Issuu on Google+


20 MARET 2011

28 HALAMAN/Rp3.000,-

Pelaku Bom Buku Diduga 3 Orang

Wapres: Pulihkan Jati Diri Bangsa! BANDARLAMPUNG – Wakil Presiden (Wapres) Boediono menilai jati diri bangsa Indonesia mengalami degradasi pasca ketidakstabilan politik selama dua dasawarsa. Karena itu, dia mengajak seluruh elemen untuk memulihkan jati diri bangsa. ’’Setelah mengalami gonjangganjing politik selama dua dasawarsa sejak Proklamasi, negara ini memasuki era ketidakstabilan politik yang panjang,” kata Wapres saat membuka Seminar Nasional Ikatan Alumni Lemhanas (Ikal) Ke-14 tahun 2011 di Balai Keratun Kantor Pemprov Lampung kemarin. Dalam kurun waktu itu, lanjut Boediono, kemajuan ekonomi dan sosial yang berarti dapat dicapai. Hal tersebut, menurut dia, kemudian menjadi landasan bagi tuntutan masyarakat dan kebutuhannya yang lebih tinggi. ’’Saat ini masyarakat ingin sebuah kehidupan bernegara yang demokratis, yang mempunyai mekanisme perimbangan kekua saan atau check and balances di antara lembaga-lembaga pemegang kekuasaan,” terangnya. Pada bagian lain, Wapres juga mengingatkan bahwa upaya perbaikan sistem bernegara memang dapat membuat orang kehilangan kesabaran. ’’Namun rasanya memang tidak ada jalan pintas untuk menuju sistem yang ideal itu. Artinya, belum ada resep di dunia ini yang mampu menjadi solusi sekali jadi bagi semua bangsa,” kelakarnya. Sementara, anggota Dewan Pertimbangan Presiden (Watimpres) Ryaas Rasyid menuturkan, hubungan antara pemerintah pusat dengan daerah perlu ditata kembali dengan memperhatikan aspirasi dari daerah. Ryaas mengatakan, daerah selama ini menjadi korban akibat ketidaktegasan pemerintah pusat yang kebanyakan mengeluarkan aturan dan berbenturan satu sama lainnya. ’’Pola pemerintahan harus diubah dengan memberikan Baca WAPRES Hal. 2


SEMINAR IKAL: Wakil Presiden Boediono saat membuka Seminar Nasional Ikatan Alumni Lemhanas (Ikal) Ke-14 tahun 2011 di Balai Keratun Kantor Pemprov Lampung kemarin.

JAKARTA - Pelan tapi pasti, pengejaran terhadap kelompok bom buku mulai menemukan titik terang. Penyidik yang mengumpulkan barang bukti jejak bom (bomb signature) dari lapangan mulai melakukan langkah taktis. Salah satunya, memetakan ulang para pelatih atau instruktur bom yang pernah menularkan keahliannya di medan konflik, terutama Ambon dan Poso (2005-2007) . ’’Ciri-cirinya memang khas bom termos Upik Lawanga. Tetapi, yang bisa membuat model seperti ini tentu bukan eksklusif dia saja,’’ kata sumber Jawa Pos (grup Radar Lampung) kemarin. Pada konflik Poso, banyak sukarelawan yang datang ke sana. Kelompok-kelompok itu melakukan semacam pelatihan singkat membuat bom. Hanya kelompok Upik yang sukses melakukan beberapa serangan dengan bom termos dan bom senter periode 2005-2006. Upik adalah perakit bom Pasar Tentena, bom Pasar Maesa Palu, bom Pasar Sentral Poso, dan aneka macam bom yang lain. Sebagian besar para instruktur, selain Upik, sudah tertangkap. Namun, ada juga yang tidak teridentifikasi. ’’Sebab, jumlahnya memang belasan orang. Begitu konflik selesai, orang-orang ini pulang dan hidup normal,” katanya. Baca PELAKU Hal. 2

Ketika Yayasan SMA Plus UNESCO Berkonflik dengan Pengelola (2/Habis)

Harusnya Bukan Siswa yang Dikorbankan Siswa SMA Plus UNESCO, terutama yang naik kelas XII, resah. Hampir setahun lamanya, rapor mereka ditahan mantan kepala sekolah (Kepsek) itu. Buku evaluasi belajar tersebut baru dikembalikan jika mereka mampu melunasi semua biaya SPP (sumbangan pembinaan pendidikan) dan semester. FOTO WAHYU SYAIFULLAH

UNJUK RASA: Kunjungan kerja Wapres Boediono sempat disambut aksi unjuk rasa elemen mahasiswa di depan pintu masuk Unila dan Tugu Adipura.

SIAPA sangka sikap mantan Kepala SMA Plus UNESCO Herlina yang menahan rapor siswanya mendapat dukungan dari ’’orang dalam” sekolah itu. Dia bahkan menyatakan langkah itu merupakan jalan terbaik untuk menyelesaikan masalah dengan yayasan. Baca HARUSNYA Hal. 2






Bulan Mepet Bumi FENOMENA supermoon atau lunar perigee terjadi tadi malam (19/3). Badan Meteorologi, Klimatologi, dan Geofisika (BMKG) menjelaskan, supermoon merupakan fenomena kala bulan purnama berjarak paling dekat dengan bumi, yakni 356.577 kilometer. Akibatnya, bulan terlihat lebih besar daripada biasanya. Supermoon juga memengaruhi gelombang pasang air laut. Karena semakin dekatnya bulan dengan bumi, daya gravitasi dari bulan semakin

Pelepasan peserta Jalan Sehat dan Sepeda Santai (JSSS) yang digelar Radar Lampung bersama Dinas Pemuda dan Olahraga kemarin (19/3).

Mengikuti Sibuknya ’’Tim Langit’’ Menjinakkan Bom-Bom di Jakarta

Petugas Berteriak A1, Darrr... Ternyata Boneka Barbie Sejak Selasa lalu (15/3) hingga kemarin (19/3), Jakarta dan sekitarnya digempur kabar paket bom. Ada yang benar-benar bom. Tetapi, ada juga yang awu-awu. Itu membuat Detasemen Gegana, tim penjinak bom, kewalahan.



Baca JSSS Hal. 2


Baca BULAN Hal. 2

FENOMENA supermoon atau lunar perigee yang terlihat di Manila, Filipina, tadi malam.

BANDARLAMPUNG - Jalan Sehat dan Sepeda Santai (JSSS) yang digelar harian ini bersama Dinas Pemuda dan Olahraga (Dispora) Lampung kemarin (19/3) berlangsung meriah. Pada acara yang dihadiri Deputy General Manager Radar Lampung Taswin Hasbullah dan Pemimpin Redaksi Nizwar itu, tampak ribuan peserta sepeda santai maupun jalan sehat ambil bagian. Acara tersebut diselenggarakan dalam rangka memeriahkan HUT Ke-47 Lampung. Peserta jalan sehat antusias mengikuti kegiatan yang digelar di Lapangan Korpri itu. Seorang peserta, Mirna, mengaku berminat mengikuti kegiatan tersebut sebagai bentuk partisipasi. ’’Saya datang bersama teman sekantor, mudah-mudahan dapat hadiah,” ungkap PNS di lingkungan Pemprov Lampung itu. Sementara, para peserta sepeda santai pun tampak bersemangat. Mereka memenuhi jalan-jalan utama di Kota Bandarlampung sejak acara belum dimulai. Komunitas Gowes Radar Lampung pun ikut

Tim Gegana Polda Metro Jaya sesaat setelah berhasil mencerai-berai sebuah paket yang diduga bom yang dikirimkan ke Universitas Muhammadiyah Jakarta, Ciputat, Tangerang Selatan, kemarin (19/3). Dari hasil temuan tersebut, paket yang diduga bom itu ternyata negatif. FOTO IRAWAN/JPNN

Laporan M. Hilmi S., JAKARTA PELATARAN markas Detasemen Gegana Satbrimob Polda Metro Jaya di Petamburan, Slipi, Jakarta Barat, kemarin (19/3) terlihat tenang. Aktivitas hanya terlihat di dua pos jaga pintu masuk. Di dalam markas, hanya terlihat beberapa motor dan satu unit mobil barakuda. Markas tersebut sepi karena 50 anggotanya disebar ke lima mapolres di Jakarta. Yaitu Mapolres Jakarta Pusat, Mapolres Jakarta Timur, Mapolres Jakarta Selatan, Mapolres Jakarta Barat, dan Mapolres Jakarta Utara. Salah seorang anggota Detasemen Gegana Briptu Aris menjelaskan, aktivitas rekan-rekannya meningkat sejak Selasa lalu (15/3), ketika Jakarta dihebohkan oleh paket bom buku untuk Ulil Abshar Abdalla di markas Utan Kayu. Sejak itu, teror bom terjadi secara beruntun. Selain Ulil, paket bom ditujukan, antara lain, kepada Kepala BNN Gories Mere, Ketua Pemuda Pancasila Yapto S. Soeryosumarno, dan Baca PETUGAS Hal. 2 Berlangganan, Hubungi: 0721 - 782306-7410327


2 JSSS...

Dari Hal. 1

berpartisipasi. Puluhan doorprize menarik juga disediakan bagi peserta yang ikut dalam kegiatan ini. Pukul 07.00 WIB, acara dimulai bagi peserta sepeda santai. Baru kemudian disusul peserta jalan sehat. Rute yang ditempuh, antara lain, melalui Jalan Pattimura yang juga pos pembagian kupon undian berhadiah bagi peserta. Hadiah-hadiahnya merupakan partisipasi dari beberapa dinas dan biro di lingkungan Pemprov Lampung. Sedangkan hadiah utama berupa tiga unit motor dipersembahkan Radar Lampung. Selain JSSS, rangkaian perayaan HUT Ke-47 Lampung yang jatuh pada 17 Maret tersebut sebelumnya juga diisi dengan berbagai kompetisi, Seperti futsal dan voli antarinstansi. (ton/c1/tru)


Dari Hal. 1

besar. Di beberapa titik, seperti di Surabaya, gelombang air setinggi 110-130 cm, lebih tinggi daripada hari-hari biasa. Meningkatnya air pasang tersebut bisa menimbulkan banjir di kawasan pesisir pantai. Tetapi, BMKG mengimbau masyarakat tetap tenang. Kepala Subbidang Gravitasi dan Tanda Waktu BMKG Rukman Nugraha menjelaskan, fenomena supermoon disebabkan beberapa faktor. Pemicu utamanya, garis edar bulan dalam mengelilingi bumi berbentuk elips. ’’Fenomena seperti itu (supermoon, Red) sejatinya terjadi setiap tahun,’’ ujarnya kemarin. Dia menambahkan, rata-rata jarak bumi dengan bulan saat purnama adalah 384.400 km. Rukman menjelaskan, jarak bulan dengan bumi tahun ini lebih dekat daripada tahun lalu. Dia mencatat, pada 2010, fenomena supermoon terjadi pada 30 Januari. Saat itu, jarak bulan dengan bumi 356.592 km. Lalu, untuk 2012, diperkirakan supermoon terjadi pada 6 Mei. Jarak bumi dengan bulan saat itu diperkirakan mencapai 356.953 km. Soal anggapan masyarakat bahwa fenomena supermoon terjadi 18 tahun sekali, Rukman memberikan klarifikasi. Dia menjelaskan, 18 tahun itu adalah periode yang digunakan oleh BMKG untuk menghitung jarak bumi dengan bulan. BMKG mencatat, fenomena supermoon tahun ini bukan yang terdekat. Pada 12 Desember 2008, jarak bumi dengan bulan tercatat 356.567 km. Lalu, dalam kurun 18 tahun ke depan, BMKG memprediksi supermoon terbesar terjadi pada 2016. Rukman memaparkan, pada 14 November 2016, jarak bumi dengan bulan 356.511 km. (jpnn/c1/adi)



Jawa Pos News Network

Dari Hal. 1

otonomi penuh kepada gubernur, sehingga dapat mengelola pemerintahan menjadi lebih baik. Konkretnya, otonomi daerah diberikan penuh kepada gubernur dan bupati/wali kota di bawah kendali gubernur, sehingga gubernur memiliki kontrol penuh terhadap bupati/wali kota,” jelasnya. Karena selama ini, lanjut Ryaas, bupati/wali kota terkesan tidak ada kendali. ’’Padahal perlu ada satu kesatuan komando administrasi dan kebijakan,” ungkapnya. MengeAGUM GUMELAR nai nepotisme dengan maraknya ’’keluarga” di jajaran eksekutif di daerah, Ryaas menilai hal itu sah-sah saja sepanjang kompeten.’’Jangan terus mentangmentang anak gubernur tidak boleh menjadi bupati. Itu namanya tidak demokratis,” ujarnya. Ryaas juga hadir dalam seminar Ikal yang membedah ’’Apa Golongan Darah Bangsa Indonesia?”. Pemateri lainnya adalah Gubernur Lemhanas Budi Susilo Supandji; Rektor Universits Islam Indonesia Syarif Hidayattullah Komaruddin Hidayat: mantan Gubernur Lemhanas Muladi; dan Rektor Universitas Indonesia Prof. Gumilar. Ketua Umum Ikal Agum Gumelar menyatakan, seminar diikuti sekitar 300 peserta, baik dari alumni Lemhanas, birokrat, dan tokoh masyarakat Lampung. Ia menegaskan akan ada sebelas rekomendasi buah seminar tersebut. ’’Ikal akan menyarankan kepada pemerintah agar dilakukan langkah penyempurnaan terhadap empat kali amandemen, namun tidak juga harus kembali ke UUD 1945, karena menentang arus reformasi,” tuturnya. Untuk dapat melakukan perubahan itu, lanjut Agum, langkah-langkahnya harus diperhitungkana secara strategis dan harus dibuat grand design karena tidak dapat mengubah undang-undang hanya dengan pertimbangan sesaat. ’’Tentunya, perubahan ini akan diputuskan secara komprehensif,” imbuhnya. Dalam kesempatan tersebut, Gubernur Lampung Sjachroedin Z.P. mengatakan bahwa penetapan provinsi ini sebagai tuan rumah seminar Ikal merupakan sebuah penghormatan. ’’Momen Ikal ini bersamaan dengan Ulang Tahun Ke-47 Lampung. Ini sebuah berkah,” kata Oedin, sapaan akrabnya, saat memberikan sambutan kemarin. Kunjungan kerja Wapres Boediono kemarin sempat mendapatkan protes dari elemen mahasiswa. Mereka melakukan unjuk rasa di depan pintu masuk kampus Universitas Lampung dan Tugu Adipura. Namun, unjuk rasa tersebut bisa diredam polisi. Petugas menghadang massa dengan membangun pagar betis. Alhasil, unjuk rasa akhirnya bubar dengan sendirinya. (gan/c1/adi)

Pelaku... Namun, tidak tertutup kemungkinan orang yang sudah hidup normal tersebut ’’bermain” lagi. ’’Kami lacak ulang, mulai mereka yang di dalam (penjara, Red) kami tanya lagi teman-temannya yang di luar siapa saja dan posisi terakhirnya,’’ ungkap dia. Polisi menduga, serangan bom buku dilakukan tidak lebih dari tiga orang. ’’Ini unit kecil, tetapi efektif membunuh dan menyerang,’’ bebernya. Pola bom buku juga merupakan salah satu cara. ’’Ada banyak teknik mereka. Misalnya, menembak dengan menggunakan pistol peredam suara, mencekik leher, menusuk, bahkan modus seperti tabrak lari. Targetnya sudah ditentukan,’’ tuturnya. Secara terpisah, Kepala Badan Nasional Penanggulangan Terorisme Mayjen (pur.) Ansyad Mbai memastikan semua orang yang dikirimi paket bom adalah target terpilih. ’’Ada benang merah. Mereka adalah kafir harbi. Yakni kafir yang harus diperangi. Sebab, mereka ingin mendirikan khilafah. Mereka marah disebut teroris karena mereka melaksanakan ideologi mereka,’’

Sambungan dari Hal. 1 katanya dalam sebuah diskusi di Jakarta kemarin. Ansyad mengonfirmasi bahwa hasil penyidikan mengarah kepada kelompok eks Poso. ’’Ini bukan pemain baru. Ini pasti pemain lama. Bom buku ada sejak dahulu. Bahkan, di Poso itu ada bom baterai. Yakni bom seukuran baterai yang bisa meledak kalau dibuka. Kalaupun ada orang baru, pasti didikan orang-orang lama. Orangnya itu-itu saja,’’ ujarnya. Ansyad meminta masyarakat ikut waspada. ’’Jangan dikira pelaku merakit bom di hutan. Mereka merakit bom bisa di seberang jalan di kos atau di tetangga kita. Ingat ketika Dul Matin tertangkap di Ciputat dekat UIN,’’ paparnya. Penanganan kasus terorisme juga tidak bisa selesai dengan hanya penangkapan. ’’Kita perlu melakukan deradikalisasi. Saat ini diam-diam deradikalisasi sudah kami lakukan. Kami roadshow ke pesantren dan daerah. Kami bekerja sama dengan MUI dan NU. Kami sengaja tidak gembargembor,’’ tandasnya. Di bagian lain, hingga kemarin kepanikan

warga masih saja terjadi. Setidaknya tim Gegana Polda Metro Jaya mendapatkan empat laporan. Yakni paket mencurigakan untuk rektor Universitas Muhammadiyah Jakarta, paket di Jalan Cempaka Putih, paket di Hotel Gran Mahakam, dan paket boneka Barbie di kawasan Pasar Minggu. Tim Gegana meledakkan paket-paket itu. Sementara itu, para santri dan warga di sekitar Pondok Pesantren Al Anwar Jawar, Kecamatan Mojotengah, Wonosobo, kemarin (19/3) digegerkan oleh paket buku yang diduga berisi bom. Sebab, pengirim paket buku tersebut mencurigkan. Oleh petugas, paket berisi empat buku tebal itu ditempatkan di ladang dan diledakkan. Pengirim buku mencurigakan itu datang ke pesantren sekitar pukul 15.30 WIB. Paket buku itu diserahkan kepada salah seorang santri bernama Mujahidin. Setelah menerima, Mujahidin tidak langsung membukanya. Paket tersebut baru dibuka setelah diserahkan kepada Pengasuh Pesantren K.H. Mu’tiqun Asnawi sekitar pukul 16.00.

Harusnya... ’’Hak Bu Herlina sebagai seorang pegawai ya digaji kan Mas. Nah, setahu saya sudah lebih dari satu tahun beliau tidak menikmati hasil jerih payahnya membangun SMA Plus karena haknya tidak dibayarkan oleh pihak yayasan,” ungkapnya kemarin. Sumber tersebut juga menambahkan, jika dinilai dengan uang, mungkin kerugian yang diderita Herlina lebih dari Rp10 juta. Untuk membayarnya, salah satu jalan tengahnya rapor siswa ditahan dengan catatan kalau sudah melunasi baru diberikan. ’’Jadi itulah sebabnya kenapa Bu Herlina sampai berani membawa rapor siswa. Selain itu, setahu saya, Ibu Herlina juga berperan dalam perkembangan SMA Plus. Dahulu SMA itu ujiannya bergabung dengan SMAN 9, selama di tangan Bu Herlina SMA Plus bisa melaksanakan ujian sendiri, dan itu tidak mudah,” ujarnya. Menurut dia, masalah ini tidak akan sampai seperti sekarang kalau saja pihak yayasan bersikap baik saat ditengahi oleh

Sambungan dari Hal. 1 Dinas Pendidikan (Disdik) Bandarlampung. Radar Lampung kemudian mencoba menemui Ketua Yayasan Kesuma Yuda, Muzi Taba, di rumahnya di Jl. Imam Bonjol, Bandarlampung, kemarin. Saat itu, ada tiga pria yang sedang duduk. Salah satu dari mereka menanyakan identitas dan maksud Radar mencari Muzi Taba. Seorang lelaki lagi berperawakan agak kurus mengenakan kemeja putih dengan celana dasar cokelat mengatakan Muzi sedang keluar tak lama setelah Radar sampai. Lelaki itu sangat mirip dengan foto besar di dalam ruangan tersebut. Di dalam foto terdapat sepasang suami-istri mengenakan pakaian daerah berwarna merah. Itulah foto Muzi Taba dan istrinya, Nurlela, yang kini menjadi kepala SMA Plus UNESCO. ’’Lho, bukankah Bapak ini Pak Muji Taba. Itu kan fotonya,” tanya Radar kepada lelaki tersebut. Namun, dia enggan menjawab. Dia hanya meminta wartawan koran

ini meninggalkan nomor telepon. ’’Nanti kalau Pak Muji mau bicara, dia akan telepon kamu,” singkatnya. Sumber Radar menyatakan Muzi memang cenderung sulit ditemui dalam masalah ini. ’’Saat dimediasi Disdik pun dia sulit datang. Setelah beberapa kali panggilan baru hadir,” ujar lelaki yang meminta namanya tidak disebutkan demi keamanannya tersebut. Terpisah, Kabid Pendidikan Menengah Disdik Bandarlampung Riyuzen Praja Kuala membenarkan pihaknya sudah berupaya menengahi persoalan ini. Namun ternyata pihak yayasan telah melaporkan masalah itu ke Polresta Bandarlampung. ’’Sehingga kami terpaksa lepas tangan,” tukasnya. Dalam kesempatan itu, ia mengimbau kepada pihak yayasan ke depan agar tidak terlalu mencampuri urusan sekolah. Dengan begitu, proses belajar-mengajar dapat berkembang sewajarnya. Pengamat pendidikan Universitas

Petugas... musisi Ahmad Dhani. ’’Kami berharap tidak ada lagi laporan tentang bom,’’ ucap anggota lain Detasemen Gegana yang bertugas di pos jaga. Aris menuturkan, sejak muncul laporan tentang kiriman bom, markasnya cukup ramai didatangi wartawan. Mereka menyanggong untuk mengikuti tim Gegana ke TKP (tempat kejadian peristiwa). Puncaknya Jumat lalu (18/3). Pada hari itu, tercatat tujuh laporan paket bom. Tetapi, setelah dicek di TKP, yang benar-benar bom hanya terdapat di kawasan Kota Wisata Cibubur, Bogor. Saat itu paket tersebut meledak. Selain menjadi pusat wartawan dalam mencari berita tentang bom, markas tersebut ramai karena seluruh anggota tim harus siap siaga. Aturan piket personel makin dipertegas. ’’Petugas tetap boleh libur, tetapi kantor tidak boleh kosong. Harinya digilir,’’ ucap Aris kepada Jawa Pos (grup Radar Lampung). Sebelum ada instruksi dari Polda Metro Jaya agar tim Gegana menyebar ke seluruh polres di Jakarta, anggota Detasemen Gegana yang berjumlah kurang dari seratus orang itu kumpul dan siaga di markas. Sejak Selasa lalu, kesibukan tim Gegana memang bertambah. Sebelumnya, aktivitas di Mako Gegana (dalam bahasa Sanskerta berarti langit) lebih tenang. Maklum, dalam satu bulan, belum tentu ada laporan soal bom yang masuk. Ketika tidak ada laporan bom, anggota tim Gegana memanfaatkan waktu untuk menambah dan mempertajam ilmu serta keterampilan menjinakkan bom. ”Ketika sekarang sibuk, kami anggap sebagai waktu praktik,” ujar anggota lain, disambut tawa

Menurut Mu’tiqun, setelah menerima paket buku tersebut, dirinya hanya membuka surat pengantar yang dikirim oleh penerbit Lazuardi Birru. Yang membuat dia curiga, pengantar surat menyebutkan bahwa buku tersebut merupakan novel berjudul Ketika Nurani Bicara yang mengisahkan testimoni Ali Imron, pelaku bom Bali I, yang telah menyesali perbuatannya. ’’Begitu membaca surat tersebut, saya langsung menelepon pihak kepolisian. Apalagi, saat ini marak dengan teror bom buku,’’ katanya. Petugas Polres Wonosobo yang datang ke pondok segera meletakkan paket itu di ladang yang tak jauh dari pesantren. Selanjutnya, polisi menghubungi tim penjinak bom dari Satbrimob Subdetasemen IV C Pelopor Kutoarjo untuk mengurai isi paket tersebut. Setelah diurai, dipastikan dalam paket itu tidak ada bom. Isinya hanya empat buku berjudul Ketika Nurani Bicara. Meski demikian, agar tak terjadi hal yang diinginkan, empat buku itu tetap diledakkan. (jpnn/c1/adi)

Lampung Dr. Undang Rosidin, M.Pd. mengatakan, masalah seperti ini harus diselesaikan secara kekeluargaan. ’’Kedua belah pihak harus duduk bersama dan mendengarkan pendapat satu sama lain demi tercapainya kesepakatan yang baik untuk keduanya. Kalau berlarut-larut, maka anak didik yang menjadi korban,” ingatnya saat dihubungi via telepon genggam kemarin. Undang menegaskan, Disdik harus berperan aktif menanggapi masalah seperti ini. ’’Harus ada sebuah pembekalan untuk pengurus yayasan yang bergerak di bidang pendidikan. Yakni pendidikan harus dilakukan dengan bijak dan harmonis,” tegasnya. Yayasan dan pengelola harusnya selalu berkomunikasi dan berkoordinasi. Masalah ini muncul hanya karena adanya miskomunikasi dan kesalahpahaman. ’’Mungkin yayasan terlalu ikut campur dalam urusan sekolah atau sebaliknya,” tandasnya. (gyp/c1/ade)

Sambungan dari Hal. 1 rekan-rekannya. Tidak berapa lama, tawa anggota tim Gegana tersebut terhenti karena telepon salah seorang teman mereka berdering. Ternyata, panggilan itu menginformasikan adanya paket mencurigakan lagi, yang diduga berisi bom. Paket tersebut berlokasi di kawasan Pasar Minggu, Jakarta Selatan. Saat menerima informasi itu, beberapa anggota tim Gegana yang mengobrol dengan Jawa Pos tersebut sedang makan siang dan baru saja membuka nasi bungkus. Segera bungkusan nasi itu ditutup lagi. Tanpa butuh waktu lama, sepuluh personel dengan slogan setia, tabah, dan waspada tersebut langsung memutar mobil penjinak bom. Mereka bergegas menuju TKP (tempat kejadian perkara). Suasana Mako Gegana yang semula senyap menjadi agak riuh. Sirene mobil jihandak meraung-raung kencang. Tidak ada perlengkapan tambahan. Hampir seluruh peralatan penjinak bom sudah tertata rapi di dalam mobil tersebut. Aris mengawal mobil itu dengan menggunakan motor. Meski melewati jalur bus Transjakarta yang cenderung sepi, mobil jihandak tersebut masih saja terjebak macet di beberapa titik. Antara lain, titiktitik pintu masuk tol dalam kota di Jalan Gatot Subroto. Beberapa persimpangan yang dilengkapi dengan traffic light terpaksa mereka terombol. ”Tolong, metromini minggir,” ujar petugas melalui pengeras suara di atap mobil penjinak bom. Seruan itu tidak digubris. Sebab, metromini juga tidak mendapatkan celah untuk minggir. Akhirnya, tim Gegana harus antre dan menunggu kemacetan sedikit mencair.

Di tengah guyuran hujan, mereka kembali terjebak macet. Tepatnya di kawasan Kalibata. Antrean mobil kali ini lebih parah. Dengan sigap, Aris mencairkan beberapa mobil yang menghalangi jalan mobil jihandak. Tiba di TKP, tim Gegana berhenti di depan rumah Doni Zulfakar, Jalan Haji Samali Ujung No 18. Di depan rumah itu, ada paket. Pengirimnya adalah Toko Mainan Indonesia. Paket sebesar kardus air mineral tersebut terbungkus plastik hitam. Beratnya sekitar 5 kg. Paket itu dikirim seseorang dengan menggunakan motor kemarin, sekitar pukul 12.00. Pengirim berhelm dan berjaket hitam. Nah, karena Doni pergi ke luar kota, paket mencurigakan tersebut dititipkan kepada Edi, tetangga Doni. Karena sering melihat berita ancaman bom dalam paket, Edi langsung curiga terhadap bingkisan tersebut. Dia lantas menelepon Polsek Pasar Minggu. ”Edi melapor, ada barang mencurigakan. Dia khawatir isinya bom,” ujar Kapolsek Pasar Minggu Kompol Sunarto. Pihaknya lantas segera mensterilkan lokasi tersebut. Sambil menertibkan masyarakat yang penasaran, tim Gegana bersiapsiap menjinakkan ”paket bom” tersebut. Salah seorang petugas mulai mengenakan seragam khusus penjinak bom. Bentuknya persis dengan yang digunakan oleh Sersan William James (diperankan Jeremy Renner) dan kawan-kawan dalam film The Hurt Locker. Setelah seragam terpasang lengkap, petugas langsung menuju paket itu. Total, petugas tersebut hilir mudik dari mobil jihandak ke lokasi paket hingga tiga kali. Setiap kembali ke mobil penjinak

bom, dia menyempatkan minum air dulu. Saat kembali ke lokasi paket untuk kali ketiga, salah seorang anggota tim menyebut bahwa paket tersebut A1. ”Paket A1, semuanya menjauh,” teriak Aris. Beberapa personel tim Gegana yang bersenjata juga menyuruh masyarakat minggir. Sebuah paket disebut A1 jika memenuhi beberapa indikator. Salah satunya, di dalam paket itu terdapat rangkaian elektronik. Rangkaian tersebut diketahui dengan alat pemindai sinar X. ’’Ada kabel dan baterai dalam sebuah rangkaian,” ucap Kapolres Jakarta Selatan Kombespol Gatot Eddy Pramono. Setelah menetapkan status A1 untuk paket tersebut, petugas langsung mengeluarkan beberapa peralatan penjinak bom. Di antaranya, kabel dan peledak berdaya rendah. Tidak berapa lama, darrr... Paket itu pun diledakkan. Ternyata, isi paket tersebut bukan bom atau bahan peledak lain. Setelah diurai, paket itu berisi boneka Barbie. Gatot menjelaskan, rangkaian kabel dan baterai yang terekam sinar X itu adalah alat kelengkapan boneka. ’’Boneka itu jenis yang bisa bergerak. Jadi, ada rangkaian elektroniknya,” imbuh dia. Bagi anggota tim Gegana, jelas Gatot, ada prosedur tertentu dalam menangani paket yang dicurigai sebagai bom. Anggota harus meledakkan paket itu jika ada tandatanda rakitan bom. ’’Tidak mungkin ada barang berbahaya yang dimasukkan ke mobil, lalu diteliti di markas,” papar dia. Sebaliknya, jika setelah disinar X tidak ada tanda-tanda mencurigakan, barang yang dilaporkan oleh warga tak akan diledakkan. Setelah berhasil memastikan bahwa paket tersebut negatif bom, Aris dan rekan-rekannya balik kanan. (jpnn/c1/adi)




Negeri Ramik Ragom Waykanan Bumi Petani


PAPAR MULANG TIUH: Bupati Waykanan Bustami Zainudin (paling kiri) memaparkan sekilas isi buku Mulang Tiuh di Graha Pena Lampung kemarin (19/3).

LAUNCHING MULANG TIUH Bustami Seru Investor Berinvestasi

BUPATI Waykanan Bustami Zainudin malam ini (20/3) melaunching buku karyanya, Mulang Tiuh (Pulang Kampung Nih). Akan hadir dalam acara eksklusif di Hotel Novotel Bandarlampung tersebut dari Sekjen Departemen Pertanian RI, tokoh masyarakat Jenderal (pur.) Ryamizard Ryacudu dan Kadarsyah Irsa, serta akademisi Unila Dr. Bujang Rahman. Masing-masing sebagai panelis. Orang nomor satu di Waykanan ini mengatakan, acara tersebut bukan semata-mata laun-

ching buku berisi program prioritasnya. Melainkan sebagai momen berkumpulnya dengan orang-orang sukses Waykanan yang selama ini berada di perantauan. ’’Harapannya, mereka (orangorang sukses Waykanan yang ada di rantau, Red) mau kembali untuk membangun daerah asal,” papar Bustami saat bersilaturahmi didampingi Kabag Humas Waykanan Rinaldi dan Kepala Dinas Pendidikan Gino Vanolie ke Graha Pena Lampung kemarin (19/3). Di kantor Radar Lampung

ini, Bustami pun memaparkan mengapa dirinya perlu menyerukan mulang tiuh. Menurutnya tidak lepas dari banyaknya persoalan yang dihadapi untuk membangun Kabupaten Waykanan. Sementara untuk mengatasinya tidak bisa dilakukannya seorang diri. Perlu kerja sama semua pihak berupa pemikiran maupun tindakan nyata. Persoalan-persoalan dimaksud di antaranya masih tingginya angka kemiskinan di Waykanan. Banyak petani yang tidak bisa menggarap lahan karena keterba-

tasan lahan yang ada. Padahal, lahan yang terbengkalai berupa belukar cukup luas. Bahkan menurutnya hampir 46 persen dari luas kabupaten ini. ’’Masalahnya, lahan-lahan tersebut sudah ada pemiliknya, namun tidak digarap. Dibiarkan begitu saja. Sementara, banyak warga yang mau menggarapnya kesulitan menemui pemiliknya karena berada di rantau,” ungkapnya. Itulah alasan mengapa dirinya perlu menyeru warga Waykanan yang berada di rantau untuk mu-

lang tiuh. Teruatama mereka yang telah berhasil atau yang selama ini memiliki lahan namun ditinggalkan. ’’Tidak lain agar dapat memanfaatkannya demi kemajuan dan kesejahteraan masyarakat Waykanan khususnya. Karena tidak ada sejengkal tanah pun yang tidak memberikan manfaat bagi kehidupan,” tandasnya. Bustami juga mengatakan ide mulang tiuh-nya muncul atas keprihatinannya selama ini. Di mana menurutnya, investor yang berinvestasi di kabupatennya justru kebanyakan dari

Ubah Paradigma Masyarakat MENDAPAT posisi sebagai orang nomor satu di Kabupaten Waykanan memiliki nilai tersendiri bagi Bustami Zainudin. Karena selain harus menjalankan roda pemerintahan, dirinya juga mempunyai tanggung jawab lain sebagai putra daerah yang harus membuat Bumi Petani ini bukan sekadar maju. Melainkan juga harus mampu mengubah paradigma berpikir masyarakatnya. ’’Saya harus mampu membuat masyarakat saya betah di kampung dan mengajak masyarakat yang ada di rantau mulang tiuh (pulang kampung). Lalu meyakinkan investor untuk berinvestasi di sini (Waykanan, Red). Sebab, Bumi Petani ini memiliki sejuta potensi,’’ ungkapnya. Di Waykanan, dirinya juga akan secara berkesinambungan memperbaiki kualitas layanan, akses masyarakat, dan hal lain dalam mempermudah masyarakat beraktivitas mengembangkan kegiatannya. Yakni dengan adanya buffer penopang. Seperti bidang kesehatan. Menurutnya bagi mereka yang tidak terakomodasi dalam jamkesmas program pemerintah pusat, akan dimasukkan dan dilayani melalui program jamkesta. Selain itu, masih banyak program yang dibuat secara khusus untuk memberikan kemudahan kepada masyarakat. Tidak hanya itu. Untuk membuat masyarakatnya betah di kampung dan memudahkan aksesnya, Bustami juga mencanangkan program yang ia sebut sebagai Malam Terang Benderang dan Jalan Tidak Berlubang. Dia menyatakan bahwa program itu merupakan program serius. Sebab, hal itu merupakan salah satu upaya untuk membuka keterisolasian tiuh-tiuh. Baik itu keterisolasian di bidang ekonomi, transportasi, maupun informasi. Sehingga ke depan masyarakat Waykanan mendapatkan fasilitas kemudahan transfer ilmu pengetahuan. Tidak heran, kata Bustami, jika pengembangan infrastruktur diarahkan untuk menunjang dan mendukung pengembangan sistem serta usaha agrobisnis dalam sesuatu kesisteman yang utuh dan menyeluruh pada kawasan sentra produksi. Selain itu, nilai budaya dan religius pun dikembangkan. Menurutnya, semangat mulang tiuh memberikan spirit tersendiri. Karena kearifan lokal yang dimiliki tiuh adalah nilai budaya yang luhur yang wajib dilestarikan dan dikembangkan. (nui/c1/rim)

luar yang perhatian terhadap kemajuan pembangunan setempat sangat kurang. ’’Mestinya kan kalau mengeruk SDA di Waykanan, ya harus mau memajukan Waykanan. Termasuk memberikan kesejahteraan terhadap masyarakat setempat. Namun, ini tidak. Mereka (investor, Red) semata mengeruk keuntungan,” tandasnya. Jujur, menurutnya, ia bukan bangga ketika di daerahnya ada investor dari luar negeri seperti Malaysia dan Tiongkok. ’’Kalau mereka tidak peduli dengan

kemajuan Waykanan kan percuma,” tukasnya. Namun, Bustami tidak alergi dengan investor asing atau dari luar. ’’Tetapi alangkah baiknya jika yang mengelola Waykanan untuk kemajuan dan kesejahteraan masayarakat Waykanan adalah warga sendiri. Daripada menggadaikan tanah atau kekayannya kepada asing yang akhirnya nanti bisa dikuasai mereka sementara kita masyarakat pribumi hanya menjadi penonton bahkan numpang di tanah kelahirannya sendiri,” pungkasnya. (c1/rim)

Pemikiran Alternatif bagi Pembangunan TANAH airku tidak kulupakan, kan kukenang selama hidupku. Biarpun saya pergi jauh, tidak kan hilang dari kalbu. Tanahku yang kucintai, kuhargai. Demikian petikan lagu Tanah Airku ciptaan Ibu Soed mengawali prakata Bupati Waykanan Bustami Zainudin dalam buku Mulang Tiuh (Pulang Kampung Nih). Dalam buku karyanya ini, orang nomor satu di Waykanan tersebut berusaha menyajikan pemikiran alternatif bagi pelaksanaan pembangunan tanpa meninggalkan kearifan lokal. Tetap pada aturan serta semangat kebersamaan. Melewati masa kanak-kanak di desa (tiuh), tulisnya, begitu nyaman. Hal itu yang kemudian membangkitkan romantisme dan membangun kesadarannya bahwa sebagai masyarakat agraris dengan kultur atau budaya tinggi harus membuat tiuh maju. Sebab, pertanian dan perkebunan menjadi anugerah bagi petani dan keluarga. Bahkan secara makro menjadi fondasi perekonomian

masyarakat Lampung. Tidak heran ketika diberi amanah menjadi bupati di Bumi Petani ini, ia pun bertekad mengajak masyarakatnya yang berada di luar kota untuk pulang kampung. Mengajak investor untuk berinvestasi di bumi nan subur ini. Melalui bukunya, Mulang Tiuh, Bustami juga mengajak khalayak untuk melihat betapa banyak potensi dan kekayaan yang dimiliki Kabupaten Waykanan ini yang bisa dikembangkan. Menurutnya, kabupaten yang selama ini banyak ditinggalkan masyarakatnya karena dianggap tidak menjanjikan dan minim harapan itu sebenarnya menjanjikan kesejahteraan dan kemakmuran. Sehingga tidak benar ketika masyarakat telah keluar tiuh lalu enggan kembali lagi. Sebagai putra daerah yang paham dengan kondisi tiuh-nya, Bustami pun terus melakukan diskusi dan membuat rumusan bagaimana agar khalayak tahu betapa kaya dan potensialnya Bumi Petani ini. Sehingga, tujuan tiuh maju bisa diwujudkan. (nui/c1/rim)



DI-LAUNCHING: Buku Mulang Tiuh karya Bustami Zainudin yang akan di-launching malam ini (20/3) di Hotel Novotel Bandarlampung.

GENCAR SOSIALISASI: Sosialisasi Mulang Tiuh untuk membangun Negeri Ramik Ragom Waykanan Bumi Petani tidak hanya di kabupaten setempat. Tetapi juga Bandarlampung sebagai pusat kota Provinsi Lampung, bahkan di luar Lampung.

WAYKANAN SEBAGAI BUMI PETANI BUPATI Waykanan Bustami Zainudin mempunyai alasan kuat menjadikan kabupatennya sebagai Bumi Petani. Itu sesuai makna filosofisnya bahwa bumi adalah potensi sumber daya alam (SDA). Sedangkan, petani merupakan sumber daya manusia (SDM) yang tidak ternilai harganya. Dua potensi ini yang me-

nurutnya bisa menjadi kekuatan hebat apabila dikelola dengan baik. Di Waykanan sendiri, sumber daya alamnya melimpah dan harus dikelola dengan baik serta didesain sebesar-besarnya untuk kemakmuran masyarakat. ’’Namun apa artinya sumber daya alam tanpa sumber daya manusia

yang mampu mengoptimalkannya. Karena itu, SDM yang ada harus dimotivasi untuk kreatif, inovatif, dan memiliki etos kerja baik,” jelasnya. Sebagai bupati di Bumi Petani ini, Bustami mengaku dirinya memiliki pekerjaan rumah yang banyak dan besar. Ini tidak lepas dari total 700.000-an penduduknya,

masih ada 47 ribuan di antaranya yang masuk dalam kategori miskin. Mereka tentunya perlu diselamatkan. Yaitu dengan menjadikannya produktif. ’’Ini merupakan kewajiban kita bersama. Termasuk warga Waykanan yang telah sukses di rantauan,” ungkapnya. Konsep mulang tiuh, menurutnya, menjadi solusi untuk

membangun dan menyejahterakan masyarakat Waykanan secara utuh dan merata. Mulang tiuh tersebut, jelasnya, tidak selalu berarti aktivitas fisik. Mulang tiuh juga berarti kembali ke akar budaya. Yakni sebuah kesadaran paling awal bahwa mereka pernah dilahirkan atau dibesarkan dengan tradisi yang kemudian membentuk

watak dan bakat mereka seperti sekarang. Melalui mulang tiuh ini pula, putra daerah asal yang sukses di rantau dapat memberikan sumbangan tidak terhingga terhadap setiap warga di tiuh-nya. Menurutnya, inilah pentingnya mulang tiuh untuk membangun Bumi Petani. (nui/c1/rim)




Jawa Pos News Network

KPK Andalkan Vonis Hakim JAKARTA - Komisi Pemberantasan Korupsi (KPK) mengakui kesulitan menetapkan tersangka terhadap pemberi suap dalam kasus cek perjalanan dalam pemilihan deputi gubernur senior Bank Indonesia (DGS BI) pada 2004. Namun, lembaga antikorupsi itu menyebut adanya peluang menjerat pemberi suap melalui putusan majelis hakim dalam perkara sebelumnya. Juru Bicara KPK Johan Budi S.P. mengatakan, melalui amar putusan, KPK bisa mengembangkan penyelidikan untuk menyeret pemberi suap aktif. ’’KPK bisa kembangkan dari vonis hakim untuk menetapkan tersangka pemberi suap,’’ paparnya ketika dihubungi koran ini kemarin (19/3). Isi amar putusan Pengadilan Tipikor, lanjut Johan, bisa menjadi alat bukti yang kuat. Sebab, putusan majelis hakim tersebut didasari fakta yuridis yang muncul selama persidangan. Namun, Johan menegaskan, tidak semua putusan bisa digunakan sebagai dasar pengembangan penyelidikan. Pasal yang dikenakan terhadap tersangka juga menjadi pertimbangan KPK. Pengenaan pasal mengacu pada pasal 55 KUHP yang menyatakan, tindak pidana korupsi dilakukan secara bersama-sama, pengembangan penyelidikan bisa dilakukan untuk menemukan dua alat bukti. Berdasar penemuan alat bukti tersebut, penyidik bisa menetapkan tersangka baru. Yakni pemberi suap. ’’Dari pasal 55 itu bisa dikembangkan," imbuhnya. Sebagaimana pernah dibe-

ritakan, empat terpidana kasus suap cek perjalanan yang telah divonis Pengadilan Tipikor dikenakan pasal 11 UU Tindak Pidana Korupsi juncto pasal 55 KUHP. Mereka adalah Dudhie Makmun Murod, Hamka Yandhu, Udju Djuhaeri, dan Endin Soefihara. Sementara itu, Wakil Ketua KPK Bidang Pencegahan Mochammad Jasin menambahkan, selain mengupayakan lewat putusan pengadilan, KPK tengah mengumpulkan sejumlah bukti untuk menjerat si pemberi suap. Bahkan, Jasin meyakini, penetapan status tersangka terhadap si pemberi suap tidak lama lagi. ’’Soal pemberi suap, bukti-buktinya sedang dikumpulkan tim KPK. Setelah ngumpul bukti tersebut, saya kira tidak ada masalah (penetapan tersangka pemberi suap). Tinggal menunggu waktu saja,’’ ujarnya. Sebelumnya, KPK telah menjerat hampir seluruh penerima aliran dana berupa cek perjalanan yang diduga terkait pemenangan Miranda Goeltom sebagai DGS BI pada 2004. Bahkan, empat pembagi cek telah divonis. Namun, hingga kini, KPK justru belum menyentuh pemberi suap tersebut. Padahal, berdasar kesaksian empat terpidana di persidangan, berulang-ulang disebut nama istri mantan Wakapolri Komjen Pol Adang Daradjatun, Nunun Nurbaeti Daradjatun, sebagai fasilitator penyedia cek perjalanan tersebut. Namun, dengan alasan menderita penyakit lupa berat, hingga kini Nunun belum juga diperiksa KPK. (jpnn/c1/adi)

Pemerintah Tunggu Surat Kongres AS JAKARTA - Persoalan Jemaat Ahmadiyah di Indonesia menarik perhatian Kongres Amerika Serikat. Sebanyak 27 anggota Kongres AS diberitakan mengirim surat kepada Presiden Susilo Bambang Yudhoyono. Isinya meminta pencabutan Surat Keputusan Bersama (SKB) Menteri Agama, Menteri Dalam Negeri, dan Jaksa Agung tahun 2008. Sejauh ini, pihak Istana belum memberikan tanggapan atas surat dari Kongres AS tersebut. ’’Kami harus baca dulu, seperti apa isinya, baru kemudian kami tanggapi,’’ kata Staf Khusus Presiden Bidang Hubungan Internasional Teuku Faizasyah kepada koran ini kemarin (19/3). Namun hingga kemarin, Faizasyah mengaku belum melihat secara langsung fisik dari surat tersebut. ’’Kami baru mendengar informasi saja bahwa ada surat dari Kongres, tetapi secara fisik belum,’’ kata dia. Biasanya, jika ada surat sejenis, lebih dahulu diterima Kementerian Luar Negeri. Menurut Faizasyah, surat dari Kongres AS bukan merupakan sesuatu hal yang luar biasa. Mereka akan mengirim surat jika menaruh perhatian pada sesuatu hal atau isu. ’’Kongres sangat dikenal sering

mengirim hal serupa ke negara mana pun kalau ada ketertarikan tentang satu hal,’’ papar mantan juru bicara Kemenlu itu. Dia mencontohkan pada tahun 2008, Indonesia juga pernah menerima surat dari Kongres AS terkait masalah Papua. Kala itu, pemerintah cukup menjawabnya melalui Dubes RI di Washington. Faizasyah mengatakan, surat dari Kongres semacam itu memang tidak harus selalu ditanggapi langsung oleh pemimpin tertinggi seperti presiden. Juru Bicara Presiden Julian Aldrin Pasha sebelumnya mengatakan telah mengecek ke sekretaris pribadi presiden. Namun, surat dari Kongres AS tersebut memang belum diterima. Persoalan penanganan Jemaat Ahmadiyah di Indonesia memang menarik perhatian Kongres AS. Pada 23 Februari lalu, saat bertemu dengan Presiden SBY, anggota Kongres AS juga sempat menyinggung masalah Ahmadiyah. Saat itu, Ketua House Democracy Partnership (HDP) United States House of Representatives David Dreier mengatakan, persoalan Ahmadiyah berkaitan dengan masalah toleransi beragama dan penegakan hukum. (jpnn/c1/adi)


TEROR BOM: Petugas tengah mengumpulkan bukti-bukti serpihan dari sebuah paket yang diduga bom yang telah diledakkan tim Gegana Polda Jabar di dekat Pos Gatur Polisi Simpang Lima, Jalan Asia Afrika, kemarin.

20 WNI Masih Disandera Perompak JAKARTA - Hingga hari ketiga penyanderaan kapal kargo berbendera Indonesia MV Sinar Kudus oleh bajak laut Somalia, pemerintah masih belum bersikap. Kementerian Luar Negeri (Kemenlu) belum mendapat update kepastian keberadaan kapal tersebut. Walaupun begitu, Menlu Marty Natalegawa mengatakan, saat ini pihaknya terus menjalin komunikasi informal dengan pemerintah setempat. ’’Kami sedang bekerja sama dengan pemilik kapal untuk menghimpun data seluruhnya, bagaimana kondisinya, dan kami masih berkoordinasi untuk me-

ngetahui lokasi kapal,’’ ujar Marty dalam jumpa pers di kantor Kemenlu, Jalan Pejambon, Jakarta, Sabtu (19/3) petang. Kapal berbendera Indonesia, MV Sinar Kudus, dibajak 50 perompak Somalia. Lokasi kapal milik PT Samudera Indonesia dan 20 anak buah kapal WNI tersebut belum diketahui. Marty mengatakan, ini bukan kalli pertama ABK Indonesia disandera perompak. Namun, dia berharap upaya koordinasi ini membuahkan hasil. ’’Tentu keselamatan mereka kami utamakan," ujarnya. Perompak diperkirakan membajak MV Sinar Kudus sekitar 320

mil timur laut Pulau Socotra pada Rabu (16/3) pagi. Perompak juga belum menyampaikan permintaan tebusan. Tetapi informasi yang diperoleh, 20 ABK dalam keadaan selamat. PT Samudera Indonesia Tbk. juga telah mengonfirmasi hal itu dan menyatakan bahwa satu kapal general cargo yakni MV Sinar Kudus berbendera Indonesia memang sedang dalam perjalanan dari Pomalaa, Sulawesi Selatan menuju Rotterdam, Belanda. Jubir Kemenlu Michael Tene mengatakan, di kawasan tersebut memang sudah sering terjadi pembajakan karena termasuk

yang dialami Jepang juga diyakini ikut memengaruhi. Saat ini harga minyak dunia tercatat menyentuh level USD113 per barel, sementara dalam asumsi makro APBN 2011 ditetapkan USD80 per barel. Meski begitu, pemerintah memastikan belum ada rencana untuk menaikkan harga BBM. Walaupun pada periode November

dapat dibebaskan, setelah pasukan elit Korsel mengerahkan pasukannya. Alhasil, selain berhasil membebaskan warga Korsel yang menjadi ABK, pasukan Korsel pun berhasil membebaskan WNI yang juga turut di sandera. Banyak pihak menilai pasukan elit Indonesia sangat mampu bertindak sendiri untuk menyelamatkan WNI yang mengalami penyanderaan tersebut. Sumber daya manusia yang dimiliki Indonesia cukup mumpuni untuk melakukan hal tersebut, tapi selama ini pemerintah cenderung menunggu bantuan negara lain. (jpnn/c1/adi)

Syuriah Tegaskan Netralitas NU


MONUMEN NASIONAL: (Dari kanan) Menko Kesra Agung Laksono, Ketua Mahkamah Konstitusi Mahfud M.D., Rahmad Sah, dan Ketua DPR RI Irman Gusman dalam penandatanganan Prasasti Monumen Nasional Keadilan di Rahmad International Wildlife Museum dan Gallery Medan, Sabtu (19/3).

Pemerintah Pastikan Harga BBM Tetap JAKARTA - Pemerintah mengkhawatirkan berbagai kondisi global yang memengaruhi melonjaknya harga minyak dunia. Konflik di negara Timur Tengah seperti Mesir, Yaman, Yordania, dan negara penghasil minyak lainnya menjadi salah satu pemicu utama kenaikan harga minyak. Bencana gempa dan tsunami

zona merah. Saat ini, Kemenlu terus berkomunikasi dengan berbagai jejaring dan organisasi untuk menangani masalah tersebut. Fokus pemerintah adalah mengupayakan keselamatan para ABK. Pemerintah juga telah berkoordinasi dengan pemilik kapal, namun belum bisa dipastikan apa saja tuntutan perompak. Pemerintah mengutamakan diplomasi dalam upaya pembebasan WNI tersebut. Hal ini belajar pada insiden serupa ketika dua ABK asal Indonesia disandera di kapal milik Korea Selatan Januari lalu. Dua WNI yang menjadi ABK di kapal milik Korsel tersebut

2010 hingga Februari 2011, beberapa negara di Asia telah menaikkan harga BBM mereka sekitar 9-16 persen. Kenaikan premium tertinggi terjadi di Filipina sekitar 11 persen untuk jenis premium. Sementara Singapura telah menaikkan harga solar mereka sekitar 16 persen. ’’Sementara kita masih tidak

menaikkan harga BBM. Namun kita harus bisa menjaga antara demand (permintaan) dan supply (ketersediaan),’’ kata Menteri Keuangan Agus Martowardojo dalam diskusi bersama Forum Wartawan Keuangan Makro (Forkem) di Jakarta, Sabtu (19/3). Agus menjelaskan, APBN saat ini masih aman. Karena besaran

APBN sangat dipengaruhi Indonesian Crude Price (ICP) dan Lifting minyak. Kenaikan harga minyak yang terjadi berdampak pada kenaikan penerimaan Migas (PPh Migas, PNBP Migas, PNBP lainnya/DMO) dan kenaikan belanja negara (subsidi BBM, subsidi Listrik, DBH Migas dan dana pendidikan). (jpnn/c1/adi)

JAKARTA - Hubungan NU dengan kelembagaan dan partaipartai, terutama PKB, kembali menjadi polemik. Pernyataan Ketua Umum Tanfidziyah PB NU Said Aqil Siradj terkait dukungan ke PKB dipersoalkan kalangan syuriah. Katib Am Syuriah PB NU Malik Madani menegaskan, sesungguhnya sudah tidak ada dasar bagi NU untuk terlibat dukung-mendukung terhadap parpol tertentu. ’’Termasuk ke PKB,’’ tegasnya saat dihubungi kemarin (19/3). Hal tersebut, menurut dia, sesuai keputusan Muktamar Ke31 NU di Boyolali, Solo, 2004. Saat itu ditegaskan bahwa NU terlepas dari semua partai politik (parpol). Sekaligus menjaga jarak yang sama dengan partai-partai yang ada. ’’Kami merasa perlu mengklarifikasi pernyataan Ketum (Said Aqil, Red),’’ ujar pengajar UIN Sunan Kalijaga, Jogjakarta, tersebut. Menurut dia, pernyataan Said terkait dukungan terhadap PKB yang didasarkan pada keputusan Muktamar Ke-30 NU di Lirboyo, Kediri, berpotensi memunculkan kesalahpahaman serta keresahan bagi warga NU. ’’Bahwa PB NU itu tetap netral sampai saat ini, sehingga sama sekali tidak ada alasan pembenar dukungan terhadap PKB karena menganggap

keputusan Muktamar Lirboyo tidak pernah dicabut,’’ tegasnya. Malik lantas mengungkapkan, dirinya telah berkonsultasi dengan Rais Am Syuriah PB NU K.H. Sahal Mahfudz. ’’Mungkin kami (syuriah, Red) akan memberikan surat teguran kepada tanfidziyah menyangkut hal ini," katanya. Apakah sudah sempat melakukan tabayun (klarifikasi) menyangkut persoalan tersebut? ’’Hingga saat ini (kemarin sore, Red) belum berhasil. Tetapi, pernyataan-pernyataan seperti itu bukan yang pertama muncul, sudah berkali-kali,’’ ungkapnya. Sebagaimana diberitakan, Said Aqil dan Ketua Umum DPP PKB Muhaimin Iskandar kembali muncul bersama dalam sebuah acara di Lumajang, Jatim. Saat itu diberitakan bahwa Said menegaskan kembali dukungan NU kepada PKB. Keharmonisan Said dan Muhaimin dengan sering tampil bersama itu memang cukup tampak belakangan ini. Dalam beberapa kegiatan PKB, ketua umum PB NU yang terpilih dalam Muktamar NU di Makassar 2010 tersebut juga secara khusus hadir. Misalnya, saat pembukaan Mukernas PKB 15 Maret lalu atau raker Fraksi PKB akhir Januari 2011. (jpnn/c1/adi)




Warga BangladeshPakistan Waswas

Fukushima Steril dari WNI JAKARTA - Kementerian Luar Negeri (Kemenlu) RI memastikan bahwa radius aman yang ditetapkan pemerintah Jepang dari radiasi nuklir telah steril dari warga negara Indonesia (WNI). Kedutaan Besar Republik Indonesia (KBRI) Tokyo menetapkan radius aman yang lebih luas dari ketentuan pemerintah Jepang. Lokasi evakuasi WNI di Jepang terletak sejauh 50 kilometer dari wilayah potensi jangkauan radiasi nuklir di Fukushima. Ketentuan pemerintah Jepang membatasi wilayah aman hingga 20 km. ’’Jika kondisi memburuk, pemerintah menyiapkan perluasan 50-100 km. Tahapannya terus dimatangkan,’’ ujar Menlu Marty Natalegawa dalam pernyataan pers di Kemenlu, Jakarta, Sabtu (19/3) petang. Marty mengatakan, WNI yang dievakuasi dalam radius 50 km dari pusat nuklir ada sebanyak 82 orang. Pemerintah RI juga secara maraton mencari keberadaan WNI yang ada di lokasi terparah terdampak gempa dan tsunami, yakni di Miyagi dan Iwate. Marty memastikan pemerintah Indonesia belum berencana memindahkan operasional KBRI dari Tokyo. Walaupun sejumlah negara sahabat sudah mulai memindahkan perwakilan negaranya dari Tokyo ke Osaka. ’’Belum, kami terus memantau dan mempelajari informasi dan pengumuman dari pemerintah Jepang,’’ tuturnya. Marty mengatakan, pemerintah sudah menyiapkan opsi siaga I dan II, tetapi belum bisa disampaikan karena justru dapat memicu kepanikan. Hingga saat ini masih ada sekitar 100 WNI yang tersebar Fukushima, Iwage, dan Miyagi yang belum diketahui keberadaannya. Sebelumnya terdapat 502 WNI yang ada di lokasi tersebut. ’’Kami terus berusaha mencari mereka yang kemungkinan masih tersebar di titik-titik evakuasi dan pengungsian,” papar dia. Dilanjutkan, pihaknya telah mendapatkan data lengkap mengenai kondisi WNI dan situasi di tiga provinsi tersebut. Gelombang relokasi pengungsi WNI dari tiga provinsi itu ke KBRI di Tokyo juga terus mengalir. ’’Data kami semakin lengkap, semakin jelas dan terdata dengan baik,” ujarnya. Untuk relokasi ke KBRI Tokyo

saat ini berjumlah 216 orang. Sedangkan untuk jumlah total WNI yang telah dipulangkan ke Indonesia hingga kemarin petang berjumlah 163 orang. Jumlah tersebut dipastikan bertambah karena tadi malam 33 orang juga mendarat. ”Pukul 21.50 WIB akan tiba lagi WNI di Jakarta setelah sebelumnya transit di Denpasar,” ujarnya. Marty mengatakan pengumpulan bantuan dari masyarakat Indonesia harus dilakukan secara kolektif. Berbagai bentuk sumbangan, kata dia, harus dikoordinasikan dulu dengan Kemenlu. Karena pemerintah Jepang hanya menerima bantuan dengan permintaan khusus karena mereka tidak mau bantuan yang terkirim justru mubazir. ”Mereka mengirim wish list jadi semua sudah ditentukan mereka mau menerima apa saja,” terangnya. Menlu mengatakan, sejauh ini Indonesia telah memberikan sejumlah bantuan ke Jepang. Komitmen awal yakni menyumbang USD2 juta dan juga pengiriman tim reaksi cepat yakni ada 15 orang yang sudah tiba di Tokyo. Tim sudah berangkat ke Miyagi dan dilaporkan terus bergerak ke wilayah bencana yang terparah.Tim, jelas Marty, fokus untuk membantu WNI dan warga negara lain yang belum terjangkau bantuan pemerintahnya. ”Kami juga mengirim 1.700 selimut lagi dan kini sudah tuntas sesuai kuota permintaan jepang yakni 10 ribu lembar,” kata dia. Pemerintah Indonesia, tambah Marty, juga menggalang solidaritas dari negara-negara anggota ASEAN. ’’RI wajib tampil proaktif, bukan saja emergency, juga fase pascatanggap darurat. Saat ini diplomasi juga sedang dikerjakan untuk menggalang komunikasi antarnegara ASEAN,” katanya. Tim Indonesia Letnan Kolonel Infantri M. Sokhir juga telah diberangkatkan ke Jepang Kamis (17/3) lalu. Tim sudah dilatih dengan pengetahuan, keahlian, dan perlengkapan dalam menangani bencana. Kesiapan ini juga termasuk dalam menangani korban radiasi akibat ledakan reaktor nuklir di Fukushima. Tim merupakan gabungan dari Badan Nasional Penanggulangan Bencanan (BNPB), Kementerian Kesehatan, TNI, Badan SAR Nasional, dan Palang Merah Indonesia. (jpnn/c1/tru)


MULAI TENANG: Pengungsi beristirahat di aula utama Sekolah Dasar Yamada, Prefektur Iwate, Sabtu (19/3) atau satu pekan setelah gempa 9 skala richter dan tsunami menghancurkan pantai timur Jepang.

Libya Siap Gencatan Senjata BENGHAZI - Di saat pasukan loyalis Moammar Kadhafi selangkah lagi meraih kemenangan, Dewan Keamanan PBB akhirnya menyetujui pemberlakuan zona larangan terbang dan mengizinkan opsi militer guna menghentikan aksi pasukan pro-pemerintah. Pemerintah Libya yang gentar dengan resolusi tersebut, kemarin langsung mengumumkan gencatan senjata dengan kelompok pemberontak. ’’Libya telah memutuskan untuk melakukan gencatan senjata dan segera menghentikan semua operasi militer,’’ tegas Menteri Luar Negeri Moussa Koussa saat menggelar jumpa pers kemarin. Dia menyatakan, keputusan tersebut diambil karena Libya adalah anggota PBB dan wajib menerima resolusi Dewan Keamanan PBB. Resolusi DK PBB tersebut disetujui Kamis malam (17/3) waktu setempat dengan dukungan Amerika Serikat, Prancis, dan Inggris. Presiden AS Barack Obama menelepon pemimpin negara

Inggris dan Prancis setelah keputusan tersebut diambil. Pejabat AS yang berbicara setelah pertemuan tertutup di Kongres menyatakan, upaya untuk menghentikan angkatan udara Libya bisa dimulai hari ini (20/3) atau besok (21/3) dengan menggunakan jet tempur, pesawat pengebom, dan pengintai. Proses pembahasan resolusi untuk Libya itu menyedot perhatian warga negeri setempat. Massa dalam jumlah besar menonton melalui layar lebar di lapangan di Kota Benghazi. Mereka menyambut gembira keputusan tersebut dengan menyulut kembang api berwarna hijau dan merah. Di Kota Tobruk, timur Benghazi, warga Libya yang bergembira menembakkan senjatanya ke udara menyambut resolusi DK PBB. Keputusan menguntungkan bagi kelompok oposisi Libya tersebut diambil selang beberapa jam setelah Kadhafi menyatakan akan melancarkan serangan

terakhirnya untuk mengambil alih kembali kontrol atas kekuasaannya. Para ahli militer memperingatkan bahwa konsekuensi dari resolusi tersebut tidak bisa diprediksi. Mantan Panglima Militer Inggris Raya Richard Dannatt mengingatkan operasi militer harus dilakukan dengan sangat hati-hati dan terencana. ’’Supaya kita tidak terjebak dalam situasi seperti yang terjadi di Iraq karena tidak mempunyai rencana B (alternatif) setelah operasi militer dilaksanakan,’’ terangnya. Sebelumnya, kubu Kadhafi menyatakan tak gentar dengan resolusi PBB yang menyetujui dilakukannya serangan udara melawan tentara Libya. Putra Kadhafi, Seif al-Islam Kadhafi, menyatakan bahwa rezim ayahnya siap menghadapi apa pun yang akan terjadi. ’’Kami berada di negara kami dan bersama rakyat. Dan kami tidak takut," tegas Seif al Islam kepada ABC News Nightline dari Tripoli.

’’Kami tidak akan takut. Ayolah! Kami tidak akan takut. Saya katakan, kalian (Barat) tidak akan membantu rakyat Libya dengan cara membom Libya, membunuh rakyat Libya. Kalian menghancurkan negara kami. Siapa pun tidak akan menyukainya,’’ tandas putra sang Kolonel itu. Seif menyatakan bahwa resolusi tersebut tidak adil. Dia juga membantah kabar bahwa pasukan Libya membunuh rakyat sipil saat berperang untuk merebut kembali kota-kota yang sudah dikuasai pemberontak beberapa pekan terakhir. ’’(Resolusi) ini tidak adil, karena Anda tahu dari awal kami menyatakan kepada semua orang bahwa tidak akan ada serangan udara untuk membunuh warga sipil, tidak ada pemboman kantong-kantong permukiman sipil ataupun para demonstran," kilahnya. ’’Apakah Anda melihat ada warga sipil yang menjadi korban? Bahkan para teroris atau kelompok bersenjata itu, mereka menyerah. Jadi tidak ada pertumpahan darah di Libya,’’ lanjut Seif. (jpnn/c1/tru)

BAHRAIN - Demonstrasi antipemerintah yang berlangsung dalam sebulan terakhir di Bahrain telah memengaruhi kehidupan warga ekspatriat (pekerja asing). Tidak sedikit orang asing yang mengeluh karena mendapatkan perlakuan kasar. Padahal, mereka sebenarnya sama sekali tidak berkepentingan dengan pergolakan di sana. Fazlul Karim, presiden Masyarakat Pekerja Bangladesh di Bahrain, menuturkan bahwa sejumlah ekspatriat telah mengalami kekerasan oleh dua pihak yang berseteru di negeri yang menganut sistem monarki konstitusional tersebut. Puncaknya, Kamis lalu (17/3), para ekspatriat protes atas pemaksaan yang dilakukan demonstran pro-pemerintah yang meminta mereka ikut berunjuk rasa. Beberapa di antara mereka juga diserang oleh demonstran Syiah atau kelompok anti-pemerintah. ’’Yang diinginkan ekspatriat adalah keamanan yang lebih baik. Supaya mereka bisa meninggalkan rumah dan kembali bekerja dengan aman,” ujarnya. Karim mengungkapkan, dua pekerja asing terbunuh pada 1 Maret lalu. Tokotoko milik warga Bangladesh diserang. Pemerintah Bahrain belum berkomentar atas protes tersebut. Pada Senin lalu (14/3), setelah menyerang polisi tak bersenjata di Manama, demonstran berkumpul di Lapangan Mutiara, kemudian berpencar dalam kelompok-kelompok kecil. Target mereka berikutnya adalah warga naturalisasi Bahrain dan para pekerja ekspatriat. Para pengunjuk rasa itu selanjutnya merusak mobil-mobil yang diparkir di jalan dan menyerang pekerja secara membabi buta. Sebuah media melansir bahwa seorang pekerja ekspatriat diserang dan dipukuli dengan kayu serta ditusuk dengan pedang. ”Mereka menyerang dengan brutal. Saat ini kami hidup dalam ketakutan, bahkan saat dalam rumah yang terkunci sekalipun,” ujar seorang warga ekspatriat di Manama yang tidak mau disebutkan identitasnya. Dia menambahkan, tidak melihat satu pun polisi yang datang. (jpnn/c1/tru)



Waahhh sudah laku!!!


Honda Tiger CW Th 2010 Wr. hitam Kodya Km Rendah tera wat 7553245/ 0813 69100428 Ninja 250R 4tak Th ’10 Bln 1 W.Mrh Brg simpnn Mls Sprt Bru Jrg Pki Ban Bs+Km Msh 1000 Hrg 48Jt Ng Hub: 0813795 28989 / 081808532777 Beat ’09,BE,Merh,Pjk Br,An .Sndr,Konds Bgs,Nego,0812 72244747/081272888855 Djual Cpt Absolute Revo Th 2009 AKhir Ban Baru Hrg 7.5jt Ng;Hb 3667913 Honda Tiger ’07 Bln 5 Merah Kdya full Ors Ban Besar Hrg 16.5Ng Hub: 085269705525 Honda CBR ’07 Km rendah W.merah Tgn 1 BE kodya Hub: 08127918698 Ngo Jual Cpt+Murah Tiger 2003 Plt BE Gunung Sugih,Silver, 9.2jt; Hub 085269725294 Mio sporty Lamsel 9Jt RX King ’98 Kodya 6Jt, Rx King ’95 4Jt Hub: 082180677890 / 7434353 Scorpio 08 CW Msn+Body 100% Bgs 16jt Ng;Hub 0812 7911152/261547 Blade,Revo 2010 Kdy/Kbptn 8.5jt Jl.Ratu Dibalau/Kasbun; 08127957272 Supra X 125 Th2006 Ori, Mls, 6.5jt Nego 081369695300 Supra X 125 Th 2006 BE Tan gan I Hrg 7.5jt;Hub 7168324 BAJAJ Pulsar 200cc wrn hitm BE KODYA th’08 knds mls hrg ngo. 0721-3640426 Vega R th 2005 Biru Original BE Kdy Hrg 5.5jt;Hb 0811793882/ 7558832 MOBIL ACCU

HOME ACCU,Jual beli Accu baru, Tukar Tmbh Accu Scond, Cas, Brgransi .Jl.Raya Hajime na Dpn Swalayan Fitrinop (0721 7583971) DAIHATSU

Gebyar Promo Dahsyat Krdt Daihatsu Br Xenia Li DP18.6jt Ang.3,3jt an 4th; Terios TS+ DP37,3jt Ang.4jt 4th &DP24jt Ang.4,5jtan 4th; Luxio DP17,3 jt Ang,3,8jtan 4th;MB G.max DP 14jt Ang.3,5jtan 4th;PU G.Max DP 7.3jt Ang.2,8jtan 3th Dlm &Lr KotaPross Cpt Data Djmpt Byr DP Bw PlgMbl;Simon 7343981081272194536 Xenia Mi Dp 17 Jt Ang 3jt 5 Th, Xenia Li Dp 17.9 Jt Ang 3.1Jt 5 Th, Xenia Xi 19Jt Ang 3.3Jt 5TH, Xenia Li DP 20% Prepaid Angs 2.6Jt 4th, xenia DP 20% Prepaid Angs 2.7Jt 4Th Terios TS Xtra DP 24Jt Ang 4.5Jt 4 Th, Terios TX DP 27 Jt Angs 5 Jt A Th, Press Cpt Syrt Mudh Hub Mas ANTO ASTRA Mobil 07217333100 / 0811721578 Terios TX Advnture ’10 Mt Slver Met BE lamteng An Sdri Dr Bru TV,DVD Multi Mdia 3 Monitor Wood Panel, Hordeng, Sport Rack, Subwofer, Ban Serep Blum Trun, Djamin Puas ! Over Krdt Pulang DPn 98Jt Angs 8.3Jt x 14 Hub: Bp.Iwan Bd Jaya 082175533357 / 081369488004 Hardtop 82, Diesel, Msn Ori, VR 33", PS, Cakram, Ramsex winch, Full Vrs, 125 Jt Ng Jl. G. Subroto 47 Hb. 081319538087 Espas ZL’06,BE,AC,DVD, Mrh, Mls L/D,Ng 085269983968/ 3559280 Taft’91,Gts,Htm,Brg.S.Pki,H 57Jt Ng 081369383113 Taruna Fx 1.5 Th 02, silver met, Bdy mls, AC, Tape, BE Kdy, H. Ng 0721-3616661 / 0816 414650 Xenia 1.0 Li 2006, BE, Hub. 0821å76800276 Grandmax 1.3D’10 Bln8,MB, Silver, AC,Alarm,DVD+S. Systm ,Pintu Blkg Buka Atas, Km. 7rb, Tgn1 dr Baru,Mulus,Plat B,Hrg 101jt Ng, 9906011 Rocky Th 87 4x4 Aktif Orsinil Full Kaleng Cat Mls VR BR31 DVD MP4 Jrg Ada BE 57jt Ng; 081379772777 Metro Terios TX MT Deluxe 2010 Putih Mls KM 10rb Pjk Baru 03 Ass 1th,Jl.Damar TD II 09 BTN III WHP;0811722452 Daiahtsu Terios Matic ’10 Type A Plat B slver Brg Gress Tp Cacat KM rendah 157Jt Ngo 0813 79671991 Espaas 1.6 th ’96 MB W.Hjau Met brg Siap Luar Kota d Jual Cpt Ng Hb: 085368357772 Feroza ’94 Mrh Ac, BE Kdy Kleng VR Ban Bsr Bgs Ng Pjk Baru 081369488676 Rocky Th 92 4x4 Aktif VR BR31 RT Cat Mulus Mesin Sehat Plat BE Siap Pakai;Hub 082184021 462 Metro

Feroza SE 95 Hijaju Silver B Mls Hrg Nego Ban Bsr Rmt CL RT Pmkai; 085269323070 Xenia Xi Family 07 B Hitam Pjk Pjg Jok Klt VR Spion Sen 112.5jt Ng; 0811727354 Feroza SE 95 B Merah Abu2 Pjk Pjg J.Klt AC Ban31 Pcl Antik F.Ors Hrg Ng;0811727354 Zebra MB Jumbo BE VRBR + Tape Bdy Mls + msn Std S.Pkai 9778440 16Jt Bs TT Mtor Daihatsu Ceria th ’06 Mrh Met Khss Pmakai Hub: Jl.Dr.Cipto Gg Sri Rejeki II / 69 T.B Hb: 0812 7904517 Xenia Xi 1.3 Fmily 2008 Aqua Blue BE VR Fog Lamp Sen Spi on 5 Ban Bru, Ng;08137 9312 343 Terios TX 02 Be Pilihan Silver Dp 18 JT Angsuran 5.318.000 x 35 Bulan Hub. 0813 69014088 Sirion 08 Be Exc Wanita Dp. 20 Jt Angsuran 3.331.000 x 35 Bln Hb. 0813 69014088 XENIA XI 1.3 VVTI 2008 Silver Be tngn I AC/PW/PS/VR/BR Mulus Ors. Hub. 0813 67572075 Grand Max 1.3 Family Htm Plt F Jok Hdp Dpn AC PW Tgn I F.Orsnl 87jt Ng; 0721-3535645 Xenia Xi Fmly VVTi 06 BE Kdy Aq.Blue Vrsi Ass.Allrisk 7 Bln 108jt Ng; 085269831251 Espass Th 95 Wrn Ungu Plt Kdy ACDB VR Ban Br Siap Pkai;Hb 081379459844 Feroza’94,htm,BE kdy,int ori,bdy ful ors cat,tv,audio ,rmt, good cndtn,081977992777 Daihatsu ferosa ’95 Type SE tipe AC Luar Dalam djamin Ori 081373653322 Terios TX 07 Hitam BE Kodya Pjk Baru Brg Gress;Hub 7151304 Taft Long 92 BE 4x2 Mls CD AC PS Msh Bgs 45jt Ng;Hb 0812 79462549 Djual Mbil Xenia Th ’06 BE Kodya W.Cklat Met Hb: 0812 57900701 Xenia Xi’04 silvr,pjk pjg,ors l/ d,brg trwt,istw,jl cpt,bu,100jt, 081272514134 CHEVROLET

Trooper 2.3 LS 4x4 Hijau Met Msh Orsnl Tgn I BE Lengkap Antik;7189819 Pmakai Optra 1.8 LT 2004 Pjk Pjg Htm Met Jok Klt TV BR VR RT Mls T.Belt Bru Cmprsor AC Bru Trwt Ass Allrisk Garda Oto 95 Jt Ng Balik DP 18.5 Jt Angs 2.2 Jt x 43 Bln Hub 082180790981 Chevrolet Pick Up Th 84 Biru VR PS Ban Bsr Yg Short Hrg Nego Siap Pakai; 08538101 9918/0721.3665650 Trooper 4x2 Th 92 BE W.Hijau Bagus Siap Pake 08218356844/ 0721-3623981 Cevrolet Lux PU Th’92,Cevrolet Lux Minubus Th’87,Hb:10812 .7918908 FORD

Laser 1.3 GL 90 Msn Bgs Body Mls AC VR 10jt Ng;08526952 3775 Bs TT Mtr/Mbl ISUZU

Panther LS Turbo Hi Grade 05 (Pmkaian) MT, Merah, BE Kdy, AC DB, PW, PS, CL, CD Changer, Brg Ors/Sip 155 Jt Ng TP 081369354333 Panther’97,2.5,Biru,VR,BR, PS,BE,H 65jt Ng 081272357777 PANTHER LS HIGRADE 2003 AHR BE ABU2 JOK KLT MLS SPT BR ORS DJMN PUAS 132JT NG;085366888829 isuzu Phanter LV ’10 Silver Proses BE Brg Spt Baru 185Jt Ng METRO 082176203334 Panther Grand Royal 98 Body Klg AC Dgn Dbl PWPS CL Brg Bgs Rmt S.Pki; 081369142909 Panther MB’93/94,w.hijau met, plat b,pjk pjg,vr,ac,rt,cl,br,msn bdy bgs,h.damai,081279 5169 99 Panther Higrade 96 BE Kdy Orsinil Hrg 67jt Ng;Hb 081369 157298/ 081369391938 Panther New Grand Royal 2000 BE Brg Bagus 80jt Ng;081369 157298/ 081369391938 Phanter TTl Assy ’93 B putih AC,VR, Intrior Mewah 51Jt Ng Hub: 082177132168 Panther 96 Mls RT AC VRBR PWPS Msn Bgs Hrg 46jt Ng;Hb 081279462549 Panther’92,BE,Mrh,Pjk Des’ 11,AC,PS Hrg.37,5jt Ng 07217542081 Higrade 94/95 BE Kdy Biru PWPS CL ACDB Bdy Klg Msn Mls 63jt Ng; 081272801999

Phnter Th ’91 BE AC DVD Velg Racing PS Mulus Msn Bgs 0812 7985861 37 Jt Panther LS 01 BE ACDB Rmt TV Full S.Syst PWPS Orsnl L/D 100% ;081379228679 Panther LS’01,Coklt Muda Met, BE,An.Sendri,S.Pki,Nego,081272 244747/081272888855 Panther LS Higrade 2000 akhr ,plat B,pjk bln12,w.silver-gold, mls,08127245632 Panther LS 04 Akhr Up Grade New Mdl 2010 Silver B Gres Mls T.Cct Jl Cpt Ng; 0811794020 Panther;94,PS,PW,AC Dgn, CL,Pjk Br, BE Kdy,Cat Asli,53jt Ng 0721-7488509 Isuzu Phanter LV ’02 Biru B Ors 100 JtNego METRO 08127 232535 Royal Th,96 B Hjau Met Total Assy 93 Mrh Metalik 0721363 2777 Panther Higrade 96 BE Orsinil Siap pakai;Hub 082183155539 Jl Bli Panther Hi Sporty’97, Biru,AC Dgn,Brg Mls,H 60jt Ng Hub.9804456Jl Cpt Panther Grand Royal’96/97, Hju,Bdy Mls,67jt Ng 081272522842 Carry 10,Pick Up’92,BE,Tgn 1,Faktur, Srt Lkp,Mrh,H 20 Ng 0721-7581977 HONDA

Honda Civic VTI- S Tahun 20 05, BE, Hitam, Mulus, harga 165 jt nego Hubungin: 081369 777704 Honda CITY 05 VTEEC Hitam Orisi nil Mulus Harga 140 JT Nego Hub. 085269511200/ Tan pa Perantara Jazz Vtec Sport Tahun 2007 Putih Mutiara Manual, BE, mulus, pajak bulan 11, nopol Pilih an, harga 148,5 jt, TDP 36,5 jt angs 4,106,000 hubungin Bin tang Berlian Motor 08136 9777704 Jazz Vtec Sport Tahun 2007 Putih Mutiara Manual, BE, mulus, pajak bulan 11, nopol Pilihan, harga 148,5 jt, TDP 36,5 jt angs 4,106,000 x 35 bulan. Hubungin Bintang Berlian Motor 081369777704 Jual Cpt Honda Ferio Th 96 BE Kodya Bdy Kaleng Hjau Mls PW,PS CL ban Bru AC Dgn 78Jt Ngo Hub: 0811797839 CRV 2009 / AT 2.0 cc, BE kdy, IStw, 315 Ng Khusus pemakai 081279777999 Jazz’04,Abu2 Mda,Istmw, 0813 79777056/08789820056/ 7500735 Crv 2.0 MT 08 Abu2 met BE 2anka Plhn Vrsi TV 3 Audio Allrsk Srvs Hnda Jmn Ori S.pke 272 Jt C/k T/T Han2 Utomo MOTOR 9017070 Jazz Vtec AT Htm Tgn1 Pjk Br Km 51 Rb Jmn Ori Tdk Kcw 135 Jt C/k T/T Han2 Utomo MOTOR 9017070 City idsi MT 07 Htm Pjk Pjg Tgn1 Trwt Srvs Honda Jmn Tdk Kcw 149 jt Utomo MOTOR Stream MT 04 Abu2 Met BE Pjk Pjg Vrsi J.Klt Jmn T.Kcw S.Pk u/Yg Hobi 145jt;Utomo MOTOR 9017070 Honda STREAM 1.7 MATIC Th 2004 / 2003 Tng Pertama Warna Merah Marun mulus luar dalam tanpa cacat H. 132 Jt HUb. 0815 408901111 Honda accord prestige htam th ’88 BE a/n sdri AC,Rt,VR, PW, PS,Cl Remot mls s.Pke 26 Ng hub:0721-7532410 Civic LX th ’89 BE VR 15 BR AC PW,EM Jok Kulit Mls S.pakai Hrg 37Ng Hub: 082180488778 Honda City Th ’06 ( Pjk Br Smnggu) BE A/n Sdri W.hitam Met S.pakai Hrg Ngo Hub: 0813 79994888 Honda Jazz ’08 Matic Aqua Blue Proses BE Km Rendah brg Gress 158Jt Nego 081279 62347 Vtec Matic jul’08,plat kodya,bodi mls,wrn abu2,orng1.hub:081 532475080 Honda CRV Th ’02 W.Silver Plat BE kodya TV,DVD,Pemakai hrga Ng Hb: 085269871948 Jazz 05 Manual BE Abu2 Met Mls Ors L/D Kondsi Prima Assrnsi H.Ng; 08127915070 Stream 04 Manual 1.7 BE Kdy Biru Muda Mls Djual Cpt BU; 081278902150 Cielo 94 BE Abu2 Tua Met Rapi Trwt 68jt Ng;Hub 0813790 82345 Tukar Baleno City Wrn.Gold Th 2004 Bln 11 (B) Audio TV Kndsi Mulus 125jt Ng; 085279922345 Metro City Z V Tech th ‘2000 Biru don ker BE bgs Sekali Kaya Bru 87.5 Jt Nego Hb: 082184058806

Civic Wonder 87 BE Pjk Baru Body & Int Ors Kaleng 20jt Ng; 085269523775 Bs TT Mbl All New CRV 07 Matic BE KM Rndh Ors Mls Gress SPt Br T. Cct Jl Cpt Ng; 0811794020 JAZZ MATIC 2004 BE ABU2 SILVER CD MP3 KF VKOOL JOK KLT ISTMW JRG PKI 118JT;7437200 JAZZ MANUAL 2006 BE KDY HITAM JOK KLT TV DVD CD MP3 S.SUST ISTMW DJMN PUAS;081379088875 Grand Civic LX 88 BE PWPS AC Dngin VR R15 Mbl Bgs;Hub 081279633617 JAZZ VTEC SPORT MNL 2005 BE KDY SILVER MET KNDSI PRIMA; 081279109500 Honda Maestro th ’91 BE kodya Hub; 081369222304 CRV 2.4 AT Th 09,Htm Met, BE,Pjk Br,TV,Audio Lengk,Hb: 0721-7407399 Accord ’82 BE Htm Mls Vr,BR ,CD 12Jt Ngo Hub: 085279 549282 Honda Cty th ’03 A/T Idsi Plat B W.Silver Hrg 115Jt 081272 200505 Cielo Th 95/96 Warna Merah Tangan Pertama;Hub 07217360050 Honda accord Vti th ’00 MT Biru Tua VR 18 Hub: 081369105010 / 770290 Honda Stream 1.7 Th ’04 W.hitam Manual 08127212640 Accor Presg’87,pjk br,pintu otmts,full snd,22jt ng,08526952 3775 bs tt mbl MAZDA

Mazda Mr ’91 cat Mls AC/RT/ VR/BR Int Ors Bdy klg S.paki BE 17.5Jt Ngo 081369450462 / 7501 215 TT Mtr Mazda Capela ’89 BE Kodya Msn bgs W.Biru Ada KTP Murah 22 jt Ngo 7549115 Mazda Interfly th’90,BE kdy, htm,ac,vr,rmt,pwr,orsl,31jt Ng, 085279009388 Mazda MR’91,BE kdy,Pjk br, ac,rt,mp3,bdy klg,msn krg,int rpi, 16,5jt ng,08127977675-7552050 Mazda Interply ’99,htmm,be/ac/ vr/mls,kleng,31jt ng,085269 523775 bs tt mbl Mazda 323 Th 86 BE Kndsi Siap Pakai 20jt Ng;Hub 0812 7274 0654 MITSUBISHI

Doble Cabin Strada Triton Exxed Tahun 2008, BE, Merah, Mulus, pakaian Pribadi harga 270 jt Total DP 62,6 jt angsuran 7,698,000 x 35 bulan Hubungin Bintang Berlian Motor 0813 69777704 (Bonus Hp blackberry jika kredit via ACC) L300 PU Th 07 BE Kodya Siap Kerja DP 20 Jt Angs. 3.310.000 x 35 Bln Hb. 0813 69014088 Doble Cabin Strada tipe exxed Tahun 2008, BE, merah, mulus hubungin 081369777704 Mits Kuda Diesel ’01 GLS Merah Met B AC VR,DVD ,PW,Mls Over Krdt Pulang DP 44Jt Angs 2.9Jt x 16 Daihtsu Zebra 1000 ’88 Siap Jalan Kndsi Lumayan Coklat Hrg 10Jt Aja Hub : Bp. Iwan Bd Jaya 0821 75533357 / 081369488004 Honda STREAM 1.7 MATIC Th 2004 / 2003 Tng Pertama Warna Merah Marun mulus luar dalam tanpa cacat H. 132 Jt HUb. 0815 408901111 Mitsubishi Prmo,Triton,Lncer Grnds serba 9jt,Tss PU 3jtn, L300 4jtn,Colt Dsl 5jtn,Hendra 07217365003/085369003888 Lancer ’86 Akhir BE Kodya Mrah Ferari Mls modif AC,PS ,RT 18Jt Ng Hb: 085279549282 Lancer Dan Gan GTi 91 Hij Met Ors Trwt VR16 Lkp BE Kdy H Nego; Hb 08127908914 TP Kuda GLS Diesel Th ’00 Silver BE Kodya Mobil Trwat Baik Hub: 081279427235 DJUALMITS PICK UP TS 120 SS TH 93 BEB HRG 19.5 JT NGO HUB: 081279059099 Dijual Mits.Th 93 Evo3 Mulus Siap pakai Kodya Hrg 50jt Ng;Hb 0721-7149413 Hiu V6 New Galant 2001 ABu2 Met TV DVD V17 Ban Br BE Kdy Prwtn ;08127265999 Kuda Spr Exed Bnsn 00/99 AC DB PW CL Alrm Mbl Brsih Ors Mls Bru Slvr H.80 Jt Ng 0721 7302419 Dan Gan 91 Silver Mls CD AC VRBR PWPS Msn Bgs BE 34jt Ng; 0721.770383 Kuda Diesel Spr Exeed ’01 AC DB Bg Pjk Pjg Mrah Mutiara TP Hub: 081278319300

Mits L300 PU,th’02,BE kdy,Pjk, Kir,Iu lengk,msn& bdy Bgs,Hb: 0813-79954737 Kuda Grandia 02 Htm BE Orsnl Gress Mls VRBRPWPS CL ACDB 95jt Ng; 0811794020 Colt T120SS 1.5 PU 2009 Hita m Mls KM 10rb STNK Br Hrg Ng;7464885/ 0811793882 Evo 4 98 SEi,BE,pjk br,F.snd, ors, vr15,msn kring,lht psti ska, 9905140 ng Mitsubishi Pajero ’97 V6,4x4, Hijau Met,Konds Mls,0812. 7200961 Lancer ’83 BE VRBR,MP3 Str racing W.Merah Mls 13 Ngo 7489308 Dum Truk 86 BE Siap Pakai Hrg Nego Bisa TT;Hub 0721. 9312564 J.cpt Kuda S.EXCEED’00 Solar BE M Slvr S.pke H 83 NG 08127966428 Dijual Evo IV SEi’97,silvr,B,pjk baru,H.nego,085768922324 Avanza G’08ahr,htm,Be,Ban br,Kond l/d Ors.tgn1H.134jt Ng;081369319909 MERCEDES

Dijual Cpt Marcedes Benz 300E,Th’93,4 pintu,Orgnl,Hb :0721-7431663/08127206909 Mercy Tiger Th ’77 W.hitam Ori Plat B Hub: 081541370999 SUZUKI

SUZUKI ESTEEM 1.6 GR Th 94 Warna Merah Metalik VR, BR, RT, Mulus Siap pakai H. 39 Jt Hub. 0852 79674353 (No SMS) KATANA Th 90 Be, Merah VR, RT, AC, Nego Hub. 0721 7544 55 9/ 085841115888 Esteem 93/94 BE kondisi MBL Bgs Mulus Siap Pakai Hub. 7330433 KATANA GX 96 Hijau Be Kodya Msn AC Oke Shok Baru Kaki Bgs Enak Dipakai HUb. 0813 79777707 Dijual Suzuki AERIO TH 03 Wrn Hitam Mulus Siap Pakai 95 Jt. Nego Hub. 083170497000 Dijual Grand Vitara Htm JLX ’06 Bulan 9 Tgn 1 Sangat Memuas kan Km 60Rb Asli Ban + Sok & Rem + Asrnsi all Risk 10 Bln Bru Hb: 08127932681 Katana GX ’97 Pth Mls BE Kodya AC,RT,TV,PS,VR,BR,CL Pjk Baru An Sdri Hub: 081377 161522 / 08963138519 Pmnt Serius NO SMS SWIFT ’06 AT TGN 1 KM LOW, SPT BRU LGPK CASH/CRDT/ TT TDP 30JTAN ANGS 3 JT AN X 35 BLN HB: 7486381 / 08127 2067599 ESCUDO 1.6 TH 2004 BE KDY HITAM JOK KLT VRBR RNT PS MLS SPT BR JRG PKI 118JT NG;085366888829 Baleno ’00 Silver VR 15 Baru S.sytem Ors L/D (Ex Dr) Siap Pakai Hub: 081369212139 Sedekick Dragone ’96 BE AC,PS,PW,VR 15/ CD + Soud Sstem Mls Liat pasti suka hb: 081272017060 Esteem 1.3 th ’94 Hjau Met Vr, Br Kmplit S.pakai An Sdri H 38 Ngo Hb: 0811797255 ( METRO ) Jual Cpt Futura PU ’06 BE bdi Msn sasis Bgus 081272000444 / 081279233348 Amenity 90 AC Dingin W.Hitam Siap Pakai Bgs;082183568441/ 0721.3623981 Katana GX 96 BE Hjau Met Ors PS,AC Dgn CL Rmt Tp Pwr Msn Ok 46Jt 085366139007 Esteem ’92 haju muda Met PW,PS,R/t AC,PR,Br H 35.5Jt Ng 081279148949 Futura Minibus 93 Pintu Blkg Body Mls Msn Ok Abu2 27jt NG;Hb 0721.7562454 Carry 1000 Th 85 BE Pick Up Body Ban Msn Bgs S.Pake Me rah Hati H.Ng;0812725 02224 Katana Gx’96,BE Kdy,Vr Br Ps, Ac,Rt,Sgt mls Ors,Hrg Ngo 081272622344 Escudo 94 BE Kdy AC Hitam Met CD TV S.Syst Orsnl F.Varia si 75jt Ng; 08127903581 Jual Cpt Katana 91 BE Kdy Hitam AC Tape VRBR Full Vari asi 32jt Ng; 0721.7639532 Suzuki Swift GT 3 Bln 08 ’10 Putih Mutiara TDP 27Jt Ng angs 5.045.000 x 34 Hb: 0811796507 APV ARENA GL ’09 Slver Met BE Kndsi Trwat Hrg Ngo Krdt dbn tu Hb: 085840553242 Jimny Trepes 82 Merah 4x4 BE Tape AC Dalaman Orsinil (Peng gemar); 7494567 KATANA 90 BLITZ 6 SPD BE BIRU KLG JOK HDAP DEPAN NG; 07217594230

ESCUDO 95 BE KDY BIRU ABU2 AC PS CD VRBR KLG ORI NG; 081379199860 Esteem 93-94 BE mbl Bgs AC VR Remot Pwr String S.Pk Gress 40jt Ng; 085381159433 Katan GX’96,hij-met,be kdy, msn,ac,ok,aud bgs,jok sparc, kaki2br,tnggl pki,081379777707 APV Tipe X 2005 Brg Istimew aBE Kodya Hrg 95jt;Hub 0812 79272261 Baleno ’97 PW,PS,BR.TAFE, AC BE Hijau Met 67Jt Ng 08136 9019983 Djual Karimun ’00 BE Ac Dgn W.Hjau Tosca Hrg 71Jt Hb: 0813 79542083 Carry 1.0 Pu ’96 BE Bodi msn sasis bgus 08567758111 Suzuki Futura 1.3 Th ’00 Ex angkot BE Plat hitam 28Jt 085381449852 Jimny’90 BE,AC Dgn,RT/RD, Mls, S.Pakai(31jt)Ng Hb. 7542610 Baleno DX’01,Merah,BE,Kodya pjk baru,4 ban baru.hub 0721 .9922969 APV L’05,htm,pjk br,mls l/d,sngt trwt,jl cpt,bu,h.100jt ng,0812 72514134 APV 2010 Merah BE An.Sendiri All risk Seperti Baru;0812 7960 9223 APV 2010 Hitam Allrisk An. Sendiri Jl.Ratu Dibalau 145 ;0812 7274383 Dijual Escudo 1996,BE,s. pa kai, H.73 juta,hb:0811723603 tp Jimny’82,BE Kdya,Merah, Hub.0721-9798756/08136 9583999 TOYOTA

AVANZA G Manual 2006 BE, Merah Ban BS Besar Velg racing KM rendah,terawat Hub. 0721 7472026/ 0811729162 Inova Diesel G tahun 2008 bulan 12 New Model, Silver, tgn 1, Km 27 ribu, full variasi, TV Sound, Mulus, Total DP 53,2 jt angsuran Rp 6,215,000 (Bebas Pertamax) Hubungin Bintang Berlian Motor 081369777704 Avanza 08 bulan 1, BE, silver, tgn 1, Tdp 32,5 jt angsuran 3,7 jt x 44 hubungin Bintang Berlian Motor 081369777704. Inova Diesel G tahun 2008 bulan 10 New Model, Hitam, tgn 1, Km 17 ribu, Mulus, Total DP 53,2 jt angsuran Rp 6,215,000 (bebas Pertamax) Hubungin Bin tang Berlian Motor 0813697 77704 Kjg Super Th 93 Astra Biru Met Full Orsinil AC Dingin VR CL PW Hrg Nego;Hub 081314218354/ 082183123576 Inova Diesel G tahun 2008 bulan 10 New Model, Hitam, tgn 1, Km 17 ribu, Mulus, Total DP 53,2 jt angsuran Rp 6,215,000 (bebas Pertamax) Hubungin Bintang Berlian Motor 0813 69777704 Avanza G 08 Silver Be Mulus Rmt Jok Kulit Hub. 0813 6901 4088 Corolla SE SALON Th 86 BE, AC, PR, BR, Hrg 23 Jt Nego HUb. 7594869, 0813 69020740 Corolla Twincam 91 BE Mbl Bgs Mls Irit Siap Pakai Hub. 0813 79273191 Kjg Grand Extra 1.5, 95 akhir, BE Kdy, Cat Br Abu2, Bdy Klg, Msn Krng, PW, PS, Ban Baru, AC Dgn Dbl, TP, 0816401933 Kjg G’95,1.8,Hju,BE,,VR, BR, AC, H Ng 7549777/082184 060773 Innova Silver G’04Akhr,Km Rndh,85rb,Istmw,08127978387 Tyt Kjg’94,Kond.Bgs,S.Pkai,BE Kdy,H 63jt Ng 081369908477 Jual Cpt Krista 99 Solar W. Hijau BE Kdy AC Tp PWPS 95jt Ng;0852 69740555 Corolla Altis Th 2003 Tp G W.Hitam Automatic Plt B Hrg 135jt Ng;Hb 0721.7580444/ 085269458979 LGX 2002 Hrg 120jt;Hub 082184299927 Kjg Sper G Th ’94 B Bln 7 PS,ACDB ND VRBR+Ban Bru sstem Audio Int 100% Tnp cct Sdkt Pun Bdy + msn 100% mls Hlus L/D Ori Gress sgerSpki Jl. Cpt Bu 085269688588 TGreat Corolla 94, BE, Pth Trendy , VR, BR, AC Tape, Jk Klt, Jrng Pakai Mls, H. 67 Ng Pemakai 0811 723222 Tyota Corona Twincam th ’90 W.Hitam BE Kdya Jual Cepat Hrg 29Jt Ng 081279220337 / 0721-7499055 Krdt Resmi Toyota Avanza DP 18.7 Angs 3.5 Inova Bunga 0% Dyna Truk,Yaris,vIOS,Trima Tukar Tmbah Hub Haris 0813 69422000 Toyota Crown Spr SL 30 Th ’97 Plat B W.abu2 Brg Smpanan Mls Ori & Trwat Hrg 65Jt Hb: 081379528989 / 081808532777

Jl cpt LGX 01/02,Gold,Ful Vrsi, TV,CD12 Disk,RD,Tip Tan DepBel,Ordeng,Mls L/D,Ors,Pki Sndr,BE Kdy,H.124jt Ngo, Minat,0812.67159800 Kjg GRAND X-TRALong ’95 Plat f PW,PS,CL,VR,BR Tipe ACDB Bdy kleng S.Pakai 76.5Jt Ngo Hub: 082176427403 INNOVA G DIESEL NEW MO DEL 2008 AKHIR SILVER MET BE TGN I TV SOUND FULL VARI ASI ORSINIL; HB 0812 7970022 LGX 1.8 EFi 2002 B Biru Met ACDB PWPS CL Rmt Alrm Tl.Air Lis Body/Spbr Mls Lux Luar/ Dlm; 082183837474 Mtr LGX 1.8 2003 Pjk Bln 10 B Silver Gold ACDB PWPS Alrm Rmt Srg Jok S.Klt Lis Body/Spbr Brg MLs Tgl Pki Nego;08218 3533 444 Mtr Kjg Lx Th ’02 Akhir w.Biru AC Tape,PS,BR,VR,Remt Bdy klg Cat Ori ful Variasi BE Kodya an sdri Hb: 081369906888 Kjg Minibus Long 94 5 Pintu Merah Marun Msn Sehat Plat B pjk Telat VRBR DVD MP4 42jt; Hub 081379772777 Metro Avanza G’06 Akhr VVTi W. Htm,Full vrs,Jok Klt Pres,Kdy, KM 30rb,Rwtn Auto 2000, Tg1081369240024/7548748 Djual Mbil Kijang th ’96 Biru Met AC DB pjk Pjg Kodya Full Ori pemakai Hub: Rusman 08218 3657999 / 087899585999 Kjg Grand Extra (56x) 1.8 Th 96 BE Pjk Baru Biru Met Kndsi Mls Ori PS VRBR CL Tape PW AC DB 76jt Ng; 081379847555 Kjg Super G th ’94 W.Biru Met BE Kodya RT,VR,BR,ACBD, Msn Bdy Ors hub: 08127925650 / 081279678458 NEW AVANZA TP S 1.5 MAN UAL 2011 BR 2 BLN BE KDY HTM F.VRSI JOK KLT CD MP3 ISTW SPT BR;7437200 AVANZA E 2008 BR HTM KM 17000 CD S.SYST J.KLT FOGH LAMP TNDK JRG PKI SPT BR IST MW 120JT NG;0812 794 0150 Kijng Inova G ’04 Silver BE kodya Pjk Bln 10 Km Rndah Full Variasi / Audio 148Jt Nego MET RO 081379671991 Cotolla Twincam’90 1.6cc ,Hitam ,AC,PW,PS,EM,Rmt ,Msn Kring,085369717686 Avanza G ’09 Abu2 BE KM Rndh TV KF Quantum 141 jt Ng 07217566919 No SMS Kjg LGX ’04 Htm Proses BE Brg Gress Ban Baru 149Jt Nego 08127232535 T Great Corolla Th’94 BE Kdy VR BR AC Tape CD Bdy Kaleng Mls H 69 Ng Pemakai 363389308154020191 Kijg Pick Up Diesel Th’02 BE Kodya AC PS Tape Tgn 1 Full Ors Hub: 0721-7355834 Avanza G ’06 BE kodya Km Rndah Ex Wnt an Sdri CD Jok Klt Hitam 125Jt 085269090725 Vios 2003 Silver BE Kdy Full S.System Ada TV Brg Istime wa;Hb 081279272261 LGX 1.8 1997 BE KODYA ABU2 MET ACDB PW PS VR BODY KALENG MULUS TERAWAT; HUB 7391314 Corona Exsaloon coklat Met Th ’90 ac,PW,PS,VR BE kodya Pjk Bru 31Ngo Hub: 085368368856 Kjg SSx Solar ’97 BE kdy Bdy Klg msn Krg AC,RT,VR,LGX BR CL,RMT Srg Jok S.paki Tlp 0812 7902331 LSX Solar 97 BE Kodya AC Dobel PW PS CL Remot CD VR Ban Baru Pjk Panjang;Hub 0811 793352 TP Vios 04 Silver AC PS CD/VCD MP3 VR CL Trwt Pmki Lsg H. Nego; Hub 081379147163 / 0816 413263 Kjg LGX 2001 W.Silver Bensin BE New Mdl Lengkp Full Variasi Body Mls Msn Kering 115jt Ng; Hub 7151304 Lgx 03 Matic 2.0 An.Sdri Cck Utk Wnt & Jl.Ma Cat Clvr Orsnl, 111jt; 081373961055 Frtuner Glux Th ’05 Hitam B Face Lift Mdl Baru H 275Jt H Baru 434Jt Hub: 08127942147 Kjg G th’94,BE Kdy,An sendri, Abu2 met,ACDB,brg mls,rapi luar dalam,hb:08127975761 tp Kijang Inova th ’04 Slver Type G plat BE kodya TV,DVD,MP3, Kndsi Trwat hrg Ng Hb: 0853 66151720 Djual Tyta Corlla DX ’81 W.Biru Dongker Velg Racing Tape AC Hrg Ngo Hub: 085840564466 Kjg LGX 1.8 EFi 04 (B) Cham paigne Pjk Pnjg Ext & Int Orsinil Sgt Terawat Mls;7544942/ 08127 9475175

KIJANG super short th’87 BE,w.abu2 met DVD, BODI MLS VR hrg 40jt ngo hub 35494 13-081369580721 Kjg Spr G 1.5,’95 akhr bln 12, merah met,BE,RT, PW,PS, AC Dngn,DBL,67jt Ng,hb:0813. 79510833 Avanza G 07 B Silver Tgn I F.Variasi S.Pakai VR AC Hrg 129jt NG;0811727354 Camry 2002 Akhr Biru Met BE No. Pil VR AC PWPS Rmt Msn Body Ok; 082180705447 Kijng Super ’93 BE Kodya Pjk Bru AC TIV,Mls L/D S.pakai 54Jt Ngo Hb: 0721-7392257 Satrlet ’88 BE Kodya Pjk Bru AC,TIV Msh Ors Mls L/D 28.5Jt Ng Hb: 081369649260 Corolla Twincam Th 91 W.Puth. VR BE, AC,RT, Hrg damai Hub: 085279560668 Kijang Jantan Th ’91 Plat BE AC, VR tape Kond Bgus Hrg Ngo Hub: 085279955757 Kjg Jantan Raider G Exctf 93 Biru Silver Komplit;Hub 07217520126/ 081540824725 Kjg Th ’90 VR,BR,MP3 Jok Klt Lamp Grend 6 Speed Mls skali 33Nego, 7489308 Kjg Astra ’92/93 Merah BE Kodya Lamp Grand Variasi Mulus 48Jt 082183172444 Starlet 1.3 Th 88 VRBR AC RT Hijau Met Body Mls Msn Ok Cash/Krdt; 0721.7562454 Jl cpt Soluna GLi th’00,w.biru dongker,bdy kaleng istmw,pjk pjg,nego,0811799156 Starlet 93 SEG/F.Varsi, Mrh Frari Corolla SE Th,86 Htm Met Pwr String 081272196555 Innova solar ’05n Type V Light Green Mls s.pakai 179Jt Ng Hb: 08127975991 Twincam se 1.6 th ’90 putih BE Ors DVD AC VR tdk Kcw Hrg Ng Hb: 7476005 / 0815413 64022 Vios G BE Htm 2006 BPKB 2007 AC VR CD Jok Klt F.Ors Tgn I 135jt Ng; 0721.3535645 STARLET 92 BE merah PS PW mesn hls khusus pemakai 50jt hub 0811721012 Corolla Twincam’89,BE kdy,AC dngn,VR,BR,Sond,Remot,35jt,07217373755 LSX Diesel ’97 bln 11,B,ac,rt,vr, ps, lampu bgsi blkg modi[ 2003, 89jt ng,081279054444 Kijang Pick Up 85 BE Cat Body Bak Br Jok Br Mesin Hls Sasis Mls;Hb 081369337009 Innova Dsl Euro 09 New Mdl B KM 24rb Ors Mls Gress Spt Br Jl Cpt Ng; 0811794020 INNOVA G BSN 2006 AHR B HTM ORSNL ISTMW SPT BR SIAP PKI 160JT;081379088875 LGX 1.8 EFi Th 04 B Silver Met Kndsi Orsinil Mls Msh Gress Jual Cpt Ng; 0811794020 Inova G 08 B Hitam Bensin Full Orsnil Utk Yg Serius BU188jt;Hb 081279415000 Kjg Kapsul SGX 97 Bensin BE W.Biru Kondsi Prima Siap Pakai Nego; 7151304 Kjg Spr 89 Astra 5spd BE Kdy VRBR Tp AC Trwt Pki Sndri; 0813 69438804/ 082184070860 AVANZA G 2005 BE SILVER TV BAN BRU FULL VRS KND. PRIMA; 0721. 7546094 SSX Up Bensin 97 BE Kdy VRBR PW Orsnl LD Trwt S. Pake Sndiri; 07217395369 Kjg Spr Astra 89-90 AC Dgn Bgt VR 5Bn Br Lp Grnd Mls Klg Ors 6spd 44jt Ng ;7330433 Kjg Grand Extra Th 94 Bln 12 B Abu2 Met Istimewa Sound System 67.5jt; 7301871 Inova Dsl 2005 V Biru An.Sdri Pjk 2012 Jual Cpt Murah 175jt Ng; 0811796522 /7147020 LGX ’01,BE,silvr,ful vrsi,brg istmw,trwt extra,siapa cpt,bu, 115jt ng,0721-3680350 Kjg Kpsl SX 99 Ahr Pjk&Ban Br PS Sound Msn+Bdy 100% Bgs 90jt Ng; 08127911152/261547 Corolla twincam 1,6,’88 lift back hjo met istmw VR,15,ors.0821 8318277 Toyota Twincam 1.6 Th ’88 Biru B Ac Dingn S.pakai 44Jt Hub: 08197991973 Djual Vios Th 03 BE Kodya W. hitam, Hrg Lhat Brg Hub: 0812 7276123 Djual / Take Over Yaris Merah Baru 3 Bln Matic Hub: 0811 725892 Kjg LGX ’04 B ACDB Kndsi Memuaskan 08127200961 Fortuner G Lux Bensin Th 05 Hitam B Mls Jok Kulit;Hub 0815 4048651 Kjg Sper Astra NCH Long Th ’91 AC VR RT Mls S.pake 0853 78755960


Jual Kijang Super Th 89;Hub 081541455783 Kjg LX 03 Biru Met VRBR PWPS Rmt CD;081279439654/ 0815415555393 Kjg Astra 88 B AC PS RT Mdf Grand Tgn I Mls BU 37.3jt Ng; 081369976202 Rush ’08 Type s W.Hitan Km 40Rb Hrg 171 Ng Hub: 0821 73650566 Toyota Avanza ’07 silver Type G hrg Ngo Hb: 08127906520 Inova Type G 2005 Warna Hitam Berminat Hub 08117 207686 Kjg Spr 88 BE 6spd 5 Pnt H 33jt;Hub 081279647423 Twincam 1.3 Th 90 Biru Tua Hrg 38.5jt Ng;Hub 081278902150 Toyota Kijng Pick Up Th ’93 BE Pjk Bln 1 Hub: 082180352377 Avanza G 05 Gold B Met Mls Hrg 105jt;Hub 081272552423 LGX 2.0 EFi 2001 B Silver Mobil Bagus; 0811792058 Bisa TT Mobil Lancer Evo IV SEi ’00,Silver, Go od Condition,Hb:0815 4107 3030 Krista Solar 99 Akhir BE Kdy Orsinil Luar Dlm;Hub 085378 755331 TP Kjg Pick Up 1991 Wrn Hitam BE Mulus;Hub 081279107511 Inova Tipe G 05 Slvr Plt B Tgn 1 Mls Orsnl L/D 155 Jt Ng 0821 36743737 Starlet Th 87 1.3 BE Mulus Siap Pakai;Hub 081272707065 Kijang Pick Up ’04, Plt Kdy,Hrg Nego Hub. 081369483200/0821 83426999 Rush G 08 Akhir Tgn I BE Hitam Met Jok 3 Ssn;Kjg 89 BE;0812 7204534

Inova G 06 Hitam Bagus Mulus Full Variasi TV CD;Hub 08576 8477500 Avanza ’08 Tgn 1 28 x 3.8Jt Km 57Rb DP 49Jt Hb: 0815 408 79169

SOHC 96/97 Coklat Muda Met alik 38 Jt/Ng 9966961/ 08789 9148800 DOHC 97 Orsinil Tgn I dr Baru Biru Met PW CL AC Dingin B Bs Pnjm KTP Nego;Hub 081977 760604 Timor Dohc ’99 Plat BE Msn + Body Mulus Memuaskan Hub: 082183519485 Timor DOHC ’00 Mrah AC,TIP Brg Mls L/D S.Pakai 32Jt Ngo Hb : 081369649260 Timor ’98 Sohc BE kodya Ors Biru Met Pakai sendri TP 43Jt Hub: 350013 / 085769644305 SOHC 99 Gold PWPS Body Mls Pemakai AC Tape Msn Kering 41jt; 081379319991 SOHC 96 BE Kdy Pribadi AC Dgn VRBR Mls Siap Pake;0853 66802121 Bs TT Mtr


Djual Rmh LUX Citra Garden C1 No.182.5 Lntai 5KT + Kmr Mndi d dlm + AC 1 Ruang Kerja, 1 Kmr Pmbantu 1 Gdg 2Kmr Mndi D luar Garsi 2 Mbil Lt 437 LB 499m2 Hub: 081272866682 Djual Rmh Jl.Agathis TA 3/9 Way Halim Permai ( WHP) LT/ LB 176m2 / 150m2, 2Lt, KT 5, KM 3, SHM 375Jt Ngo Hub: 082 137755788 / 0721-7471011 / 07217324607 Rmh / Tnh (SHM)LT.459m, LB 180m, KT5,1KM, Jl.Nusa Indah Gg Bunga Mayang 19 Enggal BL Hub: 0812-79207029 / 07:0017:00 (TP) Dijual Bedeng 5 Pintu SHM LT 274m2, gg Delma I Kp.Baru Hrg 165Jt Hub Agus 081369617640 / 085211238184 Blkg Polsek Kdton. Djual Rmh Jl. Nada Lestari C3 No.12 A Perum Wana Asri Brgin Raya kmiling LT 185m2, 3KT, 2Km, 1 Gdg Hub: 08218 0481103 Djual Rmh Baru/Lux LT/LB.135/ 58 2KT Bsr List 1300 Jetpump 30m Jl.Nusantara-Pujangga Alam Garden C1 No.4 Kdton B.Lpg Djual RMH SHM LT 132, 2+1KT, 2Km,RT,RK,RM, Dapur S.BOr + Pam 2200Wat, Puri WayHalim DD25, Tlp 9622760 Djual Cpt Rmh LT.290/LB.199 m2 SHM 3KT RT KM Dpr Garasi Jl.Dr.Sutomo (Dkt SD 5 Penen gahan) Bdl,Nego;Hb 707560 Djl Cpt: LB/LT74/120,Jl. ZA Pgr Alam,Prm Bumi Puspa Kencana Blkg S2 UBL,AC, Cnopi,Tmn+ Kolam,Scrty 24J,285jt.9911242

Over Kontrak Rumah Makan Yng Sdg Beroprsi Di 2 Tempat Brikut Isinya Tmpt Strtgis Hub: 0811725892

RUMAH DIJUAL Jual Rmh Mwh/Lux LT 320/LB 242 M2,3KT, Lt.Krmik List 2200w Air PAM AC Hordeng ,Jl.Pramuka Gg.Alpukat No.12 Kel.Sumberejo,Kmling;Hub 082180775857- 081379716171 RmhSHM Lt. 266 m2 / 200 m2 5 km, 2 kmd gudang, garasi Jl. Emir Noer no. 2 TelukBetung harga nego hb. 081316 822844/ 0721 7544559/ 0813 69200888 Djual Rmh D Jl. Ratu Di balau 96 Cempaka 3 Tj seneng LT/LB 554/225 Bangunan Baru Arsitek tur Kuno Klasik Modern 3KT,1 KT.Utama, 3KM, hlmn Parkir Luas List 1300Wt, Jet Pump, Bor ada Kolam Liat pasti Ter tarik Hrg Ngo BU Hub:0853 81146888 / 085769566223 Hrg Heboh!! Mnydiakn Rmh Hrg Mrh&Trjngkau.Bngunan Bata Mrh&Full Krmk.List&Air dsdiakn. Tp.28 Lt.90, Tp.36 Lt.100, Tp.36 + Lt.130. Prum Ng Skti Prsda Jl. Sri mulyo; 081119 00913/7359371 BU Jual Rmh Baru Real Estat T.60 LT 136m,SHM Hook Perum Griya Sjhtera Blok N 18 Msh Ssa Tnh smping H 179Ng Gg PU gar alam / Lbuhan ratu 0821838 9594 Djual Rmh mwah LT300m, LB300 2Lt Atap Bton rgka Bja ksen pntu Mrbo Lntai Granit Pmnas Air, 5 KT,5KM, Grasi 2 Mbil, Hlmn Luas Pnmpiln mena wan hub lok sui 081379450678


Waahhh sudah laku!!!


Carnival Bensin Matic Th 02 Bln 9 (B) Abu2 Met TV Jok Klt 70jt Ng; 085279922345 Carnival’00,B,Silver Ori L/ D,PS, S.Pkai,60jt Ng 081272 49699-081977118000 Karnival 01 Diesel Turbo Matic 7 Seat Klt PWPS Abs Airbag TV DVD; 082180798280 Visto Th 2001 Plat B Kuning Mulus AC RT PWPS Hrg 52jt; 0811793882 /7464885 Timor 02 DOHC BE Kdy VRBR AC CD Trwt Siap Pake;Hub 085269039888 Carnval GS,01 limtd gold,Dp. 25jt ng,ang.1.930rbx35, 08526 95 3775 bs tt mbl TIMOR

DOHC 97 BE Hiu Btl Bkn Ex.Taxi AC VRBR RT CL Bd Klg Cat Mls S.Pki; 081369962010 Timor Th’97,BE kdy,htm,snd,jok mbtech,vr 15,mhl trwt,lht psti ska,081272407744 Timor Th ’96 SOHC Hitam BE Kod ya Pajak Baru Hub: 0721-3627542 Timor DOHC ’00,BE,Hijau Met,H.45jt Ng,0721-7316057 SOHC 97 W.Putih VR15 CD Audio Rmt Enak Dpkai Cpt Dpt;7494567

Dijual Nissan Terano Kings Road BE Th,02 Gres 08218 3661177 Livina XR Matic 08 Abu2 Plt B Low KM 138jt;Hub 0811798339 Grand Road XT ’99 Biru Tua Plat B 105Jt Hub: 081388 274034

G. LIVINA 1.5 XV 07 BE kdy, Ma nual Asuransi Service Record Nisan Audio Full Ori 7494567 Nissan Xtrail 2.0 Manual Tahun 2008 bulan 8, BE pilihan, tangan 1, Abu-abu tua metalik, harga 225 jt, TDP 52,2 jt angsuran 6,285 ,000 x 35 hubungin Bi ntang Berlian Motor 081369777704. G.Livina XV 1.8 MT 08 Htm BE Tgn I Pjk Pjg Jmn Ori T.Kcw S.Pk 150jt Hdiah Lsg T.Diundi; Utomo MOTOR 9017070 Livina XR MT 08 Slvr BE Tgn I Pjk Br Allrisk J.Klt Jmn T.Kcw S.Pk 135jt;Utomo MOTOR 901 7070 Xtrail 03 AT PLat B Silverstone Jok Klt Mls;Hub 085279697722 Info Nissan Br/2Nd Livina, Xtrail, March Dp.10% Bng Rdh, Cpt Hrg Mngkt Hb.MIRZA 7410333- 08127975725

T.Vios th’04 kmbli Dp.60jt 22bln, Terano Kingroad th’02 kmbli Dp.60JT 29bln .Opel Blazer Montera dp.17,5 jt 31bln .hub. 081213751999 Nissan Terrano King Road K1 New Hitam BE No Cntik Kodya Ban Bru 170Jt Ng Hub: Toko Rolla nd 08117200132 / 081540 37232 Terrano Kingsroad F2 ’02 Plat B Pjk Agsts W.Hitam slver Met Kndsi Bgs Hub: 08163290701 / 08154180691 Djual Grand Livina 1.5XV ’07 Slver gold Tgn 1 Hub: 07217449595 / 081373143036 X-tril ’04 matic Abu2 Met Pjk Bru 03-2012 Mls Ors Ngo, Gress s.Pakai 082175778822 Livina XR,AT,Th’08,Grey,Plat B,Sprt Br,Km 40km,Pjk 1th,H. 136jt,Hb:7470524 0811726508 Grand Livina XV ’08 BE orange Met Servce Dealer Hid Ori 148Jt Ngo 7171666 Grand Livina 1.5 SV Th 2007 Kuning Md Met Mls Terawat Jual Cpt 135jt Ng; 08127978296 Nissan Livina X-Gear ’08 BE slver Velg 17 Jok Klt An Sdri Jrg pkai Hrg 155Jt Hb: 081369 091970 Terano Spirit 200I,B,htm,ac, rt,vr, br,pw,ps,rmt,ban serep gendng,114jt ng,0721-7461110 Grand Livina 1.5 XV 08 Mnl Silverstone BE Kdy Tgn I KM 27rb Jl Cpt Ng; 0811794020 Livina 15,xv,mnual’07,be kd,tv lyr snth,adio sys,rwtn nisssa,ful orsl,081379777707 Djual X-tril ’04 Silver Met full Ori AT Nego Hub: 7478182 / 08576 8503599 Terrano Spirit th ’01 Siver plat B Kndsi Mls 081540992999

Djual cepat 2 Unit rumah & 1 unit Rmh kost fasilitas AC, List 4400W, sumur Bor Jl.Pemuda Gg Twini No.5 Tj. Karang Pusat TP, 0811722442 BU LT /LB 2000m/350 Sertfkt IMB Ngo Lok Pggr Jln Dipone goro Skd Lamtim ( 081379 503298 / 081957166246) Komp.Citra Prsd M3 Jl.H.Agus Salim,, Lt/Lb.180/165,4KT,2KM, S.Bor;7469946-0811728250 Rmh LT.157,5KT,2KM,SHM ,DiblkgSate Cakumar Enggl, 600jt Ng 085888377023 Djual Rmh Mnmlis LT 259 LB 165 2Lt Grsi Pnmpilm Cntik H 400Jt Ng Prm Gr Sjhtera Blk M 5 Gg P.Alam Hub: 08136969 9186 Djual Rmh Komp, Jaya Permai C-15, Jl. P. Mrotai B.lmpung Lt 150 Lb 100 3 Kt dpan lap. Tennis Hb;081379358133 Djual Cpt Perum Bukit Kencana Blok FF No.5 LT 126M,LB 80m Hrg 340jt Ng ;085279213533 Rumh Djual LT/LB 530/180m, SHM , Jl. Kapten Abdul Haq Rj. Basa Dkt Pull Damri Hrg Ng 085378775909 Rmh+Isinya di Dpn Psr Tugu, Tmpt Strategis;Hub 0813694 44412/ 0721.485325 Rmh Ls.182m2,KT5,KM2 di Jl. Kijang, Kedaton B.Lpg,Hrg Nego;Hb 0721.3532709 Dijual Rumah Kontrakan 2 Pintu Jl.Antasari Gg.Manunggal Blkg BankMandiri;Hb0812791 53555 BU LT/LB 174m2/139m2 900 watt Prumnas Jsp Blok K I Metro Ngo 081379503298 / 081957 166246

Rmh SHM LT/LB 1465/400 Jl.Way Umpu 1 Pahoman Strte gis;Hb 08129401382/081614 86158 TP Rmh Jl.Tangkuban Perahu Gg. Papandayan 4KT,2KM,Cck u/ Kosan ;081369702000 Rumah D Villa Bukit Tirtayasa b2 No.11 LT 236m, LB 180m, SHM Ngo Hb: 0721-7507277 Rmh SHM LT LB 600/120m2 4KT,2KM, Jl.Urip Sumharjo H 400Jt Hub: 085811417181 ( BENNY) DIJUAL RMH TYPE 50 LT.120 DI BKP HANYA 100JT SAJA HUB.081379044331 Hook B/T.100/170 4KT+AC 2KM Grs, Bkt Ry Estate E24 Jl.R.Pemuka/Urip S; 9938755 Djual Rmh LT 200M,Lb 69m, Jl.Imam Bonjol gg Madu 70Jt Ng 081279722925 Rmh Lok.Strtgs Prum Kaliawi Indh LT/LB 95/65 Hrg 160JtNgo Hub: 085279606878 3RMH Dlm 1Hlmn,LT+/-450, 18KT, 8KM, Strtgs,H 2M Ng 0858 88377023/ 085269054499 Rmh Jl.Darussalam Gg.Langg ar 65 Lkpura Kmlng 85jt TP; 085366152555/ 087899516555 Komp.Wismamas Blok D3 No. 1/LT/LB 162/60 (hook) 2 LT Strategis , 250Jt Nego HUb. 0852 69201990 Rmh Bumi Puspa Kencana A16,Blkg MM UBL Type 54,Ph 081273167368 Djual Rmh Bkt Kencana 2 Blok ii No.18 Hrg Ngo Hb: 0852 73920888

Dijual Rumah Villa Citra 2 R1/ 23;Hub 085273133333 No SMS


Peugeot 306 Th ’97 BE Hitam 31Jt Ng 0721-7559687 OPEL

BU Sedan Optima 1.8cc DOHC 96 Biru Tosca F.Orsnl Mulus AC Velg 16 CD Komplt S.Pki Hrg Damai;0721.7550273 Pki Sndiri Optima 1.8 Th 98 Biru DP 17jt Ng Ang.10.80rbx23;08526 952 3775 Bs TT Mbl NISSAN


Hyundai Elantr’96 bln 12,BE, ungu met,snd systm l/d,orsnl, 37jt ng,081279054444 Djual Hyundai Elantra W.Ungu Hrg 38Jt Ngo Hub: 0813 69188268 JEEP

Grand Cherokee 4.7 V8 Quadra Drive Th 2001 Hitam Met Sun roof Jok Klt VKool Tndk Dpn Footstep Pjk Pnjg Hrg 190jt;Hub 08197903339 Jual Jeep Cherokeee Th ’99 4x4 Manul slver CC 2.5 BE Kdy AC,PS, mls L/D Full Modif Hrg 118Jt 085669902866 Jeep Cheroke Th ’99 4 x 4 Manual Htm Cc 2.5 BE Kodya AC PS BS Sound Mls L/D Hrg 122Jt Ngo 085768026488 Jual Jeep Cherokee th’99,4x4 mnuAl Hju CC 2,5 BE Kdy An Sndri AC PS BS Sond Mls L/D Hrg 137 jt Ng 081541545454081272172142 Nissan patrol 4 x 4 T ’80 Akhir W.merah Full Modifikasi 0878 99607444 Jeep Willys Th 51 Mesin T. Kijang 3K (irit) Hrg 28jt Nego; Hub 081379640000 OVER KREDIT

Over Crdt Phnter Grand Touring Turbo Th ’10 Angsran / Bln 3.370.250 Slma Sudah Berjaln 9Bln Km 13000 Hub: 081396 455682

RUMAH DIKONTRAKKAN RUMAH disewakan jl. P.Anta sari-Kalibalok bandar lampung, rmh tingkat, baru, 3km+km/wc didlm-bukit kencana Estate blok D/18 dpn lap. tenis- hrg 25 jt / thn hub: 0721 999 5000- 0811 720 9600 Rmh Dsewakn 2KM/KM/WC di Bukit Kencana Estate Blok E1H Dpn Lalp.Tenis,Hrg 27jt/2th, Aman& Strtgis,Jl.P. Antasari, Kali balok B.Lpg;Hub 0721. 9995000 RUKO

Dsewakan Ruko Lt.2+3 (Pnt Sndri) Lokasi Strtgis,Parkir Luas, Aman,Jl.Jend.Sudirman No .96 (DISTROMIX) Enggal, Dpn KFC Gelael;Hub 0721. 9995000/7529600 TP Djual ruko 3 Lnati Lt 117m2, Jl MH Thamrin No.82 Gtg royong hrg 700Jt Ngo Bs 3 X angsuran 081927917403 / 07212846988 Tk 2 Pnt LT.300/LB.200m2 Jl.Urip S No.49 Bdl (Saat Ini Sdg Dsw Indmart s/d Okt’11) 850jt Ng Bs Dccl;7592022/ 08128 3621756 No SMS Jl.P.Tirtayasa 50m Dr Lmp Mrh Kalibalok-By Pass Lb.4x15, SH M,Hub.08127224664 Hrg Ng,TP Djual Cpt Ruko 10x17 Lok. Strtgis Hdp Timur Jl.Kartini;Hub 08161858962/087883299372 Dkontrkan Ruko 2Lt Brkt Rmh Dblkg PAM, Tlp,Lis Jl.PEM,NUR No. 228 Bdl hub: 484266 481196

Avanza G 1300 slver th ’09 DP 70Jt Ngo Angsuran 16bln x 5.070Rb Hub: 085279999736 / 085279999650 Suzuki Baleno Th ’97 Komplit BE kodya Plg DP 30JT Ngo Angsran 2Jt x 30Bln Hub: 0812 72587734 H.Verna 01 Akhr Merah Mls F.Ori Tp CL Rmt PW DP 30jt, Angs 1.684rbx25; 0852693 23070 Avanza S 07 BE Aqua Blue DP 45jt Angs 3.2jtx30 Bln Mbl Bgs;Hb 081274509966 BENGKEL MOBIL

NEW STAR AUTO Pengerjaan Standar Dealer Menerima Service Mobil Eropa,Jepang, Korea. O/H Engine, C.Lock,P. Window, Ganti Oli, AC, Persenelling ,Gardan, Sparepart, Komputer Diag nosis,Alamat Jl Mr Gele Harun No.10 R.Laut Pahoman; Telp.263959,email:starauto10, Emergency Call: 081541515000 (Home Service) ANGKOT

T120SS Th 2005 Teluk,Futura 04 W.Halim;Hub 081369497456 MOBIL DIJUAL

Espass P.Up’02 32jt/05 42jt/ Carry Box 1.0’06 56jt/LGX’97 93jt/Panther Ryl 2000 69jt;0812 7922541 Heru Tj.Senang Engkel Box Tyt ’06 BE TDP 39Jt Angs 3.990Rb / Carry Box 1.0 Th ’06 TDP 8.9Jt Angs 1.955Rb 0812-7922541 Tj,seneng Daihatsu ’07 Xenia Xi Family, BE Silver log Lamp Elect Mirror 112Jt Hub: 0811796507 Jual Salah 1 Mbl Charade Th 81 dan Corolla Th 79;Hub 0721 9360471

Dkntrkn Ruko Wsma Mas Kmling Hook, sgt strtegis Hb: 0811791120 / 261907 TANAH

TNH SHM 800 ML Pemukiman STRGS Jl. Dr. Setia Budi Gg. Sunda Pondasi Kll jln. Aspal B.Lampung No. 0812 72183006 Hg 275 m2 0812 72331126 Jl Cpt Tnh Ls. + 470 M, SHM, Di P. Damar gg. Mangga ( Dpn Ktr Lurah Perum Way Kandis) Hub. 0721-7445161 Tnh 300m/45jt,540m/50jt: 11700m/300rb/m,3676777/ 081933552777 No SMS Djual Tnh Ls 280m, Skt Jl. Za. Pagar Alam Depan Tribun Hub: 0811728366 / 3666738 Tnh DJual L.500m2 di Suka bumi Samping Perum Nusan tara;Hub 081279699992 Tnh Ls 120m, SHM Jl. Morotai ( Blk Rs Medika Klga ) Hub: Karel Hb: 0721-3675100 ( TP ) Tnh Murah SHM 200m 23jt, 455m 60jt,BLPP Hj.Mena 3450 m 45jt Branti; Hb 085369646480 METRO Djual Tnh Lok Strtegis Jl.Jend sdrman Dkt Pom Bensin G.Agung Uk 19 x 56 Hub: 0811797422 Djual Tnh ls 6300m2,Dkomplek Btrnilla Bdl,Ls 15Rb m2, D Jl, Ngra Bandar Jaya Lampung Tengah SHM Ngo Hb: 702764 / 0811722994 TP Tanah SHM Luas 11600 M2 Letak Jl.Lintas Sumatera (Sam ping Bengkel Baleno) Kalian da;Hub Telp. 0821 83035569

L300 PU 06 Ng,Futura PU 08 Ng, Camry MB 97 23jt Ng; 081369248441 VW

VW Safari Th ’78 W.Coklt Plat BE Ori Hub: 0721-7539288

SPARE PART KENDARAAN Djual Pelk Impor + ban 22 in, Kond 95% Shock Raching Bilt Stine + Per Lampu Rem Smoke Kusus Fortuner 0811722537 MOBIL PENGANTIN

Dswkn Mbl Mercy New Eyes W.Silver,Dpt Disewa Harian. Minat Hub.0721-7361700/0811 728117 MOBIL DI CARI

P.Up,Engkel,MB,Sedan Th 8002,Trm Alat2 Kntr Bks;081279 22541 HERU (Bgs/Rusak)

TOUR & TRAVEL Jie Tour & Travel menawarkan segala kebutuhan perjalanan Anda, termasuk tiket domestik dan luar negeri, paket liburan, paket kapal pesiar, voucher hotel, asuransi perjalanan dan men yewakan Bus pariwisata. Jl.Arif Rahman Hakim Tr-9 Way Halim, Ban dar Lampung. Telp. 0721 7822 67,3530711. 085279 420456

MOBIL DISEWAKAN OBRAL GILA! Swa Avz/Xen 199rb (Mar-April) Tour Puncak 674rb, Bdra 100rb, P-Up, Inv, sdn pengantin lkp-Mrh! Hub. 7344447-7364050 ALFAN RENT Car Mnywkn Avanza, Kjg,Inova, Xenia, 7525657-081369705657 RINNIE Rental Inova,Avanza, Xenia, APV, Sdan Pngntin 2003;Hb.7470530/08127930144 `

Jual Tnh Kav SHM Dg Vr Krdt / Di Angsr +/- 1 km Dr Kmpus IAIN 1 Km, Dr Perum Indah Sejahtera Hb: 07213690775 / 08217 6863111 Jual Tnh +/- 1900m, Jl.Rajawali Simpang SMP N 5 Cndi Mas Pggr Jln, AJB 150Jt Ngo Hub: 082176801826 Dijual Tnh SHM Ls.+/-8000m Cck utk Prumhn diJl.Z.A Pgr Alam Hub.081279793834 Djula Cpt Sbdg tanah SHM Raja Basa Hrg 300Rb / m, Hub: 0899 8873491 / 081369352310 Djual Cpt Tnh Ls.3550m2 (SHM) Jl.Hajimena Pgir Jln, Ccku/Showrrom; 782694 Dijual Tnh L.586m Rp.55jt, belakang brimob merak batinsukamaju,sertfkt prs blk nma, Hub: 087899601984 Jual Tnh Ls 1253M2, SHM Dkt Kntor Cmt Tj Seneng 200Rb/m2 Hub: 08127930144 / 7470530 Dijual Tnh Ls.774 m2 SHM Jl.Palapa gg.Sebri Said Lab. Ratu Lok.u/Kos2n;Hb 254377 JL.Tirtayasa (blkg Perum Nus antara Permai) Luas;240 m2. (SH M) Hrg.45jt.Ng BU, Hub .7177500


KOS-KOSAN Trm Kos2an Khs Wnt(krywt/ mhsswi) Jl. Imam Bonjol No. 117 Hb. 082183236666

ARLENDI CAR Mnyewakn Avan za,Kjg,Inova,Xenia 0812 79085447-0857683629793628797 LKP & MEWAH Alprd,Camry, Frtuner, Pajero,Dble Cabin ,Inov,Avnz,MBL PENGANTIN 081369695051 JONI NIAGA RENTAL Inova, Avanza,Xenia, Camry ,Altis, Alphard Hb: 0721-74037007692086 / 08127264905 MAFATHORA RENTAL SW MBL KJG SPER ’99 P.STEET AC DGN / HR 125RB HR/ANG 1BLN +/ TNP SPIR HB: 7486381 / 0815-19028550 OTO RENTCAR Xenia/Avanza/ Inova/ CRV, Tarif Murah,Syarat Mudah Call 7301153-241241 MOROTAI RENTAl CAR Inova (Dsl) Avnsa, Apv, Extrada 07217444382 / 081272035341-0815 4010341 Anugrah Rent Car sewa Innova Terbru avanza Terbaru Hb: 0812 7970176 / 0721-7462916 PERDANA RENT CAR Inova .Avnz,Xen,Bln/Mggu/Hrian Call : 7377246/081369100243 ###SANJAYA RENT CAR #### INnova Diesel - Avanza 08127 2521918 / 0721-7422048 PUTRI RENTAL Sewa Kjg 04 ,Avanza 07, Innova 07;Hub 786 074-706332-08136922 8648 Paris Wisata Rent Car Inova, Avanza, Kj, Kpsul,Xenia 74 74015/ 08127901658 RINNIE Rental Inova,Avanza, Xenia, APV, Sdan Pngntin 2003-;Hb.7470530/08127930144 BINTANG OPTIMA RENTCAR Terima Titipan Mbl Sistem Bagi Hasil 0721-3697283 Mobil Pngantin Mercy Volvo freed Zafira Hub: 082183 519485

TANAH & BANGUNAN Jual Cpt Gdg Walet Tlah Isi srg Walet Uk. 12x12x3Lt Rmh Tggl Uk 100m, Kbn Jmbu Citra LT 2579m, Pgr Kllg Skmaju Prapau Kt Bumi Lamp-Utara Hrg Ng Hb: 081379288809

OVER KREDIT Over Kredit Rumah LT/LB.36/84 Tanjung Raya Permai Blok R No.14;Hub 082183035569 Over Kredit Rmh di Perumahan Permata Asri Karang Anyar Tp 21;Hub 081379801976








Jual Printer plotter epson R7880 0721-9956400 Murah !! Pentium 4 + Mon 15" = 700 CPU Petium 4=500 Hub: 7539580

Kunir Putih&Benalu Teh Efktif Hancurkan Layukan Kanker ,Tumor Rahim,Benjoln,Payu Dara, Miom,Kista S/D Akrna & Trbkti Khsiatnya Prod CV Tugu Bntang Skti Jogja 0274.6532200 Lam pung 0721.704564-9981060

Resin, Mat, Katalis, Airosil, Cobalt, talk, Miror, Pigman, Dll. ecer an / partai Bsr Hub: RAMA SWARA 0721251652

Aspal Pertamina Cilacap, 60 / 70 Shell Esso Hrg Besaing Dswakan Wall 810ton Ph 0811 722075 / 0721-7474171

WALLPAPER Wallpaper & Flooring Parket, Motif Terbru + Hrg Promo Tlp 0721-3640208 / 081279191991 Motif Baru Minimalis & anak CITRA INT 482435 Laks, Malh ayti 26 T.Betung

CCTV CV Karya Jaya Security Specialist CCTV Camera Trm Pmsngan D/L Kt, Brgrnsi;Hub 0721.257 209/ 081279131444 www. lam Jual + pasang kamera CCTV murah Grnsi 1 Th, Hub: MEGA SECURE 0721-3660745

COMPUTER JUAL KOMPUTER MURAH BERKWALITASHRG DUAL CORE 2 jtan s.d 2.3 JT, LCD SECOND 500 RB s./d 600 RB Bisa Nego, PRINTER LASER HP 8150 PS A3 , 5000 PS, HUB. 082177299377 Bursa Laptop Second,Sedia Brbgai Merk Laptop 2nd,Kwlits Trjmin Hrg Bersaing,Buktikan Hb 081379270000/0721.717373 Jual Lisinsi Geunine Kaspersky key (KIS) brlaku slm 1th/PC grnsi uang kmbali.h.100.000 hub 08127271339 Dijual Beberapa Unit Komputer & Peralatan Warnet;Hub 0812 72225656



Hburn Bdt Tunas Jy Bdut, Spngbob, Petrik,Hrg Dr 150Rb Mc,Dkor;7505935 /0812 7932 2335

Blackberry termurah selampung dan bergaransi 2 tahunONYX 9780 Black 4.425.000, Onyx 9780 White 4.450.000Onyx 9700 White 4.050.000, Torch Pearl, Curve, Gemini, Storm, odin Hub. 0852 69658480 Kami Menawarkn HP Asli Onyx (1,7),Torch(2jt),Storm(1,4),Bold (1,5), Jvln(1,3),iphone4(3jt) ,ipho ne3Gs (2,5jt),N900& N97 (1,5) ,E90(1,4),X6,E75 E72(1jt); Hb08 5217444577/ 087777 789327


BARANG BEKAS 8 Set Meja Kursi Jati,Freezer, Kulkas ,Perangkat & Perleng kapan Dapur/Masak,Nego;Hub 081272537777

ANDA BUTUH DANA CEPAT Leasing Resmi Pnglmn 28 Tahun tnp Komisi Fee Showroom, Jami nan BPKB (Mbl/Mtr) Bs Yg Msh Kre dit (khusus mobil) Hub. : 0721-7544559/ 081977188088/ 081369200888

PINJAMAN MODAL CEPAT Leasing Resmi Penglmn 28 th Tnp Komisi Free Showroom, Jami nan BPKB Mobil/ Motor Bs Yg Masih Kredit Khusus Mobil Hub. 0721 - 7316894, 0812 7377748

PRODUK KEBERSIHAN Jual Curah & Hrg Mrh Dtrjen Bubuk Matic/Busa, Dterjen Cair,Pel Lntai, Kr bol,Shampoo Mbl/Mtr,SemirBan, Sof tener Pkaian,CcI Piring, Handsoap, Pmbrsih Kc/Kerak/Krat, Cai ranUtk Ccian Anti Bkteri/Virus/ Kuman dll;081272005999 (Trima Agen)

ARSITEKTUR Smart Studio Mnerima Desain & Bangun : Rumah Tinggal, Ru ko,Kantor,skolah 2D,3D Dan RAB Hub; 081379701767 tarif Ngo OASE ASITEKTUR Rncng Bgn/ Renov,Rmh Tinggl,ktr,Ruko, Kolam,Tman,Hb:081272 634488 OASE ARSITEK Rancang/Bgun Rumah, Kntr,Taman dsb; 741 0369 /081272634488 GDesign Arstektur,Prncngn bgnn,Renov rmh,ruko&Kntr Hb: 0721-9959906 / 082180521165

AHLI GIGI AWIE AHLI BIKIN GIGI Psg Kwt Gigi,Trm Pggln Jl.Diponegoro Dkt Lmp Mrh S.Batu Tebet Cab. Dpn Psr Kota Krg;08123 4818793-081369 204677

BIRO JASA Biro Jasa WINS JAYA Meng urus SIM, STNK, dll, Hub. 07213523003 WIDI MANDIRI Prvt Mngemudi Antar Jmput+Brhdiah Urus STNK se Indone sia,SIM, KIR, SIUP, Pasport. Jl. P. Morotai No. 1A/B782999-085369 430088 Jasa Ukur Tanah Uk. LT mm bentuk Dan Mnentukan Kavling Steplan Prmhan Dll 07217628289

INTERIOR Galerry Interior Mmbuat Kitcen Set, Bedroom TV Set,Dinning Ro om, Office space,Wardr obe, Sofa Baru 7 Perbaikan Dll, Wor kshop Jl Imam Bonjol No. 140 Bdl Tlp : 07217561603 / 081279141900 LIGHTHOUSE INTERIOR Mnrma Pemsnan Pengerjaan Interior Bedroom set, Living Room, Kthcn Set, Intrior Kntor, Toko, Ruko Dll Tlp : 081218 859080 / 081311335995

KURSUS BINGUNG ANAKKU nilainya ANJLOK & tdk ada wkt ngajari? JGN BINGUNG! TEKNOS Jl. Tha mrin G.Royong 35 tlp. 2644 84 / 9719700 Bimbel-Privat-TKSD-SMP smua pljrn Prvt BINTANG EDUCATION smw pljrn TK,SD,SMP,SMA, UMUM,MGJI, Gr dtg Krumh Prfsional & sabar Hb: 3667558 / 081369277269 , siap UN,UAS Privat Purple-Bhs Inggris, Bim bel,1 kls maks.4org,Free Kn sults Pn gembngnAnk, Brk wa li ts,73 26611/081379668 608,terbatas Privat Anisa, Mengaji Bc Tulis Mipa, B,Inggrs IPS, Gr wnta 085 669762054 / 3633033 Rumh Bljar & Privat all study T.Umar 20x pertmuan 100 Rb hb: 789759 / 3661203 Privat Piano / Keyboard Guru dtg Ke Rumah Hub: David 7530201 Privat SUPRA Semua Pljrn & Mengaji CP.0721-716 1010

HEWAN Anjing Kecil Chihuahua Wrn Unik Stmbn & surat 0813 69600098

MUSIK RAMA SWARA MSK. Jl.Dr. Harun 67 Ktbr Bdl, 2516520811792034, Dstrbtr Alt Msk& Sound dg hrg Bsaing,Corg , I b a n e z , Vo x , Ta m a , C o r t , Yamaha ,Marshal,GK ,Rockwell ,Rusell, Cora,Rolnd,Belceat, Axl,Acr, Sountech,Maxtne ,Mac kie,Behringer, Beta3,Sound crest,Hupper,Pwr Art, Prowl, Roxy Jbl,BMB,Evans,Alt Drum bnd.SparePart,&Trm servce Jual Sound Systm confrence, portable Wirlelss Toa 3200,alt Karoeke&Sound Untk Meeting, seminar,Restrn,Greja,Aparte mn,Hotel,Kntr, Hall,Mall,Masjd, Band,Skolh,Kmpn ye,Pmilu, Plkda,Orasi Dll,Bs Krm/psng Se-Indnsia Tlp Kmi : 0721-2679 15/081310415106

ALUMINIUM Mitra Spesialis Kusen,Pintu ,Almn, Partisi, Kaca,Rolling Door ,Folding Gate dll,Jl.Sam Ratulangi No.33A Murah & Brgaransi; 07217477282/ 0813 79200333 TK.KARYA MURNI Jual Rel Hordeng, Rak Al,Partisi ,Expan da,Etalase,Awning, Kusen, Canopi, Jl. T. UmarPsrKoga No.2Kdtn782601Fax788520 Indoalminium,Partisi,Kusen,Pntu Kc,Jndla,Jl.Antsari No.133H Hb: 7148009 / 251158

SALON SARAH Salon Melayani Body Massage Lulur Traditional, Facial dll Ladies Gens Jl. P. Anta sari Gg Hj Tobari 7367676 / 081977900120

PELUANG USAHA Peluang Usaha dan Mudah. Ingin Buka Usaha Laundry Kiloan dengan Modal Kecil + Pendapatan Sampingan Pra ktek Langsung Hub. Syah Laoun dry Telp. 0721 3640143 HP. 0852 79161980 Pltihan Ush Laundry 100% Prktek Kiloan & Dry Clean ,Sdia Dterjen, Plmbut,Pewangi,Anti Noda,Pmutih, Luntur dll,Khusus Laundry;Hub De Fortuna Laundry 081272005999 Peluang Usaha ONLINE Wan ita Web GRATIS,Dpt Jutaan/Bln Dgn 2.6jt Dptkan Income Rp. 90jt Dlm Hitungan Bln,Hub Yuli 085269029787

HANPHONE Blackberry termurah selam pung dan bergaransi 2 tahun ONYX 9780 Black 4.425.000, Onyx 9780 White 4.450.000O nyx 9700 White 4.050.000, Torch Pearl, Curve, Gemini, Sto rm, odin Hub. 0852 69658480

ACRYLIC MKMUR JAYA ALUMNIUM, Sedia Acrylic Bening&Klsiboard tb 6 Jl.P. Antsari No,154 Tlp 7148009

FOTOCOPY Toko “POLIM” Jl.P.Emir M Noor Blok B No.10 T.Krg-Bdl Tlp 0721-7443777 , 081379671777 Mnjual msn Photocpy Mrk CA NON sparepart Rntal & Teknisi PASADENA Fotocopy BESAR, Scan-Print PETA, fc WARNA, PLOT dari cd & flashdisk, reka lkir, blue print. Jl.Katamso 25 Tlp.267489 T.Krg-Bdl Jual Msn F.Cp Canon Tp IR 6000, 5000,5070,5570,NP 60 50,6045, Sprpart,Grnsi ;0812 79644026/ 0721. 3648585 CASH/KRDT

GORDYN Vertical & Horizontal Blinds U/ Kntor & Rumah Citra Jaya 482435 T.Btung Mlhyati

RUPA-RUPA Jl Catridge Original Epson R230 Ada 7 Set 9790000 Jl Arloji 2nd,Tag,Pronto, Bulo va, Seiko Chrono 9790000 Lantai KM anda Hitam Brkerak slt Dbrshkan Dgn Produk Apa pun Jgn Panik Magic Clean Solu sinya lntai Kramik / Porselin Jadi Sperti Baru Kmbali buktikan Sgra Hub: 081253372469

KEHILANGAN 1 STNK R2 BE 8733 DI,No sin: HB61E-1477868,Noka: MH1HB 61178K496433, An.Sutriyani STNK R4 nopol BE 9342EU, NOK A MHMFE74P 5AKO39 659,N O SIN 4D34T-FX0553 AN .M.BUDIMAN STNK BE 2311 Ao, Noka MHF M1BA3JAK265450 nosin DG36 193 an NOVITA HERLANI STNK R2 BE8002 AC, NOKA, MH IJF12147K2281 ,NOSIN .JF1 2E 1232658,AN.Ratumas Aslamiah STNK R2 Nopol.BE.77495 CS ,Nok a/Nosin:MH8BE4DFA 7268 552/E451ID267533. AN.Arwan STNK R2 Nopol.7956YC,Noka/ Nosin:MH1JB91149K615706/ JB91E1613276.AN.Fatma STNK R2 Nopol.BE 3688Y G,Noka/Nosin:NH1JB C11 49K289306/JBC1E1 2909 00.An.raidin.

AIRLINES TIKET TIKET MRH GRDA,SRW JAYA ,BTV,MR.PT.LION AIR ASIA, Tket D.antr Hb: 0721486100 / 7467967 STNK R2 Nopol.6013 YA,Noka/ Nosin:MH8BE4DFA8J645911/ E451ID666631.An.Iiing STNK R2 Nopol be7956 yc,N oka /Nosin:mh1jb9114 9k6 15706/JB91E1613276 An.fatma STNK R2 Nopol.BE7582 YP, Noka/Nosin:MD2JD13 D6ACC06465/JEGBTC15753. An. Bambang

PENGOBATAN OBAT TELAT BULAN, anda Telat Bulan?? Produk Import Untuk telat Bulan aman Dan Bergaransi Hubungi Apotik Sinar Fajar Jl.Ampera 88 B. Tangerang Tlp 081272115788, Garansi Luar Kota,OBAT DIPAKAI BARU DILUNASI Bpk Erwansyah Mngatsi Brba gai Mslh Anda Pngshan,susuk, Pil / Wil, dll. Mngobati Pnykit Mds & Non Mds Hb: 082184 065911 Biaya Se Ikhlasnya BENGKEL SYARAF Mgbti: Vrtgo,Skt Kpl,Skt Pnggng,Asma dll;Hub Dedi 085959888050

PARANORMAL Ingin Jdi Paranormal ?Ckup Stu Hrio Ritual Djmin Anda bs mmliki Brmcam2 Ilmu Lgsg Bs Ngobati Brbgai Pnykit Dan Bs mmbantu Mslh Org Lain Hb: ABI 082183 320666

PIJAT KEBUGARAN Pjat Rflexi Dan Urt Trditional Jl. Pgr Alam ( gg PU) Prum Gria Sjhtera Bi 085368361555 / 085768537118

SEDOT WC Sdot WC & atsi Mmpet 07217400060, 08197973162 Sdh Operasi Cb. Pringsewu

BENGKEL Menjual Bengkel Motor Bserta Isinya Jl.Pejajaran No.Rmh 166 G.Sulah Bdl G.sulah Hrg Bs Nego Hub: 081272415739

INDOVISION & TOP TV / YES TV INDOVISION 349/Top TV 234/ Yes TV 299 Sport Italy & spanyol Hb: 085269882345 / 0721 7352345

FOLDING GATE FOLDING GATE&ROLING DOOR Melayani pembuatan & service folding gate & rolling door, pagar dll Hb.08526 9049494 BINTANG FOLDING GATE khss Trima Psnn Pintu Folding Gate&Harmonika Srt, Jual Bhn Bku Foldinggate, Jl Rya Natar Km 16 No.8A Srimulyo 0721 774905 / 7324732

MESIN BATTERY GENERATOR ( Superior Inverter) Listrik Tng Aki/ kualitas PLN s/d 3.500 Watt unt Emergensi, Stabilizer & Tambah Daya Listrik PLN, Tng Air ( MikroHydro), Tng Surya, Tng Angin & Genset. SMS Nama/ Almt anda ke 0812-80-300-300 Kami Kirim Info

AC Spesialis AC,Bgkar,Pasg, servce, Jual / Beli Secnd HB :Karunia AC 081369550834 / 7147771

ALAT PEMADAM KEBAKARAN Pengadaan & Pengisian Jl.I.Bnjol Griya I.Bonjol Blk A/ No.5 BDL; 260320-260 6260816 411233

LANTAI KAYU Parquet & Lantai Kayu Wrn Type Trbru Mrs Grnsi CITRA INTERIOR Laks. Mlhyti T.B 482435

ALAT BANTU DENGAR OPTIK SENTRAL Menyediakan Alat Bantu Dengar (Import)Hrg Terjangkau, Jl.Pemuda No. 45(Dpn Photo Indah)BDL Tlp .252286

ALAT UKUR TANAH STATION INSTRUMENT Jual Ttl Station,Theodolite, Water pas,Service& Kalibrasi, Peme taan,Topografi dg Total Station;081369120888

KOSMETIK Jual krim pnghilang Bkas Luka Utk Mghlngkan Bks Luka Sperti Cacat Knalpot, Koreng dll, Hrg 150 Rb Hb: 7588829

SERVICE CENTRAL SERVICE,KOMPOR GAS SEMUA MERK, GARANSI 1 TH HB: 0821764240161 Cahaya Servce pggl Klks,Msn Cuci,Frzer,Dispenser,TV,hub: 0721-7506579 Grnsi 6Bln AA Servce Lsg Jadi TV,Klkas, Msn,Cuci, Msn AirKmpter Hub: 0721-9809525 / 082180708967 Surya Servce pggl pompa Air Msn Cuci Kulkas Dispenser Hb: 07217387402 ALIKA SERVICE Pggl Kulkas Frezzer, M. Cuci .P.Air, Dspen ser Hb: 07217534603 ,Garansi

SERVICE AC Anugrah Teknik servce Cuci AC bgkar Psg prbaikan Brgrnsi 0721-475638 / 7599255 Bintang Muda Teknik Mlyani Cuci AC, Bgkar Psg Jual, Secnd / Baru Call 7382013 Cuncun Servce ahli Kulkas AC,Split,msn Cuci Dll. Hb: 7488 505 / 081933581650 Grnsi 5 Bln

SERVICE TV Ex-Sony Service Pgil TV,DVD, M.Cuci Smua Merk (Tknisi Ex. Sony);7444822 / 081369112008 Salim TV Servce TV, Wrna Smua merk selesai Ditempat (0721) 9983488 Andi Servce Pggl TV Semua Merk Hb: 0721-7506579 Grsi 6 Bln Putra solo Servce TV Parabola Termurah Hub: 0721-3699988 Florida Servce TV,Dll Panggil Langsung Datang Hub: 0815 4023359


AHLI K.GAS,M.CC ,P.AIR, KLKS,WTR HEATR DLL; 750 6931/085788814931 GRNSI



Spesialis Depot Air Isi Ulang 16jtan, RO Rmh Tngga & Indstri 2jtan,Sedia Tu2p,Tisu,Galon, Membrane,Media dll “SINAR TIRTA” Jl Soekarno Hatta Ruko DCC Simp.Wyhlm Wyknds Tlp/ Fax.0721.784287/ 081560 32838 Bila Anda Ingin Mmbuat Depot Air Minum Kami Jmi Mrh Bgus ada galon Ttp Dll 08788 8881592 / 081218654706 www / email fuji. Keisi Filter Mlyni Pmbuatn Dpot Air air minum,Dg Hrg mrh Brgr nsi Hnya 15Jt anda sdh Bs jd Png sha Jl.Diponegoro Yukum Jaya Lamteng Hb: 08218 4031419 FILTER AIR: Atasi Air Kuning, Bau Lumpur,Minyak; 0721.7842 87-08156032838

Bangunan / Mesin Baru ( M.fuso, Sendokan) S.kerja Ada Kolan Ikan Desa Kuningan Pa las Bangunan Ls Hb: 081369 772450

Bikin Wbste & Mrktng Online, Email Msal, Hb: 081378322207

LAUNDRY Laundry Kiloan dengan Modal Kecil + Pendapatan Sampingan Praktek Langsung Hub. Syah Laoundry Telp. 0721 26040143 HP. 0852 79161980 De Fortuna Londre,Kloan & Dryclean 3500s/d 4500/Kg Higens,Anti Bktri/ Kmn/Vrs, Pglmn & Trjmn,Anjem Grts; 0812 72005999/9910148

WARNET Dijual Warnet 10 Untl Lkp,Bns Instalasi Jaringan,H 25jt Dswkn 1jt/bl; 7534921 Djual wrnet G.Online Isever 8 Pc. LCD 40Jt Ngo Hub: 0853 68368856




CV.LAMPUNG POOL, Special pmbuatan Klm Rnang & Water BOOm,Lht Cntoh: Centro Water Boom Baudar Jaya 081369 144878 WWW.Lampung pool.


SANGGAR BUNGA LAMPUNG FLORIST Trm Psn an Krngn Bunga u/ Prnkhn ,Pr smian, Plntikn,Ultah, Dkct, Bga Mj,Disc 25 (24jm) Antr Lr Kt Jl.I. Bnjol 169 H. 3664588/08527 9714488 Sanggar Bunga Fanny Mnrima Psanan Bunga Papan Medan ( sewa ) Dan Bunga segar Jl. Jend sudrman No 110 Tlp 07219928989 / 3666219 Bella Florist Trima Psnan Bunga Papan Sistem Swa/Bli Bng Rng kaian,Bunga Sgr Hb:3587070/ 08127926426,Hrg Murah

PINJAMAN DANA Bth Dana Cpt Jmainkan BPKB Mbil Th ’86 Up Motor ’03up, Bunga Murah Mulai Dari 4.9% Hb: AAn Item, 0721-7634040 / 085279963693 SINARMAS MULITIFINANCE Kridit Modal Usha Wilayah B.Lmpung & Skitarnya Via Bank, Mudah & Cpt Info Lgkap Hub: Sidik 085279737956

Jaminkan BPKB Mbil/Truk/PU Perlu Pembiayaan?? Hub: Syahril 0721-7499055 / 0812 79220337

DANA TUNAI Mau Beli Mobil Teman / Kluarga ?? Atau Btuh Dana Tunai??? Mu rah, Mudah & cpt Kmi solusi nya Toni 081379196424 / 754 6392 Pnjamn U/ Modal Usaha Beli Mobil & Kbthan Mndsak Jmnkan BPKB Mbil Th 90-An Ke Ats Hub amin: 081369212823 Bth Dana Tunai Jaminkan BP KB Mtor / Mbil Hub: 0821 83409369 / 085769772987 Bth dana Tunai Jaminan BPKB Mobil proses Cpat msh Krdit Bisa Hub: 0811714355 / 99 04595

PUPUK Jual Ppk Organik Granul Mnyu bur kan Tnh,Mningktkn Prduksi Tnamn Singkong,Sawit, Padi, Karet,Padi,Kopi, Seng ondll ;081281173961/08127222244/ 081977940365


Terima Cetak Labeling dan Indentitas Kemasan Catering , Segel, Stiker, Kaos, Spanduk, Ban ner, Saou venir dan Promotion Produk Perusahan Hubu ngi: Jl. Sultan Agung Samping Graha Pena Radar Lampung Hub. 0821 77299377

MINI KOLOM Dbthkn frnt office,wnt,umr 2125 sgle min D3 dutmkn jur kom nks, b. ing.mnguasai windows. rmh&pnmpln mnrk,krm ke PT.Asuransi Jiwa Kresna,JL .P.Antasari No.151F BDL Anda Butuh Ass Mbl /Mtr/Property, dll,Hub:ADIRA INSURANCE (Autocilin) 0721-3695 804/081369656299

LOWONGAN DICARI:S1 Ir.Mesin,Teknik Sipil Bangunan,Umur 30th utk di Kantor;Hub 08154022959 PT Unimitra Alyon trussindo Brgrk Dibid.Aplikator Rangka Atap Baja Ringan Mbthkn: Mrktg,Syrt Pria,Min D3,Pny Kendr R2+SIM C,Brpglmn Dibid, Krm Lmrn ke Jl.Dipone goro No.18 T.Btg Bdl 0721-470649 Dbthkn sgr Tng Pembukuan,l/ p,pnmpln mnrk,energ&bkrj krs,min SMK akt,bsa m ngop rskn komptr(ofce),dutmakn brpnglmn bidg pmbukun,krm lmrn,foto trbru&cv ke,Cetro Graha Suksesindo,Jl.Bumi Manti no.17 Kampung Baru BLP,plng lmbt 1 mingg dr ikln Distributor Exxel Product Chemical Wilayah Sumbagsel yg Merupakan Product Pem bersih & Perawtan Ramah ling kungan Untuk Kegunaan otom tve & Hotel Mncari AGEN Untk Wlyah lmpug Bg Yg Brmnt & Serius Hu: Bp.Sumardi Telp 0711-8799001 / 081368903001 & Via Email: Surya88g emilang Dibthkn Sgra TERAPIS Brpng lmn Syrt L/P Max 30 Th Mmiliki Ktrmpln Rflexi kaki,Pjt Bdn, Totok Wjh TENAGA PANGKAS RAMBUT,Diutmkn yg Bsa Mnggunkn alat Clipers (Cu kur)Lmrn Antr Ke Gemilang Jaya Celluler jl P Antsari No 84 D 9961118 Dbthkan Tng Sales Pddkn Min D3 mmliki Sim C & Brpnglamn Kmpnsasi GP, ASS Kshatan, Insentif, Krm Lmran Ke PT. CIPTAKARYA MITRA MANDIRI Telp 0721-9920615 Jl.Sultan Baharudin No.05 Gd.Air Depan SMP 7 SegalaMider

Bth Cpt!!!Prshaan yg Brgrk Dibdg APCO,Mmbthkan SDM U/ Ditmptkan di Staf Gdg, ADM,Recept,Mnger u/diktr Cab.di BDL & Sktrnya.Lmrn Antr lsg ke.CV.AGAM PRASETYA Jl.Yos Sudarso No.3 Simpang 3 BW T.Betung BDL Prshan ConsGood mmbthkan SUPERVISOR Pnglmn 2Th D3 Pnya Motor Sdri SALESMAN Pnglmn 2th Trdtional Mrket Antr Lgsg Ke PT.Yunikar Jaya sakti Jl. urip s. No.146 Gn .Sulah Skrme Dbthkan Sgr : Supirn Pny Sim B1 Usia Max 37 Th Supir Pnya Sim A Max 24Th, D3 Tek, Sipil Usia Max 24Th Lmran Lkp Dtg Lgsg Jl.Tembesu No.8 Cam pang Raya Kali Balok SoekarnoHatta Bdl. Bu Wina Bth cpt max 35th U/ Asuh Anak & Jadi PRT Di Perum Elite jakarta gji s/d 1.5Jt Dta Lgkp ( KTP+Ijsh/srt Nikah Asli) Hb: 087885688458 / 082124 985696 Dbthkan sgr 2 Org Wnt Mw Krj Urt Trdsnl dkntrk 1Th Jmnn SMA Siap training 1mngg / D.ajari Hb Armiana Urt 081540025679 Slmbt2nyatgl 20Mret Dcri Cpt U/Bank ( Back Office) S1 Segla Jurusan IPK Min 3.00 Ptia Mun Max 27 Lmran Antar Lgsg ke PT.Kas Jl. Wr.Suprat man No.153 C ( smping Bank Indonsia T.Btung, UP Johanes ) Dcri Sepervisorpry, S1 Sipil / arsitek, Pnglmn 3 Th, AK3 Umum, bs Komputer & Internet Tgs Lampung Lmran PT. JAGAT BAJA, Rk Rgkt Mkmur 77 Kali rungkut Surabaya. PT Well Comm Mmbthkan Sales / Marketing Min SMA Max 25Th Ada GP 1.5Jt, komsi ,Karir krm Lmrn Jl.Morotai Perum Jaya Permai Blok G No.9

Dbthkan Segera P/ W llsn SMA/ SMK/Sdrjat/Usia Min 18Maks 28 Krja Ke PT Suko Agung Pe rum Puri Way halim Blok H No.1 BDL Dbthkn Sales pria yg Brpnglmn Dbdg Bhn Bgnn usia Max 30th pdd min SMA / Sdrjt krm Lmrn Ke Ruko Putra Kdtn No.1 Jl.Soekrno-Hatta telp 704888 Pangkas Rambut Arjuna bth pemangkas rambt,rfleksi&fcial (khs pria) income menjanji kn,786582/08127200961 Dbthkan Operator alat Berat ( Sovel / Loader) Syrat : Pria U mur Max 40Th, Brpnglmn Dmsili Bdl Hub: 0721-470032 Dbthkan tukang jahit / Pasang jok press Mobil D.Utamakan Yg Brpnglamn Hub: 085267789078 / 9380235 PD.Sehat Selalu,Jl Kimaja (Depan Kimaja Icon) Bth:1) Pengantar Brg,Laki2,max 25th, SIM A/C,2)Sales,D3,max 30th, punya Mtr Dbtkan sales pria U / TB Pend Min SMA / Sderajt Krm K. komp Indosat Putra Kedton No.1 Jl. Soekrno-Hatta telp 704888 Kerja dari rumh www.virtu hub: 08536 8684366 ( Fandy ) Dcri tng krj wnt max,25th,u salon khs wnta,pnglmn tdk diutma kn,training,08127200962 Dbutuhkn 3 wnt&1 pria brminat bljr&bkrj menjahit,SMP/SMA, max 22th,ada tempt tggl ,hb:0721-7192430 Dbthkan 1Org Utk ADM Akdmik wnta D3 Lmran diantar ke JL. P.Legundi No.31sukarame ( Mitra Karya ) Bth Wanita Min SMP Menginap Unt Toko & Laundry Hub: 0821 83408369



SMK 2 Bandarlampung Superior BANDARLAMPUNG – Lanjutan Liga Pelajar Indonesia (LPI) Kota Bandarlampung kemarin menampilkan pertandingan menarik. Ketika SMK 2 bersua SMAN 11, sembilan gol tercipta. Ya, SMKN 2 berhasil melibas SMAN 11 dengan skor meyakinkan 8-1. Pada awal pertandingan, SMAN 11 terlihat bisa mengimbangi permainan SMKN 2. Sayangnya, hal itu tak berlangsung lama. Malah sebelum jeda turun minum, kedudukan sudah 3-0 untuk SMKN 2. Memasuki babak kedua, dominasi SMKN 2 Bandarlampung tidak bisa dibendung lagi. Mereka tampil agresif sehingga mampu menambah lima gol pada babak kedua. Sedangkan SMAN 11 hanya mampu mencetak satu gol hiburan. Sementara itu, SMA Al-Azhar



SMAN 6 v SMK BLK 0-3 SMAN 11 v SMKN 2 1-8 Alkautsar v SMA Utama 2-2 SMA Al-Azhar v SMAN 7 1-3

3 harus mengakui keunggulan SMAN 7. Meski didukung puluhan suporternya, SMA Al-Azhar 3 tidak mampu mengembangkan permainan. Pada babak pertama, kedua tim sama-sama tampil ngotot. Peluang pun sama-sama mereka ciptakan. Namun, tetap saja keduanya hanya mampu menceploskan 1 gol. Skor 1-1 menyudahi pertandingan yang diwarnai hujan itu. Pada babak kedua, SMAN 7 tampil lebih dominan. Mereka berhasil mengepung daerah per-

tahanan SMA Al-Azhar 3. Hanya sesekali SMA Al-Azhar 3 melakukan serangan balik, tetapi belum mampu menciptakan gol. Sebaliknya, anak-anak SMAN 7 berhasil memanfaatkan lemahnya lini pertahanan SMA Al-Azhar 3 sehingga menambah dua gol. Dengan tambahan itu, SMAN 7 menutup pertandingan dengan skor akhir 3-1. LPI merupakan liga sepak bola berbasiskan pendidikan di bawah Kementerian Pendidikan Nasional. Pelaksanaannya menjadi tanggung jawab Dinas Pendidikan masing-masing. Liga ini sendiri telah berlangsung di beberapa wilayah di Indonesia. LPI Kota Bandarlampung sendiri diikuti oleh 21 tim yang akan berlangsung hingga 25 Maret 2011. Pada kompetisi ini menggunakan sistem gugur. (ton/c2/ade)

SMPN 26 dan Gajah Mada Berjaya FOTO REUTERS

HASIL PERTANDINGAN KEMARIN (19/3) TIM/SKOR SMPN 4 Bandarlampung SMPN 3 Jatiagung SMPN 22 Bandarlampung SMPN 30 Bandarlampung SMP Muhammadiyah SMP Wiyatama Bdl SMP Taman Siswa Bdl SMPN 7 Bandarlampung SMP Budaya Bandarlampung SMPN 21 Bandarlampung

v v v v v v v v v v

SMPN 2 Bandarlampung/ SMPN 19 Bandarlampung/ SMPN 24 Bandarlampung/ SMPN 4 Bandarlampung A/ SMPN 13 Bandarlampung/ SMP Bina Mulya/ SMP YPP Panjang/ SMPN 16 Bandarlampung/ SMP Gajah Mada Bdl/ SMPN 29 Bandarlampung/

5-0 6-9 5-0 9-3 2-2 5-0 0-5 3-8 0-5 5-5

Sumber: Panpel

BANDARLAMPUNG – SMPN 26 menunjukkan kelasnya sebagai salah satu kandidat juara. Mereka berhasil melibas SMPN 24 dengan skor telak 5-0 dalam laga lanjutan kemarin. Begitu kickoff, SMPN 26 sudah langsung tampil menggebrak. Alhasil, SMPN 26 berhasil menjebol gawang SMPN 24 pada menit kedua. Gol itu ternyata membuat mental SMPN 24 down. Aki-

batnya, mereka tak kuasa menahan gempuran anak-anak SMAN 26. Gol pun kembali melesak pada menit 13. Pada paro waktu kedua, anakanak SMPN 26 mengendurkan serangan. Meski begitu, SMPN 24 tetap tidak bisa memanfaatkan kondisi itu. Justru, mereka semakin terbenam setelah SMPN 26 menceploskan tiga gol tambahan. Pada pertandingan lainnya, SMP Budaya harus menelan pil

pahit. Mereka dilibas SMP Gajah Mada juga dengan lima gol tanpa balas. Hasil pertandingan sesungguhnya sudah bisa ditebak sejak awal pertandingan. Begitu banyak peluang yang tercipta untuk SMP Gajah Mada. Meski, hanya satu gol yang berhasil diciptakan pada babak pertama. Masuk babak kedua, SMP Gajah Mada lebih berhati-hati. Setiap peluang selalu berhasil mereka manfaatkan dengan baik. Hasilnya, empat gol berhasil mereka ciptakan pada paro waktu kedua. Skor 5-0 tidak berubah sampai pertandingan usai. Untuk diketahui, liga futsal ini sendiri bertujuan menjaring bibitbibit muda pemain futsal. Tidak hanya itu. Even itu juga merupakan bentuk konkret pembinaan olahraga, khususnya di Bandarlampung. Tercatat, 30 tim futsal turut berpartisipasi dalam kegiatan yang menggunakan sistem setengah kompetisi itu. Tim dari Kota Metro dan Lampung Selatan turut berpartisipasi. (ton/c2/ade)


DUNK: Aksi forward Tyler Hansbrough (Indiana Pacers) saat melawan Boston Celtics di Boston.

Indiana Bertahan, Houston Memburu Posisi Terakhir Playoff Wilayah Timur dan Barat INDIANAPOLIS – Indiana Pacers dan Houston Rockets sama-sama meraih kemenangan penting, Jumat malam (18/3 atau kemarin pagi WIB). Keduanya sama-sama mengalahkan raksasa NBA untuk mencapai target yang sama: Berlaga pada babak playoff musim 2010–2011. Pacers kemarin menundukkan tim terpanas di NBA sekarang ini, Chicago Bulls, lewat laga ulet yang berujung perpanjangan waktu, 115-108. Dengan hasil itu, Danny Granger dkk. pun menjaga posisi di urutan delapan wilayah timur, posisi terakhir untuk lolos ke playoff. Sedangkan Rockets menang besar atas Boston Celtics 93-77 dan terus memperdekat jarak dengan urutan delapan wilayah barat. Kini Kevin Martin dkk. masih berada di urutan sepuluh. Tapi, hanya terpaut

1,5 game dari Memphis Grizzlies di urutan delapan. Dari kedua laga itu, duel Pacers v Bulls berlangsung sangat sengit. Pacers sempat unggul jauh pada awal,namunBulls’meledak"pada kuarter keempat. Pada kuarter itu, Bulls unggul 29-13 memaksa terjadinya overtime. Beruntung bagi Pacers, bintang utama Bulls, Derrick Rose, tidak mendapat bantuan tambahan dari yang lain. Sehingga pada overtime, Pacers unggul 13-6 dan meraih kemenangan 115-108. Pada laga itu, Rose kembali menunjukkan kelas sebagai kandidat kuat most valuable player (MVP) mencetak 42 poin! Bintang muda Pacers, Tyler Hansbrough, terus menunjukkan progres. Forward asal University of North Carolina itu mencetak 29 poin dan 12 rebound. Danny Granger menambahkan 19 poin. Di urutan delapan wilayah

KLASEMEN PLAYOFF WILAYAH TIMUR 1. Chicago Bulls 2. Boston Celtics 3. Miami Heat 4. Orlando Magic 5. Atlanta Hawks 6. Philadelphia 76ers 7. New York Knicks 8. Indiana Pacers 9. Charlotte Bobcats 10. Milwaukee Bucks 11. Detroit Pistons 12. New Jersey Nets 13. Toronto Raptors 14. Washington Wizards 15. Cleveland Cavaliers

49-19 48-19 47-22 44-26 39-30 36-33 35-33 30-39 28-40 27-41 25-44 22-45 19-49 16-51 13-54

WILAYAH BARAT 1. San Antonio Spurs 55-13 2. L.A. Lakers 49-20 3. Dallas Mavericks 48-21 4. Oklahoma City Thunder 45-23 5. Denver Nuggets 41-28 6. Portland Trail Blazers 39-29 7. New Orleans Hornets 40-30 8. Memphis Grizzlies 37-32 9. Utah Jazz 36-33 10. Houston Rockets 36-34 11. Phoenix Suns 34-33 12. Golden State Warriors 30-39 13. L.A. Clippers 26-43 14. Minnesota Timberwolves 17-53 15. Sacramento Kings 16-51 Catatan: Hanya delapan tim dari masing-masing wilayah lolos ke babak playoff.

timur, posisi Pacers memang jauh dari aman. Rekor mereka sebenarnya kurang oke, hanya 29-39. Di belakang mereka, Charlotte Bobcats dan Milwaukee Bucks hanya terpaut 2,5 game. Kalau Pacers sampai selip, mereka bisa kembali gagal masuk playoff. Frank Vogel, pelatih Pacers, tampaknya, yakin timnya bakal bertahan sampai akhir musim. Laga kemarin menunjukkan ketangguhan mental itu. ’’Mereka mampu menjaga ketenangan dan menunaikan tugas pada babak overtime," ucapnya seperti dilansir Associated Press. Sementara itu, Rockets (3634) terus tampil luar biasa pada penghujung musim 2010–2011 ini. Peluang mereka untuk masuk playoff memang berat, tapi bukan mustahil. Mereka masih punya 12 game tersisa, tujuh di antaranya di kandang sendiri. Delapan di antaranya juga melawan tim ’’lemah" dengan rekor di bawah 500. (jpnn/c2/ade)



MENJAGA ASA EROPA SUNDERLAND – Liverpool mengemban misi berat pada Premie League musim ini menyusul kegagalan Europa League (18/3). Liverpool mau tidak mau harus finis lima besar apabila ingin kembali berkiprah di Eropa musim depan. Mampukah? Jawabannya masih harus melihat pencapaian The Reds –sebutan Liverpool– pada sembilan laga sisa mereka. Termasuk bentrok menghadapi Sunderland di Stadium of Light (siaran langsung MNCTV, kickoff 20.30 WIB). Laga ini tergolong sulit mengingat mental Liverpool baru drop pasca kegagalan pada Europa League. Tidak hanya itu. Sunderland merupakan salah satu tim yang di atas kertas masih berada dalam persaingan zona Europa League. Penjualan bomber Darren Bent ke Aston Villa pada Januari 2011 memang memunculkan spekulasi apabila The Black Cats –sebutan Sunderland– tidak tertarik lolos ke Eropa. Sejak kehilangan Bent, performa The Black Cats memang menurun. Meski begitu, pelatih Liverpool Kenny Dalglish tetap mewaspadai sepak terjang tuan rumah. Apalagi Sunderland memiliki catatan positif setiap menghadapi klub besar sepanjang musim ini. Chelsea dan Manchester City pernah dikalahkan, sedangkan Manchester United dan Arsenal dipaksa seri. ’’Saya tidak tahu berapa poin yang kami butuhkan untuk finis lima besar karena juga bergantung dengan hasil tim-tim lain,” ungkap Dalglish kepada Liverpool Echo. ’’Yang pasti, kami harus pergi ke Sunderland dengan misi membawa pulang tiga poin. Tidak mudah memang karena kami kalah dalam lawatan terakhir ke Sunderland,” tambah pelatih berjuluk King Kenny itu. Pada 17 Oktober 2009, Liverpool harus menyerah

0-1 di kandang Sunderland. Kekalahan waktu itu menuai kontroversi karena gol Bent pada menit kelima sempat mengenai bola pantai atau balon yang dilemparkan seorang fans dari tribun. Bola pun berbelok arah sehingga mengecoh kiper Liverpool Pepe Reina. Bagi Dalglish, kemenangan di Stadium of Light bisa memuluskan negosiasi kontrak permanennya di Liverpool. Pemilik Liverpool John Henry dikabarkan telah menyodorkan kontrak dua tahun (hingga 2013) bagi Dalglish. Namun, ada kabar yang menyaWelbeck takan

Johnson Reina Lucas



Skrtel Poulsen



Meireles Henderson Bardsle



3 2-



Sessegnon Bramble Richardson


apabila pelatih 60 tahun berkebangsaan Skotlandia itu berharap disodori kontrak empat tahun. (jpnn/c2/ade)


Mensah Muntari Ferdinand


5 4-


Maxi Rodriquez Paling Dibenci di Ghana MASIH ingat ’’Tangan Tuhan” Luis Suarez pada Piala Dunia 2010? Ketika membela Uruguay melawan Ghana pada perempat final, Suarez sengaja menahan bola yang akan masuk ke gawang dengan tangannya. Insiden pada pengujung babak tambahan waktu itu pun berbuah kartu merah bagi Suarez dan penalti bagi Ghana. Sayangnya, eksekusi penalti Ghana gagal dimanfaatkan oleh Asamoah Gyan. Skor pun tetap 1-1 sehingga lanjut ke drama adu penalti. Pada babak tos-tosan itu, Ghana akhirnya kalah 2-4 sekalipun Gyan sukses menjalankan tugas sebagai algojo pertama. Bagi Gyan, insiden itu memang sudah berlalu. Tapi, bentrok Sunderland menghadapi Liverpool malam nanti membangkitkan memori atas insiden ’’Tangan Tuhan” itu. Itu karena ada Suarez yang membela Liverpool. Gyan pun memberi komentar atas pertemuannya lagi dengan Suarez. ’’Saya harus mengatakan bahwa dia (Suarez) tidak disukai di Ghana dan dia pemain paling dibenci

Luis Suarez

di sana. Saya meminta maaf mengatakannya karena saya adalah seorang olahragawan dan saya mengerti tentang aturan permainan,” ungkap Gyan kepada Daily Mirror. Gyan seakan menyindir tangisan Suarez seusai handsball sebagai aksi teatrikal. Sebab, setelah diri-

nya gagal dalam penalti, Suarez langsung bersorak kegirangan. ’’Fans kami mungkin tidak bisa mengerti apa yang sebenarnya terjadi di balik insiden itu, tapi saya sangat tahu bagaimana ulahnya,” tambah striker 25 tahun itu. Sial bagi Suarez, Gyan bukan satu-satunya penggawa Ghana pada Piala Dunia 2010 yang ada di skuad Sunderland waktu ini. Masih ada gelandang Sulley Muntari dan defender John Mensah. Muntari dan Mensah pun tak mau ketinggalan mengecam ulah Suarez. ’’Saya tidak terkejut ketika mendengar dia diskors tujuh laga di Belanda (karena menggigit bahu pemain PSV Eindhoven Otman Bakkal pada 20 November 2010, Red),” ucap Muntari di KickoffGhana. ’’Saya memang kecewa dengan apa yang dilakukannya pada Piala Dunia. Tapi, saya akan mencoba tidak terpancing amarah untuk mengasarinya dalam pertandingan nanti,” sahut Mensah pada kesempatan terpisah. (jpnn/c2/ade)



MOTIVASI Juan Mata bakal berlipat ganda. Sebab, dia mendapat kabar baik jelang laga lawan Sevilla dini hari nanti. Kabar baik? Ya, winger Valencia itu baru saja dikontak pelatih Timnas Spanyol Vicente del Bosque. Mata dipanggil untuk membela La Furia Roja –julukan Timnas Spanyol– untuk persiapan laga lawan Republik Ceko (25/3) dan Lithuania pada kualifikasi Euro 2012. Selain Mata, Del Bosque juga memanggil dua pemain muda lainnya. Yakni bek Athletic Bilbao Andoni Iraola dan Javier Martinez. Ketiganya dipanggil untuk melapis Carles Puyol, Cesc Fabregas, dan Pedro Rodriguez yang masih dibekap cedera. Bagi Iraiola, absennya Puyol akan memberikannya kesempatan menambah caps, setidaknya bila turun sebagai pemain pengganti atau bila Sergio Ramos digeser ke bek tengah. Sebab, sejak dipanggil pada 2008, dia baru bermain pada empat laga. Sedangkan bagi Javi Martinez dan Mata, inilah comeback mereka ke Timnas Spanyol. Sejak ambil bagian pada Piala Dunia 2010, dua pemain itu tidak lagi bermain untuk tim senior. Mereka secara reguler tampil di Timnas Spanyol U-21. Kali ini pun kans Mata dan Martinez untuk mengisi posisi inti cukup berat. Untuk posisi winger, Mata masih harus bersaing dengan David Silva dan Jesus Navas. Sementara di lini tengah, Martinez masih harus bersabar untuk mendapat peran. Tiga posisi itu sudah paten menjadi milik Xavi Hernandez, Andres Iniesta, dan Sergio Busquets.Namun, Del Bosque menjamin bahwa semua pemain bisa digantikan posisinya. ’’Tidak ada satu pun yang aman. Memang kami menjaga stabilitas, tapi kami juga tidak melupakan mereka yang tampil baik," kata Del Bosque seperti dikutip Reuters. Spanyol kini menempati puncak klasemen grup I kualifikasi Euro 2012 dengan sembilan poin dari tiga laga. Tapi, Republik Ceko terus menguntit di posisi kedua dengan enam poin. Karena itu, Del Bosque menilai laga lawan Ceko akan menjadi partai sulit. ’’Kami bisa menghadapi kesulitan karena mereka adalah tim yang memiliki keunggulan fisik dan tekniknya cukup bagus. Mereka adalah salah satu tim kuat dan berpengaruh di Eropa dalam beberapa tahun terakhir," kata mantan pelatih Real Madrid itu. (jpnn/c2/ade) SKUAD TIMNAS SPANYOL Kiper: Iker Casillas (Real Madrid), Jose Manuel Reina (Liverpool), Victor Valdes (Barcelona). Belakang : Sergio Ramos (Real), Elvaro Arbeloa (Real), Raul Albiol (Real), Gerard Pique (Barcelona), Carlos Marchena (Villarreal), Andoni Iraola (Athletic Bilbao), Joan Capdevila (Villarreal). Tengah : Xabi Alonso (Real), Sergio Busquets (Barcelona), Santiago Cazorla (Villarreal), Andres Iniesta (Barcelona), Xavi Hernandez (Barcelona), Javi Martinez (Bilbao) Depan : David Silva (Manchester City), Fernando Llorente (Bilbao), Jeses Navas (Sevilla), Juan Mata (Valencia), David Villa (Barcelona), Fernando Torres (Chelsea)


Head to Head 08/11/10 Sevilla 31/01/10 Sevilla 30/08/09 Valencia 19/04/09 Valencia 22/11/08 Sevilla

v v v v v

Valencia Valencia Sevilla Sevilla Valencia

2-0 2-1 2-0 3-1 0-0

Pela tih: Gre gor io M anz Varas ano

Caceres Navarro Perotti

Alexis Zokora Fazio Rakitic





Joaquin Bruno


Jelang Laga, Terima Panggilan La Furia Roja


A. Costa Stankevicius

Topal Mathieu

Banega R. Costa

Guaita (g)

Pe lat ih :

Un ai Em ery

Valencia v


HAPUS LUKA DI MESTALLA VALENCIA – Tersingkir pada babak 16 besar Liga Champions dari Schalke membuat mental tanding Valencia drop. Akibatnya, mereka kalah 0-4 dari Real Zaragoza pada pekan lalu (12/3). Akankah mereka bangkit atau malah terpuruk pada pekan ke-29 Liga Primera? Ya, dini hari nanti tim berjuluk Los Che itu akan bertarung dengan Sevilla di Mestalla. Setelah selalu kalah dalam dua bentrok terakhir, Valencia berambisi merebut kemenangan kali ini (siaran langsung TV One pukul 03.00 WIB). ’’Sangat penting bagi kami untuk menenangkan diri dan kami harus menang melawan Sevilla. Kami baikbaik saja, tapi setelah dua pukulan telak, terutama tersingkir dari Liga Champions, benar-benar membuat

kami terpukul," kata Aritz Aduriz, striker Valencia, kepada AS. ’’Beginilah sepak bola dan Anda harus bangkit sendiri. Kami gagal melakukannya ketika melawan Zaragoza, tapi kami akan me lu pakannya dan secepat mungkin kami akan menyelesaikan kompetisi serta memastikan diri tampil lagi pada Liga Champions," lanjutnya. Senada dengan Aduriz, winger Valencia Joaquin juga menginginkan kemenangan. ’’Ini laga kandang. Tidak dibenarkan kami kehilangan angka. Ini momen untuk melupakan kepahitan yang telah kami alami," bilang Joaquin seperti dikutip Soccerway. Ya, sekarang Valencia berada pada posisi ketiga klasemen sementara dengan 54 poin. Memang terlalu jauh

bagi mereka mengejar ketertinggalan dari Barcelona dan Real Madrid, tapi setidaknya mereka tidak ingin terkejar pesaing di bawahnya. Valencia sementara unggul tiga angka di atas pesaing terdekatnya, Villarreal (51 poin). Adapun Sevilla sekarang berada pada posisi ketujuh dengan 39 poin. Mereka tertinggal tiga angka di belakang Athletic Bilbao yang berada di zona Eropa. Nah, pada saat kompetisi tinggal menyisakan sepuluh pertandingan lagi, tambahan angka sangat berarti. ’’Kami ingin sesegera mungkin memastikan tiket ke Liga Champions musim depan untuk mengobati luka akibat dua kekalahan beruntun ini," jelas Joaquin. Sementara, Sevilla berambisi membawa pulang angka. Kepercayaan di-

ri mereka melonjak drastis seiring dengan keberhasilan menahan imbang Barcelona 1-1 pada pekan lalu. Apalagi, mereka punya rekor manis selalu menang dalam dua bentrok terakhir. ’’Bila kami bermain seperti ketika melawan Barcelona, kami akan menang dalam banyak per tan dingan. Kami masih punya peluang meningkatkan performa dan mengakhiri kompetisi di zona Eropa," ujar Federico Fazio, bek Sevilla, seperti dikutip ESPN Star. Jelang melawan Valencia, kiper senior Andres Palop sudah mulai pulih, tapi belum akan turun sebagai starter. Javi Varas masih akan mengisi posisi di bawah mistar gawang. Adapun pemain anyar Gary Medel masih dalam masa pemulihan. (jpnn/c2/ade)


Tips Shevchenko untuk El Nino FERNANDO Torres terus disorot. Sejak diboyong dari Liverpool dengan fee termahal di Inggris (50 juta pounds atau Rp706 miliar), Torres lima kali diturunkan pada berbagai ajang. Meski begitu, pemain yang dijuluki El Nino itu tak kunjung mempersembahkan gol pertamanya bagi Chelsea. Kendati terus dikritik media Inggris, Torres selalu didukung klubnya. Tidak hanya itu. Dukungan juga datang dari luar klub. Salah satunya dari Andriy ’’Sheva" Shevchenko, eks striker Chelsea yang kini membela klub Ukraina Dynamo Kiev. Alasan Sheva memberi dukungan karena dia pernah merasakan situasi yang dialami Torres. Dari pengalamannya itu, Sheva pun memberi tips kepada Torres. ’’Dia (Torres) harus lebih percaya dengan kemampuan dirinya dan tenang karena gol pasti akan datang. Saya tahu, dia pekerja keras di lapangan. Hanya, dia tidak harus memikirkan bisa mencetak gol selama dia membuktikan masih seorang pemain besar," ungkap Sheva kepada talkSPORT. (jpnn/c2/ade)


MISI ANCELOTTI LONDON – Chelsea kembali meramaikan persaingan papan atas Premier League musim ini. Mereka tidak hanya kembali menempati posisi empat besar atau zona Liga Champions. Tapi, Chelsea juga berpotensi mempertahankan gelarnya. Kesempatan itu terbuka asalkan The Blues –sebutan Chelsea– konsisten menyapu bersih sepuluh laga tersisa. Salah satu laga yang tidak boleh lepas itu termasuk saat menjamu Manchester City di Stamford Bridge malam nanti (siaran langsung Global TV, kickoff 23.00 WIB). Kemenangan sangat penting bagi Chelsea mengingat City adalah tim setingkat di atas mereka dengan selisih hanya dua poin (53-51). Berarti, kemenangan akan membawa Chelsea menggusur City. ’’Jika Anda melihat klasemen, persaingan Liga Champions musim ini sangat ketat. Karena itu, kemenangan atas tim-tim pesaing kami seperti Manchester City sangatlah penting," ungkap Carlo Ancelotti, pelatih Chelsea, kepada Chelsea TV. Selain demi posisi di klasemen, kemenangan atas City menjadi misi pribadi Ancelotti terhadap koleganya di tim lawan, Roberto Mancini. Bagaimana tidak, dari tiga kali menghadapi Mancini di Inggris, Ancelotti selalu kalah. Pada pertemuan terakhir (25 September 2010), pelatih 51 tahun itu menyerah 0-1 di City of Manchester. ’’Dia (Mancini) adalah pelatih yang sangat pintar dan mempersiapkan taktiknya dengan sangat baik. Itulah yang membuat saya kesulitan menghadapinya. Tapi, saya berharap situasinya akan berbeda kali ini," jelas Ancelotti di Soccernet. Belajar dari pengalaman, Ancelotti telah mengantongi kelebihan dan kelemahan City. ’’City berbahaya dalam serangan balik, tapi mereka belum memiliki ke-





seimbangan permainan sepanjang 90 menit," tuturnya. Sebelum di Inggris, Ancelotti dan Mancini juga bersaing di Serie A Italia selama empat tahun (2004–2008). Yakni semasa Ancelotti masih menangani AC Milan dan Mancini menukangi Inter Milan. ’’Kami adalah teman, baik ketika masih membela timnas maupun di luar lapangan. Kami masih berhubungan baik sampai sekarang," sambung Ancelotti yang lebih tua empat tahun dibandingkan Mancini. Di pihak lain, City tentu tidak akan memberikan tiga poin gratis kepada Chelsea. Sebaliknya, The Citizens –sebutan City– bakal bermain habis-habisan mengejar hasil absolut demi mengamankan posisinya di Liga Champions. Tidak hanya dari gangguan Chelsea, melainkan juga Tottenham Hotspur di peringkat kelima. Gelandang City Nigel De Jong menilai, kegagalan City di Europa League akan melecut semangat timnya. ’’Europa League sudah selesai bagi kami. Target kami ke depan adalah Liga Champions dan menghadapi Chelsea tak ubahnya laga hidup-mati menilik posisi kedua tim di klasemen," kata De Jong kepada Manchester Evening News. ’’Bagi kami, lolos ke Liga Champions di peringkat ketiga lebih baik dibandingkan peringkat keempat (peringkat ketiga langsung lolos ke fase grup, sedangkan peringkat keempat harus melalui playoff, Red)," tambahnya. De Jong menambahkan, rekor positif timnya menghadapi Chelsea dalam tiga pertemuan terakhir akan memberi tekanan kepada lawan. ’’Chelsea memang bermain home, tapi mereka tahu kami berhasil menang di sana musim lalu. Jadi, saya kira mereka harus tampil 200 persen untuk bisa mengalahkan kami," tambahnya. (jpnn/c2/ade)



Diet setiap Orang Berbeda POLA konsumsi, termasuk diet, bagi setiap orang berbedabeda. Hal itu ditegaskan dr. Tutik, ahli gizi dari RSUD Bandarlampung, kemarin pada Diskusi For Her bertema Pola Hidup Sehat Sesuai Golongan

Darah AB Boleh Konsumsi


Darah. Menurutnya, diet menjadi berbeda bagi setiap orang karena masing-masing individu juga berbeda dalam angka kecukupan gizinya. ’’Selain itu, kondisi setiap individu juga berbeda-beda. Demikian pula faktor-faktor lainnya menjadikan pola diet setiap orang tidak sama,” ujarnya. Dia mencontohkan bagi orang yang memiliki kadar kolesterol tinggi, maka pola dietnya akan berbeda dengan orang normal. Begitu juga dengan jenis asupan yang harus dikonsumsi. Ada orang yang cocok melakukan diet lemak, ada pula yang tepat bila melakuakn diet karbohidrat, serta ada pula yang bagus bila banyak mengonsumsi buah. Pada diskusi yang juga menghadirkan narasumber dari Komunitas Darah AB Lampung, yakni Samsuri, S.E. (ketua) dan K. Bagus Wardianto, S.Sos., M.A.B. (sekretaris) serta disiarkan live di Radar TV itu, dr. Tutik juga menegaskan bahwa diet yang sehat sebaiknya di bawah pengawasan ahlinya. Terkait diskusi yang digelar pukul 11.30 WIB itu, Koordinator For Her Trufi Murdiani mengatakan, diskusi ini diselenggarakan dengan latar belakang bahwa setiap pemilik golongan darah itu berbeda perlakuannya. Khususnya pemilik


SEHAT: Diskusi For Her bertema Pola Hidup Sehat Sesuai Golongan Darah dengan pembicara ahli gizi RSUD Bandarlampung dr. Tutik Ernawati, M.Gizi. serta Ketua Komunitas Darah AB Lampung Samsuri, S.E. dan sekretarisnya K. Bagus Wardianto, S.Sos., M.A.B. dipandu Maria Ulfa berlangsung atraktif.

golongan darah AB yang termasuk sedikit dalam kuantitas. Dan diakui Samsuri, diet untuk

DALAM menerapkan pola hidup

asupan gizinya. Seperti protein dan

inilah yang mendasari dibentuknya

diserahkan ke sekretariat Komunitas

mencapai tingkatan hidup yang

sehat, seseorang tidak harus memilih

karbohidrat yang semuanya harus

komunitas golongan darah AB yang

AB di Jalan Nakib Gang Masjid Darul

sehat dapat dilakukan

jenis makanan yang disesuaikan

seimbang. ’’Berapa banyak yang

disebut Komunitas AB Lampung

Islah, Kotabaru, Tanjungkarang Timur,

berdasarkan golongan darah,

dengan golongan darahnya. ’’Sah-sah

dibutuhkan oleh tubuh untuk setiap

sebagai wadah perkumpulan

serta membaya biaya administrasi

kendati tidak mutlak. ’’Hal itu

saja memakan jenis makanan apa pun

orang pun berbeda-beda, tergantung

masyarakat bergolongan darah AB pada

tertentu,” ujarnya.

memang masih berupa penelitian.

sepanjang itu sehat, higienis dan

umur, aktivitas, dan jenis kelamin,”

akhir Januari 2011,” timpal Bagus.

Saya sendiri pernah membaca

kandungan gizinya cukup tanpa harus


buku tentang itu, tetapi memang

melihat golongan darah,” ujar dr. Tutik

ada semacam panduan dalam

Ernawati, M.Gizi.

mengonsumsi jenis makanan berdasarkan golongan darahnya,” sebutnya. Dia menambahkan, pemilik golongan darah AB cenderung bertubuh lebih lemah daripada pemilik golongan darah O misalnya. ’’Karena itu jenis olahraga yang dipilih pun sebaiknya yang ringan,” tutur dia mengenai perbedaan perlakuan terkait pola hidup sehat sesuai golongan darah khususnya bagi pemilik golongan darah AB. (tru/ c1/tru)

Sementara Ketua Komunitas Darah

Awalnya, tambah Samsuri,

Sedangkan bagi yang tinggal di kabupaten/kota, sebut Bagus, ada

komunitas ini dibentuk setelah melihat

perwakilan Komunitas AB di setiap

AB Lampung Samsuri, S.E. dan

salah seorang rekan mereka yang

daerah. ’’Untuk di Bandarlampung,

sekretarisnya K. Bagus Wardianto

memiliki darah AB. ’’Saat itu ia terkena

bisa datang ke FISIP Unila dan

Diskusi For Her yang disiarkan secara

yang juga menjadi narasumber diskusi

demam berdarah dengue (DBD) dan

langsung menemui saya atau Darmono

live di Radar TV kemarin (19/3).

kemarin mengungkapkan, pemilik

membutuhkan donor yang cukup

sebagai staf Puskom Unila.

Namun, menurut dokter ahli gizi RSUD

golongan darah AB termasuk langka.

banyak,” kata Sam, sapaan akrabnya.

Sedangkan yang ada di Kota Metro

Ketika itu, keluarga pasien

bisa menghubungi Dicky yang

Simpulan itu ditegaskannya pada

Bandarlampung ini, jika seseorang

’’Dari data statistik disimpulkan

ingin melakukan diet maka bisa saja

bahwa populasi pemilik golongan

kebingungan dalam berupaya

merupakan karyawan Bank Muamalat

melihat jenis makanan dari golongan

darah AB hanya 4-5 persen dari

memenuhi kebutuhan darah bagi

Metro. Selain itu bisa juga menemui

darah. ’’Kendati hal tersebut juga

seluruh populasi di dunia. Sementara

penderita. ’’Beruntung, dengan

Yuri di Perguruan Tinggi Darmajaya,”

masih dalam penelitian,” sebutnya.

di Lampung dengan jumlah penduduk

perjuangan ekstrakeras, pasien dapat


kurang lebih lima juta jiwa, jika hanya

tertolong,” sebutnya.

Artinya, tambah dia, sekalipun

Ditambahkan Samsuri, lahirnya

bergolongan darah AB yang dianggap

lima persennya atau sekitar 2.500

langka dan lemah, sah-sah saja

orang dan ini tersebar di 14

orang, pihaknya mengajak semua

menjawab keresahan sebagian

mengonsumsi jenis makanan apa pun,

kabupaten/kota,” kata Samsuri.

masyarakat Lampung yang memiliki

masyarakat akan sulitnya mencari

golongan darah AB untuk bergabung

darah AB. ’’Kami berharap dengan

yang tergabung dalam komunitas ini

ke komunitas ini. ’’Caranya pun

adanya komunitas ini, kami bisa

Dan untuk mendapatkan pola

yang semuanya tersebar di seluruh

mudah, hanya mengisi formulir dan

berbagi harapan dan kehidupan,”

hidup sehat, harus diperhatikan pula

Provinsi Lampung. ’’Latar belakang

menyertakan surat pernyataan untuk

tuturnya. (cia/c1/tru)

asalkan memenuhi persyaratan empat sehat lima sempurna.

Saat ini, lanjutnya, baru 30 orang

Kini dengan jumlah yang masih 30

komunitas ini memang untuk

Inspiration 14

20 MARET 2011

Ir. Hj. Yeni Prihati, Konsultan Teknik

Perempuan Juga Bisa Sukses

Nama Lahir Alamat Jabatan

: : : :

Ir. Hj. Yeni Prihati Kotabumi, 01 Maret 1970 Jl. Waykanan No. 17, Pahoman, Bandarlampung - Direktris CV Recacipta Lestari - Wakil Direktris PT Padma Kaweda Utama


: Hi. Toha, S.T.

ANAK-ANAK : - Rachma Fajrina - M. Padil Faturrahman - M. Fachri Hisyam RIWAYAT PENDIDIKAN: - SDN 13 Kotabumi Ilir, Lampung Utara - SMPN 3 Tanjungkarang, Bandarlampung - SMAN 1 Tanjungkarang, Bandarlampung - Fakultas Teknik Universitas Lampung

TANTANGAN KARIR Jika Anda Suka kedisiplinan dak kejujuran, bededikasi dan memiliki integritas yang tinggi, serta selalu berfikir aktif dan bekerja secara profesional, mari bergabung bersama kami sebagai: A. KASIR (Kode: KR) Persyaratan: ● Wanita umur maksimal 25 tahun berbadan sehat. ● Pendidikan minimal DIII ekonomi/akuntansi, ● Menguasai mikrosof Office, Berpenampilan Menarik. B. Staf Administrasi (Kode: SA) Persyaratan: ● Pria umur maksimal 25 tahun berbadan sehat. ● Pendidikan minimal DIII ekonomi/akuntansi, ● Menguasai mikrosof Office C. Sales Consultant/Counter (Kode: SC) Persyaratan: ● Pria/Wanita umur maksimal 25 tahun berbadan sehat. ● Pendidikan minimal SLTA ● Menguasai mikrosof ● Berbadan sehat dan berpenampilan menarik. ● Memiliki SIM A dan SIM C ● Memiliki sepeda Motor D. Satuan Pengamanan (Kode: SATPAM) Persyaratan: ● Pria umur maksimal 30 tahun ● Pendidikan minimal SLTA ● Berbadan sehat. D. Office Boy (Kode: OB) Persyaratan: ● Pria umur maksimal 26 tahun ● Pendidikan minimal SLTA ● Berbadan sehat. untuk Ditempatkan di Cabang baru kami di Lautan Berlian BARADATU WAY KANAN diutamakan yang bedomisili di baradatu Lamaran dikirim langsung ke:

Lautan Berlian Jl. Jend. Sudirman No. 36 Kotabumi Lampung Utara 34513 Telp. 0724-21983, 22563


MENJALANI pekerjaan sebagai konsultan teknik, baik pembangunan jalan, gedung, maupun irigasi, diakui Ir. Hj. Yeni Prihati memberikan kepuasan batin, di samping tantangan. Tidak heran jika perempuan kelahiran Kotabumi ini tetap konsisten menekuni bidang yang telah digelutinya sejak 21 tahun lalu itu. ’’Melalui bidang ini, saya merasa kemampuan berkarya antara lelaki dan perempuan bisa disetarakan. Karena bukan hanya pria, perempuan pun bisa sukses di bidang ini,’’ ungkap direktis perusahaan konsultan pembangunan, CV Recacipta Lestari ini. Diakui Yeni, sama seperti bidang lain, banyak hal yang harus dilewatinya sehingga sekarang dirinya memiliki dua perusahaan konsultan teknik pembangunan. ’’Dulu saya hanya karyawan biasa, sama seperti orang kebanyakan. Makanya waktu saya hampir habis di lapangan. Karena waktu itu posisi saya sebagai bagian perencanaan yang harus melakukan survei,’’ katanya kepada Radar Lampung. Tetapi dengan sistem manajemen waktu yang diterapkannya, dia bisa mengatasi permasalahan tersebut dengan baik. ’’Sempat kewalahan, karena saya juga harus berperan sebagai ibu, istri, dan juga karyawan,’’ ujarnya sambil mengaku selalu berusaha memaksimalkan waktu untuk istirahat dan keluarganya. Alhamdulillah, imbuh Yeni, masalah itu dapat diatasi dengan baik. Sehingga pada 1998, dia mulai mendirikan perusahaan konsultan pembangunan sendiri. ’’Setelah punya kantor sendiri, urusan saya jadi lebih ringan. Karena saya tinggal menjalankan peranan dalam mengontrol sistem manajemen perusahaan,’’ katanya. Dengan begitu, dirinya pun bisa fokus pada keluarga. ’’Kebetulan dari pagi sampai sore, anak-anak full belajar. Jadi waktu itu saya gunakan untuk bekerja. Tetapi setelah anak-anak pulang sekolah, saya lebih banyak dengan mereka,’’ terang ibu tiga anak ini. Yeni mengaku selalu mendampingi anakanaknya belajar, melakukan diskusi tentang mata pelajaran, hingga melakukan cek PR anakanaknya. ’’Makanya walaupun saya dan suami sibuk, prestasi anak-anak bagus. Saya bangga karena anak pertama masuk kelas akselerasi di SMAN 2 Bandarlampung. Dan yang kedua selalu juara di SD Teladan,’’ tuturnya. Semua itu, kata dia, merupakan karunia Tuhan yang tidak terrnilai harganya. ’’Bila sukses dalam karir dan bisa membuat anakanak terus bersemangat, maka saya rasa tak ada yang membahagiakan selain pencapaian itu semua,’’ terang Yeni. Ia mengaku selalu memberikan wejangan kepada anak-anaknya agar selalu menjadi yang nomor satu di segala bidang, terutama pendidikan. (nui/c1/tru)



Nikmat Saja, yang Penting Kuncinya Ikhlas SOSOKNYA sederhana, tapi ia dikenal seorang yang gigih dan begitu bertanggung jawab terhadap pekerjaannya. Hi. Ismail Zulkarnain, namanya. Pria ini punya peran penting dalam mengasuh Yayasan Yatim Piatu Riyadhus Sholihin. Menariknya, hasil usaha dari profesi yang digeluti dicurahkannya untuk membangun

kemampuan dan kepribadian puluhan anak yatim piatu yang berada di kompleks Vila Mas, Jl. Dr. Harun 2, Kotabaru, Tanjungkarang Timur. Berikut petikan wawancara singkat M. Syaiful Amri dari Radar Lampung dengannya kemarin. Yayasan Yatim Piatu Riyadhus Sholihin namanya makin tenar seiring dengan prestasi yang dicapai anak asuh? Alhamdulillah, ini berkah dan kerja keras anak-anak. Ya, ada empat piala yang menghiasi pondok kami sekarang dari ajang

Nama TTL Alamat Pekerjaan Istri Anak

: : : : : : :

MTQ Tingkat Kota Bandarlampung yang kami raih beberapa hari lalu. Pertama, diraih Abdul Hafid (juara II tartil), Marselina (juara III hafidzoh 1 juz), Desiana (juara II hafidzoh 5 juz), dan Kholida (juara III qiroat). Apa tidak repot mengurus pekerjaan sambil mengasuh anak-anak dengan kompleksnya masalah dan kebutuhan? Kalau repot, ya pasti. Tapi, ini bukan masalah bagi saya. Semua dinikmati dengan hati yang ikhlas. Soal kebutuhan, alhamdulillah Allah selalu memberikan jalan keluar. Syukurnya, hingga kini

yayasan kami tidak pernah meminta bantuan dari pemkot maupun pemprov. Bantuan terus mengalir dari berbagai pihak yang peduli dengan nasib dan masa depan anak-anak. Apa yang selama ini menginspirasi Anda dalam membangun yayasan itu? Sederhana, awalnya muncul dari rasa iba dan keprihatinan saya terhadap mereka. Saya melihat anak yatim mempunyai potensi yang luar biasa. Buktinya, begitu kita bina dengan baik dan profesional, ternyata mereka pun menunjukkan kualitasnya.

Hi. Ismail Zulkarnain Bandarlampung, 19 Juli 1972 Jl. Dr. Harun 1 Gg. Haji Wirna, Kotabaru, Tanjungkarang Timur Kontraktor Siti Musyarofah 1. Mazaya Linda Shilmina 2. Kiagus Muhammad Suharto

ORGANISASI: - Ketua Umum Laskar Pembaruan Masyarakat Lampung - Pendiri dan Pembina Yayasan Yatim Piatu Riyadhus Sholihin - Pimpinan Orkes Gambus El-Mihrob - Pimpinan Debus Laskar Lampung - Ketua Aspeknas Kota Bandarlampung

Ini yang membuat saya terharu dengan prestasi dari tingkat daerah sampai nasional. Desian, misalnya. Karena berprestasi mendapatkan hadiah umrah dari IPH (Ikatan Persaudaraan Haji Indonesia). Dia hafal Alquran lima juz. Lalu, Ambar sempat duduk sebagai juara satu MTQ Tingkat Kabupaten Pesawaran dan insya Allah dipercaya mewakili daerahnya di tingkat provinsi. Masih banyak contoh lainnya. Ini yang membuat saya bangga. Bukan kemiskinan yang kita jual, tapi prestasi yang kita tonjolkan umat. (ful/c2/adi)





Lagi, Yummie-Royco MAGCess Digelar SETELAH sukses menggelar Royco Ebi MAGCess di lapangan rumput di Perumahan Sukajaya Darat, Lempasing, Pesawaran, yang dipadati ratusan peserta Minggu (13/3) lalu, Yummie For Her Radar Lampung bekerja sama dengan PT Unilever Area Lampung kembali melaksanakan kegiatan tersebut hari ini di Lapangan Radar Lampung di Jalan Sultan Agung, Kedaton, Bandarlampung. Kegiatan yang digelar tersebut tak jauh berbeda dengan sebelumnya. Yakni lomba masak dan yelyel, serta lomba poco-poco jingle Royco. Dengan hadiah utama satu unit televisi, cooking set, tea set, serta ratusan hadiah menarik lainnya. Adapun kriteria lomba, satu kelompok terdiri lima anggota. Pemenang akan ditentukan dari nilai akumulasi cooking competition dan poco-poco. Dan setiap anggota harus membeli dua lusin Royco untuk menjadi peserta lomba. Adapun gift bagi pemenang yakni juara satu akan mendapatkan uang senilai Rp250 ribu, juara dua Rp200 ribu, dan juara tiga Rp150 ribu. Operation Manager Business Partner PT Unilever Area Lampung Romi Junanto mengatakan, pada kegiatan ini juga akan ada kupon raffle atau kocok arisan. Untuk pembelian satu lusin Royco akan mendapatkan satu kupon raffle. ’’Sementara untuk pembelian dua lusin Royco akan mendapat satu kupon raffle dan satu kupon doorprize. Sedangkan untuk pembelian tiga lusin akan mendapatkan dua kupon raffle dan dua kupon doorprize,” katanya. Dia meneruskan, bersama dengan Yummie For Her, Royco juga akan melakukan roadshow ke 30 tempat di Provinsi Lampung. ’’Kami tidak akan umumkan tempatnya. Karena kami pilih lokasinya sebagai surprise bagi masyarakat,’’ terang Romi. Dijelaskan, masyarakat Lampung wajib menggunakan Royco Ebi MAGCess. Karena varian baru dari Royco ini secara khusus diformulasikan bagi masyarakat Lampung yang suka ebi dan juga terasi. ’Di Lampung kan rata-rata masyarakat mencampur masakannya dengan ebi. Makanya Royco hadirkan varian ini yang diciptakan setara dengan ebi asli,’’ ujarnya. Makanya dengan harga Rp350, masyarakat sudah bisa merasakan kelezatan ebi yang terkandung dalam Royco Ebi MAGCess. ’’Jadi untuk mendapatkan masakan dengan rasa ebi, Anda tidak perlu lagi mengeluarkan biaya yang mahal untuk membeli ebi. Sebab, Royco Ebi sekarang hadir untuk masyarakat Lampung,’’ pungkasnya. (cia/c1/tru)


20 MARET 2011


ala Sendok Mas


Terinspirasi Komik Donald Bebek NAMA Sendok Mas untuk rumah makan ini dipilih bukan tanpa alasan. Menurut Ivong, nama tersebut diberikan oleh putranya, Jonathan, yang hobi membaca kartun Donald Bebek dan Paman Gober. ’’Dalam cerita komik tersebut, Paman Gober memiliki sebuah restoran bernama Sendok Mas yang selalu ramai dikunjungi pelanggan dan membawa banyak uang. Dengan nama itu, kami berharap hal serupa terjadi di rumah makan ini,” ungkap Ivong. Namun tentunya, sebuah nama hanya sebagai pendukung. Sebab bagi Ivong, yang utama adalah ide menu dan rasa yang disajikan kepada konsumen harus memiliki cita rasa spesial. Ivong mengatakan, ide membuka rumah makan ini berasal dari sang suami, Ongko Wijoyo. Apalagi dirinya sendiri hobi masak dan sering hunting makanan ke berbagai restoran di Indonesia. ’’Karenanya saya dan suami membuka rumah makan dengan konsep open kitchen, bahwa setiap konsumen dapat melihat makanannya diolah dengan tetap menjaga kebersihan,” jelas wanita ramah ini. Ia mengatakan, rumah makan miliknya yang buka setiap hari, kecuali Senin tersebut, menyediakan berbagai menu yang menggugah selera. Mulai sarapan pagi hingga makan malam. Untuk sarapan pagi, menu yang tersedia seperti nasi uduk, nasi uduk komplet, lontong sayur komplet, bubur ayam, ayam goreng, paru goreng, babat goreng, dendeng sapi, tahu tempe bacem, kopi susu, dan kopi luwak. Itu dapat dinikmati pukul 07.00-10.30 WIB. Dan setelah jam tersebut hingga pukul 21.00 WIB aneka makanan lezat lainnya seperti sop buntut, soto Betawi, gado-gado, steak, iga bakar, pecel lele, lumpia udang, pindang ayam, pindang iga, pindang ikan, cumi, dan rawon siap menyambut pelanggan. (cia/c1/tru)

JIKA Anda pencinta kuliner yang unik, wajib mencoba nasi bakar komplet ala Sendok Mas. Tidak hanya rasanya yang unik, saat mulai menyantap makanan ini, Anda akan dibuat terkejut. Mengapa? Pasalnya ini bukan nasi biasa, berbagai rasa tersedia. Menu yang disajikan rumah makan di Jalan Ahmad Yani, Bandarlampung, ini dibungkus dengan daun pisang. Di dalamnya telah terisi daun melinjo, jamur kaleng, daging ayam, udang, dan cabai rawit. Campuran bahan-bahan makanan tersebut akan Anda dapatkan dalam nasi bakar. Acara makan Anda pun akan sempurna karena nasi bakar yang disajikan bersama ayam goreng atau bakar, tempe, tahu, dan sambal goreng. Pemilik Rumah Makan Sendok Mas Ivong mengungkapkan, rasa yang disajikan benar-benar berbeda, apalagi terlebih dahulu dikukus selama lima menit lalu dibakar.

’’Kami juga akan menyajikan uduk bakar komplet dengan penyajian yang hampir sama. Hanya, setengah nasi uduk bakar tersebut akan dicampur dengan bawang goreng,” tutur Ivong. Harganya, kata dia, terjangkau. ’’Jadi tidak perlu khawatir karena seperti nasi bakar komplet dibanderol Rp27 ribu per porsi,” sebut dia. Dan berbagai menu lezat lainnya pun dapat Anda nikmati di rumah makan yang buka mulai pukul 07.00 hingga 21.00 WIB setiap harinya ini. Lain lagi dengan menu ikan gurame bakar. Menu yang satu ini diracik dengan resep rahasia keluarga menggunakan rempah-rempah seperti bawang merah, bawang putih, garam, serta kunyit yang akan dibumbu selama satu jam dan dimasukkan dalam kulkas. Tujuannya agar bumbu-bumbu tersebut meresap sampai bagian terdalam ikan. (cia/c1/ tru)




Tiga Kali Diterjang Puting Beliung PRINGSEWU - Untuk kali ketiga di tahun 2011, Kecamatan Sukoharjo, Pringsewu, diterjang angin puting beliung. Terakhir kemarin pukul 16.00 WIB. Hujan yang disertai puting beliung merontokkan atap rumah warga serta menumbangkan puluhan pepohonan di Dusun 7 RT 01 Pekon Sukoharjo, Kecamatan Sukoharjo. Meski tak ada korban jiwa, aparatur pekon terus melakukan pendataan. Ini mengingat puting beliung itu sempat membuat warga ketakutan.

Warga Gadingrejo Ahmad Muslim yang melintas di tempat itu juga sempat kaget atas kerasnya tiupan angin. ’’Pohon sampai roboh Mas. Begitu juga rumah warga, gentingnya pada rontok,” kata pria yang biasa disapa Mat Tehe ini. Dari informasi yang dikumpulkan, sebelum angin bertiup kencang pukul 16.00, terlebih dahulu turun hujan. Setelah beberapa saat hujan deras, lalu muncul angin kencang itu. ’’Awalnya hujan, setelah itu baru anginnya bertiup

kencang,” kata Ketua RT 02 Rasidi. Diungkapkannya, angin begitu kencang berputar-putar. Rasidi yang saat itu sedang membersihkan saluran air yang mampet mengaku melihat dengan jelas angin dari arah selatan seperti gulungan asap bertiup menuju wilayahnya. Setelah itu hujan yang turun cukup deras berhenti. ’’Angin dari selatan berputar-putar cukup kencang,” sebutnya. Meski hanya sekitar dua menit, tiupannya sempat membuat sejumlah

atap rumah warga beterbangan. ’’Di tempat kami, ada tiga rumah yang atapnya beterbangan dan kondisinya cukup parah. Yakni kediaman Yasil (56), Bejo (45), dan Naslim (46). Sementara beberapa rumah lain gentingnya juga ikut rontok, namun tak separah di tiga rumah itu,” jelasnya. Sebelumnya, puting beliung di Sukoharjo terjadi pada Sabtu (12/2) sekitar pukul 17.30. Dari data yang dimiliki kecamatan, setidaknya 59 bangunan rusak akibat musibah ini.

Puting beliung juga menerjang Sukoharjo serta merembet ke Kecamatan Banyumas pada Selasa (22/2) pukul 16.15. Akibatnya rumah, atap sekolah, serta lahan pertanian dan perkebunan di Pekon Sinarbaru Kecamatan Sukoharjo dan Pekon Banjarejo Kecamatan Banyumas rusak. Sedikitnya 6 rumah, 2 unit bangunan SD, dan 2 kandang ternak milik warga di Pekon Sinarbaru, termasuk 100 batang pohon kakao rusak akibat dahannya patah. (rnn/sag/c1/adi)

Polisi: Iwan, Menyerahlah! GUNUNGSUGIH - Kapolres Lampung Tengah AKBP Budi Wibowo meminta agar Iwan (34), tersangka pembunuhan terhadap Safe’i alias Buyung (27), warga Jalan A. Yani Kelurahan Bandarjaya Barat, Terbanggibesar, segera menyerahkan diri. ’’Walaupun terus-menerus sembunyi dan kabur dari pengejaran polisi, tetap saja nantinya tertangkap. Bahkan akan diambil tindakan tegas kalau tidak cepat menyerahkan diri,’’ pungkas Kapolres melalui Kapolsek Terbanggibesar AKP Ariefaldi kemarin. Kapolsek yang didampingi Kanitreskrim Aiptu Anwar Halusi mengatakan, saat ini anggotanya masih memburu tersangka ke sejumlah daerah. Seperti Lampung Timur dan Tulangbawang. ’’Sebab di Lamtim tempat tinggal orang tua Iwan. Kalau pelakunya tidak ada di sana, maka sebagian anggota saya telah bergerak ke Menggala, Tuba,’’ paparnya. Diketahui, Iwan menghabisi tetangganya Safe’i pada Jumat (17/3) pukul 02.00 WIB. Tukang becak tersebut tewas dengan luka tusukan senjata tajam jenis badik di punggung hingga tembus, bahu, dan dada. Sementara, pelaku kabur usai membunuh korban. Diduga, pembunuhan tersebut terjadi akibat korban dan pelaku sempat ribut soal tunggakan listrik di bedeng yang mereka tempati. Pelaku menegur korban selama dua bulan tinggal di bedeng belum bayar listrik. Padahal, pelaku juga belum membayar listrik, bahkan sudah enam bulan. ’’Mungkin penyampaian istri Iwan bernama Rahma Yuli kepada suaminya berlebihan, akhirnya terjadilah seperti ini,’’ kata Rama, istri Safe’i di rumah orang tuanya, Jl. Hasanudin, Bandarjaya Barat. Sebenarnya, lanjut Rama, suaminya telah meminta maaf akan keributan tersebut. Namun, dini hari itu pelaku datang dan mengetuk pintu, membangunkan mereka yang tengah tertidur. ’’Kata Iwan, ada urusan penting. Saya dan suami pun bangun menghampirinya. Tidak lama dari itu, saya disuruh masuk ke dalam rumah, dan dikatakan sebentar lagi selesai,’’ terang Rama. Beberapa menit di dalam rumah, Rama mendapat kabar dari para tetangga bahwa suaminya sudah berada di Puskesmas Bandarjaya dalam keadaan meninggal dunia akibat luka di tubuhnya. ’’Nah, dari situlah saya shock dan trauma karena meninggalnya suami saya ini pasti perbuatan Iwan,’’ ucapnya. (rnn/c1/adi)


HUT LAMPUNG Wakil Bupati Lampung Selatan Hi. Eki Setyanto, M.M. membacakan sambutan gubernur Lampung pada sidang paripurna DPRD setempat dengan agenda peringatan HUT Ke-47 Provinsi Lampung, Jumat (18/3) lalu.


Pembangunan Mandek PEMBANGUNAN dua gedung perpustakaan di Kecamatan Semaka, Tanggamus, masing-masing di SDN 3 Sukaraja dan SDN I Sudimoro, mandek. Pembangunan yang anggarannya berasal dari dana alokasi khusus (DAK) pendidikan tahun 2010 itu tak jelas kapan dilanjutkan. Kepala SDN 3 Sukaraja Budiono, S.Pd. mengatakan, tahun 2010 sekolahnya mendapatkan proyek pembangunan perpustakaan melalui DAK bidang pendidikan. Namun, hingga kini pembangunan mandek dan tidak jelas kapan akan dilanjutkan. Kepala SDN 1 Sudimoro Alifi, S.Pd. juga memberikan keterangan yang sama. Menurutnya, pengerjaan gedung perpustakaan di sekolahnya baru terealisasi sekitar 80 persen. Terpisah, Kepala UPT Pendidikan Kecamatan Semaka Chotib, S.Pd.I. ketika dikonfirmasi tak dilanjutkannya pengerjaan kedua proyek itu karena waktu pelaksanaannya sudah habis. (rnn/sag/c1/adi)


Butuhkan Akses Jalan FOTO TAMRIN/RNN

DIMINTAI KETERANGAN: Tujuh pasangan mesum yang terjaring razia di beberapa hotel di wilayah Bandarjaya, Lampung Tengah.

Pasangan Mesum Terjaring Operasi GUNUNGSUGIH - Tujuh pasangan bukan suami-istri terjaring Operasi Penyakit Masyarakat (Pekat) di beberapa hotel di Bandarjaya, Lampung Tengah, kemarin pukul 10.00 WIB. Mereka dipergoki saat sedang berbuat mesum di dalam kamar bersama pasangannya dalam Operasi Pekat yang digelar aparat Polsek Terbanggibesar.

Ketujuh pasangan tersebut yakni Ari (24), warga Bandarjaya, berpasangan dengan Linda (20), warga Lampung Timur; Untung (24), warga Yukumjaya, berpasangan dengan Ana (35), warga Kotagajah; Anton (31), warga Bandarjaya, berpasangan dengan Yi (17), warga Yukumjaya; dan Rupi (35), warga Terusannunyai, berpasangan dengan Riadi (25), warga Gayabaru. Kemudian Afrial (23) berpasangan dengan Fitri (19), keduanya warga Waypengubuan; Sucipto (45) berpasangan dengan Atun (45), keduanya warga Seputihmataram; dan Wasidi (48), warga Argomulyo, Lampung Timur,

kepergok berpasangan dengan Iin (26), warga Sekampung, Lamtim. Kanitreskrim Polsek Terbanggibesar Aiptu Anwar Halusi mendampingi Kapolsek AKP Ariefaldi mengatakan, Operasi Pekat ini dilakukan di wilayah Bandarjaya. Tujuan operasi adalah di losmen dan hotel. Ketujuh pasangan itu saat dirazia tengah berada di dalam kamar. ’’Untuk pasangan yang terjaring ini akan didata dan diberikan pembinaan. Sedangkan yang masih berstatus pelajar, orang tuanya akan dipanggil dan diberikan pengarahan,’’ pungkasnya. (rnn/c1/adi)

Belum Semua Ormas Terdaftar KALIANDA - Badan Kesatuan Bangsa, Politik, dan Perlindungan Masyarakat (Kesbangpolinmas) Lampung Selatan mengakui belum semua organisasi masyarakat dan LSM terdaftar pada satuan kerjanya. Karena itu, Kesbangpolinmas meminta agar ormas dan LSM yang berada di kabupaten tersebut mendaftarkan diri. Satker ini merilis, setidaknya baru sekitar 40 ormas dan LSM yang terdaftar. ’’Memang sudah seharusnya ormas dan LSM mendaftarkan diri di Kesbang,” kata Kepala Kesbang-

polinmas Lamsel Novandra kemarin. Sayangnya, dia tidak menyebutkan secara rinci ormas maupun LSM yang belum mendaftarkan diri. Ia hanya menegaskan, pihaknya selalu terbuka bagi LSM, ormas, maupun OKP untuk mendaftarkan diri. Menurutnya, selain harus mendaftarkan diri di Kesbangpolinmas, untuk menegaskan eksistensinya, sebuah organisasi, ormas, maupun LSM harus berbadan hukum, memiliki aturan berupa anggaran dasar (AD) maupun anggaran rumah tangga (ART), memiliki kepengurusan, serta memiliki

domisili atau sekretariat yang jelas. Novandra menegaskan ormas, LSM, maupun organisasi harus mendaftarkan diri di Kesbangpolinmas agar keberadaannya mudah didata dan kegiatannya juga dapat diketahui pemerintah. ’’Jangan sampai organisasi, ormas, maupun LSM itu aktif, namun tidak terdaftar,” tandasnya. Mantan kepala Bagian Perekonomian Pemkab Lamsel itu juga mengungkapkan, keberadaannya harus jelas karena pemkab juga berharap organisasi, LSM, maupun

OKP di kabupaten itu dapat bahumembahu membangun Lamsel. Baik melalui kegiatan-kegiatannya ataupun dengan memberikan sumbang saran kepada pemkab. Ditegaskan pula, pihaknya akan terus menjalin kerja sama dengan organisasi kemasyarakatan. Sehingga, organisasi itu dapat berperan dalam membangun Lamsel ke depan. Novandra juga mengimbau agar organisasi maupun lembaga yang ada di masyarakat itu dapat menjalankan tugas dan fungsinya sesuai bidangnya masing-masing. (dur/c1/adi)

AKSES jalan untuk mengangkut hasil pertanian di Lampung Selatan masih sangat terbatas. Selain jalan, pompanisasi (pompa air) dan sarana irigasi juga akan menjadi fokus pembenahan pertanian di Lamsel. Ini dilakukan agar target produktivitas pertanian pada tahun-tahun mendatang bisa lebih meningkat. Demikian rumusan hasil Musyawarah Rencana Pembangunan Bidang Pertanian (Musrenbangtan) Dinas Pertanian, Tanaman Pangan, dan Hortikultura (DPTPH) Lamsel bersama satuan kerja perangkat daerah (SKPD) lingkup Kementerian Pertanian belum lama ini. Kepala DPTPH Lamsel Ir. Muverdi C.H. mengatakan, jalan untuk pertanian yang dimiliki Kabupaten Lamsel masih sangat kurang. Akibatnya biaya angkutan hasil pertanian menjadi naik. Dan hal itu akan menjadi kendala tersendiri bagi para petani. ’’Jalan usaha tani ini sangat dibutuhkan para petani,” kata Muverdi. (rnn/c1/adi)


85% Sudah Dipanen SEBAGIAN besar atau sekitar 85 persen tanaman padi milik petani di Kecamatan Sendangagung, Lampung Tengah, sudah dipanen. Hal itu seperti disampaikan M. Tamrin, A.Md. selaku KUPTD Pertanian Kecamatan Sendangagung saat rapat koordinasi bulanan di kecamatan setempat. Dikatakan, tanaman padi milik petani Sendangagung seluas kurang lebih 1.342 hektare telah dipanen. ’’Kami turut bersyukur karena panenan musim rendeng tahun ini berhasil meningkat 5 persen dari musim sebelumnya,” ujar dia. Tamrin juga mengatakan, untuk tanaman padi di wilayah Sendangagung, pada musim rendengan ini terbilang cukup bagus. Itu salah satunya karena minimnya hama atau penyakit yang menyerang tanaman padi milik petani. Ditunjang pula oleh cuaca yang memang sangat mendukung. Yaitu cukupnya curah hujan, yang membuat persediaan air dapat memenuhi kebutuhan pengairan untuk tanaman padi tersebut. (rnn/c1/adi)




PT Pos Perketat Pemeriksaan Kiriman BANDARLAMPUNG – PT Pos Indonesia (Persero) Bandarlampung memperketat pemeriksaan semua paket pengiriman. Koordinasi dengan aparat kepolisian pun segera dilakukan guna menindaklanjuti isu bom buku. Meskipun, hingga kini belum ditemukan kejanggalan dari paket-paket pengiriman yang ada. Supervisor Marketing Mail and Logistic PT Pos Indonesia Bandarlampung Dadi Efendi mengatakan, upaya ini sebagai bentuk pengamanan. Terlebih prosedur pengecekan paket hanya menggunakan sistem manual tanpa dibantu alat detektor. ’’Semua masih manual. Tapi, kami berupaya memperketatnya,” ujar Dadi kemarin. Untuk memperketat pengamanan, sambung Dadi, setiap paket pengiriman yang masuk dibuatkan nama, alamat lengkap, disertai nomor registrasi bagi pengirim. Bahkan monitor CCTV disiapkan untuk memantau pengunjung yang melakukan aktivitas saat menyerahkan paket. ’’Ada beberapa CCTV yang kami pasang di loket pengiriman. Ini salah satu upaya mendeteksi orang-orang mencurigakan yang

ternyata kedapatan membawa paket berbahaya,” bebernya. Tidak cukup sampai di sini. Pihaknya juga bekerja sama dengan Bea Cukai, termasuk pihak Karantina Panjang, untuk mensterilisasi paket masuk. Tugas dan fungsi dua lembaga itu hampir sama, meski sedikit berbeda. Pihak karantina, misalnya, bertugas memeriksa dan memberikan izin berupa sertifikasi layak kirim terhadap paket tumbuh-tumbuhan yang ditakutkan mengandung bakteri atau virus yang membahayakan. Begitu pula dengan pihak Bea Cukai, memeriksa paket-paket elektronik yang ternyata produknya dari luar negeri, maka tidak dikeluarkan izin pendistribusian paketnya. Dikatakannya pula, kasus bom buku tidak memengaruhi jumlah pengiriman paket. Banyak masyarakat memaklumi hal ini dan mereka tidak terlalu khawatir dengan isu bom berbentuk buku atau paket. ’’Kalau dilihat dari jumlah, sama seperti biasanya. Kami mengimbau agar masyarakat tidak terpancing dengan peristiwa yang ada,” pungkasnya. (ful/c2/rim)

Perluasan Bandara Sarat Indikasi KKN TEMUAN AKAR LAMPUNG Rehabilitasi jalan operasional lingkungan sepanjang 13.280 meter dengan pagu anggaran Rp2.164.276.000. Kegiatan pekerjaan perluasan apron, taxiway, termasuk fillet (hotmix + marking 9.600 meter) dengan pagu anggaran Rp8.376.355.000. Kegiatan pengadaan dan peningkatan AFL dan low ke high intensity, termasuk pals dan flood light dengan pagu anggaran Rp12.500.000.000. Kegiatan renovasi gedung terminal (1.364 meter) dengan pagu anggaran Rp639.990.000 Kegiatan pembuatan pagar batas tanah kawat harmonika (setinggi 1,75 meter + 1.000 meter) dengan pagu anggaran Rp499.860.000. Kegiatan pembangunan gedung kargo (288 meter) dengan pagu anggaran Rp993.701.000. Kegiatan lanjutan dan normalisasi sungai tahap II (600 meter) dengan anggaran pagu Rp2.576.988.000. Sumber: Akar Lampung

BANDARLAMPUNG – Program Pemprov Lampung menjadikan Bandara Radin Inten II Branti sebagai bandara internasional patut diacungi jempol. Sayangnya, realisasi program dari APBN 2010 itu belum maksimal serta sarat indikasi korupsi, kolusi, dan nepotisme (KKN). HalinipulayangmendorongLSM Akar Lampung meminta Kejaksaan Tinggi (Kejati) Lampung, termasuk aparat penegak hukum, menindaklanjuti hasil temuan dugaan korupsi pengembangan bandara yang telah diserahkannya itu. Ketua Akar Lampung Indra M. Mengatakan, laporan tidak

hanya diserahkan kepada aparat penegak hukum. Pihaknya pun meminta DPRD Lampung bergerak mengkritisi hal ini. Sejumlah kegiatan yang diduga tidak sesuai spesifikasi dan kontrak pelaksanaan program itu, sambung Indra, di antaranya kegiatan rehabilitasi berat jalan operasional lingkungansepanjang13.280meterdengan pagu anggaran Rp2.164.276.000 (selengkapnya lihat grafis). Sampel kegiatan yang menelan anggaran negara dengan total pagu anggaran mencapai Rp27,4 miliar itu, menurut Indra, patut dikaji kembali dan diperiksa Pemprov Lampung. ’’Dengan harapan, kajian ini menjadikan program emas Pemprov Lampung,” katanya. Rehab berat jalan operasional lingkungan sepanjang 13.280 meter, misalnya, seharusnya pekerjaan jalan itu direalisasikan dengan ketebalan hingga 5 cm lebih. Namun, dari uji pengukuran ketebalan yang hanya 2,5 cm–3 cm sehingga nampak badan jalan kondisinya kini telah banyak mengelupas dan bergelombang. Begitu halnya pada proyek lanjutan dan normalisasi sungai tahap II dengan jarak 600 meter yang pagunya Rp2.576.988.000. Kondisi proyek itu kini nampak carut-marut. ’’Mulai pemasangan batu fondasi talut yang kurang maksimal dalam tingkat penggunaan material sehingga bangunan talutnya nampak telah banyak yang keropos,” imbuhnya. (ful/c2/rim)

Wadanjen Kopassus Tinjau Ekspedisi


SAPA TIM EKSPEDISI: Wadanjen Kopassus Brigjen TNI Agus Sutomo (tengah) menyapa anggota tim ekspedisi di wilayah Tanggamus kemarin (19/3).

Oknum Wasi PT KA Akan Dipolisikan BANDARLAMPUNG – Satu keluarga warga Kotabaru, Kecamatan Lubai, Muaraenim, Sumatera Selatan, akan memolisikan Sunaryo, pengawas seksi (wasi) kantor Perseroan Terbatas Kereta Api (PT KA) Divre Tanjungkarang. Pasalnya, mereka kesal dipermainkan dan uang Rp20 juta nyaris amblas. Burhanan (67), salah satu keluarga itu, mengatakan bahwa dirinya sengaja datang ke Lampung untuk menyelesaikan masalah cucunya, Eko Setyawan (19), yang dijanjikan masuk pegawai PT KA dengan membayar Rp20 juta kepada Sunaryo. Sementara pada pengumuman hasil seleksi penerimaan 12 Maret 2011, nama cucunya tidak ada di pengumuman itu. Keluarganya pun berkali-kali menghubungi Sunaryo yang ada di Lampung, namun selalu menghindar. ’’Saya datang untuk bertemu orang itu (Sunaryo, Red). Sebab, kami dari Palembang mencoba menghubungi via telepon tapi tidak diangkat. Barulah setelah menggunakan nomor lain yang tidak dikenal mau mengang-

katnya. Dalam pembicaraan itu, kami diremehkan seperti tidak ada masalah. Kami sudah bolakbalik Lampung–Palembang, tapi dibalas seperti ini,” tutur Burhanan kemarin. Burhanan menceritakan, setelah cucunya gagal dipantohir Scaba Polri tinggal bersama pamannya, Herman dan Mariani, di bilangan Tanjungsenang, Bandarlampung. Pada Minggu (20/2), Ely Nani (42) (anaknya) mengajak Eko yang diantar Herman (50) dan Mariani (48) mendatangi rumah Sunaryo di bilangan depan stasiun, Labuhanratu. Di sana, mereka bertemu secara kekeluargaan karena mereka masih satu kampung di Muaraenim. ’’Di sana, mereka bincang-cincang tentang bagaimana mencarikan pekerjaan untuk Eko yang sudah tamat SMA,” kata Burhanan saat menyambang Graha Pena Lampung –markas Radar Lampung– kemarin. Lalu, terjadilah pembicaraan ke arah penerimaan di PJKA dengan kesepakatan Rp20 juta. ’’Tapi, ternyata itu semua palsu,” imbuhnya. Ely Nani mengatakan, mereka

datang mengantar uang sepekan setelah kedatangan mereka kali pertama. Uang diterima Sunaryo di rumahnya. Sunaryo sendiri mengaku menjabat sebagai orang kedua di PT KA dan berjanji mengurus Eko hingga ke Bandung. Bahkan, Sunaryo menawarkan untuk mencarikan orang lain lagi yang ingin masuk pegawai PT KA dengan biaya Rp40 juta per orang terima beres. ’’Tadinya kami juga diminta Rp40 juta, tapi karena masih satu kampung diminta Rp20 juta. Kami pun diminta melihat pengumuman di internet dan menyerahkan nomor pendaftaran ke Sunaryo itu,” kata Ely Nani. Setelah menyerahkan uang, Ely kembali ke Palembang. Sementara, Eko menunggu di kediaman pamannya, Herman. Setelah melihat pengumuman ternyata nama Eko dinyatakan tidak lulus seleksi administrasi karena nilainya di bawah 8,5. ’’Sunaryo melalui pesan singkat menyatakan nilai ijazah Eko 7,2. Padahal nilai Eko 7,5 sesuai persyaratan. Kami coba menghubungi, tapi tidak dijawab. Baru kakeknya Eko menghubungi dengan nomor lain diangkatnya.

Kami juga tidak dianggap ada dan dengan enteng menjawab, ’’Kalian kan minta tolong.’’ Dia tidak menyuruh kami datang,” terangnya. Keluarga korban pun bermusyawarah keluarga untuk melaporkan Sunaryo kepada polisi. Mengetahui itu, Sunaryo buruburu mengembalikan uang Rp20 juta ke rumah paman korban. Sementara saat dikonfirmasi via ponsel, meski aktif, Sunaryo enggan mengangkat. Demikian juga pesan singkat tidak dibalasnya. Terpisah, Humas PT KA Divre Lampung Zakaria menyatakan, dirinya sangat menya yangkan ulah oknum pegawai PT KA itu. Pasalnya, proses penerimaan pegawai di lingkungan PT KA diumumkan melalui website dan langsung dikelola PT KA Pusat. ’’Jika benar, itu sangat disayangkan. Sebab, masuk PT KA tidak dijualbelikan. Semua melalui proses tes dan dikelola pusat,” kata Zakaria semalam seraya mengatakan, pihaknya akan melaporkan kasus itu ke pimpinan dan akan melakukan proses internal PT KA. (ful/c2/rim)

KOTAAGUNG – Wadanjen Kopassus Brigjen TNI Agus Sutomo meninjau langsung ekspedisi (penyelidikan ilmiah) Bukit Barisan 2011 oleh TNI dan kalangan akademisi di wilayah Kabupaten Tanggamus kemarin (19/3). Pos korlap ekspedisi yang ditinjau itu berada di lereng Gunung Tanggamus, Pekon Tanjunganom, Kecamatan Kotaagung Timur. Sutomo tiba di Makodim 0424 Tanggamus pada pukul 09.20 WIB. Turut mendampingi sejumlah perwira, di antaranya Mayor Inf. Susilo, Mayor Inf. Ari Yulyanto, Mayor CBA Rahmat, Mayor CBH Trisano, dan Dandim 0424 Letkol Inf. Parada Siringo Ringo. Transit beberapa saat, Sutomo kemudian menuju lokasi pos ekspedisi untuk melihat sejauh mana kegiatan para tim ekspedisi. Pada kunjungan ini, Sutomo pun mendapat pemaparan tim ekspedisi atas berbagai hal yang ditemukan dalam kegiatan itu. Misalnya, ditemukannya perambahan hutan, pembakaran hutan, dan kerusakan hutan karena faktor alam lainnya. Selanjutnya ditemukannya flora dan fauna langka, katak tanduk kuning, kotoran hewan langka, tumbuhan anggrek, serta beragam tumbuhan langka lainnya. Selain itu, tim juga menemukan beragam potensi sumber daya alam seperti panas bumi berikut sejumlah titik posisi lokasi rawan terjadi bencana, khususnya di daerah Ulubelu. Kegiatan ekspedisi akan terus bergulir. Rencananya pada 18 April 2011 mulai ke arah Taman Nasional Bukit Barisan Selatan Tampang Belimbing. Sutomo dalam pengarahannya mengatakan, beragam temuan yang didapat dari hasil kegiatan ekspedisi itu harus ada pertanggungjawaban akademis (ilmiah). Yakni membuat buku atas semua temuan dalam kegiatan itu. Buku itu akan diserahkan kepada pemerintah sebagai bukti pertanggungjawaban akademis. ’’Di mana dalam sekian tahun kemudian, beragam hasil temuan itu akan bermanfaat bagi anak cucu kita,” tuturnya. Sedangkan mengenai kurangnya tenaga ahli, Sutomo berjanji segera mengoordinasikan hal itu. Lalu, terkait ditemukannya kerusakan hutan karena perambah, tim ekspedisi diminta melakukan koordinasi dengan pihak kepolisian. Usai meninjau pos ekspedisi, Sutomo kembali ke Makodim 0424 untuk beramah-tamah dengan Bupati Tanggamus Bambang Kurniawan dan jajarannya. Pada kesempatan itu, Sutomo juga memberikan bantuan kepada 35 orang anak yatim piatu dari Kecamatan Kotaagung. (ehl/c2/rim)


Bukan Sekadar Berita!


Koin untuk Dewan Ngemis FOTO WAHYU SYAIFULLAH

SAMBANGI DAPUR REDAKSI: Peserta diklat jurnalistik Ikatan Mahasiswa Muhammadiyah (IMM) Komisariat IAIN Raden Intan Bandarlampung menyambangi dapur redaksi Radar Lampung tadi malam (19/3). Mereka juga sempat menyaksikan langsung audisi pelawak Lampung di studio Radar TV.

Perketat Pemeriksaan Paket Pengiriman BANDARLAMPUNG – PT Pos Indonesia (Persero) Bandarlampung memperketat pemeriksaan semua paket pengiriman. Koordinasi dengan aparat kepolisian pun segera dilakukan guna menindaklanjuti isu bom buku. Meskipun, hingga kini belum ditemukan kejanggalan dari paket-paket pengiriman yang ada. Supervisor Marketing Mail and Logistic PT Pos Indonesia Bandarlampung Dadi Efendi mengatakan, upaya ini sebagai bentuk pengamanan. Terlebih prosedur pengecekan paket hanya menggunakan sistem manual tanpa dibantu alat detektor. ’’Semua masih manual. Tapi, kami berupaya memperketatnya,” ujar Dadi kemarin. Untuk memperketat pengamanan, sambung Dadi, setiap paket pengiriman yang masuk dibuatkan nama, alamat lengkap, disertai nomor registrasi bagi pengirim. Bahkan monitor CCTV disiapkan untuk memantau pengunjung yang melakukanaktivitassaatmenyerahkanpaket. ’’Ada beberapa CCTV yang kami pasang di loket pengiriman. Ini salah satu upaya mendeteksi orang-orang mencurigakan yang

BANDARLAMPUNG – Tindakan Komisi B DPRD Bandarlampung ’’mengemis” kepada pelaku usaha berbuntut panjang. Sejumlah elemen masyarakat mulai angkat suara terkait ulah wakil rakyat itu. Salah satu bentuk protes elemen masyarakat itu muncul dari Jaringan Kerakyatan (JK) yang berencana menggalang pengumpulan koin di sejumlah pabrik untuk Komisi B DPRD setempat. ’’Jika dana yang sudah dialokasikan dalam APBD dan upeti pengusaha belum cukup membiayai kebutuhan anggota dewan, kami siap membantu mereka (anggota dewan, Red),” ungkap Ketua JK Rakhmat Husein kepada harian ini kemarin. Gagasan pengumpulan koin untuk anggota Komisi B DPRD Bandarlampung ini sudah disepakati seluruh unsur buruh di kota

ini. ’’Kalau tidak ada aral-melintang, kami mulai mengumpulkan koin pada minggu depan. Kini kami sedang melakukan konsolidasi,” katanya. Menurut Rakhmat, perbuatan komisi B yang meminta jatah dari para pengusaha secara tidak langsung memengaruhi rendahnya upah minimum kota (UMK) selama beberapa tahun belakangan ini. ’’Para pengusaha terpaksa mengalihkan upah karyawannya untuk memberikan upeti kepada eksekutif dan legislatif,” bebernya. Terpisah, Badan Kehormatan (BK) DPRD Bandarlampung belum melakukan klarifikasi terhadap anggota komisi B. Ini karena rombongan komisi baru kembali ke kota ini pada Jumat (18/3). ’’Mudah-mudahan pekan depan bisa dimulai proses klarifikasinya,” singkat Ketua BK Yusuf

Effendi kemarin. Tindakan Komisi B DPRD Bandarlampung yang menebar surat mohon partisipasi ini dinilai melanggar etika dan kode etik anggota dewan. Sebab, perbuatan wakil rakyat yang duduk di komisi B ini telah melampaui kewenangannya sebagai legislator. Ketua Bidang Pengkajian Konstitusi dan Peraturan Perundang-undangan Fakultas Hukum Universitas Lampung (FH Unila) Muhtadi mengatakan, perbuatan anggota Komisi B DPRD Bandarlampung itu tidak patut secara hukum maupun etis. ’’Jika pelaku usaha dimintai dana, akan memengaruhi biaya produksi. Dampak ini pastinya akan dibebankan kembali kepada masyarakat. Ongkos produksi akan bertambah mahal karena perbuatan anggota dewan,” urai

tenaga pengajar Hukum Tata Negara FH Unila. Menurut Muhtadi, pelaku usaha juga sudah memiliki kewajiban membayar pajak dan retribusi kepada daerah. ’’Dana pajak dan retribusi yang sudah dibayar pelaku usaha itu kan kembali kepada anggota dewan itu,” katanya. Hal senada disampaikan akademisi Unila Arizka Warganegara. Dosen Fisipol Unila ini menuturkan, perbuatan komisi B sudah melanggar nilai etika. ’’Jika bergerak secara personal, sudah melanggar etika. Dalam aturan manapun, apa yang dilakukan komisi B itu tidak dapat dibenarkan. Ini sudah melanggar etika politik,” ungkapnya. Cara seperti ini, lanjut Arizka, memang tidak pernah menjadi kebiasaan para wakil rakyat. Terlebih lagi, anggota dewan yang hen-

dak melakukan kunjungan kerja ke luar kota sudah dialokasikan dalam APBD. ’’Jika pihak swasta ingin dimintai dana, sifatnya harus bentuk kerja sama dan ada MoU,” bebernya. Berdasarkan penelusuran Radar Lampung, sejumlah tempat usaha yang dilayangkan surat mohon partisipasi di antaranya Hotel Indra Puri, rumah karaoke Inulvista, Golden Dragon, rumah karaoke Imperium, dan Hotel Bukit Randu. Dana yang dikeluarkan pelaku usaha ini mencapai sekitar Rp300 ribu–Rp500 ribu. ’’Karena uangnya tidak terlalu banyak, maka tidak perlu menggunakan tanda terima (kuitansi). Bahkan ada yang langsung memasukkan uangnya ke dalam tas Pak Septrio,” ungkap sumber Radar yang menolak identitasnya dikorankan. (gan/c2/rim)

ternyata kedapatan membawa paket berbahaya,” bebernya. Tidak cukup sampai di sini. Pihaknya juga bekerja sama dengan Bea Cukai, termasuk pihak Karantina Panjang, untuk mensterilisasi paket masuk. Tugas dan fungsi dua lembaga itu hampir sama, meski sedikit berbeda. Pihak karantina, misalnya, bertugas memeriksa dan memberikan izin berupa sertifikasi layak kirim terhadap paket tumbuh-tumbuhan yang ditakutkan mengandung bakteri atau virus yang membahayakan. Begitu pula dengan pihak Bea Cukai, memeriksa paket-paket elektronik yang ternyata produknya dari luar negeri, maka tidak dikeluarkan izin pendistribusian paketnya. Dikatakannya pula, kasus bom buku tidak memengaruhi jumlah pengiriman paket. Banyak masyarakat memaklumi hal ini dan merekatidakterlalukhawatirdengan isu bom berbentuk buku atau paket. ’’Kalau dilihat dari jumlah, sama seperti biasanya. Kami mengimbau agar masyarakat tidak terpancing dengan peristiwa yang ada,” pungkasnya. (ful/c2/rim)

Pemkot Warning KAI Soal Drainase Underpass Hanoman BANDARLAMPUNG – Wali Kota Bandarlampung Herman H.N. meminta PT KAI Tanjungkarang segera membenahi underpass di Jl. Hanoman, Kelurahan Kampung Sawahbrebes, Kecamatan Tanjungkarang Timur. Ini karena realisasi pembangunan PT KAI itu selalu mengundang banjir setiap musim hujan tiba. Hal itu tidak hanya mengganggu warga setempat, tapi juga dikeluhkan pengguna jalan.’’Saya minta PT KAI proaktif, segera perbaiki underpass. Lihat apa penyebab

banjirnya. Kalau drainase buruk, ya dibenahi,” katanya kemarin. Banjir rutin di underpass Jl. Hanoman, lanjut Herman, tidak saja meresahkan warga dan pengguna jalan. Lebih dari itu, jika tidak segera ditindaklanjuti, dampaknya dapat melebar merusak infrastruktur jalan dan fasilitas umum lainnya. ’’Segera benahi. Kalau dibiarkan berlarutlarut bisa merusak infrastruktur lainnya,” tandasnya. Terpisah, Kabag Humas PT KAI Zakaria berjanji segera memperbaiki instalasi drainase underpass. Ia mengakui banjir rutin di kawasan itu dipicu kesalahan konstruksi. ’’Drainasenya memang kecil, nanti akan kita perbaiki,” tutur Zack, sapaan akrab Zakaria. MenurutZack,sudahadabeberapa warga yang komplain ke PT KAI Tanjungkarang mengenai permasalahan itu. Bahkan banjir rutin underpass Jl. Hanoman itu sudah dilaporkan ke pimpinan PT KAI Tanjungkarang. ’’Sudah kita laporkan ke pimpinan karenaadabeberapawargajugayang sudah komplain ke kita,” jelasnya. Sayangnya,Zackmengakubelum dapat melakukan perbaikan dalam waktu dekat. Karena kini pihaknya masihberkonsentrasiterhadappembangunan perpanjangan sepur tidak jauh dari titik underpass di Jl. Hanoman. ’’Paling tidak lima bulan ke depan baru kita bisa memperbaiki. Karena kini kita masih konsentrasi terhadapperpanjangansepur,”pungkasnya. (gan/c2/rim)


TETAP BUKA: Sebanyak 32 unit ruko yang akan digusur di Jl. Ikan Bawal dan Jl. Ikan Simba, Telukbetung Selatan, hingga tadi malam masih buka seperti biasanya.

Pemkot Belum Transparan Soal Anggaran BANDARLAMPUNG – Akses informasi publik di lingkungan Pemkot Bandarlampung tertutup. Terutama di satuan kerja yang banyak mengelola anggaran. Sehingga masyarakat pun kesulitan mengaksesnya. Kalaupun memberikan datadata terkait informasi publik, Pemkot Bandarlampung cenderung diskriminasi. Demikian beberapa poin hasil riset Ma'arif Institut terkait penelitian tingkat keterbukaan dan transparansi pengelolaan anggaran publik Kota Bandarlampung 2010 yang diserahkan tim riset kepada Komisi Informasi Provinsi (KIP) Lampung. Ketua KIP Lampung Juniardi mengatakan, hasil riset itu menjadi referensi kerja lembaganya dan segera melakukan sosialisasi terhadap penerapan UU No. 14/2008 tentang Keterbukaan Informasi.

’’Hasil riset itu mengacu pada UU No. 14/2008. Hasilnya menyebutkan bahwa instansi publik di Kota Bandarlampung belum membentuk Pejabat Pengelola Informasi Publik (PPID). Selain itu, sosialisasi belum dilakukan di lingkungan pemkot,” kata Juniardi kemarin. Menurutnya, riset yang dilakukan Ma’arif Institut itu mengkaji permasalahan keterbukaan pengelolaan anggaran di Kota Bandarlampung. ’’Tinggirendahnya tingkat transparansi anggaran yang ditinjau melalui faktor ketersediaan dokumen, aksesibilitas, dan ketercukupan informasi dokumen pada tiap-tiap rangkaian anggaran,” terangnya. Tim riset, lanjut Juniardi, melakukan penelitian di tujuh satuan kerja. Antara lain, sekretariat DPRD Kota; Bappeko; Dinas Kesehatan; Dinas Pendidikan; Dinas Pekerjaan Umum; Dinas

Pendapatan dan Pengelolaan Aset Daerah; serta sekretariat pemkot. ’’Mereka meminta sekitar 21 bentuk dokumen,” ujarnya. Dijelaskannya pula, hasil riset menyimpulkan bahwa tingkat kesediaan dan kecukupan informasi anggaran telah cukup baik. Akan tetapi, masih minim keterbukaan dan kemudahan aksesibilitas informasi dan dokumentasi. Terutama dokumen anggaran kegiatan dan hak-hak bidang kesehatan. ’’Banyak instansi belum memahami UU No. 14/2008. Ini jelas akan berdampak terhambatnya proses partisipasi publik dan penganggaran.” jelasnya. Bahkan, tambah Juniardi, Pemkot Bandarlampung belum memiliki website sebagai wahana informasi publik. Menurutnya, website tidak hanya diisi sejarah sebuah daerah. ’’Tapi, memuat juga informasi publik, termasuk

peraturan-peraturan, kebijakan, dan anggaran, serta laporan hasil pembangunan. Pemkot harus mulai melakukan perubahan.

Ini tugas berat kita nantinya. Jika tidak ada apa-apa, saya kira tidak ada alasan untuk tertutup,” pungkasnya. (gan/c2/rim)

Berlangganan, Hubungi: 0721 - 782306-7410327


PISCES Kesehatan : Jangan mengandalkan suplemen! Keuangan : Cobalah untuk tidak bertingkah yang macam-macam. Asmara : Berusahalah untuk saling mengisi agar keharmonisan tetap terjaga. ARIES Kesehatan : Hindari dahulu minum air yang terlalu dingin, walaupun itu sangatlah menyegarkan. Keuangan : Boleh spekulasi, tapi tetap harus waspada. Asmara : Coba perbaiki sikap keras Anda.

TAURUS Kesehatan : Jangan hanya menuruti selera sehingga makan menjadi over! Keuangan : Pandai-pandailah menyeleksi tawaran yang datang. Asmara : Tingkah laku Anda jangan sampai menimbulkan rasa cemburu bagi pasangan Anda. GEMINI Kesehatan : Kondisi badan Anda terus menunjukkan grafik positif. Keuangan : Ada hawa segar yang akan membawa angin baik bagi keuangan Aanda. Asmara : Cinta tidak bisa dijamin mulus jalannya.

CANCER Kesehatan : Tampak terjaga walaupun aktivitas tampak padat dan berat. Keuangan : Ada saja dana yang harus dikeluarkan untuk mencukupi segala kebutuhan yang memang lagi meninggi itu. Asmara : Pertahankan rasa saling percaya dan menghargai.

LEO Kesehatan : Jangan banyak makan yang pedas-pedas! Keuangan : Masih seperti biasanya, lancar dan stabil. Asmara : Sekaranglah waktunya untuk mengungkapkan isi hati.

VIRGO Kesehatan : Pada pertengahan minggu ini sebaiknya kondisi badan harus diperhatikan, terutama yang punya tekanan darah rendah. Keuangan : Jangan ambil risiko! Asmara : Utarakan apa yang ingin diutarakan. LIBRA Kesehatan : Sakit perut masih merupakan ancaman bagi pencernaan Anda. Keuangan : Ada rezeki yang bisa membikin keuangan Anda menjadi menguat kembali. Asmara : Buat apa malu-malu kucing kalau sebenarnya memang suka.

SCORPIO Kesehatan : Jangan cepat merasa bebas dahulu! Keuangan : Cukup lancar dan pemasukan masih lebih baik dibanding minggu kemarin. Asmara : Jangan pesimistis! SAGITARIUS Kesehatan : Kondisi badan masih perlu diperhatikan. Keuangan : Apa mau dikata jika pengeluaran masih melebihi pemasukan yang ada? Asmara : Berusahalah untuk menerima segala yang ada.

CAPRICORN Kesehatan : Aktivitas berat yang membikin segalanya menjadi berantakan. Keuangan : Harus mau bersabar menanti datangnya rezeki. Jangan berputus asa! Asmara : Semua permasalahan akan dapat diselesaikan.

AQUARIUS. Kesehatan : Jangan makan terlalu pedas! Keuangan : Pandai-pandai menyimpan dana yang ada. Asmara : Hindari sikap otoriter dalam melaksanakan segala yang Anda harap dan cita-citakan.


Ambil Sisi Positifnya DALAM cinta, ada yang dinamakan penghargaan dan pengorbanan. Penghargaan untuk menerima segala kelebihan dan kekurangan pasangan serta pengorbanan untuk rela membuang sifat dan tingkah laku yang tidak disukai. Perbedaan pasti ada dalam sebuah hubungan. Contohnya, perbedaan selera. Dalam hal ini, bagaimana caranya setiap pasangan harus mempunyai trik tersendiri untuk mencipRATNA WIDIASTUTI takan suatu kecocokan sePsikolog hingga perbedaan itu tidak menjadi sebuah permasalahan yang besar? Membahas mengenai tema Selera Pacarku Dangdut Abis, jelas banyak sekali remaja zaman sekarang yang tidak bisa sepakat dengan selera seperti itu. Ada beberapa alasan. Yang pertama, kebanyakan orang menganggap penggemar musik dangdut berasal dari kaum minoritas sehingga membuat si pasangan malu dan gengsi jika sang pacar termasuk ke dalamnya. Alasan kedua, perbedaan kelas sosial. Sang pacar yang sudah terbiasa bergaul pada kalangan penyuka musik dangdut akan sulit disatukan dengan pasangan yang tak terbiasa dengan hal itu. Seharusnya perbedaan seperti ini harus kita ambil sisi positifnya. Bagaimana caranya kita dengan santai cukup menerima selera pasangan kita tanpa harus berkomentar? Toh, belum tentu juga pasangan kita menyukai selera musik kita. Tapi, justru dia bisa menerima selera kita. Kalau diambil sisi positifnya, pacaran dengan cewekcowok yang berselera dangdut justru malah bisa menjadi penghibur untuk kita. Nyatanya penggemar dangdut adalah orang-orang yang mempunyai selera humor tinggi dan selalu open minded dengan segala hal. (resta/rivan)


u cark Pa Selera Dangdut Abissss!!! RADAR LAMPUNG

MUSIK adalah soal selera. Dangdut, misalnya. Musik dangdut ternyata nggak hanya milik orang-orang kampung lho. Banyak juga anak-anak muda kota yang udah ketagihan dengan musik dangdut. Kalau kata Project Pop, ’’Dangdut is the Music of My Country.’’ Karena yang terpenting adalah selera dan rasa yang pas di telinga. Nah, bagaimana kalau masalahnya yang hobi dengan dangdut itu adalah pacar kita? Apakah

kamu bakal nyuruh doi untuk ngilangin hobinya terhadap dangdut atau malah fine-fine aja sih? Sebanyak 78% responden remaja di Bandarlampung mengatakan setuju-setuju saja kalau mempunyai pacar berselera dangdut. Walaupun nyatanya mereka sama sekali nggak menyukai dangdut, mereka nggak bisa ngelarang pacarnya untuk menyukai hobinya. Seperti dibilang Ferdian, alumni SMKN 1 Gadingrejo,

Pringsewu, yang suka banget sama tantangan ini. ’’Ya, nggak masalahlah. Itu kan hak dia mau suka musik apa aja. Kalau masalah hobi, jangan sampe deh kita ngelarang pacar selagi itu nggak berdampak buruk dan negatif,” katanya. Nggak jauh beda sama Lola. Cewek mungil yang hobi banget makan kuaci ini bilang, walaupun nggak terlalu suka, dia bangga kalau punya cowok seleranya dangdut. ’’Musik dangdut kan

Indonesia banget! Lagian musik dangdut juga udah banyak yang diaransemen jadi nggak norak. Misalnya, lagu Ridho Roma. Lagian juga seru kok punya pacar hobi dangdut. Bisa cukup ngibur kita kalau lagi bete dengan kelakuan konyolnya nyanyinyanyi dan joget dangdut,” tutur mahasiswa FISIP Unila. Kemudian sisanya sebanyak 22% responden mengatakan nggak setuju punya pacar hobi dangdut. Rata-rata beralasan kalau


penghobi dangdut itu norak. ’’Ih, males deh! Kalau udah suka, pasti di mana aja gatel kalau ada musik dangdut. Bisa-bisa kalau lagi diajak kondangan, dia naek ke panggung nyanyi lagu dangdut dan joget dangdut sama biduan-biduan. Malu-maluin dong pastinya! Nggak kebayang kalau gue punya pacar kayak gitu,” tutup Henny, cewek manis salah satu responden yang menyukai boneka ini. (resta/ yuli astoro)

Setuju nggak sih kalau punya pacar seleranya dangdut? Setuju.... 78% Nggak... 22%

Kota yang Memiliki Aset Miliarder rder Terbanyak Menurut Majalah Forbes orbess 1. New York Jumlah miliarder: 60 Milioner Terkaya: Michael Bloomberg ($18 miliar) Murrdoch d och,, Milioner Lainnya: Ralph Lauren, Carl Icahn, Rupert Mu doch, Donald Trump, Mortimer Zuckerman an ng bebeKota ini memang bergelimang sosok miliarder yang ko ota ini rgerak di berbagai sektor bisnis. Seiring kondisi itu, kota e aha erm hal.l juga berpredikat sebagai kota berbiaya hidup supermahal. selebritti Bayangkan saja, biaya potong rambut langganan selebriti Sally Hershberger saja mencapai $800 atau makan malam restoran mewah yang mencapai $550. 2. Moskow, Rusia Jumlah miliarder: 50 Milioner Terkaya: Vladimir Lisin ($15,8 miliar) ov, Milioner Lainnya: Roman Abramovich, Alisher Usmanov, Oleg Deripaska n Jumlah milioner meningkat pesat jika dibandingkan pada 2002 hanya lima milioner. Kekayaan para bilioner mayoritas terbangun berkat permainan bisnis di sektor minyak dan logam. Jika dibandingkan kota lain yang dihuni banyak milioner, Moskow tergolong kota dengan biaya hidup rendah. 3. London, Inggris Jumlah miliarder: 32 Milioner Terkaya: Lakshmi Mittal ($28,7 miliar) n Howard Howa oward rd Milioner Lainnya: Richard Branson, Leonard Blavatnik, Alan berka rkatt Jumlah milioner di kota itu juga terus meningkatt berkat n stabil. stabi bil. sokongan nilai tukar poundsterling yang kuat dan ki biaya a Kondisi itu juga membuat kota ini dikenal memiliki lainn nya. hidup yang supertinggi dibandingkan negara Eropa lainnya. 4. Istanbul, Turki Jumlah miliarder: 28 Milioner Terkaya: Husnu Ozyegin ($3 miliar) rik Tara, Tara, Milioner Lainnya: Mehmet Emin Karamehmet, Sarik Ferit Sahenk satawan Kecantikan kota ini memang menjadi daya tarik wisa ak semua semu ua asing sekaligus ladang bisnis kaum milioner. Namun, tak a di di sana sana a bergerak di sektor wisata. Banyak orang superkaya lular ar dan da an yang mendalami bisnis di sektor teknologi telepon selular tu rumah rumah mah perbankan. Dengan taraf hidup tinggi, seorang pembantu ha i. har tangga di kota ini bisa mendapat imbalan jasa $50 per hari. 5. Los Angeles, California Jumlah miliarder: 27 Milioner Terkaya: Eli Broad ($5,7 miliar) Mich ichael a Milioner Lainnya: Steven Spielberg, Sumner Redstone,, Michael Milken, Ron Burkle a tak mee Melihat gemerlap kota ini, sebenarnya ejumla eju mlah mla h ngejutkan jika menampung ssejumlah ngus ussa ah ah a milioner. Banyak dari peng ngu ha ang nggu gung un ng g superkaya itu mena ibu bur u an a untung dari industri hi hiburan err fil fii m man an n se perti perfilman B isn s is is Hollywood. Bisnis an n par p a ioto m otif dan pari meme eme me-wisata juga me pen entin ng. g. gang peran pen ting. (net/naviR)

foto irfasonmodel grettarya sistha ningrum dan persa amiranata

Ketergantungan dengan Dunia Modeling


CEWEK yang akrab dipanggil Ingrid ini akan mengisi kolom remaja berprestasi minggu ini. Doi memang terlihat enerjik dan memang sudah banyak mengantongi piala-piala yang menandakan hasil kerja kerasnya. ’’Gue mulai ikutan dan terjun di dunia entertainment dari TK sampai dengan sekarang. Gue bisa terjun di modeling awalnya itu dari nenek gue yang support banget. Nah, setelah itu gue mulai ketergantungan deh dan menjadi hobi yang bisa membuat gue eksis di dunia modeling ini,” tuturnya. Pada awalnya, doi mengaku memulai langkahnya di dunia modeling secara otodidak. Lalu, niatnya yang kuat untuk memperdalam dunia modeling ini dengan lebih serius lagi membuatnya

untuk ikut dalam agensi model. ’’Nah, di situ gue mulai meng-explore diri gue lebih dalam lagi. Banyak pengalaman PROFIL Nama : Clara Ingrid Setiadi Putri Sekolah : SMAN 7 Bandarlampung E-mail : PRESTASI : Juara I Cheerleader Competition Wali Kota Cup Juara Top Model Favorit Jakarta Juara Umum Top Kalender 2010 Juara Princess Center Plaza Juara The best Dress 2006 Juara III Cheerleader Competition Law Faculty Unila

yang udah gue dapetin yang menjadi pengalaman yang tak terlupakan,” jelas Inggrid semangat. ’’Pengalaman yang nggak akan gue lupain adalah sewaktu gue ikutan casting sinetron di Jakarta. Ketika itu, gue gugup banget karena kurang persiapan. Sehingga hasilnya pun tak membahagiakan. Hal itu menjadi pelajaran penting bagi gue bagaimana pentingnya persiapan untuk memulai sesuatu,” tambahnya Untuk meraih kesuksesan memang dibutuhkan kerja keras. Inggrid pun mencoba untuk menerapkan hal itu dalam langkahnya di dunia modeling ini. ’’Jangan mudah putus asa adalah kuncinya! Kalaupun kita gagal, itu bukanlah akhir dari segalanya. Tapi, itu sebuah awal yang harus kita perjuangkan untuk masa depan yang lebih baik. Selalu ingat bahwa support dan doa dari orang tua juga penting. Tanpa itu, kita tidak akan menjadi apa-apa,” pungkasnya. (octa/rivan)


Setuju dong, Alsn nya, krna kita hrz bsa menerima stiap klbhan dan kkurangan pacar kita. Dan musik dngdut asli indonsia loh jgn slah.


Namanya hobi tuh ga bsa di larang ,itu krna hak masing2 orang bagy gue...biasa aja... Ga stuju or stuju..


G sE7 lAh...... HrI gNi pnYa pCr hBi’nY dAnkDut????? Apa kAta DuNia????? HEmm tIsAm nIh bWt tMn” gUa dKntR: isYa,danIL,nOpiZan,sUprI,YanTO,En bUsmAn>,< bWt mBk” nYa jGa dEh Yg d’pNnaMn mDal eN mbK” yG da dSDA...... ...G kTngGln iRma EN aHmaD BasYk. . . ...


Asik.... msh da bnyk yg brnywa nih! W sh ikut u pd aja..... cz w ga mw pcaran! Wkwkwk



kLo gUa mAh sE7 g se7>,< hMm tIsAm nIh bWt tMn” kHusUz nYa yG Knl mA gUa aJa. . . . . SpEsiAl nA bWt iChaN sOiF dOnk>,< mGa mKin cA’em......


klU q cie stjU2 aj ap slh nA.. msk maU dlaran9.. kn skr9 ridh0 r0ma nyanYiin dan9dUt b9Us..aaaaaaaaaaaaaaaa


.dangdut itu music semua golongan.... .bule2 dari negara lain ja cinta mati ma dangdut.. .knpa kita gaq..... Inti’nya cintai lah negri sendiri seblum mencintai negri orang lain..... Jadi Gw SETUJU


Gw jg s7 bgt, soalny slain dngdut msik asli dr indonesi, dngdut jg mmpnyai si2 rmantis lq kta bsa bnr2 ngrsapnny, . NEXT, salam z wat AREMANIA LAMPUNG. ! biar rambut jabrik tpi hati tetep dangdut.


Setuju aja lah.. Kan kaya kata nya sii Project Pop, dangdut is the music of my country.. ^__^,,

Setuju Gak Kalo Pacar Kamu Hobi Dengerin Musik Dangdut?


klo gw sih setuju aja.....hehehe....lgian klo dangdut itu kan brmasyarakat...smua orng bs bergoyang...hehehe...


Msih ni idup, X-presi gmna? setujuuuuu.... dangdhut is the best, contoh keong racun bnyak yg hoby... rata2 hp mp3 pasti da lagu keong racun nya....


Asseeeek tau Dangdutan...!! Di Goyanggg Trusss Gw yach klo seandai nya gw punya cwek yang suka dangdut abisss.....hahah salam satoe djiwa lampung.



Salam buat boedak deugel talangpadang,, special nya buat maong,, Setuju2 aja karna dangdut tuch musik dalam negeri, lagipula merakyat mulai dari kalangan bawah sampe atas,,


Klau menurut gua sih gk setuju , soalnya nanti gaya dan selera sii dia dangdut lagi... gua juga mwu salam aja buat anak KOBUM khususnya buat anak SMA KEMALA BHAYANGKARI.. Moga tmbah gokilz dan jaga perdamain :)

Dangdut?ya gk masalah lah..bahkan bangga dong dangdut kan asli tu dr indonesia..ap lg pcr kt dangdut na yg edisi trbaru ya..hehe..gk ada yg ad irama sendu2 na..ckckck.. salam ya bwt pacar w heni purnama sari.. thx ya..

S7 ja si, knpa msti gengsi m dangduT , , , sbnr nya lgu dngduT t enak di dnger lirik” nya


Loq w,,enjoy n nerima aja tuh,,coz bagi w,itu gak masalah..biarpun agak jadul v w suka.jdi misal cowok juga suka,ya gpp.



oke jg dangdut,, dangdut kan nyokap w bngt,,yg psti stuju ja,,kan 1 jlur ma nyokap,, liat thu jupe,,mntab kan


klo aq setuju banget punya pacar yang suka ama lagu dangdut . soaly aq jg salah satu orang yg suka bangat ama lagu dangdut. apa lg klo bisa duet nyayi lagu dangdut asik so swet banget? soalya kita sebagai warga negara RI yang baik harus bisa jaga N cinta ama warisan leluhur ini. aq harapsi buat para pemuda n pemudi RI mau ngelestariin lagu dangdut biar g di aambil negara lain, biar anak cucu kita nanti masih bisa ngerasain gimana lagu dangdut itu. pesen aq si cintai kereasi seni anak bangsa dari pada karia anak bangsa lain.


lok w pnya pcr yg hobi dangdut stuju2 ja,,krna w jg suka dangdut nnti bsa duet bareng di panggung,,asyik kan


Setuju banget . . . Apa lg do’i bs goyang inul . . . Beh gak kbayang deh . . . Linu2 pokoknya hehehe


aq sih stju2 adja asal dy ska. knp hrus nglarang, dy yg ska , jd y hrus d ngrtiin. mga anx kels 3 pd lulus ujian smua.a. amient.


Ju2R aQ gx trLalu suka sm muSiC DANGDUT, tp kLw Qt tlah memiLih dY sbg pacar Qt, Qt hruz trima dy ap adany n mnghormtiny


.aq sie gk ska” amt.. Tp qlo dy ska sie ia gpp, kn selera music se”org brbda”.. Jd ia stuju” ajh.. Tisam na buat ank” SMA-SMk Persada ajh deh, keep spirit n’ smile ia tmen” :)


Stuju aja lah.. Karna dangdutkn musik dlam negri.. Jd dia ikut membantu mlestarikan dong.. Salam buat anak” KOBAL COMMUNITY.. Bwt x-presi mkasih,,,


ga setuju.... coz,aq ga suka dangdut.. msa’ co aq suka dangdut? kan lucu... qlo pacar aq suka dangdut,pasti nti stiap ad pestaan,dy naek panggung.. untuk nyanyi... wahhhh.... ga kebayang bgd dh,qlo tba2,aq pnya pcar yg gt.... hm....


ya lw q sh trgan2ng ma dia ya lw memg dia ska ma lgu dangdut ya q stju aja kn kt gx bs glrng slra dia asl kn baik ya stj



Pasmala Penakluk Alam Lepas BERWISATA ke alam lepas seperti gunung, bukit, dan hutan belantara mungkin menyeramkan. Tidak demikian bagi siswa-siswi SMAN 9 Bandarlampung yang tergabung dalam ekstrakurikuler (ekskul) Pencinta Alam (Pasmala). Ketua Pasmala Aditya menyatakan, banyak manfaat yang bisa dipetik dari ekskulnya itu. ’’Yang pasti, seorang anggota akan menyadari betapa pentingnya mencintai dan menjaga kelestarian alam. Selain itu, anggota juga akan merasakan pengasahan mental, keberanian, tanggung jawab, kekompakan, dan kerja sama tim,” katanya ditemui di sekolahnya. Sementara terkait perekrutan anggotanya, Indra dari Divisi Lapangan Pasmala menepis isu adanya kekerasan. ’’Yang pasti, semua tindak kekerasan tidak berlaku dalam ekskul ini. Semua siswa-siswi berkesempatan menjadi anggota dengan syarat mutlak. Yakni harus memiliki keberanian, kecintaan, dan kepedulian terhadap alam yang tinggi serta bersedia mengikuti jadwal latihan dengan benar. Satu hal yang paling penting adalah restu orang tua dengan menyertakan surat kesediaan mereka jika anaknya mengikuti ekskul ini,” terangnya. Pengalaman berharga bergabung di Pasmala pun dirasakan Riska. ’’Pastinya

semua keindahan alam yang sebelumnya hanya bisa gue nikmati lewat televisi atau gambar, telah gue buktiin dan rasakan secara nyata. Bulan lalu, misalnya. Gue dan temanteman ngelakuin ekspedisi ke Gunung Rinjani. Rasanya wuih! Benar-benar nikmat dan tak bisa diungkapkan dengan kata-kata. Bayangin aja, gue di sana bisa nikmatin udara dengan suhu yang dingin dan amat sejuk. Udah gitu pada pagi harinya, gue bisa ngeliat sunset yang amat indah. Pokoknya benarbenar unforgettable moment banget dah!” ungkapnya kagum. Devy Dwi Pertiwi menambahkan, dalam setiap ekspedisi yang dilakukannya pasti mengandung misi sosial untuk menjaga kelestarian alam. ’’Selain menikmati keindahan alam, di sana kami memunguti setiap sampah nonorganik dan membakarnya. Kami juga menyiapkan papan peringatan dan menempelkannya di setiap tempat yang bisa dibaca oleh pendaki lainnya,” katanya. Ditanya soal latihan pendakian, ia menjelaskan, setiap Kamis dan Selasa selalu menggelar latihan berupa materi, fisik, dan panjat tebing. ’’Setelah pulang sekolah, biasanya kami kumpul untuk membahas tentang materi ataupun tentang program yang akan kami lakukan,’’ jelas Devy. (yuli astoro)

in menampilkan profil BAGI sekolah yang ing ekskulnya di rubrik an iat sekolah dan keg bungi: X-school dapat menghu

YULI (085789998710) 915) atau AGNES (081957152



PROFIL Nama Lengkap Panggilan TTL Usia Nama Orang Tua: Ayah Ibu

: Alvin Wiwiet Susanto : Alvin : Bandarlampung, 2 Juli 1999 : 11 Tahun : Widodo : Etty Ning Laksmi Hendrayanti (Anak Tunggal) : Jl. R.A. Basyid, Kecamatan Jatiagung,

Alamat Lampung Selatan Sekolah : TK : Tunas Mekar Indonesia (sekarang ECC) SD : Tunas Mekar Indonesia Kelas : 6A Hobi : Main game, browsing, menggambar, download (lagu & video ), serta mendengarkan lagu. E-mail : Facebook : Alvin Jackson Prestasi : - Juara II Spelling Bee (EF), di Lampung, 2008 - Juara III Spelling Bee (EF), di Lampung, 2009 - Juara I Spelling Bee (EF), di Lampung, 2010 - Juara I Spelling Bee (Unila), 2009 - Juara I Spelling Bee (Unila), 2011 - Juara II Spelling Bee (EB), 2011 - Juara III Lomba Kaligrafi Antarsekolah Se-Kecamatan Sukabumi - Juara I Lomba Menggambar, di TMI, 2005 - Juara I Lomba Menggambar, di TMI, 2006 - Juara III Lomba Busana, di Panin Bank, 2008

Lagu Michael Jackson Paling Digemari

BAGI adik-adik yang ingin cerita tentang kegiatan sehari-hari dan majang fotonya di rubrik X-child dapat menghubungi Gusnan (085669679191) atau Veronika (089631147995).

NAMA saya Alvin Wiwiet Susanto. Saya biasa dipanggil Alvin. Saya lahir di Bandarlampung tanggal 2 Juli 1999 dari pasangan Widodo dan Etty. Sekarang, saya berusia 11 tahun. Saya adalah anak tunggal. Saat ini, saya bersekolah di SD Tunas Mekar Indonesia kelas 6A. Ketika kecil, saya bersekolah di TK Tunas Mekar Indonesia, yang sekarang bernama ECC. Saya suka sekali main game, browsing, menggambar, download (lagu & video), serta mendengarkan lagu, terutama lagu Michael Jackson. Saya memiliki e-mail, yaitu http://

www.bruce_wayne02@yahoo. com dan juga Facebook yang bernama Alvin Jackson, Untuk diketahui, saya sering mengikuti perlombaan dan memenangkannya, terutama lomba spelling bee. Saya memenangkan lomba spelling bee yang diselenggarakan oleh EF sebanyak tiga kali, yaitu pada tahun 2008 (juara II), 2009 (juara III), dan 2010 (juara I). Saya juga memenangkan lomba spelling bee yang diselenggarakan Unila sebanyak dua kali, yaitu pada tahun 2009 (juara I) dan 2011 (juara I). Dan yang terakhir, pada lomba spelling bee yang




â&#x20AC;&#x153;SUKARAJA INDAHâ&#x20AC;? Kec. Gd.Tataan Lampung Selatan FASILITAS  Lokasi terjangkau angkutan umum  Sarana dan Prasarana lengkap.  Sarana Pendidikan TK-SD-SLTP-SLTA  Lokasi Pasar  Sarana pemakaman umum  Dll.


PT. SINAR WALUYO Perwakilan Lampung Jl. Jend. Sudirman No. 94 Telp. 253800 - 261 371 Rawa Laut Bandar Lampung

diselenggarakan EB tahun 2011, saya men dapat kan juara II. Saya juga memenangkan lomba lainnya, yaitu lomba kaligrafi antarsekolah seKecamatan Sukabumi (juara III), lomba busana di Panin Bank tahun 2008 (juara III), serta lomba menggambar di TMI pada tahun 2005 dan 2006 (juara I). (X-crew/c1/ yuli astoro)



Kecil-Kecil t i w a R i Caba

DUNIA modeling pastinya sudah nggak asing lagi bagi para cewek atau cowok di Lampung. Yang selalu hidup glamor, tapi mengasyikkan. Sering kita lihat model identik dengan catwalk. Akan tetapi, seorang model bukan hanya bisa catwalk. Seorang model juga harus bisa akting, menari, dan sebagainya. Karena itu, untuk menjadi seorang model yang profesional itu nggak gampang dan perlu proses panjang untuk mencapai hal yang maksimal. Berbicara mengenai hal itu, perlu ada rasanya kemauan yang sangat tinggi dan binaan sejak kecil. Menginjak remaja, kemampuan menjadi seorang model yang profesional akan kelihatan. Kali ini, rubrik X-tainment kedatangan empat model cilik yang sudah menyabet berbagai gelar juara. Seperti orang bilang, kecil-kecil cabai rawit. Empat model cilik itu adalah Elin Setia Ningrum, Nabila Ersi Atika, Renhad Denil Ramadhan, dan Emerson Suta

Wijaya. Keempat model cilik itu sangat senang menggeluti dunia model. Mereka sangat percaya diri dan nggak pernah malu mengeluarkan kemampuan yang dimiliki. Mulai dari akting, menari, dan lain-lain. Itu dasarnya karena mereka memiliki kemauan yang sangat tinggi, sehingga memacu pada kemampuan yang sangat baik. Peran orang tua masing-masing anak pun sangat mendukung sekali. Keinginan anak menjadi seorang model yang membuat orang tua dari masing-masing anak rela berkorban demi kemajuan anaknya. Menurut para orang tua masing-masing anak, kesenangan anak adalah kesenangan orang tua. Jadi apa pun dilakukan anak yang positif, orang tua selalu dukung. Dari semua kegiatan keempat model cilik itu merupakan hal yang baik buat ke depannya. Belajar percaya diri agar berani dan tidak malu. (irfason/enny/rivan)


C Nama Sekolah Hobi Prestasi

: : : :

FOTO A Elin Setia Ningrum SDN 2 Srimenanti, Lamtim Berenang Juara Umum Top Model Valentine by Expose Entertainment

Nama Sekolah Hobi Prestasi

: : : :

FOTO B Nabila Ersi Atika SDN 2 Srimenanti, Lamtim Ngedance dan Berenang Juara Queen Top Model Valentine by Expose Entertainment

Nama Hobi Cita-Cita Prestasi

: : : :

FOTO C Renhad Denil Ramadhan Nyanyi dan Bulu Tangkis Polisi Juara I The Best Top Model

Nama Sekolah Hobi Cita-Cita Prestasi

: : : : :

FOTO D Emerson Suta Wijaya SDN 1 Beringinraya Bulu Tangkis dan Main Bola Dokter Juara Favorit III Top Model

BAGI cewek, cowok, dan band yang sudah atau ingin go nasional lalu nampilin profil dan fotonya di rubrik X-tainment, dapat menghubungi Rivan (08976179312) atau Enny (08976187702).






BAGI yang ingin menampilkan profil komunitas atau buat kamu yang punya hobi koleksi barang dan lainnya, atau ingin nampang di rubrik Xmania dapat menghubungi Irfason (07217495656/083170263777) atau Lydia (08978984283).

Dari Pengajian hingga Menggarap Sebuah Mading ASYIKNYA kalau bisa kumpul bareng temen-temen dan menuangkan semua ide yang ada. Majalah dinding salah satunya. Siapa sih yang gak tau kegiatan itu? Kini ada sekumpulan mahasiswa berbakat yang memiliki hobi yang sama, yakni membuat mading. Namanya BBQ (Belajar Baca Alquran) Ceria. Mereka terbentuk dari kegiatan yang ada di kampus setempat. ’’Sebenernya kita ini ada karena adanya acara wajib fakultas untuk kuliah agama. Jadinya kita

ketemu di acara tersebut. Setiap ketemu, pastinya kita selalu bicarain hal yang sama, dengan tilawah, sedikit menyampaikan informasi dari buku tentang Islam yang kita baca, sampai adanya kultum. Makanya kita selalu bertemu,” ungkap Debi, salah satu anggotanya.. ’’Kita seneng banget kumpul dan ngobrol bareng. Dari sering kumpul, akhirnya punya ide untuk buat kelompok mading alias majalah dinding,” cerita Debi. Ditanya kenapa harus mading,

ia menjelaskan, karena selain menarik hati, juga banyak informasi yang bisa diberikan untuk orang banyak. ’’Makanya gak jarang kalo kita seneng banget menghias dan membuat mading,” tuturnya.. Selain asyik dan banyak mendapatkan ilmu, nggak ada salahnya juga kalo kita ikut membudayakan mading. Karena sampai kapanpun, mading akan selalu ada,. Dan dapat dinikmati semua kalangan masyarakat. Baik yang muda maupun yang tua. (lydia mawar/c1/irfa )



Penuh dengan Pesona Alam yang Menggoda PANTAI, kolam renang, atau bahkan taman kupu-kupu sudah pernah disuguhkan di X-guide. Kali ini, X-guide akan mengajak Anda semua untuk melihat sisi lain dari daerah pesisir yang terletak di daerah Padangcermin, Pesawaran. Nama tempat wisata kita kali ini adalah Taman Hutan Rakyat (Tahura) Wan Abdul Rahman. Kawasan ini memiliki luas 22.244 hektare ditetapkan sebagai Tahura Wan Abdul Rahman berdasarkan Surat Keputusan Menteri Kehutanan No. 742/Kpts-II/92 tanggal 21 Juli 1992. Memang sedikit memakan waktu untuk menuju tempat ini jika kita berangkat dari pusat kota Bandarlampung. Tapi, pasti kita nggak akan dibuat kecewa dengan pesona keindahan alamnya. Sebelum sampai ke lokasi, kita sudah disuguhkan pemandangan yang nggak kalah menariknya. Yaitu bentangan areal sawah yang luas. Terlebih jika sawah itu sudah ditumbuhi padi yang sudah layak panen. Begitu sangat natural sekali pemandangannya. Mungkin kamera Anda tak akan luput dari genggaman Anda karena

tak ingin kehilangan momen untuk mengabadikan tempat yang masih sangat alami itu. Tahura Wan Abdul Rahman ini difasilitasi dengan arena bermain berupa outbound. Flora dan fauna yang beraneka ragam pun siap memberikan sensasi yang berbeda dengan tempat wisata lain akan pesona alamnya. Untuk floranya terdapat banyak jenis, di antaranya gondang (ficus variegate), medang (littala firneax), pulai (alstonia scholaris), durian (durio sp), berbagai jenis anggrek, paku-pakuan, dan lainnya. Juga siamang, babi hutan, burung rangkong, ayam hutan, sampai kukang dan beruang madu adalah berbagai fauna yang menjadi daya tarik bagi para wisatawan yang berkunjung ke sini. Tapi, untuk melihat aneka ragam fauna agak sedikit sulit. Hal itu dikarenakan semua fauna di wisata ini dikembangkan secara liar di alam yang sangat alami. Sehingga butuh tenaga lebih dan momen-momen yang pas untuk melihat satwa-satwa menarik di Tahura Wan Abdul Rahman ini. (rizki/rivan)

BAGI yang ingin menampilkan tempat-tempat wisata di rubrik X-guide dapat menghubungi:

Kikoy (089631428709)

● MEGAPOLITAN 259107 ● MEGAPOLITAN KEMILING 269386 ● CITRA DEKOR 708 781 ● INDAH JAYA 269 827 ● GRAND FURNITURE STORE 475237 / 475699 ● CYNTIA 475159 ● STAR ONE 774889 ● GAJAH LAMPUNG 0729-22181 ● KARTINI 251783 / 251751 ● KARYA INDAH JY 254960 ● KENCANA BARU 0725-640295 ● KURNIA 0725-42438 ● MATAHARI 781419 ● MEGAH ALFA 258563 ● MEGAH RUKO 264759 ● MEGA JAYA 0725-527410 ● MEGA INDAH 263330 / 259034 ● MIG 252305 ● FAJAR AGUNG 267191 ● NUSANTARA 7441449 ● PALAPA 485207 / 7495728 l ROYAL 264011 ● RUDY 255190 / 263252 ● SANJAYA 253343 ● SRI JAYA 482834 / 7514226 ● TERUSAN 0724-21135 / 21815 ● VIRGINIA 0724-21737 ● VICTORY'S 488248 ● STAR ONE 701120 / 7566726 ● LABAY FURNITURE 0724-91709 / 91550 ● FURNIMART 0725 7850598 ● ISTANA MEBEL 484141 / 251725 ● GRANT 7626168 / 785168 ● TOKO AMIN UNIT II 0726-750350 ● BEN JAYA 7561199 ● ANEKA WARNA 253339 ● BAKTI JAYA 263771 ● DE LAYLA 257765 EMPAT SAUDARA JAYA 253636 ● ANTASARI 240988 ● IDEAL F 7622868 ● ● APOLO JAYA WH 784603 ● JATI UKIR 250582 ● DIRMAN M 0725-43250 ● KEVIN 788718 ● ANUGRAH 780487 ● ABC 781280 ● AULIA 0724-21815 ● KING'S 786164 / 705780 ● ADAM JAYA 772435 ● JADI BARU 0812797 78179 ● MOLEK 261 548





)272)2722&7$ 2)272 272 2 2&7$ 2& &7$ $

PADA 2011 ini, tren yang sedang in adalah full colour. Kenapa kita nggak mencari style yang berbeda tapi tetap modis? Contohnya, pop classic style yang terlihat simpel tapi sebenarnya menampilkan konsep lebih dalam yang menggambarkan kehidupan orang yang mengenakannya. Walaupun nggak terlalu berwarna, itulah hidup memang selalu berseberangan. Model yang ditampilkan banyak mengandung warna hitam, karena itu basic yang bisa kontras ke busana apa pun. Memang terlihat seperti berbeda dengan orang lain, itulah pakaian yang cuek tapi tetap berkonsep. Seperti babydoll yang dipadukan dengan stocking hitam. Belum lagi baju terusan hitam yang masih dipadukan dengan stocking hitam. Ada juga dress yang dikenakan berwarna ungu membuat kita terlihat sangat santai sehingga nggak terlalu ribet dengan pemikiran bahwa harus selalu mengontraskan antara baju dengan celana. Walaupun ada warna terang, tetap saja dipadukan dengan rok dan stocking hitam. Buat kalian yang hobi nonton konser ataupun manggung, kenapa nggak dicoba tuh? Dengan berani tampil beda, orang pun akan melihat kalo kita berani meng-explore segala yang berhubungan dengan diri kita, baik sikap, penampilan, dan performance. Itu saja sudah menjadi paket yang baik dalam kita bergaya. Kalo orang yang kurang mengerti pasti akan berpikir jika hal ini aneh. Tapi, coba dirasakan bagaimana kita bisa nyaman dengan style yang kita gunakan. Secara nggak langsung, orang-orang pun akan tertarik untuk mengikuti style kita. Berbeda itu bukan berarti jelek. Awalnya, kita harus pede tapi jangan terlalu pede. Lihat dahulu pantas atau tidak untuk mengenakan pakaian itu. Kalaupun tidak pantas, jangan terlalu dipaksakan. Hal itu malah akan membuat kita malu. So, keep fashionable walaupun dengan konsep lama. (octa/resta/rivan)

Wardrobe by Model Foto

: Sofia Collections : Sofia : Octa dan Resta

BAGI buĆ&#x;k dan distro yang ingin nampilin barang-barang dagangannya di rubrik X-style dapat menghubungi Octa (08976123302) atau Resta (085959552555).

RADAR LAMPUNG | Minggu, 20 Maret 2011