Page 1

Červenec Ⅰ July

2015

Rony Plesl:

9

7 7 1 8 0 2

8 2 1 0 0 1

Výběr nejlepších nemovitostí Selection of the best properties Выбор лучшей недвижимости

CZK 95 € 4,50 £ 3,50

DESIGN JAKO ŽIVOTNÍ KULTURA

CHATEAU HERÁLEC | 10 NEJKRÁSNĚJŠÍCH OSTROVŮ | BYDLENÍ PRO 21. STOLETÍ


Nové luxusní bydlení v Praze na Starém Městě


www.threecarp.cz

ESTATE

|

1


VZOROVÝ BYT OTEVŘEN

MĚSTO NA DLANI, PŘÍRODA NA DOSAH RADLICKÁ, PRAHA 5 • 36 UNIKÁTNÍCH BYTŮ • 995 m2 KOMERČNÍCH PROSTOR • DOKONČENÍ STAVBY – LÉTO 2015 Tel.: 731 125 515

www.142.cz

2

|

ESTATE

www.rt-reality.cz


Va š e k r á lo v s k á ad re sa

PODZÁMČÍ HLUBOKÁ

OBJEVTE KOUZLO LETNÍHO BYTU • • • •

KOMORNÍ PROJEKT PŘÍMO POD ZÁMKEM V BLÍZKOSTI GOLF, MARINA A CYKLOSTEZKY POSLEDNÍ VOLNÉ BYTY CENY OD 1 190 000 Kč Tel.: 731 125 516

www.podzamci-hluboka.cz

www.premiumliving.cz

ESTATE

|

3


LU X U RY A PA R T M E N T S

4

|

ESTATE


* BVLGARI Diva new jewelry collection presentation at La Corte

SALES AND MANAGEMENT BY MANGHI CZECH T: +420 725 860 300 / E: info@lacortepraga.com Pařížská 68/9 - 110 00 Praha 1

www.lacortepraga.com ESTATE

|

5


PRAHA | BRNO | OSTRAVA | BRATISLAVA

1HMYĨWãt ĚHVNRVORYHQVNi DGYRNiWQtNDQFHOiš VPH]LQiURGQtP GRVDKHP

|

Havel, Holásek & Partners s kancelářemi v Praze, Brně, Ostravě a Bratislavě je s týmem více než 180 právníků největší česko-slovenskou právnickou firmou. Podle historických výsledků všech 7 ročníků oficiální soutěže Právnická firma roku je kancelář podle celkového počtu nominací a titulů nejúspěšnější českou advokátní kanceláří.

|

V roce 2012 kancelář v oficiální soutěži Právnická firma roku mj. zvítězila v kategorii Developerských a nemovitostních projektů a každoročně se umísťuje mezi velmi doporučovanými advokátními kancelářemi v této oblasti. Na Slovensku kancelář získala za rok 2014 prestižní ocenění za poskytování právních služeb souvisejících s realitními investicemi CIJ Award.

|

Zkušený specializovaný tým zaměřený na nemovitosti, stavebnictví a právo životního prostředí - více než 20 právníků včetně 7 partnerů - je jedním z největších právních týmů v České republice a na Slovensku specializujících se na oblast nemovitostí.

|

Právní služby v souvislosti s nákupem a financováním luxusních nemovitostí, strukturování a vyjednávání úvěrových smluv v souvislosti s akvizicemi nemovitostí a projektovým financováním jak na straně investora, tak na straně financující instituce.

|

Komplexní právní poradenství a související daňové služby v českém, slovenském, anglickém, německém, francouzském, italském, španělském, portugalském, ruském, polském, maďarském a ukrajinském jazyce ve více než 60 zemích světa, až 70 % případů zahrnuje mezinárodní prvek.

|

Více než 1 000 klientů, z toho 70 společností uvedených v seznamu největších firem Fortune 500, 40 společností z Czech Top 100 a 7 společností z Czech Top 10.

3UiYQLFNi¿UPDURNX YýHVNpUHSXEOLFH (2011, 2012, 2014, 2015)

.OLHQW\QHMOpSHKRGQRFHQi SUiYQLFNi¿UPD YýHVNpUHSXEOLFH (2010, 2013, 2015)

3UiYQLFNi¿UPDURNX YNDWHJRULL)~]HDDNYL]LFH YýHVNpUHSXEOLFH (2013, 2014)

PtVWRYFHONRYpPSRþWX UHDOL]RYDQêFKI~]tDDNYL]LF YýHVNpUHSXEOLFH (2009–2013)

1HM~VSČãQČMãtNDQFHOiĜ SRGOHSRþWXQRPLQDFt DWLWXOĤYãHFKVHGPL URþQtNĤVRXWČåH

PtVWRPH]LGRPiFtPL SUiYQLFNêPL¿UPDPL (2009–2012)

mergermarket

www.havelholasek.cz

6WUDWHJLFNpXYDåRYiQt_,QGLYLGXiOQtSĜtVWXS_âSLþNRYêSUiYQtWêP_'ORXKRGREpSDUWQHUVWYt


contents

Červenec ⅼ July 10

Design jako životní kultura Design as a Culture of Life

26

Estate TIP Estate TIP

30

Novinky News

50

10 NEJluxusnějších ostrovů The Top 10 Most Luxurious Islands

obsah

10

Nemovitosti ⅼ Properties

53

Nejlepší nemovitosti Best Properties

54

Prodej Sales

120

Pronájmy Rentals

146

Komerční nemovitosti Commercial Properties

160 30

Inspirace ⅼ Inspiration

160

Bydlení pro 21. století Housing for the 21st Century

164

Anglický park, provensálská kosmetika: Oáza klidu na Vysočině English park, Provencal beauty: An Oasis of Calm in the Highlands

172

Landscape Festival 2015 Landscape Festival 2015 Fotografie kvality: První dojem z nemovitos

202

164

50

ESTATE

|

7


Milé čtenářky a čtenáři, Dear Readers,

v červencovém čísle vám blíže představíme ikonu současného sklářského umění a designu Ronyho Plesla. Jaký vliv měl na jeho tvorbu pobyt v italském Miláně, co nás čeká na nejbližší jeho výstavě, a další zajímavosti, vám rádi prozradíme v hlavním rozhovoru našeho magazínu. Kromě pravidelných nemovitostních rubrik vám ve vybraných článcích z domova i zahraničí přinášíme například přehled deseti nejkrásnějších ostrovů světa. Prázdniny jsou tady, tak se nechejme inspirovat tím, jak by taková dovolená snů mohla vypadat. A pokud neplánujete strávit volno v zahraničí, zajeďte se třeba podívat na nádherný zámek na Vysočinu, v jehož prostředí na vás dýchne luxus a zároveň klid a pohoda tohoto zrekonstruovaného butikového hotelu. Více o něm se také dozvíte uvnitř tohoto magazínu. Přeji vám příjemné čtení.

The July issue introduces Rony Plesl, the icon of contemporary glass-making art and design. In our magazine's main interview, we reveal what influence his stay in Milan, Italy had on his creativity and other facts of interest. In addition to regular real estate, among others we bring you an overview of ten of the most beautiful islands in the world in selected articles from home and abroad. The holidays are here, so let's get inspired by what a dream vacation might be like. And if you don't plan on spending your leisure time abroad, come to a beautiful chateau in the Bohemian-Moravian Highlands whose reconstructed premises will enchant you with the luxury and simultaneous tranquillity and cosiness of this boutique hotel. Learn more about it in this issue. I wish you enjoyable reading.

Vaše šéfredaktorka Ⅰ Yours sincerely,

8

|

ESTATE

Dana Hradecká


DESIGN JAKO ŽIVOTNÍ KULTURA Design as a Culture of Life

AUTOR ROZHOVORU: René Hradecký FOTO: Jiří Hurt STYLING: Jitka Chramostová 10

|

ESTATE


ESTATE | 11


eské sklo prochází v posledních letech svou renesancí. Značky jako Moser, Lasvit a Preciosa dobývají nové trhy a vypadá to, že se jim daří. Ať už se jedná o produktový design ve formě sklenic, váz, svítidel a lustrů, který je žádaný u nejnáročnějších zákazníků po celém světě nebo umělecká díla našich předních designérů, kteří nezapřou českou sklářskou školu a jejich skvosty nachází své místo mezi sběrateli umění u nás i v zahraničí. Současně začínáme čím dál častěji slýchat spojení slov český design. Navštívili jsme proto Ronyho Plesla, který je synonymem českého designového skla jako málokdo a zeptali se ho, jak že to s českým sklem a českým designem opravdu je.

Právě jste se vrátil z veletrhu v Miláně. Splnila návštěva Vaše očekávání? Určitě ano. Byl jsem velice zvědavý na re-

Vytvořil jsem celokovový, kloubový terezián mužského principu Merkur, se kterým se dá manipulovat a měnit jeho tvar a násled-

akce a musím říct, že byly pozitivní. Člověk

ně terezián celoskleněný z opálového skla

je hrdý, když se něco povede. Nejvíce mne

Venuši se čtyřmi tisíci květů . Ani jeden

potěšilo, že designéři, obchodníci, i kon-

lustr nebyl jednoduchý a velice mi pomohli

kurence, ti všichni byli velmi překvapeni

odborníci z Preciosy.

a velice chválili expozici Preciosy. Moc mne

Nejdůležitější na obou projektech je,

těší především fakt, že je to týmový úspěch,

že to nejsou designy samy pro sebe, je to

který povzbuzuje a mění pozitivně atmosfé-

nějaká cesta. Na Merkuru se dá dále stavět,

ru v celé firmě. Miláno je jinak samo o sobě

chtěl bych pracovat s novými ověsy, které se

vždy zážitek a vždy se tam velmi těším.

vytvoří na míru novému tereziánu. S Venuší bych chtěl taky dále pracovat, přidat

Co konkrétně jste tam představoval?

tam další barevné kytky. Chtěl bych spojit

Dva lustry, které mají předznamenat ur-

benátský a český lustr a propojit tím svoji

čitou část budoucnosti Preciosy. Oba lustry

čtyřletou benátskou zkušenost s českou.

navazují na český terezián z osmnáctého století, který je takovým českým kultem, ale

Veletrh v Miláně je dobré místo na srov-

v moderní době se jím nikdo moc neza-

návání. Jak si podle Vás stojí ve světě český

býval, přestože je nádherný. Myslím si, že

design?

firma, která má tradici, má na tradici také

Je to pro mne hodně překvapující, ale ve-

stavět a nemá vyzobávat inspirace z konku-

lice dobře. Když se někdy kolem roku 2002

rence nebo z trendů, a proto jsem se rozho-

točil jeden z prvních dokumentů o českém

dl, že pokud budu moci, tak bych Preciosu

designu, objevilo se v něm pouze něja-

rád alespoň částečně posouval ve stylu její

kých pět osobností. Tenkrát se o designu

tradice a vlastního know-how.

ještě moc nemluvilo. Ten dokument končí

12

|

ESTATE


„Když jeden den dělám sklenice pro pivovar a jedu někam na jednání a druhý den vytvářím nějaké mé plastiky, tak to je přesně to, co mne rajcuje...“

otázkou, co je to český design. A já jsem tenkrát řekl, že nevím, protože ho ještě nikdo nevytvořil. A byl jsem jediný, kdo ho takhle trošku negoval. Dnes je to už trochu jiné. Stále si sice myslím, že typicky český design neexistuje, ale ten nejlepší český design je světový. Myslím si totiž, že daleko specifičtější pro českou kulturu je volné umění, které je velice komplikované, mnohoznačné a velice spirituální. Český design to má těžší, protože spirituální design, komplikovaný design a duchovní design, to se moc nenosí. Tedy osobně si myslím, že úplně specifický český design nikdy nevznikne, ta půda na to tady úplně není. My jsme spíše lidi takový Kafkovský a design je většinou velice přímočarý. Nicméně, co se týče kvality, tak tam jsem naopak neskutečně překvapený, protože v té podle mého patříme k evropské špičce. Takže musím trošku opravit tu tehdejší větu. Myslím si, že český design vznikl a ten dobrý český design kopíruje světový. Jindřich Halabala, Ladislav Sutnar a jiní, to jsou podle Vás takové spíše výjimky nebo nesouvislé projevy individuálních osobností, které na sebe nijak nenavazují? Ano, trošku jste to řekl. Může mi někdo samozřejmě oponovat. Já jsem vyrůstal na volném umění, učil jsem jedenáct let dějiny umění a zajímám se o kulturu taky i trochu teoreticky. Teď jsem byl na vernisáži, vynikající výstavě českého symbolismu v Anežském klášteře, kde jsem si znovu uvědomil, že to nejlepší z české malby a sochy je hodně typicky české a je to mimo všechny škatulky. Především Sutnar, to je světový unikát, ale nejde tu o typicky český design, jde spíše o věci přesahující hranice běžného užitkového designu. Je to fenomenální myšlenkový koncept. Já si české kultury velice vážím, ale pokud bereme v úvahu trendy design, který prodává, který funguje v nějakém období, tak český design buď bude super skvělý a bude kopírovat svět a pokud bude něco českým designem hodně osobitým, tak to bude spíše takový art design, hodně osobnostní. Například Skandinávský design je hodně specifický, je hodně o dřevě, o nábytku. Je ten český také něčím specifický? Myslím, že to není materiálem, ale spíše dobou. V době komunismu se vytvořila hodně osobitá kultura, ESTATE | 13


Rony Plesl Vystudoval VŠUP v Praze, kde získal cenné zkušenosti v oblasti designu. Od roku 2008 vede Studio Rony Plesl. Ve své současné tvorbě skla se zaměřuje na uranové sklo, jehož produkce byla ve většině evropských skláren zastavena. Kromě toho spolupracuje s výrobci skla jako jsou Moser, Barovier, Ajeto, Květná a s německou firmou Sahm, ve které je od roku 2009 hlavním designérem. Jako designér spolupracuje s Denizli by Pasabahce (Turecko) a Preciosa (ČR). Důkazem jeho geniálnosti v oboru designu skla je skutečnost, že jeho umění je zastoupeno v mnoha uměleckých sbírkách. Jeho díla se nacházejí po celém světě a pokud chcete některá z nich vidět, můžete navštívit například pražskou luxusní restauraci Mlýnec, kterou zdobí jeho krásný skleněný lustr, německý Hamburk, kde najdete jím navrženou skleněnou věž. Rony Plesl je držitelem mnoha ocenění v oblasti designu. Pořádá výstavy jak u nás, tak v zahraničí.

14

|

ESTATE


Určitě ano, ale i v tom nás svět trochu do-

To je trochu jinak. Mám jedenáct let kon-

vat. Izolace, zahloubanost, chalupářství,

hnal, české sklo má už jen pár věcí naprosto

trakt s velkým německým koncernem Sahm

to vše co známe jako fenomén české kultury

unikátních, především je to sklo broušené.

a mým úkolem je vyhrávat tendry.

komunismu. Já osobně s tím mám pořád

Máme skvělé školy, jsou u nás čtyři sklář-

trochu vnitřní problém. Na jednu stranu to

ské školy, více vysokých škol, na kterých se

jinský pivovar, čeká mne práce pro bělo-

chápu, ale na druhou stranu je mi z toho

vyučuje sklo. Ve světě to obvyklé není, tato

ruský pivovar. Je to opravdu služba, která

trochu úzko, protože vím, co komunismus

specifikace bývá spíše součástí postgraduál-

mne ale velice baví, protože je to zase jiná

napáchal, a právě i co se kultury a např. ar-

ního studia. Sklo bude u nás i do budoucna

část tvorby, kdy se setkávám s lidmi, kteří

chitektury týče. Oslavují se sice úžasné Máje

asi vždy fenomén. Nicméně i na řemesle se

vedou obrovské koncerny, s lidmi, kteří se

a Kotvy, na druhou stranu v každém malém

dá stavět jenom částečně, k formě se musí

zabývají úplně něčím jiným. Jsou to lidé vel-

městečku jsou naprosto příšerné samoobslu-

přidat i obsah.

mi pragmatičtí, chtějí aby se jejich výrobek

na kterou by se určitě dalo hodně navazo-

hy a naprosto zničený urbanismus. Oslava

Například nyní dělám sklenice pro ukra-

Abych to shrnul, sklo je úžasná záležitost,

prodával. Baví mne to, je to zas o něčem

komunistické éry a designu, ano, na jedné

ale nestačí jen tradice. Propojenost tradi-

jiném, o byznysu, o marketingových rozbo-

straně je v pořádku vyzdvihnout to, co bylo

ce a současného myšlení je hodně složitá

rech. Neříkám, že je to něco, čemu bych se

skvělý, na druhé straně by se ale narovinu

záležitost. Vnímám, jak někteří studenti sklo

chtěl v životě věnovat nejvíce, ale protože

mělo říci, že tři čtvrtiny všeho byly naprosto

vidí v širším uměleckém kontextu a dávají

jsem člověk činorodý, baví mne dělat více

zničující. Ale v každém případě jsou některé

mu nový náboj.

věcí najednou. Takže když jeden den dělám

designy této doby českými klenoty.

sklenice pro pivovar a jedu někam Vy se nebojíte brát komerční zakázky. Pod-

Možná je to právě o tom materiálu. Myslíte

le čeho si je vybíráte?

si, že sklo, práce se sklem, je to, v čem můžeme být v celosvětovém měřítku na přední příčce? 2003 ‘Excellent Product of 2003’ pro značkové sklenice

1999 Design Centre ČR ‘Good Design’ pro vázu Twiggy 2000 SIBO Fair ‘Nejlepší design’

16

|

ESTATE

2003 ‘Excellent Product of 2003’ pro kolekci sklenic na whisky 2003 ‘Excellent Product of  2003’ pro sklenice z kolekce ROU-RA

2005 Váza ‘Translucent’ byla vybrána mezi 100 nejlepších českých designů 20. století

2007 Red Dot Award za kolekci sklenic ‘Cleveland’ pro firmu Sahm s. r. o.

2007 Czech Grand Design 2006 nominován za design sklenic pro Staropramen vyráběné firmou Sahm s .r .o.


na jednání a druhý den vytvářím nějaké mé

to rozhodnutí padlo v Itálii, před asi pat-

To znamená, že teď vstupujete do fáze, kdy

plastiky, tak to je přesně to, co mne rajcuje.

nácti lety, pracoval jsem tehdy v Benátkách.

se více budete věnovat volnému umění?

Právě v Benátkách se do mne dostal italský

Ano, výstava, kterou připravuji na příští

Stalo se někdy, že by iniciativa nešla od za-

styl života, jako že chlapi chodí v dobrých

rok, bude mít jednoznačné téma, které nyní

davatele, ale od vás? Že byste něco držel

košilích, denně si dávají šest kafí na stojáka,

ještě neprozradím. Pokud mám alespoň

v ruce a řekl, to se mi nelíbí, to by chtělo

všichni se zdraví, mají tam krásné sklenice

naznačit, bude se týkat duše a těla. Pra-

udělat jinak?

a kávovary. Tam se do mne dostala nejen

cuji na ní dva roky. Jedná se i o některé

kultura, ale i ta jejich radost ze života

rozměrné, těžké věci. Chci přiznat, to co

a z krásných věcí. To mne moc ovlivnilo.

jsem, tedy tvarosloví bude hodně inspiro-

To jsem ještě neudělal. Vždy se trochu stydím, bez vyzvání do toho lidem kecat, vždy čekám na impuls. Ale, když mi dá někdo šanci, umím být i hodně kritický.

Design je pro mne spíše životní kultura.

vané životem designera, to co jsem poznal

Uvědomil jsem si, že je nádherné se tím

v komerčním světě, ale myšlenka, ta bude

zabývat. Od působení v Itálii, od toho roku

naopak ze světa duchovního. Nechci to

Vzpomenete si na první okamžik, kdy jste

1998, se už nestydím mluvit o módě, o krás-

nějak nadnášet, je to normální výstava, ale

se rozhodl, že budete designerem?

ném oblečení, o dobrém jídle, krásných

pro mne bude hodně znamenat, chci se po-

buticích. Je to pro mne otázka životní ra-

sunout někam dál. Rád bych zhodnotil ten

více volné tvorbě, ale že se budu designu vě-

dosti a proto mne baví design. A na druhé

můj rozporuplný pohled na svět volného

novat alespoň částečně až do konce života,

straně volné umění mne baví proto, že toto

umění a designu.

Nyní u mne převažuje zájem se věnovat

všechno často zpochybňuje, to jsou paradoxy co.

Máte nějaký vzor venku nebo u nás? Mne narovinu nezajímá moc současný design, trendy design, mne zajímají především

2011 Good Design Award 2010 pro kolekci skleniček ‘Erie’ pro firmu Sahm s.r.o.

osobnosti,

2012 Czech Grand Design 2011 ocenění ‘Designer roku’ pro kolekci nápojového setu Poppyhead pro společnost Moser a.s. a pro lustr Uovo d´Oro a d´Argento pro Lasvit s. r. o.

2013 PIVO, BIER & ALE – AWARDS 2012 sklenice na pivo vyráběné firmou Sahm s. r. o. pro Budějovický Budvar n.p. - České Budějovice, byla oceněna jako nejpůsobivější sklo roku 2012

2013 GOOD DESIGN AWARD 2013 kolekce sklenic Daytom Tumbler pro firmu Sahm s.r.o.

ESTATE | 17


které překračovaly rámec designu, což byli

V posledních pěti letech mne začalo

do místnosti, která byla původně baletním

třeba Italové Gio Ponti, Enzo Mari, scéno-

poptávat mnoho soukromých investorů,

sálem. Lustr se bude skládat ze sedmdesáti

graf Robert Wilson nebo Japonec Isamu

kteří staví domy. Uvědomili si, že nechtějí

baletek. Velmi mne v tomto ovlivnila práce

Noguchi. Zajímají mne ti, kteří razí napros-

koupit třeba krásnou Artemide lampu,

pro značku Cartier, která se myslím povedla,

to svou cestu, kteří propojují matematiku,

kterou ale vidí v každé restauraci. Postavili

a právě od té doby jsem získal větší odvahu

architekturu, módu, dekor. Z kultury české

si originální dům a chtějí tam mít originální

pracovat více s prostorem. ▬

obdivuji například už zmíněného Ladislava

svítidlo. Chtějí ode mne především svítidla,

Sutnara nebo Josipa Plečnika, i když to

ale také plastiky nebo artefakty. Většinou

vlastně nebyl Čech.

se nejedná o spolupráci přímo s architektem, bývá to sice na jeho doporučení, ale já

Pracujete i na nějakých zajímavých realit-

přicházím až v poslední fázi. Nyní například

ních zakázkách?

dělám obrovský lustr do residence Dlouhá,

„Chci přiznat, to co jsem, tedy tvarosloví je hodně inspirované životem designera, to co jsem poznal v komerčním světě, ale myšlenka, ta je naopak ze světa duchovního…“

18

|

ESTATE


In recent years, Czech glass has experienced a renaissance. Brands such as Moser, Lasvit and Preciosa are conquering new markets, and seem to be succeeding. Designer products such as glasses, vases, lamps and chandeliers are desired by the most demanding customers worldwide. The gems of works of art by our leading designers representing the Czech school of glass are sought by art collectors in the Czech Republic as well as abroad. At the same time, we increasingly often hear the phrase „Czech Design“. That is why we visited Rony Plesl who, like few others, is synonymous with Czech designer glass. We asked him what the actual state is of Czech Glass and Czech Design.

ESTATE | 19


You have just returned from a trade fair in Milan. Did the visit meet your expectations? Yes, definitely. I was very curious about the reactions, and I must say that they were positive. One can be proud when something has been successfully accomplished. I was most pleased that designers, traders as well as the competition were all very surprised and had high praise for the Preciosa exhibition. What especially pleases me is the fact that this is a team success which encourages and promotes a positive atmosphere throughout the enterprise. After all, Milan in itself is always a delight and I always really look forward to visiting the city. What specifically did you present there? Two chandeliers that foreshadow a certain part of the future of Preciosa. Both chandeliers are inspired by the 18thcentury Czech Theresian style. This was a kind of Czech cult which was wonderful, but no one has really dealt with it in modern times. I think that a company which has a tradition should also build on the tradition and not pick up inspiration from the competition or trends. Therefore I decided that, for as long as I can, I’d like to advance Preciosa at least partially in the traditional style and our own know-how. I created the all-metal, jointed Theresian chandelier called Mercury, inspired by the male figure. The structure is variable and can be adjusted to alter its shape. The other Theresian chandelier created entirely in glass, evokes Venus blossoming with 4 000 flowers. Neither of the chandeliers was easy to create and I was greatly assisted by Preciosa experts. The most important thing for both projects is that they are not designs in themselves, but are a certain method. Mercury can be further developed. I would like to work with new customised trimmings for a new Theresian chandelier. I would also like to continue working on Venus, by adding more colourful flowers. I would like to combine a Czech and Venetian chandelier and thus connect my four-year Venetian experience with my Czech experience. The Milan Fair is a good place for comparisons. How do you think Czech design performs internationally? It is quite surprising to me, but it is doing very well. When sometime around 2002 one of the first documentary films on Czech design was shot, only about five personalities appeared in it. At that time, design was not yet much discussed. The documentary ends with the question: What is Czech design? And I then said that I do not know, because nobody has yet created it. And I kind of negated it slightly in this way. 20

|

ESTATE


Bydlení s Noblesou Nový rezidenční projekt na Praze 1

ESTATE | 21


Today it is a little different. While I

design and religious design are generally

incredibly surprised, because in this area we

still think that there is no typical Czech

not in great demand. Therefore, I personally

belong among the top in Europe. So I have

design, the best Czech design is on the

think that a very specific Czech design will

to clarify that sentence a little. I think that

international level. I think in fact that free

never be created. The environment is not

there is good Czech design and good Czech

art, which is very complicated, ambiguous

accommodating enough for this. We are

design is on a par with international design.

and spiritual, is far more typical of Czech

a rather Kafkaesque nation, while design

culture. Czech design faces increasing

is usually very straightforward. However,

In your opinion, are Jindřich Halabala,

difficulties because spiritual design, intricate

on the contrary, in terms of quality, I was

Ladislav Sutnar and others exceptions or

22

|

ESTATE


perhaps incoherent expressions of individual personalities who are not linked to each other in any way? Yes, this is what I kind of said. Of course, anyone can disagree with me. I grew up on free art. I lectured Art History for 11 years and I’m also interested in culture theoretically. I recently participated in the opening of an excellent exhibition of Czech Symbolism in the Convent of St. Agnes, where I realised once again that the best of Czech painting and sculpture is very typically Czech and not able to be categorised. Especially the work of Sutnar, this is unique to the world, but it is not typical Czech design. It is rather about things beyond the boundaries of conventional utility design. It is a phenomenal concept of thinking.

„Mne narovinu nezajímá moc současný design, trendy design, mne zajímají především osobnosti, které překračovaly rámec designu.“

I have great respect for Czech culture, but if we take into account the trendy design which sells, which works in a specific period, either Czech design will be super cool and copy the world, or something will be very specific Czech design, more like art design, with a lot of personality. For example, Scandinavian design is very specific, it is largely about wood, about furniture. Is Czech design specific in some way as well? I think it is not about material, but rather about time. A very original culture was created in the communist era, and it is something that can be built upon. Isolation, spending time in cottages, being engrossed in thoughts were typical phenomena of Czech culture under communism. I personally still have a little internal problem with this. On the one hand, I understand, but on the other hand, it makes me a little uneasy, because I know what communism has done, and also in the areas of culture and, for example, architecture. While the 1st of May days were spectacular and the Kotva shopping centre was celebrated, there were absolutely terrible shops and urbanism was utterly destroyed in all the small towns. Celebrating the communist era and design, yes, on one hand it is appropriate to highlight what was great. On the other hand, however, we should honestly admit that three-quarters of everything was absolutely devastating. In any case, some designs of that period belong among the Czech gems. Perhaps it’s just all about the material after all. Do you think that glass, working with glass, is something we can excel on a global scale in? Yes, definitely. Although the world has rather caught up with us, there are only a few absolutely unique things about Czech glass, primarily cut glass. We have great schools, there are four glassmaking schools and other colleges where glassmaking is taught. This is not common in other countries, such a ESTATE | 23


specialisation instead forms part of post-

But when someone gives me the chance, I

Do you have any role models here or

graduate studies. It seems that glass will

can be very critical.

abroad?

always be a phenomenon in our country.

Frankly speaking, I’m not very interested

However, it is possible only partly to

Do you remember the moment when you

in contemporary or trendy design. I am

build on a craft, the form must also have a

decided to become a designer?

primarily interested in the personalities

content. To sum up, glass is a wonderful

Now I am more interested in free form,

that have exceeded the scope of design,

but the decision to devote myself at least

such as Italians Gio Ponti and Enzo Mari,

thing, but mere tradition is not enough.

partially to design for my lifetime was made

stage designer Robert Wilson and Japanese

The interconnectedness of tradition

in Italy, about 15 years ago, when I was

Isamu Noguchi. I am interested in those

and contemporary thinking is a very

working in Venice. It was in Venice where

who lead totally in their own way, who

complicated matter. I see how some

I adopted the Italian lifestyle, for example,

combine mathematics, architecture, fashion,

students regard glass in the wider artistic

that a man walks around in his best shirts

decor. For example, in Czech culture, I

context and are giving it a new impetus.

and drinks six coffees standing up, people

admire the aforementioned Ladislav Sutnar

greet each other and use beautiful glasses

and also Josip Plečnik, although he actually

You are not afraid to accept commercial

and coffeemakers. Not only culture, but also

was not of Czech origin.

orders. How do you choose these?

their joy of life and beautiful things became

This needs some clarification. I’ve had a contract with the large German concern of Sahm for 11 years and my task is to win

part of me there. It influenced me a great

Are you working on any interesting real

deal.

estate contracts?

For me, design is rather a culture of life

In the last five years, many private

that I realise is wonderful to be involved in.

investors who are building houses have

Since 1998 when I worked in Italy, I have

begun to request my services. They realise

for a Ukrainian brewery. There is work

no longer been ashamed to speak about

that they do not want to buy an Artemide

ahead for a Belarusian brewery. It is really

fashion, about beautiful clothes, good food,

lamp which is beautiful but is seen in every

a service, but I enjoy it tremendously,

beautiful boutiques. For me it is a question

restaurant. They build an original house

because it is a different area of creation,

of the joy of living, because I enjoy design.

and want to have original lighting in it.

meeting people who run huge corporations,

And on the other hand, I enjoy free art

They mostly want lamps from me, but also

people who deal with something entirely

because it often challenges all these things.

sculptures and artefacts. Mostly this is not

different. These are very pragmatic people

What a paradox, isn`t it?

a direct collaboration with the architect,

tenders. For example, now I’m creating glasses

who want their products to sell. It entertains

but based on his recommendations. I only

me, it again concerns something different,

Does this mean that now you are entering

appear during the last stage. For example,

business and marketing analyses. I am not

a phase where you will be more engaged in

now I am creating a huge chandelier for

saying that this is something in which I

free art?

the Dlouhá Residence, for the room which

would primarily like to be engaged for my

Yes, the exhibition which I am preparing

was originally a ballet hall. The chandelier

lifetime, but because I am an active man,

for next year will have a clear theme which

will consist of 70 ballerinas. I was greatly

I enjoy multitasking. So what thrills me

I’m not yet revealing. If I am at least to

influenced in this by my work for the

precisely is when one day I am creating

hint, it involves body and soul. I have been

Cartier brand, which turned out well, in my

glasses for a brewery and attending a

working on it for two years. These are also

opinion. Since then, I’ve had more courage

meeting somewhere and the next day I am

large, heavy pieces. I want to confess who

to work increasingly with space. ▬

working on my own sculptures.

I am, so the basic elements will be greatly inspired by the life of a designer, what I’ve

Has it happened sometimes that the

learned in the commercial world. However,

initiative has not come from the customer

on the contrary, the idea will come from the

but from you? That you hold something in

spiritual world. I don’t want to exaggerate

your hand and say, I don’t like this, it must

anything, it will be a normal exhibition, but

be done differently?

it will mean a lot to me. I want to move on

I’ve never done that. I’m always a little

to something else. I would like to evaluate

reluctant to criticise other people`s work

my ambivalent view of the world of free art

uninvited. I always wait for the invitation.

and design.

24

|

ESTATE


ESTATE | 25


miláčkové britské královny míří do Prahy

Letní

SHAKESPEAROVSKÉ opět na Pražském SLAVNOSTI hradě Favourites of the British Queen are Heading to Prague

L

etní shakespearovské slavnosti, jejichž generálním partnerem je již

šestnáctým rokem skupina PPF, zahájila 25. června na Pražském hradě premiéra inscenace Romeo a Julie v režii autorského tandemu SKUTR. Na programu Slavností budou dále již známé inscenace z minulých let Mnoho povyku pro nic, Sen noci svatojánské, Zkro-

26

|

ESTATE

|

ESTATE TIPY

|

ESTATE TIPS


cení zlé ženy, Jak se vám líbí, Večer tříkrálový aneb Cokoli chcete a již tradičně nebudou chybět Veselé paničky windsorské. Výjimečnou událostí bude projekt Patrick Doyle – Shakespeare in Concert, který pořadatelé festivalu připravují společně

Another Summer Shakespeare Festival at Prague Castle

s Prague Shakespeare Company a Film Music Prague.

Režijní dvojice SKUTR, Martin Kukučka a Lukáš Trpišovský, se do prostor Nejvyššího purkrabství vrací po dvou letech. „Po zkušenosti z Letních shakespearovských slavností roku 2013 víme, že atmosféra zkoušek na Pražském hradě je neopakovatelná. Proto jsme s radostí přijali nabídku

The Summer Shakespeare Festival, the general partner of

na Slavnostech znovu režírovat. A také jsme chtěli

which for the 16th year already is the PPF group, opened at

pracovat na tématu, které je nám blízké. Téma první velké lásky je přesně pro nás – Martina ro-

Prague Castle on 25th June with the premiere of Romeo and

mantika a mne skeptika. A stejně tak je rozkročena

Juliet directed by the SKUTR duo. The Festival programme

i Shakespearova hra Romeo a Julie. Zpočátku ro-

also includes well-known productions from previous years

mantika, v závěru drama s velkou skepsí možnosti naplnění lásky v našem světě. Zpočátku komedie,

such as “Much Ado About Nothing”, “A Midsummer Night’s

v závěru tragédie s velkým vykoupením,“ říká o hře

Dream”, “The Taming of the Shrew”,” As You Like It” and

Lukáš Trpišovský. V hlavních rolích se představí Tereza Voříško-

“Twelfth Night, or What You Will”. Traditionally,”The Merry

vá jako Julie a Jan Sklenář z královéhradeckého

Wives of Windsor” will not be missing. An exceptional event

Klicperova divadla jako Romeo. Dále hrají Naďa

will be the Patrick Doyle – Shakespeare in Concert project,

Konvalinková, Saša Rašilov, Lenka Krobotová, Jiří Vyorálek, Dana Batulková, Martin Sláma,

jointly arranged by the Festival organisers with the Prague

Marie Poulová, Petr Vančura, Jan Cina, Jakub

Shakespeare Company and Film Music Prague.

Gottwald, Michal Sieczkowski, Miroslav Zavičár a další. Letní shakespearovské slavnosti se konají od 25. Června 2015 do 5. září 2015. V Praze proběhnou již tradičně na dvou plenérových scénách. V Nejvyšším purkrabství Pražského hradu a na Letní scéně Hudební a taneční fakulty AMU v Lichtenštejnském paláci na Malostranském náměstí. Vstupenky na pražská představení jsou v prodeji v síti Ticketportal.

Více informací na www.shakespeare.cz ESTATE TIPS

|

ESTATE TIPY

|

ESTATE | 27


The SKUTR directing duo, Martin Kukučka

Tereza Voříšková will be introduced as Juliet

and Lukáš Trpišovský, return to the premises of

and Jan Sklenář from the Klicpera Theatre in

the Supreme Burgrave after two years. “After the

Hradec Králové as Romeo. Also starring are Naďa

experience of the 2013 Summer Shakespeare Festival,

Konvalinková, Saša Rašilov, Lenka Krobotová, Jiří

we know that the atmosphere of rehearsals at Prague

Vyorálek, Dana Batulková, Martin Sláma, Marie

Castle is inimitable. Therefore, we gladly accepted

Poulová, Petr Vančura, Jan Cina, Jakub Gottwald,

the offer to direct the plays again. Moreover, we also

Michal Sieczkowski, Miroslav Zavičár and others.

wanted to work on a theme that is close to our hearts.

The Summer Shakespeare Festival is held from

Martin being a romantic and I a sceptic, the theme

25th June to 5th September. Already as a tradition,

of the first great love is ideal for us. Shakespeare’s

there will be two open-air performances in Prague.

“Romeo and Juliet” is much the same — a romance

One at the Supreme Burgrave of Prague Castle, the

in the beginning, a drama at the end, with great

other on the Summer Stage of the Music and Dance

scepticism about the possibility of the fulfilment of

Faculty of the Academy of Performing Arts in Prague

love in our world. Initially a comedy, finally a tragedy,

in Liechtenstein Palace on the Lesser Town Square.

with huge redemption,” says Lukáš Trpišovský about

The tickets for Prague performances are on sale in the

the play.

Ticketportal network.

More information at www.shakespeare.cz

28

|

ESTATE

|

ESTATE TIPY

|

ESTATE TIPS


CZECH CONTEMPORARY ART

MICHAEL RITTSTEIN Michael Rittstein (1949) He studied at the VĂĄclav Hollar Secondary School of Arts and the Academy of Fine Arts in Prague. He belongs to the most important representatives of expressive figurative painting. He is well known as a painter, graphic artist and illustrator. Michael Rittstein makes also spatial installations, drawings, illustrations and graphic art. Since 2001 he teaches painting in the Academy of Fine Arts in Prague. His work is represented in numerous major collections such as the National Gallery in Prague, the Prague City Gallery, the Museum of Czech Literature, as well as the Centre Pompidou in Paris, the Albertina in Vienna and in private collections in the Czech Republic, Europe and USA. He organized dozens of solo exhibitions and participated in many group exhibitions.

A Night Almost Magical

Passion is Blind

Galerie La Femme BĂ­lkova 2, Praha 1 tel.: +420 224 812 656 GSM: +420 775 726 067 info@glf.cz

www.glf.cz

Gold-haired, Red-haired and Blue-haired


NATIONAL GEOGRAPHIC

nabízí unikátní „lodges“ Launches Unique Lodges Of The World 30

|

ESTATE

|

NOVINKY

|

NEWS


N

ovou kolekci butikových hotelů a chat společnosti National Geographic mimo jiné tvoří doškové bungalovy v deštných pralesích Kostariky a nebo luxusní stany v australském vnitrozemí. Nemovitosti prezentované pod společným názvem

Unique Lodges of the World byly posuzovány podle faktorů jako design a atmosféra, hodnocení hostů, kvalita služeb a ochrana přírody. Ve vytvořené skupině je nyní 24 chat rozprostřených po celém světě, od Austrálie po Kanadu, Jihoafrickou republiku a Latinskou Ameriku. Zároveň začaly být v rámci skupiny nabízeny speciální balíčky NatGeo, které nabízí doplňkové zážitky, jako je soukromá plavba při západu slunce v kanadském resortu Nimmo Bay Wilderness v Britské Kolumbii nebo výlet do resortu Brando ve Francouzské Polynésii spojený s privátní prohlídkou vedenou místním vědcem.

NEWS

|

NOVINKY

|

ESTATE | 31


Kromě Unique Lodges of the World společnost National Geographic začala nabízet Private Expeditions, cestovní balíčky, které účastníkům nabízí rovnováhu mezi výlety s průvodcem a svobodou cestování a poznávání na vlastní pěst. Prvních 13 expedic zahrnuje výlety do buddhistických chrámů a starých pevností v Bhútánu nebo jízdu na koních na pobřeží Západního Kapska v Jihoafrické republice. ▬

32

|

ESTATE

|

NOVINKY

|

NEWS


Thatched bungalows in the rainforest of Costa Rica and luxurious tents in the Australian Outback are among some of the properties chosen to form National Geographic’s new collection of boutique hotels and lodges. Launched as the National Geographic Unique Lodges of the World, properties chosen were judged on factors such as design and character, guest experience and quality of service, and sustainability practices. The initial collection includes 24 lodges that span the world, from Australia to Canada, South Africa and Latin America. Special NatGeo packages are also being launched within the group that offer add-ons such as a private sunset wildlife cruise at the Nimmo Bay Wilderness Lodge in British Columbia, Canada or a private tour and outing with an on-site scientist at The Brando in French Polynesia.

NEWS

|

NOVINKY

|

ESTATE | 33


In addition to its Unique Lodges of the World, the National Geographic Society has likewise launched a series called the National Geographic Private Expeditions, travel packages that offer participants a balance of guided tours and freedom to travel and explore on their own. The initial lineup of 13 expeditions includes trips to Buddhist temples and ancient fortresses in Bhutan, as well as horseback riding along the coast of South Africa’s Western Cape. ▏

34

|

ESTATE

|

NOVINKY

|

NEWS


NEWS

|

NOVINKY

|

ESTATE | 35


V PEKINGU BYL OTEVŘEN

W HOTEL V

Pekingu byla otevřena moderní a okázalá budova nového W hotelu, jehož cílem je stát se preferovaným místem pro módní, hudební a zábavní průmysl, který se slétá do rušného hlavního města.

Hotel je na třídě Dlouhého míru, hlavní dopravní tepně, na které se nachází také hlavní

dominanty a památky města jako náměstí Nebeského klidu, Zakázané město, Trh s hedvábím a Pekingská koncertní síň. W Peking se tyčí nad místem, kde se snoubí tradice a historie s 21. stoletím. Všechny pokoje a apartmány, kterých je 349, jsou vybaveny digitálními tablety pro ovládání osvětlení a atmosféry pokoje, systémem domácího kina s přenosnými reproduktory Bose a vybavením Bliss. W Peking je druhým ze skupiny W hotelů, jejichž výstavbu tento hotelový řetězec v příštích pěti letech plánuje v čínských městech Čang-ša, Čcheng-tu, Šanghaj, Su-čou, San-ja a Šen-jang. W hotely svou první čínskou adresu otevřely ve městě Kanton. ▬

36

|

ESTATE

|

NOVINKY

|

NEWS

OPENS IN BEIJING, CHINA


Beijing has opened the doors to a new W HOTEL, a modern, glitzy property that aims to be the hotel of choice for the fashion, music and entertainment industry who descend on the bustling capital. Located on Chang’an Avenue, a major thoroughfare that’s also home to major landmarks and monuments like Tiananmen Square, the Forbidden City, the Silk Market and the Beijing Concert Hall, the W Beijing towers over a place that straddles tradition, history and the 21st century. All 349 guestrooms and suites feature digital tablets that can control room lighting and mood, a home theater system with Bose portable speakers and amenities from Bliss. The W Beijing is the second of several W Hotels planned for China over the next five years in cities like Changsha, Chengdu, Shanghai, Suzhou, Sanya, and Shenyang. W Hotels opened its first China location in the city of Guangzhou. ▬

NEWS

|

NOVINKY

|

ESTATE | 37


RESTAURACE

NOMA

s klubem Monaco otevřeli concept store

R

estaurace se spojila s oděvní značkou a výsledkem je otevření dočasného butiku, kde mohou hosté koupit nažehlené košile s límečky na kno-

flíčky a vlněné svetry, a to před nebo poté, co si pochutnají na skandinávském jídle oceněném dvěma michelinskými hvězdami. Butik nabízí pánské a dámské oblečení od společnosti Polo Ralph Lauren, starožitné knihy z newyorkského knihkupectví Strand a ručně vyrobená umělecká díla z Brooklynu. Spolupráce proběhne v rámci pětitýdenní časově omezené akce, během které šéfkuchař René Redzepi přemístí svůj kodaňský personál do tokijského hotelu Mandarin Oriental. Projekt Nomě přinesl novou obchodní příležitost, když otevřela eshop prodávající použité vidličky a lžičky v cenách až 200 dolarů za kus. Místní řemeslní umělci, hrnčíři a kuchaři dostali za úkol vytvořit speciálně pro tuto událost nádobí, příbory a keramiku. Přestože se taková spolupráce může zdát na první pohled absurdní, pro módní návrháře není neobvyklé najít si cestu do restaurací. Ralph Lauren má v New Yorku kavárnu Ralph’s Coffee, Roberto Cavalli vlastní značkové restaurace v mnoha městech světa včetně Florencie, Dubaje a Miami, a Armanimu patří restaurace v New Yorku, Tokiu, Paříži a Cannes. ▬ 38

|

ESTATE

|

NOVINKY

|

NEWS


NEWS

|

NOVINKY

|

ESTATE | 39


The restaurant has partnered with the clothing brand to open a temporary boutique that will allow diners to shop

While at first blush the collaboration may seem incongruous, it’s not uncommon for fashion designers to make their foray into restaurants. Ralph Lauren has Ralph’s Coffee in New York; Roberto Cavalli has branded restaurants

for crisp button downs and woolly

around the world including Florence, Dubai and Miami; and Armani has restaurants in New

sweaters before or after their two

York, Tokyo, Paris and Cannes. ▬

Michelin-starred Scandinavian meal. The store features men’s and women’s apparel from the retailer owned by Polo Ralph Lauren, vintage books from the Strand bookstore in New York, and handcrafted art works from Brooklyn. The collaboration comes off a fiveweek pop-up event that saw chef René Redzepi transplant his kitchen staff in Copenhagen to the Mandarin Oriental, Tokyo. The project resulted in a retail opportunity for Noma, which opened an online boutique selling used forks and spoons at up to $200 a pop. Local, artisanal artists, potters and chefs were commissioned to create tableware, cutlery and earthenware specifically for the event. 40

|

ESTATE

|

NOVINKY

|

NEWS

Noma Restaurant Opened Concept Store With Club Monaco


KÜCHENIMPRESSIONEN

Německé kuchyně se stoletou tradicí spolehlivosti a luxusu! Neradi se omezujete a proto jsou tady kuchyně Bauformat od předního evropského výrobce. Nabízíme vám doslova nekonečný výběr: stovky výchozích modulů, stovky dezénů, odstínů a povrchů, tisíce variací vašich splněných přání.

Šampión ve své třídě Ať se na kuchyně Bauformat podíváte z kterékoli strany, vždycky uvidíte jen nejmodernější světový design, aktuální a futuristické technologie ve výbavě a perfektní německou kvalitu zpracování. Společně s výhodami Oresi je to skutečný šampión ve své třídě. V této kuchyni nejste jen paní domu, jste zároveň pánem svého světa.

Exkluzivně v síti Oresi – www.oresi.cz NEWS

|

NOVINKY

|

ESTATE | 41


LUXUSNÍ A ELEGANTNÍ BYT POBLÍŽ CENTRAL PARKU V NEW YORKU

T

ento byt s výhledem na Central Park, řeku Hudson a město má 280 m2 obytné plochy a je kompletně zařízený návrhářem. Výhled na Central Park nabízí prostorný

obývací pokoj, jídelna a knihovna (nebo třetí ložnice). Jídelna se otevírá do gurmánské kuchyně. Z hlavní ložnice je vidět řeka Hudson a město. Doplňují ji dvě šatny, velká koupelna s oddělenou sprchou a vanou, vestavěné skladovací prostory, podlahy sálající teplo a zrcadlo se zabudovanou televizí. Druhá ložnice má vlastní koupelnu, vestavěné moduly, šatnu a nabízí výhled na řeku Hudson.

Místo/Location: New York City, USA Postaven/Built: 2014 Plocha/Area: 280m2 Foto se svolením/ Photo courtesy: Mercedes/Berk 42

|

ESTATE

|

NOVINKY

|

NEWS


Další prvky zahrnují: Vysoké stropy, tmavé dubové podlahy, systém Crestron, automatické stínění, samostatné šatny a ozdobné lišty v celém bytě. Obyvatelé mohou využívat služby luxusních zařízení, jako například restauraci, která jídlo připraví i přímo v domácnosti, fitness centrum o velikosti 1400 m2 s plaveckým bazénem o délce 25 m osvětleným oblohou, vinárny, obchodní centrum, privátní kinosál, hernu a venkovní terasu. Tým zaměstnanců je připraven zajistit životní úroveň a komfort každého rezidenta.▬

This designer-furnished home has Central Park, Hudson River and City views with 280 square meters of living space. The apartment has an open living room, a dining room and a library or third bedroom, each with Central Park Views. The dining room opens up to the gourmet eat-in kitchen. The master suite has views of the Hudson River and City and is complete with two walk-in closets, master bath with separate walk-in shower, soaking tub, ample built-in storage, radiant heat floors and in-mirror TV. The second bedroom has an en suite bath, built-ins, an outfitted walk-in closet and views of the Hudson River

New York Luxury and Elegant Apartment Near Central Park

NEWS

|

NOVINKY

|

ESTATE | 43


Other features include: High ceilings, dark oak floors, Crestron system, automatic shades, outfitted closets and beautiful moldings throughout.

Residents have access to luxury amenities including a restaurant with in-home private dining service, 1.400 m2 fitness center with 25 m sky-lit lap pool, wine rooms, business center, private screening room, game room, outdoor terrace, and a full staff to meet the living standards and comfort level of every resident. â–Ź

44

|

ESTATE

|

NOVINKY

|

NEWS


Klimentská 36, Praha 1 tel.: +0420 224 811 136 e-mail: praha1@kreiner.cz web: www.kreiner.cz

í n c k n ´ ´ u f e Dokonal DOKONALÁ BELLA VITA 3 Lineární design, inovativní technologie, snadná údržba. Částečně rámovaná zástěna Bella VITA 3 kombinuje puristický půvab s maximální funkčností. Velké, skryté pojezdy a vysoce kvalitní materiály zajišťují zvláště tichý chod a vedení skleněných prvků bez vůle. Chytrá funkce Push & Clean: mírným tlakem z vnější strany se dveře vyklopí dovnitř a můžete tak snadno a bezpečně zástěnu vyčistit.

www.duscholux.cz


RALPH LAUREN OTEVŘEL KAVÁRNU V NEW YORKU

V

nové kavárně si hosté vychutnají Laurenovu privátní směs bio káv certifikovaných USDA, nabídku čajů, čerstvých

džusů, pečiva, sendvičů a další Ralphovy oblíbené sladkosti. „Vůně čerstvě uvařené kávy mi evokuje tolik vzpomínek, především na dobu strávenou s přáteli a rodinou, s lidmi, které mám rád,“ prohlásil módní návrhář. Jak je pro styl Ralpha Laurena typické, nebyl opomenut jediný detail, od mozaikových podlah, klenutých stropů a řemeslně zpracovaného osvětlení, po mramorové desky stolů, starožitné barové židle a ručně tesané dřevěné lavice. „Chtěl jsem připravit kávové směsi v tomto duchu a zároveň vytvořit místo, kde se budou lidé scházet a odpočívat od rušného dne.” ▬

46

|

ESTATE

|

NOVINKY

|

NEWS


The new coffee shop offers Ralph Lauren’s private coffee blends from USDA organic coffees, teas, fresh juices, pastries, sandwiches and some of the designer`s favourite sweet treats.

RALPH LAUREN OPENS COFFEE SHOP IN NEW YORK

“The smell of freshly brewed coffee evokes so many memories for me—mostly of time spent with friends and family, the people I love,” fashion designer said. In a typical Ralph Lauren style, no detail has been overlooked, from the mosaic-tiled floors, vaulted ceiling and artisanal lighting to the marble tabletops, antique bistro chairs and hand-hewn wooden benches. “I wanted to develop these coffee blends in that spirit and create a place where people could come together and take a break from their busy days.” ▬

48

|

ESTATE

|

NOVINKY

|

NEWS


NEWS

|

NOVINKY

|

ESTATE | 49


10

NEJluxusnějších ostrovů

Dovolená ve městě, prchnutí na venkov nebo odpočinek v letovisku jsou sice v naprostém pořádku, ale dekadentnímu úniku na ostrov se přece jen nic nevyrovná. Zeptejte se Sira Richarda Bransona, který si pořídil vlastní soukromý ostrov jen proto, aby unikl nesnesitelným davům. Luxusní ostrovy, na nichž si vánek pohrává s tropickými palmami a tyrkysové vody škádlí hebký bílý písek, jsou oblíbeným místem dovolených pro bohaté, slavné a božské. Následujte nás na desítku nejskvělejších luxusních ostrovů a věřte, jsou spíše z jiného světa.

5 1

9 2 6 4

7 8

10

3

1

MUSTIQUE

souostroví Exuma

Karibik

Jestli se chcete podívat sem, musíte být milí na slavného mága a majitele Davida Copperfielda. Toto souostroví nabízí nejlepší potápění na světě v dokonale průhledné vodě s celými kilometry neskutečně krásných korálových útesů. Na noc se můžete ubytovat v jednom z pěti domů, jež ukrývají veškerý představitelný luxus, a každý vrtoch vám splní někdo ze třicetičlenné obsluhy.

50

|

ESTATE

|

10 NEJ

|

10 BEST

2

MUSHA CAY

V tomto tropickém ráji v zájmu zachování exkluzivity a ochrany zdejší krásné přírody je dovoleno pobývat pouze vybrané skupině osob. Mezi návštěvníky patří princ William nebo Mick Jagger. Hosté tu mohou dovádět v akvamarínovém příboji, rozvalovat se na nedotčených bílých plážích nebo celé noci strávit v baru Basil’s, oblíbeném podniku dovolenkující smetánky.


3

ŽELVÍ OSTROV Fidži

Soukromý majitel tohoto ostrova, podnikatel Richard Evanson, tu za 30 let nechal vysázet přes půl milionu stromů, zavedl tucty soukromých pláží a neuvěřitelné letovisko se 14 ekologickými vilami. Není divu, že právě tady se natáčela Modrá laguna, slavný romantický film ze 70. let s Brooke Shields. Jestli vás o dech nepřipraví ani tento ostrov, pak se obáváme, že už nic.

PALMOVÝ OSTROV Svatý Vincenc a Grenadiny

4

V tomto tropickém ráji v zájmu zachování exkluzivity a ochrany zdejší krásné přírody je dovoleno pobývat pouze vybrané skupině osob. Mezi návštěvníky patří princ William nebo Mick Jagger. Hosté tu mohou dovádět v akvamarínovém příboji, rozvalovat se na nedotčených bílých plážích nebo celé noci strávit v baru Basil’s, oblíbeném podniku dovolenkující smetánky.

5

BERMUDY severní Atlantik

Bermudy jsou zajímavou směsicí koloniální architektury a rajského prostředí. Nejlepší ubytování je v podniku Fairmont Southampton, z něhož si budete moci vychutnávat zdejší pověstné pláže s růžovým pískem, rozmazané jantarové západy slunce a bujnou zeleň zahrad. Budete zajisté souhlasit, že to vše je prostě fantastické.

BARBADOS Karibik

6

Přestože je Barbados možná jedním z nejvýznamnějších luxusních ostrovů světa, stále neztratil nic ze své exkluzivity. Ostrov o rozloze 430 km2 je naprosto plochý, díky čemuž jeho překrásné pobřeží z bílého písku hustě lemují luxusní hotely a špičkové restaurace. Zvláště doporučujeme letovisko Sandy Lane Luxury Golf & Spa Resort v St. James.

7

KAKAOVÝ OSTROV Maledivy

Přiléhavě pojmenovaný ostrov má všechno, co hledáte: Hedvábný bílý písek pod nohama, lagunu, která už prostě nemůže být modřejší, a speciálně vybudované pětihvězdičkové letovisko. Nad hladinou moře tu pro hosty čeká třicet tři vil a zázemí zahrnuje překrásně udržované zahrady, bazény, lázně, jogínský pavilon, středisko vodních sportů i elegantní restauraci.

OSTROV MNEMBA Indický oceán

8

Každá vyhlídka tohoto ostrova tu vypadá jako fotka z brožurky líbánkové cestovní kanceláře, každá z plážových chat má verandu s výhledem na moře, nedotčenou bílou pláž, mihotavé modré vody a přesně ten typ žhnoucího západu slunce, co se vidí jen ve filmech. Rozloha ostrůvku je jen necelé dva kilometry a okolní korálové útesy, obří želvy, plážové kraby a tropické rybky chrání speciální mantinel.

9

NECKERŮV OSTROV Britské Panenské Ostrovy

Na Neckerově ostrově našel svůj druhý domov majitel značky Virgin Sir Richard Branson. Hosté si ostrova mohou za čtyřicet sedm tisíc dolarů denně neomezeně užívat. K tomu patří vila v balijském stylu, která je vystlaná luxusním brazilským dřevem, starožitnostmi a textiliemi, dále dvě soukromé pláže, řada bazénů, tenisové kurty i osobní kuchař.

OSTROV COUSINE Seyschelly

10

Tento tropický ostrůvek vypadá jako z Robinsona Crusoe a dostanete se sem výhradně helikoptérou. Ostrov přetéká bujnou vegetací, ptactvem a želvstvem, takže je na způsob Rajské zahrady moderního věku.

10 BEST

|

10 NEJ

|

ESTATE | 51


Komorní projekt dvou elegantních viladomů o 10 bytových jednotkách v jedné z nejvyhledávanějších pražských lokalit. Exclusive residential project of two elegant villas featuring 10 apartments, located in one of the most sought-after Prague locations.

INFOSVOBODAWILLIAMS.COM +420 724 551 238


NEJLEPŠÍ NEMOVITOSTI 54

120

146

Prodej Sales

Pronájmy Rentals

Komerční nemovitosti Commercial Properties

SALE

|

PRODEJ

|

ESTATE | 53


Create Your Dream Home

Luxusní byt v Náprstkové ul., Praha 1 – Staré Město Prostorný a světlý byt s vysokými stropy pokrývá celé 2. patro budovy – celkem 278m2. Byt prošel kvalitní a citlivou rekonstrukcí, propojující historické prvky s moderními standardy bydlení, včetně instalace inteligentního systému, nových dubových parket a repasovaných oken s dvojitým sklem. Zbývá jen doplnit poslední detaily dle přání budoucího investora. Byt se nachází jen pár metrů od Betlémského náměstí a pět minut chůze od Karlova mostu. Jedná se o unikátní byt v mimořádně atraktivní a klidné části centra Prahy.

Luxury flat for sale in the Old Town A 5 minute walk from Charles Bridge, this open-planned and carefully restored flat has retained its old world charm. At 278m2, the flat occupies the entire 2nd floor and high ceilings throughout give it a light and luxurious feel. Windows are double-glazed, new oak flooring has been laid and a fully automated intelligent system has been installed. Finishing decisions have been left to the future owner. This is a unique opportunity to create your dream home in the heart of Prague.

Cena/Price: 31 700 000 Kč Kontakt/Contact: Náprstkova9 s.r.o., +420 603 922 660, roman.kacin@gmail.com, www.naprstkova9.cz 62

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


SALE

|

PRODEJ

|

ESTATE | 63


Vila v Cannes, Francouzská riviera

Villa in Cannes, French Riviera

6NYÝO£PRGHUQ¯QHPRYLWRVWY&DQQHVQDFK£]HM¯F¯VHYHVODYQ« REODVWLVSRGQ¯&DOLIRUQLHRUR]OR]HSěLEOLŀQÝPORŀQLF NRXSHOHQ9HOPLNYDOLWQ¯Y\EDYHQ¯3DWLRDYHON¿VNOHS9HON¿ ED]«QΖQȴQLW\3RRO3R]HPHNRUR]OR]HP0RŀQRVW]¯VNDWE\WSURVSU£YFH

0DJQLȴFHQWQHZEXLOWPRGHUQVW\OHSURSHUW\LQ&DQQHVORFDWHGLQWKHIDPRXVDUHDRIWKHORZHU&DOLIRUQLHRIDSSUR[ VTP  EHGURRPV  EDWKURRPV +LJK TXDOLW\ ȴWWLQJV 3DWLR DQGODUJHEDVHPHQWJDUDJHΖQȴQLW\SRRO3ORWRIODQGP 3RVVLELOLW\RIFDUHWDNHUȇVDSDUWPHQW

Prodej |5HIÏ&$1|&HQDQDSRŀ£G£Q¯

Sale |5HI1R&$1| Price on request

3ODWLQLXP5LYLHUD1DG.U£ORYVNRXRERURX3UDKDÎHVN£UHSXEOLNDLYD#SODWLQLXPULYLHUDFRPZZZSODWLQLXPULYLHUDFRP

64

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


%\WÏQHER%\WÏ

$SDUWPHQWRU$SDUWPHQW

1£GKHUQ¿ KLVWRULFN¿ GıP SRVWDYHQ¿ URNX  GRFKRYDQ¿ VW\O V KLVWRULFN¿PL SUYN\ H[WHULHU LQWHULHU QRY¿ Y¿WDKȐ  MH VLWXRY£QXQHMYÝWģ¯KRDQHMNU£VQÝMģ¯KR3UDŀVN«KRSDUNX6WURPRYNDNWHU¿Y\]¿Y£NURGLQQ¿PSURFK£]N£PDVSRUWRYQ¯PX Y\ŀLW¯%\W\MVRXNSURGHMLYHVWDQGDUGXȊUHDG\WRȴQLVKȋDPRŀQRVW¯QRY«PXPDMLWHOLQDE¯GQRXWGRNRQÏHQ¯LQWHULHUXVQDģ¯P GHVLJQHUHP D DUFKLWHNWHP  0RŀQRVW WHUDV\ GR YQLWUREORNX 'ıP MH ]DEH]SHÏHQ PRGHUQ¯P ]DEH]SHÏRYDF¯P V\VW«PHP 9 RNRO¯ MH YHģNHU£ REÏDQVN£ Y\EDYHQRVW 9HONRX Y¿KRGRX MH VNYÝO£GRSUDYQ¯GRVWXSQRVW

%HDXWLIXOKLVWRULFKRXVHEXLOWLQSUHVHUYHGVW\OHKLVWRULFIHDWXUHV H[WHULRULQWHULRUQHZHOHYDWRUȐ LVVLWXDWHGIURQW RI WKH PRVW EHDXWLIXO DQG ELJJHVW 3UDJXH SDUN 6WURPRYND ZKLFKEHFNRQV\RXIRUDIDPLO\ZDON7KLVDSDUWPHQWVDUHIRU VDOHLQWKHVWDQGDUGȊUHDG\WRȴQLVKȋDQGZHR΍HUWRWKHQHZ RZQHUWKHRSSRUWXQLW\WRȴQLVKWKHLQWHULRUZLWKRXUGHVLJQHU DQGDUFKLWHFW3RVVLELOLW\WHUUDFHLQWKHFRXUW\DUG7KHKRXVH LVVHFXUHGE\PHDQVRIDPRGHUQVHFXULW\V\VWHP7KHUHDUH DOOQHFHVVDU\FRPPXQLW\DQGSXEOLFIDFLOLWLHVLQWKHVXUURXQGLQJV$QRWKHUJUHDWDGYDQWDJHLVJUHDWWUDQVSRUWDYDLODELOLW\

3URGHM|E\W|5HI35*|P|.Ï

6DOH|$SDUWPHQW|5HI35*|6T0|&=.

3URGHM|E\W|5HI35*|P|.Ï

6DOH|$SDUWPHQW |5HI35*|6T0|&=.

3ODWLQLXP5LYLHUD1DG.U£ORYVNRXRERURX3UDKDÎHVN£UHSXEOLNDLYD#SODWLQLXPULYLHUDFRPZZZSODWLQLXPULYLHUDFRP

SALE

|

PRODEJ

|

ESTATE | 65


66

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


DEVELOPMENT

VÁŠ DOMOV.

VAŠE TEMPO. VÁŠ ŽIVOT.

Vitality Rezidence I Praha 5 - Hřebenky I 1+kk až 3+kk I 44 – 154 m² Vitality Rezidence představuje příjemné a komfortní bydlení pro dlouhý a bohatý život seniorů, které splní veškerá očekávání měnící se v čase dle individuálních potřeb a přání, bez ohledu na věk a budoucí zdravotní stav. Poskytuje nádherné výhledy, maximální soukromí a bezpečí v klidném prostředí přímo u parku Sacre Coeur a zahrady Kinských v centru Prahy, pár kroků od centra Nový Smíchov. Vitality Rezidence je architektonicky zasazena mezi moderní Rezidencí Sacre Coeur² a parkem stejného jména v jižním svahu, v oblíbené rezidenční čtvrti Na Hřebenkách. Účelně navržené byty s dispozičním uspořádáním 1+kk, 2+kk a 3+kk s balkónem, terasou či předzahrádkou se záhonkovou úpravou jsou umístněné tak, aby byly dostatečně osluněné, poskytovaly krásný výhled a zároveň zachovaly a plně respektovaly soukromí každého rezidenta. Vitality Rezidence nabízí široké spektrum služeb jako je recepce, volnočasové aktivity, služby domácnosti a domácí zdravotní péče. Nad rámec základní nabídky určené všem rezidentům je možné využít i na „míru šité“ balíčky, které jsou zaměřené na zdraví, vitalitu, péči o domov či zcela individuálně je možné sestavit svůj vlastní rozsah osobní péče a poskytovaných služeb. Při volbě nového domova v Rezidenci Vitality budete připraveni na jakoukoli situaci a už se nikdy nemusíte stěhovat. Резиденция Vitality представляет приятное и комфортное жилье для долгой и богатой жизни, которая оправдает все ожидания, меняющиеся со временем в соответствии с индивидуальными потребностями и пожеланиями, независимо от возраста и здоровья в будущем. Она предоставляет наслаждение прекрасными видами, максимальную конфиденциальность и безопасность в спокойной обстановке прямо возле парка Сакре-Кер и сада Кинских в центре Праги, в нескольких шагах от центра Новы Смихов. Резиденция Vitality расположена между современной резиденцией Сакре-Кер 2 и парком с тем же названием на южном склоне, в популярном жилом районе На Гржебенках. Целесообразно спланированные квартиры с планировкой 1 + кухонный уголок, 2 + кухонный уголок и 3 + кухонный уголок с балконом, террасой или палисадником с подготовленными грядками размещены так, чтобы были достаточно освещены солнцем, позволяли наслаждаться прекрасным видом и в то же время сохраняли и в полной мере уважали частную жизнь каждого жителя. Резиденция Vitality предлагает широкий спектр услуг: ПОРТЬЕ и помощь, ФИТНЕС-программы, ПРИГОТОВЛЕНИЕ ПИЩИ для радости, Социальная АКТИВНОСТЬ, Основа заботы о ДОМЕ, Домашнее МЕДИЦИНСКОЕ обслуживание.Сверх рамок базового предложения, предназначенного всем жильцам, можно использовать и специальные пакеты, направленные на здоровье, жизнеспособность, заботу о доме или полностью индивидуально можно составить свой собственный спектр личного обслуживания и предоставляемых услуг.

SALE

|

PRODEJ

|

ESTATE | 67


Luxusní byt na prodej Malá Strana

Luxury apartment for sale Mala Strana

Prodej / Praha 1/ 2+kk / interiér 44 m2 + balkon 4m2

Sale / Prague 1/ 2+kk / interior 44 m2 + balcony 4 m2

Světlý byt je situován ve třetím podlaží krásné neorenesanční rezidence. Dispozičně je byt řešen jako 2+kk. Obývací pokoj je spojený s kuchyňskou linkou a okny orientovanými na západní stranu do klidné ulice. Z ložnice je vstup na balkón s výhledem do upraveného vnitrobloku. Neorenesanční rezidence se nachází v jedné z nejlepších lokalit města – na Malé Straně, na levém břehu Vltavy jen kousek od mostu vedoucího k Národnímu divadlu nebo od novobarokního skvostu – budovy Café Savoy. Klenotem projektu je šeříková zahrada ve vnitrobloku domu – zcela k dispozici všem rezidentům. Zahrada navazuje na tradici původní zahrady z 19. století, která dříve musela ustoupit urbanistickému vývoji.

Luminous apartment for sale on the third floor of Neo-Renaissance residence. The layout of the flat is 1 bedroom. Living room with the kitchen is overlooking to the quiet street and is oriented to the west .The bedroom is facing garden of the project. The Neo-Renaissance residence stands in one of the best locations in the city - in Mala Strana, on the left bank of the Vltava River, just a short walk from the bridge to the National Theater and the Neo-Baroque jewel - the Café Savoy building. The crown jewel of the project is the lilac garden in the interior courtyard of the building - wholly accessible to all residents. The garden continues the tradition of the original garden from the 19th century, which previously had to give way to urban development.

Exkluzivně Cena / Price na vyžádání / on request 68

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


www.ytpi.cz

Luxusní byt na prodej Malá Strana

Luxury apartment for sale Mala Strana

Prodej / Praha 1/ 2+kk / interiér 45 m2

Sale / Prague 1/ 2+kk / interior 45 m2

Světlý byt je situován v druhém podlaží krásné neorenesanční rezidence. Dispozičně je byt řešen jako 2+kk. Prostorný obývací pokoj je spojený s kuchyňskou linkou a okny orientovanými na západní stranu do klidné ulice. Ze světlé ložnice je krásný výhled do klidné ulice. Neorenesanční rezidence se nachází v jedné z nejlepších lokalit města – na Malé Straně, na levém břehu Vltavy jen kousek od mostu vedoucího k Národnímu divadlu nebo od novobarokního skvostu – budovy Café Savoy. Klenotem projektu je šeříková zahrada ve vnitrobloku domu – zcela k dispozici všem rezidentům. Zahrada navazuje na tradici původní zahrady z 19. století, která dříve musela ustoupit urbanistickému vývoji.

Luminious apartment for sale on the second floor of Neo-Renaissance residence. There is 1 bedroom in the apartment. Large living room with the kitchen is overlooking the quiet street and is oriented to the west. There is a beautiful view of the quiet street from the bright bedroom. The Neo-Renaissance residence stands in one of the best locations in the city - in Mala Strana, on the left bank of the Vltava River, just a short walk from the bridge to the National Theater and the Neo-Baroque jewel - the Café Savoy building. The crown jewel of the project is the lilac garden in the interior courtyard of the building - wholly accessible to all residents. The garden continues the tradition of the original garden from the 19th century, which previously had to give way to urban development.

Exkluzivně Cena / Price na vyžádání / on request

Ing. arch. Helena Urbanová

T: +420 224 282 506 info@ytpi.cz SALE

|

PRODEJ

|

ESTATE | 69


Luxusní byt na prodej Nové město

Luxury apartment for sale New Town

Prodej / Praha 1 / 3+kk / interiér 73m2 + balkón 3m2 + terasa 24m2

Sale / Prague 1 / 3+kk / interior 73m2 + balcony 3m2 + terrace 24m2

Luxusní byt na prodej v centru Prahy se nachází v krásném funkcionalistickém domě z první poloviny 20. století s výhledem na Palác Chicago, a pohybující se sochu Jana Kafky od Davida Černého. Luxusně zrekonstruovaný byt o dispozici 3+kk je řešen velmi prakticky s terasou a balkónem. Ložnice a obytný prostor s kuchyní jsou orientovány na západní stranu. Pracovna s východní orientací má krásný kruhový balkón. Dvě mramorové koupelny, jedna s vanou a druhá se sprchovým koutem, jsou přístupné ze vstupní chodby s vestavěnou skříní. Rekonstrukce byla provedena kvalitně za použití drahých materiálů. Lokalita je v samém srdci Prahy 1 a nabízí skvělou občanskou vybavenost. Obchodní centrum hned u domu a mnoho možností kulturního vyžití.

Luxury apartment for sale in the Prague city center in a beautiful building from the first half of the 20th century with a view of Palace Chicago and a moving statue of Jan Kafka by David Černý. The apartment has been reconstructed very tastefully and luxuriously, the layout is 3+kk with a terrace and a balcony. The bedrooms and a living room connected with a kitchen are oriented to the west. A study with a beautiful circle balcony is oriented to the east. From the hallway with a built-in wardrobe you can enter two bathrooms, one with a bath tube, the second one with a shower cubicle. Only the materials of highest quality were used during the reconstuction. Location in the heart of Prague 1 offers excellent public amenities. Shopping center right next to the apartment building and many other cultural activities.

Exkluzivně Cena / Price na vyžádání / on request 70

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


www.ytpi.cz

Byt na prodej na Letné

Apartment for sale at Letná

Prodej / Praha 7/ 1+kk / interiér 39m2 + pavlač 4m2

Sale / Prague 7/ 1+kk / interior 39m2 + gallery 4m2

Nabízíme byt k prodeji v oblíbené lokalitě Prahy 7 na Letenském náměstí, s výbornou dostupností do centra Prahy. Dům je po kvalitní rekonstrukci s výtahem na patře. Výtah je opatřen kódem. Byt je dispozičně řešen jako 1+kk, velká obytná místnost spojená s kuchyňským koutem. Do bytu se vstupuje skrze pavlač, která může být využita jako terasa. Byt je po rekonstrukci cca 5 let, v obytné místnosti je parketová podlaha a kuchyňská linka včetně vestavěných spotřebičů. Dále se vstupuje do koupelny se sprchovým koutem, kde je prostor na pračku a sušičku. Byt se skvěle hodí pro mladý pár na startovací bydlení, či pro lidi s pejskem, jelikož je byt bezbariérový. V pěší dostupnost je veškerá občanská vybavenost - obchody, školy, restaurace. Letenský park i Stromovka jsou vzdálený 250m.

We offer an apartment for sale in an attractive location of Prague 7 – Letenské náměstí, within a good reach to the city center. The apartment building has undergone a thorough reconstruction. The lift is secured with a code and is situated on each floor. The layout of the apartment is 1+kk – big living room connected with a kitchen court. The entrance to the apartment is through a gallery that can be used as a terrace. The apartment underwent reconstruction 5 years ago, there is wooden floor in the living room and built-in kitchen appliances in the kitchen court. There is a shower cubicle in the bathroom and enough space for washing machine and drying machine. The apartment is suitable for young couple or for people with a dog as the apartment is barrier-free. All necessary public amenities within a walking distance – shops, schools, restaurants. Letenský park and Stromovka park are 250m far from the apartment.

Exkluzivně Cena / Price 2.700.000 Kč / CZK

Ing. Michaela Kuglerová

T: +420 224 282 506 info@ytpi.cz SALE

|

PRODEJ

|

ESTATE | 71


1RYÙE\WRYÙSURMHNWYHIXQNFLRQDOLVWLFN—PGRPÐQD1RY—PPÐVWÐ3UDKD 1DE™]™PH OX[XVQ™ E\W\ Y QRYÐ NRPSOHWQÐ UHNRQVWUXRYDQ—P VHGPLSRGOD«Q™P GRPÐ VH VW“ORX UHFHSF™ D SRG]HPQ™PL JDU“«HPL 7HQWRYHONRU\VÙSURMHNWY]QLN“Y«“GDQ—ORNDOLWÐQHGDOHNR.DUORYDQ“PÐVW™nQDSUD«VN—P1RY—PPÐVWÐnMHQS“UPLQXWSШN\ RG9OWDYVN—KRQ“EÖH«™ÎL9“FODYVN—KRQHER6WDURPÐVWVN—KRQ“PÐVW™=“MHPF×PRNYDOLWQ™E\GOHQ™MHNGLVSR]LFLPRGHUQ™FK QDGVWDQGDUGQÐ Y\EDYHQÙFK E\WRYÙFK MHGQRWHN Y GLVSR]LF™FK RG NN D« SR NN V WHUDVDPL .H ND«G—PX E\WX SDW֙ L VNOHS D SRG]HPQ™ SDUNLQJ 3UR Q“URÎQ— MVRX SÖLSUDYHQD GYÐ XVWRXSHQ“ KRUQ™ SDWUD GRPX V RULJLQ“OQ™PL OX[XVQ™PL SURVWRUQÙPL E\W\ VYHONÙPLWHUDVDPLDYÙKOHGHPQDSUD«VN—SDQRUDPD1RYRPÐVWVNRXUDGQLFLD3UD«VNÙKUDG

1HZ5HVLGHQWLDO3URMHFWLQWKH)XQFWLRQDOLVW%XLOGLQJLQDKLVWRULFDO3UDJXH1HZ7RZQ :H DUH GHOLJKWHG WR RIIHU \RX IRU \RXU FKRLFH WKH YDULHW\ RI OX[XU\ DSDUWPHQWV LQ D QHZO\ FRPSOHWHO\ UHFRQVWUXFWHG IORRU 3UDJXHKRXVHZLWKWKHUHFHSWLRQDQGXQGHUJURXQGSDUNLQJ7KLVJHQHURXVKRXVLQJSURMHFWLVORFDWHGLQDGHVLUDEOHORFDWLRQ QHDUWKH&KDUOHV6TXDUH3UDJXH1HZ7RZQnMXVWDIHZPLQXWHVZDONIURPWKH9OWDYDULYHUVLGH:HQFHVODVVTRUIDPRXV2OG 7RZQ6TXDUH)RUWKRVHLQWHUHVWHGLQDKLJKTXDOLW\KRXVLQJWKHUHDUHPRGHUQOX[XULRXVO\HTXLSSHGDSDUWPHQWVDYDLODEOH nIURPNNWRNNZLWKWHUUDFHV(DFKDSDUWPHQWLVFRPSOHWHGZLWKDFHOODUDQGXQGHUJURXQGSDUNLQJ)RUFOLHQWVLQWHUHVWHG LQH[FOXVLYHRIIHUVWKHUHDUHWZRUHFHVVHGXSSHUIORRUVRIWKHKRXVHZLWKVSDFLRXVVPDUWKRPHVW\OHDSDUWPHQWVZLWKODUJH WHUUDFHVRYHUORRNLQJWKHSDQRUDPDRI3UDJXH1HZ7RZQ+DOODQG3UDJXH&DVWOH

&HQ\QDY\«“G“Q™Y5.7KHSULFHVDUHRQUHTXHVWLQRXUUHDOHVWDWHRIILFH /8;(17VUR3DODFN—KR3UDKDn1RY—0ÐVWR_7HO_HPDLOLQIR#OX[HQWF]_ZZZOX[HQWF] 72

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


9ÙMLPHÎQÙYLORYÙSURMHNW$57&/8%35$+$/,3(1&( 3ÖHGVWDYXMHPH]FHODQRYÙGRGHWDLOXSURP\¨OHQÙSURMHNWQ“GKHUQÙFKYLOY3UD]Hn/LSHQF™FK1DFK“]™VHYPDOHEQ—NUDMLQÐSÖHGVRXWRNHP%H URXQN\D9OWDY\S“UPLQXWRGFHQWUD3UDK\DYWÐVQ—PVRXVHGVWY™JROIRY—KRKÖL¨WÐ3UDJXH&LW\*ROI=EUDVODY$UH“O$UWFOXEXWYR֙RMHGLQÐOÙFK YLORGDUFKLWHNW×]HVWXGLDGHIDNWRVPR«QRVW™Q“Y¨WÐY\Y]RURY—YLO\'SRVWDYHQ—UHQRPRYDQÙPÎHVNÙPDUFKLWHNWHP0DUWLQHP6ODGNÙPNWHU“ Y\KU“OD'×PURNX-HGQ“VHRPHQ¨™OX[XVQ™SURMHNWGRSOQÐQÙPRGHUQ™PLXPÐOHFNÙPLG™O\nLGH“OQ™SURŸVSШQ—OLGLVO“VNRXNHNUHDWLYQ™ PXD]GUDY—PX«LYRWX'RP\MVRXYU×]QÙFKSURYHGHQ™FKVRE\WQRXSORFKRXRGGRPDYODVWQ™PLSR]HPN\RGGRP,QWHUL—U\ GRNRQDOHSURSRMXM™«LYRWYGRPÐVH«LYRWHPQD]DKUDGÐ1™]N“HQHUJHWLFN“Q“URÎQRVWMHVDPR]ÖHMPRVW™8ND«G—KRGRPXMHJDU“«SURGYDYR]\ &™OHPSURMHNWXMHY\WYRÖLWNU“VQ—DS֙MHPQ—E\GOHQ™VSRMHQ—VS֙URGRXDXPÐQ™PNWHU—EXGHR]GRERX3UDK\DFKORXERXDSRWШHQ™PND«G—KR NGREXGHYWÐFKWRGRPHFKE\GOHW

([FHSWLRQDO9LOODSURMHFW$57&/8%35$+$/,3(1&( ,QWURGXFLQJDEUDQGQHZGHWDLORULHQWHGFRQFHSWLQ3UDJXHn/LSHQFH7KHSURMHFWLVLQDEHDXWLIXOSURWHFWHGDUHDRIULYHU%HURXQNDDQG9OWDYD IHZPLQXWHVIURPWKHFLW\FHQWHUFORVHWRWKH*ROI&RXUVH3UDJXH&LW\*ROI=EUDVODY7KHFRPSOH[$UW&OXEKDVDUFKLWHFWXUDOO\GLVWLQFWDQG XQLTXHYLOODVGHVLJQHGE\DUFKLWHFWVIURPGHIDNWRVWXGLRZLWKWKHSRVVLELOLW\WRYLHZPRGHOYLOOD'EXLOGE\WKHUHQRZQHG&]HFKDUFKLWHFW0DUWLQ 6ODGNÙ7KHYLOODZRQ+RXVHRIWKH\HDU7KLVLVDVPDOOOX[XU\SURMHFWFRPSOHWHZLWKPRGHUQDUWZRUNnLGHDOIRUVXFFHVVIXOSHRSOHZLWK DORYHRIFUHDWLYHDQGKHDOWK\OLIH7KHKRXVHVDUHLQYDULRXVGHVLJQVZLWKOLYLQJDUHDEHWZHHQVTXDUHPHWHUVDQGRZQODQGIURPWR VTXDUHPHWHUV7KHLQWHULRUVSHUIHFWO\FRPELQHOLYLQJLQDKRXVHZLWKOLIHLQWKHJDUGHQ/RZHQHUJ\FRQVXPSWLRQLVDPXVW(DFKKRXVHKDV DJDUDJHIRUWZRFDUV7KHSURMHFWDLPVWRFUHDWHDEHDXWLIXODQGFRPIRUWDEOHOLYLQJZLWKQDWXUHDQGDUWZKLFKZLOOEH3UDJXHjVGHFRUDWLRQDQG SULGHDQGGHOLJKWIRUDQ\RQHZKROLYHLQWKHVHKRXVHV

9™FHLQIRUPDF™Y5.0RUHLQIRUPDWLRQLQRXUUHDOHVWDWHRIILFH /8;(17VUR3DODFN—KR3UDKDn1RY—0ÐVWR_7HO_HPDLOLQIR#OX[HQWF]_ZZZOX[HQWF] SALE

|

PRODEJ

|

ESTATE | 73


6W\ORY—E\GOHQ™YQRYÙFKS×GQ™FKE\WHFKYEO™]NRVWLFHQWUD3UDK\n$UEHVRYRQ“PÐVW™3UDKD 0RGHUQ™VYÐWO—PH]RQHWRY—E\W\YSUHFL]QÐ]UHNRQVWUXRYDQ—PGRPÐRSOR¨HPDPDGLVSR]LF™FKNNVHVWÖH¨Q™ PL WHUDVDPL D YÙKOHGHP QD 3HW֙Q D 3UD«VNÙ KUDG %\W\ VH QDFK“]HM™ Y OXNUDWLYQ™ ΓVWL SUD«VN—KR 6P™FKRYD Y SÐWLSDWURY—P GRPÐVYÙWDKHPNWHUÙQDE™]™NRPIRUWQ™E\GOHQ™YEO™]NRVWL]HOHQÐ3HW֙QVNÙFKVDG×VHVNYÐORXGRVWXSQRVW™GRX«¨™KRFHQWUD MDNDXWHPWDNPÐVWVNRXGRSUDYRX%\W\PDM™NYDOLWQ™SURYHGHQ™nGXERY—GYRXYUVWY—SRGODK\GHVLJQRY—VFKRGL¨WÐGÖHYÐQ“ ¨SDOHWRY“RNQDNYDOLWQ™VDQLWDDYNRXSHOQ“FKDQDFKRGE“FKNHUDPLFN“GOD«EDVY\W“SÐQ™P.REÐPDE\W×PQ“OH«™VNOHS 9HYQLWUREORNXGRPXMHPDO—GÐWVN—KÖL¨WÐ3“UPLQXWRGUH]LGHQFHMHQ“NXSQ™FHQWUXP1RYÙ6P™FKRYV¨LURNRX¨N“ORXVOX«HE 6NYÐO“REÎDQVN“Y\EDYHQRVWYRNRO™3DUNRY“Q™YHÖHMQ—QHERYRNROQ™FKSRG]HPQ™FKSDUNRYL¨W™FK

6W\OLVKOLYLQJLQDQHZORIWDSDUWPHQWVFORVHWR3UDJXHFHQWHUn$UEHVRYRQ“PÐVW™3UDJXH 0RGHUQ EULJKW GXSOH[ DSDUWPHQWV LQ WKRURXJKO\ UHQRYDWHG KRXVH n IORRU DUHDV LQ UDQJH RI  VTP DQG  VTP GLVSRVLWLRQ RI   NN n ZLWK GLIIHUHQW WHUUDFHV DQG YLHZV RI 3HW֙Q DQG 3UDJXH &DVWOH $SDUWPHQWV DUH ORFDWHG LQ D OXFUDWLYH SDUW RI 6P™FKRY LQ DILYHIORRUEXLOGLQJZLWKDQHOHYDWRUWKDWRIIHUVFRPIRUWDEOHOLYLQJQHDUWKHJUHHQDUHDVRI3HW֙QRUFKDUGVYHU\JRRGDFFHVVWRWKH QDUURZHUFLW\FHQWHUERWKE\FDUDQGSXEOLFWUDQVSRUW$SDUWPHQWVDUHRIDKLJKTXDOLW\ILQLVKnGRXEOHOD\HURDNIORRUVGHVLJQHG VWDLUFDVH ZRRGHQ ZLQGRZV KLJK TXDOLW\ EDWKURRPV ZLWK FHUDPLF WLOHV DQG IORRU KHDWLQJ %RWK IODWV FRPH ZLWK FHOODUV WRR ,Q WKH FRXUW\DUGRIWKHKRXVHWKHUHLVDVPDOONLGVSOD\JURXQG'HVLUHGORFDWLRQIHZPLQXWHVIURPJUHDWSDUNVRU1RYÙ6P™FKRYVKRSSLQJ FHQWHUZLWKDZLGHUDQJHRIVHUYLFHV$OOFLYLFDPHQLWLHVLQWKHDUHD3XEOLFSDUNLQJRUHDV\UHQWLQJRIQHDUE\XQGHUJURXQGJDUDJHV

&HQDQDY\«“G“Q™Y5.7KHSULFHLVRQUHTXHVWLQRXUUHDOHVWDWHRIILFH /8;(17VUR3DODFN—KR3UDKDn1RY—0ÐVWR_7HO_HPDLOLQIR#OX[HQWF]_ZZZOX[HQWF] 74

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


3URGHMH[NOX]LYQ™KRVW\ORY—KRVUXEXPSR]n6WÖHGRÎHVNÙNUDM 1DE™]™PH SURGHM PLPR֓GQ— QHPRYLWRVWL YKRGQ— N UHNUHDFL VW“O—PX E\GOHQ™ QHER SRGQLN“Q™ -HGQ“ VH R VUXE RENORSHQÙ OHV\ DPDOHEQÙPŸGRO™P9QLWÖQ™SURVWRU\MVRXÖH¨HQ\VW\OHPRSHQVSDFHnYHONRU\V“NXFK\QÐVWHUDVRX P QDYD]XM™F™QDM™GHOQ™ΓVW REÙYDF™SURVWRUOR«QLFHVNRXSHOQRXDWHUDVRX P '“OHMH]GHWHFKQLFN—]“]HP™NRWHFSURSV\SURVWRU\SURFKRY“Q™RYF™DNR],QWHUL—U WYR֙SRX]HS֙URGQ™N“PHQGXERY—WHDNRY—VPUNRY—DERURYLFRY—GÖHYR9]DKUDGÐMH]DVWÖH¨HQÙED]—QVHVRO“ULHPOHWQ™NDPHQQÙ DOW“Q V YHQNRYQ™ NXFK\Q™ S֙URGQ™P RKQL¨WÐP D SLQJSRQJHP 'DO¨™ ]DKUDGQ™ VWDYERX MH DWHOL—UJDUVRQL—UD V NRXSHOQRX  P  =DKUDGDMHVS™¨HS֙URGQ™PSDUNHPVPQRKDGUXK\GÖHYLQYÙWYDUQÙPLSUYN\DS֙URGQ™PLGHNRUDFHPL.DPHQQÙ]DVWÖH¨HQÙGY×USRMPH YR]\DSURYR]×YROQ—SDUNRY“Q™

6DOHVRIH[FOXVLYHVW\OLVKKRXVH VTP IRUUHFUHDWLRQRUOLYLQJn&HQWUDO%RKHPLDQ5HJLRQ :HRIIHUDQH[FHSWLRQDOSURSHUW\VXLWDEOHIRUUHFUHDWLRQDVZHOODVIRUKRXVLQJRUEXVLQHVVXQLTXHO\DQGJHQHURXVO\GHVLJQHGODUJH ORJFDELQSHUFKHGLQDZRQGHUIXOO\DUWLVWLFDQGYLVXDOO\UHVROYHGJUHDWODQG7KHFDELQKDVDQDUHDRIVTPGHVLJQHGOLNHDQRSHQ VSDFH7KHWHUUDFHE\WKHNLWFKHQKDVDERXWVTPDQGLVSDUWLDOO\URRIHG7KHEHGURRPLVFRQQHFWHGZLWKWKHWHUUDFHRIDERXWVTP 7KHLQWHULRUFRQVLVWVRQO\RIQDWXUDOVWRQHDQGRDNWHDNVSUXFHDQGSLQHZRRG7KHUHDUHDOVRLQVXODWHGNHQQHOIRUGRJVJDUGHQVWXGLR VSDFHIRUEUHHGLQJDQLPDOVRXWGRRUILUHSODFHHWF7KHJDUGHQLVUDWKHUDQDWXUDOSDUNZLWKWKRXJKWIXOSODFHPHQWRIYDULRXVVSHFLHV RI WUHHV DUWLVWLF HOHPHQWV DQG QDWXUDO GHFRUDWLRQV ZDOOV URFNHULHV DQG QDWXUDO URFNV 6WRQH URRIHG FRXUW\DUG FDQ DFFRPPRGDWH YHKLFOHVDQGDQRWKHUFDQRXWVLGH

&HQDQDY\«“G“Q™Y5.7KHSULFHLVRQUHTXHVWLQRXUUHDOHVWDWHRIILFH /8;(17VUR3DODFN—KR3UDKDn1RY—0ÐVWR_7HO_HPDLOLQIR#OX[HQWF]_ZZZOX[HQWF] SALE

|

PRODEJ

|

ESTATE | 75


3URGHMSUYRUHSXEOLNRY—YLO\VED]—QHPQDH[NOX]LYQ™PSR]HPNXRYÙPÐÖHPn3\¨HO\ 1DE™]™PHSURGHMGYRXSRGOD«Q™URGLQQ—YLO\NUHNRQVWUXNFLQDXQLN“WQ™PUR]OHKO—PSR]HPNXPR]DVWDYÐQ—SOR¨HP DX«SOR¨HP9S֙]HP™MHREÙYDF™SRNRMVH]LPQ™]DKUDGRXSRNRMSURKRVW\VRFL“OQ™]D֙]HQ™DNXFK\Ô]HNWHU—MHYVWXS QDWHUDVXVYHQNRYQ™PJULOHP9SDWÖHMVRXWÖLOR«QLFHDKODYQ™NRXSHOQD9HVNOHSQ™FKSURVWRUHFKMHNRWHOQDSO\QÎHUSDGORSUR VWXGQXSU“GHOQDVNO™SHNDGDO¨™YROQ—SURVWRU\9H¨NHU—]PÐQ\DŸSUDY\VHRGYLQRXRGSRWÖHEEXGRXF™FKPDMLWHO×1DSR]HPNX MHG“OHED]—Q ÄP GYÐVWXGQ\]DKUDGQ™GRPHNVY\EDYHQRXJDUVRQL—URXDNU“VQÙGÖHYÐQÙVUXE2]GRERXYLO\MHQ“GKHUQ“ UR]OHKO“]DKUDGDVSDUNRYRXŸSUDYRXDY]URVWOÙPLVWURP\=DYHGHQ\MVRXY¨HFKQ\LQ«HQÙUVN—V™WÐORNDOLWDP“YH¨NHURX29

6DOHRIWKH)LUVW5HSXEOLFYLOODZLWKDVZLPPLQJSRROLQWKHH[FOXVLYHODQGDUHDRIVTPn3\¨HO\ :HDUHGHOLJKWHGWRRIIHUIRUVDOHDWZRVWRUH\GHWDFKHGKRXVHIRUUHFRQVWUXFWLRQRIWKHXQLTXHODUJHSORWVTPRIEXLOWXS DUHDRIVTPDQGXVDEOHDUHDRIVTP7KHJURXQGIORRUKDVDOLYLQJURRPZLWKDZLQWHUJDUGHQJXHVWURRPEDWKURRPDQG NLWFKHQIURPZKLFKLWLVH[LWWRWKHWHUUDFHZLWKDRXWGRRUEDUEHFXH8SVWDLUVDUHWKUHHEHGURRPVDQGDPDVWHUEDWKURRP,QWKH EDVHPHQWLVDJDVERLOHUSXPSIRUZHOOODXQGU\FHOODUDQGRWKHUIUHHVSDFH$Q\FKDQJHVRUPRGLILFDWLRQVZLOOIROORZWKHQHHGVRI IXWXUHRZQHUV7KHSORWKDVDOVRDVZLPPLQJSRRO ÄPHWHUV WZRZHOOVJDUGHQKRXVHZLWKDVWXGLRIODWDQGDQLFHORJFDELQ $GRUQPHQWRIWKLVYLOODLVDEHDXWLIXOODUJHODQGVFDSHGJDUGHQZLWKWDOOWUHHV$OOXWLOLWLHVDUHDYDLODEOHKDELWDWKDVDOOWKHDPHQLWLHV

&HQDQDY\«“G“Q™Y5.7KHSULFHLVRQUHTXHVWLQRXUUHDOHVWDWHRIILFH /8;(17VUR3DODFN—KR3UDKDn1RY—0ÐVWR_7HO_HPDLOLQIR#OX[HQWF]_ZZZOX[HQWF] 76

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


VILA BARRANDOV .U£VQ£YLODQDOHJHQG£UQ¯P%DUUDQGRYÝV¼ŀDVQ¿PLY¿KOHG\QD9OWDYXD9\ģHKUDG'ıPSURģHOFLWOLYRXDGıNODGQRXUHNRQVWUXNF¯ VGıUD]HPQD]DÏOHQÝQ¯GRRNROQ¯DUFKLWHNWXU\9LODVSOĊXMHLY\VRN«SRŀDGDYN\MDNRUHSUH]HQWDWLYQ¯V¯GORͤUP\ÏLYHOY\VODQHFWY¯ &HO£ YLOD MH QHREY\NOH YNXVQÝ Y\EDYHQ£ D ]Dě¯]HQ£ GHVLJQRY« SUYN\ QHMNYDOLWQÝMģ¯ PDWHUL£O\ D NU£VQÝ ]Dě¯]HQ« NRXSHOQ\ PLOH SěHNYDS¯NDŀG«KR]£MHPFH7DWRMHGLQHÏQ£ORNDOLWDQDE¯]¯ERKDWRXKLVWRULLDVODYQ«VRXVHG\ %HDXWLIXOYLOODRQWKHOHJHQGDU\%DUUDQGRYZLWKDPD]LQJYLHZVRIWKH9OWDYDDQG9\ģHKUDG7KHKRXVHZHQWWKURXJKDFDUHIXO DQGFRPSOHWHUHFRQVWUXFWLRQZLWKDQHPSKDVLVRQLQWHJUDWLRQZLWKWKHVXUURXQGLQJDUFKLWHFWXUH7KHYLOODDOVRPHHWVWKHKLJK UHTXLUHPHQWVDVDUHSUHVHQWDWLYHRͦFHRUHPEDVV\7KHZKROHYLOODLVWDVWHIXOO\IXUQLVKHGDQGXQXVXDOO\GHFRUDWHGGHVLJQHOH PHQWVTXDOLW\PDWHULDOVDQGEHDXWLIXOO\DSSRLQWHGEDWKURRPVSOHDVDQWO\VXUSULVHHYHU\RQH7KLVXQLTXHORFDWLRQRIIHUVDULFK KLVWRU\DQGIDPRXVQHLJKERUV

ǡǡ-Ȭ 9LNWRULD'XGRY£YLNWRULDGXGRYD#SURIHVVLRQDOVF] 3URIHVVLRQDOV9&HOQLFL3UDKD SALE

|

PRODEJ

|

ESTATE | 77


%WPVQPEMByOÇSPEJOO»WJMBTF[BISBEPV Prodej · Praha 4 · 5+1 · 284 m2ā.þ 'YRXSRGODåQtURGLQQiYLODVH]DKUDGRXNU\WêPED]pQHPDVDXQRXVHQDFKi]tYUHSUH]HQWDWLYQtUH]LGHQþQtþWYUWL+UQþtĜH9LODMHGLVSR]LþQČĜHãHQD WDNDE\Y\KRYČODSRWĜHEiPURGLQQpKRE\GOHQt5R]OHKOêREêYDFtSRNRMMH Y\EDYHQNUEHPVUR]YRG\WHSODDSĜtPêPYVWXSHPGR]DKUDG\VDOWiQHP D SRVH]HQtP 'ĤP MH ]DEH]SHþHQ VWDKRYDFtPL UROHWDPL QHSUĤVWĜHOQêPL VNO\DRFKUDQNRX

5XPTUPSFZWJMMBXJUIHBSEFO Sale · Prague 4 · 5+1 · 284 m2 · 20 450 000 CZK 7KLVWZRVWRUH\YLOODZLWKJDUGHQLQGRRUVZLPPLQJSRRODQGVDXQDLV ORFDWHGLQWKHUHSUHVHQWDWLYHUHVLGHQWLDO3UDJXHGLVWULFWRI+UQþtĜH7KH YLOODLVGHVLJQHGWRPHHWWKHQHHGVRIIDPLO\KRXVLQJ7KHVSDFLRXVOLYLQJ URRPKDVD¿UHSODFHDQGGLUHFWDFFHVVWRWKHJDUGHQZKLFKLQFOXGHVD VXPPHUKRXVH DQG EDUEHFXH DUHD7KH KRXVH LV VHFXUHG E\ UHWUDFWDEOH EOLQGVEXOOHWSURRIJODVVDQGVHFXULW\SHUVRQQHO

(QJHO 9|ONHUVā$QGČO3UDJXH:HVW +420 233 091 011 -DQiþNRYRQiEĜHåt3UDKD 3UDJXH$QGHO#HQJHOYRHONHUVFRP ZZZHQJHOYRHONHUVFRPDQGHOSUDJXHZHVW


1SWPSFQVCMJLPW»WJMBTF[BISBEPV Prodej · Praha 6 · 6+2 · 362 m2ā.þ 3UYRUHSXEOLNRYiYLOD]URNXVHQDFKi]tYH[NOX]LYQtþiVWL%XEHQþH QHGDOHNR6WURPRYN\7DWRWĜtSRGODåQtYLODSURãODUHNRQVWUXNFtYURFH DYVRXþDVQpGREČGLVSRQXMHGYČPDWHUDVDPLEDONRQHPYQLWĜQtPED]pQHP VHVDXQRXY]URVWORX]DKUDGRXDJDUiåtSURGYČDXWD9SĜt]HPtVHQDFKi]t VDPRVWDWQiE\WRYiMHGQRWNDYSRGNURYtQHY\XåLWêSĤGQtSURVWRU9]KOHGHP NHVYpSROR]HYMHGQp]QHMOXNUDWLYQČMãtFKYLORYêFKþWYUWtDYêERUQpGRVWXSQRVWL/HWLãWČ9iFODYD+DYODYLODQDEt]tNRPIRUWQtE\GOHQtYSUHVWLåQt ORNDOLWČVWHMQČMDNRPRåQRVWY\EXGRYiQtVtGOD VSROHþQRVWLþLDPEDViG\

)JTUPSJDBMWJMMBGSPN Sale · Prague 6 · 6+2 · 362 m2 · 43 000 000 CZK 7KLV KLVWRULFDO YLOOD EXLOW LQ  LV ORFDWHG LQ WKH H[FOXVLYH 3UDJXH GLVWULFW RI %XEHQHþ QHDU 6WURPRYND 3DUN 7KH WKUHHVWRUH\ YLOOD ZDV UHFRQVWUXFWHG LQ  DQG FXUUHQWO\ KDV WZR WHUUDFHV D EDOFRQ\ DQ LQGRRUVZLPPLQJSRROZLWKVDXQDDPDWXUHJDUGHQDQGWZRFDUJDUDJH 7KHJURXQGÀRRURIIHUVDVHSDUDWHDSDUWPHQWXQLWDQGWKHDWWLFFXUUHQWO\ KDVXQXVHGIUHHVSDFH'XHWRLWVORFDWLRQLQRQHRIWKHPRVWOXFUDWLYH UHVLGHQWLDO DUHDV ZLWK H[FHOOHQW DFFHVV WR 9iFODY +DYHO $LUSRUW WKLV YLOOD RIIHUV FRPIRUWDEOH OLYLQJ LQ D SUHVWLJLRXV ORFDWLRQ DV ZHOO DV WKH SRVVLELOLW\RIEXLOGLQJDFRPSDQ\KHDGTXDUWHUVRUWKHVHDWRIDQHPEDVV\

(QJHO 9|ONHUVā$QGČO3UDJXH:HVW +420 233 091 011 -DQiþNRYRQiEĜHåt3UDKD 3UDJXH$QGHO#HQJHOYRHONHUVFRP ZZZHQJHOYRHONHUVFRPDQGHOSUDJXHZHVW


#ZUQSPNJMPWOÇLZ4UBSÃIP.õTUB Prodej · Praha 1 · 2+kk · 50 m2ā.þ 6YČWOêE\WVHQDFKi]tYH13þLQåRYQtKRGRPXSRNRPSOHWQtUHNRQVWUXNFL SĜL NWHUp E\O NODGHQ GĤUD] QD ]DFKRYiQt SĤYRGQtFK SUYNĤ 3ĜtMHPQi DWPRVIpUDE\WXMHSRGSRĜHQDVW\ORYêPRVYČWOHQtPUHSDVRYDQêPLRNQ\ GĜHYČQêPLSDUNHWDPLDY\EDYHQtP%\WVHQDFKi]tYVUGFL6WDUpKR0ČVWD DMHWDNNOHQRWHPSURW\NWHĜtPLOXMtKLVWRULFNRX3UDKX

"QBSUNFOUGPSUIFMPWFSTPG0ME5PXO Sale · Prague 1 · 2+kt · 50 m2 · 6 500 000 CZK 7KLVEULJKWDSDUWPHQWORFDWHGRQWKHVWÀRRURIDQDSDUWPHQWEXLOGLQJ LV DIWHU FRPSOHWH UHFRQVWUXFWLRQ ZLWK DQ HPSKDVLV RQ SUHVHUYLQJ WKH RULJLQDO IHDWXUHV 7KH SOHDVDQW DWPRVSKHUH RI WKH DSDUWPHQW LV HQKDQFHGE\VW\OLVKOLJKWLQJUHIXUELVKHGZLQGRZVZRRGHQÀRRULQJDQG IXUQLVKLQJV7KHDSDUWPHQWLVORFDWHGLQWKHKHDUWRIWKH2OG7RZQDQGLV DMHZHOIRUWKRVHZKRORYHKLVWRULFDO3UDJXH

(QJHO 9|ONHUVā$QGČO3UDJXH:HVW +420 233 091 011 -DQiþNRYRQiEĜHåt3UDKD 3UDJXH$QGHO#HQJHOYRHONHUVFRP ZZZHQJHOYRHONHUVFRPDQGHOSUDJXHZHVW


#ZUWIJTUPSJDLÃNçJOyPWOÇNEPNõ OB/PWÃN.õTUõ Prodej · Praha 1 · 2+kk · 44,6 m2ā.þ ÒWXOQêE\WYNUiVQpPþLQåRYQtPGRPČSRUHNRQVWUXNFLVYêWDKHPVHQDFKi]tYFHQWUiOQtREODVWL1RYpKR0ČVWD9E\WČMVRX]DFKRYiQ\SĤYRGQt UHQRYRYDQpSDUNHW\DGĜHYČQiRNQD'tN\VYpORNDOLWČE\WQDEt]tXQLNiWQt PRåQRVWLQYHVWLFHGRQHPRYLWRVWLYFHQWUX3UDK\QHGDOHNR.DUORYDD9iF ODYVNpKR QiPČVWt RGNXG MH WDNp Y\QLNDMtFt GRSUDYQt VSRMHQt GR GDOãtFK KLVWRULFNêFKþiVWt3UDK\YþHWQČYHãNHUpREþDQVNpY\EDYHQRVWL

"QBSUNFOUJOIJTUPSJDBMBQBSUNFOUCVJMEJOH TJUVBUFEJOUIF/FX5PXO Sale · Prague 1 · 2+kt · 44,6 m2 · 4 800 000 CZK 7KLV FRV\ DSDUWPHQW LV VLWXDWHG LQ D EHDXWLIXO DSDUWPHQW EXLOGLQJ DIWHU UHFRQVWUXFWLRQ ZLWK HOHYDWRU ORFDWHG LQ WKH FHQWUDO DUHD RI WKH 1HZ 7RZQ 7KH DSDUWPHQW KDV WKH RULJLQDO UHIXUELVKHG SDUTXHW DQG ZRRGHQZLQGRZV7KDQNVWRLWVORFDWLRQWKHDSDUWPHQWRIIHUVDXQLTXH RSSRUWXQLW\WRLQYHVWLQUHDOHVWDWHLQWKHFHQWUHRI3UDJXHQHDU&KDUOHV 6TXDUH DQG :HQFHVODV 6TXDUH ZKHUH WKHUH DUH DOO DPHQLWLHV DQG H[FHOOHQWWUDQVSRUWFRQQHFWLRQVWRRWKHUKLVWRULFDOSDUWVRI3UDJXH

(QJHO 9|ONHUVā$QGČO3UDJXH:HVW +420 233 091 011 -DQiþNRYRQiEĜHåt3UDKD 3UDJXH$QGHO#HQJHOYRHONHUVFRP ZZZHQJHOYRHONHUVFRPDQGHOSUDJXHZHVW


1SPTUPSO×NF[POFUPW×CZUOB#ıFWOPWõ Prodej · Praha 6 · 5+kk · 173 m2ā.þ 7HQWRNRX]HOQêSURVWRUQêPH]RQHWVHQDFKi]tYHD13VW\ORYpQRYRVWDYE\]URNX%\WGLVSRQXMHGĜHYČQêPLHXURRNQ\GĜHYČQRXSRGODKRX Y\EDYHQRX NXFK\ĖVNRX OLQNRX GYČPD NRXSHOQDPL D NOLPDWL]DFt YHGYRXPtVWQRVWHFK%\WMHVLWXRYiQYNOLGQpORNDOLWČQHGDOHNRFHQWUD 3UDK\VYHãNHURXREþDQVNRXY\EDYHQRVWtDMHWDNSĜtMHPQêPPtVWHPSUR URGLQQpE\GOHQt

4QBDJPVTEVQMFYBQBSUNFOUJO#ıFWOPW Sale · Prague 6 · 5+kt · 173 m2 · 14 500 000 CZK 7KLV FKDUPLQJ VSDFLRXV GXSOH[ DSDUWPHQW LV ORFDWHG RQ WKH VW DQG QG ÀRRU RI D VW\OLVK QHZ EXLOGLQJ IURP  7KH DSDUWPHQW KDV ZRRGHQ ZLQGRZVZRRGHQÀRRUVIXOO\HTXLSSHGNLWFKHQWZREDWKURRPVDQGDLU FRQGLWLRQLQJLQWZRURRPV7KHDSDUWPHQWLVVLWXDWHGLQDTXLHWORFDWLRQ QHDUWKHFLW\FHQWUHZLWKDOODPHQLWLHVDQGLVWKHSHUIHFWSODFHIRUIDPLO\ KRXVLQJ

(QJHO 9|ONHUVā$QGČO3UDJXH:HVW +420 233 091 011 -DQiþNRYRQiEĜHåt3UDKD 3UDJXH$QGHO#HQJHOYRHONHUVFRP ZZZHQJHOYRHONHUVFRPDQGHOSUDJXHZHVW


SALE

|

PRODEJ

|

ESTATE | 83


Prodej | Praha-východ | Kamenice | 400 m2 | pozemek 4 151 m2 |FHQDQDY\çiGiQt ,PSR]DQWQtURGLQQiYLODVQHRSDNRYDWHOQRXURPDQWLFNRXDWPRVIpURXVHQDFKi]tQDUR]OHKOpPĀiVWHĀQę]DOHVQęQpPSR]HPNXVHOHWVWDURX RSHĀRYiYDQRX]DKUDGRX'ģPVWRMtYWLFKpP]iNRXWt7ęSWtQDPLQXWMt]G\RGREFH.DPHQLFHVYHåNHURXREĀDQVNRXY\EDYHQRVWtSĨtPRQDYD]XMtFt QDVi]DYVNpOHV\-LçQęRULHQWRYDQi]LPQt]DKUDGDVSRMHQiVH[WHULpUHPDREìYDFtPSRNRMHPNXFK\ĞORçQLFHNRXSHOQ\UHOD[DĀQtPtVWQRVWVH YVWXSHPGRVDXQ\åDWQ\SUiGHOQDVDPRVWDWQpWRDOHW\WHFKQLFNiPtVWQRVWNRPRUDWHUDV\JDUiçSURDXWRPRELO\VSĨtPìPYVWXSHPGR GRPX9\EDYHQt]DKUQXMHGĨHYęQpSRGODK\]NDQDGVNpWĨHåQęDGODçEXYHVWDYęQìQiE\WHNY\UREHQìQDPtUXGRVWDWHN~ORçQìFKSURVWRUY\WiSęQt SO\QRYìPNRWOHP(=6YĀHWQęODVHURYpKR]DEH]SHĀHQtSR]HPNX]DKUDGQtDOWiQ)DViGD]SiOHQìFKFLKHO]$QJOLH3ĨtMHPQpSURVWĨHGtVi]DYVNìFK OHVģVHVQDGQRXGRVWXSQRVWtGR3UDK\PLQXWRGQiMH]GXQDGiOQLFL'

Pro kompletní nabídku navštivte / For complete property listing please visit

84

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

svoboda-williams.com


Sale | Praha-východ | Kamenice | 400 m2 | plot 4 151 m2 | price upon request Boasting a unique romantic atmosphere, this impressive family villa is situated on a large, partially forested plot with a carefully well-tended garden. The house is located in a quiet, private area of Tìptín, just a five-minute drive from the village of Kamenice where you can find all amenities. The area is directly linked to the Sázava forests. South-facing conservatory connected both to the exterior and to the spacious living room, kitchen, 4 bedrooms, 2 bathrooms, relaxation room with sauna, 2 walk-in closets, laundry, 2 separate toilets, utility room, storage room, 3 terraces, garage for 2 cars with direct access to the house. Amenities include quality Canadian cherry wood floors and tiles, built-in custom-made furniture, storage space, gas boiler, ESS including laser security system, garden gazebo. Facade consists of clay bricks from England. Pleasant area of the Sázava forests within easy reach of the city, just a 15-minute drive to the D1 motorway.

Svoboda & Williams, Na Perštýnì 2, 110 00, Praha 1, tel. 257 328 281, info@svoboda-williams.com

SALE

|

PRODEJ

|

ESTATE | 85


Prodej | Praha 1 | Nové Mìsto | 2 720 m2 |FHQDQDY\çiGiQt ÿLQçRYQtGģPE\WģDNRPHUĀQtSURVWRU\QDGVWDQGDUGQtFKSDUNRYDFtFKVWiQtNODVLFLVWQtIDViGDY\VRNpVWURS\QDGVWDQGDUGQt Y\EDYHQtMHGQRWHNNOLGQiXOLFHYFHQWUiOQtORNDOLWęEOt]NRQiPęVWt5HSXEOLN\YSęåtPGRVDKX6WDURPęVWVNpKRD9iFODYVNpKRQiPęVWt ÿLQçRYQtGģPSURFKi]HMtFtNRPSOHWQtFLWOLYRXUHNRQVWUXNFtYĀHWQęY\EXGRYiQtQiVWDYE\GRGDWHĀQpKRSRGODçtQDEt]HQìYHVWDYX NRPSOHWQtKRGRNRQĀHQtIRUPRXRGNXSXSRGtOXDNFLRYpVSROHĀQRVWL $SDUWPHQWEXLOGLQJIODWVFRPPHUFLDOSUHPLVHVVXSHULRUVL]HGSDUNLQJVSDFHV&ODVVLFDOIDFDGHKLJKFHLOLQJVTXDOLW\VWDQGDUG TXLHWVWUHHWLQDFHQWUDOORFDWLRQQHDUQiPęVWt5HSXEOLN\VTXDUHZLWKLQZDONLQJGLVWDQFHRI6WDURPęVWVNpRU9iFODYVNpVTXDUHV $SDUWPHQWEXLOGLQJXQGHUJRLQJDWKRURXJKVHQVLWLYHUHFRQVWUXFWLRQLQFOXGLQJFRQVWUXFWLRQRIDQDGGLWLRQDOWKIORRURIIHUHGLQDVWDWHRI ILQDOFRPSOHWLRQDQGDYDLODEOHIRUSXUFKDVHDVVKDUHVRIDMRLQWVWRFNFRPSDQ\

Pro kompletní nabídku navštivte / For complete property listing please visit

86

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

svoboda-williams.com


Prodej | Praha 1 | Josefov | 137 m2 | 19 900 000 Kรจ %\WURPDQWLFNpYรฌKOHG\QD6WDUรฌรงLGRYVNรฌKฤจELWRYIXQNฤ€QtNDFKORYiNDPQDUHSDVRYDQpGฤจHYฤ™QpSDUNHW\QRYiรฅSDOHWRYiRNQD VNOHS-LรงQฤ™RULHQWRYDQรฌURKRYรฌE\WYH]YรฌรฅHQpPSฤจt]HPtNRPSOHWQฤ™]UHQRYRYDQpKRฤ€LQรงRYQtKRGRPXVQRYรฌPYรฌWDKHPYDWUDNWLYQtORNDOLWฤ™ KLVWRULFNpฤ€iVWL3UDK\-RVHIRYYVRXVHGVWYt3DฤจtรงVNpXOLFHDMHQSiUNURNฤฃRG6WDURPฤ™VWVNpKRQiPฤ™VWt3ฤจtMHP]SURQiMPXQHE\WRYรฌFK SURVWRUYGRPฤ™SRNU\MHPฤ™Vtฤ€QtSRSODWN\QDE\W EHGURRPDSDUWPHQWZLWKYLHZVRIWKH2OG-HZLVK&HPHWHU\IXQFWLRQDOWLOHVWRYHVUHIXUELVKHGZRRGHQSDUTXHWIORRULQJQHZFDVHPHQW ZLQGRZVFHOODU6RXWKIDFLQJFRUQHUDSDUWPHQWVLWXDWHGRQWKHXSSHUJURXQGIORRURIDFRPSOHWHO\UHQRYDWHGEXLOGLQJZLWKDQHZOLIW$Q DWWUDFWLYHKLVWRULFDODUHDRI-RVHIRY3UDJXHLQWKHQHLJKERUKRRGRI3DฤจtรงVNi6WUHHWDQGMXVWDIHZVWHSVIURP2OG7RZQ6TXDUH,QFRPH IURPFRPPHUFLDOVSDFHLQWKHKRXVHFRYHUVPRQWKO\IODWIHHV

Na Perลกtรฝnรฌ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

SALE

|

PRODEJ

|

ESTATE | 87


Prodej | Praha 5 | Hluboèepy | 876 m2 | pozemek 2 136 m2 |FHQDQDY\çiGiQt $UFKLWHNWRQLFN\YìMLPHĀQiYLODSRVWDYHQiGOHQiYUKXUHQRPRYDQpKRDUFKLWHNWD-RKQD(LVOHUDMH]DVD]HQiY]HOHQpPVYDKXQDRNUDMLYLORYp]iVWDYE\ %DUUDQGRYD3ĨHGQRVWtGRPXMVRX]HMPpQDMHGLQHĀQpYìKOHG\GR3URNRSVNpKR~GROtDQDPęVWRVYęWRYìGHVLJQDYHONRU\VpĨHåHQtGLVSR]LF WHUDV\URKRYìREìYDFtSRNRMVSURVNOHQìPLVWęQDPLNXFK\ĞVMtGHOQRXSURVNOHQiSUDFRYQDORçQLFHNRXSHOQ\VWXGLRSURKRVW\UHOD[DĀQt]yQD VSĨtSUDYRXSURILWQHVVDED]pQJDUiçSURDXWRPRELO\2VREQtYìWDKSĨtMHPQpYìKOHG\GRRNROt9LODMHQDEt]HQDYHVWDYXKUXEpVWDYE\VNRPSOHWQt SURMHNWRYRXGRNXPHQWDFtDSODWQìPVWDYHEQtPSRYROHQtPDVNìWiWDNSĨtOHçLWRVWGRNRQĀLWLQWHULpUYHVWDQGDUGXGOHYODVWQtFKSĨHGVWDY-RKQ(LVOHU MHYì]QDPQìPDUFKLWHNWHPFHORVYęWRYpKRIRUPiWXDXWRUHPDUFKLWHNWRQLFNpKRQiYUKXĨtPVNpKR&KXUFKRIWKH-XELOHH0XVHRGHOO·$UD3DFLV a dalších význaèných staveb.

Pro kompletní nabídku navštivte / For complete property listing please visit

88

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

svoboda-williams.com


Sale | Praha 5 | Hluboèepy | 876 m2 | plot 2 136 m2 | price upon request Architecturally unique villa designed by the renowned architect John Eisler, set into a green hillside in the suburbian villa area of Barrandov. Advantages of the house are particularly the unique views of Prokopské údolí valley and the whole city, its timeless design and generous disposition. 2 terraces, corner living room with large format windows, kitchen with dining room, glass study, 3 bedroom, 2 bathrooms, studio for guests, relaxation area with fitness and preparation for an indoor swimming pool, garage for 3 cars. Lift, pleasant views of the green surroundings. Villa is in the state of rough construction, with complete project documentation and valid building permit. Future owner will thus have the opportunity to finish it in a standard of their liking. John Eisler is a reputable architect whose work includes Church of the Jubilee and the Museo dell’Ara Pacis in Rome and other distinguished buildings.

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

SALE

|

PRODEJ

|

ESTATE | 89


Prodej | Praha 1 | 3DĨtçVNi | 273 m2 |FHQDQDY\çiGiQt %\WNOLPDWL]DFH]iSDGQtRULHQWDFHGR3DĨtçVNpXOLFHPRçQRVWY\WYRĨHQtEDONRQXĀLWHUDV\QDPtUXY\UREHQiNXFK\Qę/HLFKWVH VSRWĨHELĀL.SSHUVEXVFKSRGODK\]MDYRURYìFKSUNHQGĨHYęQiRNQDVFKRGLåWęDREORçHQtUR]YRG\SURDXGLRV\VWHPDWHOHIRQ0H]RQHWRYì E\WYDSDWĨHĀLQçRYQtKRGRPXVYìWDKHPYQHMSUHVWLçQęMåtĀiVWLKLVWRULFNpKRFHQWUD3UDK\PLQXWFKģ]HRG6WDURPęVWVNpKR QiPęVWtVWDQLFHPHWUDĀLQiEĨHçt9OWDY\ EHGURRPDSDUWPHQWDLUFRQGLWLRQLQJZHVWRULHQWDWLRQWR3DĨtçVNi6WUHHWSRVVLELOLW\RIFUHDWLQJDEDOFRQ\RUWHUUDFHFXVWRPPDGH /HLFKWNLWFKHQZLWK.SSHUVEXVFKDSSOLDQFHVPDSOHIORRUERDUGVZRRGZLQGRZVVWDLUFDVHDQGSDQHOOLQJZLULQJIRUDXGLRV\VWHPDQG KRPHSKRQH6SOLWOHYHODWWLFIODWRQWKHth and 6thIORRUVRIDQDSDUWPHQWEXLOGLQJZLWKDQHOHYDWRULQWKHPRVWSUHVWLJLRXVSDUWRIWKH KLVWRULFDOFHQWHURI3UDJXHMXVWDPLQXWHZDONIURP2OG7RZQ6TXDUHWKH0HWURDQGWKH9OWDYD5LYHU

Pro kompletní nabídku navštivte / For complete property listing please visit

90

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

svoboda-williams.com


Prodej | Praha 1 | NovÊ MÏsto | 78 m2 | 8 800 000 Kè %\WNNGXERYpSDUNHW\QRYiüSDOHWRYiRNQDQDPtUXY\UREHQiNXFK\ĞVHVSRWĨHELĀL6LHPHQVD(OHFWUROX[NRXSHOQDVGHüĢRYRXVSUFKRX UR]YRG\SURDXGLRV\VWpPEH]SHĀQRVWQtYVWXSQtGYHĨHVNOHSYHüNHUpY\EDYHQtYFHQę-LçQęRULHQWRYDQÏNRPSOHWQę]UHNRQVWUXRYDQÏE\W YHSDWĨHĀLQçRYQtKRGRPXVYÏWDKHPYHY\KOHGiYDQpORNDOLWęSiUNURNģRGQiEĨHçt9OWDY\VWDQLFHPHWUDQDQiPęVWt5HSXEOLN\QHER /HWHQVNÏFKVDGģ 1-bedroom apartment, oak parquet flooring, new casement windows, custom-made kitchen with Siemens and Electrolux appliances, bathroom with rain shower, wiring for audio system, security entry door, cellar, all equipment included in the purchase price. South oriented, fully renovated apartment on the 3rd floor of an apartment building with elevator in a popular location, just a few steps from the ULYHUEDQNPHWURVWDWLRQDWQiPęVWt5HSXEOLN\VTXDUHDQG/HWHQVNpVDG\SDUN

Na PerťtýnÏ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

SALE

|

PRODEJ

|

ESTATE | 91


Prodej | Praha 5 | Hluboèepy | 244 + 145 m2 | FHQDQDY\çiGiQt| price upon request %\WWHUDVD]DKUDGD~FKYDWQpYÏKOHG\QDYOWDYVNp~GROtSURVNOHQpVWęQ\GYRMLWiYÏüNDVWURSXJDUiçRYiDYHQNRYQtSDUNRYDFtVWiQt 3URVWRUQÏPH]RQHWRYÏE\WORIWRYpKRW\SXYSĨt]HPtDSDWĨHQRYpKRIXQNFLRQDOLVWLFN\ODGęQpKRYLODGRPXRE\WRYÏFKMHGQRWNiFKQDY\YÏüHQpP PtVWęYSģYRGQtSUYRUHSXEOLNRYpYLORYp]iVWDYEę%DUUDQGRYD2MHGLQęOÏSURMHNWVYÏKRGQRXSRORKRXYNOLGQpMHGQRVPęUQpXOLFLSOQp]HOHQęSĨtPR QDYD]XMtFtQD]DOHVQęQRXSORFKX&KXFKHOVNpKRKiMH9tFHLQIRUPDFtQDZZZEDUUDQGRYVNDF] EHGURRPDSDUWPHQWWHUUDFHJDUGHQVWXQQLQJYLHZVRIWKH9OWDYD5LYHUYDOOH\JODVVZDOOVGRXEOHKHLJKWFHLOLQJJDUDJHDQGRXWGRRU parking spaces. Spacious loft apartment on the ground and 1st floors of a new Functionalist style villa with a total of only 3 flats, located on a hill in the unique 1930`s residential area of Barrandov. This special project emerged on a quiet one-way street full of greenery, bordering WKH&KXFKHOVNÏKiMJURYH)RUPRUHLQIRUPDWLRQVHHZZZEDUUDQGRYVNDF]

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

92

|

ESTATE

|

NEJLEPĹ Ă? NEMOVITOSTI

|

BEST PROPERTIES

svoboda-williams.com


Prodej | Praha 1 | Novรฉ Mรฌsto | 206 + 41 m2 | FHQDQDY\รงiGiQt %\WWHUDVDVYรฌKOHGHPQD3UDรงVNรฌKUDGRULHQWDFHRE\WQรฌFKPtVWQRVWtQD]iSDGVPDUWKRPHV\VWpPNOLPDWL]DFHSRGODKRYpWRSHQt PRQROLWLFNpNRYRYpVFKRG\SฤจtSUDYDSURVDXQXDSiUXWฤจtYUVWYpGXERYpSRGODK\PRรงQRVWLQVWDODFHNUEXNRPRUDQDSDWฤจH1RYรฌSRGNURYQt E\WYDSDWฤจHNODVLFNpKRฤ€LQรงRYQtKRGRPXVYรฌWDKHPVLWXRYDQpKRYFHQWUX3UDK\MHQSiUNURNฤฃRG9iFODYVNpKRQiPฤ™VWt EHGURRPDSDUWPHQWZLWKWHUUDFHRYHUORRNLQJWKH3UDJXH&DVWOHFRPSOH[URRPVRULHQWHGWRWKHZHVWVPDUWKRPHV\VWHP DLUFRQGLWLRQLQJXQGHUIORRUKHDWLQJODUJHPHWDOVWDLUFDVHSUHSDUDWLRQIRUVDXQDDQGVWHDPURRPWKUHHOD\HURDNIORRUVSRVVLELOLW\RI LQVWDOOLQJDVROLWDU\ILUHSODFHFKDPEHURQWKHVDPHIORRU1HZO\EXLOWVSOLWOHYHODWWLFIODWRQWKHthIORRURIDQDSDUWPHQWEXLOGLQJZLWKDQ HOHYDWRULQWKHYHU\FHQWHURI3UDJXHMXVWDIHZVWHSVIURP:HQFHVODV6TXDUH

Na Perลกtรฝnรฌ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

SALE

|

PRODEJ

|

ESTATE | 93


Prodej | Praha 6 | Bubeneè | 107 + 25 m2 | 10 900 000 Kè Designový klimatizovaný prosklený byt v loftovÊm stylu s terasou je situovaný ve 3. patøe renovovanÊho funkcionalistickÊho domu ze 30. let 20. století, který si plnÏ zachoval svÚj pÚvodní råz, v tichÊ rezidenèní lokalitÏ v blízkosti parku Låzara Cårdenase a Stromovky, s dobrou dostupností GRFHQWUD2WHYĨHQÏSOQę]DĨt]HQÏNXFK\ĞVNÏNRXWREÏYDFtSRNRMORçQLFHNRXSHOQ\NRPRUD.YDOLWQtSRXçLWpPDWHULiO\DGHVLJQRYpY\EDYHQt zahrnují klimatizaci, týkovÊ podlahy, betonovou stÏrku PANDOMO, velkoploťnå okna a velkÊ støeťní okno s hydraulickým ovlådåním a pøístupem na VWĨHüQtWHUDVXVDQLWX+DQVJURKHYĀHWQęGHüĢRYpVSUFK\SRGODKRYpY\WiSęQtDXGLRV\VWpP/RJLWHFK=VWURSQtVYtWLGOD(5&2PQRçVWYt~ORçQÏFK SURVWRUVNOHS0RçQRVWSURQiMPXJDUiçRYpKRVWiQtYRNROt'ģPVHQDFKi]tQęNROLNPLQXWFKģ]HRG6WURPRYN\SDUNXSRG%DERXD]DVWiYN\ autobusu MHD se spojením na metro Dejvickå.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

94

|

ESTATE

|

NEJLEPĹ Ă? NEMOVITOSTI

|

BEST PROPERTIES

svoboda-williams.com


Sale | Praha 6 | Bubeneè | 107 + 25 m2 | 10 900 000 Kè Design glazed air-conditioned loft apartment with a terrace, situated on the 3rd floor of a renovated Functionalist building from the 1930s boasting its original character. Located in a quiet residential area near Lázaro Cárdenas and Stromovka Park, easy access to the center. Open, fully equipped kitchen, spacious living room, master bedroom with en-suite bathroom, second bedroom, shared bathroom, utility room. Quality materials and designer features include air-conditioning, teak floors, PANDOMO concrete aggregate, large windows and a large hydraulically controlled skylight with access to the roof terrace, Hansgrohe fittings including a rain shower head, underfloor heating, Logitech Z4 audio system, ERCO ceiling lamps, storage space, cellar. Area with the possibility to rent a garage space in the neighborhood, just a few minutes’ walk from Stromovka Park and a park underneath the Baba ruins. Bus stop with easy reach to Dejvická metro.

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

SALE

|

PRODEJ

|

ESTATE | 95


Prodej | Praha 1 | Malá Strana | 150 m2 | 15 000 000 Kè Byt 3+kk, jedineèné výhledy, døevìné podlahy, špaletová okna, pùvodní odhalené trámy, videotelefon, plynový kotel. Pùdní byt v exkluzivní lokalitì Malé Strany jen pár krokù od Karlova mostu a Malostranského námìstí a nièím nerušenou privátní klidnou atmosférou, ve 3. a 4. patøe zrekonstruovaného historického domu bez výtahu, s peèlivì zachovanými pùvodními prvky, hezkými spoleènými prostory a fasádou. 2-bedroom apartment, unique views, wooden floors, casement windows, original exposed beams, gas boiler, videophone. Attic apartment in the exclusive area of Malá Strana, just a few steps from Charles Bridge and Malostranské námìstí square - and yet offering an undisturbed private tranquil atmosphere. The apartment is located on the 3rd and 4th floors of a renovated historic building without a lift, with carefully preserved original features and attractive common areas and facade.

Pro kompletní nabídku navštivte / For complete property listing please visit

96

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

svoboda-williams.com


Prodej | Praha 5 | Hluboèepy | 375 m2 | pozemek 671 m2 | 38 000 000 Kè 9LODNNNUEYLQRWpNDKHUQDEH]SHĀQRVWQtVNODDODUPXSUDYHQiY]URVWOi]DKUDGDJDUiçSURYR]\EOt]NRVW3URNRSVNpKR~GROt DYÏERUQiGRVWXSQRVWGRFHQWUD-HGLQHĀQiSĨtOHçLWRVWNRXSęNODVLFNpYLO\VNUiVQRXDUFKLWHNWXURXSRNRPSOHWQtUHNRQVWUXNFLUHDOL]RYDQp UHQRPRYDQÏPDUFKLWHNWHP-iQHP6WHPSHOHPYHY\KOHGiYDQpUH]LGHQĀQtORNDOLWę3UDK\VYÏKOHGHPQD'tYĀtKUDG\DPLQXW RGFHQWUD$QGęO 5-bedroom villa, wine rack room, playroom, safety glass in all windows, alarm, mature and well-kept garden, garage for 2 cars, close to 3URNRSVNp~GROtYDOOH\DQGZLWKLQHDV\UHDFKWRWKHFHQWHU8QLTXHRSSRUWXQLW\WRDFTXLUHDFODVVLFYLOODIRUVDOHZLWKVXSHUEDUFKLWHFWXUDO GHVLJQDQGIHDWXUHVIURPUHQRZQHGDUFKLWHFW-iQ6WHPSHOLQDTXLHWVRXJKWDIWHUUHVLGHQWLDODUHDRI3UDJXHZLWKYLHZVRIWKH'tYĀt KUDG\DUHDPLQXWHVIURPWKH$QGęOFRPPHUFLDODQGHQWHUWDLQPHQWFHQWHU

Na PerťtýnÏ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

SALE

|

PRODEJ

|

ESTATE | 97


Byt 7+1, 156 + 8 m2, Praha-západ – Tuchoměřice, K Poště | 6 990 000 Kč Mezonetový byt s balkonem v 1. a 2. patře rezidenčního projektu umístěného pod klášterem, v klidné přírodní oblasti s dobrou dostupností do mezinárodních škol v Praze 6 a na Letiště Václava Havla. Dřevěné plovoucí podlahy a dlažba, plastová okna a dřevěná střešní okna – protihluková, alarm, domácí vrátný, 1 venkovní parkovací stání a sklep. Základní občanská vybavenost v místě, 5 minut jízdy od Outlet Airport Praha nebo jezdeckého klubu. Duplex apartment with a balcony, on the 1st and 2nd floors of a residential project located close to a monastery in a quiet green area within easy reach of international schools in Prague 6 and Letiště Václava Havla Airport. Wood floating floors and tiles, plastic windows and soundproof wood skylights, alarm, intercom, 1 outdoor parking space, cellar. Basic amenities and easy access to Prague; the Outlet Airport Praha and an equestrian club are just five minutes from the village by car.

Pro kompletní nabídku navštivte / For complete property listing please visit 98

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

feelhome.cz


Prodej

Pronájem

RD 11+kk, 330 m2, pozemek 808 m2, Praha-západ – Zvole, Přední | 9 490 000 Kč Výhodně situovaný rodinný dům z roku 2006 s nízkými náklady vhodný pro dvougenerační bydlení nebo pro bydlení spojené s podnikáním či lékařskou praxí. Byty 4+1 v přízemí a 6+1 v 1. a 2. patře domu, krb, tepelné čerpadlo, garáž pro 2 vozy a další 2 stání na pozemku. Lokalita poskytuje klid a soukromí, možnosti pro aktivní odpočinek a současně dobrou dostupnost do Prahy – stanice autobusu na metro Kačerov 100 m od domu. Conveniently situated family house from 2006 with low utility fees suitable for two-generation/family housing or housing combined with office or medical practice. 3-bedroom ground floor apartment and 5-bedroom 1st and 2nd floors duplex apartment, fireplace, heating pump, garage for 2 cars and 2 additional outdoor parking spaces on plot. Tranquil and private location with options for active recreation and good access to Prague – bus stop with connection to Kačerov metro station 100 m from the house.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz SALE

|

PRODEJ

|

ESTATE | 99


Prodej

Rodinný dům 6 + kk v ulici U břehu 45a, Praha 15 – Hostivař

Sale

Familly 5-bedroom house in U břehu 45a, Praha 15 – Hostivař

Dispozičně je dům řešen jako 6 + kk s úžitnou plochou 700 m2, přičemž

The layout of the house is designed as 5-bedroom with a usable area of

celkem obsahuje 5 ložnic se 3 koupelny, 2 garážová stání + 1 venkovní stá-

700 m2 and includes 5 bedrooms with 3 bathrooms, 2 garage parking

ní, vnitřní bazén, sauna, výtah a střešní terasa. Dům se nachází v nádherné

+ 1 outdoor parking, indoor pool, sauna, elevator and roof terrace. The

přírodní a klidné lokalitě na kraji místního lesa s potokem Botič, v pěším

house is located in a beautiful natural and quiet location on the edge of the

dosahu Hostivařského parku a přehrady. Přesto ale lokalita nabízí velmi

forest with a local brook Botič, within walking distance is forest park and

dobrou dostupnost do centra Prahy. Celý dům je zabezpečen pohybový-

lake. Nevertheless this location offers excellent access to the city center.

mi čidli a alarmen napojeným na 24h bezpečnostní službu. Vila má inte-

The entire house is secured by motion sensors and an alarm connected

ligentní osvětlení ovládané přes dotykové panely,stejně tak i elektronické

to a security service for 24 hours / day. The villa has an intelligent lighting

venkovní rolety.

controlled via touch panels, as well as electronic outdoor blinds.

Cena: info o ceně v kanceláři JLL/ price: price info in JLL Jones Lang LaSalle, s.r.o., Na Příkopě 21, 110 00 Praha 1, mob: (+420) 602 589 370, tel: (+420) 222 222 101, e-mail: info@homefinder.cz

100

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


Prodej

Prostorný byt 5+kk v areálu Bělohorské zahrady, Praha 6

Sale

Spacious 4-bedroom apartment in Bělohorské zahrady, Prague 6

Tento prostorný byt o velikosti 150 m2 je dispozičně řešen jako 5+kk s dvě-

This spacious apartment of 150 m2 is designed as a 4-bedroom apartment

ma koupelnami a je součástí areálu Bělohorské zahrady, který je zasazen

with two bathrooms and is part of the Bělohorské zahrady, which is area

do území sousedícího se čtvrtí rodinných vilek nedaleko křižovatky Čis-

adjacent to the area with family villas near the intersection of Čistovická

tovické a Slánské ulice, od jejíhož ruchu jsou dostatečně chráněny okolní

and Slánská street, from whose loudness are sufficiently protected by

zástavbou. Byt je nadstandartně vybaven – podlaha z běleného dubu,

the surrounding buildings. The apartment is furnished in high standard

bezpečnostní vstupní dveře, žaluzie na všech oknech, terasy s dřevěnou

- bleached oak flooring, security door, blinds on all windows, terraces

podlahou a parapety. Areál je koncipován jako uzavřená zahrada, přičemž

with wooden floors and window sills. The area is designed as a gated

jediný vstup do Bělohorských zahrad vede z odbočky od Čistovické ulice

garden with the only entrance from Čistovická street through the gate

přes bránu s recepcí a ostrahou, kde se bude zdržovat nepřetržitá 24ho-

with a reception and security providing a non stop 24-hour service.

dinová služba.

Cena : 9 980 000 Kč / price: CZK 9,980,000

Jones Lang LaSalle, s.r.o., Na Příkopě 21, 110 00 Praha 1, mob: (+420) 602 589 370, tel: (+420) 222 222 101, e-mail: info@homefinder.cz

SALE

|

PRODEJ

|

ESTATE | 101


Prodej

Luxusní apartmánový byt, 250m2 Rašínovo nábřeží, Praha 2, 3 000 000 €

Sale

Luxury apartment, 250 m2 Rašínovo nábřeží, Prague 2, 3 000 000 €

Byt s kouzelným výhledem na Pražský hrad je situován ve

Apartment with magnificent views of Prague Castle in 2. floor

2. podlaží domu. Zachována původní výška stropů přes 3,5 m.

house. Maintaining the original ceiling height over 3.5 m. The

Největší prostor (kolem 100 m2) je věnován okázalému obýva-

largest area (about 100 m2) is dedicated to the spectacular

címu pokoji propojenému s kuchyní a jídelnou. Dvě ložnice,

interconnected living room with kitchen and dining room. Two

prostorné koupelny, tři samostatné toalety, šatna i dostatek

bedrooms, spacious bathrooms, three separate toilets, dressing

úložných prostor, nechybí balkon s neopakovatelným výhledem

room and ample storage space, there is a balcony with a superb

na Hradčany!

view of the Castle!

Použity nejkvalitnější materiály, „chytré“ spotřebiče renomova-

Using the finest materials, “smart” appliances renowned brands,

ných značek, moderní podlahové vytápění, rozvody pro vysoko-

modern underfloor heating, wiring for high-speed data access

rychlostní datové připojení k internetu, ke kabelové či satelitní

to cable or satellite television. Direct elevator access to the

televizi. Přímý výtah se vstupem do bytu.

apartment.

For For complete complete portfolio portfolio or or real real estates estates visit visit www.faraon.cz www.faraon.cz 102

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

FARAON FARAON reality, reality, s.r.o., s.r.o., Polská Polská 26,26, 120 00 120 00Praha Praha 2, 2, tel. tel. +420 +420 224 829 322, 224 829 322, info@faraon.cz info@faraon.cz


Prodej

Noblesní byt, byt 4+kk, 180 m2, Mariánské Lázně, 16 566 600 Kč

Sale

Apartment, 4 + kk, 180 m2, Marianske Lazne, 16 566 600 CZK

Luxusní byt na nejlepší adrese v samém centru proslulého lá-

The apartment has 4 + kk + additional separate technical and

zeňského města, u lázeňské kolonády. Byt má dispozici

storage room. The large living room and dining room are sunlit

4+kk+další samostatné technické a úložné místnosti. Rozlehlý

western sun not only French windows with artistic wrought

obývací pokoj i jídelna jsou osluněné západním sluncem nejen

iron railing. The dining room is connected to a fully equipped

francouzskými okny s umělecky kovaným zábradlím. Jídelna

kitchen Siematic. Romantic bedrooms have balconies and scenic

navazuje na plně vybavenou kuchyňskou linku SieMatic. Roman-

southern flashy own bathrooms. High ceilings, solid wood

tické ložnice mají malebné jižní balkóny a vlastní honosné kou-

floors, high quality Italian designer tiles, ceramicsand Duravit,

pelny. Vysoké stropy, masívní dřevěné podlahy, kvalitní značkové

Hansgrohe reliable battery emphasize the technical excellence

italské obklady a dlažby, keramika Duravit. Pohodlně se z garáží

and perfect building design. Conveniently accessible by elevator

dostanete výtahem až ke dveřím bytu. Metropole je rychle do-

from the garage to the front door of the apartment. Metropole

stupná po kvalitní dálnici D5 za 45 minut.

is available for fast quality highway D5 for 45 minutes.

For complete portfolio or real estates visit www.faraon.cz

FARAON reality, s.r.o., Polská 26, 120 00 Praha 2, tel. +420 224 829 322, info@faraon.cz SALE

|

PRODEJ

|

ESTATE | 103


Prodej

Novostavba domu 152m2, Benešov u Prahy, 7 290 000 Kč

Sale

House, 152 m2, Benešov, 7 290 000 CZK

Novostavba krásného, samostatného domu ve vilové a klidné

New building beautiful, detached house in a residential

části Benešova. Jedná se o novostavbu dispozice 5+kk

and quiet area Benešova. It is a new layout 5 + kk an area of

o rozloze 250m2. Interiér je velmi moderní. Nová kuchyňská

250 square meters. The interior is very modern. New kitchen.

linka. Dům je stavěn s ohledem na energetickou náročnost.

The house is built with respect to energy consumption. Gas

Vytápění ústřední plynové. Rovinatý pozemek je vybavený

central heating. Flat land is equipped with electric gate and

elektricky ovládanou bránou a zámkovou dlažbou, bazénem

paving, swimming pool and wooden building things for the

a dřevěnou přístavbou na věci k údržbě zahrady. S vyřízením

maintenance of the garden. With the settlement of mortgage

financování hypotékou rádi pomůžeme.

financing happy to help.

For For complete complete portfolio portfolio or or real real estates estates visit visit www.faraon.cz www.faraon.cz 104

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

FARAON FARAON reality, reality, s.r.o., s.r.o., Polská Polská 26,26, 120 00 120 00Praha Praha 2, 2, tel. tel. +420 +420 224 829 322, 224 829 322, info@faraon.cz info@faraon.cz


Prodej

Sale

Exklusivní vila 7+kk na pozemku 4 179 m2 s jezírkem a bazénem Praha východ, 18 900 000 Kč

Uniquet villa, 7+ kk, Prague East, 18 900 000 CZK

Moderní rozlehlá rezidence na pozemku 4 179 m2 s dispozicí

Modern large residence on a plot 4179 m2 with 7 bedrooms with

7+kk s nádhernou vzrostlou zahradou s bazénem a jezírkem pl-

beautiful mature garden with swimming pool and fish pond.

ným ryb. V přízemí vily se nachází vzdušný obývací pokoj s plně

On the ground floor there is an airy living room with a fully

vybaveným kuchyňským koutem o rozměru 84,5 m a se vstupem

equipped kitchenette 84.5 square meters in size, and access to

na terasu a do zahrady. Dále dva pokoje, které lze využít jako

the terrace and the garden. Furthermore, two rooms that can be

pracovnu, pokoj pro hosty či ložnici. Designová koupelna a pro-

used as an office, guest room or bedroom. Designer bathrooms

storné zádvěří. V prvním patře jsou 4 ložnice, moderní koupelna,

and spacious porch. On the first floor are four bedrooms,

prádelna a šatna.

a modern bathroom, laundry room and cloakroom.

2

For complete portfolio or real estates visit www.faraon.cz

FARAON reality, s.r.o., Polská 26, 120 00 Praha 2, tel. +420 224 829 322, info@faraon.cz SALE

|

PRODEJ

|

ESTATE | 105


Prodej

Atypický rodinný dům 3+1, funkcionalistická dřevostavba, Praha východ, 10 500 000 Kč

Sale

Design house 3+1, Prague East, 10 500 000 CZK

Jedinečná investiční příležitost. Slavná funkcionalistická dře-

Unique investment opportunity. The famous functionalist

vostavba od studia Olgoj Chorchoj. Originální a architektonicky

house by Olgoj Chorchoj. Original and architecturally valuable

hodnotný dům postavený s největší pečlivostí se nachází ne-

house built with the utmost care is located near the city center.

daleko centra Prahy. Lokalita svým majitelům nabídne napros-

Location their owners will offer complete comfort, tranquility,

té pohodlí, klid, čistý vzduch a zároveň rychlou dostupnost do

clean air and also quick access to the capital, the golf course

metropole, na golfové hřiště nebo za nákupy v komerční zóně

or to go shopping in the commercial zone Průhonice-Čestlice

Průhonice-Čestlice nebo v Centru Chodov. Jedná se nejen o vý-

or Center Chodov. This is not only an exceptional investment in

jimečnou investici do kvalitního bydlení, ale také do prvotřídní

quality housing, but also to first-class Czech architecture, the

české architektury, jejíž cena bude v budoucnu stoupat. Obytné

price will rise in the future. Living rooms house is situated to

místnosti domku jsou situovány na jih a otevírají se francouz-

the south and open the French windows over wooden terrace to

skými okny přes dřevěnou terasu do zahrady.

the garden.

For For complete complete portfolio portfolio or or real real estates estates visit visit www.faraon.cz www.faraon.cz 106

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

FARAON FARAON reality, reality, s.r.o., s.r.o., Polská Polská 26,26, 120 00 120 00Praha Praha 2, 2, tel. tel. +420 +420 224 829 322, 224 829 322, info@faraon.cz info@faraon.cz


SALE

|

PRODEJ

|

ESTATE | 107


CENTURY 21 Premium Zlatnická 1582/10, 110 00 Praha 1

Rodinná vila, 10+kk/T,G, 559m2, Praha-západ, Průhonice Luxusní čtyřpodlažní vila, s osobitým charakterem a působivou architekturou, v jedné z nejvyhledávanějších lokalit v okolí Prahy, Průhonice, Praha-západ. Dům stojí na rovinaté parcele o velikosti 846m2 a je situován v klidné části Průhonic, ve vilové oblasti plné zeleně a krásy okolního prostředí. Dispozice domu nabízí více než deset obytných místností ve čtyřech podlažích (1. PP–3. NP), saunu s relaxační místností, fitness, několik koupelen a samozřejmostí jsou šatny a technické místnosti společně s prostornou dvojgaráží.

Cena: 44 000 000 Kč Realitní makléř: Jaroslav Kareš, Realitní makléř Master, Kontakt: +420 739 682 221, E-mail: jaroslav.kares@century21.cz Více informací na www.century21.cz / For more information visit www.century21.cz / Более подробная информация на www.century21.cz

108

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


CENTURY 21 Premium Zlatnická 1582/10, 110 00 Praha 1

Exklusivní rodinná vila 5+1, 350m2, Říčany Exklusivní prodej rodinné vily ve městě Říčany u Prahy o dispozici 5+1, a užitné ploše 350 m2. Cihelný dům je zateplen s novou střechou. Předností této nemovitosti je klidné a ničím nerušené umístění u lesa v žádané lokalitě s výbornou dostupností a blízkou občanskou vybaveností. Nemovitost se skládá ze třech podlaží. Celý dům je zabezpečen alarmem s připojením na bezpečnostní pult ochrany, plastová okna jsou zabezpečena el. předokenními roletami, menší okna v přízemí mají bezpečnostní sklo. Parkovaní je zajištěno dvoj garáží s možností dalšího parkování na pozemku za oplocením pro návštěvy. Zařízení u této nemovitosti je předmětem domluvy s majiteli, část zařízení zůstává a zbylé movité zařízení je předmětem diskuze. Nemovitost lze financovat hypotečním úvěrem. Pro více informací kontaktujte makléře nemovitosti.

Cena: 11 900 000 Kč Realitní makléř: Pavel Bartoš, Realitní makléř Master Kontakt: +420 725 293 139, E-mail: pavel.bartos@century21.cz Více informací na www.century21.cz / For more information visit www.century21.cz / Более подробная информация на www.century21.cz

SALE

|

PRODEJ

|

ESTATE | 109


&(1785<%HVW5HDOLW\ 'RQVN£3UDKD9UďRYLFH WHO

6HFHVQ¯E\WQD.DUORYÙQ£PÙVW¯

.U£VQ¿VOXQQ¿VHFHVQ¯E\WY3ć¯ÍQ«XOLFLQD.DUORYÙQ£PÙVW¯%\WVHQDFK£]¯YHSDWćHSć¯PRQDSURWLKRWHOX6KHUDWRQ3UDJXHDVNO£G£VH]HVDPRVWDWQ¿FKSRNRMęKDO\NRXSHOQ\WRDOHW\NRPRUDNXFK\QÙ1DSRGOD]HE\WXQDMGHWHNU£VQ«GćHYÙQ«SDUNHW\YSHUIHNWQ¯PVWDYX%XGRYDGRPX SURďODYHONRXUHNRQVWUXNF¯DYEO¯]NRVWLGRPXVHQDFK£]¯NRPSOHWQ¯REÍDQVN£Y\EDYHQRVW6DPR]ćHMPRVW¯MHY¿ERUQ£GRSUDYQ¯GRVWXSQRVWPLQXW\ FKę]HQDPHWUR.DUORYRQ£PÙVW¯QHERQD]DVW£YNXWUDPYDMH.DUORYRQ£PÙVW¯

&HQD.Í 5HDOLWQ¯PDNO«ć ,QJ=GHQÙN5RXÍND Kontakt: E-mail:]GHQHNURXFND#FHQWXU\F] 9¯FHLQIRUPDF¯QDbZZZFHQWXU\F])RUPRUHLQIRUPDWLRQYLVLWZZZFHQWXU\F]ŊŷŴŮŮŸŷŭŹŷŪŶũƈűŶŽŷŹŵũſűƈŶũZZZFHQWXU\F] 110

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


9¨&(1(ŖNOVÝCH%<7ň91$%¨'&( 7,6¨&(352'$1¸&+%<7ň$'20ň (;3(571$35$Ŗ6.¤129267$9%<

PRODEJ NOVOSTAVEB y NEW HOME SALE

www.lexxus.cz

MORE THAN 1000 NEW APARTMENTS IN OFFER THOUSANDS OF SOLD FLATS AND HOUSES PRAGUE‘S NEW HOMES SALE EXPERT better reality

JIŽNÍ ZAHRADY


B

Rezidence na Farkáně Praha 5, Malvazinky

Dispozice | Disposition: 1+kk - 4+kk Ceny od | Prices from: 3 941 378 Kč

75% PRODÁNO / PRÁVĚ KOLAUDUJEME

75% SOLD / JUST FINISHING

Komorní projekt Rezidence na Farkáně je dokončen! V nabídce jsou poslední byty o dispozicích od 2+kk do 4+kk. Nízkoenergetický bytový projekt se nachází v klidné vilové čtvrti Malvazinky a je příjemnou variantou bydlení na Praze 5. Dva bytové domy s celkem 49 byty jsou umístěny na jižním svahu, který zajišťuje dostatek slunečního svitu i atraktivní výhledy do okolní zeleně.

The small-scale Rezidence na Farkáně project is finished! The last flats, with layouts of two rooms + kitchenette to four rooms + kitchenette, are available (75% sold). The low-energy housing project is in the peaceful villa district of Malvazinky and is a pleasant housing option in Prague 5. The two residential buildings with a total of 49 flats are located on a southern slope, which ensures sufficient sunlight and attractive views of the surrounding green space.

lexxus.cz

better reality


B

Nové Chabry Praha 8, Dolní Chabry

Dispozice | Disposition: 4+kk Ceny od | Prices from: 6 273 856 Kč

IHNED K NASTĚHOVÁNÍ

READY TO MOVE IN

Projekt Nové Chabry představuje opravdu inovativní pojetí dokonalého domova. Součástí veřejného prostoru je cyklostezka lemovaná fitness prvky a dětské hřiště. Aktuálně se instaluje i venkovní expozice soch známých umělců. Letní akce zaměřená na luxusní byty 4+kk (cca 100 m2) s terasou 60 m2 či příjemnou zahradou, nabízí možnost výhodného nákupu se slevou až 5%. Přijďte se přesvědčit o benefitech Nových Chaber do naší prodejní kanceláře, či vzorového bytu.

Nove Chabry project represent truelly inovative conception of perfect home. Part of the public space is cycling path lined with fitness equipment and children playground. Recently there is installed outdoor statues exposition of known artists. Summer action aimed to luxury 3-bedroom apartments (aprox. 100 sqm) with terrace 60 sqm or cosy garden, offer an option of favourable buy with discount up to 5%. Come and see the benefits or Nove Chabry in our sales office or show flat.

lexxus.cz

better reality


PRODEJ | SALE

Energetická náročnost | Energy performance label: G

Janáčkovo Nábřeží, Praha 5 Janáčkovo nábřeží (dříve Ferdinandovo nábřeží) je garantem prestižního bydlení v blízkosti parků Kampa a Petřín. Dům č. 39 palácového typu byl postaven dle návrhu Josefa Lipovského v roce 1877. Tento luxusní „palác“ nabízí 8 bytů s impozantním výhledem na Vltavu, Národní divadlo i Žofín. Nyní probíhá kompletní rekonstrukce společných prostor a vestavba garáží. Nabízíme k prodeji poslední 4 byty ve stavu shell&core. Ke každému bytu jsou k dispozici 2 parkovací stání.

#600279 Info v RK | Info upon request Janackovo nabrezi, (originally Ferdinandovo nabrezi) is one of Prague’s treasures moments from the parks of Kampa and Petrin. Residence No. 39 was designed by Josef Lipovsky in 1877. This lavishly renovated „Palace“ offers 8 apartments with unparalleled views over the Vltava River, National Theatre and Zofin. The common parts are being refreshed and construction of the underground garages is underway. We offer last 4 apartments shell&core with a minimum of two parking spaces for each apartment.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


PRODEJ | SALE

Energetická náročnost | Energy performance label: G

#110841 Info v RK | Info upon request

Atletická, Praha 6 Rezidenční projekt s nadčasovým designem se nachází u parku Ladronka v blízkosti Kinského zahrad a Petřína. Dispoziční řešení bytu 3+1 (200,7 m2) je flexibilní a umožňuje rozdělení prostoru do 3 ložnic, velkého obývacího pokoje a jídelny s kuchyní. Zázemí tvoří velká šatna, 2 koupelny a toaleta. Bytový dům kopíruje svažitý terén, čímž vznikají možnosti pro terasy a zahradu. Byt je vybaven ve vysokém standardu – inteligentní systém ABB (dálkové ovládání světel, externích žaluzií, vytápění a klimatizace), zabudovaný audio systém, alarm napojený na PCO.

Residential development with timeless design within vicinity of Ladronka Park, Kinskeho garden and Petrin. Layout of the two bedroom apartment (200,7 sqm) is flexible and allows dividing of space on 3 bedrooms, spacious living room and kitchen with dining area. Background features large walk-in cabinet, 2 bathrooms and toilet. The residential building follows the sloping terrain. The flat is fitted with high standard - intelligent system ABB (remotely controlled lights, outer shutters, heating and A/C), built-in audio system, alarm with connection to a security agency.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


PRODEJ | SALE

Energetická náročnost | Energy performance label: G

Cukrovarnická, Praha 6 V posledních dvou podlažích vily z roku 1928 na Praze 6 - Ořechovce se nachází prostorný a světlý byt (218 m2) se čtyřmi ložnicemi a terasou s krásným výhledem. Při rekonstrukci v roce 2007 vznikly rozdělením původní rodinné vily tři prostorné bytové jedntoky s vlastními vchody. Uživatelům je k dispozici příjemná zahrada s vzrostlými stromy. Součástí kupní ceny jsou 2 parkovací místa v zakladači.

#108079 Info v RK | Info upon request In the last two floors of the villa built in 1928 in Prague 6 - Orechovka is situated a spacious and bright flat (218 sqm) with four bedrooms and a terrace with beautiful views. During the reconstruction in 2007 were created 3 original family apartments with separate entrances. Available to users is a pleasant garden with mature trees. The price includes 2 parking spaces in the stacker.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


PRODEJ | SALE

Energetická náročnost | Energy performance label: A

Hornoměcholupská, Praha 10 Vila 6+kk (381 m2) v Hornoměcholupské ulici byla vystavěna v roce 2010 v rámci architektonicky uceleného území v sousedství golfového hřiště. Její vybavení podléhá přísným nárokům majitelů objektu, které zahrnují také dostatečný uživatelský komfort, odpovídající nejmodernějším standardům. Lokalita je zajímavá nejen mnohým sportovním vyžitím, ale také blízkostí vodní nádrže a rozlehlého parku. Ideální prostředí pro relaxaci.

#112579 Info v RK | Info upon request Five bedroom villa (381 sqm) in Hornomecholupska street was built in 2010 as a part of an architecturally coherent territory adjacent to a golf course. Villas device complies with the strict demands of the owners of the building, which includes, of course, sufficient user comfort corresponding to the most modern standards. The area is remarkable thanks to enough sport activities, proximity to the water tank and a large park. The ideal environment for relaxation.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


PRODEJ | SALE

Energetická náročnost | Energy performance label: G

Brtnice, Velké Popovice Hledáte-li dům se zimní zahradou (72 m2) či dům s bazénem, je tato klasická vila vhodná právě pro Vás. Zimní zahradu lze otevřít do zahrady, bazén je udržován pomocí nanotechnologií, což umožňuje pěstovat i tropickou zeleň. Komfortní rodinný dům v blízkosti Prahy leží v rezidenční části obce s příjemným výhledem a výbornou dopravní dostupností. Prostorné a světlé pokoje mají logické uspořádání a návaznosti. Rozlehlý obývací prostor předěluje oboustranný krb na obývací a jídelní část. Plně vybavená kuchyně, pět ložnic, čtyři koupelny, odborně založená zahrada. Garáž pro dva vozy, venkovní parkování.

#112940 Cena | Price: 18 490 000 CZK If you are looking house with winter garden (72 sqm), or a house with a swimming pool, this classic villa is suitable just for you. Winter garden can be opened onto the garden, a swimming pool is maintained by using nanotechnology. Comfortable family home near Prague lies in a residential area with pleasant views and excellent transport links. The spacious and bright rooms have a logical layout and sequence. Large living areas is devided by both-sided fireplace on the living and dining area. Fully equipped kitchen, five bedrooms, four bathrooms, professionally established garden. Garage for two cars, outside parking.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


ZAHRANIÄ&#x152;NĂ? NEMOVITOSTI NA PRODEJ | PROPERTIES ABROAD FOR SALE

EnergetickĂĄ nĂĄroÄ?nost | Energy performance label: G

#112483 Cena | Price: 2 190 400 EUR

La Balise Mauritius (MUS) 7URSLFNĂ&#x2DC;RVWURYVSDQHQVNRXSÄľĂ&#x2C6;URGRXEĂ&#x2C6;OĂ&#x2DC;PLSĂ&#x2C6;VN\DSUĹ&#x2030;]UDèQĂśPRGUĂ&#x2DC;PLODJXQDPL1DVYĂ&#x201E;VLSÄľLMGRXY\]QDYDèLYRGQĂ&#x2C6;FKVSRUWĹ&#x2030;MDFKWDÄľL U\EŸľLDSÄľHGHYwĂ&#x2C6;PKUŸèLJROIX YEOĂ&#x2C6;]NRVWLVHQDFKÂź]Ă&#x2C6;GHYĂśWY\KOÂźwHQĂ&#x2DC;FKUHVRUWĹ&#x2030; =ÂźPĂśUHPUH]LGHQèQĂ&#x2C6;KRSURMHNWX%ODFN5LYHUMHVSRMHQĂ&#x2C6; OX[XVQĂ&#x2C6;KRE\GOHQĂ&#x2C6;VSÄľĂ&#x2C6;URGRXYNOLGQĂ&#x201E;èŸVWLRVWURYD9WĂ&#x201E;WRH[NOXVLYQĂ&#x2C6; WURSLFNĂ&#x201E;GHVWLQDFL9ÂźPQDEĂ&#x2C6;]Ă&#x2C6;PHXQLNÂźWQĂ&#x2C6;YLOXVXĹ&#x2014;LWQRXSORFKRXP2 For complete portfolio or real estates visit www.faraon.cz VYODVWQĂ&#x2C6;PED]Ă&#x201E;QHPDNRWYLwWĂśPP

A tropical island with virgin countryside, white sand and crystal clear blue lagoons. The project is great for lovers of water sports, yachtVPHQ ƏVKHUPHQ DQG SULPDULO\ JROIHUV WKHUH DUH QLQH SRSXODU UHsorts nearby). The aim of the Black River residential project is to link luxury housing to the countryside in a peaceful part of the island. In WKLVH[FOXVLYHWURSLFDOGHVWLQDWLRQZHRƪHUDOX[XU\YLOODZLWKƎRRU FARAON reality, s.r.o., Polskå 26, 120 00 Praha 2, tel. +420 224 829 322, info@faraon.cz area of 265 sqm, private swimming pool and 12 m mooring.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


PRONÁJEM | RENT

Senovážné náměstí, Praha 1 Moderní, zařízený byt (82 m2), který se nachází v 1. patře objektu Belwicz Palace v centru Prahy. Byt nabízí prostorný obývací pokoj s výhledem do zahrady, plně vybavenou kuchyni se vstupem na terasu (23 m2), ložnici, ze které je také vstup na terasu, koupelnu s vanou a sprchovým koutem a extra toaletu. V rezidenci je 24 hod. recepce a možnost pronájmu garážového stání. Reprezentativní bydlení, 5 minut chůze od Václavského náměstí.

#400260 Měsíční nájem | Monthly rent: 30 000 CZK Modern, furnished apartment (82 sqm), located on the 1st floor of the building Belwicz Palace in Prague center. The apartment offers spacious living room, fully equipped kitchen with direct access to the terrace (23 sqm), bedroom with an entrance to the terrace, bathroom with tub and shower and extra toilet. In the residence is 24/7 reception desk and option to rent garage space. Representative housing, 5 minutes walk from Wenceslas Square.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


PRONÁJEM | RENT

#410618 Cena | Price: 40 000 CZK

V Zářezu, Praha 5 Slunný, moderní byt, který se nachází ve 4. patře novostavby v příjemné lokalitě Prahy 5 - Jinonice. Byt o rozloze 125 m2 nabízí vstupní chodbu, obývací pokoj s plně vybaveným kuchyňským koutem, 3 ložnice, 2 koupelny a komoru. K bytu náleží balkon, 2 terasy s krásnými výhledy na panorama Prahy, sklep a garáž pro dva vozy. Byt je částečně zařízený a na žádost klienta je možno dozařídit nábytkem. V okolí veškerá občanská vybavenost, přímo u stanice metra a autobusové zastávky Jinonice a s výbornou dostupností do Německé školy.

Sunny, modern apartment located on the 4th floor of new building in nice area of Prague 5 - Jinonice. The apartment with area of 125 sqm offers entrance hall, living room with fully equipped kitchen corner, 3 bedrooms, 2 bathrooms and storage room. The apartment has balcony, 2 terraces with beautiful views over the city, basement and garage for two cars. The apartment is partly furnished and can be fully furnished on the client request. Comfortable living just steps from metro station and bus stop Jinonice with excellent access to the German school.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


PRONÁJEM | RENT

Hanzelkova, Praha 6 Reprezentativní polovina dvojdomu, která se nachází ve vyhledávané lokalitě Prahy 6 - Hanspaulka. Tento dům (182 m2) nabízí 3 podlaží. Obývací pokoj s jídelnou a plně vybaveným kuchyňským koutem s přístupem na zahradu s jacuzzi, 3 ložnice, 2 koupelny, saunu a extra toaletu. K domu náleží také terasa s výhledem na panorama Prahy, garáž pro jedno auto a 2 stání na pozemku. Luxusní bydlení, vhodné pro rodinu s dětmi s výbornou dostupností do centra, na letiště a do mezinárodních škol.

#407249 Měsíční nájem | Monthly rent: 87 000 CZK Modern semi-detached house located in popular area of Prague 6 Hanspaulka. The house (182 sqm) offers 3 floors. Living room with dining area, fully equipped kitchen corner with access to garden with jacuzzi, 3 bedrooms, 2 bathrooms, sauna and extra toilet. The house has terrace with view over the city, garage for one car and 2 spaces in the yard. Luxurious living, suitable for family with children with excellent access to the downtown, airport and international schools.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


PRONÁJEM | RENT

#410621 Měsíční nájem | Monthly rent: 60 000 CZK

V Přístavu, Praha 7 Unikátní, nadstandardní penthouse (192 m2) nacházející se v posledním patře moderního projektu Prague Marina na břehu Vltavy. Tento luxusní byt nabízí vstupní halu, obývací pokoj s plně vybaveným kuchyňským koutem, 3 ložnice, pracovnu, 2 koupelny, 2 šatny a 2 komory. K bytu náleží také sauna, 2 terasy s nerušenými výhledy na panorama Prahy, sklep (možno využít jako vinný sklep) a 2 garážová staní, která jsou již zahrnuta v ceně nájmu. V domě je 24 hodinová recepce. Atraktivní bydlení s dobrou dostupností do centra města.

Unique, luxury penthouse (192 sqm) located on the top floor of modern project Prague Marina on the branch of the Vltava river. This luxury apartment offers entrance hall, living room with fully equipped kitchen corner, 3 bedrooms, study, 2 bathrooms, 2 cloakrooms and 2 chambers. The apartment has sauna, 2 terraces with unobstructed views over the city, cellar (can be used as wine cellar) and 2 parking spaces, which are already included in the rent. There is 24/7 reception. Attractive living with good access to the city center.

tel.: 221 111 900, info@lexxusnorton.cz, www.lexxusnorton.cz


PRONÁJEM LUXUSNÍHO PENTHOUSU 5+kk (221 m2) s velkou terasou (120 m2) a bazénem Praha 2, Královské Vinohrady, Nad Petruskou Cena na vyžádání Byt kompletně zařízen moderním i stylovým nábytkem, kuchyňská linka se spotřebičemi Miele, úklidová komora s pračkou a sušičkou. Terasa s bazénem, sprchou, teakovým nábytkem a krásným výhledem na Prahu. Byt má zabezpečovací zařízení, topení na elektřinu (přímotopy a klimatizační jednotky), na podlaze dřevěné parkety nebo dlažba, 2 parkovací stání v podzemní garáži. The flat is fully furnished in modern and antique furniture, Miele kitchen appliances, and a laundry room with washer and dryer. It also features a terrace with pool, shower, teak furniture, and a beautiful view of Prague. The flat has an alarm system, electric heating (radiators and air conditioning), parquet and tile floors, 2 parking spaces in the underground garage.

Bližší informace

124

|

ESTATE

|

Tero Loukonen, mobil: 724 607 264, email: tero.loukonen@passerinvest.cz

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


'(9(/230(17

7285 EHVWJROIWRXU

IRUGHYHORSHUV

Ϯϳ͘ϰ͘ϮϬϭϱ Ϯϳ͘ϱ͘ϮϬϭϱ  Ϯϱ͘ϲ͘ϮϬϭϱ

Wza>zͲ'K>&<>h 'K>&Z^KZd/,>Ez <Z>KszsZz 'K>&Θ^WZ^KZd<hE d/<,KZ

hnjĂǀƎĞŶĄŐŽůĨŽǀĄ ƚƷƌĂǀŽďůĂƐƚŝ ĚĞǀĞůŽƉŵĞŶƚƵ

Ϯϰ͘ϵ͘ϮϬϭϱ'K>&>hͲ^,tE,K&E D<K ͘͘͘ĂŶĂŬŽŶĞĐǀĞēşƌĞŬǀĐĞŶƚƌƵWƌĂŚLJ

ǁǁǁ͘ĚĞǀĞůŽƉŵĞŶƚͲƚŽƵƌ͘Đnj

,>sE1WZdE\/dhZE :

ŚĐĞƚĞƐĞƐƚĄƚ ƉƌĞƐƟǎŶşŵƉĂƌƚŶĞƌĞŵ͍ ƚĞů͗͘ϲϬϱϵϱϵϵϱϵ ĞŵĂŝů͗ĚĞǀĞůŽƉŵĞŶƩŽƵƌΛďĞƐƚŐŽůŌŽƵƌ͘Đnj

ĞǀĞůŽƉĞƎŝƐŝƚŽƐǀŝƓơŶĂŐŽůĨŽǀĠŵŚƎŝƓƟ EĞũůƵdžƵƐŶĢũƓşŬĂŶĐĞůĄƎũĞŐŽůĨŽǀĠŚƎŝƓƚĢ͘:ĞƉƌŽƐƚŽƌŶĄ͕ǀnjĚƵƓŶĄ͕ ƐǀljŚůĞĚĞŵĚŽƉƎşƌŽĚLJĂƌŽnjŚŽĚŶĢƐĞĚŽŶşǀǎĚLJďƵĚĞƚĞƚĢƓŝƚ͘WƌŽƚŽƐĞ ĚĞǀĞůŽƉĞƎŝƐĞƐǀljŵŝƉƎĄƚĞůŝĂŽďĐŚŽĚŶşŵŝƉĂƌƚŶĞƌLJƌĄĚŝƐĞƚŬĄǀĂũşŶĂŐŽůĨƵ͘ dŽũŝŵƵŵŽǎŸƵũĞƉƌĞƐƚŝǎŶşŐŽůĨŽǀĄƚƷƌĂs>KWDEdƚŽƵƌ͕ŬƚĞƌĄƉŽƎĄĚĄ ƵnjĂǀƎĞŶĠƚƵƌŶĂũĞƉƌŽǀljnjŶĂŵŶĠŽƐŽďŶŽƐƚŝnjĚĞǀĞůŽƉŵĞŶƚƵĂǀLJƚǀĄƎşũŝŵ ƉƎşũĞŵŶĠƉƌŽƐƚƎĞĚşƉƌŽƉƎĄƚĞůƐŬĄŝŽďĐŚŽĚŶşƐĞƚŬĄŶşͣ͘'ŽůĨŽǀĠƚƵƌŶĂũĞũƐŽƵ ƐŬǀĢůŽƵƉƎşůĞǎŝƚŽƐƚş͕ũĂŬƐĞƐĞnjŶĄŵŝƚƐĞnjĂũşŵĂǀljŵŝůŝĚŵŝ͕͞ĚŽƉůŸƵũĞƉĂƌƚŶĞƌ s>KWDEdƚŽƵƌ:ŝƎşaǀĞĐ͕ũĞĚŶĂƚĞůƐƉŽůĞēŶŽƐƚŝĚŽďƌĄd/^<ZE͘ dƵƌŶĂũĞŵŽĚĞƌƵũĞnjƉĢǀĄŬKŶĚƎĞũ,ĞũŵĂ͘dĞŶƐŝŶĂǀşĐϮϳ͘ŬǀĢƚŶĂŶĂƚƵƌŶĂũŝ ǀŝŚĞůŶĄĐŚǀƌĄŵĐŝs>KWDEdƚŽƵƌůĞƚŽƐƉŽĚĞůƓşƉĂƵnjĞƉŽƉƌǀĠnjĂŚƌĄů͘ ĢŚĞŵƐĞnjſŶLJƐĞŽĚĞŚƌĂũşēƚLJƎŝƚƵƌŶĂũĞŶĂŶĞũƉƌĞƐƚŝǎŶĢũƓşĐŚŚƎŝƓƚşĐŚǀĞƐŬĠ ƌĞƉƵďůŝĐĞĂǀnjĂŚƌĂŶŝēş͘ĞůĄƚƷƌĂǀƌĐŚŽůşƐůĂǀŶŽƐƚŶşŵǀĄŶŽēŶşŵǀĞēşƌŬĞŵ ƐǀLJŚůĄƓĞŶşŵǀşƚĢnjƽ͘ĄǀĢƌĞēŶljēƚǀƌƚljƚƵƌŶĂũƉƌŽďĢŚŶĞƉŽůĠƚĢǀŶĢŵĞĐŬĠŵ ^ĐŚǁĂŶŚŽĨƵϮϰ͘njĄƎşϮϬϭϱ͘ ,ůĂǀŶşŵŝƉĂƌƚŶĞƌLJƚƷƌLJũƐŽƵƐƉŽůĞēŶŽƐƚŝ<ŽŵĞƌēŶşďĂŶŬĂ͕ƵƚŽƐĂůŽŶ <ůŽŬŽēŬĂ͕sZKWƌĞĂůŝƚŶşŬĂŶĐĞůĄƎ͕EŽĨĨŝĐĞĨƵƌŶŝƚƵƌĞ͕KƵƚĚŽŽƌĂŬnjĞŶƚ͕ D͕ůĂƚƵƐ͕dŚĞDĂƌŬ͕'ŽůĨŽǀĠĐĞƐƚLJĂEĂĚĂĐĞdĂƛĄŶLJ<ƵĐŚĂƎŽǀĠ͘

WZdE\/dhZE :

SULKO Spolehlivá okna

CZECH REAL ESTATE

OBSESSION

2015

LEASE

|

PRONÁJEM

|

ESTATE | 125


PronĂĄjem | Ve smeèkĂĄch | NovĂŠ MĂŹsto | Praha 1 | 235 m2 | 60 000 Kè / mĂŹsĂ­c 32'.5291Ă&#x152;0(=21(7NNVDXQDWHUDVDNRXSHOQ\ĂĽDWQDNOLPDWL]DFHGĨHYÄ&#x2122;QpSRGODK\YHVWDYÄ&#x2122;QpVNĨtQÄ&#x2122;D~ORçQpSURVWRU\ EH]SHÄ&#x20AC;QRVWQtGYHĨHFHQWUiOQtY\StQDÄ&#x20AC;DODUP0RGHUQtE\WQDYUçHQĂŹDUFKLWHNWRQLFNĂŹPVWXGLHP'RQOLFYHSDWĨHÄ&#x20AC;iVWHÄ&#x20AC;QÄ&#x2122; ]UHNRQVWUXRYDQpKRÄ&#x20AC;LQçRYQtKRGRPXEH]YĂŹWDKXYDWUDNWLYQtORNDOLWÄ&#x2122;GRVORYDSiUNURNÄŁRG9iFODYVNpKRQiPÄ&#x2122;VWtVU\FKOĂŹPSĨtVWXSHP NHYĂĽHPWĨHPWUDViPSUDçVNpKRPHWUD SPLIT-LEVEL ATTIC APARTMENT, sauna, terrace, 5 bedrooms, 3 bathrooms, walk-in closet, air-conditioning, wood floors, built-in wardrobes and storage, security door, central switch, alarm. Fourth floor apartment boasting a tastefully designed interior by Donlic studio, in a partly reconstructed building without a lift. Attractively located just a minute walk from Wenceslas Square with immediate access to all three Prague metro lines.

126

|

ESTATE

|

NEJLEPĹ Ă? NEMOVITOSTI

|

BEST PROPERTIES


PronĂĄjem | MĂ­ĹĄeòskĂĄ | MalĂĄ Strana | Praha 1 | 220 m2 | 65 000 Kè / mĂŹsĂ­c 5(35(=(17$7,91Ă&#x152;%<7NNVDXQDSÄŁYDEQi]DKUiGNDYHYQLWUREORNXVDORQVNDFKORYĂŹPLNDPQ\YHONiORçQLFHVWRÄ&#x20AC;LWĂŹPVFKRGLĂĽWÄ&#x2122;PQD vestavĂŹnou galerii, zachovanĂŠ pĂšvodnĂ­ prvky, vysokĂŠ stropy, parkety, bezpeènostnĂ­ dveøe, alarm. ZrenovovanĂ˝ zaøízenĂ˝ byt v 1. patøe plnĂŹ zrekonstruovanĂŠho historickĂŠho domu bez vĂ˝tahu v atraktivnĂ­ lokalitĂŹ doslova pĂĄr krokĂš od Karlova mostu a MalostranskĂŠho nĂĄmĂŹstĂ­, pĂĄr minut chĂšze od stanice metra MalostranskĂĄ. FULLY REFURBISHED HISTORIC FLAT, sauna, cozy courtyard garden, lounge with an historic ceramic stove, large bedroom with a circular staircase leading to a built-in gallery, study, preserved original details, high ceilings, solid wood parquet floors, security entry door, alarm. Furnished flat on the first floor of a fully renovated historic building with no lift located steps from the Charles Bridge and within walking distance of the Prague Castle, a few min. walk to MalostranskĂĄ metro.

Na PerťtýnÏ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

LEASE

|

PRONĂ JEM

|

ESTATE | 127


PronĂĄjem | Ĺ paèkova | Suchdol | Praha 6 | 176 m2 | 38 500 Kè / mĂŹsĂ­c MODERNĂ? ZAĂ&#x2DC;Ă?ZENĂ? BYT 5+kk, terasa 60 m2ORçQLFHNRXSHOQ\HOHNWULFNĂŹNUEGYÄ&#x2122;ĂĽDWQ\YHVWDYÄ&#x2122;QpVNĨtQÄ&#x2122;SRGODKRYpWRSHQt YNRXSHOQiFKFHQWUiOQtY\VDYDÄ&#x20AC;SUDÄ&#x20AC;NDVXĂĽLÄ&#x20AC;NDP\Ä&#x20AC;ND79XPÄ&#x2122;OĂŹWUiYQtNQDWHUDVHVNOHS'YÄ&#x2122;NU\WiSDUNRYDFtVWiQt3URVWRUQĂŹE\W YSDWĨHUH]LGHQÄ&#x20AC;QtKRNRPSOH[XYNOLGQpORNDOLWÄ&#x2122;VDXWREXVRYĂŹPLVSRMLNPHWUX'HMYLFNiXDUHiOXĂż=85\FKOiGRVWXSQRVWQDOHWLĂĽWÄ&#x2122; DNPH]LQiURGQtPĂĽNROiP,63D5LYHUVLGH6FKRRO 02'(51)851,6+(')/$7P2 terrace, four bedrooms, two bathrooms, electric fireplace, two walk-in closets, built-in wardrobes, central vacuum, washer, dryer, dishwasher, TV, synthetic lawn on the terrace, cellar. Two covered parking places. First floor flat in a gated residential SURMHFWLQDTXLHWJUHHQQHLJKERUKRRGZLWKTXLFNDFFHVVWR'HMYLFNiPHWURVWHSVIURPWKH&]HFK8QLYHUVLW\RI/LIH6FLHQFHVFDPSXV &RQYHQLHQWWRWKH,63DQG5LYHUVLGHLQWHUQDWLRQDOVFKRROVDQGWKHDLUSRUW

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

128

|

ESTATE

|

NEJLEPĹ Ă? NEMOVITOSTI

|

BEST PROPERTIES

svoboda-williams.com


PronĂĄjem | KomunardĂš | HoleĹĄovice | Praha 7 | 196 m2 | 2 000 EUR / mĂŹsĂ­c NOVĂ? LUXUSNĂ? MEZONET 4+kk, støeĹĄnĂ­ terasy (158 m2), 2 koupelny, ĹĄatna, svĂŹtlovody, døevĂŹnĂŠ podlahy, stĂŹrka, bezpeènostnĂ­ dveøe, YLGHRWHOHIRQVNOHSNDPHURYĂŹV\VWpPYVWXS\QDÄ&#x20AC;LS*DUiçRYpVWiQt3URVYÄ&#x2122;WOHQĂŹE\WYSDWĨHQRYRVWDYE\VRVWUDKRXDYQLWUREORNHP VSDUNRYRX~SUDYRX'\QDPLFNiORNDOLWDVSOQRXY\EDYHQRVWtDPRçQRVWPLNXOWXUQtKRDVSRUWRYQtKRY\çLWtYEOt]NpPRNROtPLQXWMt]G\GR centra, dvĂŹ zastĂĄvky tramvajĂ­ od stanice metra VltavskĂĄ. NEW HIGH QUALITY SPLIT-LEVEL FLAT, 158 m2 of roof terraces, three bedrooms, two bathrooms, walk-in closet, sun tunnels, hardwood and polished concrete floors, security entry door, video entry phone, cellar, camera system, chip entry. Garage parking. Bright flat on the seventh floor of a new building with security, in a dynamic neighborhood with full amenities within easy reach, a ten minute drive to the city center, two tram stops from VltavskĂĄ metro station.

Na PerťtýnÏ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

LEASE

|

PRONĂ JEM

|

ESTATE | 129


Pronájem | Filipiny Welserové | Bílá Hora | Praha 6 | 200 m2 | 95 000 Kè / mìsíc LUXUSNÍ RODINNÝ DÙM 6+1, støešní terasa, 3 koupelny, oboustranný krb, šatna, nadstandardní materiály (mramor, kámen, bøidlice), GĨHYęQpSRGODK\YHVWDYęQp~ORçQpSURVWRU\SUDĀNDVXåLĀNDDODUP*DUiç0RGHUQtGģPVXGUçRYDQRX]DKUDGRXDYìKOHGHPQD OHWRKUiGHN+Yę]GDYNOLGQpPSURVWĨHGtSOQpP]HOHQęYGREUpGRVWXSQRVWLGRFHQWUD WUDPYDMHDXWREXV\ YEOt]NRVWLSDUNģ/DGURQND DäiUNDDYU\FKOpPGRVDKXOHWLåWęDPH]LQiURGQtFKåNRO +,*+48$/,7<02'(519,//$URRIWHUUDFHILYHEHGURRPVWKUHHEDWKURRPVGRXEOHVLGHGILUHSODFHZDONLQFORVHWTXDOLW\PDWHULDOV VWRQH PDUEOHVODWH ZRRGIORRUVEXLOWLQVWRUDJHZDVKHUGU\HUDODUP*DUDJH)UHHVWDQGLQJKRXVHZLWKDODQGVFDSHGJDUGHQORFDWHGLQDTXLHW UHVLGHQWLDOQHLJKERUKRRGPLQXWHVIURPWKH+Yę]GD6XPPHU&DVWOHDQG3DUNQHDUWKHäiUNDDQG/DGURQND3DUNVDQGWKHDLUSRUW*RRG DFFHVVWRWKHFLW\FHQWHU WUDPVEXVHV FRQYHQLHQWWRLQWHUQDWLRQDOVFKRROV

130

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


PronĂĄjem | Kunice | Praha-vĂ˝chod | 517 m2 | 95 000 Kè / mĂŹsĂ­c LUXUSNĂ? ZAĂ&#x2DC;Ă?ZENĂ? DĂ&#x2122;M 4+kk, vnitønĂ­ bazĂŠn, sauna, 3 koupelny, 120 m2 obĂ˝vacĂ­ pokoj s krbem, spoleèenskĂ˝ pokoj s kuleènĂ­kem, dvĂŹ ĂĽDWQ\RWHYĨHQiJDOHULHVSUDFRYQRXDNQLKRYQRXWÄ&#x2122;ORFYLÄ&#x20AC;QDWĨLWHUDV\GĨHYÄ&#x2122;QpSRGODK\YHVWDYÄ&#x2122;Qp~ORçQpSURVWRU\VROiUQtSDQHO\ LQWHUQHW83&VDWHOLWDODUPYLGHRWHOHIRQNDPHURYĂŹV\VWpPYODVWQtVWXGQD'YRMJDUiç=DĨt]HQĂŹGÄŁPVNUiVQRXXSUDYHQRX]DKUDGRX nedaleko chrĂĄnĂŹnĂŠ oblasti Velkopopovicko, cca 30 min. jĂ­zdy od centra Prahy. HIGH STANDARD FURNISHED HOUSE, indoor pool, sauna, three bedrooms, three bathrooms, 120 m2 living room with a fireplace, billiard room, open gallery with a study and library, fitness room, three terraces, wooden floors, built-in storage, solar system, Internet, UPC, satellite, alarm, video entry phone, camera system, private well. Double garage. Free standing house with a beautiful landscaped garden near the Velkopopovicko natural preserve, a 30 min. drive to the city center.

Na PerťtýnÏ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

LEASE

|

PRONĂ JEM

|

ESTATE | 131


PronĂĄjem | TruhlåøskĂĄ | StarĂŠ MĂŹsto | Praha 1 | 112 m2 | 33 000 Kè / mĂŹsĂ­c KOMPLETNĂ&#x152; ZRENOVOVANĂ? BYT 3+1, koupelna s vanou, ĹĄatna, pĂšvodnĂ­ zachovanĂŠ prvky, parkety, bezpeènostnĂ­ dveøe, plnĂŹ vybavenĂĄ kuchyò VYHĂĽNHUĂŹPQiÄ&#x20AC;LQtPSUDÄ&#x20AC;ND79VDWHOLW:L)L=DĨt]HQĂŹE\WYFLWOLYÄ&#x2122;]UHNRQVWUXRYDQpPÄ&#x20AC;LQçRYQtPGRPÄ&#x2122;VYĂŹWDKHPYDWUDNWLYQtORNDOLWÄ&#x2122;YEOt]NRVWL nĂĄmĂŹstĂ­ Republiky se stanicĂ­ metra, zastĂĄvkou tramvajĂ­ a nĂĄkupnĂ­mi centry Palladium a Kotva. KlidnĂĄ ulice v pĂŹĹĄĂ­m dosahu StaromĂŹstskĂŠho a VĂĄclavskĂŠho nĂĄmĂŹstĂ­. COMPLETELY RENOVATED FLAT, two bedrooms, walk-in closet, bathroom with tub, preserved original features, solid wood parquet floors, security entry door, fully furnished kitchen with all utensils, washer, TV, WiFi, satellite. Bright furnished flat in a fully refurbished traditional building with a lift. Located in a quiet street steps from NĂĄmĂŹstĂ­ Republiky Square with the new Palladium shopping mall, tram stops and metro station, within walking distance of the Old Town and Wenceslas Square.

132

|

ESTATE

|

NEJLEPĹ Ă? NEMOVITOSTI

|

BEST PROPERTIES


Pronรกjem | รฆLWQi_1RYp0ฤ™VWR_3UDKD_P2 | .ฤ€/ mรฌsรญc =5(.21675829$1รซ=$ฤรŒ=(1รซ./,0$7,=29$1รซ%<7EDONRQORรงQLFHQRYiNXFK\ฤžรฅDWQDSฤฃYRGQtร…SRNRMSURVOXรงNXยดYHVWDYฤ™Qp ~ORรงQpSURVWRU\SDUNHW\SฤฃYRGQtQiE\WHNDGฤจHYฤ™QpรงDOX]LHP\ฤ€ND79DODUPVNOHSYVWXSGREXGRY\QDฤ€LS%\WVH]DFKRYDQรฌPL SฤฃYRGQtPLSUYN\YHSDWฤจHIXQNFLRQDOLVWLFNpKRGRPXVYรฌWDKHPYFHQWUX3UDK\SiUPLQXWFKฤฃ]HRG9iFODYVNpKRQiPฤ™VWtDVWDQLFPHWUD ,33DYORYDD.DUORYRQiPฤ™VWt 5(129$7('$,5&21',7,21(')/$7EDOFRQ\WZREHGURRPVQHZNLWFKHQZDONLQFORVHWRULJLQDOยดPDLGยทVURRPยตVROLGZRRGSDUTXHWIORRUV RULJLQDOIXUQLWXUHDQGZRRGHQEOLQGVEXLOWLQVWRUDJHGLVKZDVKHU79DODUPFHOODUFKLSHQWU\WRWKHEXLOGLQJ)XOO\IXUQLVKHGIODWZLWKSUHVHUYHG RULJLQDOIHDWXUHVRQWKHIRXUWKIORRURID)XQFWLRQDOLVWEXLOGLQJZLWKDOLIW&HQWUDOO\ORFDWHGDIHZPLQXWHZDONIURP:HQFHVODV6TXDUHDQG .DUORYRQiPฤ™VWtDQG,33DYORYDPHWURVWDWLRQV

Na Perลกtรฝnรฌ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

LEASE

|

PRONรJEM

|

ESTATE | 133


Pronájem | Národní obrany | Bubeneè | Praha 6 | 94 m2 | 32 000 Kè / mìsíc 129ë=$čÌ=(1ë32'.5291Ì%<7ORçQLFHNRXSHOQ\NUESDUNHW\EH]SHĀQRVWQtGYHĨHYHVWDYęQpVNĨtQęDWHOLpURYiRNQDSUDĀND P\ĀNDVNOHS1RYę]UHNRQVWUXRYDQìE\WYSDWĨHNRPSOHWQę]UHQRYRYDQpKRĀLQçRYQtKRGRPXVQRYìPYìWDKHP2EOtEHQiUH]LGHQĀQt ORNDOLWDPLQXWXFKģ]HRGVWDQLFHPHWUD'HMYLFNiYSęåtPGRVDKX3UDçVNpKRKUDGXDSDUNX6WURPRYND3OQiREĀDQVNiY\EDYHQRVWU\FKOp VSRMHQtQDOHWLåWęDGRPH]LQiURGQtFKåNROY3UD]H %5$1'1(:)851,6+('$77,&)/$7WZREHGURRPVWZREDWKURRPVILUHSODFHVROLGZRRGSDUTXHWIORRUVVHFXULW\HQWU\GRRUEXLOWLQ ZDUGUREHVDWHOLHUZLQGRZVZDVKHUGLVKZDVKHUFHOODU)XOO\UHIXUELVKHGIODWRQWKHILIWKIORRURIDFRPSOHWHO\UHFRQVWUXFWHGEXLOGLQJZLWK DOLIW/RFDWHGLQWKHSRSXODUHPEDVV\DUHDZLWKIXOODPHQLWLHVPRPHQWVIURP'HMYLFNiPHWURQHDUWKH6WURPRYNDDQG/HWHQVNp6DG\ 3DUNVDQGWKH3UDJXH&DVWOHFRQYHQLHQWWRWKHDLUSRUWDQGLQWHUQDWLRQDOVFKRROV

134

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


Pronรกjem | V Kolkovnรฌ | Starรฉ Mรฌsto | Praha 1 | 122 m2 | 85 000 Kรจ / mรฌsรญc (;./8=,91รŒ%<7NNORรงQLFHVYODVWQtPLNRXSHOQDPL]LPQt]DKUDGDEDONRQ]DFKRYDQpSฤฃYRGQtGHWDLO\VWฤ™UNDGODรงEDEH]SHฤ€QRVWQt GYHฤจHYHVWDYฤ™Qp~ORรงQpSURVWRU\SUDฤ€NDP\ฤ€ND799NXVQฤ™]Dฤจt]HQรฌNRPSOHWQฤ™]UHNRQVWUXRYDQรฌE\WYSDWฤจH]UHQRYRYDQpKRฤ€LQรงRYQtKR GRPXVYรฌWDKHPDSฤฃYRGQtPL]DFKRYDQรฌPLDUFKLWHNWRQLFNรฌPLSUYN\YNOLGQpXOLFLSiUNURNฤฃRG6WDURPฤ™VWVNpKRQiPฤ™VWtYEOt]NRVWLSUHVWLรงQt 3DฤจtรงVNpXOLFHYSฤ™รฅtPGRVDKXQiEฤจHรงt9OWDY\ 81,48($5&+,7(&7'(6,*1(')/$7WKUHHEHGURRPVWKUHHHQVXLWHEDWKURRPVZLQWHUJDUGHQEDOFRQ\VWRUDJHSUHVHUYHGRULJLQDO GHWDLOVSROLVKHGFRQFUHWHIORRUVWLOHVVHFXULW\GRRUZDVKHUGLVKZDVKHU797DVWHIXOO\IXUQLVKHGIXOO\UHIXUELVKHGIODWRQWKHILIWKIORRURID UHQRYDWHGEXLOGLQJZLWKDOLIW&HQWUDOO\ORFDWHGZLWK3UDJXHยทVPRVWH[FOXVLYHVWUHHW3DฤจtรงVNiMXVWURXQGWKHFRUQHUZLWKLQZDONLQJGLVWDQFH RIWKH9OWDYD5LYHUWKH2OG7RZQ6TXDUHDQGPDMRUKLVWRULFVLJKWV

Na Perลกtรฝnรฌ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

LEASE

|

PRONรJEM

|

ESTATE | 135


Byt 2+kk, 48 m2, Bubeneč – Praha 7, Šmeralova | 17 000 Kč / měsíčně Nově zrekonstruovaný zařízený byt ve zvýšeném přízemí zrenovovaného činžovního domu v klidné ulici u Stromovky a Letenského náměstí. Tramvaje k metru Hradčanská a Vltavská, 15 min. chůze do centra, rychlé spojení na letiště. 1 ložnice, obývací pokoj s kuchyní, koupelna se sprchou, šatna, parkety, myčka, TV, UPC, sklep. New fully refurbished furnished flat on the upper ground floor of a reconstructed building near Stromovka and Letná Parks, with trams to Hradčanská and Vltavská metro, and quick access to the airport. One bedroom, living room with kitchen, shower bathroom, walk-in closet, hardwood floors, security entry door, dishwasher, TV, UPC, cellar.

Pro kompletní nabídku navštivte / For complete property listing please visit 136

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

feelhome.cz


Pronájem

Prodej

Byt 2+kk, 75 m2, Strašnice – Praha 10, Gutova | 17 000 Kč / měsíčně Zařízený klimatizovaný podkrovní mezonet s balkonem v 6. patře novostavby s výtahem, 5 minut od metra Strašnická, v blízkosti parku, s rychlou dostupností do centra. Obývací pokoj s kuchyní, koupelna s vanou, otevřená galerie s ložnicí, výhled do zeleně, vestavěné skříně, myčka, TV, sklep. Garážové stání. Furnished air-conditioned split-level attic flat with a balcony, on the sixth floor of a modern building with a lift, in a quiet residential area a five min. walk to Strašnická metro. Living room with kitchen, bathroom with tub, open gallery used as a bedroom, green views, security entry door, built-in wardrobes, dishwasher, TV, cellar. Garage parking.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz LEASE

|

PRONÁJEM

|

ESTATE | 137


Byt 2+kk, 53 m2, Radlice – Praha 5, Pechlátova | 15 000 Kč / měsíčně Byt s balkonem a výhledy do zeleně ve 4. patře novostavby s výtahem v klidné lokalitě u parku a dětského hřiště, v rychlém dosahu stanic metra Radlická a Anděl. 1 ložnice, obývací pokoj, kuchyňský kout, koupelna se sprchou, plovoucí podlahy, dlažba, bezpečnostní dveře, myčka, sklep. Parkovací stání. Flat with a balcony and views of the local park, on the fourth floor in a modern building with a lift, near a playground, in a quiet street with quick access to the city center - Radlická and Anděl metro within easy reach. One bedroom, living room, kitchenette, shower bathroom, security entry door, dishwasher, cellar. Garage parking.

Pro kompletní nabídku navštivte / For complete property listing please visit 138

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

feelhome.cz


Pronájem

Prodej

Byt 3+kk, 54 m2, Lochkov – Praha 5, U Sladovny | 13 500 Kč / měsíčně Byt se 48 m2 zahrádkou, terasou a výhledem do zeleně v přízemí nové rezidence – zrekonstruované bývalé sladovny. 10 km od centra Prahy, u parku a dětského hřiště, v blízkosti brdských lesů. Obývací pokoj s kuchyní, 2 ložnice, koupelna s vanou, bezpečnostní dveře, dubové podlahy, pračka, myčka. Garážové stání. Modern flat with a 48 m2 garden and a terrace, on the ground floor of a fully refurbished former malt-house and brewery near a park, 10 km from the center of Prague, near the Brdy Mountains. Living room with kitchen, two bedrooms, bathroom with tub, security entry door, hardwood floors, washer, dishwasher. Garage parking.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz LEASE

|

PRONÁJEM

|

ESTATE | 139


Byt 2+kk, 61 m2, Vinohrady – Praha 2, Americká | 25 000 Kč / měsíčně Zařízený byt s 26 m2 terasou v 1. patře zrekonstruovaného činžovního domu s výtahem pár minut chůze od stanice metra Náměstí Míru, nedaleko Havlíčkových sadů, s plnou vybaveností v okolí. Obývací pokoj s kuchyní a jídelnou, 1 ložnice, koupelna s vanou, dřevěné podlahy, bezpečnostní dveře, videotelefon, sklep. Furnished first floor flat with a 26 m2 terrace in a fully refurbished building with a lift, in a quiet residential neighborhood within easy reach of full amenities, near Havlíčkovy Sady Park, moments from Náměstí Míru metro. Living room with kitchen and dining area, one bedroom, bathroom with tub, wooden floors, security entry door, cellar.

Pro kompletní nabídku navštivte / For complete property listing please visit 140

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES

feelhome.cz


Pronájem

Prodej

Byt 2+kk, 55 m2, Vinohrady – Praha 2, Slezská | 25 000 Kč / měsíčně Vkusně zařízený, kompletně zrenovovaný byt s výhledem do parku v 1. patře zrekonstruovaného činžovního domu s výtahem pár kroků od stanice metra Jiřího z Poděbrad. Obývací pokoj s kuchyní, 1 ložnice, koupelna se sprchou, zachované původní prvky, parkety, dlažba, bezpečnostní dveře, myčka, TV, videotelefon. Tastefully furnished refurbished first floor flat overlooking a park, in a reconstructed building with a lift. Attractive location steps from Jiřího z Poděbrad metro, with full amenities. Living room with kitchen, one bedroom, shower bathroom, preserved original details, solid wood parquet floors, security door, dishwasher, TV, video entry phone.

Na Perštýně 2, 110 00 Praha 1, T: +420 257 328 281, info@feelhome.cz LEASE

|

PRONÁJEM

|

ESTATE | 141


ApartmĂĄn Glass Suitet6CZUPWĂ&#x2C6;OĂ&#x201C;BäQSPPTPCt LLt1SBIBtPEFVSOPD 1MOÄŁTFSWJTPWBOâLMJNBUJ[PWBOâBQBSUNĂ&#x2C6;OTĂ&#x17E;äBTOâNJWâIMFEZOB'SBOUJĂ?LĂ&#x2C6;OTLPV[BISBEV EWÄŁNBMPäOJDFNJBQMOÄŁWZCBWFOPV LPVQFMOPV WFQBUÄżFEPNVTWâUBIFN0WĂ&#x2C6;MOâPUFWÄżFOâQSPTUPSPCâWBDĂ&#x201C;IPQPLPKFBLVDIZOÄŁTWFMLâNJGSBODPV[TLâNJPLOZ KĂ&#x201C;EFMOĂ&#x201C; TUÄ°MBCBMLĂ&#x2DC;O/PWPNÄŁTUTLĂ&#x2C6;MPLBMJUBTQBNĂ&#x2C6;ULBNJJOPÄĄOĂ&#x201C;NäJWPUFN7ZCBWFOĂ&#x201C;8J'J TBUFMJUOĂ&#x201C;UFMFWJ[FTQMB[NPWPVPCSB[PWLPV %7% EPNĂ&#x2C6;DĂ&#x201C;LJOP QSBÄĄLB OPOTUPQCF[QFÄĄOPTUOĂ&#x201C;TMVäCBBOPOTUPQIPUMJOFĂ LMJEKFEOPVUâEOÄŁBWâNÄŁOBMPäOĂ&#x201C;IPQSĂ&#x2C6;EMBBSVÄĄOĂ&#x201C;LÄ°WDFOÄŁ Fully serviced air-conditioned, two-bedroom, one full bathroom 4th ďŹ&#x201A;oor apartment with magniďŹ cent views of the Franciscan Garden, building with lift. Open-plan semi circular living and kitchen area with abundance of windows, dining table and balcony. New Town area known for sights and nightlife. Amenities: Wi-Fi Internet, satellite TV, plasma screen, washing machine, 24-hour hotline, 24-hour security guard. Weekly cleaning with change of linen and towels included in the price.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

142

|

ESTATE

|

NEJLEPĹ Ă? NEMOVITOSTI

|

BEST PROPERTIES

prague-stay.com


ApartmĂĄn Metropolitant6CZUPWĂ&#x2C6;OĂ&#x201C;BäQSPPTPCt LLt1SBIBtPEFVSOPD "QBSUNĂ&#x2C6;OTLPNQMFUOĂ&#x201C;NTFSWJTFN EWÄŁNBMPäOJDFNJ KFEOPVLPVQFMOPVBTBNPTUBUOâN8$ QBUSPTWâUBIFN7FMLâPUFWÄżFOâPCâWBDĂ&#x201C; BKĂ&#x201C;EFMOĂ&#x201C;QSPTUPS QMOÄŁWZCBWFOĂ&#x2C6;LVDIZOÄŁ EWÄŁQSPTUPSOĂ?MPäOJDF IPKOPTUPLFO0CMBTU/PWĂ?IP.ÄŁTUB[OĂ&#x2C6;NĂ&#x2C6;QSPTWĂ?QBNĂ&#x2C6;ULZ QÄżĂ&#x201C;MFäJUPTUJ LOĂ&#x2C6;LVQÄ°NBOPÄĄOĂ&#x201C;äJWPU7ZCBWFOĂ&#x201C;8J'J TBUFMJUOĂ&#x201C;UFMFWJ[FTQMB[NPWPVPCSB[PWLPV %7%EPNĂ&#x2C6;DĂ&#x201C;LJOP QSBÄĄLB OPOTUPQIPSLĂ&#x2C6;MJOLB Ă LMJEKFEOPVUâEOÄŁBWâNÄŁOBMPäOĂ&#x201C;IPQSĂ&#x2C6;EMBBSVÄĄOĂ&#x201C;LÄ°WDFOÄŁ Fully serviced, two-bedroom, one and a half bathroom apartment, 5th ďŹ&#x201A;oor with lift. Large open-plan living and dining area, fully ďŹ tted kitchen, two spacious bedrooms, abundance of windows. New Town area known for sights, shopping and entertainment. Amenities: Wi-Fi Internet, satellite TV with plasma screen, DVD/home theater system, washing machine, 24-hour hotline. Weekly cleaning with change of linen and towels included in the price.

Na PerĹĄtĂ˝nÄ&#x203A; 2, 110 00 Praha 1, T:

+420 222 311 084 LEASE

|

PRONĂ JEM

|

ESTATE | 143


ApartmĂĄn Romantict6CZUPWĂ&#x2C6;OĂ&#x201C;BäQSPPTPCZt LLt1SBIBtPEFVSOPD 1MOÄŁTFSWJTPWBOâQPELSPWOĂ&#x201C;LMJNBUJ[PWBOâBQBSUNĂ&#x2C6;OTKFEOPVMPäOJDĂ&#x201C;OBDIĂ&#x2C6;[FKĂ&#x201C;DĂ&#x201C;TFW,BSMPWÄŁVMJDJWCVEPWÄŁTOPOTUPQSFDFQDĂ&#x201C; LUFSĂ&#x2C6; KFOBTF[OBNV6/&4$01SPTUPSOâPUFWÄżFOâPCâWBDĂ&#x201C;QSPTUPSTQMOÄŁWZCBWFOâNLVDIZÄŞTLâNLPVUFN7ZCBWFOĂ&#x201C;8J'J TBUFMJUOĂ&#x201C;UFMFWJ[F TQMB[NPWPVPCSB[PWLPV %7%EPNĂ&#x2C6;DĂ&#x201C;LJOP QSBÄĄLBTVĂ?JÄĄLB QSĂ&#x2C6;EFMOBBOPOTUPQIPUMJOFĂ LMJEBWâNÄŁOBMPäOĂ&#x201C;IPQSĂ&#x2C6;EMBBSVÄĄOĂ&#x201C;LÄ°KFEOPV UâEOÄŁKTPV[BISOVUZWDFOÄŁ Fully serviced, air-conditioned one-bedroom attic apartment on Karlova Street, next to Old Town Square in UNESCO listed building with 24-hour reception. Spacious open-plan living and fully ďŹ tted kitchen area, laundry room. Amenities: Wi-Fi Internet, satellite TV with plasma screen, DVD/home theater system, washing machine/dryer and 24-hour hotline. Weekly cleaning with change of linen and towels included in the price.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

144

|

ESTATE

|

NEJLEPĹ Ă? NEMOVITOSTI

|

BEST PROPERTIES

prague-stay.com


Cozy ApartmĂĄnt6CZUPWĂ&#x2C6;OĂ&#x201C;BäQSPPTPCZt t1SBIBtPEFVSOPD 1MOÄŁTFSWJTPWBOâKFEOPQPLPKPWâBQBSUNĂ&#x2C6;O TPCâWBDĂ&#x201C;NQPLPKFNTSP[LMĂ&#x2C6;EBDĂ&#x201C;QPIPWLPVBQMOÄŁWZCBWFOPVLVDIZOĂ&#x201C;TKĂ&#x201C;EFMOĂ&#x201C;NLPVUFNTF OBDIĂ&#x2C6;[Ă&#x201C;WFEMF4UBSPNÄŁTUTLĂ?POĂ&#x2C6;NÄŁTUĂ&#x201C;WIJTUPSJDLĂ?CVEPWÄŁ6,BQSB[QPÄĄĂ&#x2C6;ULVTUPMFUĂ&#x201C; [BQTBOĂ?OBTF[OBNV6/&4$0"QBSUNĂ&#x2C6;OOBCĂ&#x201C;[Ă&#x201C; NPEFSOĂ&#x201C;WZCBWFOĂ&#x201C;BKF[BÄżĂ&#x201C;[FOLWBMJUOĂ&#x201C;NOĂ&#x2C6;CZULFNTQPMFÄĄOÄŁTNBMPWBOâNJTUSPQZBQBSLFUBNJ7ZCBWFOĂ&#x201C;8J'J TBUFMJUOĂ&#x201C;UFMFWJ[FTQMB[NPWPV PCSB[PWLPV %7%EPNĂ&#x2C6;DĂ&#x201C;LJOP NZÄĄLBTVĂ?JÄĄLBBOPOTUPQIPUMJOFĂ LMJEKFEOPVUâEOÄŁ WâNÄŁOBMPäOĂ&#x201C;IPQSĂ&#x2C6;EMBBSVÄĄOĂ&#x201C;LÄ°WDFOÄŁ Fully-serviced one-bedroom apartment with ensuite bathroom, living room with fold-out sofa bed, and a fully-ďŹ tted kitchen with dining space, located in the UNESCO-protected U Kapra building, located next to Old Town Square. Offering a modern as well as unique art and high-quality furnishings including rich old-world charm painted ceilings and parquet ďŹ&#x201A;oors. Amenities: Wi-Fi Internet, satellite TV with plasma screen, DVD/home theater system, washer/dryer and 24-hour hotline. Weekly cleaning, change of linen and towels included in price.

Na PerĹĄtĂ˝nÄ&#x203A; 2, 110 00 Praha 1, T:

+420 222 311 084 LEASE

|

PRONĂ JEM

|

ESTATE | 145


Nebytový prostor | Pronájem | Thámova | Praha 8 | Karlín | 71 – 3 032 m2 | 12,00 – 16,00 EUR / m2 / mìsíc Kanceláøské a obchodní prostory k pronájmu v oblíbené obchodní, rezidenèní a administrativní lokalitì Prahy 8. Prostory s otevøenou GLVSR]LFtPRKRXEìWX]SģVREHQ\WDNDE\VSOĞRYDO\SRçDGDYN\PDOìFKLYHONìFKILUHP]DĀtQDMtFtFKSRGQLNģLYHONìFKPH]LQiURGQtFK NRUSRUDFt6QDGQiGRSUDYQtGRVWXSQRVWPęVWVNRXKURPDGQRXGRSUDYRXLDXWHP²YEH]SURVWĨHGQtEOt]NRVWLVWDQLFHPHWUD.ĨLçtNRYD WUDVD% DWUDPYDMRYìFK]DVWiYHN9EXGRYęMHKRGLQRYiEH]SHĀQRVWQtVOXçEDDSRG]HPQtJDUiç&HQ\MVRXXYHGHQ\EH]'3+ 2IILFHDQGUHWDLOSUHPLVHVIRUOHDVHLQWKHSRSXODUEXVLQHVVUHVLGHQWLDODQGDGPLQLVWUDWLYHORFDWLRQRI3UDJXH7KHSUHPLVHVZLWK IOH[LEOHRSHQSODQOD\RXWFDQEHDGDSWHGWRPHHWWKHQHHGVRIVPDOODQGODUJHFRPSDQLHVDOLNHVWDUWXSFRPSDQLHVDQGDOVRLQWHUQDWLRQDO FRUSRUDWLRQV,WLVHDVLO\DFFHVVLEOHE\SXEOLFWUDQVSRUWDQGE\FDU²LQFORVHYLFLQLW\RIWKH.ĨLçtNRYDPHWURVWDWLRQ OLQH% DQGWUDPVWRSV %XLOGLQJDPHQLWLHVLQFOXGHKRXUVHFXULW\JXDUGDQGXQGHUJURXQGJDUDJH3ULFHVOLVWHGZLWKRXW9$7

146

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


Nebytovรฝ prostor | Pronรกjem | 1iGUDรงQt_3UDKD_6PtFKRY_ยฒP | (85PPฤ™VtF .DQFHOiฤจVNpSURVWRU\NSURQiMPXYDGPLQLVWUDWLYQtEXGRYฤ™QDFKi]HMtFtVHYWฤ™VQpEOt]NRVWLREFKRGQtKRFHQWUD1RYรฌ6PtFKRY9รฌERUQi GRSUDYQtGRVWXSQRVWDXWHPLYHฤจHMQRXGRSUDYRXยฒVWDQLFHPHWUD$QGฤ™O WUDVD% VHQDFKi]tSฤจtPRSRGEXGRYRXYEOt]NRVWLMVRX]DVWiYN\ WUDPYDMtDXWREXVRYpDYODNRYpQiGUDรงt%XGRYDGLVSRQXMHQฤ™NROLNDUHFHSFHPLDXPRรงฤžXMHWDNSฤจtPรฌYVWXSGRSURQDMDWรฌFKSURVWRU9URFH ]tVNDODEXGRYDFHUWLILNiW%5((0(;&(//(173DUNRYiQtMHNGLVSR]LFLSฤจtPRYEXGRYฤ™&HQ\MVRXXYHGHQ\EH]'3+ 2IILFHSUHPLVHVIRUOHDVHLQDQDGPLQLVWUDWLYHEXLOGLQJORFDWHGLQFORVHYLFLQLW\RI1RYรฌ6PtFKRYVKRSSLQJFHQWHU9HU\JRRGDFFHVVLELOLW\E\ FDUDQGSXEOLFWUDQVSRUWDWLRQยฒPHWURVWDWLRQ$QGฤ™O OLQH% LVORFDWHGMXVWEHORZWKHEXLOGLQJWUDPVWRSVEXVDQGWUDLQVWDWLRQQHDUE\7KH EXLOGLQJKDVVHYHUDOUHFHSWLRQGHVNVZKLFKDOORZVGLUHFWDFFHVVLQWRWKHOHDVHGSUHPLVHV,QWKHEXLOGLQJZDVDZDUGHGZLWKD%5((0 (;&(//(17FHUWLILFDWH2QVLWHSDUNLQJVSDFHVDYDLODEOH3ULFHVOLVWHGZLWKRXW9$7

Na Perลกtรฝnรฌ 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

COMMERCIAL PROPERTIES

|

KOMERฤŒNร NEMOVITOSTI

|

ESTATE | 147


NebytovĂ˝ prostor | PronĂĄjem |)UDQWLĂĽND.ĨtçND | Praha 7 | LetnĂĄ | 168 m2 | 290 Kè / m2 / mĂŹsĂ­c NetradiènĂ­ kancelåøskĂŠ prostory v podkrovĂ­ industriĂĄlnĂ­ budovy situovanĂŠ na Praze 7. Nedaleko se nachĂĄzĂ­ stanice metra VltavskĂĄ (trasa C), zastĂĄvka tramvajĂ­ Strossmayerovo nĂĄmĂŹstĂ­ je jen nĂŹkolik minut chĂšze od budovy. Lokalita se vyznaèuje vĂ˝bornou obèanskou vybavenostĂ­ DĂĽLURNRXĂĽNiORXPRçQRVWtSURDNWLYQtRGSRÄ&#x20AC;LQHN /HWHQVNpVDG\SDUN6WURPRYNDF\NORVWH]N\DM 9EXGRYÄ&#x2122;MHNGLVSR]LFLFHQWUiOQtUHFHSFH DKRGLQRYiRVWUDKD0RçQRVWSDUNRYiQtYHGYRĨH&HQ\MVRXXYHGHQ\EH]'3+ Atypical attic office premises in an industrial building situated in Prague 7. VltavskĂĄ metro station (line C) located nearby, while Strossmayerovo nĂĄmĂŹstĂ­ tram stop is just a few minutes on foot from the building. Lively neighborhood with full amenities and a wide range of opportunities for active relaxation (LetenskĂŠ sady, Stromovka Park â&#x20AC;&#x201C; perfect for sports and leisure, cycling, etc.). Building amenities include central reception desk and 24-hour security services. Possibility of parking in the courtyard. Prices listed without VAT.

Pro kompletnĂ­ nabĂ­dku navĹĄtivte / For complete property listing please visit

148

|

ESTATE

|

NEJLEPĹ Ă? NEMOVITOSTI

|

BEST PROPERTIES

svoboda-williams.com


Nebytový prostor | Pronájem | Na Pøíkopì | Praha 1 | Nové Mìsto | 303 – 1 209 m2 | 18,50 EUR / m2 / mìsíc Tento exkluzivní projekt nabízí k pronájmu moderní, flexibilní kanceláøské prostory nejvyšší kvality ve støedu mìsta. Uprostøed objektu je klidný dvùr s parkovou úpravou vytváøející unikátní prostøedí pro odpoèinek. Výhodou je výborná dostupnost mìstskou hromadnou dopravou i automobilem. Stanice metra Mùstek (trasa A, B) a Námìstí Republiky (trasa B) se nachází v docházkové vzdálenosti, podzemní parkování v objektu. Ceny jsou uvedeny bez DPH. This exclusive project offers for lease high quality, modern and flexible office space in the city center. At the center of the development is a peaceful landscaped courtyard that provides a unique campus environment. The property has excellent access by car and by public transport. There is underground parking, Mùstek metro station (line A, B), Námìstí Republiky metro station (line B) and several tram stops located close to the property. Prices listed without VAT.

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

COMMERCIAL PROPERTIES

|

KOMERČNÍ NEMOVITOSTI

|

ESTATE | 149


NebytovĂ˝ prostor | PronĂĄjem | KlimentskĂĄ | Praha 1 | NovĂŠ MĂŹsto | 225 m2 | 12.90 EUR / m2 / mĂŹsĂ­c KompletnĂŹ zrekonstruovanĂŠ kancelåøe k pronĂĄjmu v 1. patøe budovy situovanĂŠ v historickĂŠm centru Prahy. Velmi dobrĂĄ dopravnĂ­ dostupnost â&#x20AC;&#x201C; v blĂ­zkosti zastĂĄvky tramvajĂ­, autobusĂš a stanice metra NĂĄmĂŹstĂ­ Republiky (trasa B). Velkou vĂ˝hodou je blĂ­zkost mnoha GÄŁOHçLWĂŹFKILQDQÄ&#x20AC;QtFKDREFKRGQtFKLQVWLWXFtREFKRGÄŁDUHVWDXUDFt.DQFHOiĨVNpSURVWRU\MVRXVYÄ&#x2122;WOpDYHOPLGREĨHGLVSR]LÄ&#x20AC;QÄ&#x2122;ĨHĂĽHQp Ceny jsou uvedeny bez DPH. &RPSOHWHO\UHFRQVWUXFWHGRIILFHVSDFHSUHPLVHVIRUOHDVHRQWKHstIORRURIDEXLOGLQJVLWXDWHGLQWKHKLVWRULFDOFHQWHU9HU\JRRG DFFHVVLELOLW\E\DOOPHDQVRIWUDQVSRUW²WUDPEXVVWRSVDQGPHWURVWDWLRQ1iPÄ&#x2122;VWt5HSXEOLN\ OLQH% MXVWDIHZPLQXWHVZDONDZD\ 7KHDUHDLVVHUYHGE\DQXPEHURIILQDQFLDODQGEXVLQHVVLQVWLWXWLRQVVKRSVDQGUHVWDXUDQWV%ULJKWRIILFHVSDFHLGHDOOD\RXW3ULFHVOLVWHG ZLWKRXW9$7

150

|

ESTATE

|

NEJLEPĹ Ă? NEMOVITOSTI

|

BEST PROPERTIES


Nebytový prostor | Pronájem | Lazarská | Praha 1 | Nové Mìsto | 128 – 1 479 m2 | 9,53 – 11,64 EUR / m2 / mìsíc Kanceláøské prostory k pronájmu v reprezentativní budovì situované v blízkém dosahu Václavského námìstí a Karlova námìstí. Exkluzivitu prostor umocòuje atraktivní lokalita ve finanèním a obchodním centru mìsta, s vynikající dostupností mìstskou hromadnou dopravou a s vlastním parkováním. Budova se nachází v pìším dosahu metra Mùstek (trasa A a B), Národní tøída (trasa B) a Karlovo námìstí (trasa B), tramvajové zastávky jsou pøímo pøed vchodem do budovy. Nájemné je osvobozeno od DPH. Office premises for lease in an administrative building located in close vicinity of Wenceslas Square and Charles Square. The exclusivity of space is enhanced by an attractive location in the financial and commercial center, with excellent access to public transportation and private parking. The building is situated within walking distance of metro station Mùstek (lines A, B), Národní tøída (line B) and Karlovo Námìstí (line B); tram stops in front of the building. The rent is exempt from VAT.

Na Perštýnì 2, 110 00, Praha 1, tel. 724 485 926, 257 328 281, info@svoboda-williams.com

COMMERCIAL PROPERTIES

|

KOMERČNÍ NEMOVITOSTI

|

ESTATE | 151


Otevíráme pobočku v Brně. Kompletní realitní servis při prodeji a pronájmu rezidenčních a komerčních nemovitostí v Brně. Investiční a developerské poradenství.

Best Local Real Estate Agency info@svoboda-williams.com, +420 724 551 238 152

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


Nebytovรฝ prostor | Pronรกjem | Vรญdeรฒskรก | Brno | Brno - jih | 15 โ€“ 1 202 m2 | 192 CZK / m2 / mรฌsรญc Modernรญ kancelรกรธskรก budova splรฒujรญcรญ veลกkerรฉ souรจasnรฉ specifikace a standardy nabรญzรญ k pronรกjmu kompletnรฌ postavenรฉ kancelรกรธe pรธipravenรฉ NRNDPรงLWpPXQDVWฤ™KRYiQt%XGRYDMHXPtVWฤ™QDQDNฤจLรงRYDWFHGiOQLFH'DVLOQLFH(YHVPฤ™UXQD9tGHฤžVSฤจtPรฌPQDSRMHQtPQDGiOQLFL' 3ฤจtPRSฤจHGEXGRYRXMHL]DVWiYND0+'VGRVWXSQRVWtGRFHQWUDFFDPLQXW9EXGRYฤ™MHNGLVSR]LFLFHQWUiOQtUHFHSFHDKRGLQRYiRVWUDKD 0RรงQRVWSDUNRYiQtYSRG]HPQtJDUiรงLDSฤจHGEXGRYRX&HQ\MVRXXYHGHQ\EH]'3+ 0RGHUQDGPLQLVWUDWLYHEXLOGLQJWKDWPHHWVDOOFXUUHQWVSHFLILFDWLRQVDQGVWDQGDUGVERDVWLQJIXOO\EXLOWPRYHLQUHDG\RIILFHV7KHEXLOGLQJLV ORFDWHGDWWKHFURVVLQJRIKLJKZD\'DQGURDG(LQWKHGLUHFWLRQRI9LHQQDZLWKGLUHFWFRQQHFWLRQWRKLJKZD\' WR%UDWLVODYD ,QIURQW RIWKHEXLOGLQJWKHUHLVDSXEOLFWUDQVSRUWVWDWLRQDFFHVVLELOLW\WRFHQWHUDSSUR[PLQXWHV%XLOGLQJDPHQLWLHVLQFOXGHFHQWUDOUHFHSWLRQGHVN DQGKRXUVHFXULW\VHUYLFHV3RVVLELOLW\RISDUNLQJLQWKHXQGHUJURXQGJDUDJHDQGLQIURQWRIWKHEXLOGLQJ3ULFHVOLVWHGZLWKRXW9$7

Biskupskรก 8, 602 00, Brno, tel. 257 328 281, info@svoboda-williams.com

COMMERCIAL PROPERTIES

|

KOMERฤŒNร NEMOVITOSTI

|

ESTATE | 153


Prodej | Jihomoravský kraj | Mikulov | 130 m2 | pozemek 320 m2 |FHQDQDY\çiGiQt 3R]HPHNYìKOHGQD]iPHNY\EXGRYDQìYLQQìVNOHSH[NOX]LYQtORNDOLWDYKLVWRULFNpĀiVWLPęVWD]SUDFRYDQiDUFKLWHNWRQLFNiVWXGLHSRĀtWi VYDULDELOQtPLPRçQRVWPLY\XçLWtSURE\GOHQtLMDNRREFKRGQtSURVWRU\3R]HPHNVURGLQQìPGRPHPYKRGQìPNHNRPSOHWQtUHNRQVWUXNFLĀL YìVWDYEę]FHODQRYpQHPRYLWRVWLVSOQRXREĀDQVNRXY\EDYHQRVWtYEH]SURVWĨHGQtPRNROtDVSHUIHNWQtGRVWXSQRVWtDXWHP]XOLFH%UQęQVNi 3ORWEHDXWLIXOYLHZRIDFKDWHDXZLQHFHOODUH[FOXVLYHDUHDLQWKHKLVWRULFFHQWHUDUFKLWHFWXUDOVWXG\IRUWKHUHQRYDWLRQUHFRQVWUXFWLRQRIWKH SURSHUW\FRXQWVZLWKQXPHURXVSRVVLELOLWLHVRIXVHLQFOXGLQJUHSUHVHQWDWLYHFRPSDQ\DGGUHVVKRXVLQJRUFRPPHUFLDOSUHPLVHV3ORWZLWK DIDPLO\KRXVHVXLWDEOHIRUIXOOUHQRYDWLRQRUFRQVWUXFWLRQRIDFRPSOHWHO\QHZSURSHUW\ZLWKIXOODPHQLWLHVLQWKHLPPHGLDWHYLFLQLW\DQGHDV\ DFFHVVE\FDUIURP%UQęQVNi6WUHHW

154

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


Prodej | Brno | Brno-støed | 223 m2 | pozemek 352 m2 | 9 840 000 Kè 5RGLQQĂŹGÄŁPNNEDONRQ]DFKRYDQpY]iFQpSÄŁYRGQtSUYN\JDUiçSURYR]\DUFKLWHNWRQLFNiVWXGLHNRPSOHWQtUHNRQVWUXNFHVSODWQĂŹP stavebnĂ­m povolenĂ­m. RodinnĂ˝ dĂšm postavenĂ˝ ve 20. letech 20. stoletĂ­ znĂĄmĂ˝mi architekty Ladislavem Fuchsem a Jindøichem KumpoĹĄtem v jednĂŠ z nejatraktivnĂŹjĹĄĂ­ch rezidenènĂ­ch lokalit Brna, v rychlĂŠm dosahu centra i veĹĄkerĂŠ obèanskĂŠ vybavenosti. DĂšm patøí k jednĂŹm z nejzachovalejĹĄĂ­ch staveb KumpoĹĄtova dĂ­la. 4-bedroom family house, balcony, preserved rare original features, garage for 2 cars, project of a complete reconstruction including the building permit. Family house from the 1920â&#x20AC;&#x2122;s, built by renowned architects Ladislav Fuchs and Jindøich KumpoĹĄt, situated in one of the most desirable residential locations in Brno, within easy reach of the center and all amenities. The house belongs to one of the best preserved KumpoĹĄtâ&#x20AC;&#x2122;s buildings.

BiskupskĂĄ 8, 602 00, Brno, tel. 257 328 281, info@svoboda-williams.com

SALE

|

PRODEJ

|

ESTATE | 155


Praha 5-Stodůlky, ulice K Hájům, prodej komerčního pozemku 6072 m2 Prodej zajímavého komerčního pozemku v ulici K Hájům o celkové výměře 6072 m2 v průmyslové zóně v žádané lokalitě Praha 5-Stodůlky. Pozemek je vhodný například pro výstavbu skladů, výrobní haly, autosalonu, sídla firmy, administrativní budovy. Veškeré sítě jsou na pozemku, vydané územní rozhodnutí. Výhodou pozemku je 90% zastavitelnost plochy, výborná dostupnost na MHD a přímý nájezd na dálnici D5. Nabízíme možnost zajištění financování nemovitosti.

Ing. Nela Jírová +420 605 059 271 nela.jirova@fincentrum.com www.fincentrum.com/nela.jirova Kubánské náměstí 1391/11, 110 00 Praha 10

156

|

ESTATE

|

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


BUDOVA ALPHA, BB CENTRUM - PRONÁJEM PRVOTŘÍDNÍCH KANCELÁŘÍ (199 m2 – 2 843 m2) Praha 4, Vyskočilova 2a Cena na vyžádání Budova ALPHA na rohu ulice Vyskočilova a sjezdu z magistrály 5. května je součástí multifunkčního areálu BB Centrum na Praze 4. Prostory k pronájmu disponují veškerými sítěmi, jsou vybavené zátěžovými koberci, klimatizací (4trubkové fancoily) a otevíratelnými okny. Součástí budovy je kantýna, kavárna a střešní terasa se zahradou a příjemným posezením. Vynikající je dopravní dostupnost: autobusová zastávka přímo před budovou (jedna zastávka autobusu od stanice metra Budějovická), přímé napojení na Pražský okruh a dálnici D1. The ALPHA Building, located on the corner of Vyskočilova Street and the exit from the 5. května highway, is part of BB Centrum, a multifunctional complex in Prague 4. Spaces for lease have all networks, are equipped with commercial-grade carpets, air conditioning (4 pipe fan coils), and openable windows. The building has a cafeteria, a café, and a rooftop terrace with a garden and comfortable seating. Excellent transport accessibility: bus stop directly in front (one bus stop from the Budějovická metro station), direct connection to the Prague ring road and D1 highway. Bližší informace

158

|

ESTATE

|

Kateřina Junková, mobil: 607 632 757, email: katerina.junkova@passerinvest.cz, www.bbcentrum.cz

NEJLEPŠÍ NEMOVITOSTI

|

BEST PROPERTIES


NOVÁ KAROLINA PARK - PRONÁJEM PRVOTŘÍDNÍCH KANCELÁŘÍ A OBCHODŮ V CENTRU OSTRAVY Ostrava, 28. října 3348/65 Cena na vyžádání Nový unikátní projekt Nová Karolina Park, nacházející se v centru města přímo u tramvajové zastávky na hlavní ostravské třídě 28. října, nabízí k pronájmu atraktivní kanceláře a obchody již od 40 m2. Průchozí vnitroblok budovy s upravenou zelení, fontánkami a lavičkami navíc slouží jako hlavní trasa pro pěší k největšímu obchodnímu centru a denně jej využije více než 4 000 osob. Vynikající dopravní dostupnost k autobusovému a vlakovému nádraží i přímé napojení na dálniční spojení D1. Nová Karolina Park, a new, unique project located in the city centre directly at a tram stop on Ostrava’s main thoroughfare 28. října, offers attractive offices and shops from 40 sq m for lease. The building’s atrium, with landscaping, fountains and benches, serves as the main pedestrian walkway to the city’s largest shopping centre, and is used daily by over 4000 people. Excellent transport accessibility to bus and train stations, as well as direct links to the D1 motorway junction.

Bližší informace

Naďa Filina, mobil: 724 095 546, email: nada.filina@passerinvest.cz, www.novakarolinapark.cz

COMMERCIAL PROPERTIES

|

KOMERČNÍ NEMOVITOSTI

|

ESTATE | 159


Barton Hills Residence – od/by A Parallel Architecture Místo/Location: Austin, Texas, USA Postaven/Built: 2014 Plocha/Area: 280 m2

Novostavba zasazená do hrany kopce v jižním Austinu se nachází na jednom z nejvyšších míst ve městě a nabízí panoramatický výhled na město i zvlněnou krajinu. Kvůli příkrému svahu je budova částečně zabořena do země, aby umožnila příjezd a parkování aut dole. Zároveň tak byly zvednuty obytné prostory, včetně stíněné střešní terasy. Konstrukce rozdělených úrovní stavbě umožňuje vyhovět omezením daným rozvojem města, zároveň maximálně využít výhledů ven a zajistit soukromí od ulice níže. Budova je vertikálně vrstvena na několik úrovní. Na nejnižší úrovni poskytuje prostor pro vozidla, výše se nachází veřejný prostor a sekundární místnosti pro spaní na úrovni zadního dvora. Skladovací a technické zázemí je na vsunuté 3. úrovni a velkorysá hlavní ložnice s obývacím pokojem a střešní terasou jsou na 4. úrovni. Když člověk vystupuje po centrálním schodišti, má díky těmto vrstvám širokou škálu prostorových vjemů a výhledů. Tektonický design toto vertikální procesí posiluje, počínaje těžkým betonovým 160

|

ESTATE

|

BYDLENÍ 21. STOLETÍ

|

LIVING OF THE 21ST CENTURY


podstavcem, který obsahuje ponořenou garáž a tvoří základy domu. Odhalené ocelové široké vnější nosníky nesou těžkou váhu druhého podlaží a střešní plášť. Konzolové lepené nosníky u střechy se směrem k nebi zužují a orientují tuto úroveň na primární výhled na město. Vestavěné střešní květináče zamezují nežádoucím pohledům z okolí a zajišťují soukromí pro hlavní ložnici. Externí schodiště spojuje střešní terasu se soukromým zadním dvorkem, kde velkorysá krytá veranda stíní okenní zeď orientovanou na západ a slouží jako venkovní obývací pokoj. ▬

LIVING OF THE 21ST CENTURY

|

BYDLENÍ 21. STOLETÍ

|

ESTATE | 161


Nestled into the edge of a hilltop in South Austin, this new construction home sits on one of the highest points within the city limits, offering panoramic skyline and hill-country views. Due to the steep approach to the house, the building is partially sunken into the earth, allowing for vehicular access and parking below, as well as elevated living spaces above, including a deep shaded roof deck. The split-level design allows the building to comply with city development restrictions while maximizing views out and privacy from the street below. The building is vertically stratified across the split-level configuration, housing vehicles on the lowest level, public space and secondary sleeping rooms at the rear yard level above, storage and mechanical on the interstitial 3rd level, and a generous master suite with lounge and roof deck on the 4th. This stratification allows for a wide variety of spatial experiences and view opportunities as one ascends the central stair tower. The tectonic design reinforces this vertical procession, starting with a heavy concrete plinth that retains earth at the sunken garage and becomes the

162

|

ESTATE

|

BYDLENÍ 21. STOLETÍ

|

LIVING OF THE 21ST CENTURY


foundation, exposed steel wide-flange beams which support the heavy loads of the second story and roof deck, and cantilevered glulam beams at the high roof, that taper up to the sky and orient this level to its primary downtown view. Built-in rooftop planters screen undesirable neighboring views while offering privacy to the master suite. An exterior stair connects the roof deck with the private rear yard, where a generous covered porch shades the west-facing window wall and serves as an outdoor living room. ▬

LIVING OF THE 21ST CENTURY

|

BYDLENÍ 21. STOLETÍ

|

ESTATE | 163


Anglický park, provensálská kosmetika:

OÁZA KLIDU NA VYSOČINĚ 164

|

ESTATE


L

uxusní butique hotel na Vysočině by čekal asi málokdo. Zámek v Herálci však není jen tak ledajaký pětihvězdičkový hotel. Uprostřed uzavřeného anglického parku

se ocitnete na místě neuvěřitelného klidu, pohody a odpočinku. Ke snídani si pochutnáte na domácím pečivu, k obědu na steaku z místní produkce, přes den můžete relaxovat ve Spa provoněném lokálními bylinkami nebo třeba vyrazit pást ovce. Večer pak můžete posedět na příjemné venkovní zahrádce se sklenkou dobrého vína. A po

celou dobu si zde připadáte tak nějak jako doma. Přijeli jsme na pozvání paní majitelky Alexandry Kasperové. Když nás v zámku Herálec přivítala, měla v ruce kolečko se zahradním nářadím a na nohou stylové holínky. “Jdu se trochu podívat na naše růže”, řekla, a my jsme šli s ní. Kromě toho, že hotel nabízí túry na kolech, která jsou k dispozici přímo v hotelu, nebo túry pěší s hotelovými „nordic“ hůlkami, poskytuje pro své hosty i farmářské výlety za svými dodavateli. V blízkém okolí sídlí dodavatel hovězího masa, několik kozích farem, vše místní a autentické, neboť majitelé si potrpí na kvalitu. Hoteloví hosté si také mohou vychutnat vyjížďky a pohledu ze hřbetu koní z nedalekého hřebčína. “Když spouštíte projekt uprostřed ničeho, kde v zásadě do té doby ani nebyl turistický ruch, musíte od začátku přemýšlet, co by zde vaši hosté mohli dělat. Vysočina není nijak vyhlášeným a vyhledávaným místem, kam by turisté dojížděli, byť je nádherná, a dosud myslím nedoceněná a neobjevená. Vlastně jsme museli od začátku dělat i destinační marketing, který můžete dělat několika způsoby. Jednou z možností je představení toho kraje pomocí lidí, kteří v něm žijí. Přestože jsou zde i historické památky, ne však pro každého jsou cílem. Vše vznikalo přirozeně, nic násilného. A tak jsme našli i dodavatele skopového, jehněčího i králičího. I vejce a mléko bereme z farem”, říká paní Alexandra. Originálním příkladem jsou například čerstvé dalamánky, které jsou součástí balíčku „Běž pást ovce“. “Náhodou jsme objevili skvělou farmu u Humpolce, kam opravdu lidi vybavujeme uzlíčkem s čerstvým dalamánkem, sýrem z Úhořilky a čerstvě napečenými povidlovými buchtami. Nemají ani piknikový košík. Klienti jsou z toho nadšeni. Jedou na farmu, kde se pasou ovce. Mohou si vzít ze zámku i holínky, kdyby nebylo suché počasí, aby si ESTATE | 165


nezablátili své boty”, dodává paní majitelka. Zajímavý je i příběh, jak postupně měnili hotelové pečivo. “Chtěli jsme péct vlastní chléb a housky, ale to je docela náročný proces. Když se rozhodnete to dělat, tak to musí fičet, musí to mít svého pána. Náhodou jsme zjistili, že jedna zaměstnankyně, která v kuchyni myla nádobí, je bývalá pekařka. A tak jsme s ní najednou začali péct skvělé housky, chleba a dalamánky. Byli jsme spokojeni s kvalitou a najednou jsme objevili i dodavatele čerstvé mouky od majitele rodinného mlýna ve Střížově. A kvalita našich housek zase o málo stoupla. Vždy je důležité, aby vstupní suroviny, se kterými pracujeme, byly kvalitní. A nás samozřejmě hřeje u srdce, že jsou navíc místní”, říká s radostí Alexandra. Dnes mají v Herálci téměř všechny suroviny z vlastní produkce nebo od místních dodavatelů, jako třeba maso od místního řezníka nebo domácí sušenky, které každý host dostává na rozloučenou. “Mohli bychom dovážet kvalitní suroviny třeba z Francie nebo Itálie, kde je úroveň 166

|

ESTATE


LUXUSNÍ

terasy

®

ESTATE | 167


gastronomie úžasná, kde je i širší portfolio toho, s čím můžete pracovat. Ale pak nejste regionální, nejste místní. Ale přesto si myslím, že naše kuchyně je důkazem toho, že i u nás se dají vykouzlit dobré a nádherné věci. Naše gastronomie je česká, i když samozřejmě trochu šmrncnutá dalšími kuchyněmi, tomu se nevyhnete”. Letos majitelé založili i zeleninovou zahradu a restauraci začali zásobovat vlastní zeleninou. “Na poli jsme zasázeli pět druhů brambor, dýně a založili jsme i nádhernou zeleninovou zahrádku tzv. „Le potager“. Každá ta rostlinka, zejména bylinka, potřebuje čas, je to klasická zahrádka ve francouzském stylu”, dodává. Na zahrádku jim rády chodí pomáhat i babičky z místní vesnice. V klidové zóně hotelového Spa můžete objevit ručně vyrobené herbáře a do krabic pečlivě roztříděné bylinky. “Na začátku jsme založili hodně bylinných zahrádek. Máme zde i staré lípy, které jsou nádherné. Z našich surovin nám osoby k tomu kompetentní míchají čaje, které jsou k dispozici našim hostům“. Pouze kosmetika na pokojích není místní. Tu dodává francouzská společnost, která se specializuje na nejkvalitnější přírodní výrobky. “Chtěla jsem k nám od začátku získat francouzskou značku L’Occitane a podařilo se mi to. Oslovilo je naše zaměření více k přírodě a tak jsme se domluvili a bylo u nás otevřeno první L’Occitane Spa v ČR, což je pro nás velká věc”. Začátky Chateau Herálec nebyly pro vznik hotelu vůbec typické, vzpomíná paní Alexandra. “Tehdy jsme s manželem podnikatelsky působili na Vysočině. Byli jsme unaveni stálým cestováním a bydlením po hotelích. Navíc jsme cítili pocit vykořenění a rozhodli jsme se, že si na Vysočině uděláme druhé středisko životních zájmů a že koupíme dům, který si zrenovujeme. Dostávali jsme různé tipy, běžte se podívat tam. Nic jsme ale nenašli. Až jednou jsme se doslechli o tom, že by se v Herálci měl dražit zámek, který patřil státu. Tak jsme sem jeli a já málem omdlela už u brány. Ta rozlehlost! To nebyl dům na bydlení. Můj muž je ale takový ten šílenec, a zavelel, že když už jsme tady, tak si to projdeme. Mne to tehdy vůbec neokouzlilo, bylo to takové vlhké, studené a omšelé. Budova chátrala, střechou teklo dovnitř. Mého muže to tehdy naopak 168

|

ESTATE


jejich oslovení přímo nabízelo. Mám velmi ráda kreativní lidi, kteří umí přemýšlet ve velkém, ale s minimalistickými výrazovými prostředky. Měla jsem od začátku jasno v tom, že nechci kudrlinkovat, že to chci vyčistit, že to musí být dokonce až pro někoho možná asketické, ale ta čistota byla pro mne velmi důležitá. Chtěla jsem, aby byl hrdinou ten zámek, ta budova, třeba někde štuky, někde klenby, nerovná stěna, ale aby měl člověk šanci si toho všimnout, protože to je to, co je dnes krásné, to, co dnes v nových objektech nenajdete. A v tom jsme se shodli všichni. Celý proces nebyl o diktátu jedné nebo druhé strany, byl to dialog mezi oběma stranami. Nemyslím si, že je správná pozice, když investor diktuje. Ale nemělo by to být ani opačně. Návrhem scénografů bylo, že se v zámku v interiérech budou instalovat velkoplošné tapety jako skutečné kulisy. Řekli jsme si, ano, rozehrajeme tady divadlo a bude to čisté a jasné. Měli jsme i architekta, který vše kreslil a traffic managera, který všechno ostatní zajišťoval. Logisticky tedy skvěle vyskládaný tým”. Za srdce projektu si zvolili kapli, fresky z osmnáctého století od známého českého freskaře Pátera Noseckého, který má svá díla například v Želivském klášteře. Fresky se nafotily, upravily a různé detaily se poté měly instalovat v prostorách. “Když mi ale začali nosit ty instalace, najednou jsem se lekla. Ta velkolepost, kterou pocítíte, když vstoupíte do vstupní haly, uvidíte tam ty anděly stylizované barevně a řeknete si, to je krása. Ale když je toho moc, tak to není dobré. Anděly jsme tedy nechali jen dole a do ostatních prostor jsme museli najít jiný výrazový prostředek. Kluci oslovilo, a tak jsme si nakonec řekli, že zámek koupíme a uděláme z něj hotel. Za dva a půl roku jsme zámek, který je na seznamu národních kulturních památek, úspěšně zrekonstruovali”. Ještě zajímavějším příběhem je vznik myšlenky tematicky propojit jednotlivé pokoje s obrazy. “Základem interiérového výsledku tohoto projektu bylo rozhodnutí nepracovat s interiérovými designéry, byť je mám v úctě a určitě je mezi nimi spousta úžasných a šikovných lidí, kteří by si i s tak velkým objektem poradili. Když ale pracujete s takto velkým prostorem, musíte oslovit profesionály, kteří s ním umí pracovat. Už dříve jsem měla z předchozích spoluprací velmi dobrou zkušenost s divadelními scénografy a zde se ESTATE | 169


navrhli, že nafotíme zdejší přírodu, pohra-

jsme s galerií smlouvu o výpůjčce. Podle ba-

jeme si s fotkami, které budeme podobným

rev obrazů jsme poté volili i barvu pokojů”.

hostům ale i originální služby, které jsou

principem instalovat na pokojích. Líbilo

Základem dobrého hoteliérství je podle

ryze jejich. Je tomu tak například v jejich

se mi, že budeme moci individualizovat

Alexandry Kasperové nejen osobní přístup,

přístupu ke psím hostům často cestujících se

pokoje, zároveň jsem ale nechtěla, aby to

což je zejména u butikových hotelů doslova

svými pány.

bylo silové řešení. Při každém fotografování

podmínkou.

bylo tak ošklivé počasí, že to nevycházelo.

„Je tu i příležitost, méně pokojů rovná se

Majitelé Chateau Herálec poskytují svým

“Máme zde velký prostor, obrovskou zahradu, a vždy o víkendu, kdy je zde plně

V té době se mi o projektu hodně zdálo,

limitovaný počet hostů, kterým je možné se

obsazeno, se mezi hosty objeví i majitelé

a měla jsem pocit, že to focení nebude ono,

individuálně věnovat“, dodává.

pejsků. Většinou jsou to psi dobře vycho-

asi možná i proto, že do té doby nic konkrét-

“Cestujeme s manželem po světě s ote-

vaní. My máme rádi i chlupaté hosty, a tak

ního nepřišlo. A nabyla jsem dojmu, že by

vřenýma očima a spoustu věcí, které zde

jsme zavedli kroniku chlupatých hostů.

fototapety nakonec mohly být i kýčové. Při

realizujeme, jsme viděli někde jinde. Ale

Fotíme psí hosty a jejich majitelé jsou

jednom sezení nejzkušenější scénograf Jož-

není to pouhé kopírování. Je to o tom, že

velmi šťastni. Máme pro ně i uvítací proces,

ko Ciller navrhnul, že by ta příroda mohla

když někdo dělá něco líp, nebo ho napad-

v rámci kterého dostanou misku s vodou

projít malířským ztvárněním. A to bylo ono!

lo něco, co vás ne, tak proč to nepoužít

a tuňákovou sušenku pečenou u nás na zám-

Stylizovat malby na plátně - obrazy. Pocho-

v našem hotelu. Cílem je mít v našem hotelu

ku. Na pokoji jsou jim k dispozici ručníky

pili jsme, že je to realizovatelné”.

spokojeného a šťastného hosta“.

poskládané do tvaru pejska a psí uvítací do-

Paní Alexandra navrhla kontaktovat místní galerií, která by jim propůjčila obrazy. Měla štěstí na tehdejšího ředitele Oblastní

pis. A na cestu zpět dostávají pejsci balíček psích sušenek“. „Stále je možné něco nového vymýšlet,

galerie Vysočiny, kterému se nápad líbil,

jak potěšit své hosty a to nás baví”, dodává

podpořil jej a z depositů navrhl sto padesát

na závěr paní majitelka. ▬

děl k výběru. “Skončili jsme u osmnácti obrazů pro pokoje a další prostory. V galerii jsme obrazy fotili a poté přetahovali na velkou plochu tapet”. Druhou vysněnou částí plánu paní majitelky byla myšlenka, že před pokoji budou viset obrazy - originály toho, co je uvnitř. „Obrazy budou splňovat to co mají, budou těšit lidi. Být galerií v hotelu s jasnou myšlenkou. Nakonec to dopadlo, podepsali 170

|

ESTATE


ESTATE | 171


Hotel Greulich, Zurich, 2002–2003 © VOGT Landschaftsarchitekten, Christian Vogt

LANDSCAPE Galerie Jaroslava Fragnera představí letos již třetí ročník výstavního cyklu Landscape Festival Praha 2015. Stejně jako loni se koná na Nákladovém nádraží Žižkov. Úspěšný projekt, který vloni navštívilo téměř 30 000 návštěvníků, potrvá až do 27. září letošního roku.

Letošní ročník festivalu bude prezentovat veřejný prostor a krajinu pomocí médií fotografie, designu a současného výtvarného umění. Česká veřejnost má velký zájem o kvalitu veřejného prostoru, který je významným činitelem při rozvoji společnosti. Návštěvníci se mohou těšit na jedinečnou výstavu o současném švýcarském krajinářství, řadu přednášek, workshopů či projekcí. Velmi důležitým faktorem byla účast jak profesionálních architektů a umělců, tak zapojení mnoha dobrovolníků, neziskových organizací a studentů. V letošním roce se festival bude konat ve třech lokalitách – Praha 1, Praha 3 a Praha 6. ▬ 172 | ESTATE


This summer,

The Jaroslav Fragner Gallery introduces the 2015 Landscape Festival Prague — already the third in this exhibition cycle. Like last year, the Festival will be held in the Žižkov freight station. This successful event, attended by almost 30 000 people last year, will be open until 27th September.

FESTIVAL

2015

Las Margas Park, Latas, 2005 – 2008 © Verzone Woods Architectes

Stadlerstrasse, Weiach, 2009 © vi.vo. architektur.landschaft

www.gjf.cz

ESTATE | 173


Soukromá zahrada / Private garden,Langenthal, 2004 © w+s Landschaftsarchitekten

This time, the Festival presents public space and landscape through the media of photography, design and contemporary visual art. The Czech public is concerned about the quality of public space — an important feature in the development of society. Visitors can look forward to a unique exhibition of contemporary Swiss landscaping, as well as a series of lectures, workshops and screenings. Significant factors are both the participation of professional architects and artists, as well as the involvement of many volunteers, non-profit organisations and students. The Festival will be held in three locations – Prague 1, Prague 3 and Prague 6. ▬ Irchel Park, Zurich, 1980 – 2011 © asp Landschaftsarchitekten AG Zurich, Patricia Nydegger

The Sofa Experience/ Praha-Dejvice, foto © GJF

174 | ESTATE


Kรกvovรฉ kurzy

pro Baristy zdarma!                  ! 

 "  # $% $$& '

www.lucaffe.cz 600 porcรญ kรกvy a profesionรกlnรญ kรกvovar za 1,-K 7 201,-K      



ESTATE | 175


ISSN 1802-8217 Czech Republic CZK 95 Eurozone € 4,50 Great Britain £ 3,50 Redakce a obchodní oddělení Desk and Commercial Department Conventia Events, s.r.o. Badeniho 290/1 160 00 Praha 6 Czech Republic www.estatemagazine.cz Šéfredaktor / Editor In Chief Dana Hradecká Art Director Lucie Batková luciebatko@gmail.com Produkce / Production Milan Novák novak@bonafide.cz Redaktor / Editor Dana Hradecká Jazyková redakce / Proof-copy Dana Hradecká

Obchodní oddělení / Commercial Section Michaela Knappová knappova@estatemagazine.cz Předplatné / Subscriptions info@estatemagazine.cz Sídlo společnosti / Headquarters Conventia Events, s.r.o. Badeniho 290/1 160 00 Praha 6 Czech Republic Zastoupení v Londýně London Representation Kamila Vykydalová Great Chapel Street 21 W1F 8FP London United Kingdom Vydavatel ani redakce neodpovídá za obsah inzerce. Žádná část z obsahu tohoto časopisu nesmí být kopírována ani jakýmkoli způsobem rozmnožována bez  písemného souhlasu vydavatele. Titulní foto Jiří Hurt Překlady / Translation Viktor Horák viktorhorak@bonalingua.cz

176

|

ESTATE


Profile for Conventia Events s.r.o.

ESTATE - The Prague Magazine 7/2015  

ESTATE - The Prague Magazine 7/2015

ESTATE - The Prague Magazine 7/2015  

ESTATE - The Prague Magazine 7/2015

Advertisement