Page 1

Magazin für Design, Hotel-

und Restauranteinrichtung, Ausstattung, Technik und Spa

BAUVE Medien GmbH & Co. KG

Bahnhofstraße 57

D-86807 Buchloe (Bayern)

info@bauve.de

www.bauve.de

Einzelverkaufspreis € 9,90

22. Jahrgang

Ausgabe 06 / 2018 // November / Dezember // ZKZ 21967 (Deutschland) // Plus.Zeitung 12Z039463 P (Österreich) // ISSN 2194-1335 // Post-Nr. 06-18 objekte

Messevorschau 2019 Special Seite/Page 28

Willkommen im Dschungel

Luxus und Eleganz

Seite/Page 14

Seite/Page 42

Welcome to the Jungle Objektbericht / Property Feature

Luxury and Elegance Case Study


8. – 11. 1. 2019

Inspired by:

FUROSHIKI Innovationen und textile Lösungen für Innenarchitekten, Architekten und Hospitality Experten. Mehr erfahren: heimtextil.messefrankfurt.com


INNOVATION DESIGN SERVICE

Editorial Deko Stoffe - Design - Entwicklung Weltweite Logistik - Warehousing

Traditionell Dekorationsstoffe

TamaraSyptroth Objektleitung„hotelobjekte“

Aufschwung LiebeLeserinnen,liebeLeser, wie der fünfte Global Travel Forecast zeigt, der jährlich von der GBTA und Carlson Wright Travel mit Unterstützung der Carlson Family Foundation veröffentlicht wird, führt der prognostizierte Aufschwung der Weltwirtschaft im kommenden Jahr nicht nur zu einem Zuwachs im Flugsektor, sondern gleichzeitig auch zu einer größeren Nachfrage nach Hotelzimmern. Für Westeuropa wird beispielsweise mit einer Preissteigerung von 5,6 Prozent für Hotelübernachtungen gerechnet. Ein aus Sicht der Hoteliers in Deutschland erfreulicher Trend, der bereits jetzt zu beobachten ist – wie unsere Fachbeiträge zu Hotelpreisentwicklung und Marktwertanalyse deutlich machen. Ein guter Zeitpunkt für Sie als Hotelbetreiber, ein vielleicht schon länger geplantes Umbauoder Modernisierungsprojekt in Angriff zu nehmen. Zumal die Hersteller auf den wichtigsten branchenrelevanten Messen zu Beginn des Jahres wieder jede Menge Neuheiten im Gepäck haben. Wir haben uns umgesehen und zeigen Ihnen in unserem Special, welche Trends unter anderem auf der Heimtextil, der DOMOTEX, der HOGA, der imm cologne, der Maison&Objet Paris oder der EuroCIS zu sehen sein werden und möchten Ihnen gerne einige interessante Lösungen näher vorstellen. Auch für diese Ausgabe haben wir wieder einige Beispiele für besonders gelungene Neuund Umbauten gefunden und möchten Sie diesmal auf eine Reise von Warschau über Lausanne, Rhodos und weiter nach Kuala Lumpur bis ins australische Melbourne mitnehmen – als Inspiration oder Anregung für Ihr eigenes Projekt. Mit der nächsten Ausgabe werden auch wir uns einem Facelift unterziehen und freuen uns, Ihnen unser neues Logo sowie die neue Kategorie F&B-Trends zu präsentieren. Ich wünsche Ihnen ein erfolgreiches Weihnachtsgeschäft, einen guten Start ins neue Jahr und natürlich viel Spaß beim Lesen dieser Ausgabe.

Upturningtimes Dearreaders, As shown by the fifth Global Travel Forecast, published annually by GBTA and Carlson Wright Travel with the support of the Carlson Family Foundation, the predicted upturn in the global economy next year will not only lead to growth in the aviation sector, but also to greater demand for hotel rooms. For Western Europe, for example, a price increase of 5.6 percent is expected for hotel overnight stays. From the point of view of hoteliers in Germany, this is a pleasing trend that can already be observed, as evidenced by our specialist articles on hotel price development and market value analysis. A good time for you as a hotel operator to tackle a conversion or modernisation project that may have been planned for some time. Especially since manufacturers are showcasing a large number of novelties at the most important trade fairs relevant to the industry at the beginning of the year. We have looked around and in our Special, we will show you which trends will be on display at Heimtextil, DOMOTEX, HOGA, imm cologne, Maison&Objet Paris and EuroCIS, among other trade fairs, and would like to introduce you to some interesting solutions. For this issue we have once again found some examples of particularly successful new buildings and conversions, and this time we would like to take you on a journey from Warsaw via Lausanne, Rhodes on to Kuala Lumpur and on to Melbourne in Australia, to offer you some inspiration for your own project. Also, our next issue will undergo a facelift and we look forward to presenting you with our new logo and the new category F&B Trends. Here’s to a successful Holiday Season and a great start into the new year. I hope you enjoy this issue!

Kollektion Evelina Antuono

Individuell

Fertigung nach Maß

Duschvorhänge

Sensationell 360° Öko-Textilien

Unter dem geschützten Markennamen OceanSafe™ werden zum ersten Mal textile Endprodukte präsentiert, die über die gesamte Wertschöpfungskette (Lebenszyklus) hinweg, unter strengsten ökologischen Kriterien absolut schadstofffrei generiert wurden. Dies gilt für den Anbau, die Verarbeitung, die gesamte Konfektionierung und die rückstandsfreie Rückführung in den Kreislauf. In Zertifizierung Cradle-to-Cradle Certified TM

HALLE 8.0, STAND D74

Herzlichst / Sincerely, Deco Design Fürus GmbH Adolf-Dembach-Straße 5 D-47829 Krefeld Germany

www.dialog-ddf.info/oceansafe


Inhaltsverzeichnis/Contents Magazin für Design, Hotel-

August // Juli/ 04/2018

land) 7 (Deutsch ZKZ 2196

.Zeit // Plus

ung 12Z0

39463

P (Österrei

te 04-18 objek Post-Nr. -1335 // ISSN 2194 ch) //

Ausgabe 06 / 2018 // November / Dezember // ZKZ 21967 (Deutschland) // Plus.Zeitung 12Z039463 P (Österreich) // ISSN 2194-1335 // Post-Nr. 06-18 objekte

22. Jahrgang

Ausgabe

//

und Restauranteinrichtung, Ausstattung, Technik und Spa

und Restauranteinrichtung, Ausstattung, Technik und Spa

Einzelverkaufspreis € 9,90

hnik und Spa

und Restauranteinrichtung, Ausstattung, Technik und Spa

(Deutschland

) // Plus.Ze itung 12Z039

463 P (Österr

eich) // ISSN 2194-1335 // Post-Nr. 05-18



Titelthema/CoverTopic

objekte

info@ bauve

.de

tober // ZKZ 21967

Magazin für Desig

n, Hotel-

H

Aufatmpenbreath

Seite/P

n & Matratze Betten ttre sses

n BAUV E Medie

www.ba uve.de

rg ay, Hambu

Fonten The age 16

tion

Contribu Take a dee ag/Expert Fachbeitr ge 44 Seite/Pa

Beds & Ma Special28

D-86807 Buchloe (Bayern )

info@ba uve.de

ge Seite/Pa

06 / 2018

// November

/ Dezember

nd) 7 (Deutschla // ZKZ 2196

// Plus. Zeitu

ng 12Z0

Nr. // Post2194-1335 ) // ISSN (Österreich 39463 P

06-18 objek



Aufschwung Upturningtimes

Bahnho fstraße

Luxus und Eleganz

Seite/Page 14

Seite/Page 42

Luxury and Elegance Case Study

Kassen & Hotels

Seite/Page 28

SKYFOLDvonDORMAHüppe

The fully automatic vertical moveable wall system

6

100JahreKaldewei

Hotelneueröffnungen/NewHotels

8

Produktneuheiten/NewProducts

10

2018 blickt die Franz Kaldewei GmbH & Co. KG auf ihre erfolgreiche 100-jährige Firmengeschichte zurück



www.b auve.d e info@b auve.d

24

100yearsofKaldewei In 2018, Franz Kaldewei GmbH & Co. KG is looking back at 100 years of business success

Objektbericht/PropertyFeature

WillkommenimDschungel Welcometothejungle

15

W Kuala Lumpur

rn) Buchl oe (Baye

22

SKYFOLDbyDORMAHüppe

Pinnwand/BulletinBoard

e

Einzel verka

3

Akustiklösungen für Hotels Acoustics

Solutions for Hote ls Fachbeitrag/E xpert Contrib Seite/Page 46 ution

Firmen-/Produktpräsentation Company-/ProductPresentation

Das vollautomatische vertikale Trennwandsystem 

Seite/Page 16

oftware POS Systems & Hotel Software Special



te

Glamouröse teinrichtung, Ausstattung, Technik und Spa stauranMeisterwer und Res The Bul elgarHot k i Ho Design, tel, Shanghai Magazin für

ang 22. Jahrg F 9,90BAUVE Medien GmbH & Co. KG

Seite/Page 28

Welcome to the Jungle Objektbericht / Property Feature

AusgabeNovember/Dezember2018

Editorial/Editorial

Branchennews/BrancheNews

ufspre is

Special Willkommen im Dschungel

richtung, Auss

57

Ausgabe

28

Messevorschau 2019

und Restaurantein

tattung, Technik dtund Spa esta ie Hans d n a e g omma

Co. KG GmbH &

Einzelve rkaufsp

Buch loe reis F 9,90 D-86 807 raße 57 22. Jahrgan g Bahn hofst

(Baye rn)

Messevorschau2019 Previewexhibitions2019

BAUVE Medien GmbH & Co. KG

18 // Septem ber/Ok

www. bauve

.de

Ausgabe 05/20

Bahnhofstraße 57

Einze lverk

aufsp reis

D-86807 Buchloe (Bayern)

€ 9,90

info@bauve.de

ang 22. Jahrg

Magazin für Design, Hotel-

www.bauve.de

ttung, Tec

tung, Aussta

ranteinrich

und Restau

, Hotel-

Design Magazin für

Magazin für Design, Hotel-

DigitalerZimmerservice mitgastronovi

25

Mehr Komfort für Hotelgäste

Digitalroomservicewithgastronovi

D-868 07

More comfort for hotel guests

& Co. KG n GmbH BAUVE Medie

Bahnh

57 ofstra ße

chau 2019 Messevors Specgeial28 Seite/Pa

gel n im Dschun Willkomtome the Jungle ture Welcome perty Fea richt / Pro Objektbe 14

TropischvitaleEleganzmitFliesen vonAgrobBuchtal

26

Keramikfliesen überzeugen im Oasia Hotel Singapur

d Eleganz Luxus unEleg ance

Tropicalelegancefullofvitality withtilesofAgrobBuchtal

Luxury and dy Case Stu e 42 Seite/Pag

e Seite/Pag

Ceramic tiles convince at the Oasia Hotel Singapore

Das Fachmagazin für Planung, Ausstattung und Einrichtung im Hotel und Restaurant The Magazine for Hotel and Restaurant Planning, Furnishings and Equipment

Don’t miss the online edition!

www.bauve.de 4

hotel objekte –

Impressum ISSN 2194-1335 (hotel objekte) Kurzcharakteristik:

hotel objekte liefert Informationen und Hintergründe über aktuelle nationale und internationale Hotelprojekte, Hotelarchitektur und -design, Hotelausstattung und -einrichtung sowie Facilitymanagement. In Fachbeiträgen und Praxisberichten werden interessante Interviews mit bekannten Architekten, Hotelmanagern, Hoteleigentümern und Hotelausrüstern umfangreich behandelt. Specials zu Neuheiten und Produkten aus allen relevanten Bereichen liefern Ausstattern, Veranstaltern und Messen eine wichtige Informationsplattform. Die Auflage von 12.100 Exemplaren erscheint im Verbreitungsgebiet D-A-CH (in deutscher und englischer Sprache) und wird auch im Abonnement verkauft. Quick info: hotel objekte provides information about current national and international hotel projects, hotel design, equipment, facilities and technical details. Interesting and beautiful property and practice reports and interesting interviews inspire our readers to plan and realize hotel rooms that make their guests feel good. We are also an important source of information for planners and exhibition organizers.

Verlag / Herausgeber: BAUVE Medien GmbH & Co. KG, Bahnhofstr. 57, D-86807 Buchloe Telefon +49 (0) 82 41-99 88 4-0, Telefax +49 (0) 82 41-99 88 4-1 00 Internet www.bauve.de, E-Mail info@bauve.de Geschäftsführerin: Ines te Heesen

Verlagsleitung: Hannelore Syptroth

Objektleitung: Tamara Syptroth E-Mail ts@bauve.de, Telefon +49 (0) 82 41-99 88 4-1 20 Medienberatung: Andrea Gutsche E-Mail hotel-objekte@bauve, Telefon +49 (0) 82 41-99 88 4-1 40 Redaktion: Tamara Syptroth, Julia Brey E-Mail redaktion-ho@bauve.de, Telefon +49 (0) 82 41-99 88 4-1 20 Übersetzung/Schlussredaktion: Tanya Quintieri Telefon +49 (0) 82 41-99 88 4-0 Satz/Layout/Grafi k: Markus Miller E-Mail mm@bauve.de, Telefon +49 (0) 82 41-99 88 4-1 40 Druck/Vertrieb: W. Kohlhammer Druckerei GmbH + Co. KG, Augsburger Straße 722, D-70329 Stuttgart Telefon +49 (0) 7 11-32 72-1 00, Telefax +49 (0) 7 11-32 72-1 04




Special/Special

Messevorschau 2019 Preview exhibitions 2019 



28

40

Like living on a yacht

A quiet hotel room is not the only thing guests wish for. They expect holistic acoustic quality.

Volumen investmentrelevanter  Hotels wächst

48

Traditionelle Hotellerie setzt Wachstumskurs ­unbeirrt fort – trotz Airbnb

Abet Laminati provides yacht feeling at the Mövenpick Hotel Lausanne

Investable hotel market grows 42

Traditional hotel industry continues its growth course – despite AirBnB

Im Hotel Raffles Europejski verbinden Dornbracht-Armaturen Tradition und Moderne

Hotelpreise im Vergleich

Luxury and elegance in the heart  of Warsaw

Aktuelle Entwicklungen für Deutschland, Europa und die Welt

51

Hotel prices compared

At the Hotel Raffles Europejski Dornbracht fittings span traditional and modern

Organisches Design als Hommage  an die Natur

46

For good acoustics in the hotel

Abet Laminati sorgt im Mövenpick Hotel Lausanne für Yachtfeeling

Luxus und Eleganz im Herzen W ­ arschaus

Für eine gute Akustik im Hotel Ein ruhiges Hotelzimmer ist nicht der einzige Wunsch der Gäste. Sie erwarten ganzheitliche ­akustische Qualität

Case Studies/Case Studies

Wohnen wie auf einer Yacht

Fachbeiträge/Expert Contributions

Current developments for Germany, Europe and the world

44

Im Olympic Palace Resort Hotel auf Rhodos ­überzeugen Armaturen von Fir Italia

Organic design as a tribute to nature The Olympic Palace Resort Hotel in Rhodes boasts fittings by Fir Italia



Rubriken/Rubrics

Impressum/Imprint Einkaufsführer/Service List Anbieter von A–Z/Suppliers from A to Z

Veranstaltungskalender/ Event Calendar Vorschau/Outlook

Bildnachweis und Illustrationen: (Titel, S.  4 oben, S.  42  –  43) Dornbracht/Fotograf: Juliusz Sokołowski, (S. 4 unten) Marriott International Inc., (S. 5 links) DOMEDECO, (S. 5 rechts) Koelnmesse GmbH, Thomas Klerx, (S. 6 oben) H-Hotels.com, (S. 6 Mitte) The Ritz-Carlton Hotel Company, L.L.C., (S. 6 unten) Travel Charme Hotels & Resorts, (S. 7) Mario Andreya, (S. 8 oben) EXKi, (S. 8 unten) Shangri-La Hotels and Resorts, (S. 9) klosterbraeu.com, (S. 10 oben) Forbo/Starck Network/Sophie Delaporte, (S. 10 Mitte) Kettal, (S. 10 unten) Tante Lotte Design GmbH, (S. 11 oben) Skipper Furniture AB, (S. 11 unten) leet design, (S. 12 oben) arrmet, (S. 12 Mitte) Cizeta, (S. 12 unten) Leolux LX, (S. 13) Klöber, (S. 40 – 41) ABET LAMINATI S.p.A., (S. 44 – 45) Fir Italia, (S. 46) Shutterstock/Sangasaeng, (S. 47) Fraunhofer- Institut für Bauphysik IBP (S. 48, S. 50 oben) Union Investment Real Estate/bulwiengesa, Mai 2018, (S. 50 unten links) bulwiengesa, (S. 50 unten rechts) Union Investment Real Estate, (S. 51 – 53) HRS GROUP, (S. 58) Kaldewei/Marina Bay Sands Einsendungen: Für unverlangt eingereichte Manuskripte gibt es keine Gewähr. Sie gelten in jeder Hinsicht der Redaktion zur freien Verwendung überlassen. Namentlich gekennzeichnete Artikel geben nicht unbedingt die Meinung der Redaktion wieder. Eine Verwertung der in hotel objekte veröffentlichten Beiträge ist unzulässig. Nachdruck von Text und Abbildungen zum Zwecke der Werbung, für Fernseh- und Funksendungen, Filme, Übersetzungen, Vervielfältigung, Vorträge und das Speichern auf Datenverarbeitungsanlagen ist, auch auszugsweise, ohne Zustimmung des Verlages nicht gestattet. Das Recht des Zitierens bleibt hiervon unberührt.

4 54 58 58

Titel: Der Titel hotel objekte ist urheberrechtlich geschützt und Eigentum der BAUVE Medien GmbH & Co. KG. Das gilt für die Schreibweise, den Aufbau, das Layout, die Art und Weise der Erscheinung und den Verwendungszweck. Das Logo und den Titel anderweitig zu verwenden, zu verfälschen oder zu ändern ist nur mit ausdrücklicher Genehmigung der BAUVE Medien GmbH & Co. KG zulässig. Bei Nichtbeachten wird Schadenersatz geltend gemacht. Leserzielgruppen: Architekten und Innenarchitekten, Bau­ i n­ genieure, Fachplaner, Facilitymanager, Hotelausrüster, Hotelberater, Hotel­betreiber und Hotelmanager, Investoren und Projektentwickler. Abonnements: abo@bauve.de Telefon +49 (0) 82 41-99 88 4-0, Telefax +49 (0) 82 41-99 88 4-1 00 Abonnementpreise (Inland): € 44,– inkl. 7 % USt. und Versandkosten (Einzelverkauf € 9,90 inkl. 7 % USt. zzgl. Versandkosten) Abonnementpreise (Ausland): € 44,– exkl. USt. zzgl. € 18,50 Versandkosten und € 12,50 Bankspesen* (Einzelverkauf € 9,90 exkl. USt. zzgl. Versandkosten und Bankspesen) (* in Nicht-Euro-Ländern) Gültige Anzeigenpreisliste: Vom 01.01.–31.12.2018 Abolaufzeit: Die Abonnementdauer beträgt ein Jahr. Das Abonnement verlängert sich automatisch um ein weiteres Jahr, wenn es nicht bis sechs Wochen vor Ablauf eines Bezugsjahres schriftlich gekündigt wird.


Pinnwand

Branchennews H-Hotels.com ExpansioninÖsterreich

Das Unternehmen eröffnet erstes H+ Hotel in Wien. H-Hotels.com weiter auf dem Vormarsch: Am 29. Oktober 2018 hat das familiengeführte Unternehmen erstmalig ein Hotel in Wien eröffnet und verstärkt damit seine Präsenz in Österreich. Das H+ Hotel in Wien verfügt über 77 Zimmer und befindet sich in zentraler Lage in der Nähe des Palais Liechtenstein. Das erste H+ Hotel in Wien ist barrierefrei und offeriert seinen Gästen 77 Zimmer auf sieben Etagen mit moderner Ausstattung sowie elf Parkplätze in der Tiefgarage direkt am Hotel. Zu den weiteren Annehmlichkeiten

ExpansioninAustria

The company opens fi rst H+ Hotel in Vienna. On 29 October 2018, the family-run company opened its first hotel in Vienna, thus strengthening its presence in Austria. The H+ Hotel in Vienna has 77 rooms and is centrally located near the Palais Liechtenstein. The first H+ Hotel in Vienna is barrier-free and offers its guests 77 rooms on seven floors with modern facilities as well as eleven parking spaces in the underground car park directly next to the hotel. Other amenities include a rich breakfast buffet, a modern restaurant with 72 seats and a hotel bar. n

zählen ein großzügiges Frühstücksbuffet, ein modernes Restaurant mit 72 Plätzen sowie eine Hotelbar. n

TheRitz-Carlton,Vienna EineeinzigartigeneueBar conCucina

Ciccio Sultano bringt mit dem Pastamara den wahren Aperitivo nach Wien. Mit Ende des Jahres darf sich Wien über ein exzeptionelles kulinarisches Ganztagskonzept freuen, das mitunter das italienische Ritual des Aperitivo in den Mittelpunkt stellt: eine Bar con Cucina, die von der Lobby aus frei zugänglich ist und für Wien einzigartig ist. Die Küche wurde vom sizilianischen Starkoch Ciccio Sultano erdacht, das Interieur vom renommierten Designstudio Tarruella Trenchs entworfen. Serviert wird eine moderne Reinterpretation sizilianischer Speisen. Davor darf es gerne ein Negroni sein – vom eigens konzipierten Negroni-Wagen. n

from the lobby and unique for Vienna. The kitchen was designed by the Sicilian star chef Ciccio Sultano, the interior by the renowned design studio Tarruella Trenchs. A modern reinterpretation of Sicilian dishes is served. Before a Negroni can be served – from the specially designed Negroni trolley. n

AuniquenewBarconCucina

Ciccio Sultano brings the true aperitivo to Vienna with the Pastamara. At the end of the year, Vienna can look forward to an exceptional all-day culinary concept that focuses on the Italian ritual of the aperitivo: a Bar con Cucina, which is freely accessible

TravelCharmeHotels&Resorts VierGault&MillauHaubenan zweiHäuserinÖsterreich

 ourGault&Millautoques F gototwohotelsinAustria

Bildnachweise siehe Impressum

SKYFOLD by DORMA Hüppe

Die Kilian Stuba mit Küchenchef Sascha Kemmerer im Travel Charme Ifen Hotel erhielt erneut drei Hauben und 17 Punkte. Auch das Restaurant Laurentius im Travel Charme Fürstenhaus Am Achensee mit Küchenchef

sonders durch Qualität auszeichnet“, freut sich Matthias Brockmann, Geschäftsführer der Travel Charme Hotelbetriebsgesellschaften. n

Domenic Kreller freut sich über eine Haube und konnte sich im Vergleich zum Vorjahr sogar auf 14 Punkte steigern. „Wir sind sehr stolz auf diese herausragenden Leistungen. Die Teams um die beiden österreichischen Küchenchefs haben einmal mehr bewiesen, dass sich jedes Travel Charme Hotel & Resort be-

6

hotel objekte – November/Dezember 2018

The Kilian Stuba with head chef Sascha Kemmerer in the Travel Charme Ifen Hotel received again three toques and 17 points. Also the restaurant Laurentius in the Travel Charme Fürstenhaus Am Achensee with head chef Domenic Kreller is happy about a toque and could even increase to 14 points compared to last year. “We are very proud of these outstanding achievements. The teams around the two Austrian chefs proved once more that every Travel Charme Hotel & Resort is distinguished by quality”, underlines Matthias Brockmann, Managing Director of Travel Charme Hotelbetriebsgesellschaften. n


B&BHOTELS Erfolgreiches3.Quartal2018

Mit einer Steigerung um 17,7 Prozent stieg der Umsatz auf 132,3 Millionen Euro an – Spitzenreiter in Sachen Gästezufriedenheit. Weiterhin auf der Überholspur: Sowohl bei der Expansion als auch beim Umsatz zählt die Budget-Hotelgruppe zu den Spitzenreitern in ihrem Segment. Mit einem Anstieg um 19,9 Millionen Euro im Vergleich zum dritten Quartal des Vorjahres ist der Umsatz im dritten Quartal 2018 um insgesamt 17,7 Prozent gestiegen und liegt damit bei 132,3 Millionen Euro. Der Gross Operating Profit (GOP) wuchs um 11,1 Millionen Euro auf insgesamt 77,7 Millionen Euro an. Die GOPMarge beträgt unverändert 59 Prozent, trotz der hohen Anzahl an neu eröffneten Hotels im Portfolio. Ebenso unverändert, ist die Zimmerauslastung mit 65 Prozent. Alle B&B Hotels bieten einen gleichbleibenden Standard mit den günstigsten Preisen im Marktsegment. Nach Übernahme von neun Hotels der Covivio Gruppe zum 1. November 2018 sowie weiteren sechs geplanten Neueröffnungen im vierten Quartal 2018 umfasst das Portfolio von B&B HOTELS bis Ende 2018 insgesamt 124 Hotels in Deutschland. n

Successful3rdquarter2018

With an incease of 17.7 percent, turnover rose to 132.3 Million Euros – leader in terms of guest satisfaction. Still in the fast lane: The budget hotel group belongs to the leaders in its segment in terms of both expansion and sales. With an increase of 19.9 million euros compared to the third quarter of the previous year, sales in the third quarter of 2018 rose by a total of 17.7 percent to 132.3 million euros. Gross operating profit (GOP) grew by 11.1 million euros to a total of 77.7 million euros. The GOP margin remained unchanged at 59 percent, despite the high number of newly opened hotels in the portfolio. Room occupancy also remained unchanged at 65 percent. All B&B hotels offer a constant standard with the lowest prices in the market segment. Following the acquisition of nine hotels of the Covivio Group as of November 1, 2018, as well as a further six planned new openings in the fourth quarter of 2018, B&B HOTELS’ portfolio comprises a total of 124 hotels in Germany by the end of 2018. n

„NICHTS ERSETZT DIE HAND DES KÜNSTLERS“ © Forbo / Starck Network / Sophie Delaporte

Philippe Starck Entdecken Sie visionäre Bodendesigns, visualisiert mittels hochauflösender Digitaldrucktechnik auf einem außergewöhnlichen Textilbelag:

Mehr unter: www.forbo-flooring.de/flotexbystarck

GeschäftsführerMaxC.Luscher

hotel objekte – November/Dezember 2018

7


Pinnwand

Neueröffnungen EXKi

www.exki.de

ErstesRestaurantinKölneröffnet

Frisch, gesund, schnell: Der belgische Systemgastronom EXKi hat seine erste deutsche Filiale in Köln eröffnet. Das in Benelux, Frankreich und Italien sehr erfolgreiche Konzept setzt auf ein abwechslungsreiches und frisches Angebot an Healthy Fast Food 2.0 im Self-Service-Prinzip. Im Fokus: der mobile, qualitätsorientierte Gast, der wenig Zeit hat und sich trotzdem gut und gesund ernähren will. Auf rund 250 Quadratmetern findet der Gast bei EXKi für jede Tageszeit das passende Angebot, alles frisch und aus eigener zentraler Produktion. Alle Gerichte können mitgenommen oder direkt vor Ort verzehrt werden. Entwickelt wird die große Auswahl an Gerichten vom renommierten Sternekoch Frank Fohl. 156 Sitzplätze und ein urbanes Feelgood-Design laden zum entspannten Genießen und Energietanken ein. Jedes EXKi-Restaurant wird individuell geplant und es werden ausschließlich hochwertige Materialien verwendet, um eine wohlig einladende Atmosphäre zu schaffen. Besonderen Wert legt EXKi bei

all seinem Handeln auf die nachhaltige Entwicklung und die soziale Verantwortung des Unternehmens. n

 irstrestaurantin F Cologneopened

Fresh, healthy, fast: The Belgian system gastronomy EXKi has opened its first German branch in Cologne. The highly successful concept in the Benelux, France and Italy relies on a varied and fresh self-service offer from Healthy Fast Food 2.0. In focus: the mobile, quality-oriented guest, who has little time and still wants to eat well and healthy.

Shangri-LaHotel,Melbourne ZuwachsinAustralien

Bildnachweise siehe Impressum

Mitten im Zentrum der Millionenmetropole eröffnet 2022 mit dem Shangri-La Hotel, Melbourne das vierte Haus der Luxushotelgruppe in Australien. Am 15. Oktober 2018 fanden sich Vertreter der Shangri-La Hotels, der Immobiliengesellschaft SP Setia, des Bauunternehmens Multiplex und der Stadt Melbourne zur Grundsteinlegung des Projektes zusammen. Der 62-stöckige Westturm wird das neue Shangri-La Hotel, Melbourne

8

hotel objekte – November/Dezember 2018

At around 250 square meters, the EXKi guest will find the right offer for every time of day, all fresh and from his own central production. All dishes can be taken away or consumed on the spot. The wide range of dishes is developed by renowned star chef Frank Fohl. 156 seats and an urban “Feel Good” design invite you to relax and recharge your batteries. Each EXKi restaurant is individually planned and only high-quality materials are used to create a cozy and welcoming atmosphere. In all its activities, EXKi attaches particular importance to sustainable development and corporate social responsibility. n

www.shangri-la.com

beherbergen, während im 60-stöckigen Ostturm mit dem Wohnkomplex „Sapphire by the Gardens“ rund 300 Luxus-Appartments entstehen. Beide Gebäudeteile werden durch die Sky Lounge im 42. Stock verbunden sein. An einer der besten Adressen – im Nordwesten des Central Business District mit Blick auf den Stadtpark Carlton Gardens und das Royal Exhibition Building – gelegen, ist das neueste Fünf-Sterne-Hotel der Stadt mit 500 luxu-

riösen Zimmern ideal für Touristen und Geschäftsreisende. Die Beteiligten rechnen mit einer Bauzeit von drei Jahren und Eröffnung im Jahr 2022. n

GrowthinAustralia

In 2022, the Shangri-La Hotel in Melbourne, the fourth hotel of the luxury hotel group in Australia, opens in the center of the metropolis with its capital of millions. On October 15, 2018, representatives of Shangri-La Hotels, the real estate company SP Setia, the construction company Multiplex and the city of Melbourne met to lay the foundation stone for the project. The mixed-use project’s western tower measures 62 storeys and will host Melbourne’s newest five-star hotel, the Shangri-La. The eastern tower is 60 storeys and will house over 300 luxury residential apartments. The two buildings will be connected through the Sky Lounge on the 42nd floor. Located at one of the best addresses in the north east corner of Melbourne’s Central Business District, overlooking the Carlton Gardens and Royal Exhibition Center, the project’s 500room luxury hotel is perfectly positioned to cater for tourists and business travellers. The parties anticipate a construction period of three years and opening in 2022. n


Hotel&SpaKlosterbräu www.klosterbraeu.com Wellnesshotelpräsentiert sichinneuemLook

Im Fünf-Sterne-Wellnesshotel & Spa Klosterbräu in Seefeld, Tirol, schuf Familie Seyrling, die das exklusive Haus in alten Klostermauern seit über 200 Jahren führt, für ihre Gäste 35 neue Lifestyle-Zimmer sowie das 220 Quadratmeter große Luxus-Loft 500. In allen Räumlichkeiten wurden Tiroler Eichenhölzer und Steine in der Optik der 500 Jahre alten Klostermauern mit modernen Lifestyle-Elementen kombiniert. Die gewählten Formen sind klar und weich zugleich, wodurch eine offene und freundliche Atmosphäre geschaffen wird. Die neuen Hotelzimmer versprechen so Erholung und Luxus auf höchstem Niveau inmitten der idyllischen Tiroler Berglandschaft. Das Redesign umfasst 35 der insgesamt 90 Zimmer und Suiten des Wellnesshotels. Ganz ohne Architekt, aber mit viel Liebe zum Detail, wählte die Gastgeberfamilie Materialien, Farben und Möbel, die die Geschichte und Wärme des gesamten Hauses widerspiegeln. „Diese

Zimmer begeistern Stammgäste sowie junge Hipster“, so Eigentümer Alois Seyrling. „Wir haben hier unsere jahrelange Vision verwirklicht und wahrlich einzigartige Wohlfühloasen geschaffen – so ‚younique‘ und persönlich, wie es jeder Besuch in unserem Haus ist.“ n

 pahotelpresentsitself S inanewlook

In the 5-star Wellnesshotel & Spa Klosterbräu in Seefeld, Tyrol, the Seyrling family, who have been running the exclusive house in old monastery walls for over 200 years, created 35 new lifestyle rooms and the 220 square meters luxury loft 500 for their guests. Tyrolean oak woods and stones in the look of the 500-yearold monastery walls were combined with

modern lifestyle elements in all rooms. The chosen shapes are clear and soft at the same time, creating an open and friendly atmosphere. The new hotel rooms promise relaxation and luxury at the highest level amidst the idyllic Tyrolean mountain landscape. The redesign comprises 35 of the 90 rooms and suites of the spa hotel. With no architect, but with great attention to detail, the host family chose materials, colours, and furniture that reflect the history and warmth of the entire house. “These rooms are a delight for both regulars and young hipsters,” says owner Alois Seyrling. “We brought our vision of many years to life and created a truly unique oasis of well-being, just as ‘younique’ and personal as every visit to our hotel is.” n

hotel objekte – November/Dezember 2018

9


Pinnwand

Produktneuheiten ForboFlooring

www.forbo-flooring.de/flotexbystarck

TextilbödendesignedbySTARCK

In Zusammenarbeit mit dem visionären Designer Philippe Starck entwickelte Forbo Flooring die textile Bodenbelagskollektion FLOTEX BY STARCK. Durch hochauflösende Digitaldrucktechnik lassen sich die einzigartigen Kompositionen des Künstlers auf die extrem dichte Faseroberfläche eines außergewöhnlichen Textilbelags drucken. Diese Kollektion verlässt die gewohnten, traditionellen Pfade und definiert Innenraumgestaltung neu: Jedes der drei Design-Konzepte besteht aus fünf Modulen und ergibt durch Kombination raffinierte Bilder am Boden. n

 extilefloorcoverings T designedbySTARCK

The visionary designer Philippe Starck and Forbo Flooring Systems present the textile flooring collection FLOTEX BY STARCK. Using a high definition digital printing technique, the artistʼs unique compositions can be printed on the extremely compact fiber surface of a remarkable textile covering. Leaving the accustomed and traditional path behind, this collection redefines interior designs: each of the three design concepts is based on five individual modules, which in combination create sophisticated images on the floor. n

Kettal

www.kettal.com

NeueProduktefürdenArbeitsplatz

Die Office Pavilions von Kettal sind eine flexible Alternative zur Festlegung dynamischer Arbeitsräume. Die Idee, die hinter den Office Pavilions steckt, ist, großen offenen Räumen Gestalt zu verleihen – sowohl im Innen- als auch im Außenbereich. Die Office Pavilions verfügen über bewegliche Wände, mit denen getrennte Räume geschaffen werden können, wodurch die Akustik in Großraumbüros optimiert wird. Die große Auswahl an Farb- und Materialausführungen bei Wänden und Decken (Aluminium, Holz, Stoff, Glas) sowie das integrierte Automatisierungssystem verwandeln jeden Office Pavilion in ein individuelles Produkt. n

Kettal

TanteLotte

Newproductsfortheworkplace

Kettal’s Office Pavilions are a flexible alternative designed to create dynamic workplaces. The idea behind the Office Pavilions is to give shape to big, open spaces, both indoors and outdoors. These Office Pavilions are made up of movable walls capable of creating secluded rooms to optimise the acoustics in open-plan office spaces. The wide array of colour and material finishes for walls and ceilings, including aluminium, wood, fabric and glass, as well as the integrated automation feature, makes this product as personalised as they come. n

www.tantelotte.at

Akustikplattenaus TirolerSchafwolle

Alle Angaben laut Hersteller

Forbo/StarckNetwork/SophieDelaporte

Whisperwool sind schallabsorbierende Paneele aus Tiroler Schafwolle, erhältlich in den drei Naturtönen Anthrazit, Silbergrau und Naturweiß. Whisperwool Paneele sind weich und biegbar, dennoch steif und stabil. Sie werden an Unterkonstruktionen von Decke oder Wand abgehängt aufgenagelt, wobei die Nagelköpfe unsichtbar in der Wolle verschwinden. Erhältlich sind die zu 100 Prozent recyclingfähigen Platten in 90 × 90 Zentimeter und zwölf Millimeter Dicke. Sie verbessern nicht nur die Raumakustik, sondern auch das Raumklima, filtern Giftstoffe aus der Luft und machen z. B. Büro- und Besprechungsräume oder Wellness- und Ruhebereiche zu schallberuhigten Zonen. n 10 hotel objekte – November/Dezember 2018

 cousticboardsmadeof A Tyroleansheep’swool

Whisperwool are sound absorbing panels made of Tyrolean sheep wool, available in three natural shades of anthracite, silver grey and natural white. Whisperwool panels are soft and bendable yet stiff and sturdy. They are nailed to substructures suspended from the ceiling or wall, whereby the nail heads disappear invisibly into the wool. Available are the 100 percent recyclable panels in 90 × 90 centimeters and 12 millimeters thick. They not only improve the room acoustics, but also the room climate and filter out toxins from the air and make office and meeting rooms or wellness and relaxation areas to quiet areas. n

WhisperwoolFleurdeLis Foto:TanteLotteDesignGmbH


SkipperFurniture

www.skipperfurniture.se

Cocoon–RaumimRaum

Außergewöhnliches Design in weicher, futuristischer Gestaltung: Der Sessel Cocoon bietet die Pause vom arbeitsreichen Werktag. Im Cocoon ist man vor dem Lärm und der Hektik des Alltags, die einen umgibt, abgeschirmt. Cocoon ist der „Raum im Raum“ – ein Ort, an dem man kurzzeitig ungestört sein kann: bequem und ideal, um sich auszuruhen, ungestört zu arbeiten, zu lesen, zuzuhören, zu sprechen und mit der Möglichkeit, sein Smartphone/iPad anzuschließen oder zu laden. Acht Rollen, die bei Belastung bremsen, machen Cocoon mobil und überall einsetzbar. Darüber hinaus ist der Sessel u. a. mit drei regu-

leetdesign

lierbaren LED-Leuchten, zwei Lautsprechern, einem USB-Ladegerät, Bluetooth-System und Bedienpanel ausgestattet. n

Cocoon–aroominsidetheroom

Cocoon is a unique design in soft, futurist shapes. Cocoon is the break of the busy weekday. Seated in the Cocoon you are shielded against the noise and pulse around you. – Cocoon is “a room inside the room” – a place where you can be undisturbed for a short while, appearing in a pleasant design, being mobile, where smartphone or iPad can be connected and recharged, and where you can relax, work, read, listen, speak … The model is movable by

SkipperFurnitureAB

means of 8 castors, braking when being loaded. It is equipped with three adjustable LED lights, two loudspeakers, a 12 V battery with charger for 220 V, USB charger, Bluetooth system as well as control panel. n

www.leet-design.com

E-Bulle:OfficePodfürjedenRaum

Das Open-Concept-Büro hat in vielen Unternehmen eine immense Popularität erlangt. Es kann jedoch angesichts der ständigen Ablenkungen mitunter schwierig werden, die Arbeit zu erledigen. Der E-Bulle Office Pod von leet design hilft dabei, dieses Problem zu lösen. Der eiförmige Sessel verbindet einen Computerarbeitsplatz mit Komfort. Er kann in Büros, Co-Working-Räumen, Geschäfts- und Ausstellungszentren oder Multimedia- und Lounge-Bereichen eingerichtet werden. Mit seinem stilvollen und futuristischen Design kann das Pod in jeden Raum integriert werden und bietet eine beeindruckende Technologie im Innenraum – für optimale Produktivität. Dazu gehören ein LED-Beleuchtungssystem, ein integriertes Computersystem, Lautsprecher, HD-Touchscreen und USB-Anschlüsse. n

E-Bulle:officepodforeveryroom

leetdesign

The open-concept office has gained immense popularity amongst many businesses but can be a difficult space to get work done in given the constant distractions that can be present, so the leet design E-Bulle office pod has been created to solve this problem. E-Bulle is an egg-shaped connected armchair that combines a computer workstation with comfort. It can be set up in offices, co-working spaces, business and exhibition centers or multimedia and lounge areas. Boasting a stylish and futuristic design, the pod is able to be incorporated into any space and offers impressive technology on the interior to ensure optimal productivity. This includes an LED lighting system, a built-in computer system, loudspeaker, HD touchscreen and connectivity ports like USB. n

www.Classen-Leuchten.de www.Classen-Lampenschirme.de www.lampenschirme-online.de E-Mail:Info@classen-lampenschirme.de Telefon05232–6966130 W.ClassenGmbH Stoddartstraße82a 32758Detmold hotel objekte – November/Dezember 2018 11


Pinnwand

Produktneuheiten arrmet

www.arrmet.it

SitzmöbelkollektionMacka

Die Sitzmöbel der Kollektion Macka, entworfen von Note Design Studio aus Stockholm, bestehen aus geschäumten und tapezierten feuerhemmenden Elementen, die auf einem lackierten Stahlgestell mit gelenkig verstellbaren Füßen zusammengebaut werden. Weich bereits im Aussehen und von maßvoller Größe, sind sie ideal für jedes Restaurant. Die Armlehnen passen sich bequem dem Körper an, die Verbindung mit der Rückenlehne ist ein prägendes Merkmal, das einen ganzheitlichen Ausdruck von schwereloser Eleganz verleiht.

Cizeta

Die Kollektion Macka wurde vom australischen Fachmagazin Indesignlive unter die zehn schönsten und überzeugendsten Sitzmöbel der Möbelmessen 2018 eingereiht. n

SeatingcollectionMacka

The Macka collection, designed by Stockholm-based Note Design Studio, is made of upholstered fireproof foam elements assembled on a painted steel structure with adjustable articulated feet. They are ideal for dining rooms, thanks to their soft appearance and compact size. Armrests are designed to

embrace the body so comfortably and the junction with the backrest is the key feature that creates holistic expression of lightness and elegance. The collection Macka was reviewed by Australian magazine Indesignlive as one of the ten most beautiful and convincing seatings of 2018 edition of Saloni. n

www.cizetasedie.it

Neuinterpretation klassischerFormen

Handwerkliche Leidenschaft und moderne Produktionstechnologien vereinen sich in der Sitzmöbelkollektion MISSY (Design: Edi & Paolo Ciani), bestehend aus Stuhl und Sessel. Solide Polyurethan-Schalen mit innenliegender Stahlstruktur machen diese Produkte zu einer beruhigenden und zugleich spannenden Neuinterpretation klassischer Formen, angepasst an heutige Räume und Lebensstile. Die Beine aus massiver Buche sind in zwei Versionen erhältlich: essenzieller, mit Beinen direkt in den Körper eingefügt, oder eher klassisch mit der Holzstruktur, die als Rahmen fungiert. n

LeoluxLX

 reinterpretation A ofclassicshapes

Artisan passion and modern production technologies come together in the seating collection MISSY (design by Edi & Paolo Ciani) consisting of chair and armchair. Sturdy polyurethane shells with an internal steel structure, these seats are a reassuring, yet at the same time exciting reinterpretation of classic shapes, adapted for today’s spaces and lifestyles. The solid beech base is available in two versions: more essential, with legs inserted directly into the body, or more classical with the wooden structure that acts as a frame. n CizetaMISSY

www.leolux-lx.com

RaffinesseundErgonomie inperfekterVerbindung

Alle Angaben laut Hersteller

arrmetMacka

Der Sessel LX662 zeichnet sich durch Komfort und Charme aus. Die ergonomisch geformte Schale mit der hohen Rückenlehne und den „Ohren“ an beiden Seiten bietet genau das richtige Maß an Bequemlichkeit und Privatsphäre. Der Metallfuß ist in einer vier- und einer fünfstrahligen Version verfügbar. Beide sind mit integrierter Erinnerungsfunktion lieferbar, sodass der Sessel immer wieder in den neutralen Stand zurückkehrt. Der LX662 kann auch mit einer Kippmechanik ausgestattet werden. Er eignet sich hervorragend für Projekte und Inneneinrichtungen mit einer exklusiven Ausstrahlung und ist der perfekte Sessel für exklusive (Hotel-)Empfangshallen und Lounges. n 12 hotel objekte – November/Dezember 2018

 ophisticationandergonomics S inperfectcombination

The armchair LX662 is characterised by its great combination of comfort and style. The ergonomically-shaped seat with a high back and “ears” at either side offer the highest level of comfort and privacy. The metal legs are available in four or five-prong versions. Both are available with a memory function, ensuring that the armchair always reverts to the 0 setting. LX662 can also be finished with a reclining mechanism. It is ideal for projects and interiors with an exclusive look: the perfect armchair for exclusive corporate lobbies, hotel lobbies and hotel lounges. n

LeoluxLX662


www.kloeber.com

WORK+ROOM=WOOOM

Der neue Schalensessel des Bürositzmöbelherstellers Klöber verbindet das Beste aus „Work“ und „Room“ und kombiniert so Effizienz und Entspannung. Die großzügige schwenkbare Ablagefläche an der Armlehne bietet ausreichend Platz für Laptop, Smartphone, Notizbuch und vieles mehr. Schnelles Aufladen aller gängigen Geräte gewährleistet der im Sessel eingebaute USB-Anschluss. Alle elektronischen Funktionen können komfortabel via App für iOS- und Android-Endgeräte bedient werden. Die Sesselvariante mit Ohren ist mit einem dimmbaren LED-Leselicht, das oberhalb der Schultern angebracht ist, ausgestattet. Nie war Arbeiten entspannter. WOOOM überzeugt durch zahlreiche Komfortfunktionen: Der Nutzer kann die Temperatur von Sitz und Rücken selbst regulieren und für noch mehr Entspannung sorgt die DreiZonen-Massagefunktion. n

KlöberWOOOM

CONTRACT www.3c-contract.de

WORK+ROOM=WOOOM

The new shell chair made by the office seating manufacturer Klöber has combined the best aspects of “Work” and “Room” to offer the best of efficiency and relaxation in a single product. A generous swing-out writing tablet that’s attached to the armrest offers plenty of space for laptop, smartphone, notebook and much more. A USB 2 port is integrated into the chair for fast charging of all standard devices. All electronic functions can be managed conveniently via app for iOS and Android devices. The armchair version with wings features a dimmable LED reading light that is positioned above shoulder height. Work has never been more relaxed. WOOOM offers an impressive set of comfort functions: The users can regulate the seat and backrest temperature for themselves and the three-zone massage function ensures an even higher level of relaxation. n

H20140150

KlöberGmbH

Geprüfte Qualität Garantierte Sicherheit www.blauer-engel.de /uz148 Gesundes Wohnen

info@3c-contract.de Fon: +49 5242 9309 400

DETAILS, DIE ÜBERZEUGEN Dieses Modell besticht durch das originelle Design seiner Armlehnen in Kombination mit der Leichtigkeit seiner hohen Füße. Die einzigartige Form macht CC 336 zu einem Trendmöbel und lässt sich durch Ihren Wunschbezug individualisieren. So macht das Sofa in jeder Umgebung eine gute Figur, ob Lobby oder Zimmer. Qualitativ profetieren Sie von 25 Jahren Erfahrung in unserer eigenen Produktion.

Hier finden Sie weitere Informationen zu Modell CC 336

www.3c-contract.de/hotelobjekte-2

hotel objekte – November/Dezember 2018 13


Bildnachweise siehe Impressum

Objektbericht

W Kuala Lumpur

14 hotel objekte – November/Dezember 2018


W Kuala Lumpur

Willkommen im Dschungel W bringt seinen unverwechselbaren Stil nach Malaysia und lässt in der sßdostasiatischen Metropole ein modernes Flaggschiff entstehen

hotel objekte – November/Dezember 2018 15


Objektbericht

W Kuala Lumpur

WET® Deck: stilvolle Poolbar, mit mutigem modernen Design und spektakulärem Blick auf die Petronas Twin Towers / WET® Deck: stylish pool bar, with

bold modern design and spectacular view of the Petronas Twin Towers

Bildnachweise siehe Impressum

D

as W Kuala Lumpur, erstes Haus der Marke in Malaysia, öffnet seine Türen im Herzen der Hauptstadt, nur wenige Schritte von den weltberühmten Petronas Twin Towers entfernt, und ist der ideale Ort, um sich in den Bann der Metropole ziehen zu lassen. Kuala Lumpur ist eine der modernsten Städte in Asien und bekannt für seinen schnelllebigen Geist. Eingerahmt von den Flüssen Klang und Gombak, wartet Kuala Lumpur mit sonnig-tropischem Klima, üppiger Dschungelvegetation, Wolkenkratzern und traditionell malaysischer Architektur auf – an jeder Ecke spürt man die Verknüpfung von Alt und Neu sowie Mensch und Natur. Sogar im Stadtzentrum verbinden sich Natur und Architektur in Form von himmelhohen Wolkenkratzern, die zwischen den Baumkronen hervortreten. Kuala Lumpur ist bekannt für seine multikulturelle Spitzengastronomie und Kreativität,

16 hotel objekte – November/Dezember 2018

was die Stadt zum perfekten Ort für das Debüt von W Hotels Worldwide, eine Marke von ­Marriott International Inc., in Malaysia macht. Luxus auf verspielte Art genießen

Das gewagte und innovative Hoteldesign des W Kuala Lumpur kombiniert kräftige und schlichte Farbtöne und vereint Aromen sowie Klänge im Hotel, die ein Erlebnis für alle Sinne schaffen. Ein besonderes Designmerkmal ist der „Pixel“ – oder Punkt. Dieser ist auf kreative Weise im ganzen Hotel integriert und ergibt ein von Malaysias breiter ethnischer Zusammensetzung inspiriertes Gesamtbild. Bei Ankunft treffen Gäste zunächst auf überlebensgroße traditionelle Batik-Motive, die eine Hommage an die altehrwürdige Kunst der Region sind und mit metallischen Akzenten versehen ­werden.

Die üppige Pflanzenpracht der Stadt spiegelt sich in bambusartigen Kronleuchtern wider, die im Kontrast zu einer ständig wechselnden Lichterwand stehen, eine Darstellung der neuen Technologien, die das Stadtbild prägen. In der Welcome Area checken Gäste in modernem Dschungel-Ambiente ein. Fließende LED-Lichter hängen einem Wasserfall ähnlich, von oben herab und wechselnde Lichtpunkte erstrecken sich wie ein Fluss am Boden entlang. Das Muster der Decke stellt eine kunstvolle Interpretation der Topografie Kuala Lumpurs dar, während sich an den Kronleuchtern die Formen altbekannter malaysischer Spielzeuge drehen. Vom W Living Room aus erstreckt sich eine große Treppe, die mit ihrem geometrischen Stufenverlauf aus verspiegelten Stahlverkleidungen mit Licht und Raum spielt. Die Treppe reflektiert die kräftigen Farben und lokalen Designs – je nach Blickwinkel der Gäste verändern sich Farbe und Raumwirkung.


WOOBAR: urban, schick und das pulsierende Herz des W Kuala Lumpur / WOOBAR: urban, chic and

the pulsating heart of W Kuala Lumpur

150 Zimmer und Suiten

Sehen und gesehen werden

Das W Kuala Lumpur verfügt über 150 stylishe Gästezimmer und Suiten, darunter zwei WOW Suiten und die luxuriöse Ex­ treme WOW Suite – W Hotelsʼ Interpretation der traditionellen Präsidentensuite. Mit einer Wohnfläche von 520 Quadratmetern wird die Extreme WOW Suite den Luxus in der Stadt neu definieren. Alle Zimmer und Suiten verkörpern sowohl die traditionellen als auch die modernen Elemente der Dschungel-Metropole. So sind die markentypischen Betten von W mit traditionellen Akzenten wie den indigenen „Wau“-Quasten, die an malaysischen Drachen zu finden sind, und verpixelten Batik-Designs geschmückt.

Mit seinen sechs verschiedenen Restaurants trägt das W Kuala Lumpur zu der florierenden und multikulturellen Gastronomie-Szene der Stadt bei. In kaiserlichem Ambiente bietet das YEN traditionelle kantonesische Speisen mit einem modernen Twist sowie eine breite Auswahl an frischen Meeresfrüchten an. Das ganztägig geöffnete Restaurant FLOCK verfügt über eine großzügige offene Küche, wo Profiköche australische „Farm-to-FLOCK“-Gerichte mit Fokus auf biologische Herstellung und Nachhaltigkeit servieren. Die WOOBAR besticht den ganzen Tag über mit originellen Bar-Häppchen und lie-

hotel objekte – November/Dezember 2018 17


Bildnachweise siehe Impressum

Objektbericht

W Kuala Lumpur

Der Ballsaal Great Room bietet Platz für bis zu 700 Gäste / The Great Room can accommodate up to 700 guests

bevoll kreierten Cocktails – der ideale Ort zum Auftanken und Verweilen. „Sehen und gesehen werden“ heißt es in der Pool-Bar des WET® Deck mit kreativen Mixturen und Ausblick auf die Petronas Twin Towers und ihre spannende Kulisse. Zudem wartet das W Kuala Lumpur mit dem SAINT PIERRE auf, ein französisches Restaurant mit 70 Sitzplätzen, das an seinem Standort in Singapur bereits einen Michelin-Stern erhalten hat. Das WICKED, Kuala ­Lumpurs neuester VIP-Club, wird das blühende Nachtleben der Stadt maßgeblich ergänzen. Sowohl das SAINT PIERRE als auch der Club WICKED sind extern geführt.

Das W Kuala Lumpur liefert einen hochmodernen Ansatz, wenn es darum geht, aus gewöhnlichen Veranstaltungen etwas Außergewöhnliches zu machen. Mit über 1.500 Quadratmetern Bankettfläche, darunter der 1.000 Quadratmeter große Ballsaal GREAT ROOM, stellt das W Kuala Lumpur die Weichen für erfolgreiche Vorträge, Konferenzen, Hochzeiten und Produktpräsentationen. Zurück zu luxuriösem Glanz

Ruhesuchende Gäste und Einheimische lassen sich auf luxuriöse Art und Weise im

Das australische Restaurant FLOCK ist ganztägig geöffnet ... / The Aus-

tralian restaurant FLOCK is open all day ...

18 hotel objekte – November/Dezember 2018

AWAY Spa verwöhnen. Die 1.100 Quadratmeter große Oase bietet in ihren fünf Behandlungsräumen Massagen sowie Behandlungen an und verfügt über Vital-Pools, Dampfbäder mit Farbtherapie und Bio-Infrarot-Saunen. Die Beauty Bar, ein lokaler Schönheitssalon, macht das Ganzkörper-Wohlfühlprogramm komplett, indem sie mit Maniküre, Pediküre sowie Angeboten für Haar- und Wimpernverlängerungen aufwartet. All diejenigen, denen der Sinn nach etwas Detox steht, kommen im Fitnessstudio FIT des Hotels bei hochmoderner Ausstattung und Ausblick auf die Skyline ins Schwitzen. n

... und legt Wert auf biologische Herstellung und Nachhaltigkeit / ... and

attaches great importance to organic production and sustainability


Welcome to the jungle W brings its unmistakable style to Malaysia and creates a modern flagship in the Southeast Asian metropolis

EinervonfünfBehandlungsräumenim1.100QuadratmetergroßenAWAYSpa/Oneoffivetreatmentroomsinthe1,100squaremeterAWAYSpa

W

Kuala Lumpur, the iconic brand’s first-ever hotel in Malaysia, opens its doors in the heart of the capital, steps from the world-famous Petronas Twin Towers and is the perfect place to be mesmerized by the metropolis. Kuala Lumpur is one of the most modern cities in Asia and known for its fast-paced spirit. Nestled between the Klang and Gombak Rivers, Kuala Lumpur boasts a sunny tropical climate, flourishing jungle, soaring buildings and traditional Malaysian architecture – a meeting of old and new, nature and humankind, on every street. Even within the city centre, nature is juxtaposed against architecture with towering skyscrapers emerging from the canopy of green. Beyond the city’s juxtapositions, Kuala Lumpur is home to a multicultural

mix of world-class cuisine and creativity, the perfect spot for the brand debut of W Hotels Worldwide, part of Marriott International, Inc., in Malaysia. Enjoyluxuryinaplayfulway

W Kuala Lumpur combines an inexhaustible mix of old and new colours, aromas and sounds that blend effortlessly together in a cultural festival for the senses. A distinct design feature at W Kuala Lumpur is the pixel – or dot. It is cleverly integrated throughout the hotel and is used to create a bigger picture inspired by a broader multicultural Malaysia made up of many ethnicities. Upon arrival, guests are welcomed by larger-than-life traditional batik motifs, a nod to ancient artwork of the

region, blended with sleek metal accents. The city’s abundant plant life is pulled into the space via bamboo-inspired chandeliers set against an ever-changing wall of lights, a representation of the new technology that is enhancing the cityscape. At the Welcome area, guests check in among modern nods to the jungle. Streaming LED lights hang from above, playfully mimicking waterfalls, spotlights alternate along the floor like a flowing river while the ceiling patterns depict an artistic interpretation of Kuala Lumpur’s topography, and chandeliers show off the shapes of spinning Malay toys known throughout the country. Extending from the Living Room, the hotel’s grand staircase plays with light and space in a towering geometric cascade of steel-mirrored panels. Reflecting the vibrant hotel objekte – November/Dezember 2018 19


Objektbericht

W Kuala Lumpur

colours and native designs found throughout the room and floors above, the staircase shifts each guests’ view of both colour and spacial dynamics as they move through the creatively extroverted mirroring.

Bildnachweise siehe Impressum

150 guest rooms and suites

W Kuala Lumpur features 150 stylish guest rooms and suites, including two WOW suites and the lavish Extreme WOW Suite (the brand’s take on the traditional presidential suite). With a living space of over 520 square meters, the Extreme WOW Suite brings a 20 hotel objekte – November/Dezember 2018

new level of eclectic luxury to the city. All W Kuala Lumpur rooms and suites embody both the traditional and modern elements of the Jungle City, teaming W essentials like signature W beds with traditional accents like indigenous “Wau” tassels commonly featured on Malaysian kites and pixelated versions of batik designs. The scene to be seen

W Kuala Lumpur brings a flawless synergy to Kuala Lumpur’s booming, multicultural food and drink scene with six diverse

beverage and food venues. YEN offers an imperial ambience with a contemporary take on traditional Cantonese recipes and a wide selection of fresh seafood. The energetic all-day dining restaurant, FLOCK, showcases an extensive open kitchen where expert chefs serve up Australian, farm-toflock dishes featuring organic produce and a focus on sustainable eats. For inventive bar bites and meticulously crafted cocktails, WOOBAR is a chic allday social space perfect to fuel up and stay longer. Set to be the best spot to see and be seen in Kuala Lumpur, the WET® Deck


Die 150 Zimmer und Suiten kombinieren tra-

ditionelle asiatische Elemente und modernes Design / The 150 rooms and suites combine traditional Asian elements with modern design

Traditionelles Markenzeichen: die „Wau“-­

Quasten / Traditional trademark: the „Wau“ tassels

to-toe pampering, the Beauty Bar, a local elite beauty house by 176 Avenue, offers manicures and pedicures, as well as hair and eyelash extension services. For those wanting to detox before they detox and repeat, guests can sweat it out at the hotel’s FIT gym which features state-of-the-art equipment and views of the city skyline. n

Das Objekt auf einen Blick

pool bar features creative concoctions, with breathtaking views of Petronas Twin Towers as its stunning backdrop. W Kuala Lumpur will also offer two privately-managed dining and entertainment venues including SAINT PIERRE, a 70-seat French eatery that has already earned a Michelin star at its Singapore location, and WICKED, the city’s newest VIP club, further amplifying Kuala Lumpur’s buzzing nightlife. W Kuala Lumpur adopts a bold approach to elevate events from ordinary to extraordinary. Featuring over 1,500 square meters of function space including the sprawling

1,000-square-meter GREAT ROOM, W Kuala Lumpur is setting the stage for lively and vivid presentations, conferences, weddings, and product launches. Get your glow on

Guests and staycationers looking to get pampered can treat themselves to luxe indulgences at AWAY Spa. With five treatment rooms, this 1,100-square-meter oasis offers massages and treatments, vitality pools, chroma-therapy steam baths and bio infrared saunas. For complete head-

Etagen: 23 Zimmer/Suiten: 132/18 Kategorie: Luxus Eröffnung: August 2018 Architekt: Entwurf von Skidmore, Owings and Merrill, ausgeführt von Vertitas Architects Innenarchitekt: Entwurf von Nic Graham & Associates, ausgeführt von Blu Water Studios Bildrechte: Marriott International Inc.

hotel objekte – November/Dezember 2018 21


SKYFOLD von DORMA Hüppe Das vollautomatische vertikale Trennwandsystem

Foto: Juliana Franco

Firmen-/Produktpräsentation

Raumteiler und Trennwände

Skyfold: vertikale Trennwand parkt platzsparend / Skyfold: vertical partitions ensures space-saving stacking

F

ür das flexible Raummanagement im Tagungs- und Kongressbetrieb bietet DORMA Hüppe mit Skyfold eine besonders attraktive Lösung: eine vertikale Trennwand, die sich im Gegensatz zu den üblichen horizontal verfahrbaren Systemen platzsparend in die Decke öffnet. Das sieht nicht nur spektakulär aus, sondern bietet auch eine ganze Reihe handfester Vorteile. Platzsparendes Parken

an der Decke Die Decke ist meist ungenutzter Raum. Werden die Wandelemente bei geöffneter Trennwand dort geparkt, schafft das Platz, der nun anderweitig funktionell genutzt werden kann. Mit nur 34 kg Wandgewicht pro Quadratmeter in der Standardausführung ist das System trotz seiner aufwendigen Konstruktion ein echtes Leichtgewicht. 22 hotel objekte – November/Dezember 2018

Skyfold benötigt zudem keine Führungsoder Laufschienen, die Trennwände können praktisch überall installiert werden – bis zu einer Höhe von elf Metern. Mit der vollautomatischen Bedienung verfahren die stabilen Elemente schnell und zuverlässig per Knopfdruck. Eingebaute Sensoren an der Unterkante sorgen dafür, dass das System beim Herabsinken und etwaigen Auftreffen auf ein Hindernis stoppt. Vielfältige Oberflächenvarianten in einer eleganten Optik – ohne sichtbare Scharniere und Beschläge – ermöglichen individuelle Lösungen für eine anspruchsvolle Raumatmosphäre. Die Standardvariante Skyfold Classic bietet Schalldämmung bis zu Rw 59 dB und kann bei Bedarf mit akustisch wirksamer Oberfläche ausgestattet werden. Die Modellvariante Zenith faltet ausschließlich im oberen Bereich, sodass Möbel noch näher an der Trennwand platziert werden können. n


Anzeige

SKYFOLD by DORMA Hüppe The fully automatic vertical moveable wall system

W

a sophisticated interior atmosphere. The standard variant, Skyfold Classic, provides sound insulation up to Rw 59 dB and can be equipped with an acoustically effective

ith Skyfold, DORMA Hüppe offers an extremely attractive solution for the flexible management of conference and meeting rooms: a vertical moveable wall, which, in contrast horizontal systems, retracts into the ceiling to save space. This not only looks spectacular but offers a whole host of tangible benefits.

surface, if needed. The Zenith model only folds in the upper area, so that furniture can be placed even closer to the moveable wall. n

The ceiling is often an unused space. When the moveable wall is opened, the wall elements can be parked on the ceiling to create a functional space that can now be used for other purposes. Weighing only 34 kg per square meter in the standard version, the system is a real lightweight despite its elaborate design. Skyfold also requires no guide rails or runners, and the moveable walls can be installed virtually anywhere – up to a height of 11 meters. The robust elements can be operated quickly and reliably via the fully automatic controls at the push of a button. In-built sensors on the lower edge ensure that the system stops if it detects an obstacle while being lowered. Many different surface varieties in an elegant look – without visible joints or fittings – enable individual solutions for

Foto: Juliana Franco

Compactstorageontheceiling

Einzelabmessungenbis11MeterHöheundnahezuunbegrenzteBreite/Individualdimensionsupto

11metersinheightandalmostunlimitedwidth ModellZenithentfaltetsichbereits

platzsparendimoberenWandbereich/ ModelZenithunfoldsalreadyinthe upperwallareatosavespace

DORMA Hüppe Raumtrennsysteme GmbH + Co. KG Industriestrasse 5 D-26655 Westerstede/OcholtGermany www.dorma-hueppe.com hotel objekte – November/Dezember 2018 23


Anzeige

100 Jahre Kaldewei 2018 blickt die Franz Kaldewei GmbH & Co. KG auf ihre erfolgreiche 100-jährige Firmengeschichte zurück

Four Seasons Hotel Seoul

EI

„Ich habe großen Respekt vor den Leistungen meiner Vorgänger. Aus der Vergangenheit lernen, um die Zukunft neu zu gestalten – das ist mein Credo bei der Fortführung des Familienunternehmens. Ich gebe neue zeitgemäße Impulse und konzentriere mich unter anderem auf die fortschreitende Internationalisierung und die Digitalisierung“, blickt Franz Kaldewei optimistisch in die Zukunft. n

DE W

E

in stets nach vorn gerichteter Blick und die Kunst, sich immer wieder neu zu erfinden: So ist aus einer kleinen Blechwarenfabrik einer der weltweit führenden Hersteller von Premium-Badlösungen geworden. Mutige Entscheidungen wie die Investition in ein eigenes Emailierwerk in den frühen 1930er-Jahren trugen dazu ebenso bei, wie die Entscheidung, trotz neuer Materialien wie Acryl am nachhaltigen Material Stahl-Email festzuhalten und es zum Markenkern des Unternehmens zu machen. Kaldewei ist stets eigene Wege gegangen, hat auf seine Stärken vertraut und der Branche mit neuen Ideen wichtige Impulse gegeben. Mit seinem Dreiklang aus Duschfläche, Waschtisch und Badewanne ist Kaldewei heute in Millionen Badezimmern auf der ganzen Welt zu Hause und bleibt weiter auf Wachstumskurs. In Zeiten von Digitalisierung, Globalisierug und steigendem Umweltbewusstsein schreibt Franz Kaldewei in nunmehr vierter Generation die Erfolgsgeschichte des Familienunternehmens fort.

KAL

Firmen-/Produktpräsentation

Firmenjubiläum

MitderErfahrungvon100JahrensetztKalde-

weiheuteundinZukunftkonsequentaufdas 1934schlugdieGeburtsstundederersten

Material,daszumMarkenkerndesUnterneh-

Kaldewei-Badewanne,dienochausmehreren

menswurde:KaldeweiStahl-Email/Basedon

Teilenzusammengeschweißtwurde/The

100yearsofexperience,Kaldeweireliescon-

firstKaldeweibathtubwasbornin1934–at

sistentlytodayonthematerialthathasbecome

thattimestillmadeofseveralpartsthatwere

thecompany’sbrandessence–Kaldeweisteel

weldedtogether

enamel–anditwillcontinuetodoso.

100 years of Kaldewei In 2018, Franz Kaldewei GmbH & Co. KG is looking back at 100 years of business success

24 hotel objekte – November/Dezember 2018

Kaldewei, the fourth generation of his family to run the business, is writing the next chapter of the company’s success story. “I have great respect for the achievements of my predecessors. My credo for running the family business is ‘learn from the past in order to shape the future’. I am creating fresh momentum in keeping with the times and am focusing on a number of areas such as growing our international presence and providing digitalisation tools,” says Franz Kaldewei, looking confidently to the future. n

FranzKaldewei

HalleA4,Stand-Nr.517

Franz Kaldewei GmbH & Co. KG Postfach 14 61 59206 Ahlen, Deutschland www.kaldewei.com

KALDEWEI/Evelyn Dragan

A

gaze firmly fixed on the future and the art of constantly reinventing itself – these are the attributes that have turned a small tinware factory into one of the world’s leading manufacturers of premium bathroom solutions. Brave decisions such as investing in the company’s own enamelling works in the early 1930’s contributed to this, as did the decision to stick to the sustainable material steel enamel, despite new materials such as acrylic, making it the core competence of the company’s brand. Kaldewei has always gone its own way, building on its strengths and introducing new ideas that provided the industry with important momentum. Today with its triad portfolio of shower surfaces, washbasins and bathtubs, Kaldewei is present in millions of bathrooms all over the world. In times of digitization, globalization and increasing environmental awareness, Franz


Digitalisierung

Anzeige

Mehr Komfort für Hotelgäste

I

n der Hotellerie werden verschiedene Unternehmensbereiche zunehmend digitalisiert, um den Gästen einen angenehmen Aufenthalt und großen Komfort zu

bieten. Insbesondere die Hotelgastronomie arbeitet schon heute mit moderner Technik, um den Gästeservice zu verbessern. Mit intelligenten Kassensystemen wie gastronovi,

Mitdemgastronovi-BestellsystemkönnenHotelgästebequemvonihremZimmerausEssenbestellen/

Thankstothegastronoviself-orderingsystem,hotelguestscanordercomfortablybysmartphone

die perfekt in zahlreiche Hotelsoftwarelösungen integriert sind, können Hoteliers ihren Roomservice noch komfortabler gestalten. Dank des Gäste-Bestellsystems von gastronovi können Hotelgäste bequem per Handy Speisen und Getränke auf ihr Zimmer bestellen. Den Gästen wird ein individueller QR-Code zugewiesen, mit dem sie auf dem Smartphone die Speisekarte des Hotelrestaurants aufrufen können. Beim Bestellvorgang kann der Gast auch gleich die offene Rechnung online bezahlen. Diese Möglichkeit ist besonders bei internationalen Gästen beliebt. Planen Hotelgäste lieber einen Besuch im Restaurant, ist ein Tisch bequem per Smartphone reserviert. Um lange Wartezeiten zu vermeiden, können sie außerdem ihre Bestellungen im Vorfeld abgeben. Bei der Ankunft stehen die Speisen direkt zum Verzehr bereit. n

fromtheirroom

Digital room service with gastronovi

I

More comfort for hotel guests

n the hotel industry, various business units are increasingly digitized in order to offer guests a pleasant stay and great comfort. In particular, hotel restaurants already work with modern technology to improve guest service. With intelligent POS systems such as gastronovi, which are perfectly integrated into numerous hotel software solutions, hoteliers can make their room service even more comfortable. Thanks to gastronoviʼs guest ordering system, hotel guests can conveniently order food and drinks to their rooms using their mobile phone.

Guests are given an individual QR code that allows them to access the menu of the hotel restaurant on their smartphones. When ordering, the guest can also pay the bill online. This option is especially popular with international guests. If hotel guests prefer to visit the restaurant, they can book their table conveniently by smartphone. In order to avoid long waiting times, they can also submit their orders in advance. Upon arrival, their food is ready to be served. n

DieTischreservierungüberdasgastronovi-

SystemwirdperMailbestätigtundkannbei BedarfzumspäterenZeitpunktvomGast selbstständigbearbeitetwerden/Thetable reservationviathegastronovisystemisconfirmedbyemailandcanbeprocessedbythe guestindependentlyifrequiredlater

gastronovi GmbH Buschhöhe 6 28357 Bremen Tel.: +49 421 40 89 42 0 kontakt@gastronovi.com www.gastronovi.com hotel objekte – November/Dezember 2018 25

Firmen-/Produktpräsentation

Digitaler Zimmerservice mit gastronovi


Tropisch vitale Eleganz mit Fliesen von Agrob Buchtal Keramikfliesen überzeugen im Oasia Hotel Singapur Fotos: Agrob Buchtal GmbH / Infinitude, Singapur

Firmen-/Produktpräsentation

Agrob Buchtal Architekturkeramik

Das Oasia Hotel Singapur: Die Dachterrasse ist von einem zehn Stockwerke hohen Schirm aus rotem Aluminium-Maschengewebe umgeben / The Oasia

Hotel Singapore: the roof terrace is surrounded by a 10-storey high shield of red aluminium meshwork

D

Die dynamische Winkelverlegung der Agrob-Buchtal-Fliesen setzt einen wohldosierten Kontrastpunkt

/ The dynamic angular laying pattern of the Agrob Buchtal tiles creates a well-dosed contrast

26 hotel objekte – November/Dezember 2018

as Oasia Hotel im zentralen Geschäftsviertel von Singapur ist ein in jeder Hinsicht einzigartiges Projekt. Es setzt neue Maßstäbe dafür, was ein Hochhaus in feuchtem, tropischem Klima leisten kann. Im Gegensatz zu konventionellen, hermetisch abgedichteten und klimatisierten Hochhaustürmen verbindet dieses vom örtlichen Büro WOHA entworfene Hotel in beeindruckender Weise Architektur und Natur sowie Innen und Außen. Dieses Konzept wurde mit Fliesen von Agrob Buchtal und durch die kreative Hand der spanischen Architektin und Designerin Patricia Urquiola auch auf die Pools des Hauses übertragen. Die Pools sind elementarer Bestandteil eines Gebäudes, das durch Farbe, Form und Proportion ein unübersehbares architektonisches Ausrufezeichen setzt. WOHAs erklärte Intention: „Eine alternative Bildsprache für gewerblich genutzte Hochhausobjekte zu schaffen. Wir wollten innovative Möglichkeiten der


Anzeige

Flächennutzung mit einem tropischen Ansatz kombinieren, der zu einem offenen, durchlässigen, wuscheligen, grünen Turm führte.“ Mit Keramikfliesen des Systems ChromaPlural von Agrob Buchtal findet dieser Anspruch auch bei den Pools Anwendung. Im 21. Stock ist er zum Beispiel stylishe Location für den dortigen Lounge-Club und im dynamischen Winkelmuster aus hell- und dunkelblauen Fliesen ausgekleidet. Der Pool auf dem Dach im 27. Stock hingegen ist durch das in der Mitte liegende Restaurant charakterisiert. Der Blick auf die Skyline der Stadt ist hier fast vollständig durch einen bewachsenen Schirm verdeckt. Eine unkonventionelle Architektur, die den Dachbereich zu einer unerwarteten tropischen Oase im Getümmel der Großstadt macht. n

Anzeige

PoolsspieleneineelementareRolleimganzheitlichenDesignkonzept–wiehierinder21.Etage/

Poolsplayanelementarypartinthecomprehensivedesignconcept–likehereonthe21stfloor

Tropical elegance full of vitality with tiles of Agrob Buchtal

Halle A4, Stand-Nr. 500

Ceramic tiles convince at the Oasia Hotel Singapore

T

he Oasia Hotel in the central business quarter of Singapore is a unique project in every respect. It sets new standards for what a high-rise building can be like in a humid, tropical climate. In contrast to conventional, hermetically sealed and air-conditioned tower blocks, this hotel designed by the local WOHA office impressively combines architecture and nature as well as interior and exterior areas. With tiles of Agrob Buchtal and thanks to the creativity of the Spanish architect and designer Patricia Urquiola, this concept

also formed the basis for the pools of the hotel. The pools are an elementary part of a building which sets a striking architectural accent by colour, form and proportion. “Our intention was to create an alternative visual language for commercially used high-rise projects. We wanted to combine innovative possibilities of floor space utilization with a tropical approach, which resulted in an open, permeable, tousled, green tower“, WOHA explains. Using ceramic tiles of the system ChromaPlural of Agrob Buchtal, this pretension

was also realized in the case of the pools. On the 21st floor, for example, the pool is the stylish location for the Lounge-Club there and cladded with light- and darkblue tiles in a dynamic angular pattern. The pool on the roof on the 27th floor, on the other hand, is characterized by the central restaurant. There, the view of the city’s skyline is almost completely obstructed by a shield covered over with plants. An unconventional architecture which turns the roof area into an unexpected tropical oasis in the hustle and bustle of the big city. n DieFassadewirdmitderZeitvon21verschie-

denenArtenvonKletterpflanzenundReben erobertsein/Overtheyears,thefacadewillbe completelycoveredby21differentspeciesof climbingplantsandgrapes

AGROB BUCHTAL GmbH Buchtal 1 D-92521 Schwarzenfeld www.agrob-buchtal.de hotel objekte – November/Dezember 2018 27


Special

Messevorschau2019

Messevorschau 2019

Z

u Beginn des kommenden Jahres präsentieren die Hersteller auf den wichtigsten branchenrelevanten Messen wieder eine Vielzahl neuer Produkte und Dienstleistungen. Vielleicht planen ja auch Sie im nächsten Jahr eine Renovierung oder einen Umbau und wollen sich im Rahmen eines Messebesuchs über

die verschiedenen Möglichkeiten informieren? In unserem Special erfahren Sie bereits vorab, welche Trends Sie auf der Heimtextil, der DOMOTEX, der HOGA, der BAU 2019, der imm cologne, der Maison&Objet Paris und auf der EuroCis erwarten. Darüber hinaus haben wir wieder jede Menge interessanter und zukunftsweisender Neu-

heiten aus den Bereichen Objekttextilien, Bodenbeläge, Oberflächengestaltung oder Kassensysteme, Hard- und Software sowie Cash Management gefunden, die wir Ihnen – als Anregung und Inspiration für Ihr Projekt – auf den folgenden Seiten gerne vorstellen möchten. n

Preview exhibitions 2019

A

t the beginning of next year, manufacturers will once again be presenting a large number of new products and services at the most important trade fairs in the industry. Perhaps you are also planning a renovation or conversion next year and would like to find out more

www.heimtextil.messefrankfurt.com

Interior.Architecture.Hospitality Expo–dieZukunftdertextilen Objektausstattung

Alle Angaben laut Hersteller

from the fields of facility textiles, floor coverings, surface design as well as POS systems, hardware, software, and cash management solutions, which we would like to present to you on the following pages to inspire you for your next project. n

Die Heimtextil ist für die Branche der erste Pflichttermin des Jahres. Auf der weltgrößten Messe für Wohn- und Objekttextilien richten sich von rund 3.000 Ausstellern allein 500 speziell an die Objektbranche. Unter dem Titel Interior.Architecture.Hospitality fasst die Heimtextil das Produkt- und Informationsangebot für diesen Anwendungsbereich zusammen. Teil dieses Angebots ist die Interior.Architecture.Hospitality Expo. Sie ist genau auf die Bedürfnisse von Innenarchitekten, Hoteleinrichter und Planer ausgerichtet. Die Expo in Halle 4.2 präsentiert die neuesten ästhetischen und funktionalen Lösungen für die Objektausstattung: von Textilien mit Akustikfunktion oder speziellen Abrieb-Eigenschaften bis hin zu modularen Teppichen, Sonnenschutz oder innovativen Wandbelägen. Neu und besonders interessant für die Hotellerie wird die Erweiterung des Produktportfolios rund um das Thema Bett sein. Auf der Expo finden Hotelplaner dann auch Bettsysteme, Matratzen, Bettwaren und -wäsche für die speziellen Bedürfnisse in Hotels. Das gestalterische Gesamtkonzept wird im nächsten Jahr vom Atelier ushitamborriello geplant 28 hotel objekte – November/Dezember 2018

und umgesetzt. Ushi Tamborriello gehört zu den gefragtesten Innenarchitekten und Szenebildnern und schafft mit ihrem Team international viel beachtete Rauminszenierungen. n

I nterior.Architecture.Hospitality Expo–thefutureoftextile contractfurnishing

Heimtextil is the industry’s first date of the year. At the world’s largest trade fair for home and contract textiles, 500 of around 3,000 exhibitors alone will target the contract sector in particular. Under the title ‘Interior. Architecture.Hospitality’, Heimtextil concentrates the spectrum of products and information for this area of application. Part of this offer is the Interior.Architecture. Hospitality Expo. It is precisely tailored to the

needs of interior designers, hotel furnishers and planners. The latest aesthetic and functional solutions for contract furnishing will be presented at the Expo in hall 4.2: from textiles with acoustic function or special abrasion properties to modular carpets, sun protection and innovative wall coverings. New and particularly interesting for the hotel industry will be the expansion of the bed-related product portfolio. At the Expo, hotel planners will also find bed systems, mattresses, bedding and linen that meet the special requirements of hotels. Next year, the overall design concept will be planned and implemented by Atelier ushitamborriello. Ushi Tamborriello is one of the most sought-after interior designers and set designers and her team creates internationally acclaimed spatial installations. n Messe Frankfurt Exhibition GmbH/Thomas Fedra

Heimtextil

about the various possibilities during a visit to a trade fair? In our Special, you will learn about the trends featured at Heimtextil, DOMOTEX, HOGA, BAU 2019, imm cologne, Maison&Objet Paris and EuroCis. In addition, we have once again found a host of interesting and trend-setting innovations


KomarProductsGmbH&Co.KG

www.komar.de

Anzeige

heimtextil:Halle3.1,StandC18 Maßanfertigungenfür denObjektbereich

Komar bietet dem Objektbereich mit KomarOne die Möglichkeit, Tapeten auf Sondermaß zu drucken sowie eine Auswahl an hochwertigen Vliesmaterialien. Diese sind besonders nutzerfreundlich: Der Kleister wird direkt auf die Wand aufgetragen, was eine einfache Anbringung ermöglicht. Außerdem ist das Produkt trocken rückstandslos abziehbar. Der Service beinhaltet eine eingehende Beratung

und Projektbetreuung sowie Grafikleistungen, wie die Anfertigung von Wunschmotiven. Als Hersteller mit 50-jähriger Tradition kann Komar auf umfangreiche Er fahrung zurückgreifen und ist so der ideale Partner. n

 ade-to-measureproductsfor M thepublicinteriorssector

With Komar-One, Komar offers the public interiors industry the possibility to order special-size wallpapers on a selection of

high-quality non-woven materials. These are especially user-friendly. Paste is applied directly to the wall, which makes it easy to hang wallpapers. The wallpaper can also be removed again after drying without leaving behind any residue. The service package includes a detailed consultation and project management as well as graphic services, such as the customised production of desired motifs. With a 50-year track record as a manufacturer, Komar is therefore the ideal partner. n

KomarProductsGmbH&Co.KG

HefelTextilGmbH

www.hefel.com

heimtextil:Halle11.0,StandB21 HEFELWell-Pur: DerpflegeleichteSchlafgenuss

Mit der Bettdecke Well-Pur bringt HEFEL die multifunktionale Tencel®-Faser in den Objektbereich. Mit angenehmem Schlafklima, bauschigem Komfort und beeindruckender Pflegeleichtigkeit: bei 60°C waschbar und trocknergeeignet. Die HEFEL Well-Pur-Bettdecke sorgt durch die Füllfaser Tencel für ein optimales Feuchtigkeitsmanagement, die eingearbeitete Mikrofaser für die herrliche Bauschkraft. Das Gewebe aus edlem Baumwoll-Feinsatin ist mit Aloe Vera veredelt. HEFEL Well-Pur besticht durch perfekte Funktion und einfache Pflege. HEFEL überzeugt europaweit mit hochqualitativen Bettdecken, Kissen und Unterbetten – 100 Prozent made in Austria. n

Anzeige

sector. The comforter offers a pleasant sleeping climate, fluffy comfort and impressive easycare characteristics: it can be washed at 60°C and tumble-dried. The HEFEL Well-Pur comforter provides optimal moisture management courtesy

of the Tencel filling fibres. The integrated microfibres ensure wonderful fill power. The luxurious fine satin cotton fabric features an Aloe Vera finish. HEFEL WELL-PUR impresses with its perfect functionality and easy-care characteristics. n

HEFELWell-Pur: Enjoyablesleep,theeasy-careway.

With the launch of the Well-Pur comforter HEFEL introduces the multifunctional Tencel® fibre into the contract furnishing

HefelTextilGmbH

hotel objekte – November/Dezember 2018 29


Special

Messevorschau2019 EnglischDekor

www.englisch.at

Anzeige

heimtextil:Halle8.0,StandA33

jazz–dietextileMelodiezur dänischenHygge-Philosophie

Unsere neue Möbelstoffkollektion bezaubert durch ihre subtilen Tonlagen. Über Variationen in der Struktur bietet sie einen dezenten, angenehmen Rhythmus: Verläufe von semi-uni und klein-gemustert bis zum geometrischen Kick ermöglichen ausgewogene und gemütliche Einrichtungskombinationen. Hygge steht unter anderem für sorglose Bequemlichkeit, die die schwer brennbaren, pflegeleichten, mit Fleckschutz optimierten Stoffe spenden. jazz ist eine klare Einladung zum genussvollen Zurücklehnen! n

jazz–thetextilemelodyto theDanishHyggephilosophy

Our new upholstery fabrics collection captivates with its subtle shades. Over variations in the structure, it offers a discreet, pleasant rhythm: gradients from faux-uni and small-patterned to a geometric kick allow balanced and cozy furnishing combinations. Among other things, Hygge stands for carefree comfort which these flame retardant, with stain protection optimised fabrics offer. jazz is a clear invitation to delightful relaxing! n

EnglischDekor

DecoDesignFürusGmbH

www.dialog-ddf.info/oceansafe

Anzeige

heimtextil:Halle8.0,StandD74

Alle Angaben laut Hersteller

360-Grad-Öko-Bettwäsche

Auf der Heimtextil zeigt die Deco Design Fürus GmbH aus Krefeld neue Kollektionen von Bettwäsche und Vorhängen, die unter dem geschützten Markennamen OceanSafe ausgestellt werden. Dabei handelt es sich um textile Endprodukte, die über die gesamte Wertschöpfungskette (Lebenszyklus) hinweg, unter streng ökologischen Kriterien absolut schadstofffrei generiert werden. Die Produkte sind zu 100 Prozent sicher für den biologischen Kreislauf. Dies gilt für den Anbau, die Verarbeitung, die gesamte Konfektionierung und die absolut rückstandsfreie Rückführung in den Kreislauf, ohne dass jemals Abfall entsteht. Diese innovativen Textilien befinden sich nach langer Forschungs- und Entwicklungszeit in der Endphase der Zertifizierung Cradle-to-Cradle certified TM. n

the brand name OceanSafe. The products are 100 per cent safe for the biological lifecycle. These textile end products are produced with no harmful substances under the strictest ecological criteria through the whole cradle-tocradle value chain. This applies to cultivation,

360degreeecobedlinen

At Heimtextil Deco Design Fürus GmbH from Krefeld, Germany, presents new collections of bed linen and curtains under 30 hotel objekte – November/Dezember 2018

DecoDesignFürusGmbH

processing, finishing and residue-free return to the value chain, without ever producing waste. These innovative products are currently after a long research and development cycle in the final phase of the certification cradle-tocradle certified TM. n


DOMOTEX

www.domotex.de

InspirierendesRahmenprogramm aufderDOMOTEX

Das aktuelle Leitthema „CREATE’N’CONNECT“ der DOMOTEX, die vom 11.– 14. Januar 2019 in Hannover stattfindet, rückt den Megatrend der Konnektivität in den Fokus. Bei den „TALKS“, einem Vortragsprogramm, thematisieren neun international bekannte Referenten das Thema der Verbundenheit an den Schnittstellen von Architektur, Innenarchitektur und Design und stellen innovative Projekte sowie aktuelle Ideen vor, bei denen der Boden eine tragende gestalterische Rolle spielt. Zudem präsentieren ausgewählte Hochschulen verschiedene Semesterprojekte zum Thema „Zukunft des Bodens“. Im Anschluss an die Vorträge folgt ein persönliches „MEET&GREET“: Das neue Format bringt Referenten und Gäste aus Industrie und Handel in einem informellen Rahmen zusammen, um fachlichen Austausch sowie eine lebendige Vernetzung zu ermöglichen. Vor

HOGA

DeutscheMesseAG

und nach den Talks führen trendorientierte Architekten und Designer interessierte Besucher in den „GUIDED TOURS“ zu ihren persönlichen Highlights der DOMOTEX. n

 xcitingsupportingprogram E atDOMOTEX

“CREATE’N’CONNECT” – the keynote theme of DOMOTEX, which next takes place in Hannover from 11 – 14 January 2019 – puts the focus on the mega trend connectivity. The “TALKS” program element will feature a total of nine internationally renowned professionals speaking about the connections between architecture, interior design and product design and present innovative projects and fresh new

ideas that illustrate the key role of flooring in interior design. In addition, a selection of universities will present several semester project works on the topic “The Future of Flooring”. At the close of each of the talks there will be a new type of “MEET&GREET” session in which the respective speakers, as well as participating representatives from industry and commerce, can meet informally with the audience. This provides a good opportunity for knowledge transfer and productive networking. Before and after the Talks iconic architects and designers take visitors who are eager to learn more on “GUIDED TOURS” to their personal favourites and highlight exhibits at DOMOTEX. n

www.hoga-messe.de

Trendschmiedefürdasbayerische Gastgewerbe

Rund 700 Aussteller machen die HOGA vom 13.–15. Januar 2019 zu dem Treffpunkt des bayerischen Gastgewerbes. Fachleute aus Hotellerie, Gastronomie und Gemeinschaftsverpflegung kommen nach Nürnberg, um Neuheiten und Trends zu entdecken, sich neu auszustatten und um sich mit Dienstleistern, Herstellern, Lieferanten und Berufskollegen zu vernetzen. Neben den klassischen Angebotsbereichen „Food & Beverage“, „Küchentechnik“ sowie „Einrichtung & Ausstattung“ und „Software- & IT-Dienstleistungen“ stellt die HOGA verschiedene Trendthemen in den Fokus und liefert damit Informationen, Konzepte, Produkte und Ansprechpartner für Gastronomen, Hoteliers, Cateringbetriebe und Gemeinschaftsverpfleger. Beispielsweise zeigen unter dem Titel „Spezialitätenland Bayern“ 20 bayerische Unternehmen bayerische Kulinarik von ihrer besten Seite: von Spirituosen über Feinkost hin zu Säften und Wein. Bei „Kidsʼ First Choice“ stehen dagegen die zukünftigen Gäste im Vordergrund: Die Aussteller informieren über funktionale Ausstattung für Kinder, die den Restaurantaufenthalt auch für die kleinen Besucher zum Erlebnis macht. Im HOGA-Novum treffen sich Start-ups aus allen Bereichen der Branche und präsentieren hier ihre Ideen. Dazu gehören zum Beispiel Food-Trends und Innovatio-

nen aus dem Beverage-Bereich. Unter „Digital Future“ finden sich Software-Lösungen und IT-Angebote, die das Gastgewerbe voranbringen, Arbeitsabläufe optimieren und dadurch erleichtern. n

 rend-setterfortheBavarian T hospitalityindustry

Around 700 exhibitors will make HOGA the meeting place for the Bavarian hospitality industry from January 13-15, 2019. Experts from the hotel, catering and communal catering industries will be coming to Nuremberg to discover new products and trends, equip themselves for the future and network with service providers, manufacturers, suppliers and professional colleagues. In addition to the classic product segments “Food & Beverage”, “Kitchen Technology”, “Furnishing & Equipment” and “Software & IT Services”,

HOGA will focus on various trend themes and thus provide information, concepts, products and contacts for restaurateurs, hoteliers, catering businesses and canteens. For example, under the title “Speciality Land Bavaria”, 20 Bavarian companies will be showing Bavarian culinary delights at their best: from spirits and delicatessen to juices and wine. “Kidsʼ First Choice”, on the other hand, focuses on future guests: exhibitors provide information on functional equipment for children that makes a restaurant stay an experience for young visitors as well. HOGA-Novum is where startups from all sectors of the industry present their ideas. These include, for example, food trends and innovations from the beverage sector. At the “Digital Future” you will find software solutions and IT offerings that advance the hospitality industry and optimize work processes, thus making them easier. n

AFAGMessenundAusstellungenGmbH

hotel objekte – November/Dezember 2018 31


Special

Messevorschau2019 BAU2019

www.bau-muenchen.com

AngebotefürPlaner,Architekten undIngenieure

Der Gewerke übergreifende universelle Ansatz der BAU, Weltleitmesse für Architektur, Materialien und Systeme, macht sie zum wichtigsten Branchentreffpunkt für alle, die professionell mit dem Planen und Bauen zu tun haben. Die BAU 2019 bietet insbesondere für Planer und Architekten zahlreiche spezifische Angebote und Veranstaltungen. In den drei Messe-Foren gibt es zahlreiche Vorträge, die sich an den Leitthemen orientieren: Wie

MesseMünchen

S  pecialattractionsforplanners, architectsandengineers

Alle Angaben laut Hersteller

BAU, the world’s leading trade fair for architecture, materials and systems covers the entire building industry and all its trades – that’s what makes it the most important sector gathering for all those involved in the world of planning and construction. And BAU 2019 has much to offer these professionals in a wide range of attractions specifically targeted to these groups. In each of the three forums at the show there are different themes, all connected with the key themes

MesseMünchen

32 hotel objekte – November/Dezember 2018

geht es weiter mit der Digitalisierung? Welche Möglichkeiten bieten Vorfertigung und modulare Systembauweise? Wie wohnen und arbeiten wir in der Zukunft? Welche Bedeutung hat das Licht im Smart Building? Die Referenten in den Messforen sind unabhängige Experten aus aller Welt. Auch die Sonderschauen der BAU wenden sich in erster Linie an Planer und Ingenieure. Die BAU arbeitet dabei mit Partnern aus Forschung und Wissenschaft zusammen. Bei der Sonderschau „Lebensräume der Zukunft:

digital, nachhaltig, smart“ ist das die Fraunhofer Allianz Bau. Deren 14 Institute zeigen innovative Lösungen und Produkte aus der Fraunhofer-Bauforschung. Themenschwerpunkte sind Digitalisierung, „neue Nachhaltigkeit“, erneuerbare Materialien sowie smarte Gebäude und Quartiere. Das ift Rosenheim präsentiert eine Sonderschau zum Thema „Bauelemente TripleS – Smart/Safe/Secure“. Die Sonderschau zeigt den Einsatz intelligenter Bauelemente, Antriebe, Sensoren sowie Sicherheitssysteme. n

MesseMünchen

of the show: What next in digitization? What new possibilities are opening up because of advances in prefabrication and modular system construction? How will we be living and working in the future? What is the role of light in smart buildings? The speakers in the forums are independent experts from all over the world. The special shows at BAU are aimed mainly at planners and engineers. For these shows, BAU is working with partners from research and development. In the special show called “Spaces for living in the future:

MesseMünchen

digital, sustainable, smart”, the partner is the Fraunhofer Building Innovation Alliance. The 14 institutes in this alliance will be presenting innovative solutions and products emerging from Fraunhofer research in construction. The focal themes are digitization, “new sustainability”, renewable materials and smart buildings and urban districts. The ift Rosenheim is presenting a special show entitled “Building elements TripleS – Smart/ Safe/Secure”, which showcases the use of intelligent building components, drives, sensors and security systems. n


PfleidererDeutschlandGmbH

www.pfleiderer.com

Anzeige

BAU:HalleB5,Stand320undHalleA2,Stand413 PrimeBoardinHochglanz undMattsetztMaßstäbe

Lackoberflächen liegen voll im Trend und werden auch in den kommenden Jahren weiter an Bedeutung gewinnen. Pfleiderer beschäftigt sich schon seit längerer Zeit mit diesem Thema und ist nun mit einem eigenen Produkt am Markt. PrimeBoard verbindet dabei ansprechende Lack-Optik in Matt und Hochglanz mit optimaler Verarbeitbarkeit und hoher Beanspruchbarkeit. Besonders zusätzliche funktionale Eigenschaften wie der Anti-Fingerprint-Effekt begeistern die Kunden. Neben dem Design stößt besonders die gute Verarbeitbarkeit auf positive Resonanz. n

gloss and optimum machinability and high robustness. It is the additional functional properties, such as the anti-fingerprint effect,

that enthuse Pfleiderer’s customers. Apart from the design, it is the good machinability that is met with positive response. n

P  rimeBoardinhighglossand mattissettingnewstandards

Lacquered surfaces are the current trend and, in the coming years, will even gain in importance. Pfleiderer has been dealing with the topic for quite some time and has now entered this market with a product of their own. PrimeBoard offers both an attractive lacquered appearance in matt and high-

PROJECTFLOORSGmbH

Pfleiderer

www.project-floors.com

Anzeige

BAU:HalleA5,Stand119 NochmehrMöglichkeiten

Unsere beiden renommierten LVT-Designboden-Kollektionen floors@home und floors@ work erfahren Anfang 2019 ein umfangreiches Update mit neuen Dekoren, Formaten und synchrongeprägten Oberflächen bei den Holzdekoren. Anspruchsvoll gestaltete Bodenflächen bleiben ein großes Thema. Unsere Fischgrät-Kollektion erhält ebenfalls eine Erweiterung durch sechs Dekore im

französischen Fischgrät-Format (Chevron), die in einem Winkel von 60° abgeschrägt sind. So entstehen neue Verlegemöglichkeiten, die an die Parkettböden alter Herrenhäuser des 17. Jahrhunderts erinnern. Ebenfalls neu sind sechs Dekore mit einer sogenannten Groutline-Fase bzw. Profilfase. Um den rustikalen Holzdielen einen besonderen Touch zu geben, wird die Fase dieser in drei Breiten gelieferPROJECTFLOORS

ten Planken bis in die Mittellage hineingefräst. Die tiefe Fase und die unterschiedlichen Breiten der Planken schaffen eine außergewöhnliche Dielencharakteristik. n

Evenmorepossibilities

Our two renowned LVT design floor collections floors@home and floors@work will be extensively updated at the beginning of 2019 with new decors, formats and synchronously embossed surfaces for the wood decors. Sophisticatedly designed floor surfaces remain a major theme. Our herringbone collection will also be extended by six French herringbone decors (Chevron), which are bevelled at an angle of 60 degrees. This creates new laying possibilities reminiscent of the parquet floors of old 17th century mansions. There are also six new decors with a so-called Groutline bevel or profile bevel. In order to give the rustic wooden planks a special touch, the bevel of these planks, supplied in three widths, is milled into the middle layer. The deep bevel and the different widths of the planks create an unusual plank characteristic. n hotel objekte – November/Dezember 2018 33


Special

Messevorschau2019 norasystemsGmbH

www.nora.com

Anzeige

BAU:HalleA5,Stand133 TheHouseofDesign

Zwei Etagen voller Inspiration für gestalterische und funktionale Lösungen, modern und zukunftsgewandt – so präsentiert sich nora systems auf der BAU 2019 in München. Die Besucher erwartet eine effektvolle Insze-

nierung der hochwertigen Kautschukböden „Made in Germany“. Der im Vergleich zu 2017 größere Stand bietet Raum für Inspiration und persönliche Gespräche. Im Fokus der Messe steht diesmal ein Überblick über die breite Vielfalt an kundenindividuellen Lösun-

gen, die der Weinheimer Kautschuk-Spezialist anbietet – sei es im Hinblick auf Farben, Designs, Intarsien oder spezielle Formate. Außerdem wurde das meistverkaufte Produkt von nora systems, ein Boden aus der noraplan-Reihe, neu überarbeitet. n

Thehouseofdesign

Two floors full of inspiration for creative and functional solutions, modern and futureoriented – this is how nora systems presents itself at BAU 2019 in Munich. Visitors can expect an effective presentation of the highquality rubber floorcoverings “made in Germany”. Compared to 2017, the larger stand offers space for inspiration and personal exchange. This time the focus will be on an overview of the wide range of customerspecific solutions offered by the Weinheimbased rubber specialist – be it in terms of colours, designs, inlays or special formats. In addition, the best-selling product from nora systems, a floor from the noraplan range, has been reworked. n

norasystemsGmbH

EmcoBautechnikGmbH

www.emco-bau.com

Anzeige

BAU:HalleA6,Stand310 Domotex:Halle12,StandB68 Sauberkeitbeginntmit demerstenSchritt

Vielfältige Sauberlaufsysteme für die bedarfsorientierte Ausstattung von Eingangsbereichen präsentiert emco Bau auf der Domotex 2019. Der Fokus liegt dabei auf der DreiZonen-Reinigung, einer Systemkombination aus Eingangsmatten und Sauberlaufbelägen für die äußerst wirksame Aufnahme von Grob-, Fein- und Feuchtschmutz. In den ersten beiden Zonen kommen hochwertige Mattenlö-

Alle Angaben laut Hersteller

emcoBautechnikGmbH

34 hotel objekte – November/Dezember 2018

sungen zum Einsatz, die sich optimal auf die Anforderungen in dem jeweiligen Gebäudeeingang anpassen lassen. Für die dritte Zone steht ein breites Spektrum an Sauberlaufbelägen der Tochtergesellschaft C/R/O/ zur Verfügung. Die Systeme können nicht nur in vielen Farben und Formen ausgeführt, sondern auch individuell bedruckt und als Werbe-, Imageund Informationsträger genutzt werden. Sie finden uns auch auf der BAU in München: Halle A6, Stand 310. n

 akethefirststep T towardscleanliness

emco Bau presents a diverse array of cleanoff systems which enable entrance areas to be fitted out in line with each client’s needs at Domotex 2019. Here, the focus was on 3 zone cleaning, a combination system consisting of entrance mats and clean-off systems for the most effective dirt-trapping, ensuring the successive removal of coarse, fine and damp dirt in the entrance area. High-quality mat solutions are used in the first two zones. These can be optimally adapted to the requirements of the building entrance at hand. For the third zone, a broad spectrum of clean-off systems is available from our subsidiary C/R/O. The systems can be supplied in many different colours and forms, but that’s not all. We can also customise them by printing them with images or patterns selected by you, thus enabling them to serve multiple functions as advertising, image displaying or informative design elements. You will also find us at BAU in Munich: Hall A6, booth 310. n


immcologne www.imm-cologne.de ZurinternationalenEinrichtungsmessetrifftDesignaufBusiness

Direkt zum Auftakt des Einrichtungsjahres 2019 können die Entscheider, Interior Designer, Influencer und designorientierte Endverbraucher in Köln vom 14.–20. 01. 2019 die Trends in der Einrichtungswelt live erleben. Alle relevanten Marktführer und Top-Design-Labels sind dabei und nutzen die imm cologne für ihre internationalen Geschäfte. In elf Hallen entfaltet sich eine ungeheure Vielfalt an Wohnstilen und -sortimenten: von den eleganten Lifestyle-Marken und angesagten Designlabels im Designsegment bis zu den cleveren Einrichtungslösungen für junges, trendbewusstes Wohnen im Angebotssegment Smart – und alles dazwischen. Die imm cologne überzeugt mit der richtigen Balance zwischen Showroom und Business, Design und Alltagstauglichkeit, Vollständigkeit und Kompaktheit. Und mit einem Besuch der parallel stattfindenden LivingKitchen, lassen sich in Köln so ziemlich alle Aspekte des Wohnens auf einmal erfahren. Zur imm cologne 2019

Maison&ObjetParis

wird es als Highlight für Design-Interessierte auch wieder das Interior-Design-Projekt „Das Haus“ geben. n

 esignmeetsbusinessatthe D internationalinteriorsshow

From 14 – 20 January decision makers, interior designers, influencers and design-oriented consumers can experience the trends in the sector for themselves in Cologne right at the start of the 2019 interiors year. All the relevant market leaders and top design labels will be there and take advantage of imm cologne to do international business. Home lifestyles and product ranges will be on show in all their

diversity across eleven halls: from elegant lifestyle brands and on-trend design labels in the design segment to intelligent interiors solutions for young, trend-aware homes in the Smart segment – and everything in between. imm cologne impresses visitors because it has the right balance between a showroom and business, design and suitability for daily use, completeness and compactness. And with a visit to LivingKitchen, which is taking place alongside, almost all aspects of home living can be experienced together in Cologne. In addition imm cologne 2019 will once again feature the interior design project “Das Haus” as a highlight for design enthusiasts. n

www.maison-objet.com

WeltweitwichtigsterBranchentreff

Seit 1995 gilt die Maison&Objet Paris, deren nächste Ausgabe vom 18.–22.01.2019 stattfindet, bereits als der internationale Branchentreff für Lifestyle, Innenraumgestaltung und Design. Unter ihrem Dach kommen auf über 115.000 Quadratmetern mehr als 3.000 Marken und jedes Mal rund 90.000 Besucher zusammen, darunter 50 Prozent aus dem Aus-

Anne-EmmanuelleThion

KoelnmesseGmbH,ThomasKlerx

land. Zweimal jährlich dient die Messe mit ihrem hohen Potenzial für Begegnungen und das Aufspüren neuer Talente als Inspirationsquelle und Wegweiser für die Trends von heute und morgen. So kurbelt sie die Entwicklung und das Wachstum der Marken ordentlich an. Die 2016 eingeführte digitale Plattform MOM (d. h. Maison&Objet and more) vereint Neuheiten und Produkte der Marken, Hersteller,

Kunsthandwerker und Designer. Für die Besucher bietet sie täglich unerschöpfliche Inspirationsmöglichkeiten und ganzjährig die direkte Kontaktaufnahme zu tausenden von Marken.n

Theworld’sleadingindustryevent

Since 1995, Maison&Objet Paris, whose next edition will take place from 18 – 22 January 2019, has been the world’s foremost event for professionals of the lifestyle, interior design and design industries. On more than 115,000 square meters every edition brings together some 3,000 exhibitors and more than 85,000 unique visitors – of which 50 % hail from outside France. Promoting new contacts and emerging talents, Maison&Objet presents twice a year the latest sources of inspiration by shedding insight into current and future trends. As a result, the event has become an effective catalyst for brand development and business growth. Launched in September 2016, the digital platform MOM (Maison&Objet and more) offers a comprehensive overview of the latest news from and products by exhibiting labels, manufacturers, artisans, craftspeople and designers. A never-ending source of inspiration, it also provides a tool for visitors to establish a direct conversation with thousands of brands all year round. n hotel objekte – November/Dezember 2018 35


Special

Messevorschau2019 EuroCIS2019

www.eurocis.com

MesseDüsseldorf

Alle Angaben laut Hersteller

Zeichensetzungfürdie ZukunftdesHandels!

Die EuroCIS, The Leading Trade Fair for Retail Technology, erreichte in 2018 mit 13.400 Quadratmetern netto eine neue Bestmarke. Auch im kommenden Jahr werden rund 500 Aussteller aus 29 Ländern vom 19. bis 21. Februar 2019 in Düsseldorf vertreten sein, mehr als 12.000 internationale Besucher aus über 90 Ländern werden erwartet. Die EuroCIS-Aussteller setzen Zeichen mit hoch spezialisierten Entwicklungen und Lösungen, z. B. in den Bereichen Omnichannel-Management, Big Data, Zahlungssysteme, E-Commerce-Lösungen, Supply-Chain-Management, Mobile Solutions, Checkout Management, Digital Marketing, Robotics, Workforce Management oder Warensicherung. Für einen direkten Praxisbezug ist ebenfalls gesorgt, denn das EuroCISForum und auch das OmnichannelForum bieten aktuelle Fallstudien, Innovationen und Trends. Zusätzlich besteht für die Fachbesucher die Möglichkeit, an „Guided Innovation Tours“ teilzunehmen. Das erfolgreiche Start-Up Hub wird bei seiner zweiten Auflage noch einmal vergrößert und erhält ein eigenes Forum, in dem Newcomer spannende Vorträge rund um ihre innovativen Lösungen anbieten. Last but not least wird die Verleihung der begehrten retail technology awards europe (reta europe) durch das EHI Retail Institute ein 36 hotel objekte – November/Dezember 2018

Highlight im Rahmenprogramm der EuroCIS 2019 sein. Ausgezeichnet wird der exzellente und innovative Einsatz von Informationstechnologie im Handel. n

 akingastatementfor M thefutureofretail!

In 2018 EuroCIS, The Leading Trade Fair for Retail Technology, achieved a new record

MesseDüsseldorf

with 13,400 m² net exhibition space. Next year once again to the tune of 500 exhibitors from 29 countries will be represented in Düsseldorf from 19 to 21 February 2019 and more than 12,000 international visitors from over 90 countries are expected to attend. The EuroCIS exhibitors make a statement with highly specialised developments and solutions in such fields as omni-channel management, big data, payment systems, E-commerce solutions, supply-chain management, mobile solutions, check-out management, digital marketing, robotics, workforce management or article surveillance. Direct reference to practical application is also ensured because the EuroCISForum and the OmnichannelForum will present current business cases, innovations and trends. Additionally, trade visitors are given the opportunity to take part in “Guided Innovation Tours”. For its second edition the successful Start-Up Hub will be enlarged yet again and fitted with its own Forum where newcomers will be delivering exciting talks revolving around their innovative solutions. Last but not least, the presentation of the coveted retail technology awards europe (reta europe) by the EHI Retail Institute will prove a highlight in the line-up of events accompanying EuroCIS 2019. They recognise the excellent and innovative use of information technology in retail. n


troniTAGGmbH

www.tronitag.com

Anzeige

EuroCis:Halle09,StandA66 DigitaleBeschilderungfür GastronomieundHotellerie

Mit den digitalen Schildern von troniTAG lassen sich Informationen mehrmals täglich, vollautomatisch und in Höchstgeschwindigkeit aktualisieren – überall dort, wo Informationen sonst manuell gewechselt werden. Egal ob an der Rezeption, im Restaurant oder als Raumbeschilderung, das Beschriftungsdesign lässt sich an jeden Einsatzort in Ihrem Etablissement anpassen. Weitere Vorteile: zentrale Informationssteuerung und -planung, Einsparung von Personal- und Druckkosten, sekundenschnelle und zeitpunktgenaue Aktualisierungen, individuelle Gestaltungsmöglichkeiten, sichere Datenübertragung, Batterielaufzeit > 5 Jahre. n

changed. Whether at the front desk, in the restaurant or as room signs, the design can be adapted to any environment in your establishment. Additional advantages: central information control and planning, saving of personnel and printing costs, instantaneous and timely updates, individual design options, secure data transmission, battery life> 5 years. n

Digitalsignageforgastronomy andhotelindustry

With the digital signs from troniTAG, information can be updated several times a day, fully automatically and at top speed – wherever information is otherwise manually

ErgonomicSolutions

troniTAG

www.ergonomic.solutions

Anzeige

EuroCis:Halle09,StandA60 Tabletssicherbefestigenmit OpenSpaceA-Frame™

Sicherheitsbedenken stehen häufig der Nutzung von In-Room Tablets in Hotelzimmern entgegen. Doch mit OpenSpace A-Frame™ von Ergonomic Solutions ist die sichere und flexible Montage möglich. Stabile TabletHalterungen bieten maximalen Schutz für sämtliche Arten von Tablets, ob am Tisch, an der Wand oder am Tresen. Sie sichern und schützen Tablets vor unbefugten Eingriffen oder Diebstahl. Mit OpenSpace A-Frame™ von Ergonomic Solutions lassen sich auch Ladekabel in die sichere Halterung oder in das Tablet-Gehäuse integrieren, sodass die Geräte zum Aufladen nicht bewegt werden müssen. n

using security peripherals such as secure fixed tablet mounts (to a table, the wall or counter top) or safety tethers to keep tablets safe from tampering or theft such as the OpenSpace A-Frame™ from the Ergonomic Solutions

Group. Charging cables can also be integrated with the secure mount or tablet enclosure, meaning the devices do not need to be moved to recharge. n

ErgonomicSolutions

E  nsuringtabletdevicesecurity withOpenSpaceA-Frame™

One of the biggest barriers to overcome with in-room tablets at hotels are the security concerns over theft or damage to the devices themselves. One way to mitigate this is by hotel objekte – November/Dezember 2018 37


Special

Messevorschau2019 ADASYSGmbHaPoindusCompany

www.adasys.de

EuroCis:Halle10,StandB22 PerformanceundFlexibilität amPOS

Die VariPOS 2 Serie von Poindus kombiniert Design, Performance und Flexibilität für Ihren Kassenarbeitsplatz. Mit ihrem schlanken und edlen Design sind diese Systeme echte Eyecatcher, bieten dank Skylake CPUs ausreichend Power für Ihre Software und eignen sich aufgrund ihrer hohen Servicefreundlichkeit auch für größere Projekte. Speziell

konzipiert für den leistungsstarken Einsatz in Handel und Gastronomie kann jedes Gerät mit Peripheriegeräten aus der gesamten VariPOS 2 Serie an die verschiedensten Anwendungsszenarien angepasst werden. n

 erformanceandflexibility P atyourPOS

The Poindus VariPOS 2 Series combines design, performance and flexibility at your

Point of Sale. Their sleek and elegant design makes these systems real eye catchers, their Skylake CPU offer enough power for your software and their high service-friendliness makes them suitable for larger projects. Specifically designed for high-performance use in retail and hospitality, each device can be customized with a variety of peripherals, available for the whole VariPOS 2 Series, to fit many different application scenarios. n

ADASYS

GloryGlobalSolutions(Germany)GmbH

www.glory-global.com

EuroCis:Halle09,StandB04

Alle Angaben laut Hersteller

InnovativesCash-Management

Im Hotel- und Gastronomiebetrieb spielt Bargeld nach wie vor eine große Rolle. Da die manuelle Bargeldverarbeitung allerdings mit einem immensen Zeit- und Arbeitsaufwand verbunden ist, werden innovative Cash-Management-Lösungen immer wichtiger. Unter dem Motto „Mensch, Maschine, Interaktion – Hightech meets Cash Management“ präsentiert Glory auf der EuroCIS 2019 unter anderem den Banknoten- und Münz-Recycler CI-50 für das Backoffice. Das System zählt, authentifiziert und verwahrt Einnahmen vollkommen automatisiert, verhindert Abrechnungsdifferenzen und entlastet so die Mitarbeiter. n 38 hotel objekte – November/Dezember 2018

Innovativecashmanagement

Cash still captures a major role in hotel and restaurant business. As manual cash processing can be time-consuming and impacts the efficiency of staff and business operations, innovative cash management solutions are becoming increasingly important. Under the motto “Human, machine, interaction – hightech meets cash management”, Glory will present the banknote and coin recycler CI-50 as a back office solution at EuroCIS 2019. The system counts, authenticates and stores revenues completely automated, prevents failures while accounting-processes and eases employees. n

CI-50fürBackoffice, GloryGlobalSolutions


POSIFLEXGmbH

www.posiflex.com

EuroCis:Halle09,StandC42 InteraktivesKiosksystem ParagonTK-3200

Paragon TK-3200 ist ein interaktives 32-Zoll-Kiosksystem für Hotellerie und Gastronomie, insbesondere Fast-Casual- und Schnellservicerestaurants. Als nahtlose Erweiterung existierender Kassensysteme hilft es dem Gastronomen, zu Spitzenzeiten die Umsätze weiter

zu steigern und bietet Kunden diverse Bestell-, Zahl- und sonstige Interaktionsoptionen. Der 32”-PCAP-Touchscreen der Paragon TK-3200 Serie besitzt eine Halterung für EMV-Zahlungsgeräte und unterstützt Scannen und Drucken. Für flexible Einsatzmöglichkeiten gibt es die Montageoptionen Wandbefestigung, Einzel- und Doppelseitenbetrieb. n

Posiflex Paragon TK-3200, Posiflex GmbH

I nteractivekiosk ParagonTK-3200

Paragon TK-3200 is a 32" interactive kiosk that is suited for hospitality venues including quick service and fast casual restaurants. It serves as a seamless extension of the existing POS terminals, helping hotel and restaurant owners to drive sales during peak times, and offers various ways for guests to order, pay and engage with the brand. Featuring a 32” PCAP touchscreen, the TK-3200 Series supports EMV payment with a customized bracket as well as scanning and printing. Easily adapting to environments, it offers various mounting options: wall-mounted, single or dual sided operation. n

PosiflexParagonTK-3200,PosiflexGmbH

AURESTechnologiesGmbH

www.aures.com/de

EuroCis:Halle09,StandF26 AURESTechnologieszeigtneue ProduktlinieTWISTaufderEuroCIS 2019.

Der Spezialist für Kassensysteme präsentiert u. a. mit TWIST seine neuesten POS-Innovationen. TWIST ist ein kompaktes EPOS-Terminal mit projiziert-kapazitivem Touchscreen (PCAP, 13.3“, 16:9). Modernste Designkonzeption, minimaler Platzbedarf und enorme Variabilität zeichnen die TWIST aus. Drei leistungsstarke Intel-Prozessoren stehen zur

Auswahl. TWIST ist lüfterlos und damit immun geben Staub, Fett und Schmutz. Das puristische und klare Design fügt sich an jedem POS perfekt ein. n

 URESTechnologiespresents A newproductlineTWISTat EuroCIS2019.

The specialist for cash register systems presents its latest POS innovations, including TWIST. TWIST is a compact EPOS terminal

with projected-capacitive touchscreen (PCAP, 13.3”, 16:9). The most modern design concept, minimal space requirement, and enormous variability characterize the TWIST. Three powerful Intel processors are available. TWIST is fanless and thus immune to dust, grease, and dirt. The purist and clear design matches perfectly with every POS. n

AURESTechnologiesGmbH

hotel objekte – November/Dezember 2018 39


Case Study

Oberflächen

Wohnen wie auf einer Yacht Abet Laminati sorgt im Mövenpick Hotel Lausanne für Yachtfeeling

Basis des Entwurfskonzepts: Der Genfer See mit Blick auf den Yachthafen / The basis of the design concept: Lake Geneva with a view of the marina

Bildnachweise siehe Impressum

S

egel frei am Hafen von Lausanne: Seit Kurzem begrüßen die frisch renovierten Zimmer des Mövenpick Hotels ihre Gäste im neuen Look. Zwischen 2015 und 2017 wurden unter der Federführung des Planungsbüros Geplan Design aus Stuttgart, 264 Zimmer und sieben Geschossflure des Hotels neu konzipiert. Die phantastische Lage am Genfer See mit Blick auf den Yachthafen wurde zur Basis des Entwurfskonzeptes der Stuttgarter. Funktional: Schichtstoff in

warmer Holzoptik Unter dem Motto „Wohnen wie auf einer Yacht“, sollten sich klassische Elemente und 40 hotel objekte – November/Dezember 2018

Materialien aus dem Umfeld des Yachtinteriors in den Zimmern wiederfinden und zeitgemäß umgesetzt werden. Schnittig und geradlinig, aber nicht kühl, sollte das Ambiente dem Gast begegnen. Die Designer haben hier auf Materialkontraste gesetzt – glatte, glänzende Flächen im Zusammenspiel mit optisch warmen Materialien wie Holz. Hierbei spielte natürlich auch die funktionale Seite eine wichtige Rolle. So entschied man sich aus diesem Grund gegen ein Naturholz und fand eine haptisch gleichwertige, doch pflegeleichtere und gegenüber UV-Licht unempfindlichere Alternative im Holzdekor Schichtstoff. Dieses Material fasst als Rahmen den wunderbaren Panoramaausblick der Zimmerfenster auf den Hafen ein und ist

zugleich ein kuschliger Platz zum Verweilen und Genießen des Ausblicks. Maritime Akzente auch im

Interior-Design Das Interior-Design der Hotelzimmer überrascht den Gast durch viele weitere Akzente und Symbole. Großflächige Spiegelpaneele in Form von Segeln, ein gekonnt eingesetzter Blauton der Bettenrückwand und an Wasserspiegelungen erinnernde Bodenbeläge geben die maritime Atmosphäre der Umgebung wieder und erzeugen ein Gefühl von Klarheit und Leichtigkeit. Hier fühlt man sich den Elementen nahe und ist doch sicher und geborgen. n


Like living on a yacht Abet Laminati provides yacht feeling at the Mövenpick Hotel Lausanne pressure laminate, alternative to natural wood but easier to clean and less sensitive to UV light. Like in a frame, this material takes the wonderful panoramic view of the windows on the harbour. And at the same time it is a cosy place to stay and enjoy the view. Maritimeaccents

ininteriordesign The interior design of the hotel rooms surprises the guest with many other accents and symbols. Large-area mirror panels in the shape of sails, a skilfully inserted shade of blue on the back of the bed and floor coverings reminiscent of water reflect the maritime atmosphere of the surroundings and create a feeling of clarity and lightness. Here you feel close to the elements and yet safe and secure. n DerBlautonderBettenrückwandunterstreichtdiemaritimeAtmosphäre/Thebluetoneofthebed‘s

headboardunderlinesthemaritimeatmosphere

S

et sail at the port of Lausanne: Recently, the guests of the Mövenpick Hotel are welcomed by the newly renovated rooms with a new look. Between 2015 and 2017, 264 rooms and 7 storey corridors of the hotel were redesigned by the planning office Geplan Design in Stuttgart. The fantastic location on Lake Geneva became the basis of the design concept. Functional:laminatewith

awarmwoodlook Under the motto “like living on a yacht”, it was intended that classic elements and materials from the environment of yacht interiors should be reflected in the rooms and implemented in a contemporary way. Sleek and straightforward, but not cold, the ambiance should meet the guest. The designers have set a material contrasts – smooth, shiny surfaces in conjunction with optically warm materials, such as wood. Of course, the functional side played also an important role here. For this reason it was decided to search for a haptic equivalent which was found in a wood decorative high

GroßflächigeSpiegelpaneeleimharmonischenZusammenspielmitoptischwarmenMaterialien/

Thelarge-surfacemirrorpanelsplayinperfectharmonywithopticallywarmmaterials.

hotel objekte – November/Dezember 2018 41


Case Study

Badlösungen

Luxus und Eleganz im Herzen Warschaus Im Hotel Raffles Europejski verbinden Dornbracht-Armaturen Tradition und Moderne Zeiten an und steht auch heute für beispiellose Eleganz: Es verfügt über 106 moderne Zimmer und Suiten. Die Gäste speisen in exklusiven Restaurants, Bars und Cafés und lassen sich im hauseigenen Spa- und Wellnessbereich verwöhnen. Auch zahlreiche Werke zeitgenössischer Kunst gehören zum Interieur des Europejski und werden größtenteils öffentlich zugänglich ausgestellt. Baden im Luxus

Wer im Raffles Europejski Warschau nächtigt, ist von Luxus umgeben: Die Bäder des Hotels sind vollständig in grauem Marmor gefliest und verfügen über ansprechende Mosaik-Musterungen, die Warschaus Skyline mit seinen berühmtesten Gebäuden darstellen. Die installierten Armaturen der Serien CL.1, Tara.Logic, Tara und MEM von Dornbracht in Chrom oder Champagner gehen entweder eine harmonische Symbiose mit den steinfarbigen Oberflächen ein oder bilden einen auffälligen Akzent. In den meisten Bädern sowie im Spa- und Poolbereich des Hotels wurde die Serie CL.1 verbaut. Charakteristisch für CL.1 sind der konische, nach oben strebende Auslauf sowie das präzise Spaltmaß zwischen Sockel und Armaturenköper. Optisch und haptisch besonders auffällig sind die strukturierten Relief-Griffe der Armatur. Passende Brausegarnituren, Regenbrausen, Handtuchhalter oder Haken runden die Badgestaltung ab. Die passenden Türgriffe der luxuriösen Duschkabinen stammen ebenfalls von Dornbracht und wurden speziell für das Europejski angefertigt. Ausgewogenes und exaktes Design Das elegante und zugleich moderne Interior-Konzept des Raffles Europejski findet sich in auch in der

Bar im Erdgeschoss des Hotels wieder / The elegant yet modern interior design concept of the Raffles Europejski is also encountered in the Long Bar on the ground floor of the hotel

Bildnachweise siehe Impressum

1

857 erbaut, galt das Hotel Europejski als eines der repräsentativsten und elegantesten Hotels seiner Zeit. Knapp 160 Jahre später erfolgte die aufwendige Kernsanierung des geschichtsträchtigen Baus: Die historische Neo-Renaissance-Fassade wurde renoviert, das Gebäude um Boutiquen und Büros ergänzt, die Zimmer

42 hotel objekte – November/Dezember 2018

an modernste Standards angepasst und die Bäder mit Premiumarmaturen von Dornbracht ausgestattet. Im Zentrum Warschaus gelegen, fügt sich das Fünfeinhalb-Sterne-Hotel elegant in ein von Palästen, Kirchen und Denkmälern gesäumtes Straßenbild ein. Nach seiner Renovierung knüpft das Raffles Europejski an glorreiche

Des Weiteren wurden auch die Armatur-Serien MEM und Tara bzw. Tara. Logic installiert. Die freistehende Tara. Logic-Wannen-Einhandbatterie befindet sich in insgesamt 44 Bädern des Hotels. Die Armatur reckt sich elegant in die Höhe und besticht durch ihr schlankes, reduziertes und zeitloses Design. Sämtliche Dornbracht-Produkte fügen sich harmonisch in das moderne Einrichtungskonzept des traditionsreichen Hotels ein und garantieren ästhetische Langlebigkeit. n


Luxury and elegance in the heart of Warsaw At the Hotel Raffles Europejski Dornbracht fittings span traditional and modern

B

uilt in 1857, the Hotel Europejski was regarded as one of the most representative and elegant hotels of its day. Some 160 years later, the historically important building has been painstakingly restored: The historic Neo-Renaissance façade has been renovated and new elements have been added to the building – among them an office and boutiques. The rooms have been upgraded to the latest modern standards and the elegant bathrooms have been furnished with premium fittings from Dornbracht. Located at the heart of Warsaw, the five-star hotel fits elegantly into a street scene that is lined with palaces, churches and monuments. After its painstaking renovation, Europejski provides a link to glorious days gone by, while still representing elegance: It has 106 modern rooms and suites. Guests at the Europejski dine in exclusive restaurants, bars and cafés and a famous longbar. They are pampered in the hotel’s own spa and wellness area. The interior of the Europejski is also home to various contemporary artworks, most of which are on display and accessible to the public.

Balancedandaccuratedesign

Also installed are the Dornbracht MEM, Tara and Tara.Logic series. The freestanding Tara.Logic single lever bath mixer can be found in a total of 44 bathrooms throughout the hotel. The slender and reduced design of the fitting is captivating, as it stretches elegantly upwards. All the Dornbracht products installed here blend into the modern interior design concept of this traditional hotel and are remarkable for their long-lasting aesthetic appeal. n DiefreistehendeTara.Logic-Wannen-Einhand-

batterierecktsichelegantindieHöheund bestichtdurchihrschlankesundreduziertes Design/Thefree-standingTara.Logicsingleleverbathmixerstretcheselegantlyupwardsand impresseswithitsslenderandreduceddesign

Batheinluxury

When you spend the night at the Raffles Europejski Warsaw, you are surrounded by elegance. The hotel bathrooms are fully tiled in grey marble mosaic which shows Warsaw’s skyline with its most characteristic buildings. The polished chrome or champagne of the Dornbracht CL.1, Tara. Logic, Tara and MEM series fittings installed here either form a harmonious symbiosis with the stone-coloured surfaces or create a striking highlight. Dornbracht’s CL.1 series is installed in most bathrooms as well as in the spa and pool area of the hotel. The tapered, upward-reaching spout and the precise gap width between the base and the body of the fitting are typical of CL.1. The relief-textured handles give the fitting a particularly striking appearance and feel. The bathroom design is rounded off by matching Dornbracht CL.1 series spray sets, rain showers and accessories such as towel bars or hooks. Dornbracht has also crafted matching door handles for the luxury shower cubicles at the Europejski.

DieBäderdesHotelssindvollständigingrauemMarmorgefliestundverfügenüberansprechende

Mosaik-Musterungen,dieWarschausSkylinedarstellen/Thehotelbathroomsarefullytiledingrey marblewithmosaicsshowingWarsaw’sskylinewithitsmostcharacteristicbuildings

hotel objekte – November/Dezember 2018 43


Case Study

Badlösungen

Organisches Design als Hommage an die Natur Im Olympic Palace Resort Hotel auf Rhodos überzeugen Armaturen von Fir Italia

I

m Nordosten der griechischen Insel Rhodos mitten in Ixia gelegen, nur wenige Schritte vom Strand und nur zwölf Kilometer vom Internationalen Flughafen „Diagoras“ entfernt, befindet sich das Olympic Palace Resort Hotel.

tektin Rena Mania auf der Suche nach von der Natur inspirierten Armaturen, die gänzlich im Einklang mit dem Relax-Bereich und seiner Atmosphäre wären. Die Waschtischarmaturen Synergy Stone 95 von Fir Italia – ein Francesco Lucchese Design –

Liebe zum Detail und edle

Bildnachweise siehe Impressum

Materialien Hinter der mediterranen Fassade des Fünf-Sterne-Hauses verbergen sich zahlreiche moderne und durchdachte Einrichtungen, z.  B. verschiedene Restaurants, Schwimmbäder, Tennis-, Handball- oder Kinderspielplätze, die durch eine Auswahl feiner Materialien und anspruchsvoller Designelemente mit viel Liebe zum Detail bereichert wurden. Das Highlight des Hotels ist jedoch die Luxus-Wellnessanlage Vithos. Für deren Massagebereich war Innenarchi-

Olympic Palace Resort Hotel Rhodos

mit ihrem „Stone“-Griff lieferten hier das ideale gewünschte optische Resultat, da sie sich perfekt den Keramikwaschtischen und dem Holz der Behandlungs- und Massageräume anpassen. Jede Armatur erinnert an einen Stein, auf dem Wind, Sonne und Wasser Jahrhunderte lang ihre Spuren hinterlassen und ihm diese unvergleichlichen Formen gegeben haben. Die „Total Black“-Ausführung der Waschtische in der Farbe Dupont™ Corian® Deep Nocturne harmoniert fantastisch mit den zarten, ungleichen und bildhauerischen Formen der Synergy-Stone-95-Armaturen. Die Kollektion mit ihrem von der Natur inspirierten innovativen Design, die in vollkommener Harmonie mit den zeitlosen Räumen des Gebäudes ist, garantiert sowohl eine hohe optische als auch materielle Qualität und sorgt für ein unvergessliches und ganzheitliches Relax-Gefühl. n

Von der Natur inspiriertes Armaturen-Design in vollkommener Harmonie mit den zeitlosen Räumen / Faucet design inspired by nature in perfect harmony

with timeless spaces

44 hotel objekte – November/Dezember 2018


DieArmaturenpassensichperfektdenKeramikwaschtischenunddemHolzderBehandlungsräumean/Thefaucetsmatchperfectlytheceramicwashba-

sinsandthewoodusedtodesignthetreatmentrooms

Organic design as a tribute to nature The Olympic Palace Resort Hotel in Rhodes boasts fittings by Fir Italia

T

he Olympic Palace Resort Hotel is located in the northeast of the Greek island of Rhodes in the middle of Ixia, just a few steps from the beach and only twelve kilometers from the International Airport “Diagoras”.

Attentiontodetailand

finematerials Behind the Mediterranean facade of the five-star house, there are numerous modern and sophisticated facilities, such as various restaurants, swimming pools, tennis courts, handball and children’s playgrounds, which have been enriched by a selection of fine materials and sophisticated design elements with great attention to detail. The highlight of the hotel, however, is the luxury spa Vithos. For their massage area, interior designer Rena Mania was on the lookout for nature-inspired fittings that would be in complete harmony with the relaxation area and its atmosphere. The Synergy Stone 95 washbasin faucets from Fir Italia—a Francesco Lucchese design—with their

“stone” handle provided the ideal visual result, as they perfectly match the ceramic washbasins and the wood used to design the treatment and massage rooms. Each faucet is reminiscent of a stone on which wind, sun, and water have left their mark for centuries, giving them these incomparable forms. The “Total Black” version of the washbasins in the colour Dupont™ Corian®

Deep Nocturne harmonizes fantastically with the delicate, uneven and sculptural shapes of the Synergy Stone 95 fittings. The collection, with its nature-inspired innovative design, in perfect harmony with the timeless spaces of the building, guarantees both high visual and material quality and provides an unforgettable and holistic feeling of relaxation. n

DiehoheoptischeundmaterielleQualitätsorgtfüreinganzheitlichesRelax-Gefühl/Thehighvisual

andmaterialqualityprovidesaholisticfeelingofrelaxation

hotel objekte – November/Dezember 2018 45


Fachbeitrag

Hotelakustik

Für eine gute Akustik im Hotel Ein ruhiges Hotelzimmer ist nicht der einzige Wunsch der Gäste. Sie erwarten ganzheitliche akustische Qualität

Das Fraunhofer IBP forscht im Verbund mit Partnern an maßgeschneiderten und zugleich wirtschaftlichen Lösungen für eine ganzheitliche akustische

Hotelqualität / The Fraunhofer IBP research in cooperation with partners of customized, yet cost-effective solutions for a holistic acoustic hotel quality

Bildnachweise siehe Impressum

O

b Geschäftsreisender oder Tourist – fast jeder verbindet mit einem Hotelaufenthalt Wohlbefinden und Entspannung, Komfort und manchmal auch Luxus. Neben Sauberkeit und Hygiene steht das »ruhige Zimmer« weit oben auf der Wunschliste. Dagegen ist »Hellhörigkeit« ein häufiger Anlass für Beschwerden. Der Bedarf an akustischer Hotelqualität ist unverkennbar. Von einer ganzheitlichen akustischen Hotelqualität profitieren sowohl Gäste und Hoteliers als auch Personal und Nachbarn. Gute Hotelakustik reicht von der Privatsphäre im Zimmer über die Diskretion an der Rezeption bis zur Sprachverständlichkeit in der Lobby und im Tagungsraum. Aber auch die akustische Atmosphäre in Restaurants gehört zu den bleibenden Höreindrücken. Wie kann die Hotellerie diese Ansprüche ihrer Gäste in die Realität umsetzen? Es gibt zwar einige Qualitätsanforderungen wie z. B. die hierzulande etablierte Schallschutznorm, bislang fehlen jedoch hinreichende wissenschaftliche Untersuchungen zur Akustik von Hotels und Restaurants.

46 hotel objekte – November/Dezember 2018

Im Vordergrund: die Gesamt­

wirkung aller Maßnahmen Um die Grundlagen für eine umfassende Gestaltung der akustischen Hotelqualität zu identifizieren, führte das Fraunhofer-Institut für Bauphysik IBP u. a. Gästebefragungen und Messungen durch und wertete internationale Forschungsergebnisse aus. Die Liste organisatorischer, technischer und baulicher Maßnahmen mit positiven akustischen Resultaten ist lang. Letztlich stehen jedoch nicht nur die Wirkung von Einzelmaßnahmen, sondern die Wechsel- und vor allem die Gesamtwirkung im Vordergrund. Störfaktor Nummer eins:

Verkehrslärm Die Ergebnisse der Befragung sind eindeutig: Von außen eindringender Verkehrslärm bei geschlossenen Fenstern ist für Hotelgäste der größte akustische Störfaktor. Ein wirksamer Lärmschutz von Außenbauteilen steht deshalb an erster Stelle. Dabei erweisen sich häufig Fenster und ihre Zusatzein-

richtungen als Schwachstelle. Die hörbaren Schallquellen im Inneren der Hotelgebäude bieten aber aus Sicht der Gäste ebenfalls Potenzial für Verbesserungen. Wer kennt das nicht: Gespräche und Geräusche auf dem Flur dringen ins Zimmer, Zimmerund Brandschutztüren fallen donnernd ins Schloss. Technische Gegenmittel gibt es zwar, aber sie werden oft falsch eingebaut, dem Kostendruck geopfert oder mitunter auch einfach vergessen. Hotelbad: Ruhepol dank schall­

gedämmter Installationen Im Bad sind nicht nur Design und Hygiene gefragt, um beste Voraussetzungen für Entspannung pur zu garantieren. Das Brummen des gefühlt ewig nachlaufenden Lüfters ist als akustische Störquelle ein »Klassiker«. Dabei ist eine Komfort-Lüftung mit energieeffizienten Ventilatoren auch geräusch­ los möglich. Dann wiederum kann gelegentlich Aufklärung nötig sein, dass Ruhe nicht etwa Fehlfunktion bedeutet. Ähnlich stellt sich die Situation bei Wasser- und Sa-


nitärgeräuschen dar. Die nach Norm gemessenen Schallpegel im Nachbarzimmer sind zwar gering. Die Norm blendet allerdings die Geräuschspitzen aus, obwohl gerade sie zu Aufwachreaktionen führen können. In jedem Fall sind schalltechnisch geprüfte Geräte und Installationen ein Schritt in die ruhige Richtung. Auch die Entscheidung

einem Wissens- und Gestaltungsfundus zusammengetragen wurden. Auf deren Basis lassen sich auch die jeweiligen Kenngrößen und -werte je nach Art und Nutzung konkret formulieren. Umgesetzt in die Praxis wird nicht nur das »Hotel Schlaflos« vermieden, sondern eine akustische Qualität erreicht, in die zufriedene Gäste gern wiederkehren. n

über den Bodenbelag in Hotels erfolgt nach vielen Kriterien. Dabei stehen Teppiche für eine Reihe von akustischen Vorteilen. Sie mindern spürbar Trittschall, Geh- und Rollgeräusche und sie verringern die Halligkeit in Fluren und offenen Hotelbereichen. So ließe sich die Liste der nützlichen Details fortführen, die vom Fraunhofer IBP zu

For good acoustics in the hotel A quiet hotel room is not the only thing guests wish for. They expect holistic acoustic quality.

Intheforeground:theoverall

effectofallmeasures In order to identify the basics for a comprehensive design of acoustic hotel quality, the Fraunhofer Institute for Building Physics IBP carried out guest surveys and measurements and evaluated international research results. The list of organizational, technical and construction measures with positive acoustic results is long. Ultimately, however, not only the effect of individual measures, but also the effects of changes and, above all, the overall effect are in the foreground.

Disturbancefactornumberone:

trafficnoise The results of the survey are clear: traffic noise entering from the outside when the windows are closed is the biggest acoustic disturbance for hotel guests. Effective noise protection of exterior components is therefore paramount. Often windows and their additional features prove to be weak points. However, the audible sound sources inside the hotel building also offer potential for improvement from the guests’ point of view. Who has not experienced the following: Conversations and noises in the hallway penetrate the room, other room and fire doors fall thunderously into their locks. Although there are technical antidotes, they are often installed incorrectly, sacrificed to cost pressure, or sometimes they are simply forgotten. Hotelspa:acalmingbreakthanks

tosoundproofedinstallations In the bathroom, not only design and hygiene are required to guarantee the best conditions for pure relaxation. The buzzing of the fan, which feels like an ever-lagging fan, is a classic in terms of acoustic interference. Comfort ventilation with energy-efficient fans can also be silent. In turn, it may sometimes be necessary to clarify that quietness does not mean malfunctioning. The situation is similar for water and sanitary noise. The sound levels measured in the neighboring room according to the standard are low. The standard, however, fades out the noise peaks, even though they can lead to awakening reactions. In any case, acoustically tested equipment and installations are a step in the quiet direction.

Even the decision on the flooring in hotels is based on many criteria. Carpets are favored for a number of acoustic benefits. They noticeably reduce impact noise as well as walking and rolling noise and reduce the reverberation in corridors and open hotel areas. This would allow us to continue the list of useful details that the Fraunhofer IBP has compiled into a wealth of knowledge and design. Based on this, the respective parameters and values can be formulated specifically depending on the type and use. Put into practice, this would not only help avoid “Hotel No Sleep”, but an acoustic quality would be achieved, to which satisfied guests like to return. n 

DerAutor

Prof.Dr.PhilipLeistner Foto: © Fraunhofer- Institut für Bauphysik IBP

W

hether business traveler or tourist, almost everyone associates wellness and relaxation, comfort and sometimes luxury with a hotel stay. In addition to cleanliness and hygiene, a quiet room is at the top of the wish list. Noises from other rooms, on the other hand, are frequently the cause for complaints. The need for acoustic hotel quality is unmistakable. A holistic acoustic hotel quality benefits both guests and hoteliers as well as staff and neighbors. Good hotel acoustics range from the privacy in the room to the discretion at the front desk to the speech intelligibility in the lobby and in the meeting room. But the acoustic atmosphere in restaurants is one of the lasting listening impressions. How can the hotel industry meet these guest requests? Although there are some quality requirements, such as the sound insulation standard established in Germany, to date not enough scientific research into the acoustics of hotels and restaurants has been carried out.

LeiterdesFraunhofer-Institutsfür BauphysikIBPundDirektordesInstituts fürAkustikundBauphysikander UniversitätStuttgart,Mitinitiatordes Verbundprojekts„UnerhörteHotels“. DirectoroftheFraunhoferInstitutefor BuildingPhysicsIBPandDirectorofthe InstituteforAcousticsandBuilding PhysicsattheUniversityofStuttgart, co-initiatorofthejointproject“Unerhörte Hotels”(UnheardofHotels).

hotel objekte – November/Dezember 2018 47


Fachbeitrag

Marktwertanalyse

Volumen investmentrelevanter Hotels wächst Traditionelle Hotellerie setzt Wachstumskurs unbeirrt fort – trotz Airbnb

Verdoppelung des Hotel-Marktvolumens in den letzten zehn Jahren

Bildnachweise siehe Impressum

D

er Marktwert der investmentrelevanten Hotels in Deutschland ist 2017 gegenüber 2016 um rund sechs Prozent auf 52,6 Milliarden Euro gestiegen. Wie Union Investment und bulwiengesa in ihrer aktuellen Marktwertanalyse ermittelt haben, hat sich das Hotelmarktvolumen in Deutschland damit in den letzten zehn Jahren verdoppelt. Ausschlaggebend für die Wertsteigerung ist der weitere Vormarsch der von Investoren bevorzugten Markenhotellerie in Deutschland sowie ein generell anhaltendes Angebotswachstum. Dieses drückt sich in einem Plus bei den Hotelbettenzahlen von 16,6 Prozent innerhalb der letzten zehn Jahre aus.

48 hotel objekte – November/Dezember 2018

land treiben diese Entwicklung maßgeblich voran. Trotz des breit gefächerten Konkurrenzangebots von Airbnb setzt der Wertsteigernd erweist sich zudem die gute institutionelle Hotelmarkt sein Wachstum Performanceleistung der deutschen Ketten- auf stabilem Niveau unbeirrt fort. Parallel hotellerie, die durch steigende Auslastungs- zum traditionellen Hotelmarkt schließt das zahlen und höhere Zimmerraten getrieben Wachstum auch neuere Hotelkonzepte ein. wird. So ist der RevPAR (revenue per avai- Hierzu gehören zum Beispiel Apartmenlable room) der deutschen Kettenhotellerie, thotels, die mittlerweile in zunehmendem also der Umsatz pro verfügbarem Zimmer, Maße investmentrelevant sind. im Betrachtungszeitraum von 49,9 auf Als investmentrelevantes Angebot wurde 66,7 Euro deutlich gestiegen. Überpropor- ein Bestand von rund 375.200 Hotelzimtionale Wertsteigerungen entfielen dabei mern ermittelt, die sich auf deutsche Klein-, auf Betriebe im Economy- und Midscale-­ Mittel- und Großstädte verteilen. Lag der durchschnittlich ermittelte Wert pro ZimSegment. Die bereits im achten Jahr in Folge stei- mer 2016 noch bei 135.600 Euro, betrug er genden Übernachtungszahlen in Deutsch- 2017 bereits 140.100 Euro.

Überproportionale Wertsteigerung

im Economy- und Midscale-Segment


RückläufigesTransaktionsvolumen

NachhaltigeInvestmentansätze

Dem Volumenwachstum des institutionellen Hotelmarktes steht im Jahr 2017 ein rückläufiges Transaktionsvolumen von rund 4,2 Milliarden Euro (2016: rund 5,2 Milliarden Euro) gegenüber. Wurden im Vorjahr etwa 10,2 Prozent des berechneten Marktvolumens gedreht, beläuft sich der Wert der gehandelten Hotels im Jahr 2017 auf 8,0 Prozent. Die Bereitschaft von Bestandshaltern, sich von Hotel-Assets zu trennen, ist gegenüber dem Vorjahr signifikant gefallen. In den sinkenden Transaktionszahlen spiegeln sich die gesunkene Produktverfügbarkeit und das gestiegene Preisniveau deutlich wider. Gleichwohl bleiben Hotels eine hochliquide Asset-Klasse, mit der sich weiterhin überdurchschnittliche Renditen erzielen lassen.

Man kann davon ausgehen, dass die Zahl der Einzeltransaktionen in Deutschland 2018 weiter zurückgehen wird. In dieser Marktphase sind clevere und nachhaltige Investmentansätze gefordert. Dazu gehören beispielsweise Forward Deals sowie gezielte, wertsteigernde Maßnahmen bei Bestandsobjekten, die langfristig im Portfolio gehalten werden sollen. Den Berechnungen zufolge kommen die Wertzuwächse auch in den deutschen C-Standorten an, die bei Betreibern und Entwicklern auf immer größeres Interesse stoßen. Die Markenhotellerie geht dorthin, wo hohe und wachsende Tourismuszahlen vorliegen und entsprechend gute Voraussetzungen für den erfolgreichen Betrieb von Hotels gegeben sind. Einige Klein- und Mittelstädte bieten hier ein interessantes Aufholpotenzial.

Apartmenthotelsals

Wachstumstreiber Für 2018 erwarten die Experten von Union Investment und bulwiengesa ein Wachstum des institutionellen Hotelmarktes um ca. fünf Prozent, was in etwa dem Vorjahresniveau entspricht. Der vielerorts in die Jahre gekommene Bestand treibt die Neuentwicklung von Hotels in allen Segmenten voran, mit starken Verdrängungseffekten bei privat geführten Hotels. Von der weiterhin dynamischen Entwicklung dürften Immobilien für temporäres Wohnen wie Apartmenthotels 2018 überproportional profitieren. Das Marktwertmodell von Union Investment und bulwiengesa basiert auf Daten von Unternehmen, der öffentlichen Statistik sowie Hotelverbänden. Es ermöglicht eine vergleichende Analyse des institutionellen Hotelmarktes der Jahre 2007 bis 2017. n

Investable hotel market grows Traditional hotel industry continues its growth course – despite AirBnB

T

he investable hotel market in Germany grew in 2017 by approximately six per cent to EUR 52.6 billion compared to 2016. According to the latest market value analysis carried out by Union Investment and bulwiengesa, the size of the German hotel market has doubled in the last ten years. The key factor in this rise is the continued growth of the branded hotel segment in Germany – which is favoured by investors – as well as a general increase in supply. This is reflected in an upturn of 16.6 per cent in the number of hotel beds over the last ten years.

Above-averagevaluegrowthfor

budgetandmid-rangehotels The strong performance of the German hotel chain segment, which is being driven by rising occupancy and higher room rates, also boosted value. RevPAR (revenue per available room) in the German hotel chain segment increased significantly over the period in question, climbing from EUR 49.9 to EUR 66.7. Budget and mid-range hotels saw above-average value growth. Overnight stays in Germany, which have risen for eight years in a row, are the main

factor behind this development. Despite competition from Airbnb, the institutional hotel market continues to grow steadily. Alongside the traditional hotel market, newer hotel concepts are also part of this growth story. This includes apartment hotels, which are becoming increasingly investable and therefore also feature in our market value model. Union Investment and bulwiengesa identified an investable universe of around 375,200 hotel rooms, which are split across small, medium and large towns and cities in Germany. The average value per room was approximately EUR 140,100 in 2017. In the prior year, the corresponding figure was EUR 135,600. Declineintransactionvolume

The growth in the size of the institutional hotel market in 2017 contrasts with a fall in transaction volume from around EUR 5.2 billion in 2016 to approximately EUR 4.2 billion in 2017. Whereas in the prior year some 10.2 per cent of the calculated total market changed hands, the value of the hotels traded in 2017 was eight per cent. Property holders’ willingness to

divest themselves of hotel assets has fallen significantly compared to the prior year. The decrease in product availability and rise in prices are reflected in declining transaction figures. Hotels nonetheless remain a highly liquid asset class capable of delivering above-average returns. Long-terminvestmentstrategy

It is assumed that the number of individual transactions in Germany will continue to fall in 2018. During this market phase, a sophisticated, long-term investment strategy is required. Options here include forward deals and targeted improvements to existing properties that boost their value, assuming they are to be held in the portfolio for an extended period. The analysis shows that value increases are also being achieved in German tertiary locations, which are of growing interest to operators and developers. The branded hotel segment goes wherever there are high – and growing – tourist figures and correspondingly good prospects for running a successful hotel. Several small and medium-sized towns offer interesting catch-up potential here. hotel objekte – November/Dezember 2018 49


Fachbeitrag

Marktwertanalyse

Germany: Institutional hotel market doubles in size over last 10 years

Apartment hotels as drivers

of growth In 2018, Union Investment and bulwiengesa expect around five per cent growth in the institutional hotel market, which more or less corresponds to the prior-year level.

the continuing strong growth in 2018. The Union Investment and bulwiengesa market value model is based on data from companies, official statistics and hotel associations. It enables a comparative analysis of the institutional hotel market for the years 2007 to 2017. n

Die Autoren/The authors Dierk Freitag

Martin Schaller

Bereichsleiter und Partner  bei bulwiengesa Departmental head and partner at bulwiengesa.

Leiter Asset Management Hos­pitality bei der Union Investment Real Estate GmbH Head of Asset Management Hos­pitality at Union Investment Real Estate GmbH

50 hotel objekte – November/Dezember 2018

Foto: © Union Investment Real Estate

Bildnachweise siehe Impressum

Foto: © bulwiengesa



Many existing properties are getting rather long in the tooth, which is driving the development of new hotels across all segments and putting huge pressure on privately run hotels. Real estate for temporary living, such as apartment hotels, is likely to profit disproportionately from


Hotelpreisentwicklung

Fachbeitrag

Hotelpreise im Vergleich Aktuelle Entwicklungen für Deutschland, Europa und die Welt

D

as Onlineportal HRS hat die durchschnittlichen Preise für eine Nacht im Hotel ermittelt. Betrachtet wurden alle nicht stornierten Hotelbuchungen im Zeitraum 01. 07. 2018 bis 30. 09. 2018 über das Portal HRS sowie der entsprechende Vorjahreszeitraum. Wie in den Quartalen zuvor, hat sich das dritte Quartal in Deutschland aus Sicht der Hotellerie positiv entwickelt. Im Schnitt kostete eine Hotelnacht 92 Euro, ein Plus von 2,2 Prozent im Vergleich zum Vorjahreszeitraum. Die teuerste deutsche Stadt ist München mit 121 Euro. International zählen Zürich mit 185 Euro (für Europa) und New York mit 250 Euro (global) zu den teuersten Städten für Hotelübernachtungen. Hotelpreisradar Europa / Hotel price radar Europe

Deutschland: Steigende Preise in

Nürnberg, Berlin und Stuttgart In den meisten Großstädten haben sich die Übernachtungspreise im Vergleich zum Vorjahr moderat verändert. Eine deutliche Steigerung von 8,4 Prozent auf 90 Euro erfuhr Nürnberg. Die Congress- und Touris-

mus-Zentrale Nürnberg berichtete bereits in ihrem Halbjahresbericht von einem äußerst erfolgreichen Jahr. Neben Messebesuchern haben auch häufiger Touristen Nürnberg besucht. Auch die Hotelpreise in Berlin (+7,2 Prozent auf 104 Euro) und Stuttgart (+6,2

Prozent auf 103 Euro) haben im Vergleich zum Vorjahr stärker angezogen. Die Hotelpreise in Düsseldorf erhielten einen leichten Dämpfer von -4,1 Prozent auf 93 Euro. Am meisten zahlten Gäste für die Hotelübernachtung unverändert in München. Hier hotel objekte – November/Dezember 2018 51


Fachbeitrag

Hotelpreisentwicklung kostete die Nacht im dritten Quartal im Schnitt 121 Euro. Wesentlicher Treiber ist das Oktoberfest. Europa:InBarcelonasinken

dieHotelpreise Verglichen mit dem Vorjahreszeitraum sind die Hotelpreise in Barcelona um 13,7 Prozent auf 132 Euro gefallen. Dies ist in zweierlei Hinsicht auf das Klima zurückzuführen: Zum einen das politische Klima im Zusammenhang mit den Unabhängigkeitsbestrebungen Kataloniens, zum anderen das meteorologische Klima. Da der Sommer in ganz Europa sehr gut war, zog

es weniger Touristen in den Süden. Vermutlich sanken aus demselben Grund die durchschnittlichen Hotelpreise in Athen (-8,8 Prozent auf 104 Euro) und Lissabon (-7,8 Prozent auf 107 Euro). In allen weiteren europäischen Destinationen blieben die Preisschwankungen im einstelligen Prozentbereich. Spitzenreiter in Europa bleibt Zürich mit durchschnittlich 185 Euro pro Übernachtung im Hotel, gefolgt von London (176 Euro) und Kopenhagen (169 Euro). Günstiger haben es da Gäste im Osten Europas: Unter 100 Euro lagen im dritten Quartal Warschau (77 Euro), Istanbul (79 Euro), Prag (91 Euro), Moskau (94 Euro) und Budapest (95 Euro).

Welt:Pekingboomtin2018

Bei den globalen Destinationen sticht vor allem Peking im dritten Quartal 2018 hervor. Die Hotelpreise stiegen hier um 21,5 Prozent auf 96 Euro pro Nacht. Auch Bangkok erfuhr eine kräftige Preissteigerung von 13,3 Prozent auf 85 Euro. Damit liegen die beiden Städte aber eher im unteren Preissegment, verglichen mit den anderen Weltmetropolen. An der Spitze steht nach wie vor New York. Hier kostete die Hotelnacht im dritten Quartal im Schnitt 250 Euro. Es folgen Washington mit 192 Euro und Toronto mit 189 Euro. Globales Schlusslicht ist Kuala Lumpur mit 49 Euro pro Nacht. n

Hotel prices compared Current developments for Germany, Europe and the world

T

he online hotel portal HRS has determined the average prices for hotel nights. All not cancelled hotel bookings in the period from 01. 07. 2018 until 30. 09. 2018 booked via HRS The Hotel Portal and the corresponding dates from the previous year were taken into consideration. Similar to the previous quarters, the third quarter in Germany developed positively from the perspective of the hotel industry. On average, a hotel night costs 92 Euros. This marks an increase of 2.2 percent compared to the same period in the last year. The most expensive city in Germany is Munich with 121 Euros per hotel night. On an international basis, Zurich with 185 Euros per hotel night (in Europe) and New York with 250 Euros per hotel night (globally) are amongst the most expensive cities for hotel nights.

year report. Next to trade fair visitors, the number of tourists visiting Nuremberg is increasing. Furthermore, prices per hotel nights in Berlin (+7.2 percent, 104 Euros per hotel night) and Stuttgart (+6.2 percent, 103 Euros per hotel night) rose strongly in comparison to the previous year. However, hotel prices in Dusseldorf decreased by -4.1 percent and are now at 93 Euros per hotel night. Munich remains the most expensive city in Germany with an average price per hotel night of 121 Euros in the third quarter.

Main driver for the high average price is the Oktoberfest. Europe:hotelpricesin

Barcelonadecreased Compared to the same time period during the last year the price per hotel night in Barcelona dropped by 13.7 percent (132 Euros per hotel night). This can be related to the climate in two respects: on the one hand, the political situation

Germany:risingpricesin

Bildnachweise siehe Impressum

Nuremberg,BerlinandStuttgart In most of the major cities prices for hotel nights have developed moderately compared to the previous year. Nuremberg has experienced a significant increase of 8.4 percent, which now leads to 90 Euros per hotel night. Nuremberg’s Congress and Tourism Center already reported an extremely successful year within its half52 hotel objekte – November/Dezember 2018

HotelpreisradarDeutschland/HotelpriceradarGermany


due to Catalonia’s ambitions to become independent and on the other hand the meteorological climate as the summer in Europe was very good, fewer tourists travelled to the south. This is probably also the reason for the averages prices of hotel nights in Athens (-8.8 percent, 104 Euros per hotel night) and Lisbon (-7.8 percent, 107  Euros per hotel night). Within all other European destinations, fluctuations remained in single-digit percentage changes. The European leader remains Zurich with 185 Euros per hotel night on average, followed by London (176 Euros per hotel night) and Copenhagen (169 Euros per hotel night). In Eastern Europe travellers can make better deals: prices below 100 Euros can be found in Warsaw (77 Euros per hotel night), Istanbul (79 Euros per hotel night), Prague (91 Euros per hotel night), Moscow (94 Euros per hotel night) and Budapest (95 Euros per hotel night). Global: Beijing booms in 2018

In terms of global destinations, Beijing stood out within the third quarter of 2018. Hotel prices per night rose by 21.5 percent and are now at 96 Euros per hotel night. Bangkok also experienced an increase of 13.3 percent (85 Euros per hotel night).

Hotelpreisradar weltweit / Hotel price radar worldwide

Though experiencing this increase, those two metropolises are still in the lower price segment compared with other metropolises. New York’s position as the most expensive city with regards to hotel prices on an international basis remains unchanged. The price per hotel night in New York is 250 Euros on average, followed by Washington with 192 Euros per hotel night and Toronto with 189 Euros per hotel night. Kuala Lumpur is the global taillight with only 49 Euros per hotel night. n

Über die HRS GROUP Das Unternehmen vereinfacht als Outsourcing-Provider für Konzerne die Prozesse rund um den Hotelaufenthalt und bietet Reiseverantwortlichen und den Reisenden selbst zukunftsweisende Lösungen.

About the HRS GROUP As an outsourcing-provider for global corporations, HRS simplifies all processes relating to the hotel stay – beyond booking and billing – and provides both travel managers and business travellers with pioneering solutions.

hotel objekte – November/Dezember 2018 53


Einkaufsführer

Einrichtung&Planung

WWW.HUETTINGER-DIE-EINRICHTUNG.DE

www.dorma-hueppe.com

Ladenbau und Hoteleinrichtungen www.ambrosmontagen.at office@ambrosmontagen.at +43 3135 47 085

www.tenbrink.de

www.gastronovi.com

www.kreuzer-gmbh.com

Haidbachstraße 23 | A-4061 Linz-Pasching Tel. +43 (7229) 66360 | Fax +43 (7229) 66360 - 9 office@kreuzer-gmbh.com

Tel.: +49 (0) 2451 - 91 12 80

K DESIGN Großschirme & Windschutz

www.k-design.biz info@k-design.biz Und wer kümmert sich ums Spülen?

»Ich!«

Karl Winterhalter,, 1947

W W W. G R A P O S . C O M 54 hotel objekte – November/Dezember 2018

»Ich!«

Jürgen Winterhalter, 1971

»Ich!«

Ralph Winterhalter, 2008

Seit drei G Generationen ti Ih Ihr Spezialist fü für perfekte f k Spülergebnisse! ül

www.winterhalter.de


Bad&Sanitär

www.kaldewei.de

www.keuco.com

TOTO_Hotelobjekte-Einkaufsführer_SchriftInPfaden_90x40_180508.indd 1

08.05.18 11:37

WELLNESS FÜR IHRE GÄSTE

GEBERIT AQUACLEAN. DAS DUSCH-WC. www.geberit-aquaclean.de

www.aeg-haustechnik.de

Geberit AquaClean Hotel AZ 90x40 4c_Einkaufsführer Hotel Objekte.indd 1

Stoffe

27.06.18 10:02

Kassensysteme

www.vescom.com hotel objekte – November/Dezember 2018 55 T_MM_90x40mm.indd 1

25.06.18 13:49


Betten&Matratzen

Einkaufsführer

Bodenbeläge

markmann gmbh Wir sind der Hersteller und Boxspringspezialist

www.boxspring.de

www.agrob-buchtal.de www.gerz-matratzen.de

Timeless and pure ceramics mosa.com

www.3c-contract.de

www.coco-mat.com PROJECT FLOORS GmbH Max-Ernst-Straße 4 50354 Hürth Tel. +49 (0) 2233 - 9687-0 Fax +49 (0) 2233 - 9687-10 info@project-floors.com www.project-floors.com

Unbenannt-3 1

08.05.2018 13:53:29

www.symphonic.at 56 hotel objekte – November/Dezember 2018


Beleuchtung

Hotellights.de–www.Classen-Leuchten.de www.lampenschirme-online.de www.Classen-Lampenschirme.de

RIDI Leuchten GmbH 72417 Jungingen · www.ridi-group.com Kontakt Sales Shopbeleuchtung: Markus Keller, markus.keller@ridi.de T +49 172 7473 866

WWW.PROLICHT.AT

www.phoenico.com

Veranstaltungstechnik

ArtEvolutionServiceOHG Fritz-Klatte-Str.6 D-65933FrankfurtamMain

Ausgab

e 04/201

8 // Juli/Au

ZKZ 21967 gust //

(Deutsc

hland)

// Plus.Ze

itung 12Z039

463 P (Österre

. 04-18 Post-Nr 35 // ISSN 2194-13 ich) //

astera@art-evolution.de www.art-evolution.de T:069-7895971

objekte

Ausgabe

06 / 2018

// Novembe

r / Dezembe

r // ZKZ 21967

(Deutsch

land) // Plus.Zeit

ung 12Z0394

63 P (Österrei

ch) // ISSN 2194-133 5 // Post-Nr.

06-18 objekte

Ausgabe 05/2018 // September/Oktober // ZKZ 21967 (Deutschland) // Plus.Zeitung 12Z039463 P (Österreich) // ISSN 2194-1335 // Post-Nr. 05-18 objekte

Don’t miss the online edition!

und Spa g, Technik

, Ausstattun

22. Jahrgang

und Restaurante

inrichtung,

Ausstattung,

Technik und

Spa

F 9,90

Design, Hotel-

aufspreis Einzelverk e.de www.bauv e.de info@bauv Buchloe (Bayern)

www.bauve.de

Beds & Mattr pecial

Auf

The Bulgari Hotel, Shanghai

tion breath Take a deep rt Contribu rag/Expe Seite/Page 16 Fachbeit 44 Seite/Page

raße 57

Bahnhofst

Messevors chau 2019 Glamouröses Meisterwerk atmen BAUVE Medien GmbH & Co. KG

Matratzen Betten &esses

Bahnhofstraße 57

Seite/Page

n GmbH & Co. KG

traße 57 Bahnhofs Co. KG GmbH &

ay, Ham

ten The Fon 16

www.bauve.de

D-86807

info@bauve.de D-86807 Buchloe (Bayern)

D-86807

dt

Hansesta e an die Hommag burg BAUVE Medien

The Magazine for Hotel and Restaurant Planning, Furnishings and Equipment

Magazin für

und Restauranteinrichtung, Ausstattung, Technik und Spa

Einzelverkaufspreis F 9,90

Einzelve ve.de www.bau ve.de info@bau (Bayern) Buchloe

Das Fachmagazin für Planung, Ausstattung und Einrichtung im Hotel und Restaurant

Magazin für Design, Hotel-

22. Jahrgang

eis € 9,90

und Restauranteinrichtung, Ausstattung, Technik und Spa

rkaufspr

Magazin für Design, Hotel-

htung uranteinric

und Resta

-

Design, Hotel

22. Jahrgang

Magazin für

Special

Seite/Page 28

Willkommen

im Dschung Welcome to el the Jungle Objektbe richt / Prop erty Feat 14 ure

Seite/Page

Luxus und Eleg anz

Luxury and

Elegan

hotel objekte – November/Dezember 2018 57


Vorschau

Veranstaltungskalender

Horecava

BAU

EuroCIS

Amsterdam (NL), 07.–10.01.2019 (jährlich) Internationale Fachmesse für Hotels, Gaststätten und Großküchen

München, 14.–19.01.2019 (zweijährlich) Weltleitmesse für Architektur, Materialien und Systeme

Düsseldorf, 19.–21.02.2019 (jährlich) Leitmesse für Retail-Technologie

Heimtextil

imm cologne

Frankfurt, 08.–11.01.2019 (jährlich) Internationale Messe für Heimtextilien, Bodenbeläge und Innenraumausstattung

Köln, 14.–20.01.2019 (jährlich) Internationale Einrichtungsmesse

DOMOTEX

ITB Berlin, 06.–10.03.2019 (jährlich) Internationale Tourismusbörse

ISH

Living Kitchen

Hannover, 11.–14.01.2019 (jährlich) Weltmesse für Teppiche und Bodenbeläge

Köln, 14.–20.01.2019 (zweijährlich) Internationales Küchenevent gemeinsam mit der imm cologne

HOGA

maison&objet

Nürnberg, 13.–15.01.2019 (zweijährlich) Fachmesse für Hotellerie, Gastronomie und Gemeinschaftsverpflegung

Paris (F), 18.–22.01.2019 (halbjährlich) Internationale Ausstellung für Innendekoration, Geschenkartikel und Tischdekoration

Industrial Building

Christmasworld

Essen, 14.–16.01.2019 (zweijährlich) Fachmesse für Baustoffe, Bausysteme und Technik für industriell und gewerblich genutzte Gebäude

Frankfurt, 25.–29.01.2019 (jährlich) Weltleitmesse für saisonale Dekoration und Festschmuck

Frankfurt/M., 11.–15.03.2019 (jährlich) Weltleitmesse für Bad, Gebäudetechnik, Energietechnik, Klimatechnik & erneuerbare Energien

Gastro Vision Hamburg, 15.–19.03.2019 Businessforum für Entscheider aus Hotellerie, Gastronomie und Catering

Internorga Hamburg, 15.–19.03.2019 (jährlich) Internationale Fachmesse für Hotellerie, Gastronomie, Gemeinschaftsverpflegung, Bäckereien und Konditoreien

Themen-Vorschau hotelobjekte1/2019erscheintam6.Februar2019 Special:Bad&Spa ÄsthetikundKomfortstehenbeiBadundWellnessbereich imHotelfürvieleGästeanersterStelle,dennsiewollen sichwohlfühlen.DazutragennichtzuletztauchBademäntel, HandtücherundGuestSuppliesbei.SiesinddieVisitenkarte einesHotelsundwerdenvondenGästenmeistals selbstverständlichvorausgesetzt. InunseremSpecialpräsentierenwirIhnenzahlreiche interessanteProdukteundLösungenrundumdasThema BadundSpa,u.a.ausdenBereichenSpiegel,Sanitär, Keramik,Fliesen,Pool,Sicht-/Sonnenschutz,Outdoor, BeleuchtungfürdenNassbereich,GuestSuppliesund Wellness. NeueRubrik:F&B-TrendsausallerWelt

Inserentenverzeichnis:

3C Contract S. 9, S. 56; AFAG Messen und Ausstellungen GmbH S. 31, 59; Agrob Buchtal S. 26,27,56; Ambros Interior Montagen S. 54; Art Evolution Service OHG S. 57; AURES Technologies S. 55; Bauve Medien GmbH S. 4; COCOMAT Deutschland GmbH S. 56; Deco Design Fürus GmbH S. 3, 30; Deutsche Messe AG S. 31; DORMA-Hüppe Raumtrennsysteme GmbH + Co. KG S. 22, 23, 54,60; Dula Werke Dustmann & Co GmbH S. 54, EHT Haustechnik GmbH S. 55; Englisch Dekor HandelsgmbH & Co. KG S. 17, 30, 55; Emco Bautechnik GmbH S. 34; Ergonomic Solutions S. 37; Europlac Röhr GmbH S. 56, Franz KALDEWEI GmbH & Co. KG S. 26, 55; gastronovi GmbH S. 25, 54; Gerz Matratzen GmbH S. 56, Grapos Postmixsirup Vertriebs GmbH S. 54; Hansen GmbH S. 57; Hefel Textil GmbH S. 29; Hüttinger Die Einrichtung GmbH S. 54; Komar Products GmbH & Co. KG S. 29; nora systems GmbH S. 33; Messe Düsseldorf S. 36; Messe Frankfurt GmbH S. 2, 28; Messe Köln S. 34; Messe München S. 32; Organisation SAFI S. 35; RIDI Leuchten GmbH & Co. KG S. 57; RUCO Licht GmbH S. 57; Royal Mosa S. 56; Infloor Teppichboden GmbH & Co. KG S. 9, 56, K-Design Großschirme & Windschutz GmbH S. 54; KEUCO GmbH & Co. KG S. 55; Kreuzer GmbH S. 54; Markmann

58 hotel objekte – November/Dezember 2018

Kaldewei,MarinaBaySandsSingapore

Schlafkomfort-Produktion GmbH S. 56; Phoenico Design GmbH S. 57; Pfleiderer Deutschland GmbH S. 33; Prolicht GmbH S. 57; PROJECT FLOORS GmbH S. 33, 56; Schramm Werkstätten GmbH S. 5, 57; Symphonic Trading GmbH S. 57; Telekom Deutschland GmbH S. 55; Tenbrink Hotelplan GmbH S. 54; TOTO Europe GmbH S. 55; troniTAG GmbH S. 37; Vescom GmbH S. 55; V&B Fliesen GmbH S. 55; W. Classen GmbH S. 11, 57; Winterhalter Deutschland GmbH S. 54.

Redaktionsschluss Anzeigenschluss Druckunterlagenschluss

4.Januar2019 17.Januar2019 21.Januar2019


DAS TRENNWANDSYSTEM SKYFOLD Vollautomatisch vertikal Skyfold ist die neue vertikale Trennwand von DORMA Hüppe, die sich komplett in den Deckenbereich öffnet. Sie ist platzsparend, benötigt keine Führungs- oder Laufschienen und bietet Schalldämmung bis zu Rw 59 dB. Ob Hörsaal, Veranstaltungsräume oder kleinere Konferenzräume – dieses elegante und stabile Trennwandsystem ermöglicht ein schnelles und vollautomatisches Verfahren per Knopfdruck.

Öffnet sich platzsparend in die Decke

Vollautomatisch: schnell & zuverlässig

DORMA Hüppe Raumtrennsysteme GmbH + Co. KG Industriestraße 5 26655 Westerstede/Ocholt T +49 4409 666-0 info-hueppe@dormakaba.com www.dorma-hueppe.com

hotel objekte 06 2018  

Magazin für Design, Hotel- und Restauranteinrichtung, Ausstattung, Technik und Spa

hotel objekte 06 2018  

Magazin für Design, Hotel- und Restauranteinrichtung, Ausstattung, Technik und Spa

Advertisement