÁDWJURXQGZLWKHVWDEOLVKHGYHJHWDWLRQDQGHTXLSSHGZLWKDQLUULJDWLRQV\VWHP ǖǎnjǜǞǔǜnjǗǚǠǞǝǛnjǜǖǚǎǖǚǕǎǛǜǔǎǗǑǖnjǞǑǗǨǙǚǘǘǑǝǞǑǛǜnjǏǔ ǔǹǾDZǼDZǽǹǬȋǻǼǺǽǾǺǼǹǬȋǶǮǬǼǾǴǼǬǾǴǻǬǷǺȀǾǮǺǐǮǺǼȂDZ©%HOZLF]ªǻǼȋǸǺǮȂDZǹǾǼDZǛǼǬǯǴǹDZǰǬǷDZǶǺǺǾǎǬȂǷǬǮǽǶǺǵǻǷǺȅǬǰǴǼǬdzǰDZǷDZǹǬǹǬǰǮǬǿǼǺǮǹȋǻǷǺȅǬǰȈȊǶǮǬǰǼǬǾǹȇȁ ǛǜǚǐnjǒnjǜǚǝǖǚǤǙǚǕǎǔǗǗǧǝǖǜǧǞǧǘǍnjǝǝǑǕǙǚǘǍǜnjǙǐǔǝǙnjǐǗnjǍǑǘ ǸDZǾǼǺǮǎǹǴDzǹDZǵȃǬǽǾǴǴǸDZDZǾǽȋǻǺǷǹǺǽǾȈȊǺǭǺǼǿǰǺǮǬǹǹǬȋdzǺǹǬǶǿȁǹǴǯǺǽǾǴǹǬȋǴǽǾǺǷǺǮǬȋǽǮȇȁǺǰǺǸǹǬǾDZǼǼǬǽǿǴǽǮǴǰǺǸǹǬǽǬǰǺǾDZǷȋ©.HPSLQVNLªǞǬǶDzDZdzǰDZǽȈǼǬǽǻǺǷǺDzDZǹȇ  ǛǼDZǰǷǬǯǬDZǸȉǶǽǶǷȊdzǴǮǹǿȊǮǴǷǷǿDzǴǷǬȋǻǷǺȅǬǰȈǸ dzǬǽǾǼǺDZǹǺǸǿȃǬǽǾǺǶǸǮǍǼǬǹǰǴǽDZǹǬǰǗǬǭDZǸǿǷ=iU\EVNiǙǬǻDZǼǮǺǸȉǾǬDzDZǰǺǸǬǴdzǻǼǴȁǺDzDZǵ ǹDZǭǺǷȈȄǬȋǮǬǹǹǬȋǶǺǸǹǬǾǬǽǰǿȄDZǸǴǾǿǬǷDZǾǺǸǮǽǾǼǺDZǹǹȇDZȄǶǬȀȇǶǺǸǹǬǾǶǬǰǷȋǽǾǴǼǬǷȈǹǺǵǸǬȄǴǹȇǴǶǷǬǰǺǮǬȋǙǬǮǾǺǼǺǸȉǾǬDzDZǯǬǷDZǼDZDZǽǻǬǷȈǹȋǴǻǼǺǽǾǺǼǹǬȋǮǬǹǹǬȋ ǶǺǸǹǬǾǬǽǿǯǷǺǮǺǵǮǬǹǹǺǵǰǿȄDZǮǺǵǶǬǭǴǹǺǵǴǾǿǬǷDZǾǺǸǖǶǮǬǼǾǴǼDZǺǾǹǺǽǴǾǽȋǻǺǰǮǬǷǖǮǬǼǾǴǼǬǸǺDzDZǾǭȇǾȈǻDZǼDZǽǾǼǺDZǹǬǹǬǶǶǎǰǺǸDZ³ȃǬǽǺǮǬȋǼDZȂDZǻȄǹǴǽǷǿDzǭǬ ǸǺDzǹǺǻǺǻǬǽǾȈǮǶǿȁǹȊǺǭȆDZǰǴǹDZǹǹǿȊǽǺǽǾǺǷǺǮǺǵǴǯǺǽǾǴǹǺǵǬdzǬǾDZǸǮǽǾDZǶǷȋǹǹȇǵǬǾǼǴǿǸǔdzǻǼǴȁǺDzDZǵǾǬǶDzDZǰǺǽǾǿǻǶǽǻǬȂDZǹǾǼǿǽǭǬǽǽDZǵǹǺǸǙǬǻDZǼǮǺǸȉǾǬDzDZǰǺǸǬ ǭDZdzǺǻǬǽǹǺǽǾǴ ǹǬȁǺǰǴǾǽȋDzǴǷǬȋȃǬǽǾȈǽȃDZǾȇǼȈǸȋǶǺǸǹǬǾǬǸǴǬǹǬǯǬǷDZǼDZDZǹǬȁǺǰǴǾǽȋǼǬǭǺȃǴǵǶǬǭǴǹDZǾǎǺǮǽDZȁǶǺǸǹǬǾǬȁDZǽǾȈǶǺǹǰǴȂǴǺǹDZǼȇǎǻǺǰǮǬǷDZǰǺǸǬǹǬȁǺǰȋǾǽȋǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇ ǴǻǺǰǽǺǭǹȇDZǻǺǸDZȅDZǹǴȋǝǬǸǺǽǺǭǺǵǼǬdzǿǸDZDZǾǽȋǮǺdzǸǺDzǹǺǽǾȈǻǺǰǶǷȊȃDZǹǴȋǽǴǯǹǬǷǴdzǬȂǴǴǶǻǿǹǶǾǿȂDZǹǾǼǬǷȈǹǺǵǺȁǼǬǹȇǎǴǷǷǬǻǼǺȄǷǬǻǼǴDZǸǶǿ ǶǺǷǬǿǰǬȂǴȊ ǮǯǺǰǿǴ ǭȇǷǬǻǺǽǾǼǺDZǹǻǺǻǼǺDZǶǾǿǬǼȁǴǾDZǶǾǺǼǬǴǹDzDZǹDZǼǬǝǬǼǬǷǵǴȃDZǟȃǬǽǾǺǶǼǬǮǹǴǹǹȇǵǽǺǮdzǼǺǽǷȇǸǴdzDZǷDZǹȇǸǴǹǬǽǬDzǰDZǹǴȋǸǴǺǽǹǬȅDZǹǽǴǽǾDZǸǺǵǿǮǷǬDzǹDZǹǴȋ Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

&HQDYÿSURYL]H5.3ULFHLQFFRPPLVVLRQRIWKHUHDOHVWDWHDJHQF\ǮǶǷǶǺǸǴǽǽǴȊǬǯDZǹǾǽǾǮǬ.ÿ&=.

CENTURY 21 Bonus Praha, Korunní 104, Praha 10 - Vinohrady

Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F] 88

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

CENTURY 21 Plus+, Jankovcova 1596/14, Prague 17 - Holešovice


Realitní makléř: Daniel Svoboda Kontakt: +420 777 779 483 Realitní makléř: Martin Hušpauer E-mail: daniel.svoboda@century21.cz Kontakt: +420 725 293 493 E-mail: martin.huspauer@century21.cz

52',11ê'š09ŏ(91,&Ì&+35$+$=É3$')$0,/<+286(,1ŏ(91,&(35$*8(:(67ǐǚǘŏ(91,&(ǛǜnjǏnjǓnjǛnjǐ 352'(-35$+$2ŏ(&+29.$P32=(0(.P6$/(35$*8(2ŏ(&+29.$PñPñ3/27 3R]HPHNPVSDQDURPDWLFNëPYëKOHGHPGR~GROt%HURXQN\$WUDNWLYQtMLæQtVYDKQDGFHQWUHPŏHYQLFVSRKOHGHPGR~GROt%HURXQN\QDEt]tSR]HPHNPV YODVWQtPOHVHP'ŢPMHVLWXRYDQëQDKRUQtPRNUDMLSDUFHO\VYODVWQtSŐtVWXSRYRXFHVWRX]DÿtQDMtFt]NRPXQLNDFH]DNRQÿHQpSDUNRYDFtSORFKRXSURDXWDDYMH]GHPGRJDUi -HGLQHÿQiYLODQD2ŐHFKRYFH æHSURYR]\2E\WQëSURVWRUMHNRQFLSRYiQGYRXJHQHUDÿQĚVSRGQtÿiVWWYRŐtMHGQRWNDVHYVWXSHPQDVSRGQtÿiVWSR]HPNXDPHQät]DKUDGXYODVWQtPVRF]i]HPtP 9LODQDEt]tMHGLQHÿQpE\GOHQt]pU\OHWHOHJDQFLDDWPRVIpUXVSŢYRGQtPLSUYN\ DWHFK]i]HPtPGRPXVSROXV~ORæQëPLPtVWQRVWPL+RUQtÿiVWMHŐHäHQDMDNRKODYQtREëYDFtSURVWRUGLVSR]LFHGĚOHQëQDREëYDFtSRNRMPNXFK\ŁDVRXNURPRX -HGQiVHRYLOXVHWŐHPLVDPRVWDWQëPLE\WRYëPLMHGQRWNDPLNDæGiVGLVSR]LFt9SŐt]HPtMHVSROHÿQp]i]HPtYLO\VMHGQtPDæGYĚPLJDUiæRYëPLVWiQtPL9LODMHXUÿHQD ]yQXORæQLFDSRNRMŢ=REëYDFtKRSRNRMHVHYVWXSXMHQDKRUQtWHUDVXDGRÿiVWL]DOHVQĚQpKRSR]HPNX1HFK\EtED]pQRYiKDODRGSRÿtYiUQRXDZKLUOSRROHP'ŢPE\O NUHNRQVWUXNFL YORNDOLWĚY\VWDYĚQMDNRQRYRVWDYED]URNXRFHONRYpRE\WQpSORäHPNWHUiQDYD]XMHQDVRXVHGQtGRP\DYLO\VKLVWRULtSRÿiWNXNRQFHDSRÿiWNXVWROHWt 7KHKRXVHLVVLWXDWHGRQWKHXSSHUHGJHRIDPñSORWZLWKLWVRZQIRUHVWRQWKHDWWUDFWLYHVRXWKHUQVORSHDERYHWKHFHQWUHRIŏHYQLFHZLWKDYLVWDRIWKH%HURXQND9DOOH\7KH 8QLTXHYLOODLQ2ŐHFKRYND SULYDWHDFFHVVURDGVWDUWVIURPWKHSXEOLFWUDQVSRUWWHUPLQXVDQGHQGVLQDFDUSDUNDQGHQWUDQFHWRWKHYHKLFOHJDUDJH7KHUHVLGHQWLDODUHDFRPSULVHVVSDFHIRUWZRJHQHUDWLRQV 7KHYLOODRIIHUVXQLTXHKRXVLQJIURPWKHHUDRIWKHVZLWKWKHHOHJDQFHDQGDWPRVSKHUHRIRULJLQDOIHDWXUHV7KLVYLOODFRPSULVHVWKUHHVHSDUDWHÁDWXQLWVHDFKZLWKGLVSRVLWLRQ 7KHORZHUSDUWFRQVLVWVRIXQLWZLWKHQWUDQFHWRWKHORZHUSDUWRIWKHSORWDQGDVPDOOHUJDUGHQLWVRZQVHZHUDJHDQGWHFKQLFDOIDFLOLWLHVDVZHOODVVWRUHURRPV7KHXSSHUSDUWLV 7KHVKDUHGWHFKQLFDOIDFLOLWLHVZLWKRQHRUWZRSDUNLQJED\VLQWKHJDUDJHDUHRQWKHJURXQGÁRRU7KHYLOODLVLQWHQGHGIRUUHFRQVWUXFWLRQ GHVLJQHGDVWKHSULQFLSDOUHVLGHQWLDODUHDZLWKOD\RXWGLYLGHGLQWRDPñOLYLQJURRPNLWFKHQDQGSULYDWH]RQHRIEHGURRPVDQGH[WUDURRPV,WLVSRVVLEOHWRHQWHUWKHXSSHU WHUUDFHIURPWKHOLYLQJURRPDQGWKHIRUHVWHGSDUWRIWKHSORW7KHUHLVDOVRDQHQWHUWDLQPHQWFHQWUHZLWKVZLPPLQJSRROUHVWURRPDQGZKLUOSRRO7KHKRXVHZDVQHZO\EXLOWLQWKHORFDOLW\ LQZLWKDWRWDOÁRRUDUHDRIPñZKLFKLVLQFRQFRUGZLWKWKHQHLJKERXULQJKRXVHVDQGYLOODVZLWKDKLVWRU\GDWLQJEDFNWRWKHHQGRIWKDQGEHJLQQLQJRIWKHWKFHQWXULHV ǛǜǚǐnjǒnjǛǜnjǏnj2ŏ(&+29.$0ǟǣnjǝǞǚǖǘ ǟǹǴǶǬǷȈǹǬȋǮǴǷǷǬǮǼǬǵǺǹDZǛǼǬǯǬ³ǚǼDzDZȁǺǮǶǬ ǟȃǬǽǾǺǶǸǽǻǬǹǺǼǬǸǹȇǸǮǴǰǺǸǹǬǰǺǷǴǹǿǼDZǶǴǍDZǼǺǿǹǶǴǙǬǻǼǴǮǷDZǶǬǾDZǷȈǹǺǸȊDzǹǺǸǽǶǷǺǹDZǹǬǰȂDZǹǾǼǺǸǜDzDZǮǹǴȂǽǮǴǰǺǸǹǬǰǺǷǴǹǿǍDZǼǺǿǹǶǴǹǬȁǺǰǴǾǽȋ ǩǶǽǶǷȊdzǴǮǹǺDZ DzǴǷȈDZ ǽǺ ǮǼDZǸDZǹ ȁ ǺǽǺǭǬȋ ǺǼǴǯǴǹǬǷȈǹǬȋ ǬǾǸǺǽȀDZǼǬ ȉǷDZǯǬǹǾǹǺǽǾǴ Ǵ ǴdzȇǽǶǬǹǹǺǯǺ ǽǾǴǷȋ ǎ ǮǴǷǷDZ ǽ ǾǼǴ ǺǾǰDZǷȈǹȇȁ ǶǮǬǼǾǴǼȇ ǶǬDzǰǬȋ Ǵdz ǶǺǾǺǼȇȁ ǴǸDZDZǾ ǸǿȃǬǽǾǺǶǽǽǺǭǽǾǮDZǹǹȇǸǷDZǽǺǸǐǺǸǼǬǽǻǺǷǺDzDZǹǹǬǮDZǼȁǹDZǸǶǼǬȊǿȃǬǽǾǶǬǽǽǺǭǽǾǮDZǹǹȇǸǻǺǰȆDZdzǰǹȇǸǻǿǾDZǸǹǬȃǴǹǬȊȅDZǵǽȋǺǾǶǺǸǸǿǹǴǶǬȂǴǵǴǻǼǴǮǺǰȋȅDZǵǶǽǾǺȋǹǶDZ ǻǷǬǹǴǼǺǮǶǿǙǬǻDZǼǮǺǸȉǾǬDzDZǮǴǷǷȇǺǭȅDZDZǸDZǽǾǺǰǷȋǮǽDZȁǻǼǺDzǴǮǬȊȅǴȁǮǮǴǷǷDZǽǸDZǽǾǬǸǴǰǷȋǻǬǼǶǺǮǶǴǬǮǾǺǸǺǭǴǷȋǎǴǷǷǬǻǼDZǰǹǬdzǹǬȃDZǹǬǰǷȋǼDZǶǺǹǽǾǼǿǶȂǴǴ ǰǷȋ ǬǮǾǺǸǺǭǴǷDZǵ Ǵ ǮȆDZdzǰǿ Ǯ ǯǬǼǬDz ǹǬ  ǸǬȄǴǹȇ ǖǺǹȂDZǻǾ DzǴǷǺǵ dzǺǹȇ ǻǼDZǰǹǬdzǹǬȃDZǹ ǰǷȋ  ǻǺǶǺǷDZǹǴǵ ǮǹǴdzǿ ǼǬǽǻǺǷǺDzDZǹǬ ǶǮǬǼǾǴǼǬ   ǽǺ ǮȁǺǰǺǸ ǹǬ ǹǴDzǹȊȊ ȃǬǽǾȈ ǿȃǬǽǾǶǬǴǸǬǷȇǵǽǬǰǴǶǽǺǭǽǾǮDZǹǹǺǵǮǬǹǹǺǵǶǺǸǹǬǾǺǵǴǽǬǹǿdzǷǺǸǬǾǬǶDzDZǾDZȁǹǺǷǺǯǴȃDZǽǶǴǸǺǭǺǼǿǰǺǮǬǹǴDZǸǰǺǸǬǮǸDZǽǾDZǽǽǶǷǬǰǽǶǴǸǴǻǺǸDZȅDZǹǴȋǸǴǎDZǼȁǹȋȋȃǬǽǾȈǰǺǸǬ ǻǼDZǰǹǬdzǹǬȃDZǹǬǮǶǬȃDZǽǾǮDZǺǽǹǺǮǹǺǵDzǴǷǺǵǻǷǺȅǬǰǴǼǬdzǰDZǷDZǹǹǺǵǹǬǯǺǽǾǴǹǿȊǸǶǿȁǹȊǴȃǬǽǾǹǿȊdzǺǹǿǽǽǻǬǷȈǹȋǸǴǴǶǺǸǹǬǾǬǸǴǔdzǯǺǽǾǴǹǺǵǸǺDzǹǺǻǺǻǬǽǾȈǹǬ &HQD3ULFHǢDZǹǬ.ÿ&=. ǮDZǼȁǹȊȊǾDZǼǼǬǽǿǴǹǬȃǬǽǾȈǷDZǽǹǺǯǺǿȃǬǽǾǶǬǑǽǾȈǾǬǶDzDZǭǬǽǽDZǵǹǽǶǺǸǹǬǾǺǵǺǾǰȇȁǬǴǰDzǬǶǿdzǴǐǺǸǶǬǶǹǺǮǺDZdzǰǬǹǴDZǭȇǷǻǺǽǾǼǺDZǹǮǺǭȅǬȋǻǷǺȅǬǰȈǸǺǹǽǮȋdzǬǹ ǽǽǺǽDZǰǹǴǸǴǰǺǸǬǸǴǴǮǴǷǷǬǸǴǮDZǰǿȅǴǸǴǴǽǾǺǼǴȊǽǶǺǹȂǬǯǺǴǹǬȃǬǷDZǯǺǮDZǶǬ Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

&HQDYÿSURYL]H5.3ULFHLQFFRPPLVVLRQRIWKHUHDOHVWDWHDJHQF\ǮǶǷǶǺǸǴǽǽǴȊǬǯDZǹǾǽǾǮǬ.ÿ&=.

CENTURY 21 K+K Consulting, Sladkovského nám. 525/1, Praha 3 - Žižkov

Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F] 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

CENTURY 21 Plus+, Jankovcova 1596/14, Prague 17 - Holešovice

89


Realitní makléř: Šárka Kováčová Kontakt: +420 281 866 806 E-mail: sarka.kovacova@century21.cz

520$17,&.É86('/267.02'35$+<520$17,&)$5067($'.0)52035$*8(ǜǚǘnjǙǞǔǣǑǝǖnjǫǟǝnjǐǨǍnjǎǖǘǚǞǛǜnjǏǔ 1DEt]tPH9iP]HPĚGĚOVNRXXVHGORVWYPtUQpPVYDKXVMHGLQHÿQëPYëKOHGHPGRRNROt1DFKi]tVHYNUiVQpSŐtURGĚQHGDOHNR6ODSVNpSŐHKUDG\DJROIRYpKRKŐLäWĚ.RQRSLäWĚPH]L SDVWYLQDPLQDY\YëäHQpPPtVWĚREFH5DGtÿ9REFL]UHNRQVWUXRYDQë]iPHNVERKDWëPNXOWXUQtPSURJUDPHPREFKRGHPSRKRVWLQVWYtP«=HPĚGĚOVNiXVHGORVWVHVWiYi]SĚWLQHPR YLWRVWtNWHUpX]DYtUDMtNODVLFNëGYŢU=YHONpÿiVWLXVHGORVWSURäODFLWOLYRXUHYLWDOL]DFt3RXæLW\SŢYRGQtPDWHULiO\NiPHQGŐHYR'QHVGYĚRE\WQpEXGRY\DGDOätRE\WQiÿiVWSOiQRYDQiY SRGNURYtVHVDPRVWDWQëPYFKRGHP.DPHQHPY\]GĚQëSŐtVWŐHäHNVNUEHPSURSRVH]HQt3ŢYRGQtNOHQXWëVNOtSHN8VHGORVWQDEt]HQDVU\EQtÿNHPPORXN\POHVDD VDPRVWDWQëPVWDYHEQtPSR]HPNHP

:HRIIHUDIDUPVWHDGRQDJHQWOHVORSHZLWKDXQLTXHYLHZRIWKHVXUURXQGLQJODQGVFDSH,WLVORFDWHGLQWKHEHDXWLIXOFRXQWU\VLGHQHDU6ODS\'DPDQGWKH.RQRSLäWĚJROIFRXUVHDPLG SDVWXUHVLQDQHOHYDWHGSRVLWLRQDERYH5DGtÿYLOODJH,QWKHYLOODJHWKHUHLVDUHFRQVWUXFWHGFKDWHDXZLWKDULFKFXOWXUDOSURJUDPPHDVZHOODVVKRSVDQGUHVWDXUDQWV7KHIDUPVWHDG FRQVLVWVRIÀYHEXLOGLQJVVXUURXQGLQJDFODVVLFFRXUW\DUG0RVWRIWKHSURSHUW\KDVXQGHUJRQHVHQVLWLYHUHVWRUDWLRQ1DWXUDOPDWHULDOVZHUHXVHGVXFKDVVWRQHDQGZRRG7ZREXLOGLQJV DUHUHVLGHQWLDOQRZDQRWKHUUHVLGHQWLDOSDUWLVSODQQHGLQWKHDWWLFZLWKDVHSDUDWHHQWUDQFH7KHUHLVDVWRQHZDOOHGVKHOWHUZLWKKHDUWKIRURXWGRRUVHDWLQJ2ULJLQDODUFKHGFHOODU7KH IDUPVWHDGLVRIIHUHGZLWKDPñSRQGPHDGRZPñIRUHVWDQGVHSDUDWHEXLOGLQJSORW

ǛǼDZǰǷǬǯǬDZǸǽDZǷȈǽǶǺȁǺdzȋǵǽǾǮDZǹǹǿȊǿǽǬǰȈǭǿǹǬǻǺǷǺǯǺǸǽǶǷǺǹDZǽǿǹǴǶǬǷȈǹȇǸǮǴǰǺǸǹǬǺǶǼDZǽǾǹǺǽǾǴǚǹǬǼǬǽǻǺǷǺDzDZǹǬǽǼDZǰǴDzǴǮǺǻǴǽǹǺǵǻǼǴǼǺǰȇǹDZǰǬǷDZǶǺǺǾǝǷǬǻǽǶǺǯǺ ǮǺǰǺȁǼǬǹǴǷǴȅǬǴǻǺǷȋǰǷȋǯǺǷȈȀǬǖǺǹǺǻǴȄǾDZǸDZDzǰǿǻǬǽǾǭǴȅǬǸǴǹǬǮǺdzǮȇȄDZǹǹǺǽǾǴǿǸDZǽǾDZȃǶǬǜǬǰǴȃǎǻǺǽDZǷǶDZǹǬȁǺǰǴǾǽȋǻǼǺȄDZǰȄǴǵǼDZǶǺǹǽǾǼǿǶȂǴȊdzǬǸǺǶǽǭǺǯǬǾǺǵ ǶǿǷȈǾǿǼǹǺǵǻǼǺǯǼǬǸǸǺǵǸǬǯǬdzǴǹǺǸǾǼǬǶǾǴǼǺǸǟǽǬǰȈǭǬǽǺǽǾǺǴǾǴdzǻȋǾǴǺǭȆDZǶǾǺǮǹDZǰǮǴDzǴǸǺǽǾǴǶǺǾǺǼȇDZǺǶǼǿDzǬȊǾǶǷǬǽǽǴȃDZǽǶǴǵǰǮǺǼǍǺǷȈȄǬȋȃǬǽǾȈǿǽǬǰȈǭȇǻǼǺȄǷǬ ǿǸDZǷǿȊǮǺǽǽǾǬǹǺǮǴǾDZǷȈǹǿȊǼDZǶǺǹǽǾǼǿǶȂǴȊǛǼǴȉǾǺǸǭȇǷǴǴǽǻǺǷȈdzǺǮǬǹȇǺǼǴǯǴǹǬǷȈǹȇDZǸǬǾDZǼǴǬǷȇǿǽǬǰȈǭȇǶǬǸDZǹȈǴǰDZǼDZǮǺǙǬǽDZǯǺǰǹȋȄǹǴǵǰDZǹȈǮǿǽǬǰȈǭDZǰǮǬDzǴǷȇȁ dzǰǬǹǴȋǴdzǬǻǷǬǹǴǼǺǮǬǹǹǬȋDzǴǷǬȋǻǷǺȅǬǰȈǮǸǬǹǽǬǼǰDZǽǺǾǰDZǷȈǹȇǸǮȁǺǰǺǸǶǬǸDZǹǹȇǵǹǬǮDZǽǽǶǬǸǴǹǺǸǰǷȋǻǼǴȋǾǹǺǯǺǮǼDZǸȋǻǼǺǮǺDzǰDZǹǴȋǚǼǴǯǴǹǬǷȈǹȇǵǬǼǺȃǹȇǵǻǺǯǼDZǭǺǶ ǟǽǬǰȈǭǬǻǼDZǰǷǬǯǬȊǾǽȋǽǻǼǿǰǺǸǷǿǯǬǸǴǸǸǷDZǽǬǴǺǾǰDZǷȈǹȇǸǿȃǬǽǾǶǺǸǰǷȋǽǾǼǺǴǾDZǷȈǽǾǮǬ

Cena / Price / ǢDZǹǬ: 9.300.000 Kč / CZK 9,300,000 Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Elán, Smetanova 240, Úvaly 90

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Šárka Kováčová Kontakt: +420 281 866 806 E-mail: sarka.kovacova@century21.cz

9ê+/('1$&(/2835$+83$125$0$2)(17,5(35$*8(ǚǍǓǚǜǙǧǕǎǔǐǙnjǛǜnjǏǟ -HGLQHÿQëPH]RQHWRYëE\WPVWHUDVRXPDYëKOHGHPQDFHORX3UDKX1RYiSŢGQtYHVWDYED'LVSR]LFHOX[XVQtY\EDYHQt[NRXSHOQD[ZFäDWQDVNOHS'HVLJQ QiE\WNXQDPtUX9FHQĚE\WXVDPRVWDWQiJDUiæ2SUDYHQëGŢP]WëFKOHWVSŐHG]DKUiGNRXDVYëWDKHPQDOXNUDWLYQtPPtVWĚ3UDK\9VRXVHGVWYt1iURGQtWHFKQLFNpPX]HXP /HWHQVNë]iPHÿHN/HWHQVNpVDG\0H]RQHWRYëE\WYDQDG]HPQtPSRGODæt]DUXÿXMHVRXNURPtVYëPQiMHPQtNŢP9HONRU\VHŐHäHQëRE\WQëSURVWRUMH]ŐHMPëLKQHGSŐLYFKRGX GRE\WX.XFK\ŁMtGHOQDREëYDFtSRNRMP6WŐHäQtRNQDVDW\SLFNëPSUŢQLNHPVYĚWODXPRFŁXMt]iæLWHN]SRKRG\DNOLGXSŐLQiYUDWXGRPŢ]UXFKXYHONRPĚVWD 9ëKOHGQD9OWDYX3UDæVNëKUDG.DWHGUiOXVY9tWD1iURGQtGLYDGOR3HWŐtQVNRXUR]KOHGQXåLæNRYVNRXWHOHYL]QtYĚæ«7HUDVDRULHQWRYDQiQDMLæQtVWUDQXYFKRG]JDOHULH1XWQRYLGĚW

8QLTXHPñGRXEOHVWRUH\ÁDWZLWKPñWHUUDFHSURYLGLQJDYLHZRIWKHHQWLUH3UDJXH1HZO\EXLOWDWWLFLQWHULRU'LVSRVLWLRQOX[XU\HTXLSPHQW[EDWKURRPV[:&V GUHVVLQJURRPFHOODU&XVWRPGHVLJQHGIXUQLWXUH7KHÁDWSULFHLQFOXGHVDVHSDUDWHJDUDJH7KLVLVDUHFRQVWUXFWHGV·EXLOGLQJZLWKIURQWJDUGHQDQGOLIWLQWKHSUHVWLJLRXVORFD WLRQRI3UDJXH,QWKHYLFLQLW\DUHWKH1DWLRQDO7HFKQLFDO0XVHXP/HWQi&KDWHDXDQG/HWQi*DUGHQV7KLVPDLVRQHWWHÁDWRQWKHWKDQGWKÁRRUVJXDUDQWHHVSULYDF\WRLWV LQKDELWDQWV7KHJHQHURXVO\GHVLJQHGOLYLQJDUHDLVREYLRXVXSRQHQWHULQJWKHÁDW7KHNLWFKHQGLQLQJURRPDQGOLYLQJURRPKDYHDWRWDODUHDRIPñ5RRIZLQGRZVZLWKDW\SLFDOOLJKW GLIIXVLRQHQKDQFHWKHIHHOLQJRIZHOOEHLQJDQGFDOPZKHQUHWXUQLQJKRPHIURPWKHQRLVHRIWKHPHWURSROLV9LHZRI9OWDYD5LYHU3UDJXH&DVWOH6W9LWXV&DWKHGUDO1DWLRQDO7KHDWUH 3HWŐtQREVHUYDWLRQWRZHUåLæNRYWHOHYLVLRQWRZHU«7KHJDOOHU\KDVDQH[LWRQWRWKH6RXWKIDFLQJWHUUDFH7KLVLVDPXVWVHH ǟǹǴǶǬǷȈǹǬȋǸDZdzǺǹDZǾǶǮǬǼǾǴǼǬǹǺǮǬȋǸǬǹǽǬǼǰǹǬȋǻǼǴǽǾǼǺǵǶǬǸǾDZǼǼǬǽǬǸǽǺǭdzǺǼǹȇǸǮǴǰǺǸǹǬǯǺǼǺǰǖǮǬǼǾǴǼǬǼǺǽǶǺȄǹǺǺǭǺǼǿǰǺǮǬǹǹǬȋǮǬǹǹȇDZ ǶǺǸǹǬǾȇ   ǾǿǬǷDZǾǬ  ǯǬǼǰDZǼǺǭ ǻǺǰǮǬǷ ǘDZǭDZǷȈ ǻǺ ǴǹǰǴǮǴǰǿǬǷȈǹǺǸǿ dzǬǶǬdzǿ ǎ ǽǾǺǴǸǺǽǾȈ ǶǮǬǼǾǴǼȇ ǮȁǺǰǴǾ ǺǾǰDZǷȈǹȇǵ ǯǬǼǬDz ǐǺǸ ȁ ǯǺǰǺǮ ǻǺǽǷDZ ǼDZǶǺǹǽǾǼǿǶȂǴǴ ǽ ǻǬǷǴǽǬǰǹǴǶǺǸǷǴȀǾǺǸǹǬǻǺǻǿǷȋǼǹǺǸǸDZǽǾDZǮǛǼǬǯDZǼȋǰǺǸǽǸǿdzDZDZǸǙǬȂǴǺǹǬǷȈǹȇǸǾDZȁǹǴȃDZǽǶǴǸǸǿdzDZDZǸǗDZǾDZǹǽǶǴǸǴǽǬǰǬǸǴǖǮǬǼǾǴǼǬǰǿǻǷDZǶǽǹǬȁǺǰǴǾǽȋǹǬǴ ȉǾǬDzǬȁǯǬǼǬǹǾǴǼǿDZǾǶǺǹȀǴǰDZǹȂǴǬǷȈǹǺǽǾȈǽǮǺǴȁǬǼDZǹǰǬǾǺǼǺǮǚǾǷǴȃǹǬȋǻǷǬǹǴǼǺǮǶǬDzǴǷǺǵǻǷǺȅǬǰǴǮǴǰǹǬǿDzDZǻǼǴǮȁǺǰDZǮǶǮǬǼǾǴǼǿǖǿȁǹȋǽǾǺǷǺǮǬȋǯǺǽǾǴǹǬȋǸ ǘǬǹǽǬǼǰǹȇDZǺǶǹǬǽǬǾǴǻǴȃǹȇǸǻǼǺǹǴǶǹǺǮDZǹǴDZǸǽǮDZǾǬǿǽǴǷǴǮǬȊǾǺȅǿȅDZǹǴȋǸǴǼǬǴǽǻǺǶǺǵǽǾǮǴȋǻǼǴǮǺdzǮǼǬȅDZǹǴǴǰǺǸǺǵǴdzǯǺǼǺǰǽǶǺǵǽǿDZǾȇǎǴǰǹǬǼDZǶǿǎǷǾǬǮǬǛǼǬDzǽǶǴǵ ǏǼǬǰǽǺǭǺǼǝǮȋǾǺǯǺǎǴǾǬǙǬȂǴǺǹǬǷȈǹȇǵǾDZǬǾǼǛDZǾǼDzǴǹǽǶǿȊǭǬȄǹȊǾDZǷDZǭǬȄǹȊǮǼǬǵǺǹDZǒǴDzǶǺǮǞDZǼǼǬǽǬǺǼǴDZǹǾǴǼǺǮǬǹǬǹǬȊDzǹǿȊǽǾǺǼǺǹǿǮȁǺǰǴdzǯǬǷDZǼDZǴǚǭȋdzǬǾDZǷȈǹǺ ǽǾǺǴǾǷǴȃǹǺǺdzǹǬǶǺǸǴǾȈǽȋǽǶǮǬǼǾǴǼǺǵ

&HQD3ULFHǢDZǹǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Elán, Smetanova 240, Úvaly 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

91


Realitní makléř: Roman Šenigla Kontakt: +420 725 293 491 E-mail: roman.senigla@century21.cz

352'(-/8;861Ì9,/<6.5<7ê0%$=e1(0%5$1'ê61$'/$%(06$/(2)/8;85<9,//$:,7+&29(5('6:,00,1*322/%5$1'ê61$'/$%(0 1DEt]tPHH[NOX]LYQĚOX[XVQtYLOXXæLWQiSORFKDP]DVWDYĚQiPSORFKDSDUFHO\PY%UDQGëVHQDG/DEHPXO=iU\EVNi9SŐt]HPtGRPX]HYVWXSQt FKRGE\YFKi]tPHGRNXFK\QĚSURSRMHQpVMtGHOQRXDREëYDFtPSRNRMHPDQiVOHGQĚGRSURVNOHQpKRDWULD=FKRGE\MH]iURYHŁYVWXSGRUHOD[DÿQtKRFHQWUDVED]pQHP9 SUYQtPSDWŐHGRPXMHRE\WQiÿiVWREVDKXMtFtÿW\ŐLSRNRMHDYJDOHULLGRPXMHXPtVWĚQDSUDFRYQD9HYäHFKSRNRMtFKMVRXNOLPDWL]DÿQtMHGQRWN\9HVNOHSĚGRPXMVRXWHFK QLFNpPtVWQRVWLDGYRMJDUiæ6DPR]ŐHMPRVWtMHDODUPVPRæQRVWtQDSRMHQtQDSXOWFHQWUiOQtRFKUDQ\9LODE\ODNRODXGRYiQDYURFHDE\ODVWDYĚQDGOHQiYUKXDUFKLWHNWD ,QJDUFK6DUDOMLÿH3R]HPHNMHURYLQDWëRVi]HQëMLæY]URVWORX]HOHQtDY\EDYHQ]DYODæRYDFtP]DŐt]HQtP

:HRIIHUDQH[FOXVLYHOX[XU\YLOODZLWKXWLOLW\DUHDRIPñEXLOWXSDUHDRIPñRQDPñSORWLQ=iU\EVNi6WUHHW%UDQGëVQDG/DEHP)URPWKHHQWUDQFHKDOORQWKH JURXQGÁRRURQHHQWHUVWKHNLWFKHQFRQQHFWHGWRWKHGLQLQJURRPDQGOLYLQJURRPDQGVXEVHTXHQWO\WRDJODVVHGLQDWULXP)URPWKHHQWUDQFHKDOOLWLVDOVRSRVVLEOHWRHQWHUWKHHQ WHUWDLQPHQWFHQWUHZLWKVZLPPLQJSRRO7KHUHVLGHQWLDOSDUWRQWKHÀUVWÁRRUFRQVLVWVRIIRXUURRPVZLWKDVWXG\VLWXDWHGLQWKHORJJLD7KHUHDUHDLUFRQGLWLRQLQJXQLWVLQDOOWKHURRPV 7KHEDVHPHQWFRQWDLQVWHFKQLFDOURRPVDQGDGRXEOHJDUDJH7KHUHLVDQDODUPGHYLFHZLWKWKHSRVVLELOLW\RIFRQQHFWLRQWRDFHQWUDOL]HGSURWHFWLRQXQLW7KHYLOODZDVDSSURYHGLQ DQGEXLOWDFFRUGLQJWRWKHSURSRVDORIDUFKLWHFW,QJDUFK6DUDOMLÿ7KHJDUGHQLVRQÁDWJURXQGZLWKHVWDEOLVKHGYHJHWDWLRQDQGHTXLSSHGZLWKDQLUULJDWLRQV\VWHP

ǛǜǚǐnjǒnjǜǚǝǖǚǤǙǚǕǎǔǗǗǧǝǖǜǧǞǧǘǍnjǝǝǑǕǙǚǘǍǜnjǙǐǔǝǙnjǐǗnjǍǑǘ ǛǼDZǰǷǬǯǬDZǸȉǶǽǶǷȊdzǴǮǹǿȊǮǴǷǷǿDzǴǷǬȋǻǷǺȅǬǰȈǸdzǬǽǾǼǺDZǹǺǸǿȃǬǽǾǺǶǸǮǍǼǬǹǰǴǽDZǹǬǰǗǬǭDZǸǿǷ=iU\EVNiǙǬǻDZǼǮǺǸȉǾǬDzDZǰǺǸǬǴdzǻǼǴȁǺDzDZǵ ǸǺDzǹǺǻǺǻǬǽǾȈǮǶǿȁǹȊǺǭȆDZǰǴǹDZǹǹǿȊǽǺǽǾǺǷǺǮǺǵǴǯǺǽǾǴǹǺǵǬdzǬǾDZǸǮǽǾDZǶǷȋǹǹȇǵǬǾǼǴǿǸǔdzǻǼǴȁǺDzDZǵǾǬǶDzDZǰǺǽǾǿǻǶǽǻǬȂDZǹǾǼǿǽǭǬǽǽDZǵǹǺǸǙǬǻDZǼǮǺǸȉǾǬDzDZǰǺǸǬ ǹǬȁǺǰǴǾǽȋDzǴǷǬȋȃǬǽǾȈǽȃDZǾȇǼȈǸȋǶǺǸǹǬǾǬǸǴǬǹǬǯǬǷDZǼDZDZǹǬȁǺǰǴǾǽȋǼǬǭǺȃǴǵǶǬǭǴǹDZǾǎǺǮǽDZȁǶǺǸǹǬǾǬȁDZǽǾȈǶǺǹǰǴȂǴǺǹDZǼȇǎǻǺǰǮǬǷDZǰǺǸǬǹǬȁǺǰȋǾǽȋǯǬǼǬDzǹǬǰǮDZǸǬȄǴǹȇ ǴǻǺǰǽǺǭǹȇDZǻǺǸDZȅDZǹǴȋǝǬǸǺǽǺǭǺǵǼǬdzǿǸDZDZǾǽȋǮǺdzǸǺDzǹǺǽǾȈǻǺǰǶǷȊȃDZǹǴȋǽǴǯǹǬǷǴdzǬȂǴǴǶǻǿǹǶǾǿȂDZǹǾǼǬǷȈǹǺǵǺȁǼǬǹȇǎǴǷǷǬǻǼǺȄǷǬǻǼǴDZǸǶǿ ǶǺǷǬǿǰǬȂǴȊ ǮǯǺǰǿǴ ǭȇǷǬǻǺǽǾǼǺDZǹǻǺǻǼǺDZǶǾǿǬǼȁǴǾDZǶǾǺǼǬǴǹDzDZǹDZǼǬǝǬǼǬǷǵǴȃDZǟȃǬǽǾǺǶǼǬǮǹǴǹǹȇǵǽǺǮdzǼǺǽǷȇǸǴdzDZǷDZǹȇǸǴǹǬǽǬDzǰDZǹǴȋǸǴǺǽǹǬȅDZǹǽǴǽǾDZǸǺǵǿǮǷǬDzǹDZǹǴȋ

&HQDYÿSURYL]H5.3ULFHLQFFRPPLVVLRQRIWKHUHDOHVWDWHDJHQF\ǮǶǷǶǺǸǴǽǽǴȊǬǯDZǹǾǽǾǮǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Plus+, Jankovcova 1596/14, Prague 17 - Holešovice 92

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Martin Hušpauer Kontakt: +420 725 293 493 E-mail: martin.huspauer@century21.cz

52',11ê'š09ŏ(91,&Ì&+35$+$=É3$')$0,/<+286(,1ŏ(91,&(35$*8(:(67ǐǚǘŏ(91,&(ǛǜnjǏnjǓnjǛnjǐ 3R]HPHNPVSDQDURPDWLFNëPYëKOHGHPGR~GROt%HURXQN\$WUDNWLYQtMLæQtVYDKQDGFHQWUHPŏHYQLFVSRKOHGHPGR~GROt%HURXQN\QDEt]tSR]HPHNPV YODVWQtPOHVHP'ŢPMHVLWXRYDQëQDKRUQtPRNUDMLSDUFHO\VYODVWQtSŐtVWXSRYRXFHVWRX]DÿtQDMtFt]NRPXQLNDFH]DNRQÿHQpSDUNRYDFtSORFKRXSURDXWDDYMH]GHPGRJDUi æHSURYR]\2E\WQëSURVWRUMHNRQFLSRYiQGYRXJHQHUDÿQĚVSRGQtÿiVWWYRŐtMHGQRWNDVHYVWXSHPQDVSRGQtÿiVWSR]HPNXDPHQät]DKUDGXYODVWQtPVRF]i]HPtP DWHFK]i]HPtPGRPXVSROXV~ORæQëPLPtVWQRVWPL+RUQtÿiVWMHŐHäHQDMDNRKODYQtREëYDFtSURVWRUGLVSR]LFHGĚOHQëQDREëYDFtSRNRMPNXFK\ŁDVRXNURPRX ]yQXORæQLFDSRNRMŢ=REëYDFtKRSRNRMHVHYVWXSXMHQDKRUQtWHUDVXDGRÿiVWL]DOHVQĚQpKRSR]HPNX1HFK\EtED]pQRYiKDODRGSRÿtYiUQRXDZKLUOSRROHP'ŢPE\O YORNDOLWĚY\VWDYĚQMDNRQRYRVWDYED]URNXRFHONRYpRE\WQpSORäHPNWHUiQDYD]XMHQDVRXVHGQtGRP\DYLO\VKLVWRULtSRÿiWNXNRQFHDSRÿiWNXVWROHWt 7KHKRXVHLVVLWXDWHGRQWKHXSSHUHGJHRIDPñSORWZLWKLWVRZQIRUHVWRQWKHDWWUDFWLYHVRXWKHUQVORSHDERYHWKHFHQWUHRIŏHYQLFHZLWKDYLVWDRIWKH%HURXQND9DOOH\7KH SULYDWHDFFHVVURDGVWDUWVIURPWKHSXEOLFWUDQVSRUWWHUPLQXVDQGHQGVLQDFDUSDUNDQGHQWUDQFHWRWKHYHKLFOHJDUDJH7KHUHVLGHQWLDODUHDFRPSULVHVVSDFHIRUWZRJHQHUDWLRQV 7KHORZHUSDUWFRQVLVWVRIXQLWZLWKHQWUDQFHWRWKHORZHUSDUWRIWKHSORWDQGDVPDOOHUJDUGHQLWVRZQVHZHUDJHDQGWHFKQLFDOIDFLOLWLHVDVZHOODVVWRUHURRPV7KHXSSHUSDUWLV GHVLJQHGDVWKHSULQFLSDOUHVLGHQWLDODUHDZLWKOD\RXWGLYLGHGLQWRDPñOLYLQJURRPNLWFKHQDQGSULYDWH]RQHRIEHGURRPVDQGH[WUDURRPV,WLVSRVVLEOHWRHQWHUWKHXSSHU WHUUDFHIURPWKHOLYLQJURRPDQGWKHIRUHVWHGSDUWRIWKHSORW7KHUHLVDOVRDQHQWHUWDLQPHQWFHQWUHZLWKVZLPPLQJSRROUHVWURRPDQGZKLUOSRRO7KHKRXVHZDVQHZO\EXLOWLQWKHORFDOLW\ LQZLWKDWRWDOÁRRUDUHDRIPñZKLFKLVLQFRQFRUGZLWKWKHQHLJKERXULQJKRXVHVDQGYLOODVZLWKDKLVWRU\GDWLQJEDFNWRWKHHQGRIWKDQGEHJLQQLQJRIWKHWKFHQWXULHV ǟȃǬǽǾǺǶǸǽǻǬǹǺǼǬǸǹȇǸǮǴǰǺǸǹǬǰǺǷǴǹǿǼDZǶǴǍDZǼǺǿǹǶǴǙǬǻǼǴǮǷDZǶǬǾDZǷȈǹǺǸȊDzǹǺǸǽǶǷǺǹDZǹǬǰȂDZǹǾǼǺǸǜDzDZǮǹǴȂǽǮǴǰǺǸǹǬǰǺǷǴǹǿǍDZǼǺǿǹǶǴǹǬȁǺǰǴǾǽȋ ǸǿȃǬǽǾǺǶǽǽǺǭǽǾǮDZǹǹȇǸǷDZǽǺǸǐǺǸǼǬǽǻǺǷǺDzDZǹǹǬǮDZǼȁǹDZǸǶǼǬȊǿȃǬǽǾǶǬǽǽǺǭǽǾǮDZǹǹȇǸǻǺǰȆDZdzǰǹȇǸǻǿǾDZǸǹǬȃǴǹǬȊȅDZǵǽȋǺǾǶǺǸǸǿǹǴǶǬȂǴǵǴǻǼǴǮǺǰȋȅDZǵǶǽǾǺȋǹǶDZ ǰǷȋ ǬǮǾǺǸǺǭǴǷDZǵ Ǵ ǮȆDZdzǰǿ Ǯ ǯǬǼǬDz ǹǬ  ǸǬȄǴǹȇ ǖǺǹȂDZǻǾ DzǴǷǺǵ dzǺǹȇ ǻǼDZǰǹǬdzǹǬȃDZǹ ǰǷȋ  ǻǺǶǺǷDZǹǴǵ ǮǹǴdzǿ ǼǬǽǻǺǷǺDzDZǹǬ ǶǮǬǼǾǴǼǬ   ǽǺ ǮȁǺǰǺǸ ǹǬ ǹǴDzǹȊȊ ȃǬǽǾȈ ǿȃǬǽǾǶǬǴǸǬǷȇǵǽǬǰǴǶǽǺǭǽǾǮDZǹǹǺǵǮǬǹǹǺǵǶǺǸǹǬǾǺǵǴǽǬǹǿdzǷǺǸǬǾǬǶDzDZǾDZȁǹǺǷǺǯǴȃDZǽǶǴǸǺǭǺǼǿǰǺǮǬǹǴDZǸǰǺǸǬǮǸDZǽǾDZǽǽǶǷǬǰǽǶǴǸǴǻǺǸDZȅDZǹǴȋǸǴǎDZǼȁǹȋȋȃǬǽǾȈǰǺǸǬ ǻǼDZǰǹǬdzǹǬȃDZǹǬǮǶǬȃDZǽǾǮDZǺǽǹǺǮǹǺǵDzǴǷǺǵǻǷǺȅǬǰǴǼǬdzǰDZǷDZǹǹǺǵǹǬǯǺǽǾǴǹǿȊǸǶǿȁǹȊǴȃǬǽǾǹǿȊdzǺǹǿǽǽǻǬǷȈǹȋǸǴǴǶǺǸǹǬǾǬǸǴǔdzǯǺǽǾǴǹǺǵǸǺDzǹǺǻǺǻǬǽǾȈǹǬ ǮDZǼȁǹȊȊǾDZǼǼǬǽǿǴǹǬȃǬǽǾȈǷDZǽǹǺǯǺǿȃǬǽǾǶǬǑǽǾȈǾǬǶDzDZǭǬǽǽDZǵǹǽǶǺǸǹǬǾǺǵǺǾǰȇȁǬǴǰDzǬǶǿdzǴǐǺǸǶǬǶǹǺǮǺDZdzǰǬǹǴDZǭȇǷǻǺǽǾǼǺDZǹǮǺǭȅǬȋǻǷǺȅǬǰȈǸǺǹǽǮȋdzǬǹ ǽǽǺǽDZǰǹǴǸǴǰǺǸǬǸǴǴǮǴǷǷǬǸǴǮDZǰǿȅǴǸǴǴǽǾǺǼǴȊǽǶǺǹȂǬǯǺǴǹǬȃǬǷDZǯǺǮDZǶǬ

&HQDYÿSURYL]H5.3ULFHLQFFRPPLVVLRQRIWKHUHDOHVWDWHDJHQF\ǮǶǷǶǺǸǴǽǽǴȊǬǯDZǹǾǽǾǮǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Plus+, Jankovcova 1596/14, Prague 17 - Holešovice 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

93


Realitní makléř: Michaela Mošovská Kontakt: +420 725 293 183 E-mail: michaela.mosovska@century21.cz

520$17,&.É86('/267.02'35$+<ǙǚǎǚǝǞǜǚǕǖnjǖǖ9(/.e32329,&(ǛǜnjǏnjǎǚǝǞǚǖ

'RYROXMHPHVL9iPQDEtGQRXWPRGHUQtVYĚWOëDSURVWRUQëE\WYRVREQtPYODVWQLFWYtPRGLVSR]LFLNNVEDONRQHPDFHONRYRXSRGODKRYRXSORFKRXPYH13QRYRVWDYE\1RYi+DUID,]URNX%\WVHQDFKi]tYNOLGQp ORNDOLWĚVYëERUQRXGRVWXSQRVWtGRFHQWUDPĚVWDDYHäNHURXREÿDQVNRXY\EDYHQRVWt%\WMHRULHQWRYiQGRYQLWUREORNXYGRFKi]NRYpY]GiOHQRVWLQDWUDPYDMDDXWREXVVWDQLFHPHWUD9\VRÿDQVNiVHQDFKi]tWDNWpæQHGDOHNR%\W PiGYDVDPRVWDWQpSRNRMH[NRPRUXYE\WĚXSUDYHQRXGRSRGRE\äDWQ\VGRVWDWNHP~ORæQpKRSURVWRUXSROLFHäDWQtW\ÿDGUiWĚQëSURJUDP9ORæQLFLMHYHONiYHVWDYĚQiURKRYiäDWQtVNŐtŁRII/LERYLFNë7DNWpæNXFK\ŁVNi OLQNDMHY\UREHQDQDPtUXRGVWHMQpÀUP\MHY\EDYHQDYHVWDYĚQëPLVSRWŐHELÿL:KLUSRROOHGQLFHVHVDPRVWDWQëPPUD]iNHPPLNURYOQQiWURXEDP\ÿNDQDQiGREtGŐH]DEDWHULH)UDQNHDNDPHQLQRYiSUDFRYQtGHVND$(* VNORNHUDPLFNiGHVNDDKRUNRY]GXäQiWURXEDVPQRKDIXQNFHPL9NRXSHOQĚVHQDFKi]tYDQDVXP\YDGOHP:&DHOHNWULFNpVXätFt]DŐt]HQt9E\WĚMVRXEH]SHÿQRVWQtGYHŐHRGÀUP\1(;7DGRPiFtVWURSQtDODUPQDYäHFK RNQHFKMVRXQDLQVWDORYiQ\æDOX]LH.E\WXGiOHQiOHætSURVWRUQiNRPRUDQDFKRGEĚVæHOH]QëPLSROLFHPLDJDUiæRYpVWiQtYëERUQĚXPtVWĚQpQHGDOHNRYëWDKX'DOätPRæQRVWtSDUNRYiQtMHY]DVWŐHäHQpPSRGORXEtXGRPX9E\WĚ MH]DYHGHQëNDEHOQD79,QWHUQHWDWHOHIRQ1DSRGODKiFKYSRNRMtFKMHOLQRLPLWDFHGŐHYĚQpSRGODK\QDFKRGEĚDYäDWQĚMHGODæED :HRIIHUWKLVPRGHUQOLJKWDQGVSDFLRXVÁDWXQGHUSHUVRQDORZQHUVKLSNNZLWKDEDOFRQ\DQGWRWDOÁRRUDUHDRIPñ,WLVVLWXDWHGRQWKHWKÁRRURI1RYi+DUID 1HZ+DUS ,DEXLOGLQJQHZO\FRQVWUXFWHGLQ7KH ÁDWIDFLQJWKHFRXUW\DUGLVORFDWHGLQDTXLHWVHWWLQJZLWKH[FHOOHQWDFFHVVWRWKHFLW\FHQWUHDQGDOOFLYLFDPHQLWLHV,WLVZLWKLQZDONLQJGLVWDQFHRIWUDPDQGEXVVWRSVDQGWKH9\VRÿDQVNi0HWURVWDWLRQLVDOVRQHDUE\7KHÁDW KDVWZRVHSDUDWHURRPVURRPLVHTXLSSHGDVDGUHVVLQJURRPZLWKSOHQW\RIVWRUDJHVSDFHVKHOYHVFORWKHVUDLODQGZLUHSURGXFWV7KHEHGURRPFRQWDLQVDELJEXLOWLQFRUQHUZDUGUREHE\WKH/LERYLFNëFRPSDQ\7KHNLWFKHQ XQLWLVDOVRFXVWRPPDGHE\WKHVDPHFRPSDQ\HTXLSSHGZLWK:KLUOSRRODSSOLDQFHVIULGJHZLWKVHSDUDWHIUHH]HUPLFURZDYHGLVKZDVKHUVLQN)UDQNHWDSVDQGVWRQHZDUHZRUNWRS$(*JODVVFHUDPLFKREDQGKRWDLURYHQ ZLWKPDQ\IXQFWLRQV7KHEDWKURRPFRQWDLQVDEDWKWXEZDVKEDVLQWRLOHWDQGHOHFWULFGU\LQJUDLO7KHÁDWLVHTXLSSHGZLWKD1(;7VHFXULW\GRRUDQGKRPHDODUPV\VWHP-DORXVLHVDUHLQVWDOOHGRQDOOWKHZLQGRZV7KHUHLVDOVR DVSDFLRXVURRPZLWKLURQVKHOYHVLQWKHFRUULGRU7KHSDUNLQJED\LVIDYRXUDEO\ORFDWHGQHDUWKHOLIW$QRWKHURSWLRQLVSDUNLQJXQGHUWKHFRYHUHGDUFDGHRIWKHEXLOGLQJ&DEOHVIRU79,QWHUQHWDQGWHOHSKRQHDUHDYDLODEOHLQWKH ÁDW7KHURRPÁRRUVDUHFRYHUHGZLWKOLQROHXP²LPLWDWLRQZRRGÁRRULQJWKHFRUULGRUDQGGUHVVLQJURRPKDYHWLOHGÁRRUV ǛǼDZǰǷǬǯǬDZǸǽǺǮǼDZǸDZǹǹǿȊǻǼǺǽǾǺǼǹǿȊǴǽǮDZǾǷǿȊǶǮǬǼǾǴǼǿǮȃǬǽǾǹǺǵǽǺǭǽǾǮDZǹǹǺǽǾǴǛǷǬǹǴǼǺǮǶǬNNǭǬǷǶǺǹǺǭȅǬȋǻǷǺȅǬǰȈǸǵȉǾǬDzǮǹǺǮǺǸdzǰǬǹǴǴ©1RYi+DUID,ªǯǺǰǻǺǽǾǼǺǵǶǴǖǮǬǼǾǴǼǬ ǹǬȁǺǰǴǾǽȋ Ǯ ǾǴȁǺǸ ǼǬǵǺǹDZ ǽ ǻǼDZǶǼǬǽǹȇǸ ǾǼǬǹǽǻǺǼǾǹȇǸ ǽǺǺǭȅDZǹǴDZǸ ǰǺ ȂDZǹǾǼǬ ǯǺǼǺǰǬ Ǵ ȁǺǼǺȄDZǵ ǴǹȀǼǬǽǾǼǿǶǾǿǼǺǵ ǖǮǬǼǾǴǼǬ ǺǼǴDZǹǾǴǼǺǮǬǹǬ  ǮǺ ǰǮǺǼ ǹDZǽǶǺǷȈǶǺ ǸǴǹǿǾ ȁǺǰȈǭȇ ǰǺ ǾǼǬǸǮǬǵǹǺǵ Ǵ ǬǮǾǺǭǿǽǹǺǵ ǺǽǾǬǹǺǮǺǶǽǾǬǹȂǴȋǸDZǾǼǺ©ǎȇǽǺȃǬǹǽǶǬªǾǬǶDzDZǹǬȁǺǰǴǾǽȋǹDZǻǺǰǬǷDZǶǿǎǶǮǬǼǾǴǼDZǰǮDZǺǾǰDZǷȈǹȇDZǶǺǸǹǬǾȇǶǷǬǰǺǮǬȋǻDZǼDZǰDZǷǬǹǹǬȋǮǯǬǼǰDZǼǺǭǹǿȊǽǭǺǷȈȄǴǸǶǺǷǴȃDZǽǾǮǺǸǸDZǽǾǰǷȋǽǶǷǬǰǴǼǺǮǬǹǴȋǮDZȅDZǵ³ǻǺǷǶǴ ǴǰǼǮǹǿǾǼDZǹǹDZDZǺǭǺǼǿǰǺǮǬǹǴDZȄǶǬȀǬǎǽǻǬǷȈǹDZǭǺǷȈȄǺǵǮǽǾǼǺDZǹǹȇǵǿǯǷǺǮǺǵȄǶǬȀǺǾȀǴǼǸȇ©/LERYLFNëªǖǿȁǹȋǻǺǰǼǬdzǸDZǼǺǾǾǺǵDzDZǶǺǸǻǬǹǴǴǺǭǺǼǿǰǺǮǬǹǴDZ:KLUOSRROȁǺǷǺǰǴǷȈǹǴǶǽǺǾǰDZǷȈǹǺǵǸǺǼǺdzǴǷȈǹǺǵ ǶǬǸDZǼǺǵǸǴǶǼǺǮǺǷǹǺǮǬȋǻDZȃȈǻǺǽǿǰǺǸǺDZȃǹǬȋǸǬȄǴǹǬǼǬǶǺǮǴǹǬǴǶǼǬǹ)UDQNHǴǼǬǭǺȃǬȋǻǬǹDZǷȈǴdzǶǬǸDZǹǹǺǵǶDZǼǬǸǴǶǴ$(*ǻǷǴǾǬ ǽǾDZǶǷǺǶDZǼǬǸǴǶǬ ǴǰǿȁǺǮǶǬǽǭǺǷȈȄǴǸǶǺǷǴȃDZǽǾǮǺǸȀǿǹǶȂǴǵǎǮǬǹǹǺǵǶǺǸǹǬǾDZ ǮǬǹǹǬǽǼǬǶǺǮǴǹǺǵǾǿǬǷDZǾǴȉǷDZǶǾǼǴȃDZǽǶǺDZǽǿȄǴǷȈǹǺDZǺǭǺǼǿǰǺǮǬǹǴDZǎǶǮǬǼǾǴǼDZǭDZdzǺǻǬǽǹȇDZǰǮDZǼǴǺǾȀǴǼǸȇ1(;7ǴǻǺǾǺǷǺȃǹǬȋǽǴǯǹǬǷǴdzǬȂǴȋǹǬǮǽDZȁǺǶǹǬȁǿǽǾǬǹǺǮǷDZǹȇDzǬǷȊdzǴǖǶǮǬǼǾǴǼDZǺǾǹǺǽǴǾǽȋǻǼǺǽǾǺǼǹǬȋ ǶǷǬǰǺǮǬȋǮǻǼǴȁǺDzDZǵǽDzDZǷDZdzǹȇǸǴǻǺǷǶǬǸǴǴǯǬǼǬDzǹǬȋǽǾǺȋǹǶǬǼȋǰǺǸǽǷǴȀǾǺǸǐǼǿǯǺǵǮǬǼǴǬǹǾǻǬǼǶǺǮǶǴǮdzǬǶǼȇǾǺǵǬǼǶDZǰǺǸǬǎǶǮǬǼǾǴǼDZǶǬǭDZǷȈǰǷȋǞǎǴǹǾDZǼǹDZǾǴǾDZǷDZȀǺǹǙǬǻǺǷǿǮǶǺǸǹǬǾǬȁǷǴǹǺǷDZǿǸ ǴǸǴǾǬȂǴȋǰDZǼDZǮǬǮǻǼǴȁǺDzDZǵǴǮǯǬǼǰDZǼǺǭDZǻǷǴǾǶǬ

&HQD3ULFHǢDZǹǬ 3.149.000 Kč / CZK 3,149,000 Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Energy, Korunní 1167/43, Praha 2 – Vinohrady 94

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Ondřej Skokan Kontakt: +420 720 150 000 E-mail: ondrej.skokan@century21.cz

'RYROXMHPHVL9iPQDEtGQRXWQiGKHUQRXYLOXVXæLWQRXSORFKRXPYOXNUDWLYQtORNDOLWĚ3UDK\6WRGŢOHNSŐtPRQDRNUDMLOHVDNGHPDMLWHOŢPQDEt]tDEVROXWQtVRXNURPtDNOLG RGUXFKXPĚVWD1HWUDGLÿQĚŐHäHQëSURVWRUGRPXXPRæŁXMHE\GOHQtMDNYtFHÿOHQQpURGLQĚWDNSRVORXætLMDNRUHSUH]HQWDWLYQtVtGORÀUP\'ŢPVHVWRMtQDSR]HPNXRUR]OR]HP =DKUDGDNROHPGRPXMHXGUæRYDQiVHY]URVWOëPLVWURP\NHŐLDVNOHQtNHPVSŐtSUDYRXQDYHQNRYQtED]pQ9RNROtGRPXVHQDFKi]tYHäNHUiREÿDQVNiY\EDYHQRVWäNRO\äNRON\UHVWDX UDFHREFKRG\OpNiUQ\EDQNRPDW\SURPLORYQtN\VSRUWXYRNROtYHGHQĚNROLNF\NORWUDVYEOt]NRVWL.DOYiULHY0RWROH0RWROVNëRUGRYLNQHERSŐtURGQtSDUN.RätŐH0RWRO9GRFKi]NRYp Y]GiOHQRVWLRGGRPXVHQDFKi]tWUDPYDMRYp]DVWiYND.UHPDWRULXP0RWROVYëERUQRXGRVWXSQRVWtGRFHQWUD :HZRXOGOLNHWRRIIHU\RXDEHDXWLIXOYLOODZLWKXWLOLW\DUHDRIPñLQWKHSUHVWLJLRXVORFDOLW\RI3UDJXH²6WRGŢON\ULJKWRQWKHHGJHRIWKHIRUHVWZKLFKDIIRUGVRZQHUVDEVROXWH SULYDF\DQGWUDQTXLOOLW\DZD\IURPWKHFLW\QRLVH7KHQRQWUDGLWLRQDOO\GHVLJQHGKRXVHLVERWKVXLWDEOHDVDUHVLGHQFHIRUDODUJHIDPLO\RUDVWKHKHDGTXDUWHUVRIDFRPSDQ\7KHKRXVH LVEXLOWRQDSORWRIPñ7KHJDUGHQDURXQGWKHKRXVHLVPDLQWDLQHGZLWKHVWDEOLVKHGWUHHVVKUXEVDQGDJUHHQKRXVHDQGKDVSURYLVLRQIRUDQRXWGRRUVZLPPLQJSRRO$OOFLYLF DPHQLWLHVDUHVLWXDWHGLQWKHYLFLQLW\²VFKRROVNLQGHUJDUWHQVUHVWDXUDQWVVKRSVSKDUPDFLHV$706SRUWVHQWKXVLDVWVZLOODSSUHFLDWHVHYHUDOF\FOLQJURXWHVWKH.DOYiULHY0RWROH SURWHFWHGDUHD0RWROVNëRUGRYLN1DWXUDO0RQXPHQWDVZHOODVWKH.RätŐH0RWRO1DWXUH3DUN7KH.UHPDWRULXP0RWROWUDPVWRSLVZLWKLQZDONLQJGLVWDQFHZLWK H[FHOOHQWDFFHVVLELOLW\WRWKHFLW\FHQWUH ǛǼDZǰǷǬǯǬDZǸǶǼǬǽǴǮǿȊǮǴǷǷǿǽDzǴǷǺǵǻǷǺȅǬǰȈȊǸǮǻǺǻǿǷȋǼǹǺǸǼǬǵǺǹDZǛǼǬǯǬǝǾǺǰǿǷǶǴǻǼȋǸǺǹǬǶǼǬȊǷDZǽǬǯǰDZǮǷǬǰDZǷȈȂȇǭǿǰǿǾǴǸDZǾȈǬǭǽǺǷȊǾǹǺDZǿDZǰǴǹDZǹǴDZǴǻǺǶǺǵ ǺǾǯǺǼǺǰǽǶǺǵǽǿDZǾȇǙDZǾǼǬǰǴȂǴǺǹǹǺDZǼDZȄDZǹǴDZǻǼǺǽǾǼǬǹǽǾǮǬǰǺǸǬǻǺdzǮǺǷȋDZǾǾǬǸDzǴǾȈǶǬǶǭǺǷȈȄǺǵǽDZǸȈDZǾǬǶǴǮȇǽǾǿǻǬǾȈǮǶǬȃDZǽǾǮDZǻǼDZǰǽǾǬǮǴǾDZǷȈǽǶǺǯǺǺȀǴǽǬǶǺǸǻǬǹǴǴ ǐǺǸǽǾǺǴǾǹǬǿȃǬǽǾǶDZǻǷǺȅǬǰȈȊǸǎǺǶǼǿǯǰǺǸǬǿȁǺDzDZǹǹȇǵǽǬǰǽǺǮdzǼǺǽǷȇǸǴǰDZǼDZǮȈȋǸǴǶǿǽǾǬǼǹǴǶǬǸǴǴǺǼǬǹDzDZǼDZDZǵǻǺǰǯǺǾǺǮǷDZǹǹǺǵǰǷȋǺǾǶǼȇǾǺǯǺǭǬǽǽDZǵǹǬǐǺǸ ǼǬǽǻǺǷǺDzDZǹǹDZǰǬǷDZǶǺǺǾǮǽDZȁǿǰǺǭǽǾǮȄǶǺǷǰDZǾǽǶǴȁǽǬǰǺǮǼDZǽǾǺǼǬǹǬǸǬǯǬdzǴǹǺǮǬǻǾDZǶǭǬǹǶǺǸǬǾǺǮǰǷȋǷȊǭǴǾDZǷDZǵǽǻǺǼǾǬǮǼǬǵǺǹDZǹǬȁǺǰǴǾǽȋǹDZǽǶǺǷȈǶǺǮDZǷǺǽǴǻDZǰǹȇȁ ǸǬǼȄǼǿǾǺǮǼȋǰǺǸǻǼǴǼǺǰǹȇǵǻǬǸȋǾǹǴǶ©ǖǬǷȈǮǬǼǴȋªǮǘǺǾǺǷDZǘǺǾǺǷǽǶǴǵǺǼǰǺǮǴǶǴǷǴǻǼǴǼǺǰǹȇǵǻǬǼǶ©ǖǺȄǴǼDzDZǘǺǾǺǷªǎǹDZǽǶǺǷȈǶǴȁǸǴǹǿǾǬȁȁǺǰȈǭȇǺǾǰǺǸǬǹǬȁǺǰǴǾǽȋ ǺǽǾǬǹǺǮǶǬǾǼǬǸǮǬȋȱǺǾǷǴȃǹǺDZǾǼǬǹǽǻǺǼǾǹǺDZǽǺǺǭȅDZǹǴDZǰǺȂDZǹǾǼǬǯǺǼǺǰǬ

&HQD3ULFHǢDZǹǬ.ÿ&=. Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Energy, Korunní 1167/43, Praha 2 – Vinohrady 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

95


Realitní makléř: Václav Horák Kontakt: +420 725 293 942 E-mail: vaclav.horak@century21.cz

BYTY V NOVOSTAVBĚ REZIDENCE SEDLEC, PRAHA 6 / APARTMENTS IN A NEWLY BUILT RESIDENCE IN SEDLEC, PRAGUE 6

([NOX]LYQĚQDEt]tPHPRGHUQtE\GOHQtYQRYRVWDYEĚUH]LGHQFH6HGOHF9äHFKQ\E\W\MVRXYHOPLVYĚWOpDSŐtMHPQp%\W\PDæPNDæGëE\WPiWHUDVXQHER YVWXSQD]DKUiGNX.HNDæGpPXE\WXQiOHætVNOHSNU\WiJDUiæRYiVWiQtMHPRæQRGRNRXSLW'ŢPVHQDFKi]tYPDOHEQpPSURVWŐHGtPH]L3RGEDEVNëPLD6HGOHFNëPL VNiODPLVPRæQRVWtMDNWXULVWLFNëFKWUDVWDNF\NORWUDVDSŐLWRPSRXKëFKSiUPLQXWDXWHPÿL0+'RG'HMYLF1ĚNROLNPLQXWFKŢ]HRGGRPXVHQDFKi]tSUHVWLæQt 5LYHUVLGH6FKRRO  ([FOXVLYHO\RIIHULQJEHDXWLIXOVSDFLRXVDQGPRVWLPSRUWDQWO\VXQQ\OLYLQJLQDQHZO\EXLOWUHVLGHQFHLQ6HGOHF7KHDSDUWPHQWVDUHPWRPKDYHDWHUUD FHEDOFRQ\DQGIURQWJDUGHQ*DUDJHED\VDUHLQXQGHUJURXQGJDUDJHVHDFKDSDUWPHQWFRPHVZLWKDEDVHPHQWFORVHW7KHEXLOGLQJLVVLWXDWHGLQDSLFWXUHVTXH VHWWLQJEHWZHHQ3RGEDEDDQG6HGOHFFOLIIVRIIHULQJERWKZDONLQJDQGF\FOLQJWULSV\HWMXVWDIHZPLQXWHV·GULYHRUEXVULGHWR'HMYLFH3UHVWLJLRXV5LYHUVLGH6FKRRO LVMXVWDIHZPLQXWHVZDON

ǖǎnjǜǞǔǜǧǎǙǚǎǚǝǞǜǚǕǖǑǜǑǓǔǐǑǙǢǔǔ6('/(&35$+$$3$570(176,1$1(:/<%8,/75(6,'(1&(,16('/(&35$*8( ǩǶǽǶǷȊdzǴǮǹǺDZǻǼDZǰǷǺDzDZǹǴDZǽǺǮǼDZǸDZǹǹǺǯǺDzǴǷȈȋǮǹDZǰǬǮǹǺǻǺǽǾǼǺDZǹǹǺǵǼDZdzǴǰDZǹȂǴǴǝDZǰǷDZȂǎǽDZǶǮǬǼǾǴǼȇǺȃDZǹȈǽǮDZǾǷȇDZǴǶǼǬǽǴǮȇDZǖǮǬǼǾǴǼȇǺǾ ǸǰǺǸǶǬDzǰǬȋǶǮǬǼǾǴǼǬǴǸDZDZǾǾDZǼǼǬǽǿǴǷǴǮȁǺǰǹǬǽǮǺǵǽǬǰǺǮȇǵǿȃǬǽǾǺǶǟǶǬDzǰǺǵǶǮǬǼǾǴǼȇDZǽǾȈǻǺǰǮǬǷǎǺdzǸǺDzǹǺǰǺǶǿǻǴǾȈǶǼȇǾǿȊǯǬǼǬDzǹǿȊ ǽǾǺȋǹǶǿǐǺǸǼǬǽǻǺǷǺDzDZǹǮDzǴǮǺǻǴǽǹǺǸǸDZǽǾDZǸDZDzǰǿǛǺǰǭǬǭǽǶǴǸǴǴǝDZǰǷDZȂǶǴǸǴǽǶǬǷǬǸǴǽǮǺdzǸǺDzǹǺǽǾȈȊǻDZȄDZǯǺǴǮDZǷǺǽǴǻDZǰǹǺǯǺǾǿǼǴdzǸǬǻǼǴǾǺǸǮ ǹDZǽǶǺǷȈǶǴȁǸǴǹǿǾǬȁǹǬǸǬȄǴǹDZǴǷǴǹǬǺǭȅDZǽǾǮDZǹǹǺǸǾǼǬǹǽǻǺǼǾDZǺǾǐDZǵǮǴȂǎǹDZǽǶǺǷȈǶǴȁǸǴǹǿǾǬȁȁǺǰȈǭȇǺǾǰǺǸǬǹǬȁǺǰǴǾǽȋǻǼDZǽǾǴDzǹǬȋȄǶǺǷǬǜǴǮDZǼǽǬǵǰ

&HQD3ULFHǢDZǹǬ: 3.030.000 - 5.670.000 Kč / CZK 3,030,000 - 5,670,000 Více informací na ZZZUH]LGHQFHVHGOHFF]For more information visit ZZZUH]LGHQFHVHGOHFF]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZUH]LGHQFHVHGOHFF]

CENTURY 21 Reality Express, Václavské nám. 56, Praha 1 – Nové Město 96

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Ing. Markéta Kodlová Kontakt: +420 725 293 222 E-mail: marketa.kodlova@century21.cz

BYTOVÝ DŮM NAD MARJÁNKOU, PRAHA 6 - BŘEVNOV / NAD MARJÁNKOU BUILDING , PRAHA 6 - BŘEVNOV

'š01$'0$5-É1.28MHQRYĚQDYUæHQëE\WRYëGŢPYDWUDNWLYQtDY\KOHGiYDQpUH]LGHQÿQtPĚVWVNpÿiVWL3UDK\YVDPpPVUGFL%ŐHYQRYD0RGHUQtSĚWLSDWURYë GŢPURGLQQpKRFKDUDNWHUXSŢGRU\VQĚLYëäNRYĚQDYD]XMHQDVWiYDMtFt]iVWDYEXYXOLFL%ĚORKRUVNiDQDEt]tE\GOHQtSURYäHFKQ\YĚNRYpNDWHJRULH9HäNHUiREÿDQVNi Y\EDYHQRVWMHYGRFKi]NRYpY]GiOHQRVWL3DUN\ 3DUN/DGURQND2ERUD+YĚ]GDD]DKUDG\%ŐHYQRYVNpKRNOiäWHUD YEOt]NpPRNROt'REUiGRSUDYQtGRVWXSQRVW GRFHQWUDLYHQ]3UDK\9GRPĚMHSRX]HE\WŢRGNN P GRNN P 'iOHNE\WRYëPMHGQRWNiPQiOHætEDONRQWHUDVDÿL]DKUDGD%\W\MVRXRULHQ WRYiQ\REëYDFtPLSRNRMLQDMLKVYëKOHGHPGR]DKUDG 7+('š01$'0$5-É1.28LVDQHZO\GHVLJQHGDSDUWPHQWEXLOGLQJLQDQDWWUDFWLYHDQGVRXJKWDIWHUUHVLGHQWLDOORFDOLW\LQWKHYHU\KHDUWRI%ŐHYQRYZKLFKLVSDUW RIWKH3UDJXH0HWURSROLWDQ'LVWULFW0RGHUQÀYHOHYHOKRXVHRIIDPLO\FKDUDFWHUEOHQGVLQZLWKWKHH[LVWLQJGHYHORSPHQWRQ%ĚORKRUVNi6WUHHWZLWKUHVSHFWWR JURXQGSODQDQGKHLJKWDQGRIIHUVKRXVLQJWRDOODJHFDWHJRULHV$OOFLYLFDPHQLWLHVDUHZLWKLQZDONLQJGLVWDQFH3DUNVDUHQHDUE\ /DGURQND3DUN2ERUD+YĚ]GD 6WDU*DPH5HVHUYH DQGWKH%ŐHYQRY0RQDVWHU\*DUGHQV *RRGWUDQVSRUWDWLRQDFFHVVLELOLW\WRGRZQWRZQDQGZKHQJRLQJRXWRI3UDJXH7KHEXLOGLQJRIIHUV DSDUWPHQWVVWDUWLQJDWNN P XSWRNN P )XUWKHUPRUHWKHDSDUWPHQWXQLWVKDYHDEDOFRQ\WHUUDFHRUDJDUGHQ7KHDSDUWPHQWVKDYHOLYLQJURRPV IDFLQJVRXWKZLWKDYLHZRIWKHJDUGHQ ǐǺǸǹǺǮǺǽǾǼǺǵǶǬǙǬǰǘǬǼȈȋǹǶǺǵǹǬȁǺǰǴǾǽȋǮDzǴǮǺǻǴǽǹǺǸǴǻǺǻǿǷȋǼǹǺǸǮǴǷǷǺǮǺǸǼǬǵǺǹDZǛǼǬǯǴǮǽǬǸǺǸǽDZǼǰȂDZǍǼDzDZǮǹǺǮǬǝǺǮǼDZǸDZǹǹȇǵǻȋǾǴȉǾǬDzǹȇǵ ǰǺǸǽDZǸDZǵǹǺǯǺǾǴǻǬǻǺǽǮǺDZǵǻǷǬǹǴǼǺǮǶDZǴǮȇǽǺǾDZǺǼǯǬǹǴȃǹǺǮǻǴǽȇǮǬDZǾǽȋǮǽǿȅDZǽǾǮǿȊȅǿȊdzǬǽǾǼǺǵǶǿǿǷǴȂȇǍDZǷǺǯǺǼǽǶǬǴǻǼDZǰǺǽǾǬǮǷȋDZǾDzǴǷȈDZǮǽDZǸ ǮǺdzǼǬǽǾǹȇǸǶǬǾDZǯǺǼǴȋǸǎǽȋǯǺǼǺǰǽǶǬȋǴǹȀǼǬǽǾǼǿǶǾǿǼǬǹǬȁǺǰǴǾǽȋǮǻǼDZǰDZǷǬȁǻDZȄDZǵǰǺǽȋǯǬDZǸǺǽǾǴǎǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵǭǷǴdzǺǽǾǴǼǬǽǻǺǷǺDzDZǹȇǴdzǮDZǽǾǹȇDZ ǻǼǬDzǽǶǴDZǻǬǼǶǴǻǬǼǶǗǬǰǼǺǹǶǬǚǭǺǼǬǏǮDZdzǰǬǴǽǬǰȇǍǼDzDZǮǹǺǮǽǶǺǯǺǸǺǹǬǽǾȇǼȋǡǺǼǺȄǬȋǰǺǽǾǿǻǹǺǽǾȈǶǬǶǰǺȂDZǹǾǼǬǯǺǼǺǰǬǾǬǶǴdzǬǻǼDZǰDZǷȇǛǼǬǯǴǎ ǰǺǸDZǮǽDZǯǺǶǮǬǼǾǴǼǺǾǶǶ Ǹ ǰǺǶǶ Ǹ ǖǬDzǰǬȋǶǮǬǼǾǴǼǬǴǸDZDZǾǭǬǷǶǺǹǾDZǼǼǬǽǿǴǷǴǻǬǷǴǽǬǰǹǴǶǏǺǽǾǴǹǹȇDZǶǮǬǼǾǴǼǽǮǴǰǺǸǹǬǽǬǰ ǺǼǴDZǹǾǴǼǺǮǬǹȇǹǬȊǯ

Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Tandem, Perlová 3, Praha 1 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

97


Realitní makléř: Jaroslav Bolina Kontakt: +420 722 504 504 E-mail: jaroslav.bolina@century21.cz

)81.&,21$/,67,&.É9,/$85þ(1É,3521(-1É52þ1ę-ãÌ+2./,(17$)81&7,21$/,679,//$68,7$%/((9(1)257+(0267'(0$1',1*&/,(17 3RNXGMLæGHOätGREXKOHGiWHGŢPNWHUëQDSOQtYäHFKQ\9DäHSŐHGVWDY\RSŐtMHPQpPDSUDNWLFNpPE\GOHQtD]iURYHŁXVSRNRMt9DäHHVWHWLFNpFtWĚQtGRYROWHQiPYHOPLVWUXÿQĚSŐHGVWDYLW WXWRYLOX-HSRVWDYHQiYGXFKXPRGHUQtKRIXQNFLRQDOLVPXYLQWHULHUXSŐHYOiGDMtSŐtURGQtPDWHULiO\XäOHFKWLOpGŐHYREHWRQVNORORæQLFHNDæGiVYODVWQtNRXSHOQRXDäDWQRXQHMPR GHUQĚMät]DŐt]HQtMHYNXVQĚ]DVD]HQpGRSUDYLGHOQëFKOLQLtRENODGŢ]SŐtURGQtKRNDPHQH9\EDYHQtEH]NWHUpKRVLQHGRYHGHWHSŐHGVWDYLWDNWLYQtWUiYHQtYROQpKRÿDVXWYRŐtSŐtVOXäHQVWYt WRKRWRGRPXDMH]KRWRYHQpYQHMY\äätNYDOLWĚ5R]OHKOpJDUiæHEHQHYROHQWQtSR]HPHNRYëPĚŐHWpPĚŐPVH]DKUDGQtPDOWiQHPDæSURVHGtFtFKKRVWŢDYQHSRVOHGQtŐDGĚ WDNpPHQätGŢPSURGORXKRGREpQiYäWĚY\QHERVSUiYFHWYRŐtQHGtOQRXVRXÿiVWWpWRQHPRYLWRVWL9äHFKQ\RVWDWQtLQIRUPDFH9iPSŐHGiPDNOpŐ

,I\RXKDYHDOUHDG\EHHQVHDUFKLQJIRUDORQJWLPHIRUDKRXVHWRIXOÀO\RXUGUHDPVRIDFRQJHQLDOSUDFWLFDOUHVLGHQFHZKLOHDWWKHVDPHWLPHVDWLVI\LQJ\RXUDHVWKHWLFWDVWHOHWXVYHU\ EULHÁ\LQWURGXFHWKLVYLOOD&RQVWUXFWHGLQWKHVW\OHRIPRGHUQ)XQFWLRQDOLVPQDWXUDOPDWHULDOV ÀQHZRRGDQGFRQFUHWH DUHSUHGRPLQDQWLQWKHLQWHULRU7KHEHGURRPVHDFKKDYHDQ HQVXLWHEDWKURRPDQGGUHVVLQJURRP+LJKWHFKHTXLSPHQWLVWDVWHIXOO\HPEHGGHGLQWRWKHUHJXODUOLQHVRIWKHQDWXUDOVWRQHIDFLQJ7RSTXDOLW\À[WXUHVLQFOXGHJDGJHWVHVVHQWLDOIRU HQMR\DEOHOHLVXUHWLPH6SDFLRXVJDUDJHVDJHQHURXVVL]HGSORWRIDOPRVWPñZLWKJDUGHQSDYLOLRQVHDWLQJXSWRJXHVWV/DVWEXWQRWOHDVWDQLQVHSDUDEOHSDUWRIWKLVSURSHUW\ LVDVPDOOHUJXHVWKRXVHVXLWDEOHIRUORQJWHUPYLVLWRUVRUDFDUHWDNHU)XUWKHULQIRUPDWLRQLVDYDLODEOHIURPWKH$JHQW ǎǔǗǗnjǎǝǞǔǗǑǠǟǙǖǢǔǚǙnjǗǔǓǘnjǐǗǫǝnjǘǧǡǞǜǑǍǚǎnjǞǑǗǨǙǧǡǖǗǔǑǙǞǚǎ ǑǽǷǴǮȇǰǬǮǹǺǴȅDZǾDZǰǺǸǶǺǾǺǼȇǵǭȇǽǺǺǾǮDZǾǽǾǮǺǮǬǷǮǽDZǸǮǬȄǴǸǺDzǴǰǬǹǴȋǸǺǻǼǴȋǾǹǺǸǴǮǸDZǽǾDZǽǾDZǸǻǼǬǶǾǴȃDZǽǶǺǸDzǴǷȈDZǴǮǾǺDzDZǮǼDZǸȋǿǰǺǮǷDZǾǮǺǼȋǷǮǬȄǴȉǽǾDZǾǴȃDZǽǶǴDZ ȃǿǮǽǾǮǬ ǾǺ ǻǺdzǮǺǷȈǾDZ ǮǬǸ ǶǼǬǾǶǺ ǻǼDZǰǽǾǬǮǴǾȈ ǰǬǹǹǿȊ ǮǴǷǷǿ ǚǹǬ ǻǺǽǾǼǺDZǹǬ Ǯ ǰǿȁDZ ǽǺǮǼDZǸDZǹǹǺǯǺ ȀǿǹǶȂǴǺǹǬǷǴdzǸǬ Ǯ ǴǹǾDZǼȈDZǼDZ ǻǼDZǺǭǷǬǰǬȊǾ ǹǬǾǿǼǬǷȈǹȇDZ ǸǬǾDZǼǴǬǷȇ ǭǷǬǯǺǼǺǰǹǺDZǰDZǼDZǮǺǭDZǾǺǹǴǽǾDZǶǷǺǽǻǬǷȈǹǴǶǬDzǰǬȋǽǽǺǭǽǾǮDZǹǹǺǵǮǬǹǹǺǵǶǺǸǹǬǾǺǵǴǯǬǼǰDZǼǺǭǹǺǵǽǺǮǼDZǸDZǹǹǺDZǺǭǺǼǿǰǺǮǬǹǴDZȉǷDZǯǬǹǾǹǺǮǻǴǽǬǹǺǮǽǺǮDZǼȄDZǹǹȇDZ ǷǴǹǴǴǺǭǷǴȂǺǮǶǴǴdzǹǬǾǿǼǬǷȈǹǺǯǺǶǬǸǹȋǚǭǺǼǿǰǺǮǬǹǴDZǭDZdzǶǺǾǺǼǺǯǺǹDZǷȈdzȋǽDZǭDZǻǼDZǰǽǾǬǮǴǾȈǬǶǾǴǮǹȇǵǺǾǰȇȁȋǮǷȋDZǾǽȋǹDZǺǾȆDZǸǷDZǸǺǵǻǼǴǹǬǰǷDZDzǹǺǽǾȈȊȉǾǺǯǺǰǺǸǬǴ ǶǺǹDZȃǹǺǺǹǺǽǬǸǺǯǺǮȇǽǺǶǺǯǺǶǬȃDZǽǾǮǬǛǼǺǽǾǺǼǹȇǵǯǬǼǬDzǮDZǽȈǸǬǻǼDZǰǽǾǬǮǴǾDZǷȈǹȇǵǿȃǬǽǾǺǶǻǺȃǾǴǸǽǽǬǰǺǮǺǵǭDZǽDZǰǶǺǵǹǬǸDZǽǾǰǷȋǽǴǰDZǹǴȋǴǹDZǮǻǺǽǷDZǰǹȊȊ ǺȃDZǼDZǰȈǸDZǹȈȄǴǵǰǺǸǰǷȋǻǼǴDZdzDzǬȊȅǴȁǹǬǰǺǷǯǺǯǺǽǾDZǵǴǷǴǰǷȋǿǻǼǬǮǷȋȊȅDZǯǺǰǺǸǬ³ǮǽDZȉǾǺȋǮǷȋDZǾǽȋǹDZǺǾȆDZǸǷDZǸǺǵǴǸǿȅDZǽǾǮǬǮǴǷǷȇǎǽȊǺǽǾǬǷȈǹǿȊǴǹȀǺǼǸǬȂǴȊǮǬǸ ǻǼDZǰǺǽǾǬǮǴǾǹǬȄǬǯDZǹǾ

&HQD3ULFHǢDZǹǬQDY\æiGiQtRQUHTXHVWǻǺdzǬǻǼǺǽǿ Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Reality 21, Na Poříčí 1071/17, Prague 1 98

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: ing. Jaroslav Denemark Kontakt: +420 774 287 732 E-mail: jaroslav.denemark@century21.cz

/8;861Ì9,/$652=/(+/ê032=(0.(09ŏÌþ$1(&+5$'2ã29,&Ì&+/8;85<9,//$21/$5*(3/27,1ŏÌþ$1<5$'2ã29,&(

-HGQiVHRGYRXSRGODæQtSURVWRURYĚYHONRU\VHSRMDWRXYLOXR]DVWDYĚQpSORäHPQDYUæHQRXDUFKLWHNWRQLFNRXNDQFHOiŐt'LSODNDGDUFKLWHNWD$GDPD/DQJUD þtWiPtVWQRVWtNRXSHOHQ:&DJDUiæSURDXWD.GRPXQiOHætUR]OHKOiUHOD[DÿQt]DKUDGDRYëPĚŐHPVNRXSDFtPMH]tUNHPD]DKUDGQtGRPHN 7DWRQHPRYLWRVWQDEt]tQDGVWDQGDUGQtE\GOHQtSURYtFHÿOHQQRXURGLQXSRORKRXVGREURXGRVWXSQRVWtGR3UDK\L]DVSRUWHPGRUR]OHKOëFKŏtÿDQVNëFKOHVŢQDNWHUp QDYD]XMt9RGĚUDGVNpEXÿLQ\

7KLVLVDWZRVWRUH\VSDFLRXVYLOODFRYHULQJDQDUHDRIPñGHVLJQHGE\WKHDUFKLWHFWXUDOVWXGLRRI'LSODFDGDUFKLWHFW$GDP/DQJU,WFRQVLVWVRIURRPV EDWKURRPV:&VDQGDFDUJDUDJH7KHKRXVHDOVRLQFOXGHVDODUJHWUDQTXLOPñJDUGHQZLWKVZLPPLQJODNHDQGVXPPHUKRXVH7KLVSURSHUW\RIIHUV DERYHDYHUDJHDFFRPPRGDWLRQWRDODUJHH[WHQGHGIDPLO\7KHORFDWLRQKDVHDV\DFFHVVLELOLW\WR3UDJXHDQGVSRUWLQJDFWLYLWLHVLQWKHYDVWŏtÿDQ\IRUHVWVDQG9R GĚUDG\EHHFKZRRGV ǜǚǝǖǚǤǙnjǫǎǔǗǗnjǝǍǚǗǨǤǔǘǟǣnjǝǞǖǚǘǎŏÌþ$1<5$'2ã29,&( ǐǮǿȁȉǾǬDzǹǬȋǶǼǬǵǹDZǻǼǺǽǾǺǼǹǬȋǮǴǷǷǬǻǷǺȅǬǰȈdzǬǽǾǼǺǵǶǴǸǻǺǻǼǺDZǶǾǿǬǼȁǴǾDZǶǾǿǼǹǺǵȀǴǼǸȇǴdzǮDZǽǾǹǺǯǺǬǼȁǴǾDZǶǾǺǼǬnjǰǬǸǬǗǬǹǯDZǼǬǝǺǽǾǺǴǾ ǴdzǶǺǸǹǬǾǮǬǹǹȇȁǶǺǸǹǬǾǾǿǬǷDZǾǺǮǴǯǬǼǬDzǬǹǬǸǬȄǴǹȇǖǰǺǸǿǺǾǹǺǽǴǾǽȋǭǺǷȈȄǺǵǽǬǰǸǽǻǼǿǰǺǸǰǷȋǶǿǻǬǹǴȋǴǽǬǰǺǮȇǵǰǺǸǴǶǩǾǬ ǹDZǰǮǴDzǴǸǺǽǾȈǻǼDZǰǷǬǯǬDZǾǼǺǽǶǺȄǹȇǵǽǾǴǷȈǻǼǺDzǴǮǬǹǴȋǰǷȋǭǺǷȈȄǺǵǽDZǸȈǴǸDZǽǾDZǽȁǺǼǺȄDZǵǾǼǬǹǽǻǺǼǾǹǺǵǰǺǽǾǿǻǹǺǽǾȈȊǰǺǛǼǬǯǴdzǬǹȋǾǴDZǸǽǻǺǼǾǺǸǴ ǻǼǺǯǿǷǶǬǸǴǮǺǭȄǴǼǹȇȁǜDzǴȃǬǹǽǶǴȁǷDZǽǬȁǼȋǰǺǸǽǶǺǾǺǼȇǸǴǹǬȁǺǰȋǾǽȋǎǺǰDZǼǬǹǽǶǴDZǭǿǶǺǮȇDZǼǺȅǴ

Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Real servis, Koněvova 182, Praha 3 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

99


Realitní makléř: Ing. David Votápek Kontakt: +420 725 293 221 E-mail: david.votapek@century21.cz

'(9(/23(56.ê352-(.79,/$'š0+ŏ(%(1.$35$+$'(9(/23(5352-(&7+ŏ(%(1.$9,/$'š0 9,//$+286( 35$+$

'HYHORSHUVNëSURMHNW9LODGŢP+ŐHEHQNDQDEt]tXQLNiWQtVSRMHQtE\GOHQtYOX[XVQtFKE\WRYëFKMHGQRWNiFKYNRPRUQtPSURVWŐHGtYMHGQp]QHMSUHVWLæQĚM ätFKYLORYëFKORNDOLWFHQWUiOQt3UDK\QD]ëYDQp+ŐHEHQND'ŢPMHVLWXRYiQQDMLæQtVWUiQLRENORSHQ]HOHQtPLPRYHäNHUëGRSUDYQtUXFKWDNQDEt]tNOLGD LQWLPLWXVNUiVQëPYëKOHGHPGRRNROt9SURMHNWXMHQE\WRYëFKMHGQRWHNNNDæRGP

'HYHORSHUSURMHFW+ŐHEHQND9LOODKRXVHRIIHUVXQLTXHFRQQHFWLRQRIOLYLQJLQOX[XU\DSDUWPHQWXQLWVZLWKVHUHQHHQYLURQPHQWRIRQHRIWKHPRVWSUHVWLJLRXVYLOOD ORFDOLWLHVLQFHQWUDO3UDJXHFDOOHG+ŐHEHQND7KHKRXVHLVVLWXDWHGRQDVRXWKHUQVORSHVXUURXQGHGE\JUHHQHU\DZD\IURPWUDIÀFDQGWKXVRIIHUVLQWLPDWHSHDFH DQGTXLHWZLWKJRUJHRXVYLHZRIVXUURXQGLQJV7KHSURMHFWKDVRQO\XQLWVNNXSWRVWDUWLQJDWP

ǐǑǎǑǗǚǛǑǜǝǖǔǕǛǜǚǑǖǞ©9,/$'š0+ŏ(%(1.$ªǛǜnjǏnj ǐDZǮDZǷǺǻDZǼǽǶǴǵ ǻǼǺDZǶǾ ©ǎǴǷǷǬǰǺǸ ǏǼDzDZǭDZǹǶǬª ǻǼDZǰǷǬǯǬDZǾ ǿǹǴǶǬǷȈǹǿȊ ǮǺdzǸǺDzǹǺǽǾȈ ǻǼǺDzǴǮǬǹǴȋ Ǯ ǶǮǬǼǾǴǼǬȁ ǶǷǬǽǽǬ ÅǷȊǶǽ´ Ǯ ǴǹǾǴǸǹǺǵ ǺǭǽǾǬǹǺǮǶDZǺǰǹǺǯǺǴdzǻǼDZǽǾǴDzǹȇȁǮǴǷǷǺǮȇȁǼǬǵǺǹǺǮȂDZǹǾǼǬǛǼǬǯǴǏǼDzDZǭDZǹǶǬǐǺǸǼǬǽǻǺǷǺDzDZǹǹǬȊDzǹǺǸǽǶǷǺǹDZǮǺǶǼǿDzDZǹǴǴdzDZǷDZǹǴǮǰǬǷDZǶDZ ǺǾǺDzǴǮǷDZǹǹȇȁǿǷǴȂǐǺǸǻǼDZǰǻǺǷǬǯǬDZǾǻǼǺDzǴǮǬǹǴDZǮǽǻǺǶǺǵǹǺǸǼǬǵǺǹDZǽǻǼDZǶǼǬǽǹȇǸǮǴǰǺǸǹǬǯǺǼǺǰǛǼǺDZǶǾǻǼDZǰǽǾǬǮǷȋDZǾǽǺǭǺǵǾǺǷȈǶǺ ǶǮǬǼǾǴǼǺǾǶǶ Ǹ ǰǺ Ǹ 

Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Tandem, Perlová 3, Praha 1 100

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


Realitní makléř: Jaroslav Bolina Kontakt: +420 722 504 504 E-mail: jaroslav.bolina@century21.cz

/X[XVQtSHQWKRXVHRYHOLNRVWLNNPVWHUDVRXPNWHUiMHNRQFLSRYiQDMDNRVWŐHäQt]DKUDGD%\WVHQDFKi]tYMHGQp]QHMDWUDNWLYQĚMätFKORNDOLWQD3UD]H².DYÿt+RU\YXOLFL1D+ŐH EHQHFK,,%\WMHXPtVWĚQYSRVOHGQtPSDWŐHGRPXDGtN\WRPXMH]GHQiGKHUQëYëKOHGQD3UDKX9E\WĚMHVDPR]ŐHMPRVWtNOLPDWL]DFHYNDæGpRE\WQpPtVWQRVWLGYĚNRXSHOQ\²MHGQDVHVSUFKRYë NRXWHPDGUXKiVK\GURPDViæQtYDQRX3ŐHGQRVWtWRKRWRE\WXMHYëMLPHÿQRVWORNDOLW\YHNWHUpVHE\WQDFKi]tDWDNpWRæHYWRPWRSURMHNWXMHSRX]HQĚNROLNE\WŢFRæGRGiYiE\GOHQtYWRPWRGRPĚ QDH[NOX]LYLWĚDNRPIRUWX9WĚVQpPVRXVHGVWYtVHQDFKi]tOHVRSDUNNGHVHPŢæHWHYĚQRYDWVSRUWRYQtPDNWLYLWiPQHERMHQUHOD[RYDW=iURYHŁMVWHPLQMt]G\DXWHPQHERGYĚ]DVWiYN\PHWUHP RGVDPRWQpKRFHQWUDPĚVWD.E\WXQiOHætGYĚSDUNRYDFtVWiQtYSRG]HPQtFKJDUiætDYODVWQtVNOHS9HäNHUpSURVWRU\YGRPĚMVRXSRGKRGRFKUDQRX%H]SHÿQRVW]DMLäŘXMHNDPHURYëV\VWpPD RVWUDKDVtGOtFtSŐtPRYGRPĚ3RNXGE\MVWHFKWĚOLPtWNRPIRUWURGLQQpKRGRPXD]iURYHŁPtWYROQRVWDEH]VWDURVWQRVWE\WXWDNWHQWRE\WMHNWRPXLGHiOQt

/X[XU\SHQWKRXVHNNVL]HPñZLWKPñWHUUDFHGHVLJQHGDVDURRIJDUGHQ7KHÁDWLVORFDWHGLQRQHRIWKHPRVWDWWUDFWLYHORFDOLWLHVLQ3UDJXH.DYÿt0RXQWDLQVLQ1D+ŐHEHQHFK,,6WUHHW,WLV VLWXDWHGRQWKHWRSÁRRURIWKHEXLOGLQJRIIHULQJDPDJQLÀFHQWYLHZRI3UDJXH$LUFRQGLWLRQLQJLQHDFKUHVLGHQWLDOURRPRIWKHÁDWLVWKHQRUP7KHUHDUHEDWKURRPV²RQHZLWKDVKRZHUFRUQHUDQGWKHRWKHU ZLWKDZKLUOSRROWXE7KHDGYDQWDJHRIWKLVÁDWLVLWVH[FHSWLRQDOORFDWLRQDQGWKHIDFWWKDWWKHUHDUHRQO\DIHZÁDWVLQWKLVFRPSOH[DGGLQJH[FOXVLYLW\DQGFRPIRUWWROLYLQJKHUH,QWKHYLFLQLW\WKHUHLVDIRUHVW SDUNZKHUH\RXFDQHQMR\VSRUWLQJDFWLYLWLHVRUMXVWUHOD[$WWKHVDPHWLPH\RXDUHMXVWPLQXWHVE\FDURUWZR0HWURVWRSVIURPWKHFLW\FHQWUH7KHÁDWKDVWZRSDUNLQJED\VLQDQXQGHUJURXQGJDUDJHDVZHOO DVDSULYDWHFHOODU$OOWKHSUHPLVHVLQWKHEXLOGLQJDUHJXDUGHGKRXUVDGD\6DIHW\LVVHFXUHGZLWKDFDPHUDV\VWHPDQGDJXDUGVWDWLRQHGZLWKLQWKHEXLOGLQJ,I\RXZRXOGOLNHWRKDYHWKHFRPIRUWRIDIDPLO\ KRPHDQGDWWKHVDPHWLPHWKHIUHHGRPDQGFDUHIUHHIHHOLQJRIDÁDWWKHQWKLVDSDUWPHQWLVLGHDOIRU\RXUSXUSRVHV ǜǺǽǶǺȄǹȇǵǻDZǹǾȁǬǿǽǼǬdzǸDZǼǺǸǶǶǸǸǽǾDZǼǼǬǽǺǵǮǾǺDzDZǮǼDZǸȋǻǼDZǰǽǾǬǮǷȋȊȅDZǵǽǺǭǺǵǽǬǰǹǬǶǼȇȄDZǖǮǬǼǾǴǼǬǼǬǽǻǺǷǺDzDZǹǬǮǺǰǹǺǸǴdzǽǬǸȇȁǻǼǴǮǷDZǶǬǾDZǷȈǹȇȁǸDZǽǾǮǛǼǬǯDZ ³ǖǬǮȃǴǯǺǼȇǿǷ1D+ŐHEHQHFK,,ǖǮǬǼǾǴǼǬǼǬǽǻǺǷǺDzDZǹǬǹǬǻǺǽǷDZǰǹDZǸȉǾǬDzDZǰǺǸǬǭǷǬǯǺǰǬǼȋȃDZǸǿǴdzǹDZDZǺǾǶǼȇǮǬDZǾǽȋǮDZǷǴǶǺǷDZǻǹȇǵǮǴǰǹǬǛǼǬǯǿǎǶǮǬǼǾǴǼDZǶǺǹǰǴȂǴǺǹDZǼȇǮǶǬDzǰǺǵǶǺǸǹǬǾDZ ǰǮDZǮǬǹǹȇDZǶǺǸǹǬǾȇǺǰǹǬǽǰǿȄDZǮǺǵǶǬǭǴǹǺǵǰǼǿǯǬȋǽǯǴǰǼǺǸǬǽǽǬDzǹǺǵǮǬǹǹǺǵǛǼDZǴǸǿȅDZǽǾǮǺǸȉǾǺǵǶǮǬǼǾǴǼȇȋǮǷȋDZǾǽȋǴǽǶǷȊȃǴǾDZǷȈǹǺǽǾȈǼǬǵǺǹǬǮǶǺǾǺǼǺǸǹǬȁǺǰǴǾǽȋDzǴǷȈDZǬǾǬǶDzDZǾǺȃǾǺǮ ȉǾǺǸǻǼǺDZǶǾDZǮǽDZǯǺǹDZǽǶǺǷȈǶǺǶǮǬǼǾǴǼȃǾǺǻǼǴǭǬǮǷȋDZǾDzǴǷȈȊǮȉǾǺǸǰǺǸDZȉǶǽǶǷȊdzǴǮǹǺǽǾǴǴǶǺǸȀǺǼǾǬǎǹDZǻǺǽǼDZǰǽǾǮDZǹǹǺǵǭǷǴdzǺǽǾǴǹǬȁǺǰǴǾǽȋǷDZǽǺǻǬǼǶǯǰDZǸǺDzǹǺdzǬǹǴǸǬǾȈǽȋǽǻǺǼǾǺǸǴǷǴǻǼǺǽǾǺ ǺǾǰȇȁǬǾȈǎǾǺDzDZǮǼDZǸȋǮǸǴǹǿǾǬȁDZdzǰȇǬǮǾǺǸǺǭǴǷDZǸǴǷǴǮǰǮǿȁǺǽǾǬǹǺǮǶǬȁǸDZǾǼǺȂDZǹǾǼǯǺǼǺǰǬǖǶǮǬǼǾǴǼDZǺǾǹǺǽȋǾǽȋǰǮǬǻǬǼǶǺǮǺȃǹȇȁǸDZǽǾǬǮǻǺǰdzDZǸǹǺǸǯǬǼǬDzDZǴǽǺǭǽǾǮDZǹǹȇǵǻǺǰǮǬǷǐǺǸ ǹǬȁǺǰǴǾǽȋǻǺǰȃǬǽǺǮǺǵǺȁǼǬǹǺǵǍDZdzǺǻǬǽǹǺǽǾȈǺǭDZǽǻDZȃǴǮǬȊǾdzǬȅǴǾǹȇDZǶǬǸDZǼȇǴǺȁǼǬǹǹǴǶǴǹǬȁǺǰȋȅǴDZǽȋǻǼȋǸǺǮǰǺǸDZǑǽǷǴǮȇȁǺǾǴǾDZǺǭǷǬǰǬǾȈǮǽDZǸǶǺǸȀǺǼǾǺǸǽǺǭǽǾǮDZǹǹǺǯǺǰǺǸǬǴǮǸDZǽǾDZǽ ǾDZǸǽǮǺǭǺǰǺǵǴǭDZdzdzǬǭǺǾǹǺǽǾȈȊǮǷǬǰDZǷȈȂǬǶǮǬǼǾǴǼȇǾǺȉǾǬǹDZǰǮǴDzǴǸǺǽǾȈǴǰDZǬǷȈǹǺǽǺǺǾǮDZǾǽǾǮǿDZǾǿǶǬdzǬǹǹȇǸǶǼǴǾDZǼǴȋǸ

&HQD3ULFHǢDZǹǬ.ÿPĚVW&=.PRQWK Více informací na ZZZFHQWXU\F]For more information visit ZZZFHQWXU\F]ǍǺǷDZDZǻǺǰǼǺǭǹǬȋǴǹȀǺǼǸǬȂǴȋǹǬZZZFHQWXU\F]

CENTURY 21 Reality 21, Na Poříčí 1071/17, Prague 1 352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

101


Byt 3+kk, 68 + 17 m2, Praha 9 - Hrdlořezy, Mezitraťová | 4 900 000 Kč Moderní bydlení uprostřed zeleně v architektonicky zajímavém projektu. Tento byt nabízí hlavní obývací prostor s otevřenou kuchyní, 2 ložnice, koupelnu a toaletu pro hosty. Lodžie přístupná ze všech hlavních místností, dřevěné podlahy, francouzská okna, velkoformátové obklady, videotelefon. Rezidence je situována na zalesněném svahu s vlastní příjezdovou komunikací, 15 minut jízdy do centra. Kupní cena zahrnuje 1 garážové parkovací stání. Quiet modern living in an architecturally impressive residence, situated on green hillside, 15 minutes to the city center. This 2-bedroom apartment offers main living area with open kitchen, 2 bedrooms, bathroom and guest toilet. Loggia is accessible from all main rooms, wooden floors, French windows, large format tiles, KOLO / Aquatrade bathroom fixtures, videophone. The purchase price includes 1 garage parking space.

Pro kompletní nabídku navštivte / For complete property listing please visit

102

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Prodej

Pronájem

Byt 2+kk, 55 + 17 m2, Praha 7 - Holešovice, Přístavní | 3 875 000 Kč Architektem designovaný byt řešený v industriálním stylu, s velkou terasou do vnitrobloku, situovaný v 6. patře činžovní budovy. Byt nabízí otevřený koncept obývacího pokoje, kuchyně (spotřebiče Siemens) s částečně oddělenou ložnicí, dále koupelnu, komoru s pračkou. Moderní prvky: dřevěné podlahy, cihlový obklad na stěnách, posuvné skleněné dveře, vestavěné skříně a dostatek úložných prostor, bezpečnostní vstupní dveře. Veškerá občanská vybavenost v místě, zastávky tramvaje 2 minuty chůze od domu, 8 minut jízdy do centra. Architect designed flat with industrial features, large courtyard terrace, situated on the 6th floor of residential building. The flat offers open concept of living room with kitchen (Siemens appliances), partially separated bedroom, bathroom and walk-in closet. Modern and interesting features: wooden floors, brick facing, glass sliding doors, built-in wardrobes, security entry door. Public amenities close by, 2 minute walk to tram stops, 8 minute to the city center.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

103


Byt 2+kk, 60 m2, Praha 2 - Vinohrady, Lužická | 4 800 000 Kč Zařízený dvoupokojový byt po kompletní rekonstrukci situovaný v 1. patře zrenovovaného činžovního domu na Vinohradech, pár minut od náměstí Míru. Byt nabízí světlý obývací prostor s otevřenou, kompletně vybavenou kuchyní, ložnici s vestavěnou skříní, koupelnu laděnou do bílo-hnědé barvy s designovou sanitou a italskými obklady, a oddělenou toaletu. Vybavení na míru, dřevěné podlahy, společné prostory domu se zachovanými původními prvky. Furnished one-bedroom apartment after complete reconstruction on the 1st floor of residential building, few steps from náměstí Míru Square. The apartment offers bright living room, fully fitted open kitchen, bedroom with built-in wardrobes, bathroom styled in white-brown colors, design fittings and Italian tiles, and toilet. Custom-made furniture, oak floors, common areas with preserved original features.

Pro kompletní nabídku navštivte / For complete property listing please visit

104

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Prodej

Pronájem

Byt 2+kk, 49 + 4 m2, Praha 3 - Žižkov, Prokopova | 4 690 000 Kč Dvoupokojový designový byt s balkonem situovaný v 2.NP nové rezidence s recepcí, centrálním zeleným dvorem, v pěší vzdálenosti od parku Parukářka. 5 minut jízdy tramvají do centra, zastávka pár minut chůze od domu. Byt nabízí otevřený koncept obývacího pokoje s plně vybavenou kuchyní (Whirpool, Frabel), ložnici, koupelnu s vanou a vstupní halu. Teaková podlaha, výtah, 24h recepce, kamerový systém, podzemní parkování a sklep. One-bedroom apartment with balcony situated on the 1st floor of new residential complex with communal courtyard garden. The Parukářka Park and tram stop within the walking distance, 5 minute tram journey to the city center. The interior has living room with fully fitted open kitchen (Whirpool, Farbel), bedroom, bathroom with tub and entry hall. Teak floors, lift, 24h reception, surveillance system, underground parking and cellar.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

105


Byt 4+kk, 142 + 45 m2, Praha 5 - Stodůlky, Klausova | 8 500 000 Kč Prostorný, stylově zařízený byt s velkou jihovýchodně orientovanou terasou situovaný na celém 2.patře novostavby, v blízkosti Prokopského a Dalejského údolí. Dobré dopravní spojení na Pražský okruh, několik minut od OC Nové Butovice. Bytu dominuje obývací pokoj s krbem a otevřený jídelní prostor s plně vybavenou kuchyní, dále jsou k dispozici 3 ložnice, 2 koupelny s oddělenou toaletou, šatna a sauna. Vestavěné skříně ve vstupní hale, dřevěná podlaha, 2 garážová stání + 1 parkovací místo. Spacious, stylish 3-bedroom apartment with a large south-east facing terrace situated on the 2nd floor of residential development, close to Prokopské a Dalejské údolí valley. Good connection to Prague road ring, few minutes to Nové Butovice shopping mall. The design apartment has a open concept of living room with fireplace, dining area and fully fitted kitchen, 3 bedrooms, 2 bathrooms with separate toilet, closet and sauna. Built-in wardrobes, wooden floors, 2 garage spaces + 1 parking lot.

Pro kompletní nabídku navštivte / For complete property listing please visit

106

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Prodej

Pronájem

Byt 3+kk, 100 + 15 m2, Praha 10 - Vršovice, Bulharská | 7 500 000 Kč Nový mezonetový byt s terasou, zimní zahradou, klimatizací a šatnou, situovaný v 6. patře činžovního domu s výtahem. Pár minut od Havlíčkových a Heroldových sadů, snadná dostupnost do centra. Dispozice bytu nabízí otevřený koncept obývacího pokoje, jídelního prostoru a plně vybavené značkové kuchyně, 2 ložnice, koupelnu s vanou a toaletu pro hosty. K bytu náleží sklep. New split-level apartment with terrace, winter garden and air-conditioning situated on the 6th floor of building with a lift. Few minutes from Heroldovy and Havlíčkovy sady Park, many tram links to the city center. The interior of flat offers open concept of living room, dining area and fully fitted kitchen, 2 bedrooms, bathroom and walk-in closet. Cellar.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

352'(-,6$/(6,džLJDžƺƶƻljLjǖ'8%(1,$35,/,ƶdžLJƻǂǓ

107


U družstva Práce, Praha 4 - Braník

Unikátní 5-ložnicová nezařízená vila (400 m2) se zahradou a terasami, poskytujícími úchvatné výhledy, situovaná v příjemné lokalitě Prahy 4 - Braník. V domu se nachází obývací pokoj s krbem a plně vybavený kuchyňský kout, jídelna, 4 ložnice, 4 koupelny. Suterén nabízí bazén se vstupem na terasu, malý kuchyňský kout, koupelnu, prádelnu a sklep. Dále je zde k dispozici dvougaráž a dvě stání na pozemku. Bydlení pro náročné klienty. Unique 5-bedroom villa with garden, situated in a quiet area of Prague 4 – Braník. The villa (400 sqm) is unfurnished. The ground floor comprises living room with fireplace and terraces, fully equipped kitchen corner, dining room and bathroom. The first floor has 4 bedrooms, 2 bathrooms and 2 terraces. On the second floor there is a room with small kitchen corner, bathroom and a terrace with beautiful view. The basement offers swimming pool with access to the terrace, kitchen corner, bathroom, laundry room and cellar. There is a double garage and 2 parking spaces on the land. Representative living for demanding clients.

Měsíční nájem: / Monthly rent: 120 000 CZK 108

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

LEXXUS a.s., Millennium Plaza, V Celnici 10, 110 00 Praha 1 tel.: +420 221 111 922, www.lexxusnorton.cz, e-mail: info@lexxusnorton.cz


Pařížská, Praha 1 - Staré Město

Luxusní nezařízený byt po kompletní rekonstrukci, situovaný ve 3. patře reprezentativního domu s výtahem. Prostorný byt o rozloze 138 m2 nabízí k užívání vstupní halu, obývací pokoj situovaný do Pařížské ulice, plně vybavenou kuchyni s jídelním koutem, 3 ložnice - jedna s kachlovými kamny, 2 koupelny, extra toaletu a balkon. Byt se nachází v nejprestižnější ulici v centru Prahy. Luxurious, spacious, unfurnished apartment (138 sqm) after complete reconstruction, situated on the 3rd floor of representative builiding with lift. The apartment comprises entrance hall, living room with dutch stove, fully equipped kitchen with dining area, 3 bedrooms - one of them with dutch stove, 2 bathrooms, extra toilet and balcony. Living in the most prestigious street in the city center.

Měsíční nájem: / Monthly rent: 52 000 CZK LEXXUS a.s., Millennium Plaza, V Celnici 10, 110 00 Praha 1 tel.: +420 221 111 922, www.lexxusnorton.cz, e-mail: info@lexxusnorton.cz


& ( 6 7 2 9 1 Ă&#x152; . $ 1 & ( / Ă&#x2030; Ä&#x2122; 52.8

PĹ&#x2122;ihlaste svou cestovnĂ­ kancelĂĄĹ&#x2122; do celostĂĄtnĂ­ soutÄ&#x203A;Ĺže!

SoutÄ&#x203A;Ĺž je ucelenou pĹ&#x2122;ehlĂ­dkou nejlepĹĄĂ­ch Ä?eskĂ˝ch cestovnĂ­ch kancelĂĄĹ&#x2122;Ă­, je reakcĂ­ na rĹŻznorodost kvality sluĹžeb poskytovanĂ˝ch cestovnĂ­mi kancelĂĄĹ&#x2122;emi obecnÄ&#x203A;. Akce mĂĄ za cĂ­l zviditelnit kvalitnĂ­ a dĹŻvÄ&#x203A;ryhodnĂŠ cestovnĂ­ kancelĂĄĹ&#x2122;e, kterĂŠ v souÄ?asnosti na ĂşzemĂ­ Ä&#x152;eskĂŠ republiky poskytujĂ­ sluĹžby z oblasti cestovnĂ­ho ruchu a vybrat z nich tu nejlepĹĄĂ­ pro rok 2012.

E-mail: info@conventia.cz *HQHUiOQtSDUWQHU

Tel.: +420 220 515 102

0HGLiOQtSDUWQHĹ&#x2019;L

&RQYHQWLDVUR9iFODYNRYD3UDKD7HO)D[,á',áZZZFRQYHQWLDF]


Zelená, Praha 6 - Statenice

Moderní řadový rodinný dům 5+kk v projektu Statenický mlýn s 24-hodinovou ostrahou. Částečně zařízený dům o rozloze 169 m2. V přízemí se nachází vstupní hala, plně vybavená kuchyňská linka spotřebiči značky Siemens s jídelním koutem, ze kterého je vstup na zahrádku (24 m2), extra toaleta a garáž. První patro nabízí obývací pokoj s balkonem, ložnici s koupelnou a prádelnu. Ve třetím patře jsou 2 ložnice, koupelna a 2 balkony. V místě je restaurace, potraviny a fitness, které je bezplatně k dispozici rezidentům. Vhodné pro rodinu s dětmi, v blízkosti Mezinárodní školy. Modern family four-bedroom house in project Statenický mlýn with 24-hour security. Partly furnished house with usable area 169 sqm. The ground floor comprises entrance hall, fully equipped kitchen, dining part with access to the garden (24 sqm), extra toilet and garage. The first floor offers living room with balcony, bedroom with bathroom and laundry. On the third floor there are 2 bedrooms, bathroom and 2 balconies. Quiet living just a few steps from restaurant and shop. The residents has free acces to the fitness. Suitable for families with children, the International School of Prague nearby.

Měsíční nájem: / Monthly rent: 33 000 CZK LEXXUS a.s., Millennium Plaza, V Celnici 10, 110 00 Praha 1 tel.: +420 221 111 922, www.lexxusnorton.cz, e-mail: info@lexxusnorton.cz


3URQiMHP_6WDWHQLFH_3UDKD]iSDG_P_.ฤ€Pฤ™VtF 1$'67$1'$5'1รŒ9,/$Y\KฤจtYDQรฌED]pQVDXQDORรงQLFHNRXSHOQ\WHUDV\EDONRQ\NOLPDWL]DFHGXERYpSDUNHW\DGODรงED YHVWDYฤ™QpVNฤจtQฤ™IUDQFRX]VNiRNQDYHQNRYQtรงDOX]LHDODUP]DKUDGDPVNDPHUDPLQDSRMHQรฌPLQDRVWUDKXVDPR]DYODรงRYDFtV\VWpP 'YRMJDUiรง0RGHUQtYLODYXQLNiWQtPUH]LGHQฤ€QtPSURMHNWXYDWUDNWLYQtSฤจtURGQtORNDOLWฤ™ร”Qฤ™WLFNpKRSRWRNDNPVHYHUR]iSDGQฤ™RG3UDK\ YU\FKOpPGRVDKXPH]LQiURGQtFKรฅNRO &217(0325$5<9,//$KHDWHGVZLPPLQJSRROVDXQDEHGURRPVEDWKURRPVWHUUDFHVEDOFRQLHVDLUFRQGLWLRQLQJRDNDQGWLOH IORRUVEXLOWLQZDUGUREHV)UHQFKZLQGRZVRXWGRRUEOLQGVDODUPFORVHGFLUFXLWFDPHUDV\VWHPLQWKHJDUGHQDXWRPDWLFZDWHULQJV\VWHP 'RXEOHJDUDJH9LOODZLWKDQPJDUGHQLQDXQLTXHUHVLGHQWLDOFRPSOH[LQWKHSLFWXUHVTXHยดร”Qฤ™WLFNรฌ3RWRNยตYDOOH\MXVWNPIURP3UDJXH FRQYHQLHQWWRWKHDLUSRUWDQGLQWHUQDWLRQDOVFKRROV

112

1(-/(3ฤรŒ1(029,7267,,%(673523(57,(6,ว‚วŠวŽวฦถว–ว„ฦปฦบฦธฦฟฦฝฦฟวƒว…วˆว‰ว“


3URQiMHP_/XEODĞVNi_9LQRKUDG\_3UDKD_P_.ĀPęVtF '(6,*129ë%<7NNFHQWUiOQtYVWXSQtKDODORçQLFHRULHQWRYDQpGRNOLGQpKRYQLWUREORNXVH]HOHQtPR]DLNRYiNRXSHOQDSDUNHW\ ]DFKRYDQpSģYRGQtGHWDLO\YHVWDYęQp~ORçQpSURVWRU\9]GXåQìYNXVQę]DĨt]HQìUHNRQVWUXRYDQìE\WVYìKOHGHPGR9UåRYLFNpKR~GROt YHSDWĨHKLVWRUL]XMtFtKRĀLQçRYQtKRGRPX]NRQFHVWROHWtQDSRPH]t9LQRKUDGD9UåRYLF '(6,*1$3$570(17FHQWUDOHQWU\KDOOWZREHGURRPVRULHQWHGWRZDUGVDWUDQTXLOEDFNJDUGHQPRVDLFEDWKURRPSDUTXHWIORRUVSUHVHUYHG RULJLQDOGHWDLOVEXLOWLQVWRUDJH7DVWHIXOO\IXUQLVKHGDLU\UHFRQVWUXFWHGDSDUWPHQWZLWKYLHZVRIWKHVXUURXQGLQJJUHHQHU\DQGWKH9UåRYLFHYDOOH\ RQWKHWKIORRURIDODWHWKFHQWXU\UHVLGHQWLDOEXLOGLQJORFDWHGRQWKHHGJHRI9LQRKUDG\

1D3HUåWìQę3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

3521É-(0,/($6(,ƶLJƻDŽƺƶ'8%(1,$35,/,ƶdžLJƻǂǓ

113


3URQiMHP_3DฤจtรงVNi_-RVHIRY_3UDKD_P_.ฤ€Pฤ™VtF 32'.5291รŒ0(=21(7NNNRXSHOQ\SUDFRYQtNRXWYHยดYฤ™รงLยต]LPQt]DKUDGDVDWHOLpURYรฌPLRNQ\รฅDWQDNUESฤ™NQรฌYรฌKOHGQDRNROQt KLVWRULFNRX]iVWDYEXNOLPDWL]DFHGฤจHYฤ™QpSRGODK\EH]SHฤ€QRVWQtGYHฤจHEHQiWVNรฌรฅWXNOX[XVQtGODรงEDDY\EDYHQtYNRXSHOQiFKDODUP 9\VRFHNYDOLWQtE\WYSDWฤจHVHFHVQtKRฤ€LQรงRYQtKRGRPXVYรฌWDKHPQDMHGQp]QHMSUHVWLรงQฤ™MรฅtFKDGUHVY3UD]HSiUNURNฤฃRGQiEฤจHรงt 9OWDY\D6WDURPฤ™VWVNpKRQiPฤ™VWt 63/,7/(9(/$77,&$3$570(17WKUHHEHGURRPVWKUHHEDWKURRPVVWXG\DUHDLQยดWKHWRZHUยตZLQWHUJDUGHQZLWKDWHOLHUZLQGRZVZDONLQ FORVHWILUHSODFHQLFHYLHZVRIWKHVXUURXQGLQJKLVWRULFEXLOGLQJVDLUFRQGLWLRQLQJZRRGIORRUV9HQHWLDQSODVWHUOX[XU\WLOLQJDQGHTXLSPHQW LQWKHEDWKURRPVDODUP+LJKTXDOLW\WKIORRUDSDUWPHQWLQDQ$UW1RXYHDXEXLOGLQJZLWKOLIWRQWKHPRVWSUHVWLJLRXVDGGUHVVLQ3UDJXH VWHSVIURPWKH2OG7RZQ6TXDUHDQGWKH9OWDYDULYHUEDQN

3URNRPSOHWQtQDEtGNXQDYรฅWLYWH)RUFRPSOHWHSURSHUW\OLVWLQJSOHDVHYLVLW

114

1(-/(3ฤรŒ1(029,7267,,%(673523(57,(6,ว‚วŠวŽวฦถว–ว„ฦปฦบฦธฦฟฦฝฦฟวƒว…วˆว‰ว“

VYRERGDZLOOLDPVFRP


3URQiMHP_0RVWHFNi_0DOi6WUDQD_3UDKD_P_.Ä&#x20AC;PÄ&#x2122;VtF .203/(71Ä&#x2026;=5(12929$1ë%<7NNEDONRQYHVWDYÄ&#x2122;Qp~ORçQpSURVWRU\GĨHYÄ&#x2122;QpSRGODK\EH]SHÄ&#x20AC;QRVWQtGYHĨHP\Ä&#x20AC;NDPLNURYOQQiWURXED 79LQWHUQHWVDWHOLWYLGHRWHOHIRQVDPRVWDWQi~ORçQiNRPRUD.YDOLWQÄ&#x2122;]DĨt]HQìDY\EDYHQìE\WYHSDWĨHUHNRQVWUXRYDQpKRÄ&#x20AC;LQçRYQtKRGRPX VYìWDKHPSiUNURNÄ£RG.DUORYDPRVWXD0DORVWUDQVNpKRQiPÄ&#x2122;VWt &203/(7(/<5()85%,6+('$3$570(17EDOFRQ\RQHEHGURRPEXLOWLQVWRUDJHTXDOLW\IXUQLWXUHDQGHTXLSPHQWZRRGIORRUVVHFXULW\ GRRUGLVKZDVKHUPLFURZDYH79,QWHUQHWVDWHOOLWHYLGHRHQWU\SKRQHVHSDUDWHVWRUDJHURRP)XOO\IXUQLVKHGDSDUWPHQWRQWKH WKIORRURIDUHQRYDWHGEXLOGLQJZLWKDOLIWLQWKHYHU\FHQWHURIWKHSLFWXUHVTXH0DOi6WUDQDMXVWDVWRQH·VWKURZWR&KDUOHV%ULGJHDQG 0DORVWUDQVNp6TXDUH

1D3HUÃ¥WìQÄ&#x2122;3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

3521Ã&#x2030;-(0,/($6(,ƶÇ&#x2021;Æ»Ç&#x201E;ƺƶ'8%(1,$35,/,ƶÇ&#x2020;Ç&#x2021;Æ»Ç&#x201A;Ç&#x201C;

115


3URQiMHP_.ฤจtรงRYi_6PtFKRY_3UDKD_P_.ฤ€Pฤ™VtF /2)729รซ$7(/,e5VYฤ™WOรฌSURVWRUQรฌREรฌYDFtSRNRMVNXFK\ฤžVNรฌPNRXWHPRWHYฤจHQiJDOHULHVSUDFRYQRXDORรงQLFtNOLPDWL]DFHGฤจHYฤ™Qp SRGODK\SUDฤ€NDVXรฅLฤ€NDP\ฤ€ND79:L)L3RG]HPQtSDUNRYDFtVWiQt=Dฤจt]HQรฌORIWVSDQRUDPDWLFNรฌPYรฌKOHGHPQD3UDKXYSDWฤจH NRPSOHWQฤ™]UHNRQVWUXRYDQpWRYiUQtEXGRY\VYรฌUD]QRXDUFKLWHNWXURXSURMHNWXMHQรง]tVNDOฤจDGXSUHVWLรงQtFKPH]LQiURGQtFKRFHQฤ™Qt&1%& 9EOt]NpPGRVDKXNRPHUฤ€QtKRFHQWUD$QGฤ™OQHGDOHNR3URNRSVNpKR~GROt /2)7$3$570(17VSDFLRXVEULJKWOLYLQJURRPZLWKDQRSHQNLWFKHQRSHQJDOOHU\ZLWKDQRIILFHDQGDEHGURRPDLUFRQGLWLRQLQJZRRG IORRUVZDVKHUGU\HUGLVKZDVKHU79:L)L8QGHUJURXQGJDUDJHVSDFH)XUQLVKHG1HZ<RUNVW\OHWKIORRUORIWVWXGLRZLWKDSDQRUDPLF YLHZRI3UDJXHLQDFRQYHUWHGIDFWRU\DXQLTXHSURMHFWWKDWZRQDQXPEHURISUHVWLJLRXV&1%&LQWHUQDWLRQDODZDUGV/RFDWHGQHDUWKH $QGฤ™OFRPPHUFLDOFHQWHUDQGDOVRFORVHWRWKH3URNRSVNpYDOOH\QDWXUHUHVHUYH

116

1(-/(3ฤรŒ1(029,7267,,%(673523(57,(6,ว‚วŠวŽวฦถว–ว„ฦปฦบฦธฦฟฦฝฦฟวƒว…วˆว‰ว“


3URQiMHP_&XNURYDUQLFNi_6WĨHåRYLFH_3UDKD_P_.ĀPęVtF 5(.21675829$1Éč$'29É9,/$NNNRXSHOQ\]DKUDGDPWĨLSDWUDDVXWHUpQ]DFKRYDQpSģYRGQtSUYN\YNRPELQDFL VPRGHUQtPVW\OHP]DSRXçLWtåSLĀNRYìFKPDWHULiOģDY\EDYHQtNUEEDONRQ\LPSR]DQWQtVFKRGLåWęåDWQDVDPRVWDWQìE\WSURKRVW\YH GUXKpPSDWĨHSDUNHW\YHVWDYęQpVNĨtQęVKR]SUiGODSUDĀNDVXåLĀND*DUiçSURGYDYR]\([NOX]LYQtORNDOLWDYUH]LGHQĀQtĀWYUWL2ĨHFKRYND QHGDOHNR3UDçVNpKRKUDGXVU\FKORXGRVWXSQRVWtGRFHQWUD )8//<5()85%,6+('72:1+286(ILYHEHGURRPVIRXUEDWKURRPVPJDUGHQWKUHHIORRUVSOXVEDVHPHQWSUHVHUYHGRULJLQDO IHDWXUHVFRPELQHGZLWKPRGHUQGHVLJQDQGHTXLSPHQWILUHSODFHIRXUEDOFRQLHVLPSRVLQJVWDLUFDVHZDONLQFORVHWVHSDUDWHVHFRQG IORRUJXHVWDSDUWPHQWSDUTXHWIORRUVEXLOWLQZDUGUREHVODXQGU\FKXWHZDVKHUGU\HUKHDWHGGULYHZD\'RXEOHJDUDJH/RFDWHGLQWKH H[FOXVLYHUHVLGHQWLDOQHLJKERUKRRGRI2ĨHFKRYNDQHDUWKH3UDJXH&DVWOH

1D3HUåWìQę3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

3521É-(0,/($6(,ƶLJƻDŽƺƶ'8%(1,$35,/,ƶdžLJƻǂǓ

117


3URQiMHP_1HEXåLFH_3UDKD_P_.ĀPęVtF 129ë52',11ë'Đ0NNYQLWĨQtED]pQVSURWLSURXGHPVDXQDORçQLFNRXSHOQ\åDWHQNUiVQìYìKOHGQDPtVWQtNRVWHOSDUNHW\ ]GYRMHQiVNODYRNQHFKYHQNRYQtçDOX]LHSRGODKRYpWRSHQtYNRXSHOQiFKDXED]pQXDODUPVSĨLSRMHQtPQDSXOWFHQWUiOQtRFKUDQ\YHONi Y\WiSęQiJDUiçSURGYDYR]\1DGVWDQGDUGQtURGLQQìGģPYNOLGQpPSĨtURGQtPSURVWĨHGtYEOt]NpPGRVDKXPH]LQiURGQtåNRO\,63 1(:)$0,/<+286(LQGRRUSRROZLWKH[HUFLVHMHWVDXQDVL[EHGURRPVWKUHHEDWKURRPVEHDXWLIXOYLHZVRIWKHORFDOFKXUFKSDUTXHWIORRUV GRXEOHJOD]HGZLQGRZVRXWGRRUEOLQGVIORRUKHDWLQJLQWKHEDWKURRPVDQGWKHSRRODUHDDODUPFRQQHFWHGWRDVHFXULW\DJHQF\ODUJHKHDWHG GRXEOHJDUDJH+LJKTXDOLW\IDPLO\KRPHLQWKHTXLHWQDWXUDODUHDRI1HEXåLFHMXVWWZREXVVWRSVIURPWKH,QWHUQDWLRQDO6FKRRORI3UDJXH

118

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


3URQiMHP_3DฤจtรงVNi_6WDUp0ฤ™VWR_3UDKD_P_.ฤ€Pฤ™VtF /8;861รŒ%<7EDONRQ\FLWOLYฤ™UHVWDXURYDQpSฤฃYRGQtSUYN\YtGHฤžVNpVHFHVHGHVLJQRYรฌQiE\WHNNOLPDWL]DFHSDUNHW\Y\VRNpVWURS\ .RPSOHWQฤ™]UHNRQVWUXRYDQรฌ]Dฤจt]HQรฌE\WVLWXRYDQรฌYVHFHVQtPฤ€LQรงRYQtPGRPฤ™QDMHGQp]QHMSUHVWLรงQฤ™MรฅtFKDGUHVY3UD]HSiUNURNฤฃRG 6WDURPฤ™VWVNpKRQiPฤ™VWtDQiEฤจHรงt9OWDY\ +,*+48$/,7<$3$570(17WZREHGURRPVWZREDOFRQLHVEHDXWLIXOO\SUHVHUYHGRULJLQDODUFKLWHFWXUDOIHDWXUHVGHVLJQIXUQLWXUH DLUFRQGLWLRQLQJSDUTXHWIORRUVKLJKFHLOLQJV&RPSOHWHO\UHIXUELVKHGIXOO\IXUQLVKHGDSDUWPHQWLQDQ$UW1RXYHDXEXLOGLQJORFDWHGRQWKH PRVWSUHVWLJLRXVDGGUHVVLQ3UDJXHMXVWVWHSVIURPWKH2OG7RZQ6TXDUHDQGWKH9OWDYDULYHUEDQN

1D3HUรฅWรฌQฤ™3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

3521ร‰-(0,/($6(,ฦถว‡ฦปว„ฦบฦถ'8%(1,$35,/,ฦถว†ว‡ฦปว‚ว“

119


3URQiMHP_1D9ìåLQiFK_%XEHQHĀ_3UDKD_P_(85PęVtF $75$.7,91Ì32'.5291Ì0(=21(7VWĨHåQtWHUDVDPWHUDVDPEDONRQ\D·PORçQLFNRXSHOQ\REìYDFtSRNRM VNUEHPDDWHOLpURYìPLRNQ\åDWQDYHVWDYęQp~ORçQpSURVWRU\SDQRUDPDWLFNìYìKOHGQD3UDKXNOLPDWL]DFHGĨHYęQpSRGODK\SRGODKRYp WRSHQtNYDOLWQtY\EDYHQtVNOHS3DUNRYDFtVWiQtYJDUiçL1DGVWDQGDUGQtE\WYSDWĨHUHNRQVWUXRYDQpKRVHFHVQtKRGRPXVYìWDKHPSiUPLQXW FKģ]HRGSDUNģ6WURPRYNDD/HWQiVU\FKOìPVSRMHQtPGRFHQWUD $775$&7,9(63/,7/(9(/$77,&$3$570(17PURRIWHUUDFHPWHUUDFHWZRPEDOFRQLHVEHGURRPVEDWKURRPVILUHSODFHIXOO SDQRUDPLFYLHZRI3UDJXHLQFOWKH3UDJXH&DVWOHDQG3HWĨtQ+LOODLUFRQGLWLRQLQJZRRGIORRUVIORRUKHDWLQJEXLOWLQVWRUDJHFHOODU2QVLWHJDUDJH VSDFH+LJKTXDOLW\ILIWKIORRUDSDUWPHQWLQDUHFRQVWUXFWHG$UW1RXYHDXEXLOGLQJZLWKDOLIWPRPHQWVIURPWKH6WURPRYNDDQG/HWQiSDUNVZLWK TXLFNFRQQHFWLRQVWRWKHFLW\FHQWHU

120

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


3URQiMHP_,WDOVNi_9LQRKUDG\_3UDKD_P_.ĀPęVtF '(6,*129ë%<7NNNU\WiWHUDVDNOLPDWL]DFHRNQDSĨHVFHORXVWęQXYHVWDYęQpVNĨtQęGĨHYęQpSRGODK\DGODçEDSRGODKRYpWRSHQt EH]SHĀQRVWQtGYHĨHSUDĀNDVHVXåLĀNRXPLNURYOQQiWURXEDLQGXNĀQtYDUQiGHVND/('79µGRPiFtYLGHRWHOHIRQVNOHSYìWDK KRGLQRYiUHFHSFHEH]SHĀQRVWQtNDPHURYìV\VWpPVSUiYFRYVNiVOXçED3DUNRYDFtVWiQtYSRG]HPQtJDUiçL6W\ORYę]DĨt]HQìE\W YSĨt]HPtQRYpKRNRPSOH[X5H]LGHQFH5LHJURY\VDG\VLWXRYDQpKRSĨtPRXSDUNX $5&+,7(&7'(6,*1('$3$570(17FRYHUHGWHUUDFHEHGURRPDLUFRQGLWLRQLQJIORRUWRFHLOLQJZLQGRZVEXLOWLQZDUGUREHVZRRGIORRUV IORRUKHDWLQJVHFXULW\GRRUZDVKHUGU\HUPLFURZDYHLQGXFWLRQFRRNWRS/('79µYLGHRHQWU\SKRQHDODUPFHOODUOLIW8QGHUJURXQG SDUNLQJKRXUUHFHSWLRQVHFXULW\FDPHUDVRQVLWHFDUHWDNHUDQGPDQDJHPHQW6W\OLVKO\IXUQLVKHGJURXQGIORRUDSDUWPHQWLQWKH5LHJURY\ 6DG\5HVLGHQFHMXVWDVKRUWZDONWR:HQFHVODV6TXDUH

1D3HUåWìQę3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

3521É-(0,/($6(,ƶLJƻDŽƺƶ'8%(1,$35,/,ƶdžLJƻǂǓ

121


Byt 3+kk, 87 m2, Stodůlky - Praha 5, Petržílkova | 17 000 Kč / měsíčně Plně zařízený byt se zahrádkou o 109 m2 v přízemí novostavby v lokalitě s plnou občanskou vybaveností a parky, u stanice metra Hůrka, 7 min. od Německé školy. Obývací pokoj s kuchyní, 2 ložnice, koupelna s vanou, 2 WC, dřevěné podlahy, elektrické rolety, pračka, myčka, mikrovlnná trouba, satelit, internet. Garážové stání. Furnished ground floor apartment with a 109 m2 garden in the Krásná Hůrka Residence, with parks, full amenities, a 3 min. walk from Hůrka metro, 7 min. from the German School. Living room with kitchen, two bedrooms, bathroom with bath tub, two toilets, wood floors, electric blinds, washer, dishwasher, microwave, satellite, Internet. Garage space.

Pro kompletní nabídku navštivte / For complete property listing please visit

122

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Pronájem

Prodej

Byt 1+kk, 25 m2, Břevnov - Praha 6, 8. listopadu | 10 000 Kč / měsíčně Nové zařízené studio ve sníženém přízemí kompletně zrekonstruovaného domu bez výtahu v pěším dosahu Břevnovského kláštera a Pražského hradu. Obývací pokoj s kuchyní, koupelna s WC, parkety, elektrické topení, pračka, myčka, mikrovlnná trouba, TV, internet, alarm, videotelefon. Společná upravená zahrada. New lower ground floor studio in a completely reconstructed building with no lift, within walking distance of the Břevnovský Monastery and the Prague Castle. Living room with an open kitchen, shower bathroom with toilet, parquet floors, electric heating, washer, dishwasher, microwave, TV, Internet, alarm, video entry phone. Shared garden.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

3521É-(0,/($6(,ƶLJƻDŽƺƶ'8%(1,$35,/,ƶdžLJƻǂǓ

123


Rodinný dům 6+1, 260 m2, Podolí - Praha 4, Na Vápenném | 50 000 Kč / měsíčně Vila s terasami a úchvatným výhledem do podolského údolí, na Pražský hrad, Petřín a Vyšehrad v klidné rezidenční čtvrti s rychlou dostupností do centra. 5 ložnic, 2 koupelny, obývací pokoj s krbem a zimní zahradou, prádelna, masážní vana a sprchový kout, parkety, mramorové podlahy a obložení v koupelnách, alarm, internet. Garáž. Villa with terraces and beautiful views of the Podolí valley, Prague Castle, Petřín Hill and Vyšehrad Castle in a quiet residential area with quick connections to the city center. 5 bedrooms, 2 bathrooms, living room with a fireplace and winter garden, laundry, massage tub and shower, parquet floors, marble floors and bathrooms, alarm, Internet. Garage.

Pro kompletní nabídku navštivte / For complete property listing please visit

124

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Pronájem

Prodej

Rodinný dům 4+kk, 130 m2, Troja - Praha 7, V Podhoří | 39 000 Kč / měsíčně Rodinný dům (polovina dvojdomu) v atraktivní přírodní lokalitě v blízkosti Vltavy, ZOO a Botanické zahrady. Otevřený obývací pokoj s krbem, otevřená kuchyň se vstupem na zahradu, 3 ložnice, šatna, koupelna, 2 WC. Dřevěné podlahy, koberce, dlažba, vestavěné skříně, plynový kotel, myčka. Garáž a dvě stání na pozemku. Semidetached house in an attractive natural area moments from the Vltava river, the ZOO and Botanical Garden. Open living room with a fireplace, open kitchen with garden access, three bedrooms, walk-in closet, bathroom, two toilets. Wood floors, carpets, tiles, built-in wardrobes, gas boiler, dishwasher. Garage and two spaces on the plot.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

3521É-(0,/($6(,ƶLJƻDŽƺƶ'8%(1,$35,/,ƶdžLJƻǂǓ

125


Byt 2+1, 63 m2, Nové Město - Praha 1, Na Poříčí | 14 900 Kč / měsíčně Nově zrenovovaný byt v 1. patře rekonstruovaného dvoupatrového historického pavlačového domu naproti hotelu Imperial, minutu od náměstí Republiky s tramvajovými spoji a stanicí metra. Kuchyň, obývací pokoj, ložnice, koupelna s WC. Renovované prkenné podlahy, myčka, alarm, vstup do budovy na čip, vstup do bytu z pavlače. Newly reconstructed 1st floor apartment in a two storey renovated historic building, opposite the Imperial Hotel, a minute from Náměstí Republiky Square with metro and trams. Kitchen, living room, bedroom, bathroom with toilet. Renovated plank floors, dishwasher, alarm, chip operated entrance to the building, courtyard terrace. Quiet despite the vibrant location.

Pro kompletní nabídku navštivte / For complete property listing please visit

126

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

feelhome.cz


Pronájem

Prodej

Byt 2+kk, 96 m2, Nové Město - Praha 2, Podskalská | 18 000 Kč / měsíčně Byt po kompletní rekonstrukci ve 2. patře činžovního domu s výtahem v klidné ulici minutu chůze od vltavského nábřeží a stanice metra na Palackého náměstí. Obývací pokoj s kuchyňským koutem, ložnice s šatnou, koupelna, WC. Zachované původní prvky, dřevěné podlahy, plynový kotel, sklep, společná zahrada. Fully reconstructed 2nd floor apartment in a traditional building with a lift, in a quiet street a minute walk from the Vltava river and Palackého Square with metro station and trams. Living room with kitchen, bedroom with a walk-in closet, shower bathroom, toilet. Preserved original features, wood floors, gas boiler, cellar, shared garden.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz

3521É-(0,/($6(,ƶLJƻDŽƺƶ'8%(1,$35,/,ƶdžLJƻǂǓ

127


Apartmán Glass Suite • Ubytování až pro 5 osob • 3+kk • Praha 1 • od 155 eur/noc Plně servisovaný klimatizovaný apartmán s úžasnými výhledy na Františkánskou zahradu, dvěma ložnicemi a plně vybavenou koupelnou, ve 4. patře domu s výtahem. Oválný otevřený prostor obývacího pokoje a kuchyně s velkými francouzskými okny, jídelní stůl a balkón. Novoměstská lokalita s památkami i nočním životem. Vybavení: Wi-Fi, satelitní televize s plazmovou obrazovkou, DVD/ domácí kino, pračka, nonstop bezpečnostní služba a nonstop hotline. Úklid jednou týdně a výměna ložního prádla a ručníků v ceně. Fully serviced air-conditioned, two-bedroom, one full bathroom 4th floor apartment with magnificent views of the Franciscan Garden, building with lift. Open-plan semi circular living and kitchen area with abundance of windows, dining table and balcony. New Town area known for sights and nightlife. Amenities: Wi-Fi Internet, satellite TV, plasma screen, washing machine, 24-hour hotline, 24-hour security guard. Weekly cleaning with change of linen and towels included in the price.

Pro kompletní nabídku navštivte / For complete property listing please visit

128

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

prague-stay.com


Apartmán Urban • Ubytování až pro 5 osob • 3+kk • Praha 1 • od 120 eur/noc Apartmán s kompletním servisem, dvěma ložnicemi, jednou koupelnou a samostaným WC v 5. patře s výhledem na Pražský Hrad, budova s výtahem. Prostorný otevřený obývací pokoj s jídelním stolem, plně vybavenou kuchyní, dvěma prostornými ložnicemi a velkými sklěněnými stěnami a okny. Novoměstská lokalita s památkami, obchody a zábavou. Vybavení: Wi-Fi, satelitní televize s plazmovou obrazovkou, DVD/domácí kino, pračka a nonstop hotline. Úklid jednou týdně a výměna ložního prádla a ručníků v ceně. Fully serviced two-bedroom, one bathroom apartment with view of the Prague Castle, the 5th floor with lift. Large open-plan living and dining area, fully fitted kitchen, two spacious bedrooms, abundance of windows. New Town area known for sights, shopping and entertainment. Amenities: Wi-Fi Internet, satellite TV with plasma screen, DVD/home theater system, washing machine, 24-hour hotline. Weekly cleaning with change of linen and towels included in the price.

Na Perštýně 2, 110 00 Praha 1, T:

+420 222 311 084

$3$570É1<,$3$570(176,ǁƸƶLJljƿLJǒ'8%(1,$35,/,ƶdžLJƻǂǓ

129


Vault Apartmán • Ubytování až pro 5 osob • 3+kk • Praha 1 • od 110 eur/noc Plně servisovaný častečně klimatizovaný přízemní apartmán se dvěmi ložnicemi a dvěma koupelnami, v klidném atriu. Otevřený obývací prostor s kuchyní a klenutými stropy. V bezprostřední blízkosti Staroměstského náměstí v budově, která je na seznamu UNESCO. V blízkosti památek, zábavy a obchodů. Vybavení: Wi-Fi, satelitní televize s plazmovou obrazovkou, DVD/domácí kino, pračka a nonstop hotline. Úklid jednou týdně a výměna ložního prádla a ručníků v ceně. Fully serviced two-bedroom, two-bathroom, partially air-conditioned apartment, ground floor, reached through quiet courtyard of the UNESCO listed building. Open-plan living and kitchen area with vaulted ceiling. Located next to Old Town Square, neighborhood known for sights, entertainment and shopping. Amenities: Wi-Fi Internet, satellite TV with plasma screen, DVD/home theater system, washing machine, 24-hour hotline. Weekly cleaning with change of linen and towels included in the price.

Pro kompletní nabídku navštivte / For complete property listing please visit

130

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

prague-stay.com


Apartmán Royal Tower • Ubytování až pro 5 osob • 3+kk • Praha 1 • od 95 eur/noc Apartmán s kompletním servisem, dvě ložnice a dvě koupelny, 5. patro budovy s výtahem. Prostorný obývací pokoj s věží, velká, plně vybavená kuchyně a terasa. 10 minut od Starého Města, řada tramvajových linek a metro v těsné blízkosti. Další vybavení: Wi-Fi internet, satelitní televize s plazmovou obrazovkou, DVD/domácí kino, pračka, nonstop hotline. Úklid jednou týdně, výměna ložního prádla a ručníků zahrnuty v ceně. Fully serviced two-bedroom, two-bathroom apartment, 5th floor with lift. Large living room completed with regal tower, open-plan fully fitted kitchen, beautiful terrace. 10 minutes from the Old Town district, various tramlines and metro nearby. Amenities: Wi-Fi, satellite TV with plasma screen, DVD/home theater, washer and 24-hour hotline. Weekly cleaning, change of linen and towels included in the price.

Na Perštýně 2, 110 00 Praha 1, T:

+420 222 311 084

$3$570É1<,$3$570(176,ǁƸƶLJljƿLJǒ'8%(1,$35,/,ƶdžLJƻǂǓ

131


1HE\WRYìSURVWRU_3URQiMHP_1D3ĨtNRSę_3UDKD_1RYp0ęVWR_P_².ĀPPęVtF .DQFHOiĨVNpSURVWRU\YHSDWĨHEXGRY\VLWXRYDQpYFHQWUXPęVWD3UHVWLçQtDGUHVD'REUiGRSUDYQtGRVWXSQRVW9\EDYHQt]DKUQXMH SĨtSUDYXSURNOLPDWL]DFLLQWHUQHWRYpDWHOHIRQQtSĨLSRMHQt9EXGRYęMHYìWDKDFHQWUiOQtUHFHSFHVRVWUDKRX6HUYLVQtSRSODWN\ .ĀPPęVtF 2IILFHVSDFHRQWKHUGIORRURIDEXLOGLQJORFDWHGLQWKHFHQWUHRI3UDJXH3UHVWLJLRXVDGGUHVV*UHDWDFFHVVLELOLW\)HDWXUHVLQFOXGHDLUFRQGLWLRQ VHWXS,QWHUQHWDQGWHOHSKRQHOLQHV7KHEXLOGLQJRIIHUVOLIWDQGDFHQWUDOUHFHSWLRQZLWKVHFXULW\6HUYLFHFKDUJHV&=.PPRQWK

132

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


1HE\WRYìSURVWRU_3URQiMHP_83UģKRQX_3UDKD_+ROHåRYLFH_²P_(85PPęVtF 2EFKRGQtSURVWRU\YSĨt]HPt]UHNRQVWUXRYDQpEXGRY\EìYDOpKRSLYRYDUXMHçWYRĨtDUFKLWHNWRQLFN\YìMLPHĀQìNRPSOH[VSRMXMtFtPRGHUQt DGPLQLVWUDWLYQtDREFKRGQtSURVWRU\VQRVQìPLSUYN\NRQFHVWROHWt3URVWRU\MVRXSĨLSUDYHQ\YHVWDYXVKHOODQGFRUHWMVGRNRQĀHQìPL IDViGQtPLNRQVWUXNFHPLKUXERXSRGODKRXYHYìåFHPPSRG~URYQtĀLVWpSRGODK\SĨtSRMQìPLERG\SURYHåNHUpGDOåtVtWęDUR]YRG\ DSURWLSRçiUQtPV\VWpPHP6HUYLVQtSRSODWN\.ĀPPęVtF3RG]HPQtSDUNRYDFtVWiQt.ĀVWiQtPęVtF 5HWDLOVSDFHRQWKHJURXQGIORRURIDUHIXUELVKHGIRUPHUEUHZHU\ZKLFKIRUPDQDUFKLWHFWXUDOO\XQLTXHFRPSOH[ZLWKFKDUDFWHULVWLFIHDWXUHVRI WKHHQGRIWKHWKFHQWXU\7KHVSDFHLVRIIHUHGLQWKHVKHOODQGFRUHFRQGLWLRQLHZLWKFRPSOHWHGIDoDGHVWUXFWXUHVURXJKIORRUDWDKHLJKWRI PPEHORZWKHQHWIORRUFRQQHFWLRQSRLQWVIRUDOORWKHUQHWZRUNVDQGGLVWULEXWLRQV\VWHPVDQGIXOO\LQVWDOOHGILUHSURWHFWLRQV\VWHPV6HUYLFH FKDUJHV&=.PPRQWK8QGHUJURXQGSDUNLQJDW&=.VSDFHPRQWK

1D3HUåWìQę3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

.20(5÷1Ì1(029,7267,,&200(5&,$/3523(57,(6,ǁDžǃǃƻLJǎƻLjǁƶǖDŽƻƺƸƿƽƿǃDžLjljǓ'8%(1,$35,/,ƶdžLJƻǂǓ

133


1HE\WRYìSURVWRU_3URQiMHP_-DQNRYFRYD_3UDKD_+ROHåRYLFH_P_(85PPęVtF 0RGHUQtVYęWOpNDQFHOiĨVNpSURVWRU\YSDWĨHDGPLQLVWUDWLYQtEXGRY\VNUiVQìPYìKOHGHPQD9OWDYXDRNROt2EMHNWQDEt]tNDQFHOiĨH WĨtG\´$µFHQWUiOQtUHFHSFLKRGLQRYRXEH]SHĀQRVWQtVOXçEXNOLPDWL]DFLV\VWpPNDPHURYpRVWUDK\IOH[LELOQtXVSRĨiGiQtNDQFHOiĨt 3URMHNWVHQDFKi]tYG\QDPLFN\VHUR]YtMHMtFtORNDOLWę5\FKOiGRVWXSQRVWGRFHQWUDFFDPLQXWQD9iFODYVNpQiPęVWt6HUYLVQtSRSODWN\ .ĀPPęVtF3DUNRYDFtPtVWR(85PęVtF 0RGHUQEULJKWRIILFHSUHPLVHVRQWKHWKIORRURIDQHZDGPLQLVWUDWLYHEXLOGLQJZLWKZRQGHUIXOYLHZVRIWKH9OWDYDULYHUDQGLWVVXUURXQGLQJV 7KHEXLOGLQJRIIHUV´$FODVVµVSHFLILFDWLRQVFHQWUDOUHFHSWLRQKRXUVHFXULW\VHUYLFHDLUFRQGLWLRQLQJIOH[LEOHOD\RXWRSWLRQV&&79/RFDWHGLQD UDSLGO\JURZLQJGHYHORSPHQWDUHDFRQYHQLHQWWRWKHFLW\FHQWUH PLQXWHVWR:HQFHVODV6TXDUH 6HUYLFHFKDUJHV&=.PPRQWK 3DUNLQJSODFHDW(85PRQWK

3URNRPSOHWQtQDEtGNXQDYåWLYWH)RUFRPSOHWHSURSHUW\OLVWLQJSOHDVHYLVLW

134

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ

VYRERGDZLOOLDPVFRP


1HE\WRYìSURVWRU_3URQiMHP_äWęWNRYD_3UDKD_1XVOH_P_²(85PPęVtF .DQFHOiĨVNpSURVWRU\YHSDWĨHPRGHUQtKRSURMHNWX9SęåtGRVWXSQRVWLVWDQLFHPHWUD9\åHKUDG WUDVD& VNYęOpQDSRMHQtQDVLOQLĀQt DGiOQLĀQtVtĢ9\EDYHQtDVOXçE\]DKUQXMtNOLPDWL]DFLRWHYtUDWHOQiRNQDNDPHURYìV\VWpPSĨtVWXSNREHUFHDViGURNDUWRQRYpSĨtĀN\ YĀHWQęSOQìFKGĨHYęQìFKGYHĨt3DUNRYDFtPtVWRYSRG]HPQtJDUiçL]D(85PtVWRPęVtF9HQNRYQtSDUNRYiQt]D(85PtVWR PęVtF6HUYLVQtSRSODWN\.ĀPPęVtF 2IILFHVSDFHRQWKHQGIORRURIDQHZPRGHUQRIILFHSURMHFW([FHOOHQWDQGHDV\DFFHVVE\SXEOLFWUDQVSRUWDQGSULYDWHFDU$GMDFHQWWR9\åHKUDG OLQH& )HDWXUHVDQGVSHFLILFDWLRQLQFOXGHRSHQDEOHZLQGRZVDLUFRQGLWLRQLQJ&&79DFFHVVLQKRXVHEXLOGLQJPDQDJHPHQWFDUSHWV DQGSODVWHUERDUGSDUWLWLRQVVROLGZRRGHQGRRUV8QGHUJURXQGJDUDJHSDUNLQJDW(85SSPRQWK2XWVLGHSDUNLQJDW(85SSPRQWK 6HUYLFHIHH&=.PPRQWK

1D3HUåWìQę3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

.20(5÷1Ì1(029,7267,,&200(5&,$/3523(57,(6,ǁDžǃǃƻLJǎƻLjǁƶǖDŽƻƺƸƿƽƿǃDžLjljǓ'8%(1,$35,/,ƶdžLJƻǂǓ

135


1HE\WRYìSURVWRU_3URQiMHP_1XVHOVNi_3UDKD_1XVOH_P_².ĀPPęVtF .DQFHOiĨVNpSURVWRU\YDGPLQLVWUDWLYQtEXGRYęQHGDOHNR1iPęVWtEUDWĨt6\QNģVĀHWQìPLWUDPYDMRYìPLVSRMLPLQXWRGVWDQLFH PHWUD3UDçVNpKRSRYVWiQt3DUNHWRYpSRGODK\VWURSQtWUiP\NXFK\ĞNDVSUFKDDGRVWDWHN:&NGLVSR]LFLQDSDWĨH6HUYLVQtSRSODWN\ .ĀPPęVtF3DUNRYiQtYHGYRĨH 2IILFHVSDFHLQDQRIILFHEXLOGLQJLQFORVHSUR[LPLW\WR1iPęVWtEUDWĨt6\QNģVTXDUHMXVWPLQXWHVIURPPHWURVWDWLRQ3UDçVNpKRSRYVWiQt OLQH& 3DUTXHWHGIORRUVFHLOLQJEHDPVNLWFKHQHWWHDVKRZHUDQG:&VRQHYHU\IORRU6HUYLFHFKDUJHV&=.PPRQWK&RXUW\DUG SDUNLQJDYDLODEOH

136

1(-/(3ĝÌ1(029,7267,,%(673523(57,(6,ǂNJǎǏƶǖDŽƻƺƸƿƽƿǃDžLjljǓ


1HE\WRYìSURVWRU_3URQiMHP_3ĨHP\VORYVNi_3UDKD_æLçNRY_P_(85PPęVtF 9HOPLNYDOLWQtNDQFHOiĨVNpSURVWRU\VLWXRYDQpYSĨt]HPtDGPLQLVWUDWLYQtEXGRY\VREFKRGQtPLSURVWRU\NDYiUQRXDPH]LQiURGQtPKRWHOHP 9EH]SURVWĨHGQtEOt]NRVWLVWDQLFHPHWUD)ORUD WUDVD$ ]DVWiYN\WUDPYDMtDDXWREXVģ9REMHNWXMHFHQWUiOQtUHFHSFHVKRGLQRYRXRVWUDKRX 9\EDYHQt]DKUQXMH]GYRMHQpSRGODK\NREHUFHNOLPDWL]DFLSURVWRUĀiVWHĀQęUR]GęOHQìVNOHQęQìPLDVGNSĨtĀNDPL3DUNRYiQtYSRG]HPQtFK JDUiçtFK]D.ĀPtVWRPęVtF6HUYLVQtSRSODWN\.ĀPPęVtF 1HZ&ODVV$RIILFHVSDFHRQWKHVWIORRURIDPRGHUQPL[HGXVHRIILFHGHYHORSPHQW0HWURVWDWLRQ)ORUD OLQH$ DGMDFHQWVXEXUEDQWUDP DQGEXVOLQNVDYDLODEOHLQFORVHYLFLQLW\)HDWXUHVLQFOXGHFHQWUDOUHFHSWLRQZLWKVHFXULW\UDLVHGIORRUVIORRUER[HVFDUSHWVJODVVDQG SODVWHUERDUGSDUWLWLRQVDLUFRQGLWLRQLQJ8QGHUJURXQGSDUNLQJ&=.VSDFHPRQWK6HUYLFHFKDUJHV&=.PPRQWK

1D3HUåWìQę3UDKDWHOLQIR#VYRERGDZLOOLDPVFRP

.20(5÷1Ì1(029,7267,,&200(5&,$/3523(57,(6,ǁDžǃǃƻLJǎƻLjǁƶǖDŽƻƺƸƿƽƿǃDžLjljǓ'8%(1,$35,/,ƶdžLJƻǂǓ

137


'XNH(OOLQJWRQ2UFKHVWUD RG /XFHUQD²9HONëViO3UDKD

2UFKHVWU'XNH(OOLQJWRQDVHYUDFtGR3UDK\ 7KH'XNH(OOLQJWRQ2UFKHVWUD5HWXUQVWR3UDJXH DžǴǮǨǵǶǴƺȂǮǣǔǯǯǬDZǦǶDzDZǣǥDzǫǥǴǣǽǣǨǶǵȃǥdžǴǣǦǷ 3RGYRXOHWHFKVHGR3UDK\YUDFtREOtEHQiSDWQiFWLÿOHQQiMD]]RYiIRUPD FH 7KH 'XNH (OOLQJWRQ 2UFKHVWUD -HGHQ ] QHMYë]QDPQĚMätFK D QHMGpOH SŢVREtFtFKVYĚWRYëFKELJEDQGŢYMHKRæÿHOHVWRMtSRWRPFLVDPRWQpKR MD]]RYpKRYHOLNiQDY\VWRXStGXEQDRGKRGLQYH9HONpPViOH/X FHUQ\Y3UD]H9LQWHUSUHWDFLGĚOVODYQpKRDPHULFNpKRVNODGDWHOHDSLD QLVW\]D]Qt]QiPpPHORGLHMDNRMVRX5RFNLQ,Q5K\WKP7DNH7KH7UDLQ ÿL0RRG,QGLJR $IWHUWZR\HDUVWKHSRSXODUÀIWHHQPHPEHU-D]]EDQG7KH'XNH(OOLQJ WRQ2UFKHVWUDUHWXUQVWR3UDJXH2QHRIWKHPRVWVLJQLÀFDQWDQGORQJHVW RSHUDWLQJLQWHUQDWLRQDO%LJ%DQGVPDQDJHGE\WKHGHVFHQGDQWVRIWKH JHQLXVRI-D]]KLPVHOIZLOOSHUIRUPRQWK$SULOIURPLQWKH*UHDW +DOORIWKH/XFHUQD3DODFHLQ3UDJXH7KHIDPLOLDUWXQHVVXFKDV5RFNLQ  LQ5K\WKP7DNHWKH7UDLQDQG0RRG,QGLJRZLOOEHKHDUGLQDQLQWHUSUHWD WLRQRIWKHZRUNVRIWKHIDPRXV$PHULFDQFRPSRVHUDQGSLDQLVW ǓǮDZdzǰǺǵ  ǎDZǽDZǹǹDZǯǺ ǏǬǷǬǶǺǹȂDZǼǾǬ ǰǷȋ ǻǺǰǰDZǼDzǶǴ ȀDZǽǾǴǮǬǷȋ ©ǝǾǼǿǹ ǺǽDZǹǴ ª ǭǿǰDZǾ ǺȃǬǼǺǮǬǾDZǷȈǹǬȋ ǰDzǬdzǮǺǶǬǷǴǽǾǶǬ Ǵ ȃDZǾȇǼDZȁǶǼǬǾǹǬȋ ǺǭǷǬǰǬǾDZǷȈǹǴȂǬ ǻǼDZǸǴǴ ©ǏǼȉǸǸǴª ǐǬǵǬǹǬ ǜǴǮdz ǑDZ ǹDZǻǺǮǾǺǼǴǸȇǵ Ǵ ǾDZǻǷȇǵ ǯǺǷǺǽ ǻǼǺdzǮǿȃǴǾ ǴǽǶǷȊȃǴǾDZǷȈǹǺ ǰǷȋ ǯǺǽǾDZǵ ǎDZǽDZǹǹDZǯǺǏǬǷǬǶǺǹȂDZǼǾǬǮǽǺǻǼǺǮǺDzǰDZǹǴǴǰǮǿȁǺǾǷǴȃǹȇȁǯǴǾǬǼǴǽǾǺǮ ǬǸDZǼǴǶǬǹȂǬǜǬǽǽDZǷǬǘȉǷǺǿǹǬǴǭǼǬdzǴǷȈȂǬǜǺǸDZǼǺǗǿǭǬǸǭǺǮǮȇǽǺǶǺ ǺȂDZǹǴǮǬDZǸǺǸ ǹǺ ǼDZǰǶǺ ǻǼDZǰǽǾǬǮǷȋDZǸǺǵ ǶǬǸDZǼǹǺǵ ǻǼǺǯǼǬǸǸDZ ©6WULQJV $WWDFKHGª ǛǺǽǾǿǻǷDZǹǴȋ ǺǾ ǻǼǺǰǬDzǴ ǭǴǷDZǾǺǮ ǻǺǵǰǿǾ ǹǬ ǻǺǰǰDZǼDzǶǿǸDZDzǰǿǹǬǼǺǰǹǺǯǺǸǿdzȇǶǬǷȈǹǺǯǺȀDZǽǾǴǮǬǷȋ©ǝǾǼǿǹȇǺǽDZǹǴª

138


:HVOHHS          'R\RX"

/8;85,$ [%-; -; -;

 PČVtþQČ SĜL]DSODFHQtDNRQWDFH QtDNRQ QWDF WDFH H    SRGREXVSOiFHQtPČVtFĤQDYêãHQt NDWDORJRYiFHQD

+lVWHQVVKRZURRPQDMGHWHMLåRGGXEQDQDQRYpDGUHVH 62+2,17(5,e529e&(17580 6YUDWHFNi%UQR0RGĜLFHEOLåãtLQIRUPDFHQDWHO +b67(16&21&(376725(



 

  

62+2,17(5,e529e&(17580

9LQRKUDGVNi 3UDKD  7HOHIRQ





7HOHIRQ

6YUDWHFNi %UQR0RGĜLFH

HPDLOLQIR#SRVWHOHKDVWHQVF] ZZZKDVWHQVFRP ZZZSRVWHOHKDVWHQVF] 139


0LNXODQGVNi 3UDKD²1RYp0ĚVWR ZZZQDVLNPHSORVHF]

9LQiUQD1DãLNPpSORäH :LQH%DURQWKH6OLSSHU\6ORSH ǎǴǹǹȇǵǭǬǼÅ1DãLNPpSORäH´ ǙǬǽǶǺǷȈdzǶǺǵǰǺǼǺDzǶDZ

1HMVWH VL MLVWL FR WR ]QDPHQi NG\æ YiP QĚNGR ŐHNQH æH VH QDFKi]tWH ÅQDäLNPpSORäH´"1HYDGtQDYäWLYWHWXWRYLQiUQXD]iK\YiPEXGHYäHMDVQp SURWRæH WDP RSUDYGX EXGHWH 7HQWR SRGQLN VH VSHFLDOL]XMH QD NYDOLWQt VXGRYiYtQD]0RUDY\D-LæQt$PHULN\1DMGHWH]GHWDNpGREŐH]iVREHQRX YLQRWpNXVYëEĚUHPNYDOLWQtFKODKYRYëFKYtQ]GRPRYDL]QHM]QiPĚMätFK VYĚWRYëFK YLQDŐVNëFK REODVWt 6SROX V YtQHP VL PŢæHWH SRFKXWQDW QD YKRGQĚ VODGĚQpP YëEĚUX SŐHYiæQĚ VWXGHQëFK SRNUPŢ D SRFKXWLQ 3URVWRU\ YLQiUQ\ MVRX WDNp Y\XætYiQ\ MDNR JDOHULH REUD]Ţ D IRWHN WDNæH MHYKRGQiMDNRVNYĚOpPtVWRSURVSRMHQtGREUpVNOHQN\YtQDVXPĚQtP -HQ SUR ]DMtPDYRVW PtVWR SUR WXWR YLQiUQX QHE\OR Y\EUiQR QiKRGRX 6DPRWQëVWDYLWHOGRPXŐtMQDYURFHæiGDORSRYROHQtSURYR]RYDW Y WĚFKWR SURVWRUiFK SURGHMQX YtQD ÅNH NRQ]XPDFL ]GH L SŐHV XOLFL´ DOHQHE\ORPXWRWHKG\SRYROHQR9LQiUQĚ1DãLNPpSORäHDQRLNG\æVH ]SRæGĚQtPOHW

<RXDUHQRWVXUHZKDWLWPHDQVZKHQVRPHRQHVD\VWKDW\RXDUH´RQWKH VOLSSHU\VORSHµ"1HYHUPLQGYLVLWWKLVZLQHEDUFDOOHG´1DäLNPpSORäHµ ´2QWKH6OLSSHU\6ORSHµ DQG\RXZLOOLPPHGLDWHO\EHFOHDUDERXWLWEH FDXVHWKLVLVZKHUH\RXZLOOEH 7KLVHQWHUSULVHVSHFLDOLVHVLQTXDOLW\FDVNZLQHVIURP0RUDYLDDQG6RXWK $PHULFD+HUH\RXZLOODOVRÀQGDZHOOVXSSOLHGYLQRWHTXHZLWKDVHOHFWL RQRITXDOLW\ERWWOHGZLQHVIURPWKHKRPHODQGDVZHOODVIURPWKHPRVW IDPRXVLQWHUQDWLRQDOZLQHJURZLQJUHJLRQV7RDFFRPSDQ\\RXUZLQH\RX FDQDOVRGHOLJKWLQDFRQYHQLHQWO\KDUPRQLVHGVHOHFWLRQRIPDLQO\FROG PHDOVDQGGHOLFDFLHV7KHSUHPLVHVDUHDOVRXWLOLVHGDVDJDOOHU\RISD LQWLQJVDQGSKRWRJUDSKVWKHUHIRUHLWLVLGHDODVDQH[FHSWLRQDOYHQXHWR FRPELQHDÀQHJODVVRIZLQHZLWK$UW

140


$PDWWHURILQWHUHVWLVWKDWWKLVVLWHIRUWKHZLQHEDUZDVQRWFKRVHQE\ DFFLGHQW 2Q WK 2FWREHU  WKH EXLOGHU RI WKH KRXVH KDG DOUHDG\ UHTXHVWHGDSSURYDOWRRSHUDWHDZLQHVKRSLQWKLVORFDWLRQ´IRUFRQVXPS WLRQZLWKLQDQGDFURVVWKHVWUHHWµ+RZHYHUSHUPLVVLRQZDVQRWJUDQWHG DWWKDWWLPH ´2QWKH6OLSSHU\6ORSHµ:LQH%DUZDVHYHQWXDOO\JUDQWHGWKLVSHUPLVVL RQGHVSLWHWKHGHOD\RI\HDUV

ǎȇ ǹDZ dzǹǬDZǾDZ ǶǬǶ ȉǾǺ  ǮǽǾǿǻǴǾȈ ǹǬ ǽǶǺǷȈdzǶǴǵ ǻǿǾȈ" ǙDZǮǬDzǹǺ ǻǺǽDZǾǴǾDZǮǴǹǹȇǵǭǬǼÅǙǬǽǶǺǷȈdzǶǺǵǰǺǼǺDzǶDZªǴǽǶǺǼǺǎǬǸǮǽDZǽǾǬǹDZǾ ȋǽǹǺǻǺǾǺǸǿȃǾǺǎȇǰDZǵǽǾǮǴǾDZǷȈǹǺǾǬǸǺǶǬDzDZǾDZǽȈ ǩǾǺǻǼDZǰǻǼǴȋǾǴDZǽǻDZȂǴǬǷǴdzǴǼǿDZǾǽȋǹǬǶǬȃDZǽǾǮDZǹǹȇȁǭǺȃǶǺǮȇȁǮǴǹǬȁ ǴdzǘǺǼǬǮǴǴǴǪDzǹǺǵnjǸDZǼǴǶǴǎǭǬǼDZǭǺǷȈȄǬȋǮǴǹǺǾDZǶǬǽȄǴǼǺǶǴǸ ǮȇǭǺǼǺǸǶǬȃDZǽǾǮDZǹǹȇȁǭǿǾǴǷǴǼǺǮǬǹǹȇȁǮǴǹǸDZǽǾǹǺǯǺǻǼǺǴdzǮǺǰǽǾǮǬ Ǵ ǮǴǹ Ǵdz ǽǬǸȇȁ ǴdzǮDZǽǾǹȇȁ ǼDZǯǴǺǹǺǮ ǸǴǼǬ ǙǬǼȋǰǿ ǽ ǮǴǹǺǸ ǸǺDzǹǺ ǹǬǽǷǬDzǰǬǾȈǽȋ ȁǺǼǺȄǴǸ ǬǽǽǺǼǾǴǸDZǹǾǺǸ ǻǼDZǴǸǿȅDZǽǾǮDZǹǹǺ ȁǺǷǺǰǹȇȁ ǭǷȊǰ Ǵ dzǬǶǿǽǺǶ ǛǺǸDZȅDZǹǴȋ ǮǴǹǹǺǯǺ ǭǬǼǬ ǾǬǶDzDZ ǴǽǻǺǷȈdzǿȊǾǽȋ Ǯ ǶǬȃDZǽǾǮDZǯǬǷDZǼDZǴǰǷȋǮȇǽǾǬǮǺǶǶǬǼǾǴǹǴȀǺǾǺǯǼǬȀǴǵǩǾǺǻǼDZǶǼǬǽǹǺDZ ǸDZǽǾǺǰǷȋǽǺȃDZǾǬǹǴȋǭǺǶǬǷǬȁǺǼǺȄDZǯǺǮǴǹǬǽǴǽǶǿǽǽǾǮǺǸ ǔǹǾDZǼDZǽǹǺ ȃǾǺ ǸDZǽǾǺ ǰǷȋ ȉǾǺǯǺ ǮǴǹǹǺǯǺ ǭǬǼǬ ǭȇǷǺ ǮȇǭǼǬǹǺ ǹDZ ǽǷǿȃǬǵǹǺ  ǺǶǾȋǭǼȋ  ǯǺǰǬ dzǬǽǾǼǺǵȅǴǶ ǰǺǸǬ ǿDzDZ ǻǼǺǽǴǷ ǼǬdzǼDZȄDZǹǴȋǹǬǺǾǶǼȇǾǴDZǸǬǯǬdzǴǹǬǴǮǴǹǹǺǯǺǭǬǼǬ©ǰǷȋǻǴǾǴȋdzǰDZǽȈǴ ȃDZǼDZdzǰǺǼǺǯǿªǹǺǮǾDZǯǺǰȇDZǯǺǾǬǶǴǹDZǻǺǷǿȃǴǷ ǎǴǹǹȇǵǭǬǼÅǙǬǽǶǺǷȈdzǶǺǵǰǺǼǺDzǶDZªǹǬǶǺǹDZȂǻǺǷǿȃǴǷǰǺǷǯǺDzǰǬǹǹǺDZ ǼǬdzǼDZȄDZǹǴDZȁǺǾȋǴǽdzǬǰDZǼDzǶǺǵǮǷDZǾ

,1=(5&(

E S S E NC E PRO VÁŠ PŮVAB A ZDRAVÍ V útul né m p rostře d í naše ho stud i a v ce ntru Prahy 6 - Dejvicích Vám nab í z í me řad u akti vi t v ob l asti formování postavy, regenerace a relaxace

Vacushape Kosmetika - Matis Paris Masérské služby Ájurvéda Výživové poradenství Očista těla i mysli Jóga Fyzioterapie Kde: STU DIO E SSE NCE

www.studioessence.cz

Adresa: Václavkova 169 / 1

tel.: +420 235 350 235, +420 722 947 727

Budova nádraží „Dejvice“, 1. patro

e-mail: studioessence@volny.cz

Praha 6, 160 00


WHIRLPOOL CORPORATION PO STOPÁCH ČASU WH[W+HOHQD9DYUGRYi

IRWRZZZZKLUSRROF]

6SROHÿQRVW:KLUOSRRO&RUSRUDWLRQSŐHGQtYëUREFHDGRGDYDWHOGRPiFtFK VSRWŐHELÿŢRVODYLODYORŁVNpPURFHMLæVWROHWpYëURÿt9]QLNODYOLVWRSDGX URNXDRGWpGRE\VLVWLKOD]tVNDWVWDWXVEĚæQpVRXÿiVWLGRPiFQRVWL 7KH:KLUOSRRO&RUSRUDWLRQDOHDGLQJPDQXIDFWXUHUDQGVXSSOLHURIKRX VHKROGDSSOLDQFHVODVW\HDUDOUHDG\FHOHEUDWHGLWVFHQWHQQLDO7KHFRP SDQ\ZDVHVWDEOLVKHGLQ1RYHPEHUDQGVLQFHWKHQKDVPDQDJHG WRJDLQWKHVWDWXVRIDFRPPRQKRXVHKROGFRQVWLWXHQW ǎǽDZǸǴdzǮDZǽǾǹǬȋǶǺǸǻǬǹǴȋ:KLUOSRRO&RUSRUDWLRQǮDZǰǿȅǴǵǻǼǺǴdzǮǺǰǴǾDZǷȈǴ ǻǺǽǾǬǮȅǴǶǭȇǾǺǮǺǵǾDZȁǹǴǶǴǮǻǼǺȄǷǺǸǯǺǰǿǺǾǸDZǾǴǷǬǽǮǺǵǽǾǺǷDZǾǹǴǵ ȊǭǴǷDZǵ ǚǹǬ ǭȇǷǬ ǺǽǹǺǮǬǹǬ Ǯ ǹǺȋǭǼDZ  ǯǺǰǬ Ǵ dzǬ ǯǺǰȇ ǽǮǺDZǯǺ ǽǿȅDZǽǾǮǺǮǬǹǴȋ ǿǽǻDZǷǬ ǻǺǷǿȃǴǷǬ ǽǾǬǾǿǽ ǹDZǴdzǸDZǹǹǺǯǺ ǻǺǸǺȅǹǴǶǬ ǻǼǬǶǾǴȃDZǽǶǴǮǶǬDzǰǺǸǰǺǸǬȄǹDZǸȁǺdzȋǵǽǾǮDZ

:KLUOSRRO&RUSRUDWLRQLQ7UDFHVRI7LPH :KLUOSRRO&RUSRUDWLRQdzDzǵǶDzdzǣǰǥǴǨǰǨDZǬ 142


1DVDPpPSRÿiWNXKLVWRULHVWiODVSROHÿQRVW8SWRQ0DFKLQH&RPSDQ\ ]DORæHQi/RXD(PRU\8SWRQRYëPLY0LFKLJDQX)LUPD]tVNiYiVYŢMYĚ KODV VP\VOHP SUR NYDOLWX D FKDUDNWHUQtP MHGQiQtP NWHUp RKURPLO\ QH MHGQRKRVSRWŐHELWHOH1DNRQFLGYDFiWëFKOHWVHGtN\URVWRXFtSRSWiYFH VSRMXMHVHVSROHÿQRVWt1LQHWHHQ+XQGUHG:DVKHU&RPSDQ\DSŐHEtUiMHMt Qi]HY 1HGORXKR SRWp ÀUPD Y\UiEt SUYQt SUDÿNX V PRWRUHP DYäDN QD U\]HDXWRPDWLFNRXSUDÿNXSRG]QDÿNRX:KLUOSRROŠVLPXVtVSRWŐHELWHOp MHäWĚGDOätFKGHVHWOHWSRÿNDW7DVNOt]tSRVYpPXYHGHQtQDWUKREURYVNë ~VSĚFKDDE\VHQRYi]QDÿNDVKRGRYDODVQi]YHPÀUP\SŐHMPHQRYDOD VH VSROHÿQRVW QD :KLUOSRRO &RUSRUDWLRQ 9 Wp GREĚ MLæ QDEt]HOD PQRKR VSRWŐHELÿŢGRGRPiFQRVWLYÿHWQĚDXWRPDWLFNëFKVXäLÿHN

9ë]QDPQëP PH]QtNHP E\OD L äHGHViWi OpWD NG\ VH YëUREN\ :KLUOSRRO UR]äLŐXMtGRYHŐHMQëFKSUiGHOHQDÿLVWtUHQ9QiVOHGXMtFtFKGHNiGiFKVH VSROHÿQRVW VRXVWŐHGLOD QD YëUREX VSRWŐHELÿŢ äHWUQëFK N æLYRWQtPX SUR VWŐHGtDURYQĚæQDH[SDQ]LPLPRDPHULFNëWUK'RäORNH]QDÿQpPXQi UŢVWXREFKRGQtFKSRERÿHNÿLVSROXSUiFLVHVYĚWR]QiPRX]QDÿNRX,.($ :KLUOSRRO&RUSRUDWLRQE\ODGiOH]DŐD]HQDPH]LQHMYtFHLQRYDWLYQtFK VSROHÿQRVWtVYĚWDDVWDODVHSUYQtPVYĚWRYëPYëUREFHPVSRWŐHELÿŢNWHUë VLY\W\ÿLO]DFtOJOREiOQtVQLæRYiQtVNOHQtNRYëFKSO\QŢ

143


7KH8SWRQ0DFKLQH&RPSDQ\IRXQGHGE\/RXDQG(PRU\8SWRQLQ0LFKL JDQZDVWKHYHU\EHJLQQLQJRILWVKLVWRU\7KHFRPSDQ\JDLQHGLWVUHSX WDWLRQ IRU TXDOLW\ DQG KRQHVW GHDOLQJV WKDW VWXQQHG PDQ\ D FRQVXPHU $WWKHHQGRIWKHVWKDQNVWRDJURZLQJGHPDQGLWPHUJHGZLWKWKH 1LQHWHHQ +XQGUHG :DVKHU &RPSDQ\ DQG WRRN RYHU LWV QDPH 6RRQ DI WHUWKHFRPSDQ\PDQXIDFWXUHGWKHÀUVWZDVKLQJPDFKLQHZLWKDPRWRU EXWFXVWRPHUVKDGWRZDLWDQRWKHUWHQ\HDUVIRUWKH:KLUOSRROŠEUDQGHG IXOO\DXWRPDWLFZDVKLQJPDFKLQH7KLVKDUYHVWHGDKXJHVXFFHVVDIWHU LWVODXQFK7RPDWFKWKHQHZEUDQGZLWKWKHFRPSDQ\QDPHWKHÀUP·V QDPHZDVFKDQJHGWRWKH:KLUOSRRO&RUSRUDWLRQ$WWKDWWLPHLWZDVDO UHDG\RIIHULQJPDQ\KRXVHKROGDSSOLDQFHVLQFOXGLQJDXWRPDWLFGU\HUV

7KH V ZHUH DQ LPSRUWDQW PLOHVWRQH ZKHQ :KLUOSRRO SURGXFWV ZHUH H[WHQGHGWRSXEOLFODXQGULHVDQGGU\FOHDQHUV,QWKHIROORZLQJGHFDGHV WKHFRPSDQ\FRQFHQWUDWHGRQSURGXFLQJHQYLURQPHQWDOO\IULHQGO\DSSOL DQFHV DV ZHOO DV RQ H[SDQVLRQ RXWVLGH WKH 86 PDUNHW $ VLJQLÀFDQW LQFUHDVHLQVDOHVRIÀFHVIROORZHGDQGDOVRFROODERUDWLRQZLWKWKHZRUOG IDPRXV,.($EUDQG7KH:KLUOSRRO&RUSRUDWLRQZDVDOVRLQFOXGHGDPRQJ WKH0RVW,QQRYDWLYH&RPSDQLHVLQWKH:RUOGDQGKDVEHFRPHWKH ZRUOG·V OHDGLQJ PDQXIDFWXUHU RI DSSOLDQFHV WR KDYH VHW D JRDO IRU WKH JOREDOUHGXFWLRQRIJUHHQKRXVHJDVHPLVVLRQV

144


:KLUOSRRO&RUSRUDWLRQYVRXÿDVQpGREĚ]DVWŐHäXMHQĚNROLN]QDÿHNQDSŐ :KLUOSRRO%DXNQHFKW0D\WDJ.LWFKHQ$LGDM-HMLFKVSRWŐHELÿHVHSURGi YDMtYH]HPtFKVYĚWDDMVRXEĚæQRXVRXÿiVWtDVLPLOLyQŢGRPiF QRVWt1HGiYQRE\ODVSROHÿQRVWRFHQĚQDSUHVWLæQtPLFHQDPLL)3URGXNW 'HVLJQ$ZDUGDL)*ROG'HVLJQ$ZDUG]DYDUQRXGHVNXL;HOLXP709UiP FL :KLUOSRRO &RUSRUDWLRQ IXQJXMH URYQĚæ QDGDFH :KLUOSRRO )RXQGDWLRQ NWHUi VH ]DPĚŐXMH QD JOREiOQt VRFLiOQt SUREOpP\ D SRVN\WXMH ÀQDQÿQt ]GURMHGRSRWŐHEQëFKREODVWt þHVNiSRERÿND:KLUOSRROY]QLNODY3UD]HURNXDRÿW\ŐLURN\SR] GĚMLE\OQDÿHVNëWUKXYHGHQFHOëVRUWLPHQWMHMLFKVSRWŐHELÿŢ9VRXÿDVQp GREĚMH:KLUOSRROSRYDæRYiQ]DQHMREOtEHQĚMätD]iURYHŁQHMSURGiYDQĚMät ]QDÿNXQDÿHVNpPWUKX

145


7KH:KLUOSRRO&RUSRUDWLRQFXUUHQWO\FRYHUVVHYHUDOEUDQGVVXFKDV:KLUO SRRO%DXNQHFKW0D\WDJ.LWFKHQ$LGDQGRWKHUV,WVDSSOLDQFHVDUHVROG LQFRXQWULHVRIWKHZRUOGDQGDUHDQRUPDOSDUWRIDSSUR[LPDWHO\ PLOOLRQKRXVHKROGV5HFHQWO\WKHFRPSDQ\ZDVDZDUGHGWKHSUHVWLJLRXV L)3URGXFW'HVLJQ$ZDUGDQGWKHL)'HVLJQ*ROG$ZDUGIRUWKHL;HOLXP70 KRE7KH:KLUOSRRO)RXQGDWLRQDOVRRSHUDWHVZLWKLQWKH:KLUOSRRO&RUSR UDWLRQDQGIRFXVHVRQJOREDOVRFLDOLVVXHVSURYLGLQJÀQDQFLDOUHVRXUFHV WRQHHG\DUHDV 7KH&]HFKEUDQFKRI:KLUOSRROZDVHVWDEOLVKHGLQ3UDJXHLQDQG IRXU\HDUVODWHUWKHHQWLUHUDQJHRIWKHLUSURGXFWVZDVODXQFKHGRQWKH &]HFKPDUNHW&XUUHQWO\:KLUOSRROLVFRQVLGHUHGWKHPRVWSRSXODUDQG ZLGHO\VROGEUDQGRQWKH&]HFKPDUNHW

ǟǴǽǾǺǶǺǮǴǽǾǺǼǴǴȀǴǼǸȇǽǾǺǴǾǶǺǸǻǬǹǴȋ©8SWRQ0DFKLQH&RPSDQ\ª ǺǽǹǺǮǬǹǹǬȋǗǿǴǩǸǺǼǴnjǻǾǺǹǮǘǴȃǴǯǬǹDZǖǺǸǻǬǹǴȋǭȇǽǾǼǺǰǺǭǴǷǬǽȈ ȁǺǼǺȄDZǵ ǼDZǻǿǾǬȂǴǴ dzǬ ǶǬȃDZǽǾǮǺ Ǵ ȁǬǼǬǶǾDZǼǹȇDZ ǻǼǴDZǸȇ Ǯ ǼǬǭǺǾDZ dzǬǽǷǿDzǴǮȄǴDZ ǿǮǬDzDZǹǴDZ ǸǹǺǯǴȁ ǻǺǾǼDZǭǴǾDZǷDZǵ ǎ ǶǺǹȂDZ ǰǮǬǰȂǬǾȇȁ ǯǺǰǺǮǭǷǬǯǺǰǬǼȋǼǬǽǾǿȅDZǸǿǽǻǼǺǽǿǶǺǸǻǬǹǴȋǺǭȆDZǰǴǹȋDZǾǽȋǽ©1LQH WHHQ +XQGUHG :DVKHU &RPSDQ\ª Ǵ ǭDZǼDZǾ DZDZ ǹǬdzǮǬǹǴDZ ǎǽǶǺǼDZ ǻǺǽǷDZ ȉǾǺǯǺ ǶǺǸǻǬǹǴȋ ǻǼǺǴdzǮǺǰǴǾ ǻDZǼǮǿȊ ǽǾǴǼǬǷȈǹǿȊ ǸǬȄǴǹǿ ǽ ǸǺǾǺǼǺǸ ǙǺ ȉǾǺ DZȅDZ ǹDZ ǽǾǴǼǬǷȈǹǬȋ ǸǬȄǴǹǬǬǮǾǺǸǬǾ ǸǬǼǶǴ :KLUOSRRO Š  ǶǺǾǺǼǿȊǻǺǾǼDZǭǴǾDZǷǴDzǰǬǷǴDZȅDZǰDZǽȋǾȈǷDZǾǴǶǺǾǺǼǬȋǻǺǽǷDZdzǬǻǿǽǶǬǮ ǻǼǺǴdzǮǺǰǽǾǮǺǴǸDZǷǬǹǬǽǾǺǷȈǶǺǺǯǼǺǸǹȇǵǿǽǻDZȁȃǾǺǰǷȋǽǺǺǾǮDZǾǽǾǮǴȋ ǹǺǮǺǵ ǸǬǼǶǴ ǹǬdzǮǬǹǴȊ ǶǺǸǻǬǹǴǴ ȀǴǼǸǬ ǴdzǸDZǹǴǷǬ ǽǮǺDZ ǴǸȋ ǹǬ ©:KLUOSRRO &RUSRUDWLRQª ǟDzDZ Ǯ ǾǺ ǮǼDZǸȋ ǺǹǬ ǻǼDZǰǷǬǯǬǷǬ ǸǹǺDzDZǽǾǮǺ ǭȇǾǺǮȇȁǻǼǴǭǺǼǺǮǮǶǷȊȃǬȋǬǮǾǺǸǬǾǴȃDZǽǶǴDZǽǿȄǴǷǶǴ

146


ǎǬDzǹǺǵ ǮDZȁǺǵ ǽǾǬǷǴ ȄDZǽǾǴǰDZǽȋǾȇDZ ǯǺǰȇ ǶǺǯǰǬ ǶǬȃDZǽǾǮDZǹǹǿȊ ǻǼǺǰǿǶȂǴȊ:KLUOSRROǽǾǬǷǴǻǼǴǺǭǼDZǾǬǾȈǺǭȅDZǽǾǮDZǹǹȇDZǻǼǬȃDZȃǹȇDZǴ ȁǴǸȃǴǽǾǶǴ ǎ ǻǺǽǷDZǰǿȊȅǴDZ ǰDZǽȋǾǴǷDZǾǴȋ ǶǺǸǻǬǹǴȋ ǽǺǽǼDZǰǺǾǺȃǴǷǬǽȈ ǹǬǻǼǺǴdzǮǺǰǽǾǮDZǾDZȁǹǴǶǴǭDZǼDZǯǿȅDZǵǺǶǼǿDzǬȊȅǿȊǽǼDZǰǿǬǾǬǶDzDZǹǬ ȉǶǽǻǬǹǽǴǴdzǬǻǼDZǰDZǷȇǬǸDZǼǴǶǬǹǽǶǺǯǺǼȇǹǶǬǎǼDZdzǿǷȈǾǬǾDZǻǺǽǷDZǰǺǮǬǷ dzǹǬȃǴǾDZǷȈǹȇǵ ǼǺǽǾ ȀǴǷǴǬǷǺǮ ǶǺǸǻǬǹǴǴ Ǵ ǻǺǰǻǴǽǬǹ ǰǺǯǺǮǺǼ Ǻ ǽǺǾǼǿǰǹǴȃDZǽǾǮDZǽǺǮǽDZǸǴǼǹǺǴdzǮDZǽǾǹȇǸǭǼDZǹǰǺǸ,.($:KLUOSRRO&RU SRUDWLRQ ǾǬǶDzDZ ǭȇǷǬ ǮǶǷȊȃDZǹǬ Ǯ ȃǴǽǷǺ  ǽǬǸȇȁ ǴǹǹǺǮǬȂǴǺǹǹȇȁ ǶǺǸǻǬǹǴǵ ǸǴǼǬ Ǵ ǽǾǬǷǬ ǻDZǼǮȇǸ Ǯ ǸǴǼDZ ǻǼǺǴdzǮǺǰǴǾDZǷDZǸ ǭȇǾǺǮǺǵ ǾDZȁǹǴǶǴǶǺǾǺǼǬȋǻǺǽǾǬǮǴǷǬǻDZǼDZǰǽǺǭǺǵdzǬǰǬȃǿǽǺǶǼǬȅDZǹǴȋǮȇǭǼǺǽǺǮ ǻǬǼǹǴǶǺǮȇȁǯǬdzǺǮ

:KLUOSRRO &RUSRUDWLRQ Ǯ ǹǬǽǾǺȋȅDZDZ ǮǼDZǸȋ ǺȁǮǬǾȇǮǬDZǾ ǹDZǽǶǺǷȈǶǺ ǭǼDZǹǰǺǮ ǾǬǶǴȁ ǶǬǶ :KLUOSRRO %DXNQHFKW 0D\WDJ .LWFKHQ$LG Ǵ Ǿǰ ǍȇǾǺǮȇDZ ǻǼǴǭǺǼȇ ȉǾǴȁ ǸǬǼǺǶ ǻǼǺǰǬȊǾǽȋ Ǯ  ǽǾǼǬǹǬȁ ǸǴǼǬ Ǵ ȋǮǷȋȊǾǽȋ ǹDZǴdzǸDZǹǹȇǸǴ ǻǺǸǺȅǹǴǶǬǸǴ ǻǼǴǸDZǼǹǺ Ǯ  ǸǴǷǷǴǺǹǬȁ ǰǺǸǬȄǹǴȁȁǺdzȋǵǽǾǮǙDZǰǬǮǹǺǶǺǸǻǬǹǴȋǭȇǷǬǿǰǺǽǾǺDZǹǬǻǼDZǽǾǴDzǹȇȁ ǹǬǯǼǬǰ©L)3URGXNW'HVLJQ$ZDUGªǴ©L)*ROG'HVLJQ$ZDUGªdzǬǮǬǼǺȃǹǿȊ ǻǬǹDZǷȈ L;HOLXP70 ǎ ǼǬǸǶǬȁ :KLUOSRRO &RUSRUDWLRQ ǽǿȅDZǽǾǮǿDZǾ ȀǺǹǰ ©:KLUOSRRO )RXQGDWLRQªǹǬȂDZǷDZǹǹȇǵ ǹǬ ǼDZȄDZǹǴDZ ǯǷǺǭǬǷȈǹȇȁ ǽǺȂǴǬǷȈǹȇȁ ǻǼǺǭǷDZǸ Ǵ ǻǼDZǰǺǽǾǬǮǷȋȊȅǴǵ ȀǴǹǬǹǽǺǮǿȊ ǻǺǸǺȅȈ Ǯ ǹDZǺǭȁǺǰǴǸȇȁǺǭǷǬǽǾȋȁ ǣDZȄǽǶǴǵ ȀǴǷǴǬǷ :KLUOSRRO ǭȇǷ ǽǺdzǰǬǹ Ǯ ǛǼǬǯDZ Ǯ  ǯǺǰǿ Ǵ ǿDzDZ ȃDZǼDZdzȃDZǾȇǼDZǯǺǰǬǹǬȃDZȄǽǶǺǸǼȇǹǶDZǭȇǷǻǼDZǰǽǾǬǮǷDZǹǮDZǽȈǽǻDZǶǾǼ ǻǼǺǰǿǶȂǴǴǶǺǸǻǬǹǴǴǎǹǬǽǾǺȋȅDZDZǮǼDZǸȋ:KLUOSRROǽȃǴǾǬDZǾǽȋǽǬǸȇǸ ǻǺǻǿǷȋǼǹȇǸ Ǵ ǮǸDZǽǾDZ ǽ ǾDZǸ ǽǬǸȇǸ ǻǼǺǰǬǮǬDZǸȇǸ ǭǼDZǹǰǺǸ ǹǬ ȃDZȄǽǶǺǸǼȇǹǶDZ

147


3URVODYWHVYďMKRWHOYVRXWĥçL

&]HFK+RWHO$ZDUGV %ULQJ)DPHWR\RXU+RWHOLQWKH&]HFK+RWHO$ZDUGV&RPSHWLWLRQ džǴDzǵǯǣǥȀǶǨǵǥDzǭDzǶǨǯȀǥǮDzDZǮǷǴǵǨ&]HFK+RWHO$ZDUGV

-VWHKUGëPPDMLWHOHPKRWHOXNWHUëVL]tVNiYiQD]iNODGĚYëERUQëFKVOX æHEVWiOHYĚWätREOLEX"1DEt]tWHQĚFRVSHFLÀFNpKRFRMLQpKRWHO\QHPDMt" -HYiäKRWHORVRELWëDYëMLPHÿQë"3DNE\YiPQHPĚODXMtWMHGLQHÿQiSŐt OHæLWRVWMDNMHMSŐHGVWDYLWMHäWĚYĚWätPXPQRæVWYtQiYäWĚYQtNŢ3ŐLKODVWH VYŢMKRWHOGRVRXWĚæHRWLWXO+RWHOURNX 7DWRVRXWĚæSUREtKDMtFtYUiPFLSUHVWLæQtFK&]HFK+RWHO$ZDUGVSRŐiGD QëFKVSROHÿQRVWt&RQYHQWLDVURQHPiYþHVNXREGRE\DYSRVOHGQtFK OHWHFKMLO]HR]QDÿLW]DQHMYĚWätNRQDQRXDNFLYUiPFLKRWHOQLFWYtXQiV 3RNXGMVWHGRVXGYiKDOLV~ÿDVWtVYpKRKRWHOXYĚŐWHæHMHQHMY\äätÿDV 1RPLQDFtGRVRXWĚæHWRWLæ]tVNiWHQHMHQSUHVWLæDOHGRVWDQHWHWDNpQH RSDNRYDWHOQRX äDQFL RGOLäLW VH RG VYp NRQNXUHQFH D SŐHGYpVW VYp QHM VLOQĚMätVWUiQN\6LOQiPHGLiOQtSRGSRUDDY\KOiäHQtYëVOHGNŢMHäWĚSŐHG WXULVWLFNRXVH]yQRXURYQĚæSRVN\WXMtYHONëSURVWRUMDNYHMtWGRSRYĚGRPt SRWHQFLiOQtFKNOLHQWŢDQiYäWĚYQtNŢD]DMLVWLWVLWDN]QDWHOQëSŐtOLYKRVWŢ

148


2FHQĚQt+RWHOURNXMHXGĚORYiQRYHÿWUQiFWL]DVWRXSHQëFKNUDMtFK KQHG Y QĚNROLND NDWHJRULtFK D KRWHO\ WDN PRKRX ]tVNDW RFHQĚQt ]D QHM OHSätWŐtKYĚ]GLÿNRYëÿW\ŐKYĚ]GLÿNRYëÿLSĚWLKYĚ]GLÿNRYëKRWHO]DQHMOHSät ZHOOQHVV VSD KRWHO D QHMOHSät NRQJUHVRYë KRWHO 1D ]iNODGĚ KODVRYiQt YHŐHMQRVWLYNDWHJRULtFKWŐtKYĚ]GLÿNRYëFKÿW\ŐKYĚ]GLÿNRYëFKSĚWLKYĚ]GLÿ NRYëFKDZHOOQHVV VSDKRWHOŢDQD]iNODGĚKODVRYiQtRGERUQpSRURW\Y NDWHJRULLNRQJUHVRYëKRWHOEXGHY\EUiQYtWĚ]YNDæGpPNUDMLþ5+ODVRYi QtEXGHSUREtKDWQDZZZKRWHOF]DZZZKRWHODZDUGVF] &tOHPVRXWĚæHMH]PDSRYiQtD]YLGLWHOQĚQtWĚFKQHMOHSätFKDQHMNYDOLWQĚM ätFKKRWHOŢYFHOpþHVNpUHSXEOLFH9WXWRFKYtOLVHQHXVWiOHGDOätKRWHO\ UHJLVWUXMtDYĚŐtPHæH]iMHPR~ÿDVWYWpWRYĚKODVQpVRXWĚæLMHäWĚSRURVWH DSŐHGYHGHWRQHMOHSätFRXQiVPŢæHPHREODVWLKRWHOQLFWYtQDMtW 6ODYQRVWQt JDODYHÿHU V Y\KOiäHQtP YëVOHGNŢ SDN SUREĚKQH  ÿHUYQD Y3UŢP\VORYpPSDOiFLQD9ëVWDYLäWL9HONROHSiVKRZQDEtGQHSUR VWRUSURQHMUŢ]QĚMätSUH]HQWDFHDRFKXWQiYN\DVSROHÿQĚVERKDWëPSUR JUDPHPVHSRVWDUiRQH]DSRPHQXWHOQëYHÿHU

$UH\RXDSURXGRZQHURIDKRWHOZKLFKLVEHFRPLQJLQFUHDVLQJO\SRSXODU RQWKHEDVLVRILWVH[FHOOHQWVHUYLFHV"$UH\RXRIIHULQJVRPHWKLQJVSHFLÀF WKDWRWKHUKRWHOVGRQRWKDYH",V\RXUKRWHOGLVWLQFWLYHDQGH[FHSWLRQDO" 7KHQ\RXVKRXOGQRWPLVVWKLVXQLTXHRSSRUWXQLW\RISUHVHQWLQJLWWRHYHQ PRUHJXHVWV(QWHU\RXUKRWHOLQWKHFRPSHWLWLRQIRUWKHWLWOHRI+RWHORI WKH<HDU 7KLVFRPSHWLWLRQKHOGZLWKLQWKHSUHVWLJLRXV&]HFK+RWHO$ZDUGVRUJDQL VHGE\WKH&RQYHQWLDVURFRPSDQ\LVXQULYDOOHGLQWKH&]HFK5HSXEOLF ,QUHFHQW\HDUVLWKDVEHHQFRQVLGHUHGWKHODUJHVWHYHQWWREHKHOGLQ RXUFRXQWU\·VKRWHOLQGXVWU\,I\RXDUHKHVLWDWLQJDERXWSDUWLFLSDWLQJZLWK \RXUKRWHOQRZLWLVKLJKWLPHWRHQWHU%\QRPLQDWLRQLQWKHFRPSHWLWL RQ\RXQRWRQO\JDLQSUHVWLJHEXWDOVRDQXQUHSHDWDEOHRSSRUWXQLW\WR GLIIHUHQWLDWH \RXUVHOI IURP \RXU FRPSHWLWLRQ DQG WR VKRZ RII \RXU EHVW IHDWXUHV6WURQJPHGLDVXSSRUWDQGWKHDQQRXQFHPHQWRIUHVXOWVEHIRUH WKHWRXULVWVHDVRQDOVRSURYLGHDPSOHSURVSHFWVIRUDWWUDFWLQJWKHDWWHQ WLRQRISRWHQWLDOFOLHQWVDQGYLVLWRUVWKXVHQVXULQJDQRWLFHDEOHLQÁX[RI JXHVWV 7KH+RWHORIWKH<HDUWLWOHLVDZDUGHGLQWKHUHSUHVHQWHGUHJLRQV LQVHYHUDOFDWHJRULHV+RWHOVPD\EHVHOHFWHGDVWKH%HVWVWDUVWDURU VWDU+RWHOWKH%HVW:HOOQHVV 6SD+RWHODQGWKH%HVW&RQJUHVV+RWHO %DVHGRQWKHYRWHVRIWKHMXU\DQGWKHSXEOLFDQDEVROXWHZLQQHUZLOOEH FKRVHQLQHYHU\FDWHJRU\9RWLQJZLOOWDNHSODFHDWZZZKRWHOF]DQGZZZ KRWHODZDUGVF]

7KHFRPSHWLWLRQDLPVWRPDSDQGSURPRWHWKHEHVWDQGÀQHVWKRWHOVLQ WKH&]HFK5HSXEOLF$WWKLVSRLQWDQLQFUHDVLQJQXPEHURIKRWHOVLVFRQ WLQXRXVO\EHLQJUHJLVWHUHGDQGZHEHOLHYHWKDWLQWHUHVWLQSDUWLFLSDWLQJLQ WKLVSUHVWLJLRXVFRPSHWLWLRQZLOOJURZHYHQIXUWKHULQRUGHUWRGHPRQVWUD WHWKHEHVWZHFDQÀQGLQWKHÀHOGRIWKHGRPHVWLFKRWHOEXVLQHVV $ *DOD (YHQLQJ ZLWK WKH DQQRXQFHPHQW RI WKH UHVXOWV ZLOO EH KHOG RQ -XQHLQWKH,QGXVWULDO3DODFHDWWKH3UDJXH([KLELWLRQ*URXQGV 7KLVVSHFWDFXODUHYHQWZLOORIIHUVSDFHIRUDYDULHW\RISUHVHQWDWLRQVDQG WDVWLQJVDQGZLWKLWVLPSUHVVLYHSURJUDPPHZLOOHQVXUHDPHPRUDEOH HYHQLQJ

149


ǎȇǿǽǻDZȄǹȇǵǮǷǬǰDZǷDZȂǺǾDZǷȋǶǺǾǺǼȇǵǺǾǷǴȃǬDZǾǽȋǮȇǽǺǶǺǶǷǬǽǽǹȇǸǴ ǿǽǷǿǯǬǸǴ  Ǵ ǽǾǬǹǺǮǴǾǽȋ ǮǽDZ ǭǺǷDZDZ Ǵ ǭǺǷDZDZ ǻǺǻǿǷȋǼǹȇǸ" ǔǷǴ Ǯȇ ǻǼDZǰǷǬǯǬDZǾDZȃǾǺǾǺǽǻDZȂǴȀǴȃDZǽǶǺDZǾǺȃDZǯǺǹDZǾǮǰǼǿǯǴȁǺǾDZǷȋȁ"ǔǷǴ ǮǬȄ ǺǾDZǷȈ ǺǭǷǬǰǬDZǾ ǽǺǭǽǾǮDZǹǹȇǸ ǷǴȂǺǸ Ǵ ǺǽǺǭDZǹǹǺǽǾȋǸǴ" ǞǺǯǰǬ ǿ ǮǬǽDZǽǾȈǿǹǴǶǬǷȈǹǬȋǮǺdzǸǺDzǹǺǽǾȈǻǼDZǰǽǾǬǮǴǾȈǽǮǺǵǺǾDZǷȈǭǺǷȈȄǺǸǿ ǶǺǷǴȃDZǽǾǮǿǻǺǾDZǹȂǴǬǷȈǹȇȁǻǺǽDZǾǴǾDZǷDZǵǛǼǴǸǴǾDZǿȃǬǽǾǴDZǮǶǺǹǶǿǼǽDZ ǹǬdzǮǬǹǴDZ©ǚǾDZǷȈǯǺǰǬª ǩǾǺǾǻǼDZǽǾǴDzǹȇǵǶǺǹǶǿǼǽǻǼǺȁǺǰȋȅǴǵǮǼǬǸǶǬȁ©&]HFK+RWHO$ZDUGVª ǺǼǯǬǹǴdzǿDZǾǶǺǸǻǬǹǴȋ&RQYHQWLDVURǖǺǹǶǿǼǽǹDZǴǸDZDZǾǻǼDZȂDZǰDZǹǾǺǮ Ǯ ǣDZȄǽǶǺǵ ǜDZǽǻǿǭǷǴǶDZ Ǵ Ǯ ǻǺǽǷDZǰǹǴDZ ǯǺǰȇ ȋǮǷȋDZǾǽȋ ǶǼǿǻǹDZǵȄǴǸ ǽǺǭȇǾǴDZǸ ǻǼǺȁǺǰȋȅǴǸ  Ǯ ǺǭǷǬǽǾǴ ǯǺǽǾǴǹǴȃǹǺǯǺ ǭǴdzǹDZǽǬ ǑǽǷǴ Ǯȇ DZȅDZǹDZǻǼǺȄǷǴǼDZǯǴǽǾǼǬȂǴȊǹǬǿȃǬǽǾǴDZǮǶǺǹǶǿǼǽDZǾǺǽDZǵȃǬǽǽǬǸǺDZ ǮǼDZǸȋǻǼǴǽǺDZǰǴǹǴǾȈǽȋǖǬǶǿȃǬǽǾǹǴǶǶǺǹǶǿǼǽǬǮȇǻǺǷǿȃǴǾDZǹDZǾǺǷȈǶǺ ǻǼDZǽǾǴDz ǹǺ Ǵ ǿǹǴǶǬǷȈǹǿȊ ǮǺdzǸǺDzǹǺǽǾȈ ǮȇǰDZǷǴǾȈǽȋ Ǯ ǶǺǹǶǿǼDZǹǾǹǺǵ ǽǼDZǰDZ Ǵ ǻǺǶǬdzǬǾȈ ǽǮǺǴ ǽǴǷȈǹȇDZ ǽǾǺǼǺǹȇ ǝǴǷȈǹǬȋ ǻǺǰǰDZǼDzǶǬ ǽǼDZǰǽǾǮǸǬǽǽǺǮǺǵǴǹȀǺǼǸǬȂǴǴǴǺǭȆȋǮǷDZǹǴDZǼDZdzǿǷȈǾǬǾǺǮǰǺǹǬȃǬǷǬ ǾǿǼǴǽǾǴȃDZǽǶǺǯǺ ǽDZdzǺǹǬ ǾǬǶDzDZ ǻǼDZǰǺǽǾǬǮǷȋȊǾ ȄǴǼǺǶǴDZ ǮǺdzǸǺDzǹǺǽǾǴ ǮǷǴȋǹǴȋǹǬǻǺǾDZǹȂǴǬǷȈǹȇȁǶǷǴDZǹǾǺǮǴǻǺǽDZǾǴǾDZǷDZǵǴǾǬǶǴǸǺǭǼǬdzǺǸ ǺǭDZǽǻDZȃDZǹǴDZdzǬǸDZǾǹǺǯǺǻǼǴǾǺǶǬǯǺǽǾDZǵ

ǛǼDZǸǴȋ ©ǚǾDZǷȈ ǯǺǰǬ ² ª ǻǼǴǽǿDzǰǬDZǾǽȋ Ǯ ȃDZǾȇǼǹǬǰȂǬǾǴ ǻǼDZǰǽǾǬǮǷDZǹǹȇȁǺǭǷǬǽǾȋȁǻǼǴȃDZǸǽǼǬdzǿǮǹDZǽǶǺǷȈǶǴȁǶǬǾDZǯǺǼǴȋȁǾǬǶǴǸ ǺǭǼǬdzǺǸ ǺǾDZǷǴ  ǸǺǯǿǾ ǻǺǷǿȃǴǾȈ ǹǬǯǼǬǰǿ dzǬ ǷǿȃȄǴǵ ǾǼDZȁdzǮDZdzǰǺȃǹȇǵ ȃDZǾȇǼDZȁdzǮDZdzǰǺȃǹȇǵ ǴǷǴ ǻȋǾǴdzǮDZdzǰǺȃǹȇǵ ǺǾDZǷȈ dzǬ ǷǿȃȄǴǵ ZHOOQH VV VSD ǺǾDZǷȈ Ǵ ǷǿȃȄǴǵ ǶǺǹǯǼDZǽǽǺǾDZǷȈ ǙǬ ǺǽǹǺǮǬǹǴǴ ǯǺǷǺǽǺǮǬǹǴȋ ǽǻDZȂǴǬǷȈǹǺ ǮȇǭǼǬǹǹǺǯǺ DzȊǼǴ Ǭ ǾǬǶDzDZ Ǵ ǺǭȅDZǽǾǮDZǹǹǺǽǾǴ ǭǿǰDZǾ ǮȇǭǼǬǹ ǬǭǽǺǷȊǾǹȇǵ ǻǺǭDZǰǴǾDZǷȈ Ǯ ǶǬDzǰǺǵ ǶǬǾDZǯǺǼǴǴ ǏǺǷǺǽǺǮǬǹǴDZ ǭǿǰDZǾǻǼǺȁǺǰǴǾȈǹǬǽǬǵǾǬȁZZZKRWHOF]ǴZZZKRWHODZDUGVF] ǢDZǷȈ ǶǺǹǶǿǼǽǬ   ǹǬǵǾǴ Ǵ ǻǺǶǬdzǬǾȈ ǽǬǸȇDZ ǷǿȃȄǴDZ Ǵ ǽǬǸȇDZ ǶǺǸȀǺǼǾǬǭDZǷȈǹȇDZ ǺǾDZǷǴ ǣDZȄǽǶǺǵ ǼDZǽǻǿǭǷǴǶǴ Ǯ ȂDZǷǺǸ ǙǬ ǰǬǹǹȇǵ ǸǺǸDZǹǾ ǹǺǮȇDZ Ǵ ǹǺǮȇDZ ǺǾDZǷǴ ǻǼǺȁǺǰȋǾ ǼDZǯǴǽǾǼǬȂǴȊ Ǭ ǻǺ ǹǬȄDZǸǿ ǸǹDZǹǴȊǴǹǾDZǼDZǽǶǿȃǬǽǾǴȊǮȉǾǺǸǻǼDZǽǾǴDzǹǺǸǶǺǹǶǿǼǽDZǭǿǰDZǾǼǬǽǾǴ ȃǾǺǻǺdzǮǺǷǴǾǻǼǺǰDZǸǺǹǽǾǼǴǼǺǮǬǾȈǷǿȃȄDZDZǴdzǾǺǯǺȃǾǺǸǺDzǹǺǹǬǵǾǴǮ ǺǭǷǬǽǾǴǯǺǽǾǴǹǴȃǹǺǯǺǭǴdzǹDZǽǬ ǞǺǼDzDZǽǾǮDZǹǹȇǵ ǏǬǷǬǮDZȃDZǼ ǽ ǺǭȆȋǮǷDZǹǴDZǸ ǼDZdzǿǷȈǾǬǾǺǮ ǶǺǹǶǿǼǽǬ ǽǺǽǾǺǴǾǽȋǴȊǹȋǯǺǰǬǮǛǼǺǸȇȄǷDZǹǹǺǸǰǮǺǼȂDZǎȇǽǾǬǮǺȃǹǺǯǺ ǢDZǹǾǼǬ Ǯ ǏǺǷDZȄǺǮǴȂǬȁ ǏǼǬǹǰǴǺdzǹǺDZ ȄǺǿ ǭǿǰDZǾ ǮǶǷȊȃǬǾȈ Ǯ ǽDZǭȋ ǼǬdzǷǴȃǹȇDZǻǼDZdzDZǹǾǬȂǴǴǴǰDZǯǿǽǾǬȂǴǴǴǮǸDZǽǾDZǽǭǺǯǬǾǺǵǻǼǺǯǼǬǸǸǺǵ ǺǭDZǽǻDZȃǴǾǎǬǸǹDZdzǬǭȇǮǬDZǸȇǵǮDZȃDZǼ

150






















+27(/52.8

+27(/52.8

+27(/52.8

+27(/52.8

+27(/52.8

ZLQQHU

ZLQQHU

ZLQQHU

ZLQQHU

ZLQQHU

&21*5(66

63$ :(//1(66

 +27(/2)7+(<($5

+27(/2)7+(<($5

,1&=(&+5(38%/,&

,1&=(&+5(38%/,&







+27(/2)7+(<($5 

+27(/2)7+(<($5 

+27(/2)7+(<($5 

,1&=(&+5(38%/,&

,1&=(&+5(38%/,&

,1&=(&+5(38%/,&

  3ล’LKODVWH   VYลMKRWHO GRVRXWฤนลฆH &HORVWiWQtVRXWฤนลฆRWLWXOQHMOHSล–tKRKRWHOXYรทHVNpUHSXEOLFH &]HFK+RWHO$ZDUGVSRล’iGDQpVSROHฤดQRVWt&RQYHQWLD Y\KODล–XMtVRXWฤนลฆ+RWHOURNX 6RXWฤนลฆ &]HFK +RWHO $ZDUGV  +RWHO URNX  MH Sล’HKOtGNRX ฤดHVNลขFK KRWHOล QDEt]HMtFtFK QHMNYDOLWQฤนMล–tVOXลฆE\DNODGHVL]DFtO]PDSRYDWD]YLGLWHOQLWQHMOHSล–tKRWHO\SRFHOpรทHVNpUHSXEOLFH

6ODYQRVWQtY\KOiล–HQtYtWฤน]ลVRXWฤนลฆH+RWHOURNXSUREฤนKQHQDJDODYHฤดHUX GQHY3UลP\VORYpPSDOiFLQD9ลขVWDYLล–WL KODVXMWHSURVYฤMQHMREOtEHQฤฅMรฅtKRWHO

ZZZKRWHODZDUGVF] *HQHUiOQtSDUWQHU

ZZZKRWHOF]

=ODWลขSDUWQHU

6Wล’tEUQลขSDUWQHU ฤŒISTฤš

EKOLOGICKY

%URQ]RYลขSDUWQHU SARTORI DESIGN

SARTORI

0HGLiOQtSDUWQHล’L

&RQYHQWLD VUR     9iFODYNRYD    3UDKD      7HO)D[        ,รท    ',รท   


ANDREAS H. BITESNITCH: Deeper Shades / New York njǹǰǼDZǬǽǡǍǴǾDZǽǹǴǾȃ'HHSHU6KDGHVǙȈȊǕǺǼǶ ǏǷǿǭǺǶǴDZǺǾǾDZǹǶǴǙȈȊǕǺǼǶ

6YĚWRYĚX]QiYDQëUDNRXVNëIRWRJUDI$QGUHDV+%LWHVQLWFKRVREQĚXYHGO VYŢMYëMLPHÿQëYëVWDYQtSURMHNW'HHSHU6KDGHV1HZ<RUNY3UD]HNGH ]iURYHŁ SRNŐWLO L VWHMQRMPHQQRX NQLKX 9ëVWDYD SŐHGVWDYXMH IRWRJUDÀH Å9HONpKR MDEOND´ QD NWHUëFK Y\VWXSXMt NRQWXU\ QHZRUVNëFK EXGRY Y V\ WëFKÿHUQëFKRGVWtQHFKYNRQWUDVWXVEtORXREORKRX%LWHVQLWFKH[SHUL PHQWRYDOVHVYëPLQRYëPLLVWDUätPLVQtPN\DNOtÿN]DFK\FHQtDWPRVIpU\ DSRGRE1HZ<RUNXQDäHOSUiYĚYH[WUpPQtPNRQWUDVWX 9ëVWDYX'HHSHU6KDGHV1HZ<RUNPŢæHWH]KOpGQRXWRGEŐH]QDGR GXEQDY/HLFD3UDJXH*DOOHU\NGHVLWDNpPŢæHWHH[NOX]LYQĚ SRŐtGLW%LWHVQLWFKRYXNQLKX

152


$QGUHDV+%LWHVQLWFKWKHZRUOGUHQRZQHG$XVWULDQSKRWRJUDSKHUSHUVR QDOO\LQWURGXFHGKLVH[FHSWLRQDO´'HHSHU6KDGHV1HZ<RUNµH[KLELWLRQ WR3UDJXHDWWKHVDPHWLPHODXQFKLQJKLVERRNRIWKHVDPHQDPH7KH H[KLELWLRQSUHVHQWVSKRWRJUDSKVRIWKH´%LJ$SSOHµGLVSOD\LQJWKHFRQ WRXUVRI1HZ<RUNEXLOGLQJVLQULFKEODFNVKDGHVLQFRQWUDVWWRWKHZKLWH VNLHV%LWHVQLWFKKDVH[SHULPHQWHGZLWKKLVQHZDVZHOODVROGHUSKRWRV WRÃ&#x20AC;QGWKHNH\WRFDSWXULQJWKHH[WUHPHFRQWUDVWVLQWKHDWPRVSKHUHDQG DSSHDUDQFHRI1HZ<RUN <RXFDQYLHZWKH´'HHSHU6KDGHV1HZ<RUNµH[KLELWLRQIURPWK0DUFK WRWK$SULOLQWKH/HLFD3UDJXH*DOOHU\ZKHUH%LWHVQLWFK·VERRN LVDOVRH[FOXVLYHO\RQVDOH 153


ǎǽDZǸǴǼǹǺ ǴdzǮDZǽǾǹȇǵ ǬǮǽǾǼǴǵǽǶǴǵ ȀǺǾǺǯǼǬȀ njǹǰǼDZǬǽ ǡ ǍǴǾDZǽǹǴǾȃ ǷǴȃǹǺ ǻǼDZǰǽǾǬǮǴǷ ǽǮǺǵ ǿǹǴǶǬǷȈǹȇǵ ǮȇǽǾǬǮǺȃǹȇǵ ǻǼǺDZǶǾ ©'HHSHU 6KDGHV ǙȈȊǕǺǼǶª Ǯ ǛǼǬǯDZ ǯǰDZ Ǻǹ ǾǬǶDzDZ ǺǶǼDZǽǾǴǷ ǺǰǹǺǴǸDZǹǹǿȊ ǶǹǴǯǿǙǬǮȇǽǾǬǮǶDZǻǼDZǰǽǾǬǮǷDZǹȇȀǺǾǺǯǼǬȀǴǴǍǺǷȈȄǺǯǺǫǭǷǺǶǬǹǬ ǶǺǾǺǼȇȁǹǬǽȇȅDZǹǹǺȃDZǼǹȇDZǶǺǹǾǿǼȇǹȈȊǵǺǼǶǽǶǴȁdzǰǬǹǴǵǶǺǹǾǼǬǽǾǹǺ ǻǼǺȋǮǷȋȊǾǽȋ ǹǬ ȀǺǹDZ ǭDZǷǺǯǺ ǹDZǭǬ ǍǴǾDZǽǹǴǾȃ ȉǶǽǻDZǼǴǸDZǹǾǴǼǺǮǬǷ ǽǺ ǽǮǺǴǸǴ ǹǺǮȇǸǴ Ǵ ǽǾǬǼȇǸǴ ǽǹǴǸǶǬǸǴ Ǵ ǹǬȄDZǷ ǶǬǶ ǻDZǼDZǰǬǾȈ ǬǾǸǺǽȀDZǼǿǴȀǺǼǸȇǮǙȈȊǕǺǼǶDZǴǸDZǹǹǺǽǻǺǸǺȅȈȊȉǶǽǾǼDZǸǬǷȈǹȇȁ ǶǺǹǾǼǬǽǾǺǮ ǛǺǭȇǮǬǾȈ ǹǬ ǮȇǽǾǬǮǶDZ 'HHSHU 6KDGHV  ǙȈȊǕǺǼǶ Ǯȇ ǽǸǺDzDZǾDZ ǽ  ǸǬǼǾǬǻǺǬǻǼDZǷȋǯǺǰǬǮǻǼǬDzǽǶǺǵǯǬǷDZǼDZDZ©/HLFD3UDJXH*DO OHU\ªǾǬǸDzDZǸǺDzǹǺǻǼǴǺǭǼDZǽǾǴȉǶǽǶǷȊdzǴǮǹǿȊǶǹǴǯǿǍǴǾDZǽǹǴǾȃǬ

154


$'2/):g/)/, 6792ŏ,7(/81,9(56$ $'2/):g/)/,&5($7252)7+(81,9(56( njǐǚǗǨǠǎƾǗǨǠǗǔǝǚǓǐnjǞǑǗǨǎǝǑǗǑǙǙǚǕ

*DOHULHKODYQtKRPĚVWD3UDK\D$%&'RV 'ŢP8.DPHQQpKR]YRQX ² 3RGYRX~VSĚäQëFKH[SR]LFtFK]REODVWLDUWEUXWVHY'RPĚ8.DPHQQp KR]YRQXNRQiPRQRJUDÀFNiYëVWDYDMHGQRKR]QHMSR]RUXKRGQĚMätFKD QHMRULJLQiOQĚMätFKXPĚOFŢVWROHWtäYëFDUVNpKRWYŢUFH$GROID:|OÁLKR MHKRæRKURPXMtFtGtORVHY\P\NiYäHPXPĚOHFNëPNDWHJRULtPDVW\OŢP 6LURWHN NWHUë YĚWäLQX æLYRWD VWUiYLO Y OpÿHEQĚ SUR GXäHYQĚ QHPRFQp WUDQVIRUPRYDOVYRMLVRFLiOQtL]RODFLDSV\FKLFNRXQHPRFYQHVPtUQëNUH DWLYQtSRWHQFLiO 3UYQtUHWURVSHNWLYD$GROID:|OÁLKRYþHVNXSŐHGVWDYtQDGĚO]HYäHFK MHKRWYŢUÿtFKREGREt,QVWDODFHMHGRSOQĚQDXNi]NDPL]MHKRWH[WŢDKX GHEQtPGRSURYRGHPQDPRWLY\:|OÁLKRWYRUE\

9ëVWDYDSRVWXSXMHFKURQRORJLFN\3RSUYQtFKÿHUQREtOëFKNUHVEiFKSŐHG VWDYtPRQXPHQWiOQtHSRV2GNROpEN\NHKUREXÿtWDMtFtNQLKVYtFHQHæ LOXVWUDFHPL:|OÁL]GHIRUPRXFHVWRYQtKRGHQtNXOtÿtVYpY\IDEXORYD QpQiGKHUQpGĚWVWYtDQDVWLŁXMHVNYRVWQRXEXGRXFQRVW9QiVOHGXMtFtFK =HPĚSLVQëFKDSRÿWiŐVNëFKVHäLWHFKRSDQRYiYiFHORX=HPLDH[SDQGXMH GRYHVPtUX5RNXVH$GROI:|OÁLVWiYi6YDWëP$GROIHP,,YOiGFHP 9äHKRPtUD-HKRJLJDQWLFNpGtORMHSDNRSĚYRYiQRY6HäLWHFKStVQtDWDQ FŢD6HäLWHFKVEtUNiFKStVQtDSRFKRGŢNGHMVRXQDY]iMHPVHSUROtQDMtFt VNODGE\]D]QDPHQiYiQ\YVROPL]DÿQtVWXSQLFL:|OÁLKRGtORYUFKROt6PX WHÿQtPSRFKRGHPQDNWHUpPSUDFRYDODæGRVYpVPUWL+XGEDMH]GHSŐH YHGHQDGRIRUP\DEVWUDNWQtFK]YXNŢSURORæHQëFKÿtVOLFHPLDY]QLNiWDN XKUDQÿLYi]DF\NOHQiPDQWUDNWHUiEXGHQDYëVWDYĚ]SŐtWRPQĚQDWDNpYH ]YXNRYpSRGREĚ 6RXÿiVWt SURJUDPX MVRX L OHNWRUVNp SURKOtGN\ YtNHQGRYp NRPELQRYDQp SURJUDP\SRURGLQ\VGĚWPLDLQWHUDNWLYQtSURKOtGN\SURäNRO\

156


7KHPRQRJUDSKLFH[KLELWLRQRIRQHRIWKHPRVWUHPDUNDEOHDQGRULJLQDO DUWLVWVRIWKHWKFHQWXU\6ZLVVDUWLVW$GROI:|OÁLZKRVHVWXQQLQJZRUN LVEH\RQGDOOFDWHJRULHVDQGVW\OHVZLOOEHKHOGLQ'ŢPX.DPHQQpKR ]YRQX WKH+RXVHDWWKH6WRQH%HOO DIWHUWZRVXFFHVVIXOH[KLELWLRQVLQ WKHÀHOGRI$UW%UXW$QRUSKDQZKRVSHQWPRVWRIKLVOLIHLQKRVSLWDOVIRU WKHPHQWDOO\LOO:|OÁLWUDQVIRUPHGKLVVRFLDOLVRODWLRQDQGPHQWDOLOOQHVV LQWRLPPHQVHFUHDWLYHSRWHQWLDO 7KHÀUVWUHWURVSHFWLYHRI$GROI:|OÁLLQWKH&]HFK5HSXEOLFZLOOSUHVHQW ZRUNVIURPDOORIKLVFUHDWLYHSHULRGV7KHH[KLELWLRQLVDFFRPSDQLHG E\H[FHUSWVIURPKLVZULWLQJZLWKPXVLFDODFFRPSDQLPHQWRQWKHPRWLYHV RI:|OÁL·VFUHDWLRQ

7KH H[KLELWLRQ SURFHHGV FKURQRORJLFDOO\ $IWHU WKH ÀUVW EODFN DQG ZKLWH GUDZLQJVLWSUHVHQWVDPRQXPHQWDOHSLF)URPWKH&UDGOHWRWKH*UDYH FRQVLVWLQJRIERRNVZLWKRYHULOOXVWUDWLRQV:|OÁLUHFRXQWVKHUH LQWKHIRUPRIDWUDYHOGLDU\KLVLPDJLQDU\EHDXWLIXOFKLOGKRRGDQGPDJ QLÀFHQW RXWOLQHV IRU WKH IXWXUH ,Q WKH IROORZLQJ *HRJUDSKLF DQG $OJHE UDLF%RRNVKHFRQTXHUVWKHHQWLUH(DUWKDQGH[SDQGVWRWKH&RVPRV ,Q  $GROI :|OÁL EHFRPHV 6W $GROI ,, 5XOHU RI WKH 8QLYHUVH +LV JLJDQWLFZRUNLVWKHQJORULÀHGLQ%RRNVZLWK6RQJVDQG'DQFHVDQG$O EXP%RRNVZLWK'DQFHVDQG0DUFKHVZKHUHWKHLQWHUPLQJOLQJVRQJVDUH UHFRUGHG LQ VROPL]DWLRQ VFDOH :|OÁL·V ZRUN FXOPLQDWHV LQ WKH )XQHUDO 0DUFKRQZKLFKKHZRUNHGXQWLOKLVGHDWK0XVLFLVKHUHFRQYHUWHGLQWR DIRUPRIDEVWUDFWVRXQGVLQWHUODFHGZLWKFLSKHUVWKXVFUHDWLQJDPHV PHULVLQJF\FOLFDOPDQWUDZKLFKZLOODOVREHSUHVHQWHGLQDXGLRIRUPDW WKHH[KLELWLRQ 7KH SURJUDPPH DOVR LQFOXGHV OHFWXUH WRXUV ZHHNHQG FRPELQHG SUR JUDPPHVIRUIDPLOLHVZLWKFKLOGUHQDQGLQWHUDFWLYHWRXUVIRUVFKRROV

158

ǛǺǽǷDZ ǰǮǿȁ ǿǽǻDZȄǹȇȁ ȉǶǽǻǺdzǴȂǴǵ Ǯ ǺǭǷǬǽǾǴ DUW EUXW Ǯ ǐǺǸDZ ǿ ǖǬǸDZǹǹǺǯǺ ǖǺǷǺǶǺǷǬ ǻǼǺȁǺǰǴǾ ǸǺǹǺǯǼǬȀǴȃDZǽǶǬȋ ǮȇǽǾǬǮǶǬ ǺǰǹǺǯǺ Ǵdz ǽǬǸȇȁ dzǬǸDZȃǬǾDZǷȈǹȇȁ Ǵ ǽǬǸȇȁ ǺǼǴǯǴǹǬǷȈǹȇȁ ȁǿǰǺDzǹǴǶǺǮ ǯǺ ǮDZǶǬ  ȄǮDZǵȂǬǼǽǶǺǯǺ ǬǮǾǺǼǬ njǰǺǷȈȀǬ ǎȌǷȈȀǷǴ ȃȈǴ ǻǺǾǼȋǽǬȊȅǴDZ ǻǼǺǴdzǮDZǰDZǹǴȋ ǴǽǶǿǽǽǾǮǬ ǹǬȁǺǰȋǾǽȋ ǮǹDZ ǮǽȋǶǴȁ ǶǬǾDZǯǺǼǴǵ Ǵ ǽǾǴǷDZǵ ǝǴǼǺǾǬǶǺǾǺǼȇǵǭǺǷȈȄǿȊȃǬǽǾȈǽǮǺDZǵDzǴdzǹǴǻǼǺǮDZǷǮǭǺǷȈǹǴȂDZǰǷȋ ǰǿȄDZǮǹǺǭǺǷȈǹȇȁ ǾǼǬǹǽȀǺǼǸǴǼǺǮǬǷ ǽǮǺȊ ǽǺȂǴǬǷȈǹǿȊ ǴdzǺǷȋȂǴȊ Ǵ ǻǽǴȁǴȃDZǽǶǺDZdzǬǭǺǷDZǮǬǹǴDZǮǻǺǾǼȋǽǬȊȅǴǵǾǮǺǼȃDZǽǶǴǵǻǺǾDZǹȂǴǬǷ ǛDZǼǮǬȋ ǼDZǾǼǺǽǻDZǶǾǴǮǹǬȋ ǮȇǽǾǬǮǶǬ njǰǺǷȈȀǬ ǎȌǷȈȀǷǴ Ǯ ǣDZȁǴǴ ǻǼDZǰǽǾǬǮǴǾǼǬǭǺǾǴdzǮǽDZȁDZǯǺǾǮǺǼȃDZǽǶǴȁǻDZǼǴǺǰǺǮǔǹǽǾǬǷǷȋȂǴǴ ǽǺǻǼǺǮǺDzǰǬȊǾǽȋ ǺǾǼȇǮǶǬǸǴ Ǵdz DZǯǺ ǾDZǶǽǾǺǮ Ǵ ǸǿdzȇǶǬǷȈǹȇǸ ǽǺǻǼǺǮǺDzǰDZǹǴDZǸǻǺǸǺǾǴǮǬǸǾǮǺǼȃDZǽǾǮǬǎȌǷȈȀǷǴ

ǎȇǽǾǬǮǶǬ ǴǰDZǾ Ǯ ȁǼǺǹǺǷǺǯǴȃDZǽǶǺǸ ǻǺǼȋǰǶDZ ǛǺǽǷDZ ǻDZǼǮȇȁ ȃDZǼǹǺ ǭDZǷȇȁǼǴǽǿǹǶǺǮǻǼDZǰǽǾǬǮǷDZǹǸǺǹǿǸDZǹǾǬǷȈǹȇǵȉǻǺǽ©ǚǾǶǺǷȇǭDZǷǴǰǺ ǸǺǯǴǷȇªǽǺǽǾǺȋȅǴǵǴdzǰDZǮȋǾǴǶǹǴǯǽǭǺǷDZDZȃDZǸǴǷǷȊǽǾǼǬȂǴȋǸǴ ǎ ǹDZǸ ǎȌǷȈȀǷǴ Ǯ ȀǺǼǸDZ ǻǿǾDZǮǺǯǺ ǰǹDZǮǹǴǶǬ ǼǬǽǽǶǬdzȇǮǬDZǾ Ǻ ǽǮǺDZǸ ǮǺǽȁǴǾǴǾDZǷȈǹǺǸǰDZǾǽǾǮDZǴǻǼǴǮǺǰǴǾǺȃDZǼǾǬǹǴȋǻǼDZǶǼǬǽǹǺǯǺǭǿǰǿȅDZǯǺ ǎǽǷDZǰǿȊȅǴȁ©ǏDZǺǯǼǬȀǴȃDZǽǶǴȁǴǻǺȃǾǺǮȇȁǾDZǾǼǬǰȋȁªǺǮǷǬǰDZǮǬDZǾǮǽDZǵ ǓDZǸǷDZǵ Ǵ ǰǺǭǴǼǬDZǾǽȋ ǰǺ ǎǽDZǷDZǹǹǺǵ ǎ  ǯǺǰǿ njǰǺǷȈȀ ǎȌǷȈȀǷǴ ǽǾǬǹǺǮǴǾǽȋǝǮȋǾȇǸnjǰǺǷȈȀǺǸ,,ǛǼǬǮǴǾDZǷDZǸǎǽDZǷDZǹǹǺǵǑǯǺǯǴǯǬǹǾǽǶǬȋ ǼǬǭǺǾǬ ǮǺǽǻDZǮǬDZǾǽȋ Ǯ ©ǞDZǾǼǬǰȋȁ ǻDZǽDZǹ Ǵ ǾǬǹȂDZǮª Ǵ Ǯ ©ǞDZǾǼǬǰȋȁ ǽǭǺǼǹǴǶǬȁ ǻDZǽDZǹ Ǵ ǸǬǼȄDZǵª ǯǰDZ ǹǬȁǺǰȋǾǽȋ ǮdzǬǴǸǹǺ ǽǮȋdzǬǹǹȇDZ ǶǺǸǻǺdzǴȂǴǴ ǛǼǺǴdzǮDZǰDZǹǴDZ dzǬǮDZǼȄǬDZǾǽȋ ǛǺȁǺǼǺǹǹȇǸ ǘǬǼȄDZǸ ǹǬǰ ǶǺǾǺǼȇǸ Ǻǹ ǼǬǭǺǾǬǷ ǰǺ ǽǬǸǺǵ ǽǸDZǼǾǴ ǘǿdzȇǶǬ ǻǼDZǮǼǬȅDZǹǬ Ǯ ȀǺǼǸǿǬǭǽǾǼǬǶǾǹȇȁdzǮǿǶǺǮǻDZǼDZǸDZDzǬȊȅǴȁǽȋȂǴȀǼǬǸǴǮǼDZdzǿǷȈǾǬǾDZ ȃDZǯǺ ǮǺdzǹǴǶǬDZǾ dzǬǮǺǼǬDzǴǮǬȊȅǬȋ ȂǴǶǷǴȃǹǬȋ ǸǬǹǾǼǬ ǶǺǾǺǼǬȋ ǭǿǰDZǾ ǻǼDZǰǽǾǬǮǷDZǹǬǹǬǮȇǽǾǬǮǶDZǮdzǮǿǶǺǮǺǵȀǺǼǸDZ ǎǻǼǺǯǼǬǸǸDZǾǬǶDzDZǷDZǶȂǴǴǶǺǸǭǴǹǴǼǺǮǬǹǹȇDZǻǼǺǯǼǬǸǸȇǮȇȁǺǰǹǺǯǺ ǽDZǸDZǵǽǰDZǾȈǸǴǴǴǹǾDZǼǬǶǾǴǮǹȇDZȉǶǽǶǿǼǽǴǴǰǷȋȄǶǺǷ


%$.(52

H[SRUWLPSRUWVUR 2'6SHNWUXP2EFKRGQÊ ĽÊùDQ\øHVWOLFH øHVN¾UHSXEOLND 7HO )D[ 0RELO (PDLOREFKRG#EDNHURF]

ZZZEDNHURF]


$GUHViÄŠUHDOLWQtFK NDQFHOiÄŠt 5HDO(VWDWH$JHQFLHV'LUHFWRU\

3ÄŠLSUDYLOLMVPHSURYiVSÄŠHKOHGQĂŹ VH]QDPDGUHVDNRQWDNWÄ?NWHUp E\YiVPRKO\]DMtPDW :HKDYHSUHSDUHGDFRPSUHKHQVLYHOLVW RIDGGUHVVHVDQGFRQWDFWVWKDWPLJKW LQWHUHVW\RX

AUSCH REAL ESTATE, ZborovskĂĄ 49, 150 00 Praha 5, Tel.: +420 739 830 300, Fax: +420 222 251 564, E-mail: info@ausch.eu, www.ausch. eu â&#x20AC;˘ CENTURY 21 Action, Masarykovo nĂĄbĹ&#x2122;eŞí 2, 120 00 Praha 2 - NovĂŠ MÄ&#x203A;sto, Tel.: +420 777 702 300, email: action@century21.cz, www. century21.cz â&#x20AC;˘ CENTURY 21 Bonus Praha, KorunnĂ­ 104, 100 00 Praha 10 â&#x20AC;&#x201C; Vinohrady, Tel.: +420 246 090 246, E-mail: bonuspraha@century21. cz, www.century21.cz â&#x20AC;˘ CENTURY 21 ElĂĄn, Smetanova 240, 250 82 Ă&#x161;valy, Tel.: +420 281 866 806, E-mail: elan@century21.cz, www. century21.cz â&#x20AC;˘ CENTURY 21 Energy, KorunnĂ­ 1167/43, 120 00 Praha 2 â&#x20AC;&#x201C; Vinohrady, Tel.: +420 720 150 000, E-mail: energy@century21.cz, www.century21.cz â&#x20AC;˘ CENTURY 21 K+K Consulting Praha, SladkovskĂŠho nĂĄmÄ&#x203A;stĂ­ 525/1, 130 00 Praha 3, Tel.: +420 222 741 850, E-mail: kkpraha@century21.cz, www.century21.cz â&#x20AC;˘ CENTURY 21 Plus+, Jankovcova 1596/14, 17000 Praha 7, Tel.: +420 725 293 500, E-mail: plus@century21.cz, www.century21.cz â&#x20AC;˘ CENTURY 21 Reality 21, Na PoĹ&#x2122;Ă­Ä?Ă­ 1071/17, 110 00 Praha 1, Tel.: +420 271 122 711, E-mail: info.reality21@century21.cz, www.century21.cz â&#x20AC;˘ CENTURY 21 Real servis, KonÄ&#x203A;vova 182, 130 00 Praha 3, Tel.: +420 222 542 103, E-mail: realservis@century21.cz, www.century21.cz â&#x20AC;˘ CENTURY 21 Reality AndÄ&#x203A;l, RadlickĂĄ 3179/1e, 150 00 Praha 5 â&#x20AC;&#x201C; SmĂ­chov, Tel.: +420 257 220 224, E-mail: realityandel@century21.cz, www.century21.cz â&#x20AC;˘ CENTURY 21 Reality Express, VĂĄclavskĂŠ nĂĄm. 56, 110 00 Praha 1 â&#x20AC;&#x201C; NovĂŠ MÄ&#x203A;sto, Tel.: +420 608 300 600, E-mail: realityexpress@century21.cz, www.century21. cz â&#x20AC;˘ CENTURY 21 Tandem, PerlovĂĄ 3, 110 00 Praha 1, Tel.: +420 224 267 544, E-mail: tandem@century21.cz, www.century21.cz â&#x20AC;˘ ENGEL & VĂ&#x2013;LKERS PRAGUE, s.r.o., SenovĂĄĹžnĂŠ nĂĄm. 19, 110 00 Praha 1, tel.: +420 222 240 304, www.engelvoelkers.com/prag â&#x20AC;˘ FARAON REALITY, s.r.o., PolskĂĄ 26, 120 00 Praha 2, tel.: +420 224 829 322, fax: +420 222 310 484, hotline: 800 400 407, e-mail: info@faraon.cz, www.faraon.cz â&#x20AC;˘ IMMOINVEST GROUP s.r.o., TĹ&#x2122;ebĂ­zskĂŠho 7, Praha 2, 120 00, tel.: +420 246 090 090, fax: +420 246 090 099, e-mail: info@immo-invest.cz, www.immoinvest-group.cz â&#x20AC;˘ KZP real, s.r.o., MeteorologickĂĄ 987/19, 142 00 Praha 4 â&#x20AC;&#x201C; LibuĹĄ, tel.:+420 777 918 064, tel.: +420 777 918 073, e-mail: info@kzp-real.cz, www.kzpii.cz â&#x20AC;˘ LEXXUS a.s., PanskĂĄ 895/6, 110 00 Praha 1, tel.: +420 246 090 090, fax: +420 224 217 314, e-mail: info@lexxus.cz, www.lexxus.cz â&#x20AC;˘ MAXIMA REALITY, Washingtonova 5, 110 00 Praha 1, tel.: +420 221 110 110, E-mail: info@maxima.cz, www.maxima.cz â&#x20AC;˘ ORCO PROPERTY GROUP, PĹ&#x2122;emyslovskĂĄ 2845/43 , 130 00 Praha 3 â&#x20AC;&#x201C; Ĺ˝iĹžkov, Tel.: +420 226 502 999. e-mail: kontakt@orcogroup.com, www.orco.cz â&#x20AC;˘ REAL ESTATE & LIFE, S.R.O., HybernskĂĄ 24, 110 00 Praha 1, tel.: +420 222 125 286, e-mail: info@estateandlife.cz, www.estateandlife.cz â&#x20AC;˘ SEIFERT REAL, PlatnĂŠĹ&#x2122;skĂĄ 88/9, 110 00 Praha 1, tel.: +420 724 800 291, e-mail: info@seifert-real.cz, www.seifert-real.cz â&#x20AC;˘ SVOBODA & WILLIAMS s.r.o., Na PerĹĄtĂ˝nÄ&#x203A; 2, 110 00 Praha 1, tel.: +420 257 328 281, e-mail: info@svoboda-williams.com, www.svoboda-williams.com â&#x20AC;˘ TIDE REALITY s. r. o., Svobodova 9, 128 00 Praha 2, Tel.: +420 224 914 914 , +420 224 920 073, Fax: +420 224 920 680, E-mail: info@tide.cz, www.tide.cz

$GUHViÄŠLQ]HUFH penShop.cz, Na ZĂĄhonech 7, Praha 4, tel.: 241 402 925, www.penshop.cz â&#x20AC;˘ Conventia, s.r.o., VĂĄclavkova 169/1, Praha 6, tel.: +420 220 515 102, e-mail: konference@bonaďŹ de.cz, www.conventia.cz â&#x20AC;˘ ESCADA, PaĹ&#x2122;Ă­ĹžskĂĄ 204/21, Praha 1 a PasĂĄĹž Myslbek, Na PĹ&#x2122;Ă­kopÄ&#x203A; 19-21, Praha 1, www.escada.com â&#x20AC;˘ Bang & Olufsen, JĂĄchymova 4, Praha 1, tel.: +224 811 234, www.kd-elektronika.cz â&#x20AC;˘ PK InteriĂŠr, prodejna: OC Spektrum, ObchodnĂ­ 113, Ä&#x152;estlice, tel.: +420 272 183 234, e-mail: pki@pkinterier.cz, www.pkinterier.cz â&#x20AC;˘ Butik JAM Couture, Jungmannovo nĂĄm. 1, Praha 1, tel.: +420 602 624 049, www.jamcouture.cz â&#x20AC;˘ VĂĄgner Design s.r.o., VinohradskĂĄ 33/1420, Praha 2, tel.: +420 222 254 292, www.vagnerdesign.cz â&#x20AC;˘ ED Group a.s., Jeremenkova 90a, Praha 4, tel.: +420 244 016 017, e-mail: edgroup@edgroup.cz, www.edgroup.cz â&#x20AC;˘ Roberto Coin Boutique, PaĹ&#x2122;Ă­ĹžskĂĄ 1, Praha 1, www.robertocoin.com â&#x20AC;˘ Studio Essence, VĂĄclavkova 169/1, Praha 6, tel.: +420 235 350 235, www.studioessence.cz â&#x20AC;˘ Whirlpool CR, spol. s r.o., RadlickĂĄ 3201/14, Praha 5, tel.: + 420 840 111 313, www.whirlpool.cz â&#x20AC;˘ Poggenpohl studio Praha, VinohradskĂĄ 35, Praha 2, tel.: +420 222 210 783, www.poggenpohl. cz â&#x20AC;˘ SEDLĂ K INTERIER s.r.o., VinohradskĂĄ 10, Praha 2, tel.: +420 224 217 817, e-mail: info@sedlakinterier.cz, www.sedlakinterier.cz â&#x20AC;˘ ProdejnĂ­ centrum SATPO SmĂ­chov Gate, PlzeĹ&#x2C6;skĂĄ 3217/16, Praha 5, tel.: +420 296 336 900, zelenĂĄ linka: 800 800 010, e-mail: info@satpo. cz, www.satpo.cz â&#x20AC;˘ Little Foot, SlovanskĂ˝ dĹŻm, Na PĹ&#x2122;Ă­kopÄ&#x203A; 22, Praha 1, tel.: +420 224 248 714, www.littlefoot.cz â&#x20AC;˘ BAKERO exportimport s.r.o., OD Spektrum ObchodnĂ­ 113, Ĺ&#x2DC;Ă­Ä?any-Ä&#x152;estlice, tel.: +420 212 240 460, e-mail: obchod@bakero.cz, www.bakero.cz â&#x20AC;˘ Golf BeĹ&#x2122;ovice s.r.o., BeĹ&#x2122;ovice 15, Zlonice, tel.: +420 312 591, recepce@gcbr.cz, www.gcbr.cz â&#x20AC;˘ Semaco s.r.o., PodÄ&#x203A;bradskĂĄ 11, Praha 9, tel.: +420 284 011 666, e-mail: semaco@semaco.net, www.focus-creation.cz â&#x20AC;˘ MaltĂŠzskĂŠ nĂĄmÄ&#x203A;stĂ­ no. 8, tel.: +420 602 436 519, +420 226 539 540, e-mail: info@prague-lofts.cz, www.maltezskenamesti8.cz â&#x20AC;˘ 3D H. InteriĂŠr, s.r.o., showroom: RohanskĂŠ nĂĄbĹ&#x2122;. 7/657, Praha 8, tel.: +420 222 719 541, www.3dh.cz â&#x20AC;˘ Naty Naty, SenovĂĄĹžnĂŠ nĂĄmÄ&#x203A;stĂ­ 10a, Praha 1, tel.: +420 775 566 126, e-mail: pavlina.rosendahl@ natynaty.cz, www.natynaty.cz â&#x20AC;˘ Modern Art Shop, Mala Ĺ tupartskĂĄ 5, Praha 1, tel.: +420 733 643 403, e-mail: velizar77@yahoo. com â&#x20AC;˘ ARTISHOCK, s.r.o., www.freedomky.cz, prezentaÄ?nĂ­ FREEDOMEK, Brno â&#x20AC;&#x201C; KravĂ­ hora

160


Knowing what counts.

Kuchyně Poggenpohl vybavujeme spotřebiči Gaggenau

Poggenpohl studio Praha, Vinohradská 35, Praha 2, tel.: +420 222 210 783, www.poggenpohl.cz Home Interier, Janáčkova 3277/22A, Moravská Ostrava, tel.:+420 596 111 595, www.homeinterier.cz Poggenpohl studio Bratislava, Bajkalská 22, Bratislava, Slovensko, tel.: +421 253 630 641, www.poggenpohl.sk Výhradní dovozce pro Českou a Slovenskou republiku: POGGENPOHL CZECH s. r. o., Vinohradská 10, Praha 2


Profile for Conventia Events s.r.o.

Estate The Prague Magazine 04/2012  

Estate The Prague Magazine 04/2012

Estate The Prague Magazine 04/2012  

Estate The Prague Magazine 04/2012

Advertisement