Issuu on Google+

MedizinTechnik

tors c o d d n sa MOS T Patient A n o rely e d i w d l wor

2012 I 2013 Respiratory tract suction devices, Wound & Gastro drainage systems


Table of contents Mains-operated respiratory tract suction devices, 26 l/min

ATMOS C 261 Aspirator Perfect synergy of performance, safety and favourably priced reprocessing!

ATMOS A 261 Aspirator Powerful for particularly viscous secretion

........................................................................................................................... 7

........................................................................................................................... 8

Mains-operated respiratory tract suction devices, 16 l/min

ATMOS C 161 Aspirator Safe secretion management for the respiratory tract suction with low follow-up costs! ........................................................................................................................... 9

ATMOS A 161 Aspirator For use on the ward, for nursing care and during rehabilitation ........................................................................................................................ 10

Battery-operated respiratory tract suction devices, 22 l/min

ATMOS C 161 Battery Battery-operated respiratory tract suction for the mobile nursing service!

ATMOS A 161 Battery Ideal for the mobile use

........................................................................................................................ 14

........................................................................................................................ 15

Symbols

DVD

Helpful information 2

DVD to this topic available


MedizinTechnik

Emergency treatment

Reprocessing

Atmoport N The powerful respiratory tract suction device for emergency treatment ...........................................................................................................19

Reconditioning of suction devices ATMOS has optimised the reconditioning of suction devices. to 21

...........................................................................................................26

to 27

Negative Pressure Wound Therapy

New therapy measures The choice is yours! ...........................................................................................................29

ATMOS S 042 NPWT User friendly, self-explanatory, reliable to 50

...........................................................................................................32

to 39

Gastric drainage

Wound drainage

ATMOS S 041 Wound The „Portable“ for the wound drainage with dressing kits at an extremely fair price

ATMOS S 041 Gastric Microprozessor-controlled suction device for the gastric drainage

...........................................................................................................40

...........................................................................................................51

to 50

to 54

ATMOS MedizinTechnik GmbH & Co. KG Ludwig-Kegel-Str. 12, 14-16, 18 „ 79853 Lenzkirch/Germany Phone +49 7653 689-374 „ Fax +49 7653 68986-374 ApplicationSolutions@atmosmed.de „ www.atmosmed.com 3


ATMOS Direct-Docking-System DDS

More protection by triple oversuction safety

NEW: with Direct Docking System

c d e

With the introduction of the Direct Docking System DDS in the lower price category ATMOS presents a new generation of portable respiratory tract suction systems. Up to now there was uncertainty when dealing with the hoses – now that has come to an end:

With the unique features like DDS, ergonomics, design and price ATMOS introduces a whole new standard of respiratory tract suction systems.

4

Integrated overflow protection Modern Direct Docking System DDS

provide triple safety and an easier processing.

f

With the innovative ATMOS DDS the hose connection between the suction system and the secretion jar is no longer required: no hose, no problem – just dock! This procedure guarantees a costeffective processing because malfunction is excluded. Furthermore a depth filter is inserted instead of the usual surface filter. Here the interior filter surface area is with >1 m2 much larger than the existing bacterial filter.

Modern filter technology

The blue translucent cover protects the control elements underneath from external influences, contamination and can easily be slided down. Easy to clean - because of large surfaces.

Sliding cover adjustable


MedizinTechnik

Oversuction-proof and favourably priced reprocessing

The mains-operated ATMOS respiratory tract suction devices in the reliable 26 l and 16 l class 5


At a glance: Capability characteristics of the mains-operated ATMOS respiratory tract suction devices ATMOS C 261 Aspirator Aid number

Suction capacity 16 l / min 26 l / min

REF 313.0100.0 01.24.01.1012

ATMOS A 261 Aspirator

REF 313.0300.0 01.24.01.1020

-

-

ATMOS C 161 Aspirator

REF 313.0000.0 01.24.01.0019 ●

01.24.01.1021 ●

infinitely adjustable

three-step-control*

Vacuum gauge

-

-

Blue cover to protect the control elements

-

-

Quick visual inspection whether device is oversucked

-

-

Insulating mat

-

-

Vacuum display Sliding cover

Condensate trap

Sound damping

Secretion container Material

Autoclavable

*Three-step control low: -25 kPa medium: -55 kPa high: -75 kPa

PSU

approx. 100 x

PSU

approx. 100 x

infinitely adjustable

PSU

approx. 100 x

(depending on ambient air pressure and ambient conditions)

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 6

REF 313.0200.0

Vacuum adjustment

-

ATMOS A 161 Aspirator

-

three-step-control*

PSU

approx. 100 x


| respiratory tract suction mains-operated | ATMOS C 261 Aspirator MedizinTechnik

ATMOS C 261 Aspirator

Respiratory tract suction device Perfect synergy of performance, safety and favourably priced reprocessing! Powerful for particularly viscous secretion Triple overflow protection due to:

- innovative filter technology

- integrated overflow protection

- Direct-Docking-System (DDS)

Infinitely adjustable vacuum and precise indication

Condensate trap for quick visual inspection whether device is oversucked

See an overview of all characteristics on page 6

ATMOS C 261 Aspirator

ATMOS C 261 Aspirator / DDS Portable secretion suction device, airflow rate of pump: 26 ± 2 l/min. Characteristics: Infinitely variable vacuum adjustment and precision indication, condensate trap, grad. ATMOS - secretion canister 1 l, lid for secretion canister with triple oversuction safety by modern filter technology, integrated Direct-Docking-System.

REF ❁ 313.0100.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, fingertip, mains cable, 3 bacterial filters, hose connector, DDS canister, DDS canister lid, holding clamp, operating manual

ATMOS C 261 Aspirator / Receptal® Portable secretion suction device, airflow rate of pump: 26 ± 2 l/min.

❁ 313.0101.0

ATMOS C 261 Aspirator / Medi-Vac® Portable secretion suction device, airflow rate of pump: 26 ± 2 l/min.

❁ 313.0102.0

ATMOS C 261 Aspirator / Serres Portable secretion suction device, airflow rate of pump: 26 ± 2 l/min.

❁ 313.0103.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connecting hose, fingertip, receptal canister, mains cable, holding clamp and 1 Receptal® suction bag 1 l with integrated, overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connecting hose, fingertip, mains cable, Medi-Vac® canister, holding clamp and 1 Medi-Vac® suction bag 1 l with integrated, overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connecting hose, fingertip, Serres canister, mains cable, holding clamp and 1 Serres suction bag 1 l with integrated, overflow valve filter, operating manual

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 7


| respiratory tract suction mains-operated | ATMOS A 261 Aspirator

ATMOS A 261 Aspirator

Respiratory tract suction device Perfect synergy of performance, safety and favourably priced reprocessing! Powerful for particularly viscous secretion Triple overflow protection due to:

- innovative filter technology

- integrated overflow protection

- Direct-Docking-System (DDS)

Three-step control

Secretion container autoclavable up to 100 x

For use on the ward, for nursing care and clinic

See an overview of all characteristics on page 6

ATMOS A 261 Aspirator

ATMOS A 261 Aspirator/ DDS Portable secretion suction device, airflow rate: 26 ± 2 l/min. Characteristics: Threestep vacuum adjustment (-25 kPA, -55 kPa, -75 kPa) without precision indication and condensate trap, grad. ATMOS secret canister 1 l, canister lid, with triple oversuction safety by modern filter technology, integrated overflow protection and Direct-Docking-System.

REF ❁ 313.0300.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1,3 m, fingertip, mains cable, 2 bacteriall filter, hose connector, DDS canister, DDS canister lid, operating manual

ATMOS A 261 Aspirator/ Receptal® Portable secretion suction device, airflow rate: 26 ± 2 l/min.

❁ 313.0301.0

ATMOS A 261 Aspirator/ Medi-Vac® Portable secretion suction device, airflow rate: 26 ± 2 l/min.

❁ 313.0302.0

ATMOS A 261 Aspirator/ Serres® Portable secretion suction device, airflow rate of pump: 26 ± 2 l/min

❁ 313.0303.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1,3 m, connection hose, fingertip, mains cable, Receptal® canister, Receptal® canister support and, 1 Receptal® suction bag 1 l with integrated overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1,3 m, connection hose, fingertip, Medi-Vac® canister, mains cable, canister support and, 1 Medi-Vac® suction bag 1 l with integrated overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connection hose, fingertip, mains cable, Serres® canister, support, 1 Serres® suction bag 1 l with integrated overflow valve filter, operating instructions

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 8


| respiratory tract suction mains-operated | ATMOS C 161 Aspirator MedizinTechnik

ATMOS C 161 Aspirator

Respiratory tract suction device Perfect synergy of performance, safety and favourably priced reprocessing! User-friendly

Triple overflow protection due to:

- innovative filter technology

- integrated overflow protection

- Direct-Docking-System (DDS)

Infinitely adjustable vacuum and precise indication

Condensate trap for quick visual inspection whether device is oversucked

See an overview of all characteristics on page 6

ATMOS C 161 Aspirator

REF

ATMOS C 161 Aspirator / DDS Portable secretion suction device, airflow rate of pump: 16 ± 2 l/min ❁ 313.0000.0 Characteristics: Infinitely variable vacuum adjustment and precision indication, condensate trap, grad. ATMOS - secretion canister 1 l, canister lid with triple oversuction safety by modern filter technology, integrated overflow protection and DirectDocking-System. Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, fingertip, mains cable, 3 bacterial filters, hose connecter, DDS canister, DDS canister lid, holding clamp, operating manual

ATMOS C 161 / Receptal® Portable secretion suction device, airflow rate of pump: 16 ± 2 l/min

❁ 313.0001.0

ATMOS C 161 / Medi-Vac® Portable secretion suction device, airflow rate of pump: 26 ± 2 l/min

❁ 313.0002.0

ATMOS C 161 Aspirator/ Serres® Portable secretion suction device, airflow rate of pump: 16 ± 2 l/min

❁ 313.0004.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connection hose, fingertip, Receptal® canister, mains cable, canister lid, support and, 1 Receptal® suction bag 1 l with integrated overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connection hose, fingertip, Medi-Vac® canister, mains cable, canister lid, support and, 1 Medi-Vac® suction bag 1 l with integrated overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connection hose, fingertip, mains cable, Serres® canister, support, 1 Serres® suction bag 1 l with integrated overflow valve filter, operating instructions

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 9


| respiratory tract suction mains-operated | ATMOS A 161 Aspirator

ATMOS A 161 Aspirator

Respiratory tract suction device Safe secretion management for the respiratory tract suction with low follow-up costs! User-friendly

Triple overflow protection due to:

- innovative filter technology

- integrated overflow protection

- Direct-Docking-System (DDS)

Three-step control

Secretion container autoclavable up to 100 x

For use on the ward, for nursing care and clinic

See an overview of all characteristics on page 6

ATMOS A 161 Aspirator

REF

ATMOS A 161 Aspirator/ DDS Portable secretion suction device, airflow rate: 16 ± 2 l/min. ❁ 313.0200.0 Characteristics: Threestep vacuum adjustment (-25 kPA, -55 kPa, -75 kPa) without precision indication and condensate trap, grad. ATMOS secret canister 1 l, canister lid, with triple oversuction safety by modern filter technology, integrated overflow protection and Direct-Docking-Station. Technical data: Silicone suction hose Ø 6 mm, L = 1.3 m, fingertip, mains cable, 2 bacteriall filter, hose connector, DDS canister, DDS canister lid, operating manual

ATMOS A 161 Aspirator / Receptal® Portable secretion suction device, airflow rate of pump: 16 ± 2 l/min

❁ 313.0201.0

ATMOS A 161 Aspirator / Medi-Vac® Portable secretion suction device, airflow rate: 26 ± 2 l/min.

❁ 313.0202.0

ATMOS A 161 Aspirator/ Serres® Portable secretion suction device, airflow rate of pump: 16 ± 2 l/min

❁ 313.0203.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1,3 m, connection hose, fingertip, mains cable, Receptal® canister, support and 1 Receptal® suction bag 1 l, with integrated overflow valve filter,, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1,3 m, connection hose, fingertip, Medi-Vac® canister, mains cable, canister support and, 1 Medi-Vac® suction bag 1 l with integrated overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connection hose, fingertip, mains cable, Serres® canister, support, 1 Serres® suction bag 1 l with integrated overflow valve filter, operating instructions

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 10


MedizinTechnik

Battery-operated respiratory tract suction devices

11


Cleaning and care of suction devices

Cleaning and care of suction devices

Please contact the ATMOS Service: Phone: +49 7653 689-222 Fax: +49 7653 68986-222 service@atmosmed.com

General information Please excercise special care whilst handling the device! As it is essential to avoid transmission of germs and illness, the suction device may be solely used by one patient. Please observe the recommendations from ATMOS and you will have a faultless medical product with a long service life! Please observe the following: ’ A daily visual inspection of the device is esential. ’ Always operate the suction device in accordance with the operating instructions. There you will also find useful hints on cleaning and care. ’ Only use disinfectant solutions recommended by ATMOS. ’ Before cleaning the device, make sure the power supply is interrupted (Unplug the device!). Advice for cleaning Prior to cleaning please observe the information and recommendation stated in the relevant operating instructions! Secretion container and Secretion container lid Please empty the secretion container after each use, rinse it thoroughly with warm water and clean it with washingup liquid. Tenacious contaminations can be removed with a clean brush. ATMOS recommends daily disinfection! External casing After each use, wipe the external casing with a clean damp cloth. We recommend disinfection of the external casing at least once a week.

12

Bacterial filter The bacterial filter prevents bacteria and liquids from seeping into the device. Therefore, make sure the device is operated only with an original ATMOS bacterial filter! Exchange the bacterial filter at least once a week. Immediate change is necessary if it becomes wet or dirty or when the device is used for an other patient. Fingertip The fingertip connects the suction hose with the sterile suction catheter. After each use it must be rinsed with clear water. For hygienic reasons we recommend a change every 2 to 3 days. Suction hose The suction hose must be rinsed at least once a day with one of the recommended disinfection liquids. In addition the hose must be rinsed thorouthly with clear water after each suction process. With frequent use the hoses may become discoloured and get porous therefore ATMOS recommends changing them every 4 weeks. If you follow these recommendations an ATMOS suction device will remain a reliable and hygienically impeccable aid for ambulant, stationary and home care for many years.

Important Advice: In the case of use with another patient it is regulated by law to reprocess the device before further use. We are gladly prepared to perform for you a professional reprocessing of your suction devices.


MedizinTechnik

At a glance: Capability characteristics of the battery-operated ATMOS respiratory tract suction devices ATMOS C 161 Battery Aid number Suction performance Vacuum adjustment Vacuum display Vacuum gauge

Battery level indication Power supply

Mains operation

Battery operation Operating time

a) Mains operation by mains connection (with power pack charger REF 312.0439.0) b) Battery operation

Charging time (at complete discharge) Sliding cover

ATMOS A 161 Battery

REF 313.0400.0 01.24.02.0015

REF 313.0500.0

01.24.02.0012

22 l / min

22 l / min

infinitely adjustable

three-step control*

-

5-step LED

5-step LED

100-240 V~ 50/60 Hz

100-240 V~ 50/60 Hz

40 min

40 min

40 min

40 min

1.5 h

1.5 h

12 V DC

12 V DC

Blue cover to protect the control elements

-

Quick visual inspection whether device is contaminated

-

Condensate trap

Secretion container Material

Autoclavable

PSU

approx. 100 x

PSU

approx. 100 x

*Three-step control low: -25 kPa medium: -55 kPa high: -75 kPa

(depending on ambient air pressure and ambient conditions)

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 13


| respiratory tract suction battery-operated | ATMOS C 161 Battery

ATMOS C 161 Battery

Respiratory tract suction device Battery-operated respiratory tract suction for the mobile nursing service! Battery-operated by modern Li-Io battery

Battery level test function for quick checking

Infinitely adjustable vacuum and precise indication

Condensate trap for quick visual inspection whether device is oversucked Triple overflow protection due to:

- innovative filter technology

- integrated overflow protection

- Direct-Docking-System (DDS) Ideal for mobile use! See an overview of all characteristics on page 13

ATMOS C 161 Battery

REF

ATMOS C 161 Battery / DDS Battery operated secretion suction device, airflow rate: 16 ± 2 l/min. ❁ 313.0400.0 Characteristics: Infinitely variable vacuum adjustment and precision indication, condensate trap, 5-step LED battery level indicator, lithium-ionic battery, graduated ATMOS secretion canister 1 l, canister lid, with triple oversuction safety by modern filter technology, integrated overflow protection and Direct-Docking-System. Technical data: Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, fingertip, mains cable, 3 bacterial filters, hose connecter, DDS canister, charging cable for 110 - 240 V~, 50/60 Hz, DDS canister lid, hose connector, holding clamp, operating manual

ATMOS C 161 Battery / Receptal® Battery operated secretion suction device, airflow rate: 16 ± 2 l/min.

❁ 313.0401.0

ATMOS C 161 Battery / Medi-Vac® Battery operated secretion suction device, airflow rate: 22 ± 2 l/min.

❁ 313.0402.0

ATMOS C 161 Battery/ Serres® Portable secretion suction device, airflow rate of pump: 22 ± 2 l/min

❁ 313.0403.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connection hose, fingertip, mains cable, charging cable for 100 - 240 V~, 50/60 Hz, Receptal® canister, support and 1 Receptal® suction bag 1 l, with integrated overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connection hose, fingertip, mains cable, charging cable for 100 - 240 V~, 50/60 Hz, Medi-Vac® canister, support and 1 Medi-Vac® suction bag 1 l, with integrated overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connection hose, fingertip, mains cable, recharging power pack for 110-240 V~, 50/60 Hz, Serres® canister, support, 1 Serres® suction bag 1 l, with integrated overflow valve filter, operating instructions

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 14


| respiratory tract suction battery-operated | ATMOS A 161 Battery MedizinTechnik

ATMOS A 161 Battery

Respiratory tract suction device Battery-operated respiratory tract suction for the mobile nursing service! Battery-operated by modern Li-Io battery

Battery level test function for quick checking Three-step control

Triple overflow protection due to:

- innovative filter technology

- integrated overflow protection

- Direct-Docking-System (DDS)

cost-effective reprocessing

Ideal for mobile use! See an overview of all characteristics on page 13

ATMOS A 161 Battery

ATMOS A 161 Battery / DDS Battery operated secretion suction device, airflow rate: 22 ± 2 l/min. Characteristics: Threestep vacuum adjustment (-25 kPA, -55 kPa, -75 kPa) without precision indication and condensate trap, 5step LED battery level indicator, lithium-ionic battery, grad. ATMOS secret canister 1 l, canister lid, with triple oversuction safety by modern filter technology, integrated overflow protection and Direct-Docking-System.

REF ❁ 313.0500.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, fingertip, mains cable, charging cable for 110 - 240 V~, 50/60 Hz, 3 bacterial filters, DDS canister, DDS canister lid, hose connector, holding clamp, operating manual

ATMOS A 161 Battery / Receptal® Battery operated secretion suction device, airflow rate: 22 ± 2 l/min.

❁ 313.0501.0

ATMOS A 161 Battery / Medi-Vac® Battery operated secretion suction device, airflow rate: 22 ± 2 l/min.

❁ 313.0502.0

ATMOS A 161 Battery/ Serres® Portable secretion suction device, airflow rate of pump: 22 ± 2 l/min

❁ 313.0503.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connecting hose, fingertip, mains cable, charging cable for 110 - 240 V~, 50/60 Hz, Receptal® canister,, support and 1 Receptal® suction bag 1 l, with integrated overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connecting hose, fingertip, mains cable, charging cable for 110 - 240 V~, 50/60 Hz, Medi-Vac® canister, support and 1 Medi-Vac® suction bag 1 l, with integrated overflow valve filter, operating manual

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connection hose, fingertip, mains cable, recharging power pack for 110-240 V~, 50/60 Hz, Serres® canister, support, 1 Serres® suction bag 1 l, with integrated overflow valve filter, operating instructions

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 15


ATMOS A and C class | Accessories and consumables

Accessories and consumables ATMOS A and C class

1

2

3

4

5

6

7

8

9

16


MedizinTechnik

Accessories for A and C class ➀ Grad. secretion canister, 1 l DDS, blue, PSU Secretion canister for ATMOS A- and C- class DDS Grad. secretion canister, 1 l DDS, transparent, PSU Secretion canister for ATMOS A- and C- class DDS Secretion canister lid, 1 l DDS, blue, with spare bacterial filter for ATMOS A- and C- class DDS ➁ Separate rinsing canister set for A- and C- class incl. lid and support ➂ Hose connector for hoses Ø 6 mm ➃ Hose rewind for suction hoses A- and C- class Charging device for ATMOS Battery, 100 - 240 V~, 50/ 60 Hz Power cable, 3-wire Schuko connector, 2 m Carrying bag, black with practical storage pockets for consumables Car power cable for ATMOS C 161 Battery, connection: 12 V➄ Device support for ATMOS A- and C- class with rotatable holder for attaching the unit to standard rail, to a stand, patient´s bed and wheelchair etc. ➅ Trolley on 4 castors, for A- and C- class dove blue, dimensions (H x W x D): 580 x 425 x 400 mm, self assembly ➆ Support for Receptal® external canister 1 l ➇ Support for Medi-Vac® external canister 1 l ➈ Support for Serres® external canister 1 l

Consumables Bacterial filter for DDS secretion canister, 10 pcs. disposable, not autoclavable, Change: daily, with same patient: ca. every 14 days Set of consumables for ATMOS A- and C-class DDS silicone-suction hose Ø 6 mm, L = 1,3 m, 3 bacterial filters, 10 fingertips

REF

❁ 313.0015.0 ❁ 313.0017.0 ❁ 313.0006.0 ❁ 313.0008.0 ❁ 000.0836.0 ❁ 313.0007.0 ❁ 313.0080.0 ❁ 008.0866.0

❁ 313.0011.0 ❁ 313.0436.0 ❁ 313.0012.0 ❁ 320.0070.2 ❁ 313.0009.0 ❁ 313.0010.0 ❁ 313.0413.0 ❁ 340.0054.0 ❁ 313.0160.0

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 17


| respiratory tract suction battery-operated | Consumables

Technical data Noise level

Operating time Power consumption Voltage

Dimensions (H x W x D) Weight

Classifications Capacity of suction

ATMOS C 161 Aspirator

50,0 dB (A) @ 1 m (acc. to ISO 7779)

Noise level

Operating time Power consumption

ca. 170 VA (230 V~) ca. 200 VA (100 V~) ca. 275 VA (115 V~) ca. 200 VA (127 V~) 230 V~ (+/-10 %) 50/60 Hz; Special voltage: 100/115/127 V~ (+/-10 %) 50/60 Hz 250 x 255 x 180 mm 3,5 kg

Protection category: IPX0; degree of protection: type BF; protection class II; class: IIa (acc. to appendix IX, Directive 93/42/EEC) 16 ± 2 l/min

ATMOS C 261 Aspirator

50,0 dB (A) @ 1 m (acc. to ISO 7779)

ATMOS A 261 Aspirator

ca. 53,0 dB (A) @ 1 m (acc. to ISO 7779)

Intermittent operation ca. 45 min, at 230 V ~, 50 Hz, 20°C Cooling down: ca. 60 min, depending on ambient temperature

ca. 105 VA (230 V~) ca. 72 VA (100 V~) ca. 86 VA (115 V~) ca. 105 VA (127 V~)

Voltage

230 V~ (+/-10 %) 50/60 Hz; special voltage: 100/115/127 V~ (+/-10 %) 50/60 Hz

Weight

3,5 kg

Dimensions (H x W x D) Classifications Capacity of suction

250 x 255 x 180 mm

Protection category: IPX0; degree of protection: type BF; protection class II; class: IIa (acc. to appendix IX, Directive 93/42/EEC) 26 ± 2 l/min

The stated technical data are valid at the moment of printing, and are subject to change!

Technical data Noise level

Operating time Power consumption Voltage

Dimensions (H x W x D) Weight

Classifications Capacity of suction

ATMOS C 161 Battery

ca. 56 dB (A) @ 1 m (acc. to ISO 7779)

ATMOS A 161 Battery

ca. 56,0 dB (A) @ 1 m (acc. to ISO 7779)

Battery operation ca. 40 min, intermittent operation ca. 10 min. Cooling down: ca. 30 min, depending on ambient temperature 45 VA

100 - 240V~ ± 10 %; 50/60 Hz 250 x 255 x 180 mm 4 kg

Protection category: IPX0; degree of protection: type BF; protection class II; class: IIa (acc. to appendix IX, Directive 93/42/EEC)

The stated technical data are valid at the moment of printing, and are subject to change!

18

ca. 53,0 dB (A) @ 1 m (acc. to ISO 7779)

Intermittent operation ca. 45 min, at 230 V ~, 50 Hz, 20°C Cooling down: ca. 60 min, depending on ambient temperature

The stated technical data are valid at the moment of printing, and are subject to change!

Technical data

ATMOS A 161 Aspirator

22 ± 2 l/min


| respiratory tract suction battery-operated | Atmoport N basic unit MedizinTechnik

Atmoport N

Emergency suction device The powerful respiratory tract suction device for emergency treatment! Clear indication of battery charging status

Particularly long-time battery-operated (45 min) Quick charging (full load within 2 hours)

One of the most powerful, compact suction device for the emergency treatment worldwide!

The Atmoport N is an extremely compact, powerful and battery-operated suction unit for emergency treatment. The high performance makes a quick suction possible, e.g. for removing viscous mucus or food particles from the respiratory tract as well as for the quick evacuation of vacuum mattresses. The suction unit may be operated by on-board power supply or by battery. Atmoport N basic unit

Atmoport N with shoulder-bag Portable battery-operated suction unit for emergency treatment. Characteristics: Infinitely variable vacuum adjustment and precision indication, 4-step battery capacity display, 1 l secret canister (plastic) with integrated hydrophobic bacterial filter.

REF ❁ 312.0400.0

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connecting cable, car network cable for operation and charging at 12 V car network, 2 bacterial filters, fingertip, 3 hose connectors for secretion canister lid, 2 hose connectors for the connection of 8 mm hoses, shoulder-bag orange, canister, canister lid, operating manual

Atmoport N without shoulder-bag Portable battery-operated suction unit for emergency treatment

Included in delivery: Silicone suction hose Ø 6 mm, L = 1.3 m, connecting cable, car network cable for opperation and charging at 12 V car network, 2 bacterial filters, fingertip, 3 hose connectors for secretion canister lid, 2 hose connectors for the connection of 8 mm hoses, canister, canister lid, operating manual

❁ 312.0401.0

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 19


Atmoport N | Accessories and consumables

Accessories and consummables Atmoport N

1

2

3

4

5

6

7

8

9

20


MedizinTechnik

Accessories for Atmoport N ➀ Secretion canister 1 l (plastic) ➁ Secretion canister lid, complete ➂ Hose connector for hoses Ø 6 mm Shoulder-bag, black, Dimensions (H x W x D) 280 x 290 x 110 mm ➃ Shoulder-bag, orange Dimensions (H x W x D) 290 x 340 x 110 mm ➄ Operating power pack 90-264 V~, 12 V➅ Device support for Atmoport N / ATMOS S 041 with rotatable holder for attaching the unit to standard rail, to a stand, patient's bed, wheel chair etc. ➆ Charging power pack (with car socket) 230 V~, 12 V➇ Medi-Vac® canister set 1 l with holder, canister for Medi-Vac® suction bag, Medi-Vac® suction bag 1 l ➈ Receptal® canister set 1 l with holder, canister for Receptal® suction bag, Receptal® suction bag 1 l

Consumables for Atmoport N Bacterial filter for Atmoport, Atmoport S and Atmoport N, 1 pc. to be plugged, disposable, not autoclavable, Change: 1 x per patient, with same patient: 1 x per week

Technical data

Atmoport N

Power consumption

46 VA

Noise level Voltage Weight

Classifications Secretion container

Accu Operating time Capacity of suction

REF

❁ 312.0626.0 ❁ 312.0625.1 ❁ 000.0836.0 ❁ 312.0650.0 ❁ 312.0450.0 ❁ 312.0449.0 ❁ 312.0852.0 ❁ 312.0454.0 ❁ 312.0470.0 ❁ 312.0460.0 ❁ 312.0439.0

54,9 dB (A) @ 1m (acc. ISO 7779) 100 V~ up to 240 V~ 50/60 Hz without switching ca. 3,8 kg with canister

Protection category: IPX0; degree of protection: type BF; protection class II; class: IIa (acc. to appendix IX, Directive 93/42/EEC) 1 l, plastic

ca. 45 min; ca. 60 min with mains supply or low voltage supply 36 ± 2 l/min

The stated technical data are valid at the moment of printing, and are subject to change!

21


Respiratory tract suction devices | General accessories

General accessories for ATMOS respiratory tract suction devices

1

2

4

5

22

3


MedizinTechnik

General accessories ➀ Receptal® external canister 1 l ➁ Serres® external canister 1 l ➂ Medi-Vac® canister 1 l ➃ Basket for catheters, L = 340 mm ➄ Basket with standard rail holder Dimensions: (H x W x D): 340 x 127 x 178 mm

REF

❁ 312.0464.0 ❁ 312.0465.0 ❁ 312.0473.0 ❁ 444.0140.0 ❁ 320.0075.0

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 23


Respiratory tract suction devices | General consumables

General consumables for ATMOS respiratory tract suction devices

1

2

3

4

5

6

7

8

9

24


MedizinTechnik

Suction hoses / fingertip ➀ Plak-VacTM tooth brush with suction mechanism not autoclavable, Change: 1 x per patient, with same patient: every 4 weeks, minimum purchase quantity: 5 pcs. Suction hose, silicone, Ø 6mm, minimum purchase 5 m autoclavable up to 134°C, price/m ➁ Suction hose, silicone, Ø 6 mm, L = 1.30 m, 1 pc. single packed, autoclavable at 134°C ➂ Suction hose, disposable, Ø 6 mm, L = 1.30 m, 10 pcs. not autoclavable, with integrated funnel and fingertip, Change: 1x per patient Suction hose, disposable, Ø 6 mm, L = 2.10 m, 50 pcs. Change: 1 x per patient ➃ Fingertip, sterile, not autoclavable, 10 pc. Suction bags Receptal® suction bag 1.5 l, not autoclavable, 50 pcs. ➄ Receptal® suction bag 1 l, not autoclavable, 50 pcs. ➅ Medi-Vac® suction bag 1 l, not autoclavable, 50 pcs. ➆ Serres® suction bag, 1 l, not autoclavable, 36 pcs. with angled connection

Suction catheters ➇ Suction catheter Unomedical®, size: CH 12, L = 50 cm, 100 pcs. Ø 4 mm, white, straight, central opening, 2 small lateral openings, suction connection Ø 6 mm, sterile, not autoclavable Suction catheter Unomedical®, size: CH 14, L = 50 cm, 100 pcs. Ø 4.7 mm, green, straight, central opening, 2 small lateral openings, suction connection Ø 6 mm, sterile, not autoclavable Suction catheter Unomedical®, size: CH 16, L = 50 cm, 100 pcs. Ø 5.3 mm, green, straight, central opening, 2 small lateral openings, suction connection Ø 6 mm, sterile, not autoclavable

Atmolit 26, ATMOS LC 16, Atmolit 16 N ➈ Filter plates for LC 16, Atmolit 26/16 N, 25 pcs. disposable, not autoclavable, Change: 1 x per patient, with same patient: 1 x per week Filter plates for LC 16, Atmolit 26 und 16 N, 100 pcs. disposable, not autoclavable, Change: 1 x per patient, with same patient: 1 x per week Bacterial filter for Atmoport, Atmoport S and Atmoport N, 1 pc. to be plugged, disposable, not autoclavable, Change: 1 x per patient, with same patient: 1 x per week Set of consumables for LC 16, Atmolit 26/16 N consisting of: 2 coding rings (green), 1 suction hose, 1 connection hose, 25 bacterial filters and 10 fingertips

REF

❁ 000.0821.0 ❁ 006.0009.0 ❁ 000.0013.0 ❁ 006.0057.0 ❁ 006.0059.0 ❁ 000.0347.0 ❁ 310.0222.2 ❁ 312.0463.0 ❁ 312.0474.0 ❁ 312.0466.0 ❁ 000.0294.0 ❁ 000.0295.0 ❁ 000.0296.0

❁ 320.0065.0 ❁ 320.0066.0 ❁ 312.0439.0 ❁ 320.0125.0

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 25


Reprocessing of suction devices – in the past

Reprocessing for further use of suction devices – in the past

Alone in Germany there are around 20,000 patients, who are not able to cough up secretion from the respiratory tract. Here a suction device should be available. For the use at home, health insurance companies provide these appliances either brand-new or reprocessed for further use. Unfortunately, it is often common practice that suction devices are reprocessed at a favourable price, but from untrained personnel, and with insufficient means. These devices are dangerous to patients‘ and third persons‘ health. In addition a declining confidence in the professional medical care is the result – especially when a device is oversucked! Especially in the case of lump compensation, it is almost impossible for the care providers to perform a top-quality reprocessing according to manufacturer information, and at the same time cover their costs. For these reasons, patients often get suction devices which are improperly reprocessed. Here the solution is a favourably priced suction device with an oversuction stop, which – when in doubt – can be checked and reprocessed quickly!

Important Advice: In the case of use with another patient it is regulated by law to reprocess the device before further use. We are gladly prepared to perform for you a professional reprocessing of your suction devices.

26

In the past: Work steps: ’ Pre-cleaning ’ Opening the device ’ Condition appraisal ’ Thorough cleaning and disinfection ’ Exchange of all air and secretion ducting parts (including inner parts) ’ Exchange of accessories and consumables ’ Packing/shipment ’ Reprocessing: long-winded and expensive ’ Only to be performed by the ATMOS service or an authorised ATMOS partner


Reprocessing of suction devices – today MedizinTechnik

Reprocessing for further use of suction devices – today

Condensate trap quick visual inspection in case of possible contamination yIDYRXUDEO\SULFHG reprocessing

ATMOS C 161 Aspirator ATMOS C 261 Aspirator ATMOS C 161 Battery

Today:

These devices have an integrated service indicator, the so-called condensate trap. This indicator enables a quick and cost-saving visual inspection regarding its condition without having to open it. In the case where no discolouring, residues or humidity are visible in the condensate trap, this proves, the device has always been operated properly and a contamination can be ruled out.

’ Pre-cleaning ’ Condition appraisal without having to open the device ’ Exchange of accessories and consumables ’ Packing/shipment ’ Quick appraisal of the hygienic condition ’ Reprocessing: prompt and cost effective

If the indicator bears traces of an oversuction, carelessness/ improper use must be assumed. The device must then be submitted for repair to ATMOS or an authorised ATMOS partner. And the costs for repair are considerably higher than for a reprocessing because a repair is much more complex.

Work steps:

Compared with the reprocessing costs for a conventional device, the quick visual inspection enables a reduction in price of up to 40%. Therefore, these C-class suction devices are recommendable for frequent change-over to a new patient. Especially in the case of lump compensation they are the first choice.

Important Advice: In the case of use with another patient it is regulated by law to reprocess the device before further use. We are gladly prepared to perform for you a professional reprocessing of your suction devices.

27


Extract: Tracheal and oral suction Mediz inTech nik ... for Mediz a better life inTech nik ... for a bett er life

Resp iratory Tract Sucti on

You will get detailed information from our new ATMOS brochure Please order it!

Information brochure: Respiratory tract suction HM.01

Oral suction

Tracheal suction

Material: See oral and nasal suction, in addition a stethoscope is required!

Material: Â’6XFWLRQGHYLFH Â’)LQJHUWLS Â’6XFWLRQFDWKHWHU Â’6WHULOHJORYHVXQVWHULOHJORYHV Â’0DVN Â’6LQJOHXVHDSURQ Â’(YHQWXDOO\&XIISUHVVXUHJDXJH Â’6WRUDJHERZO Â’(YHQWXDOO\1D&O Â’6SDUHFDQQXOD Â’(YHQWXDOO\R[\JHQDSSDUDWXV

Performance: Â’9DFXXPDGMXVWPHQW E\DGXOWVXSWREDUE\EDELHV DQGLQIDQWVXSWREDU

Â’3XWRQXQVWHULOHJORYHV Â’,QVHUWWKHGLVFRQQHFWHGFDWKHWHULQWRWKHWUDFKHDWKURXJK WKHQRVHRUPRXWKZLWKRXWDQ\VXFWLRQ3ULRUWRLQVHUWLRQ it should be moistened with lubricant; after insertion it is FRQQHFWHGWRWKHVXFWLRQGHYLFH Â’5HPRYHZLWKVXFWLRQDQGURWDWLQJPRYHPHQWV Â’8VHWKHFDWKHWHURQO\RQFH Â’5LQVHWKHKRVHV\VWHPZLWK393LRGLQHVROXWLRQ   or with distilled water Â’&KHFNWKHEUHDWKLQJDQGWKHVHFUHWLRQ Â’6XFWLRQSURFHGXUHDQGHYHQWXDOILQGLQJVPXVWEH documented

Advice: 7KLVLVRQO\DVKRUWDEVWUDFWRIRXUSUDFWLFDOUHODWHGEURFKXUH 3OHDVHRUGHU\RXUGHWDLOHG$7026UHVSLUDWRU\WUDFWVXFWLRQEURFKXUH for free at: Phone: +49 7653 689-374

28

An info for medrmation br ochure and pa ical staff tients

Performance: Â’9DFXXPDGMXVWPHQW E\DGXOWVXSWREDUE\EDELHVDQG LQIDQWVXSWREDU

Â’3XWRQJORYHV Â’(YHQWXDOO\WKHVHFUHWLRQPXVWEHOLTXHILHGZLWK1D&O Â’,QVHUWWKHFDWKHWHUWKURXJKWKHWXEXVLQWRWKHWUDFKHDO cannula, with suction Â’7KHFDWKHWHULVDVORQJDVWKHWUDFKHDOFDQQXOD Â’8VHWKHFDWKHWHURQO\RQFH Â’5LQVHWKHKRVHV\VWHPZLWK393LRGLQHVROXWLRQ   or with distilled water Â’&KHFNWKHEUHDWKLQJDQGWKHVHFUHWLRQ Â’0HDVXULQJWKHFXIISUHVVXUH Â’6XFWLRQSURFHGXUHDQGHYHQWXDOILQGLQJVPXVWEH documented


MedizinTechnik

ATMOS Wound Therapy

Experts know why! NPWT = Negative Presure Wound Therapy

29


Wound drainage | Negative Pressure Wound Therapy

Negative Pressure Wound Therapy A therapy with new approaches For many indications in the areas of chronic and traumatic wounds the NPWT offers new ways to successful treatment.

Aim of the treatment: „

Stimulation of the granulation tissue

„

Improvement of the blood circulation

„

Reduction of wound oedema

„

Active drainage of wound secretion

„

Reduction of wound infections

„

Wound conditioning

„

A minimization of cross infections

Indications „

The ATMOS negative pressure systems are mobile suction devices for the NPWT. The systems are suitable for the long term application on humans. They are portable, mains-independent and have an electronic monitoring function with an optical and acoustic status display.

7KHDSSOLFDWLRQRIWKH$702613:7V\VWHPLVLQGLFDWHGIRUSDWLHQWVZKRZLOOEHQH¿WIURPWKH controlled negative pressure and as a result achieve the desired wound healing. In particular this could be an advantage for patients who require drainage with negative pressure for the removal of infected materials with continuous or intermittent negative pressure.

„

„

30

For the following types of wounds a treatment with the ATMOS NPWT in connection with the ATMOS wound dressing is recommended: for chronic, acute, traumatic and dehiscent wounds, ulcers (e.g. pressure and diabetic ulcers) transplants and burns.


Chronic wounds

before

after

before

after

Ulcus cruris

Diabetic foot syndrom

Decubitus

Acute wounds

Traumatic wound

Surgical wound

31


Wound drainage | ATMOS S 042 NPWT

ATMOS S 042 NPWT The simplest application at a glance

1 // The exact pressure measurement at the patient The ATMOS S 042 NPWT enables an optimum therapy control due to the exact pressure measurement directly on the wound.

The impermeability of the bandage is immediately indicated.

2 // Gentle negative pressure Optimum comfort for the patient due to the gentle build-up of negative pressure. Less pain leads to a higher acceptance among the patients.

3 // Variable intermittent-mode A further optimization of the ATMOS S 042 NPWT is the variable intermittent mode. This allows you to determine the individual intermittent mode for each patient.

4 // Mobile versus inpatient Due to the various sizes of the container and WKHSHUIHFW多WWLQJFDUU\LQJVWUDSWKLVV\VWHPLV suitable for the mobile and inpatient application.

32


5 // Day-and-night-sensor The day-night-sensor enables the patients to get a good night’s rest. The device adjusts automatically to the environmental lighting.

6 // Touchscreen The touchscreen is high resolution and enables you to easily adjust and overlook the therapy relevant settings.

7 // The ATMOS carefree package 3XWDQHQGWRLQGHÂżQDEOHDODUPV and put an end to uncertainty. At a glance the intelligent ATMOS system shows you any errors and their possible causes.

8 // Container exchange The trick with the click! Only one hand is needed to exchange the container. There is a choice of two containers 300ml and 800ml.

33


| wound drainage | ATMOS S 042 NPWT

ATMOS S 042 NPWT

Negative Pressure Wound Therapy A therapy with new approaches Self explanatory User friendly Reliable

ATMOS S 042 NPWT

REF

ATMOS S 042 NPWT Portable mains-independent wound drainage suction unit, â? 316.0000.0 airflow rate of pump: max. 4.5 l/min Characteristics: Perfect monitoring, easy handling and maximum safety due to modern microprocessor technology, unique operation concept with touch screen, filter technology, Direct-Docking-System (DDS), automatic control of s actual value, battery operation time of up to 16 h, handy size and low weight. Included in delivery: Power cable, charging power pack for 100 - 240 V~, 50/60 Hz, shoulder carrying strap, operating instructions

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 34


MedizinTechnik

Accessories ➀ Device support for ATMOS S 042 NPWT with rotatable holder for attaching the unit to standard rail, to a stand, patient´s bed and wheelchair etc. ➁ Shoulder strap for ATMOS S 042 NPWT

Spare parts ➂ Charging device for ATMOS Battery, 100 - 240 V~, 50/ 60 Hz ➃ Strap holder

REF

❁ 316.0200.0

❁ 316.1100.0 ❁ 313.0080.0

❁ 316.1110.0

Technical data

ATMOS S 042 NPWT

Dimensions (H x W x D)

162 x 201 x 95 mm

System voltage Weight

Classifications Accu Operating time Accu charging time Capacity of suction

100 - 240 V~, 50/60 Hz approx. 1.6 kg

Protection category: IP33; degree of protection: type BF; protection class I while mainsoperated, II while battery-operated; class: IIa (acc. to appendix IX, Directive 93/42/EEC) up to 16 h

approx. 2 h

4 ± 0.5 l/min

The stated technical data are valid at the moment of printing, and are subject to change!

35


Wound drainage | The optimum wound care

The optimum wound care ready for use.

1 // VivanoTecŽ Port VivanoTecŽ Port guarantees an exact pressure measurement directly on the wound. Due to the ÀH[LEOHDQGVRIWVLOLFRQHWKH application and wearing comfort is greatly improved.

2 // VivanoMedÂŽ Foam 7KHÂżQHSRUHGDQWLDOOHUJHQLF9LYDQR0HGÂŽ )RDPLVVRĂ€H[LEOHWKDWLWHYHQDGDSWVWR irregular wound edges. Due to the open pored structure the pressure is easily spread over the sponge and encourages an effective therapy.

36


Studies prove – stimulating and absolutely clean External studies have proven that the sponge encourages the cell formation and granulation of the tissue in the wounds. The sponge barely sticks to the wound therefore leaving no sponge residue.

3 // Plug connection Dressing kit and vacuum pump are connected to one another via a plug connection.

+\GUR¿OP® In order to achieve an effective therapy a reliable sealing is absolutely essential. Considering the special adhesive properties of the +\GUR¿OP®, an excellent impermeability is guaranteed.

VivanoTec®, VivanoMed® and Hydrofilm® are registered trademarks of the Paul Hartmann AG

37


Wound drainage | ATMOS S 042 NPWT | Dressing kits & consumables

Dressing kits & consumables ATMOS S 042 NPWT

1

2

3

4

5

6

7

8

VivanoTec速, VivanoMed速 and Hydrofilm速 are registered trademarks of the Paul Hartmann AG

38


MedizinTechnik

Dressing Kits ➀ VivanoMed® Foam Kit S; VE 5 5 Wound dressing kits for ATMOS S 042 NPWT, consisting of: 1x VivanoTec® Port, 1x Hydrofilm®, 1x VivanoMed® Foam 10 x 7.5 x 3.3 cm ➁ VivanoMed® Foam Kit M; VE 5 5 Wound dressing kits for ATMOS S 042 NPWT, consisting of: 1x VivanoTec® Port, 1x Hydrofilm®, 1x VivanoMed® Foam 18 x 12.5 x 3.3 cm ➂ VivanoMed® Foam Kit L; VE 5 5 Wound dressing kits for ATMOS S 042 NPWT, consisting of: 1x VivanoTec® Port, 1x Hydrofilm®, 1x VivanoMed® Foam 25 x 15 x 3.3 cm ➃ VivanoMed® Foam Kit XL; VE 5 5 Wound dressing kits for ATMOS S 042 NPWT, consisting of: 1x VivanoTec® Port, 1x Hydrofilm®, 1x VivanoMed® Foam 60 x 30 x 1.6 cm ➄ VivanoMed® Foam Kit Round; VE 5 5 Wound dressing kits for ATMOS S 042 NPWT, consisting of: 1x VivanoTec® Port, 1x Hydrofilm®, 1x VivanoMed® Foam 12.5 x 3.3 cm ➅ VivanoMed® Foam Kit Thin; VE 5 5 Wound dressing kits for ATMOS S 042 NPWT, consisting of: 1x VivanoTec® Port, 1x Hydrofilm®, 1x VivanoMed® Foam 26 x 15 x 1.6 cm

REF

❁ 314.1500.0 ❁ 314.1510.0 ❁ 314.1520.0 ❁ 314.1530.0 ❁ 314.1540.0 ❁ 314.1550.0

Dressing Kits ➆ Secretion canister 300 ml, transparent, sterile, 5 pcs. ❁ 316.1300.0 Sterile disposable suction canister with integrated overflow protection and gelling agent for more safety and hygiene. Not autoclavable. ➇ Secretion canister 800 ml NPWT, transparent, sterile, 5 pcs. ❁ 316.1400.0 Sterile disposable suction canister with integrated overflow protection and gelling agent for more safety and hygiene. Not autoclavable

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 39


Wound drainage | ATMOS S 041 Wound

ATMOS S 041 Wound The solution forthe small budget 1 // Intermittent function The intermittent function makes it possible to adjust the periods of active suction control and of no active suction separately. This permanent DOWHUQDWLRQHQFRXUDJHVEORRGÀRZDQGZLWKLW granulation of the tissue is improved.

2 // Control The microprocessor-controlled vacuum ¿QHDGMXVWPHQWSURYLGHVIRUDFRQVWDQW negative pressure. A highly sensitive, microprocessor controlled sensor measures permanently whether the vacuum values set on the ATMOS S 041 Wound is actually applied. An adjustment is made at once if the value is not compliant.

&RVWHI¿FLHQW Due to the external mains adapter the ATMOS engineers have created several advantages for the patient: „ the weight of the ATMOS S 041 Wound was reduced to ca. 2kg „ the charging time for the battery was reduced and „ the battery life increased.

40


4 // Key lock The device is protected against erroneous operation by the manual and automatic key lock.

5 // Safety ,IWKHYDFXXPGURSVEHORZDSUHGH¿QHG critical range, the alarm will be activated immediately.

6 // Flexibility The ATMOS system enables you to freely choose consumables e.g. containers. „ cReceptal® „ dSerres® „ eMediVac®

c d e

41


| wound drainage | ATMOS S 041 Wound

ATMOS S 041 Wound

Battery operation for quick mobilisation The solution for the sensor-controlled wound drainage The functions:

intermittent function

improved battery capacity longer running time

shorter charging period simplified operation Your advantages:

battery operation up to 24 h 2 kg basic weight

multilevel safety concept

the complete solution for the wound drainage

ATMOS S 041 Wound

ATMOS S 041 Wound / Serres® Portable, battery operated wound drainage suction device, air-flow rate of pump: 8 l/min. Characteristics: Microprocessor-guided vacuum adjustment and control, LCD display for easy use, safety-concept with automatic and manual key-lock, integrated overflow protection and 1 l disposable canister for hygienic treatment and disposal.

REF ❁ 312.0970.0

Included in delivery: mains cable, charging cable for 110 - 240 V~, 50/60 Hz, connection hose, Serres® secretion canister and 1 Serres® suction bag 1 l, with integrated overflow valve filter, operating manual

ATMOS S 041 Wound / Medi-Vac® Portable, battery operated wound drainage suction device, air-flow rate of pump: 8 l/min.

❁ 312.0965.0

ATMOS S 041 Wound / Receptal® Portable, battery operated wound drainage suction device, air-flow rate of pump: 8 l/min.

❁ 312.0955.0

Included in delivery: mains cable, charging cable for 110 - 240 V~, 50/60 Hz, connection hose, Medi-Vac® secretion canister and, 1 Medi-Vac® suction bag 1 l with integrated overflow valve filter, operating manual

Included in delivery: mains cable, charging cable for 110 - 240 V~, 50/60 Hz, connection hose, Receptal® secretion canister and 1 Receptal® suction bag 1 l, with integrated overflow valve filter, operating manual

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 42


MedizinTechnik

Accessories for ATMOS S 041 Wound ➀ Serres® external canister 1 l ➁ Receptal® external canister 1 l Medi-Vac® canister 1 l ➂ Shoulder-bag, black, Dimensions (H x W x D) 280 x 290 x 110 mm Device support for Atmoport N / ATMOS S 041 with rotatable holder for attaching the unit to standard rail, to a stand, patient's bed, wheel chair etc. Hose connector, 6 to 8 mm Consumables for ATMOS S 041 Wound Serres® suction bag, 1 l, not autoclavable, 36 pcs. with angled connection Receptal® suction bag 1 l, not autoclavable, 50 pcs. Medi-Vac® suction bag 1 l, not autoclavable, 50 pcs. Nipple for Receptal® canister not autoclavable Suction hose, silicone, Ø 6 mm, L = 2 m, 1 pc Autoclavable at 134 °C, change: after 20 x autoclaving

REF

❁ 312.0465.0 ❁ 312.0464.0 ❁ 312.0473.0 ❁ 312.0650.0 ❁ 312.0852.0 ❁ 000.0841.0 ❁ 312.0466.0 ❁ 312.0463.0 ❁ 312.0474.0 ❁ 312.0882.0 ❁ 000.0361.0

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 43


Wound drainage | Applying the gauze dressing

Applying the gauze dressing

D

A

We provide you dressing kits that are tailor-made to your needs, at an extremely fair price for the ATMOS S 041 Wound which contain all necessary components for the wound

B E

A

Connecting hose

E

Adhesive mass

F

B

Self-adhesive foil

F

Saline

C

Drain

G

Gauze

D

Adhesive strip

H

Non-adhesive dressing kit

C

G

H

The Dressing kits are different regarding the type of drain and the quantity of the individual components!

The optimum treatment of wounds The Dressing Kit that is supplied together with the ATMOS S 041 Wound contains all components that the nursing staff requires for the treatment of wounds. The insertion of the drain in itself is extremely simple and comfortable:

1. Cleansing of wounds in accordance with the relevant clinical standards and directives.

2. Cut the non-adherent dressing to the size of the wound H.

3. Insertion of the salinesaturated gauze in the wound. G.

44


4. Positioning of the drainage tube tailor-made to match the wound. C .

5. Fixation of the drainage tube by means of adhesive mass. E

&RPSOHWH¿OOLQJRIWKHZRXQGEHGZLWKVDOLQHVDWXUDWHGJDX]H*

*HQHURXVDSSOLFDWLRQRIWKHWUDQVSDUHQW¿OP%

8. Air-tight sealing of the exit port of the drain by means of x-shaped attachment of the waterproof adhesive strip. D .

9. Connection to the connecting hose of the ATMOS S 041 Wound A . After the Dressing Kit has been positioned correctly in the wound, the drainage tube must only be connected to the connecting hose of the ATMOS S 041 Wound and if required vacuum values and intermitting intervals must be adjusted - that‘s it!

45


Wound drainage | ATMOS S 041 Wound | Accessories & consumables

Accessories and Consumables ATMOS S 041 Wound

1

2

3

4

5

6

7

8

46


MedizinTechnik

ATMOS Dressing Kit (small) with round drainage 10 FR ➀ Included in delivery per dressing kit (25 pcs.): 10 FR round hose drainage, bioclusive wound dressing 4.5 x 7 cm, bioclusive wound dressing 20.3 x 25.4 cm, skin barrier no-sting wipe, 2 modudose saline, oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strips, 4 adhesive strips, lineal, operating manual

ATMOS Dressing / canister set (small) with round hose drainage ➁ 1 pack of Serres® suction bags à 36 pcs., 2 packs of dressing kits small à 25 pcs. with 10 mm round hose drainage. ➂ 19FR Dressing-Kit with round drain, small, VE25 Included in delivery per dressing kit (25 pcs.): 19 FR rounde drain, bioclusive wound dressing 20.3 x 25.4 cm, skin barrier nosting wipe, modudose saline, oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strip, adhesive strips, lineal, operating manual ➃ 10FR Dressing-Kit with round drain, small, VE25 Included in delivery per dressing kit (25 pcs.): 10 FR round drain, bioclusive wound dressing 20.3 x 25.4 cm, skin barrier nosting wipe, modudose saline, oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strip, adhesive strips, lineal, operating manual ➄ 19FR Dressing-Kit with round drain, medium, VE25 Included in delivery per dressing kit (25 pcs.): 19 FR round drain, 2x bioclusive wound dressing 20.3 x 25.4 cm, 2x skin barrier no-sting wipe, 2x modudose saline, 2x oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strip, adhesive strips, lineal, operating manual ➅ 19FR Dressing-Kit with round drain, large, VE25 Included in delivery per dressing kit (25 pcs.): 19 FR round drain, 2x bioclusive wound dressing 20.3 x 25.4 cm, 2x skin barrier no-sting wipe, 4x modudose saline, 2x oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress roll, Coloplast ostomy strip, adhesive strips, lineal, operating manual ➆ 19FR Dressing-Kit with round drain, XL, VE25 Included in delivery per dressing kit (25 pcs.): 19 FR round drain, 2x bioclusive wound dressing 20.3 x 25.4 cm, 2x skin barrier no-sting wipe, 4x modudose saline, 4x oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress roll, Coloplast ostomy strip, adhesive strips, lineal, operating manual

REF

❁ 314.0004.0

❁ 312.0484.0 ❁ 314.0030.0

❁ 314.0032.0

❁ 314.0040.0

❁ 314.0050.0

❁ 314.0060.0

ATMOS Dressing Kit (large) with round hose drainage 19 FR ➇ Included in delivery per dressing kit (25 pcs.) ❁ 314.0005.0 19 FR round hose drainage, bioclusive wound dressing 4.5 x 7 cm, 3 bioclusive wound dressing 20.3 x 25.4 cm, 2 skin barrier no-sting wipe, 4 modudose saline, 3 oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strip, 4 adhesive strips, lineal, operating manual

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 47


Wound drainage | ATMOS S 041 Wound | Dressing kits

Dressing kits ATMOS S 041 Wound

1

2

3

4

5

6

7

8

48


MedizinTechnik

ATMOS Dressing / canister set (large) with round hose drainage ➁ 1 pack of Serres®-suction bags à 36 pcs., 2 packs of dressing kits big à 25 pcs. with 19 FR round hose drainage.

ATMOS Dressing Kit (small) with flat hose drainage 10 mm ➁ Included in delivery per dressing kit (25 pcs.): Bioclusive wound dressing 4.5 x 7 cm, bioclusive wound dressing 20.3 x 25.4 cm, skin barrier no-sting wipe, 2 modudose saline, oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strip, 4 adhesive strips, lineal, operating manual

REF

❁ 312.0482.0 ❁ 314.0007.0

ATMOS Dressing / canister set (small) with flat hose drainage ➂ 1 pack of Serres®-suction bags à 36 pcs., 2 packs of dressing kits small à 25 ❁ 312.0483.0 pcs. with 10 mm flat hose drainage. ➃ 10 mm Dressing-Kit with flat drain, small, VE25 ❁ 314.0031.0 Included in delivery per dressing kit (25 pcs.): 10 mm flat drain, bioclusive wound dressing 20.3 x 25.4 cm, skin barrier no-sting wipe, modudose saline, oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strip, adhesive strips, lineal, operating manual ➄ 10 mm Dressing-Kit with flat drain, medium, VE25 ❁ 314.0041.0 Included in delivery per dressing kit (25 pcs.): 10 mm flat drain, 2x bioclusive wound dressing 20.3 x 25.4 cm, 2x skin barrier no-sting wipe, 2x modudose saline, 2x oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strip, adhesive strips, lineal, operating manual ATMOS Dressing Kit (small) with tunnel drainage 15 FR ➅ Included in delivery per dressing kit (25 pcs.): 15 FR tunnel drainage, bioclusive wound dressing 4.5 x 7 cm, bioclusive wound dressing 20.3 x 25.4 cm, skin barrier no-sting wipe, 2 modudose saline, oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strip, 4 adhesive strips, lineal, operating manual

ATMOS Dressing / canister set (small) with tunnel drainage ➆ 1 pack of Serres®-suction bags à 36 pcs., 2 packs of dressing kits small à 25 pcs. with 15 FR tunnel drainage. ➇ 15FR Dressing-Kit channel drain, small, VE25 Included in delivery per dressing kit (25 pcs.): 15 FR channel drain, bioclusive wound dressing 20.3 x 25.4 cm, skin barrier nosting wipe, modudose saline, oil emulsing nonadhesive dressing 7.6 x 20.3 cm, Kerlix AMD gauze compress, Coloplast ostomy strip, adhesive strips, lineal, operating manual

Technical data

ATMOS S 041 Wound

Voltage

100 - 240 V~/50/60 Hz

Noise level

Dimensions (H x W x D) Weight

Capacity of suction

❁ 314.0006.0

❁ 312.0481.0 ❁ 314.0033.0

< 38 dB (A) (acc. to ISO 7779) 260 x 250 x 106 mm with external charging unit 2 kg, incl. holder for secretion container 8 l/min ± 1 l/min

The stated technical data are valid at the moment of printing, and are subject to change!

49


Wound drainage | ATMOS S 041 Wound | DVD

DVD ATMOS S 041 Wound

For every user in the wound care sector is this movie a must!

Silent.Gentle.Powerful.

NEW

Now with intermittent function

The solution for the sensor-controlled wound drainage. ATMOS S 041 Wound The next generation

D

DV

The new DVD about the ATMOS wound care management can be ordered at: ATMOS MedizinTechnik GmbH & Co KG Phone: + 49 7653 689-374 Fax: + 49 7653 68986-374 ApplicationSolutions@atmosmed.de People who cannot wait may download it at: www.atmosmed.com

50


MedizinTechnik

ATMOS S 041 Gastric

51


The solution for active gastric drainage Compact, favourable and powerful: the sensor controlled gastric drainage

’ Highest mobility by battery operation up to 24h

The advantages

’ Easily portable – only 1.9 kg basic weight.

The drainage can be optimally adjusted to suit the patient thanks WRWKHPLFURSURFHVVRUFRQWUROOHGYDFXXP¿QHDGMXVWPHQW$KLJKO\ sensitive sensor permanently measures and automatically regulates the set values.

’ More safety by optical and acoustic alarm. ’ Microprocessor controlled vacuum precision adjustment.

Optimum control:

$ZLGH¿HOGRIDSSOLFDWLRQ The system has a continuous and intermittent mode. As a result the ATMOS S 041 Gastric can be used for the temporary and longterm gastric drainage. Low weight:

’ Automatic and manual key lock ’ A large range of applications due to the continuous and intermittent suction

52

Due to the low weight of the ATMOS S 041 a rapid mobilization of the patient is possible.


| gastric drainage | ATMOS S 041 Gastric MedizinTechnik

ATMOS S 041 Gastric

Basic unit Battery operation 2 kg light weight

Precise vacuum adjustment Multilevel safety concept Intermittent duty

ATMOS S 041 Gastric

ATMOS S 041 Gastric / Serres® Portable, battery operated gastric drainage suction device, air-flow rate of pump: 8 l/min. Characteristics: Microprocessor-guided vacuum adjustment and control, LCD display for easy use, safety-concept with automatic and manual key-lock, integrated overflow protection and 1 l disposable canister for hygienic treatment and disposal.

REF ❁ 312.0940.0

Included in delivery: mains cable, charging cable for 110 - 240 V~, 50/60 Hz, secretion hose, connection hose, Serres® secretion canister and, 1 Serres® suction bag 1 l with integrated overflow valve filter, operating manual

ATMOS S 041 Gastric / Medi-Vac® Portable, battery operated gastric drainage suction device, air-flow rate of pump: 8 l/min.

❁ 312.0941.0

ATMOS S 041 Gastric / Receptal® Portable, battery operated gastric drainage suction device, air-flow rate of pump: 8 l/min.

❁ 312.0942.0

Included in delivery: mains cable, charging cable for 110 - 240 V~, 50/60 Hz, secretion hose, connection hose, Medi-Vac® secretion canister and 1 Medi-Vac® suction bag 1 l, with integrated overflow valve filter, operating manual

Included in delivery: mains cable, charging cable for 110 - 240 V~, 50/60 Hz, secretion hose, connection hose, Receptal® secretion canister and, 1 Receptal® suction bag 1 l with integrated overflow valve filter, operating manual

Please contact us via: ApplicationSolutions@atmosmed.de | Phone: +49 7653 689-374 | Fax: +49 7653 68986-374 53


| gastric drainage | Accessories for ATMOS S 041 Gastric

Accessories for ATMOS S 041 Gastric Device support for Atmoport N / ATMOS S 041 with rotatable holder for attaching the unit to standard rail, to a stand, patient's bed, wheel chair etc. ➀ Shoulder-bag, black, Dimensions (H x W x D) 280 x 290 x 110 mm Medi-Vac® canister 1 l ➁ Serres® external canister 1 l ➂ Receptal® external canister 1 l Hose connector, 6 to 8 mm Consumables for ATMOS S 041 Gastric Serres® suction bag, 1 l, not autoclavable, 36 pcs. with angled connection Medi-Vac® suction bag 1 l, not autoclavable, 50 pcs. Receptal® suction bag 1 l, not autoclavable, 50 pcs. Nipple for Receptal® canister not autoclavable Suction hose, silicone, Ø 6 mm, L = 2 m, 1 pc Autoclavable at 134 °C, change: after 20 x autoclaving

REF

❁ 312.0852.0 ❁ 312.0650.0 ❁ 312.0473.0 ❁ 312.0465.0 ❁ 312.0464.0 ❁ 000.0841.0 ❁ 312.0466.0 ❁ 312.0474.0 ❁ 312.0463.0 ❁ 312.0882.0 ❁ 000.0361.0

Technical data

ATMOS S 041 Gastric

Voltage

100 - 240 V~/50/60 Hz

Noise level

Dimensions (H x W x D) Weight

Classifications Capacity of suction

< 38 dB (A) (acc. to ISO 7779) 260 x 255 x 106 mm

2 kg, incl. holder for secretion container

protection category: IPX1; protection. class: (EN 60601-1): I; degree of protection: type B; class: IIa (acc. to appendix IX, directive 93/42/EEC) 8 l/min ± 0,5 l/min

The stated technical data are valid at the moment of printing, and are subject to change!

54


MedizinTechnik

ATMOS Service worldwide

’ 7HFKQLFDOWUDLQLQJ ’ 0DLQWHQDQFHDQGVHUYLFLQJ ’ 6HUYLFHDQGUHSDLU

We offer you complete support so you can care for your patients! 55


MedizinTechnik

Training and instructions Â&#x2019;,QVWUXFWLRQVIRUXVH

Â&#x2019;3URGXFWWUDLQLQJ

The ATMOS product and introductory training courses will clearly and comprehensively prepare your staff for practical operation. We ensure that important knowledge and skills concerning maintenance and care are communicated and if required, this training can be carried out on customer premises.

Introductory training courses for ATMOS products )XQGDPHQWDO HOHPHQWV RI $7026 SURGXFWV DQG V\VWHP DSSOLFDWLRQV $SSOLFDWLRQ LQ FRPSOLDQFH ZLWK XVHU LQVWUXFWLRQV IXQFWLRQLQJ PRGH DXWKRULVHG DFFHVVRULHV RSSRUWXQLWLHVIRUFRPELQDWLRQZLWKRWKHUSURGXFWVVDIHW\IXQFWLRQVFDUH PDLQWHQDQFHDQGK\JLHQHPHDVXUHVSUDFWLFDOH[HUFLVH Confirmation of participation in a course by means of instruction certificate!

Location

Product

Price

Participants

2QVLWH

6XFWLRQSURGXFWV1) WDEOHWRSXQLWV1) FKDLUV1) XQLWV1)

$FFRUGLQJWR DJUHHPHQW

PD[

Target group: 8VHUVRI$7026SURGXFWV Prerequisites: &RPSDQ\SDUWLFLSDWLQJLVDQ$7026FXVWRPHU (Appoints according to agreement).

Technical product training for ATMOS Products ,QLWLDOWUDLQLQJLQXQLWDSSOLFDWLRQEDVLFWHFKQLFDONQRZOHGJHRQWKHXQLWPDLQWH QDQFHLQVSHFWLRQDQGFDUHK\JLHQHPHDVXUHVWLSVIRUWURXEOHIUHHRSHUDWLRQ UHSDLUZRUNSUDFWLFDOH[HUFLVH Confirmation of participation in the course by means of certificate!

Location /HQ]NLUFK 2QVLWH

Duration

Price

Participants

GD\

1)

±

GD\

1)

PD[

Target group: 0HGLFDOWHFKQLFLDQVZRUNLQJLQKRVSLWDOVDQGFOLQLFV Prerequisites: &RPSDQ\SDUWLFLSDWLQJLVDQ$7026FXVWRPHU3DUWLFLSDQWLVDPHGLFDOWHFKQLFLDQ (Appointment according to agreement).

1)

56

)RUSULFHVDQGVSHFLDORIIHUVSOHDVHFRQWDFW\RXUORFDOGHDOHU


zReprocessing

zConsulting

Our regular training courses dealing with the preparation of suction units provide our partners with the necessary know-how required to prepare ATMOS medical products both functionally and hygienically.

Reprocessing training courses for ATMOS small suction units Reprocessing in accordance with BVMed- und ATMOS guidelines, legal basis (MPG (Medical Product Law), RKI (Robert Koch Institute) technical principles, simple repair work as well as practical exercise. Confirmation of participation in the training course by means of certificate!

Location /HQ]NLUFK 2QVLWH

Duration

Price

Participants

GD\

1)

Âą

GD\

1)

PD[

Target group: 6HUYLFHWHFKQLFLDQVZLWKHOHFWURWHFKQLFDOWUDLQLQJDQGPHGLFDOWHFKQLFLDQV Prerequisites: &RPSDQ\SDUWLFLSDWLQJLVDQ$7026FXVWRPHU 3DUWLFLSDQWFDQSURYHWKDWKHVKHSRVVHVVHVHOHFWRUWHFKQLFDOVNLOOV &HUWLILFDWLRQLQDFFRUGDQFHZLWK,62

The new conference room in the ATMOS Academy

Advice and services all around your ATMOS products Â&#x2019; Â&#x2019; Â&#x2019; Â&#x2019;

1)

&HUWLILFDWHRIYDOXDWLRQ9DOXHUHWHQWLRQUHSRUW &HUWLILFDWHLQWKHVFRSHRILQGHSHQGHQWSUHVHUYDWLRQRIHYLGHQFH 3URMHFWDFFRPSDQ\LQJDQGDGYLVRU\DFWLYLWLHV $GYLFHZLWKUHJDUGWRFOHDQLQJFDUHDQGZDWHUK\JLHQH

)RUSULFHVDQGVSHFLDORIIHUVSOHDVHFRQWDFW\RXUORFDOGHDOHU 57


MedizinTechnik

Maintenance and inspection We recommend preventive maintenance â&#x20AC;&#x201C; because malfunction means downtime! 2XUWUHDWPHQWXQLWVDUHGHVLJQHGIRUUHOLDEOHDQGGXUDEOHXVHLQ\RXU HYHU\GD\ZRUN:HGHPDQGKLJKVWDQGDUGVRIK\JLHQHDQGVDIHW\RI RXUGHYLFHVFRPELQHGZLWKWKHFRPSOLDQFHRIVWDWXWRU\SURYLVLRQV 7KHUHIRUHWKRXVDQGVRIGRFWRUVUHO\RQWKHGXUDELOLW\RIRXUSURGXFWV HYHU\VLQJOHGD\ :HZRXOGDOVROLNHWREHDYDLODEOHIRU\RXDWDQ\WLPHDIWHUVDOHVLQ RUGHUWRVHFXUHWKHYDOXHRI\RXULQYHVWPHQW ,QVSHFWLRQ DQG PDLQWHQDQFH DUH SUHYHQWLYH PHDVXUHV HJ H[FKDQJHRIZHDUDQGWHDUSDUWVLQWLPH LQRUGHUWRDYRLGH[SHQVLYH GRZQWLPHV ,QVSHFWLRQDQGPDLQWHQDQFHSURYLGHWKHEDVLVIRUHOHFWULFDOVDIHW\ DQGIRUDK\JLHQLFDOO\SHUIHFWSURGXFW,WLVDPDWWHURIVDIHW\IRU\RXU SDWLHQWV 2XUPDLQWHQDQFHFRQWUDFWVPHHWOHJDOUHTXLUHPHQWVZLWKUHJDUGWR VDIHW\UHODWHGLQVSHFWLRQVHQVXUHDSHUIHFWZRUNIORZDQGSURYLGH DKLJKVWDQGDUGLQK\JLHQHDQGWHFKQLFDOVDIHW\:LWKRXUSUHPLXP FRQWUDFWZHJXDUDQWHHDPD[LPXPUHVSRQVHWLPHRIK Legal requirements to be fulfilled by the treating doctor Safety-related inspections Ã&#x201E;7KHRSHUDWRURIPHGLFDOSURGXFWVKDVWRDELGHE\WKHVDIHW\UHODWHG FRQWUROVSUHVFULEHGE\WKHPDQXIDFWXUHUDQGLQ DFFRUGDQFHWRWKHLUVSHFLILFDWLRQVDQGJHQHUDOUHJXODWLRQV 7KHVHQHFHVVDU\PDLQWHQDQFHPHDVXUHVKDYHWREHSHUIRUPHG ZLWKLQWKHGHDGOLQHVWDWHGDQGKDYHWKHPLPSOHPHQWHG³ *HUPDQUHJXODWLRQ

6HUYLFH

'HVFULSWLRQ

$QQXDOVHUYLFH LVSHUIRUPHG RQVLWHIUHHRI FKDUJH

$ERXWIRXUZHHNVLQDGYDQFH$7026 DUUDQJHVDQDSSRLQWPHQWZLWK\RX 7KHKRXUVRIZRUNDQGWKHWUDYHOFRVWV DUHLQFOXGHG

)XQFWLRQDO FKHFN

$OOWKHIXQFWLRQVRIWKHFRPSOHWHV\VWHP DQGWKHEXLOWLQPRGXOHVDUHFKHFNHG $QLQVSHFWLRQRIDOOWKHPHFKDQLFDOSDUWV LVSHUIRUPHG$OOWKHFDEOHVDQGSOXJLQ FRQQHFWRUVDUHFKHFNHG

6DIHW\UHOHYDQW FKHFN

6DIHW\UHOHYDQWFKHFNV LQFOXGLQJ HOHFWULFDOLQVSHFWLRQ DFFRUGLQJWRÂ&#x2020; 0HGLFDO'HYLFHV2SHUDWRU2UGLQDQFH DFFRUGLQJWR',1(1

9

9*

9*

)LWWLQJRI 'XULQJWKHDQQXDOPDLQWHQDQFHFKHFNZH RSWLRQVIUHHRI ZLOOUHWUR¿WRSWLRQV IUHHRIFKDUJH ZKLFK FKDUJH PD\EHRUGHUHGIURPRXUFDWDORJXH

9*

GLVFRXQW

)RUDOOVSDUHSDUWVDQGMRXUQH\

9

3URORQJDWLRQ RIWKH JXDUDQWHHIRU DQRWKHU\HDU

\HDULQVWHDGRID\HDUJXDUDQWHHIRU DPDLQWHQDQFHFRQWUDFWZKLFKLVPDGH ZKHQDQHZ$70266LVERXJKW

9

$GYLFHSHU KHOSZLWKWHFKQLFDOSUREOHPVLQDYDLODEOH WHOHSKRQHDQG IUHHRIFKDUJH SHUWHOHSKRQHRUYLD HPDLO HPDLO GXULQJEXVLQHVVKRXUV 

58

$7026 6WDQGDUG

Your advantages: Â&#x201E;5HGXFHVGRZQWLPHV Â&#x201E;&RQVHUYDWLRQRIYDOXHVRI\RXULQYHQWRU\ Â&#x201E;'LVFRXQWVRQUHSDLUVDQGQRFDOORXWIHH Â&#x201E;4XLFNWURXEOHVKRRWLQJ Â&#x201E;3URORQJDWLRQRIZDUUDQW\ Â&#x201E;3UHVFULEHGVDIHW\FKHFNDFFRUGLQJWR

Â&#x2020;0HGLFDO'HYLFHV2SHUDWRU2UGLDQFH


Reprocessing of small ATMOS suction devices

The reprocessing of ATMOS suction devices is our speciality!

6FRSH 'HYHORSPHQWPDQXIDFWXUH VDOHVDQGVHUYLFHRI PHGLFDOGHYLFHVIRUWUHDWPHQW GLDJQRVWLFVDQGWKHUDS\ LQFOLQLFSUDFWLFHDQG KRPHFDUHDVZHOODV reprocessing of suction devices

:HDUHFHUWLILHGIRUWKHUHSURFHVVLQJRIVXFWLRQGHYLFHV DFFRUGLQJWR(1,62DQG(1,626HQG \RXU$7026VXFWLRQGHYLFHWRRXUVHUYLFHGHSDUWPHQW ZLWKWKHUHPDUN³UHSURFHVVLQJ´<RXUGHYLFHZLOOEH SURFHVVHGHIILFLHQWO\DQGFRPSHWHQWO\ZLWKWKH DSSURSULDWHK\JLHQHSURFHGXUH

ATMOS MedizinTechnik GmbH & Co. KG Ludwig-Kegel-Str. 12, 14-16, 18 79853 Lenzkirch/Germany Phone: +49 7653 689-222 Fax: +49 7653 689-292 Service@atmosmed.de

Our Service team: Eckhardt Stender, Olaf Marx, Michael Weis, Egon Blessing, Christian König, Klaus Bendkowski, Kian Schwuchow (back) Jean-Luc Imhoff, Manuela Schmidt, Claudia Tritschler, Kerstin Wehrle, Winfried Link (front)

59


ATMOS Partners worldwide Around the globe. Around the clock. Anytime.

60

ATMOS Partners worldwide

MedizinTechnik


MedizinTechnik

ATMOS Sales & Service team Managing Director Sales

Sales Manager Germany

Headquarters:

Ludwig-Kegel-Str. 12, 14-16, 18 79853 Lenzkirch

Ludwig-Kegel-Str. 12, 14-16, 18 79853 Lenzkirch

Ludwig-Kegel-Str. 12, 14-16, 18

Maik Greiser Phone

+49 7653 689 215

E-Mail

MGreiser@atmosmed.de

Area Sales Manager Ralf Kühnemund France, Benelux, Italy, USA, Canada, Marocco, Tunisia, Algeria, South africa Phone +49 7653 689-311 E-Mail RKuehnemund@atmosmed.de

Area Sales Manager Axel Kanefeyer NE-Europ, Switzerland, Austria, Middel East, China, Egypt Phone +49 7653 689-330 E-Mail

Ludwig-Kegel-Str. 12, 14-16, 18 79853 Lenzkirch Bernd Schley Sales Phone E-Mail

DGebele@atmosmed.de

Regional Sales Manager Matthias Straub Asia & Ozeanien Phone E-Mail

Region North

Max-Nonne-Str. 45

Jan Carmienke Service North E-Mail J.Carmienke@agh-diagnostics.de

22419 Hamburg/Germany Tel: +49 40 5332 685-0 Rainer Holzem Teamleader Sales North (SI) Phone Mobile E-Mail

Daniel Gebele Great Britain, Spain, Portugal, Latin america

E-Mail

+49 7653 689-355 BSchley@atmosmed.de

Region North

Area Sales Manager +49 7653 689-340

+ 49 4231 936155 + 49 171 7640648 RHolzem@atmosmed.de

Jochen Kaufels Sales representative North (AS) Nordstr. 28a 06862 Dessau-Roßlau Phone +49 34901 947 58 Fax –59 Mobile + 49 160 96367338 E-Mail JKaufels@atmosmed.de

Ulrich Kraut Service Northwest E-Mail UKraut@atmosmed.de

Matthias Wolf Service Northeast E-Mail MWolf@atmosmed.de

Region South Ludwig-Kegel-Str. 12, 14-16, 18 79853 Lenzkirch Roland Vöstel Teamleader Sales South (SI) Phone +49 7653 689-310 E-Mail RVoestel@atmosmed.de

+60 (3) 6274 7400 MStraub@atmosasia.com

Area Sales Manager Andreas Käfer Sales representative Southwest (SI) Schwaigernerstr. 2 75050 Gemmingen Phone +49 7267 914610 Fax –629 Mobile +49 175 2905410 E-Mail AKaefer@atmosmed.de

Philipp Rellermeier Indien, Asien, Oceania, Central Africa Phone +49 7653 689-325 E-Mail PRellermeier@atmosmed.de

Sales Support Manager

Region South Horst Delling Service Southeast E-Mail HDelling@atmosmed.de

Wolfgang Heiß Sales representative Southeast (SI) Zeisigweg 13 86420 Diedorf-Anhausen Phone +49 8238 958342 Fax –624 Mobile +49 171 3049490 E-Mail WHeiss@atmosmed.de

Julia Schumacher Phone E-Mail

ATMOS MedizinTechnik GmbH & Co. KG Tel. +49 7653 689-222 E-Mail service@atmosmed.de

Business Unit Manager Sales (AS)

AKanefeyer@atmosmed.de

Phone

79853 Lenzkirch

Michael Schindler Sales Manager Germany Phone +49 7653 689 350 Mobile +49 151 11714220 E-Mail MSchindler@atmosmed.de

+49 7653 689-327 JSchumacher@atmosmed.de

Region Middle Luisenstraße 21 53721 Siegburg Georg Grünefeld Teamleader Sales West (SI) Phone +49 2241 1279146 Mobile +49 171 3616181 E-Mail GGruenefeld@atmosmed.de

Region Middle Robert Bach Service West E-Mail

RBach@atmosmed.de

Sven Schlimgen Sales representative West (AS) Phone +49 2241 1461253 Mobile +49 170 7632967 E-Mail SSchlimgen@atmosmed.de

SI = System Integration AS = Application Solutions

61


MedizinTechnik

Your contact person at the parent company in Lenzkirch Business Unit Manager OEM

Business Unit Manager Application Solutions

Business Unit Manager System Integration

Ulrich Jehle Tel. +49 7653 689- 600 UJehle@atmosmed.de

Urich Jehle Phone +49 7653 689-600 UJehle@atmosmed.de

Jรถrg Pahlke Phone +49 7653 689-642 JPahlke@atmosmed.de

Product Manager OEM

Product Manager Suction devices and Drainage systems Simon Wegner Phone +49 7653 689-644 SWegner@atmosmed.de

Product Manager ENT

Product Manager Suction devices and Drainage systems Julian Fitz Phone +49 7653 689-643 JFitz@atmosmed.de

Junior Product Manager ENT

Dominik Birkenmaier Tel. +49 7653 689- 651 DBirkenmaier@atmosmed.de

Jenny M. Doan Phone +49 7653 689-647 JDoan@atmosmed.de

Florian Betz Phone +49 7653 689-641 FBetz@atmosmed.de Product Manager Gynaecology Daniel Notheis Phone +49 7653 689-646 DNotheis@atmosmed.de

The Managing Directors a strong family team Therewith the generation change has been initiated. From left to right:

Maik Greiser Peter Greiser Gerlinde Greiser Frank Greiser

62


MedizinTechnik

Europe

Endovision B.V.B.A.

Dräger Medical Belgium N.V.

Tommy De Saeger

Marc Notez

Arseus Health

Eric Salden

Belgium / Luxembourg

Phone +32 24626211 Fax +32 26095240 E-Mail tommy.desaeger@draeger.com www.draeger.com Belgium / Luxembourg

Phone +32 475 510559 Fax +32 3 8252370 E-Mail Eric.salden@arseus-medical.be www.arseus-medical.be Belgium / Luxembourg

Medical Technic Eng. Ltd.

Seelen Care ApS

Otoplug OY

Phone +32 1640 7010 Fax +32 1640 7066 E-Mail info@endovision.be

Lise von Seelen Weis

Dimitar Konov

Kerkko Penttilä

Bulgaria

Phone +45 70 9742229 Fax +45 70 97401396 E-Mail seelen@seelen-care.dk www.seelen-care.dk Denmark

Phone +358 33 647215 Fax +358 33 647815 E-Mail NHUNNRSHQWWLOD#RWRSOXJ¿ ZZZRWRSOXJ¿ Finland

ATMOS MEDICAL FRANCE

Papapostolou Ltd.

ATMOS Medical Ltd.

Phone +31 359 2 9712845 Fax +31 359 2 8734943 E-Mail konov@mte-bg.com

Julie Siafarika

Nicolas Perusin Phone +33 491 443294 Fax +33 491 443968 E-Mail atmosfrance@atmosfrance.fr www.atmosmed.fr France MedizinTechnik

Phone +30 210 6790000 Fax +30 210 6790100 E-Mail jsiafarika@papapostolou.gr www.papapostolou.gr Greece

David Butchart Phone +44 1489 611 739 Fax +44 1489 611 612 E-Mail david.butchart@atmosmedical.com www.atmosmedical.com Great Britain MedizinTechnik

63


MedizinTechnik

Europe

ATMOS Medical Ltd.

ICEPHARMA

Arnar Adalsteinsson

David Butchart MedizinTechnik

ATMOS ITALIA S.R.L

Matteo Bertoletti

Phone +44 1489 611 739 Fax +44 1489 611 612 E-Mail david.butchart@atmosmedical.com www.atmosmedical.com Ireland

Phone +354 5 204310 Fax +354 5 408001 E-Mail arnar@icepharma.is www.icepharma.is Iceland

Phone +39 02 48402262 Fax +39 02 48402506 E-Mail m.bertoletti@atmosmed.it www.atmosmed.it Italy

INEL Medicinska Tehnika

UAB Biomedika

Pharma-Cos. Limited

Vilko Klindic

Kestutis Liegus

Phone +385 165 20546 Fax +385 165 20966 E-Mail vilko.klindic@inel-mt.hr www.inel-mt.hr Croatia

Phone +370 8 5 2709055 Fax +370 8 5 2709056 E-Mail kestutis@biomedika.lt www.biomedika.lt Lithuania

Vinora d.o.o. Skopje

Entercare BV

MedizinTechnik

Marcel K. Mifsud Phone +356 21 441977 Fax +356 21 441388 E-Mail info@pharma-cos.com www.pharma-cos.com Malta

Tefa-Portanje B.V.

Mirjam Schouten Alexandar Nikolovski Phone +389 2 3177914 Fax +389 2 3177914 E-Mail vinoramk@unet.com.mk www.vinora.com.mk Macedonia

Phone +31 348 420142 Fax +31 348 420142 E-Mail lchoogstraten@entercare.nl www.entercare.nl Netherlands

OrtoMedic AS

Neuroth AG

Morten Hansen Phone +47 67 518600 Fax +47 67 518599 E-Mail mh@ortomedic.no www.ortomedic.no Norway 64

Luc C. Hoogstraten

Karl Osobsky Phone +43 1 5455 013100 Fax +43 1 5455 013500 E-Mail karl.osobsky@neuroth.at www.neuroth.at Austria

Phone +31 348 495 882 Fax +31 348 495 799 E-Mail m.schouten@tefa-portanje.opg.nl http://www.tefa-portanje.nl Netherlands

Medicus App. i Instrumenty Medyczne

Janusz Surma Phone +48 71 3472100 Fax +48 71 3472111 E-Mail jsurma@medicus.wroc.pl www.medicus.wroc.pl Poland


MedizinTechnik

Europe

Medist S.R.L.

ATMOS Medica S.L.

Daniel Romo

Bogdan Niculescu MedizinTechnik

OOO ATMOS Medikal

Andrey Sorokin

Phone +34 902193580 Fax +34 937414672 E-Mail dromo@atmosmed.es www.atmosmed.es Portugal

Phone +40 21 4115003 Fax +40 21 4105446 E-Mail bogdan.niculescu@medist.ro www.medist.ro Romania

Phone +7 495 2580894 Fax +7 495 2580894 E-Mail atmosmed@telsycom.ru www.atmosmed.ru Russia

ATMOS Medical AG

ULTRAMED s.r.o.

Dräger Slovenija d.o.o.

Juraj Varga

Jacky Noll Phone +41 616914151 Fax +41 61 6910992 E-Mail info@atmosmed.ch www.atmosmed.ch Switzerland

MedizinTechnik

ATMOS Medica S.L.

MedizinTechnik

Robert Pristavec

Phone +421 456761318 Fax +421 456761317 E-Mail juraj.varga@ultramed.sk www.ultramed.sk Slovakia

Phone +386 4 561 2263 Fax +386 1 561 2264 E-Mail robert.pristavec@draeger.com www.draeger.com/slovenija Slovenia

HIST Medical s.r.o.

ATMOS Medikal Ltd.

Jaromir Hink

Daniel Romo

Timur Arslan

Phone +34 902193580 Fax +34 937414672 E-Mail dromo@atmosmed.es www.atmosmed.es Spain

Phone +420 737329835

Czech Republic

Phone +90 2165756414 Fax +90 216575635 E-Mail TArslan@atmosmed.de www.atmosmed.de Turkey

ATMOS HÖR-KA KFT.

TAHAT

Costas Papaellinas Org.

MedizinTechnik

E-Mail hist.medical@seznam.cz

Siarhei Shmyk

István Nyitó Phone +36 1 335 6028 Fax +36 1 335 6028 E-Mail inyito@atmosmed.hu www.atmosmed.hu Hungary

MedizinTechnik

Phone +375 17 296 54 99 Fax +375 17 296 39 99 E-Mail tahat@mail.bn.by Belarus

MedizinTechnik

Nicos Mylonas Phone +357 22 863100 Fax +357 22 675136 E-Mail nicos.mylonas@papaellinas.com www.papaellinas.com Cyprus 65


MedizinTechnik MedizinT

North- / South America

ATMOS Inc.

DEWIMED S.A.

Gernd von Dewitz

Ingo Riedl MedizinTechnik

Pablo Guzovsky

Tel. +1 610 351-7221 Fax +1 610 351-6827 E-Mail IRiedl@atmosmed.com www.atmosmed.com USA / Canada

Phone +52 55 56060777 Fax +52 55 56060520 E-Mail gvdewitz@dewimed.com.mx www.dewimed.com.mx Mexico

Phone +55 11 32894600 Fax +55 11 32844484 E-Mail pablo@panmedica.com.br www.panmedica.com.br Brazil

Ferrari Medical Ltd.

Representaciones Médicas „Mary“ S.R.Ltda.

Panadex S.A.

Ronaldo Luiz Ferrari

Mary Tafur

Phone +55 11 3205-6200 Fax +55 11 3205-6211 E-Mail ronaldo@ferrarimedical.com.br www.ferrarimedical.com.br Brazil

Phone +51 1 6140600 Fax +51 1 6140603 E-Mail int.supplier@medicasmary.com www.medicasmary.com Peru

Auditron Argentina S.A.

Auditron Chile

Hugo Wainerman Phone +54 11 43739800 Fax +54 11 43736560 E-Mail info@auditron.com.ar www.auditron.com.ar Argentina

66

Panmédica

Daniel Nocetti Phone +56 22366838 Fax +56 22366877 E-Mail danielnocetti@auditron.cl www.auditron.cl Chile

Ariel Panduro P. Phone +51 223 0412 Fax +51 223 0414 E-Mail ariel@panadex.com www.panadex.com Peru


MedizinTechnik

Africa, Middle East

Egyptian Group Co. S.A.E.

MEDICALEX

S.E.H.L.

Mohammed Ben Sadik

Yazzine Azzouz

Ayman Younis Phone +002 0222687712-13 Fax +002 0222687714 E-Mail ayounis@eggroup-eg.com www.eggroup.com.eg Egypt

Phone +213 21690551 Fax +213 21690551 E-Mail azzouz_medicalex@yahoo.fr

Phone +212 522 200356 Fax +212 522 263988 E-Mail mbensadik@gmail.com

Algir

Morocco

TDW Medical (Pty.) Ltd.

General Business Trading

General Medicals W.L.L

Tahar Somai

Terry Wiegand

K. Sridhar

Phone +27 11 7643438 Fax +27 11 7643438 E-Mail terryw@tdwmed.co.za www.tdwmed.co.za South Africa

Phone +216 71704200 Fax +216 20437417 E-Mail tahar.somai@gbtrade.com Tunisia

Phone +973 17 727600-213 Fax +973 17 728274 E-Mail sridhar.medics@intercol.com www.intercol.com Bahrain

X-Ray Iran Co. Ltd.

DANEL Medical Equipment

Hekmamed

Ori Danel

Mehdi Mohseni

Dr. Naser Tiari

Phone +98 21 66957185 Fax +98 21 66417190 E-Mail info@xrayiran.com

Phone +972 3 6326353 Fax +972 3 7600684 E-Mail ori@danelmedical.com

Phone +218 21 3608493 Fax +218 21 3611339 E-Mail hekmamed@hotmail.com

Iran

Israel

Libya

67


MedizinTechnik

Middle East

SAM MEDICAL CORPORATION.

Technomedics Co. LTD

Nizar S. Al-Kubati

Sami Aggad

Sherif Shehata

Phone +967 4 218111 Fax +967 4 218113 E-Mail info@sammedical-ye.com www.sammedical.com.ye Yemen

Phone +962 6 5532395 Fax +962 6 5533294 E-Mail techno@nets.com.jo Jordan

Phone +974 403 9550 Fax +974 403 9551 E-Mail sherif.shehata@aamalmed.com www.ebnsina.com.qa Qatar

Central Circle Co.

Ibn-Sina Pharmacy LLC

Intermed PAL.

Hani Hamad

Ramesh Prakash

Omer Fittiani Phone +965 2 411748 Fax +965 2 411758 E-Mail cencico@qualitynet.net

Phone +968 24822108 Fax +968 24813472 E-Mail ibnsina@omantel.net.om

Phone +972 2 2409616 Fax +972 2 2409790 E-Mail info@intermed-pal.com

Kuwait

Oman

Palestine

Wisam Medical Equipment

Alphamed Co.

Al-Jeel Medical & Trading Co. Ltd.

Abdul Kader Al-Kodsi

Alaa Hamdan Phone +966 1 2168222-236 Fax +966 1 2168566 E-Mail ayasin@aljeel.com www.aljeel.com.sa Saudi Arabia

68

AAMAL MEDICAL CO.

Phone +963 11 2311159 Fax +963 11 2311634 E-Mail wisam-me@scs-net.org Syria

Haitham Mafouz Phone +971 267 30114 Fax +971 267 31224 E-Mail Haitham.T@akigroup.com www.alphamedgroup.com UAE


MedizinTechnik MedizinT echnik

Asia

ATMOS Shanghai Representative Office

Medicorp. Sdn Bhd

Rohit Surgical PVT. LTD.

Rohit Grover

Lily Yan

Priscilla Hue

Phone +91 11 25753575 Fax +91 11 25754575 E-Mail rohitsur@ndf.vsnl.net.in

Brunei

Phone +86 21 64260679 Fax +86 21 64260679 E-Mail SYingYan@atmosmed.de www.atmosmed.com.cn China

MNE TECHNOLOGIES

PT. Surgika Alkesindo

Wako Shoji Co. Ltd.

Phone +673 265 2339 Fax +673 265 2329 E-Mail phue@medicorp.biz

MedizinTechnik

Handy Gunawan

N. Chelvadorai

MedizinTechnik

India

Fumio Osada

Phone +91 80 40545050 Fax +91 80 25590943 E-Mail sales@mneindia.com www.mneindia.com India

Phone +62 21 4253634 Fax +62 21 4253635 E-Mail surgika@cbn.net.id www.surgika.com Indonesia

Phone +81 466 842485 Fax +81 466 842484 E-Mail f.osada@wako-shoji.com www.wako-shoji.com Japan

ATMOS Asia SDN BHD

Europ Continents My.

United BMEC

Christophe Debroise

Matthias Straub Phone +006 03 20727107 Fax +006 03 20728109 E-Mail mstraub@atmosasia.com www.atmosmed.de Malaysia

MedizinTechnik

Phone +95 15 243301 Fax +95 15 05209 E-Mail europcomya@mptmail.net.mm www.europcontinents.com Myanmar/Cambodia/Vietnam/Laos

Vincent Tan Phone +65 63052500 Fax +65 63052549 E-Mail TanVincent@uwhpl.com www.unitedbmec.com Singapore

69


MedizinTechnik MedizinT echnik

Asia

Total Technologies (Pvt) Ltd.

Value-Rx, Inc.

Shoukat Ali Phone +92 42 757-7897 Fax +92 42 753-6586 E-Mail medl@wol.net.pk www.totalgroup.com.pk Pakistan

Endomed (1999) Co. Ltd.

Padon Thuvanalin Phone +66 2731 567-4 Fax +66 2376 0982 E-Mail padon@endomedgroup.com www.endomed.co.th Thailand

70

Mervynsons (PVT) LTD.

Ranil M. Weliwitigoda

Daniel Geiger Phone +63 2 396-5220 Fax +63 2 634-2085 E-Mail danielgeiger@gmail.com

Phone +94 11 2686789 Fax +94 11 2699618 E-Mail mervynsons@asianet.lk

Philippines

Sri Lanka


MedizinTechnik

Australia

Lateral Medical

David Fenech Phone +61 7 31391207 Fax +61 7 30366187 E-Mail david@lateralmedical.com www.lateralmedical.com Australia

71


Medical technology for a better life! ATMOS MedizinTechnik GmbH & Co. has evolved into an exemplary company in the medical technology sector and thus obtained great acceptance. ATMOS stands for: 1. Ongoing growth of ATMOS. We grow at a higher rate than the medical technology market. ATMOS has attained a significant market position in its business units and defined regional markets. We are among the market leaders. 2. ATMOS offers innovative and complete solutions (products and services) which inspire our customers. 3. The success of our company gives us flexibility and the freedom of decision. 4. We are resting solidly on at least 3 „main pillars“ (business units). „ ENT and Gynaecology workstations „ digital suction and drainage systems „ OEM business 5. ATMOS has modern, ideal “business processes”. We have a process oriented organisation. 6. ATMOS has an exemplary „company culture“, the employees enjoy working for ATMOS. Target orientation and transparency of the strategic alignment are important for us. The company and our employees should benefit from our success, this has become reality. 7. The ATMOS trademark is and will remain a strong „brand“ in the field of medical technology, standing for quality and innovation. 8. Competence. Customers, business partners, opinion leaders, salesmen, subsidiaries and agencies enjoy the level of co-operation with ATMOS. They are perfectly trained. 9. ATMOS employees are highly motivated, team-orientated, modern and international thinking, they will go through ‘fire and water’ for their ATMOS. In our region we an esteemed company with good employee opportunities, this also applies to our subsidiaries 10. We are an esteemed enterprise with good employee opportunities, this also applies to all subsidiaries ,QWKH¿HOGRIPHGLFDOWHFKQRORJ\$7026LVDJOREDOSOD\HUZLWK Centres of excellence in Germany and Asia as well as 11 sales companies around the world.

72


)DFWVDQG¿JXUHV about ATMOS

The group of companies ATMOS Greiser Holding GmbH Germany

ATMOS MedizinTechnik GmbH & Co. KG Lenzkirch / Germany

MedizinTechnik ATMOS Asia

Asia

Germany

ATMOS Asia SDN BHD KL / Malaysia

agh DIAGNOSTICS Hamburg

FRANCE ITALY SPAIN SUISSE GREAT BRITAIN

The 3 Centres of excellence

RUSSIA HUNGARY

KC NORD

USA

KC MITTE

TURKEY

KC SÜD

CHINA INDIA (RO) JAPAN (RO)

The group of companies ATMOS MedizinTechnik is a family-run medium-sized enterprise (Greiser family) with its headquarters in the Black Forest. The company manufactures and develops its products in Germany and in Malaysia. The other companies are sales, marketing and service organisations

Investment in R&D ATMOS invests around 10% of the turnover in R&D.

73


MedizinTechnik

ATMOS Academy – Training worldwide

ATMOS Academy – a guarantee for advanced training worldwide!

„All knowledge and the increasing of knowledge does not end in a full stop, but in a question mark“. Hermann Hesse – German poet and Nobel Prize laureate. This quotation makes it clear that knowledge is an essential instrument of our times. The ATMOS Academy was founded 2005 to give our partners worldwide the chance to keep themselves up to date with state of the art technology. Innovations make training necessary, in order to provide the greatest of safety in the treating of patients. The objective of the academy is to train both medical practitioners and medical personnel and also service technicians. Firstly certified training events are offered in Germany. „The continuing medical education credits“ are applied for at the relevant regional medical chamber and are credited to the additional training account of the participants. Secondly medical personnel receive instruction in new or familiar methods of treatment. The offer is rounded off with service training courses around the world. Various themes concerning the technology of ATMOS products are covered in these courses. Renowned medical practitioners and specialists together with experts from ATMOS conduct these events throughout the world. In this way we demonstrate that crediting our partners with the greatest possible competence means a lot to us. Since Summer 2007 the ATMOS Academy has been enhanced by a spacious training centre. There is an exhibition room devoted to each business segment, based on replicas of the equipment and furnishings of a medical practice. The new building also has a modern and spacious conference room. The centre is joined to the corporate building by means of a passage way For example the following training issues are communicated: ” ” ” ” ” ” ” ”

74

Laryngeal diagnostics Stroboscopy Radiosurgery and its application Secretion extraction fro respiratory tracts Opportunities for gynaecology workstations. Product training courses Preparation of suction units Maintenance and care of ATMOS products

„A delayed certainty of something is always preceded by an early idea“ – this quote is from Alexander von Humboldt, a scholar and universal genius in his time. In compliance with this quote ATMOS has dedicated itself to the training of doctors and partners worldwide. With the use of new diagnostic and therapy methods a lot of stumbling blocks are lurking in the daily practice. Therefore, together we have to smooth these out by further training courses


ATMOS General Standard Terms and Conditions MedizinTechnik

1. General:

case. Should the delivery delay be caused by a culpable infringement

is limited to damage which is regarded as typical for tthat case. This

Our General Standard Terms and Conditions apply exclusively. Clientâ&#x20AC;&#x2122;s

of non-substantial contractual duties, our client is also entitled to claim

also applies in the case of our culpable infringement of substantial

terms and conditions which are contrary to or deviate from our General

a one-off damage compen-sation worth 3 percentage points of the

contractual duties The indispensable conditions of German Liability

Standard Terms and Conditions are not recognised unless their validity

delivery value of the goods for each weekâ&#x20AC;&#x2122;s delay, up to a maximum

Law remain unaffected thereby.

is explicitly confirmed in writing. Our General Standard Terms and

which is no higher than 15 percentage points of the delivery value of

Conditions also apply even if we deliver to clients without reservation,

the goods

- For second-hand equipment, the period of warranty shall be reduced to a period of twelve months.

in the knowledge of the clientâ&#x20AC;&#x2122;s contrary terms and conditions. Our General Standard Terms and Conditions also apply to all future business with that client.

7. Delivery - Familiarisation In the case of the delivery of devices for the medico-technical industry which require assembly and/or familiarisation for the final customer using

10. Reservation of Ownership  We retain ownership of our goods until the receipt of all payments arising from the business relationship, including all demands arising

2. Proposal - Order Confirmation

VSHFLDOLVWWUDGHSHUVRQQHO VXFKDV(DU1RVHDQG7KURDW$SSDUDWXVDQG

from installation orders, subsequent orders, repairs, accessory deliveries

 Our proposals are subject to change without notice unless otherwise

Suction Units), we reserve the right to deliver the goods exclusively to

and replacement orders. Should we have agreed upon payment on the

stated in our order confirmation. Each order is only accepted by us

the relevant specialist traders. Should the trader not carry out assembly

basis of cheque and bill transactions, the ownership reservation applies

following our written order confirmation.

and/or familiarisation for the final customer, this is carried out by us. In

until the cheque received byus has been paid in, and does not expire

such cases, we reserve the right to charge the client for the additionally

through our credit upon receiving the clientâ&#x20AC;&#x2122;s cheque. In the case of

3. Orders

created costs. Our specialist traders operate a recording system so

a breach of contract by the client, especially payment arrears, we are

 Every order requires an exact description of all of our productâ&#x20AC;&#x2122;s details.

that, if necessary, our products can be traced to the final customer. The

entitled to repossess our goods. Repossession of our goods repre-sents

We assume no liability for errors and damage caused by inaccurate or

specialist trader undertakes to immediately report to us all events and

a withdrawal from the contract, unless explicitly declared in writing by

incomplete ordering details.

risks which must be reported in connection with our products.

us. We have the right to utilise the product after its repossession, whilst

4. Prices

8. Passage of Risk - Packaging

deducting appropriate utilisation costs.The client is responsible for

the income form such use is balanced against the clientâ&#x20AC;&#x2122;s arrears, after Unless otherwise stated in the order confirmation, our prices in the

Unless otherwise stated in our order confirmation, delivery is agreed

order confirmation are ex factory prices and exclude packaging and

ex factory. The risk of the goodsâ&#x20AC;&#x2122; damage or loss is therefore transferred

be necessary, the client must carry these out punctually at his own cost.

value added tax. Packaging is charged separately at cost price in the

to the client as soon as the goods leave the factory or the client is in

Our client is entitled to sell the goods he has bought from us in a proper

handling the goods with care. Should maintenance and inspection work

invoice. Value added tax is charged separately in the invoice according

default of acceptance of the goods. This also applies to cases where we

sale transaction. However, he must immediately assign all outstanding

to the legal rate on the invoice date. We reserve the right to change

confirm prepaid carriage. Transport packaging and all other packaging

claims to the value of the final invoice sum (including value added tax)

prices appropriately should price reductions or increases, especially

according to the packaging regulations is not returnable. Our client is

of our claims to his customers or third parties. The client is entitled to

due to wage settlements, changes in the price of materials or currency

responsible for disposing the packaging at its own cost. Our deliveries are

collect this claim even after such assignment. Our right to collect the

fluctuations, be incurred. Proof of such changes will be provided for the

insured by us at the clientâ&#x20AC;&#x2122;s expense unless explicitly otherwise agreed.

claim ourselves remains unaffected thereby.We undertake to release

client on request.

1RLQVXUDQFHLVDUUDQJHGLQWKHFDVHRIJRRGVZKLFKDUHFROOHFWHGE\

the securities to which we are entitled if requested to do so by the

our clients. In the case of transport damage, claims are only handled if

client should the realisable value of the our securities be more than 10

5. Payment Conditions - Balancing

the client receives confirmation of any damage, reduced weight or loss

percentage points higher than the outstanding claims. We reserve the

 Unless otherwise stated in the order confirmation, our invoices

by the shipping company before accepting the delivery.

right to choose the securities to be released.

9. Warranty

11. Plans and Illustrations

are payable with a 3% discount within 10 days (except for repair and assembly services) or within 21 days from the invoice date net cash; money receipts is decisive for complying with this term. We are entitled

The client is responsible for examining the delivered goods

We retain ownership of and copyrights to all plans, illustrations,

to charge interest after the due date at a rate 2% above the relevant

immediately after receiving them to determine any eventual deficiencies

calculations and other documents which are attached to our proposals.

basic interest rate of the German Federal Bank. Should the client have

or delivery errors, and to report these immediately. Should the client

The client must receive explicit written permission before passing these

payment arrears, we are entitled to charge interest on arrears at a rate

fulfil this examining and reporting responsibility, and should payment

on to third parties. Imitating our legally patented products is forbidden

5% above the relevant basic interest rate of the German Federal Bank.

conditions be fulfilled, we shall be liable to the client within the scope

and will be prosecuted.

Should we be able to prove higher damages due to arrears, we are also

of legal regulations. Our period of warranty shall in all cases be two

entitled to claim these. The client only has the right to balance invoices

years. Our client can make use of the warranty as follows, so long as

against its own claims should such claims be confirmed in a court of

he can provide first buyer proof (in the form of an invoice or delivery

Our central office is the place of performance for all disputes in

law or recognised by us. The client does not have the right of retention

note) and provided that the product still has the original, unchanged

connection with these General Standard Terms and Conditions and

due to disputed counterclaims.

serial number:

6. Delivery Periods Fulfilment of our delivery duties requires the punctual and proper

12. Jurisdiction and Place of Performance

the contracts closed with clients under them. This jurisdiction excludes

a. We choose whether to fulfil our guarantee by providing repair

other jurisdiction relating to persons or subject-matter. Furthermore, our

services free of charge - either on the clientâ&#x20AC;&#x2122;s premises or in our factory

client is not entitled to bring charges against us in another court should

- or replacing the product. We can also provide these guarantee

he file counter-charges, carry out counterbalancing or declare retention.

fulfilment of the clientâ&#x20AC;&#x2122;s duties. The right to defense on the grounds of an

services through an authorised company;

We, however, are entitled to bring charges against our client at their general place of jurisdiction or at another relevant court recognised by

unfulfilled contract is reserved.Should the client default in accepting the

b. Should a product be returned to us, the client agrees to send

goods delivery or breach other cooperation duties, we are entitled either

the product in its original or similar packaging, offering the same

German or foreign law.Unless otherwise stated in the order confirmation,

to withdraw from the contract or claim compensation for any increased

protection as the original packaging, to our address or any address

our central office is the place of performance.

costs incurred up to that time without setting a further deadline. The right

notified by us.

to make further claims is reserved. Furthermore, in such cases, the risk

c. Our guarantee ceases to apply if changes of any kind have been

of coin-cidental destruction or a coincidental deterioration in the quality

made to our product, unless such changes have been made by us

Lenzkirch, September 2008

of the delivered goods is transferred to the client in the case of default

or a company authorised by us, or have been previously agreed

ATMOS MedizinTechnik GmbH & Co. KG

in accepting such goods or payment arrears. Acts of God or stoppages

upon in writing by us. Our guarantee also ceases to apply if third

79853 Lenzkirch/Germany

(due to insufficient supplies of material, industrial disputes etc.) entitle

parties have carried out repairs to our products or replaced parts

us either to demand an appropriate extension of delivery periods or to

thereof. This applies regardless of the fact whether these measures

partly or entirely dissolve the delivery contract. This does not give the

individually or collectively led to a deficiency of the product;

client the right to claim damages. We have fulfilled delivery periods if the

d. We accept no responsibility for damage defects caused by

delivery goods have left our factory or the client has been informed of

- operational wear and tear;

the goodsâ&#x20AC;&#x2122; readiness for delivery within such delivery periods. Delivery

- incorrect installation or incorrect or insufficient maintenance;

periods stipulated by the client are not recognisedby us unless they

- incorrect operation of the product (in contradiction to the handbook

form part of our order confirmation. We adhere to legal terms and

delivered with the product); - improper use or operating faults; -

conditions in cases where, as a result of an undue delay in the delivery

inappropriate or negligent handling and care, especially with respect

for which we are liable, the client is entitled to claim that his interests

to dirt, lime, suction of fluids, inappropriate cleaning and sterilisation;

in a continued fulfilment of the contract have ceased. We also adhere

- using accessories and/or replacementpartswhich are not explicitly

to legal terms and conditions should a delay in delivery be caused by

approved;

deliberate or grossly negligent action by us or our representatives for

- incorrect assembly and/or initial operation by the client or third

which we are responsible. We are also responsible for such actions by

parties; - the clientâ&#x20AC;&#x2122;s negligence in handling the product; - unacceptable

our representatives or agents. Should the delivery delay not be caused

operating conditions, such as humidity, temperatures, the power supply,

by our deliberate infringement of contractual duties for which we are

vibrations.

responsible, our liability is limited to damage which is regarded as typical

- accidents, acts of God, especially lightening, water, fire, public

for that case. We are liable according to the legal terms and conditions if

unrest and insufficient ventilation. We are not liable for damage to

and in so far as the delivery delay for which we are responsible is caused

other objects apart from our product itself, except in thecase of any

by an infringement of a substantial contractual duty. In such cases, our

deliberate or grossly negligent actions by us or our representatives or

liability is also limited to damage which is regardedas typical for that

agents. Should no deliberate breach of contract be claimed, our liability

7KLVFDWDORJXHLVFRS\ULJKWHG'XSOLFDWLRQWUDQVODWLRQVPLFURÂżOPLQJDQGVDYLQJVRQHOHFWURQLFV\VWHPVSDUWLFXODUO\IRUFRPPHUFLDOSXUSRVHV are illegal without prior agreement of the manufacturer. All compiled data are based on manufacturers instructions. All logos, product names and designations used in this catalogue are property of the respective manufacturer. :HGRQRWWDNHRYHUDQ\ZDUUDQW\DQGOLDELOLW\LQWKHFDVHRIPLVVLQJLQVFULSWLRQV6XEMHFWWRPRGLÂżFDWLRQVDQGDPHQGPHQWV.


MedizinTechnik

www.atmosmed.com Your ATMOS Partner

ATMOS MedizinTechnik GmbH & Co. KG Ludwig-Kegel-Str. 12, 14-16, 18 „ 79853 Lenzkirch/Germany Phone +49 7653 689-374 „ Fax +49 7653 68986-374 ApplicationSolutions@atmosmed.de „ www.atmosmed.com REF

2011-12 Index: 01


ATMOS Care catalogue 2012 / 2013 - english