Page 1


)NDOOR

/UTDOOR

              

#UBE ª 3USPENSION !BSOLU !IRLITE !LGORITMO !LPHABETOF,IGHT !MELUNA !3HARPING !3MART #AELUM #ALENDA #ATA #HOCOLATE #HOCOLATE&LOOR

              

%GGBOARD %VERYTHING 'RADIAN 'RAFA )NCIPIT *AVA +ALIFA +ALIFA2ECESSED +AO ,O4 ,UCERI&LUO ,UCERI,%$ -OUETTE .OTA"ENE .OTHING3YSTEM

              

.UBOLI .UR!COUSTIC /LMO 0!$ 0!$ 0!$3YSTEM 0ARABOLA 0ICTO 0IXEL-ESH 2ASTAF 3HARP 3ILENT&IELD 3MART/FlCE 3OL 3OLAR,%$

           

3URF 4AGORA 4RACKS 4WIST 5GLARE 5NA0RO 5NA0RO 5NA0RO 5NA0RO0UTRELLA 6ECTOR :ENO50 :ENO5P&ROSTED

              

!RIA "ASOLO #ALUMET #ARIDDI #ARIDDIPOLE #ElSO #ElSOPOLE #HILONE #ICLOPE #UNEO $EDALO $IAMANTE $IOSCURI %FFETTO %GODOWNLIGHT

              

%GOWALKDRIVEOVER %GOSPOT %PULO &ACI &ACI6ETRO &ALANGE 'RANITO (ILA )NDICTA )PPOLITO ,ABEL,IGHT ,INEA,ED ,OGICO'ARDEN -EGARA -ICROLED

              

-INISPOT -OLLA .IKI .UDA /BICE /BLIQUE 0ANTAREI 0IROSCAFO 0OTO 0ROVOCA 2EEDS 3OLAR4REE 3OSTITUTOPOLE 3OSTITUTOSPOT 3PIKE

    

3UPERSPIKE 4ETRAGONO 4OLOMEO,AMPIONE 4OLOMEO0ARALUME 4OLOMEO88,


)NDOOR

02/*%#4/2

$/7.,)'(4).'

02/&%33)/.!,,)'(4).'

'%.%2!,,)'(4).'

/UTDOOR

3#%./'2!0()#,)'(4).'

02/*%#4/2

$/7.,)'(4).' 7!,+$2)6% /6%2,)'(4).'

'%.%2!,,)'(4).' 0!4(,)'(4).'

0,!#%3!.$342%%4,)'(4).'

4ECHNICAL

?


)NDOORTYPOLOGICALINDEX #%),).'

#%),).'2%#%33%$ 3%-)2%#%33%$

42!#+

 !IRLITE

 ,O42EmECTOR

 5NA0RO

 #UBE

 ,O4

 3OLAR,%$

 !IRLITE

 !LGORITMO

 .OTHING3YSTEM

 5NA0RO0UTRELLA

 !IRLITE

 ,O42EmECTOR

 4AGORA

 #ATA

 !3HARPING

 0!$

 !LGORITMO

 ,UCERI,%$,UCERI&LUO

 5GLARE

 ,O4

 #ATA

 0!$

 !3HARPING

 .OTHING3YSTEM

 5NA0RO

 /LMO

 #ATA

 0ICTO

 !3MART

 0!$

 5NA0RO

 0!$

 'RADIAN

 3OL

 #AELUM

 0!$

 :ENO5P

 0ICTO

 )NCIPIT

 4AGORA

 %VERYTHING

 0ARABOLA

 :ENO5P&ROSTED

 4RACKS

 +AO

 5NA0RO

 *AVA

 2ASTAF

 5NA0RO

 ,O4

 5NA0RO

 +ALIFARECESSED

 3HARP

 6ECTOR


7!,,

&,//2

 3OL

 !LGORITMO

 ª

3530%.3)/.

 3USPENSION

 #ATA

 !BSOLU

  #HOCOLATE3USPENSION .OTHING3YSTEM

 3URF3YSTEM

 !LPHABETOF,IGHT

 !LGORITMO

 !IRLITE

 %GGBOARD

 .UBOLI

 4AGORA

 #HOCOLATEWALL

 #HOCOLATE&LOOR

 !LGORITMO

 'RAFA

 .UR!COUSTIC

 4WIST

 +ALIFAWALL

 +ALIFAmOOR

 !LPHABETOF,IGHT

 )NCIPIT

 /LMO

 5NA0RO0UTRELLA

 +AO

 !MELUNA



+AO

 0!$3YSTEM

 0IXEL-ESH

 !3HARPING

 ,O4

 3ILENT&IELD

 3URFWALL

 !3MART

 ,O42EmECTOR

 3MART/FlCE

 5NA0RO

 #ALENDA

 -OUETTE

 .OTA"ENE3USPENSION

 .OTA"ENE3YSTEM

?


/UTDOORTYPOLOGICALINDEX 3530%.3)/.

,).%!202/&),%

7!,, #%),).'

7!,,2%#%33%$

 $IAMANTE

 $EDALO

 "ASOLO

 %GO3POT

 0ANTAREI

 !RIA

 4OLOMEO,AMPIONE

 ,ABEL,IGHT

 #ALUMET

 %PULO

 0ROVOCAWALL

 #ICLOPE

 4OLOMEO,AMPIONE

 ,INEA,ED

 #ARIDDI

 &ALANGE

 3OSTITUTO3POT

 &ACI

 4OLOMEO0ARALUME

 3PIKE

 #ElSO

 (ILA

 4ETRAGONO

 &ACI6ETRO

 4OLOMEO0ARALUME

 3UPER3PIKE

 #HILONE

 -INISPOT

 #ICLOPE

 -OLLA

 #UNEO

 .IKI

 $IOSCURI

 /BICE

 %FFETTO

 /BLIQUE

 .UDA


#%),).'2%#%33%$

'2/5.$2%#%33%$

&,//2 "/,,!2$

0/,%

 !RIA

 %GODRIVEWALK OVER

 "ASOLO

 'RANITO

 3OSTITUTOSPOT

 #ARIDDIPOLE

 %GODOWNLIGHT

 %GO6ETROWALK OVER

 #ARIDDI

 (ILA

 4ETRAGONO

 #ElSOPOLE

 %GO6ETRODOWNLIGHT

 ,INEA,ED

 #ElSO

 )PPOLITO

 4OLOMEO,AMPIONE

 #HILONEPOLE

 -EGARA

 #HILONE

 ,OGICO'ARDEN

 4OLOMEO0ARALUME

 (ILA

 -ICROLED

 #ICLOPE

 -INISPOT

 4OLOMEO88,

 )NDICTA

 #UNEO

 .UDA

 0OTO

 %GO3POT

 /BLIQUE

 0ROVOCA

 %PULO

 0IROSCAFO

 3OLAR4REE

 &ALANGE

 2EEDS

 3OSTITUTOPOLE

?


)NDOORLIGHTPERFORMANCEINDEX 02/*%#4/2

$/7.,)'(4).'

02/&%33)/.!,,)'(4).'

 #UBE

 0!$

 %VERYTHING

 ª

 )NCIPIT

 3URF3YSTEM

 !IRLITE

 0ICTO

 ,UCERI,%$,UCERI&LUO

 3USPENSION

 +ALIFAWALL

 5GLARE

 #AELUM

 3OL

 0ARABOLA

 !LGORITMO

 +ALIFAmOOR

 5NA0RO

 #ATA

 6ECTOR

 2ASTAF

 !3HARPING

 .OTA"ENE3YSTEM

 5NA0RO

 *AVA

 5NA0RO

 !3MART

 .OTA"ENE3USPENSION

 5NA0RO0UTRELLA

 ,O4

 :ENO5P

 #HOCOLATE3USPENSION

 .OTHING3YSTEM

 ,O42EmECTOR

 :ENO5P&ROSTED

 #HOCOLATEmOOR

 0!$3YSTEM

 /LMO

 'RADIAN

 3HARP

 0!$

 'RAFA

 3MART/FlCE


!#/534)#,)'(4).'

'%.%2!,,)'(4).'

 %GGBOARD

 !BSOLU

 .UBOLI

 .UR!COUSTIC

 !LPHABETOF,IGHT

 3OLAR,%$

 3ILENT&IELD

 !MELUNA

 3URFWALL

 #ALENDA

 4AGORA

 #HOCOLATEWALL

 4WIST

3#%./'2!0()#,)'(4).'

 0IXEL-ESH

 +ALIFARECESSED

 +AO

 -OUETTE

?


/UTDOORLIGHTPERFORMANCEINDEX 3#%./'2!0()#,)'(4).'

!##%.4,)'(4).'

'2!0()#,)'(4).'

).$)#!4/2,)'(4).'

$/7.,)'(4).'

 $EDALO

 #ARIDDI

 "ASOLO

 !RIA

 !RIA

 $IAMANTE

 #ElSO

 #ALUMET

 #ICLOPE

 %GODOWNLIGHT

 ,ABEL,IGHT

 %GOSPOT

 #UNEO

 &ACI

 %GO6ETRODOWNLIGHT

 ,INEA,ED77

 %PULO

 %FFETTO

 &ACI6ETRO

 3PIKE

 &ALANGE

 'RANITO

 .UDA

 3UPER3PIKE

 -INISPOT

 -OLLA

 /BICE

 3OSTITUTO3POT


0,!#%3!.$ 342%%4,)'(4).'

7!,+$2)6% /6%2 ,)'(4).'

'%.%2!,,)'(4).'

 %GODRIVE OVER

 "ASOLO

 4OLOMEO,AMPIONE

 #HILONE

 2EEDS

 #ARIDDIPOLE

 %GO6ETROWALK OVER

 #HILONE

 4OLOMEO0ARALUME

 #ICLOPE

 4ETRAGONO

 #ElSOPOLE

 ,INEA,EDDRIVE OVER

 #ICLOPE

 (ILA

 #HILONE

 -EGARA

 $IOSCURI

 )PPOLITO

 (ILA

 -ICROLED

 (ILA

 ,OGICO'ARDEN

 )NDICTA

 .IKI

 .UDA

 0ROVOCA

 /BLIQUE

 /BLIQUE

 3OLAR4REE

 0ANTAREI

 0IROSCAFO

 3OSTITUTOPOLE

 4ETRAGONO

 0OTO

 4OLOMEO88,

0!4(,)'(4).'

?


(UMANAND 2ESPONSIBLE ,IGHT !$6#AMPAIGN 

,IGHTISACONSTANTFEATUREOFOURLIFE4HEVISIONOF!RTEMIDE ISTRADITIONALLYFOCUSEDONTHERELATIONBETWEENMAN LIGHT ANDTHEENVIRONMENT WHICHDEVELOPEDINTIMEINVIEWOF ENSURINGAPERSONSWELLBEINGANDSPACEPERCEPTION AND CONFRONTEDWITHENVIRONMENTALSUSTAINABILITYISSUES ALSOWITH AFOCUSONNATUREANDALLLIVINGBEINGS 4HE(UMAN,IGHTISALIGHTTHATFOLLOWSTHEPACE BEHAVIOUR ANDEMOTIONSOFINDIVIDUALS ALIGHTDESIGNEDFORMANS PSYCHOLOGICALWELLBEING CAPABLETOBRINGNEWQUALITY EMOTIONS ANDCONSCIOUSNESSINTOOURLIFEANDTOOPENUPAN INNOVATIVE RESPONSIBLEOVERVIEWOFTHEPLANETSFUTURE 7ITH4HE(UMAN,IGHT LIGHTBECOMESASHAPEABLERAW MATERIAL ANACTIVEINSTRUMENTSUPPORTINGTHE3ELF AMEANS TOREGAINSTIMULIANDSENSATIONS 3ELF DETERMINATIONINTHERELATIONESTABLISHEDBETWEEN MANANDLIGHTSHOULDBEINTERPRETEDASARIGHTTOFLEXIBLE MANAGEMENTAVAILABLETOALL ASWELLAS INPARTICULAR ADUTY AIMEDATAPPROPRIATEENERGYBALANCE $ESIGNINGLIGHTMEANSREACHINGBEYONDTHEPURELY FUNCTIONALROLEOFLIGHTINGANDEMBRACINGABROADER DIMENSIONTHATLEADSTOANEWFOCUSONTHEPERCEPTIVE EXPERIENCE ONPSYCHOLOGICALANDPHYSIOLOGICALNEEDS!T !RTEMIDE THEKNOWLEDGEANDAWARENESSOFTHISTHEME COMBINEDWITHTHERESEARCHCARRIEDOUTFROMTHES TOTHISDAYINCOOPERATIONWITHUNIVERSITIES THINK TANKS ANDEXPERTSINAVARIETYOFSCIENTIFICSUBJECTSMEDICINE LIFE SCIENCES PSYCHOLOGY ANTHROPOLOGY HAVERESULTEDINTOTHE DEVELOPMENTOFINNOVATIVELIGHTINGSYSTEMS 4HROUGHOUTITSDEVELOPMENTPROCESS !RTEMIDEDESIGNED PRODUCTS ASWELLASINSTRUMENTSTOCREATEVARIABLELUMINOUS SCENARIOSTOINTERACTWITHANDTOOFFERANEW MORE STRAIGHTFORWARDANDCONSCIOUSWAYTOEXPERIENCETHERELATION WITHLIGHT-ETAMORFOSI !LSO 4UNABLE7HITE ANDDOWN TO3PECTRAL,IGHT

ˆviÊ܈ÊLiÊLiÌÌiÀÊ܈̅Ê̅iÊÀˆ}…Ìʏˆ}…Ì°


(IGH -ANUFACTURING 4ODAY!RTEMIDEEPITOMIZESDESIGN LIGHTINGDESIGNCOMPETENCE ANDINNOVATION WITHPRODUCTSTHATCONVEYRESEARCHAND PARTICULARLY THE-ADE IN )TALYCONCEPTANDHIGH QUALITY MANUFACTURING4HE!RTEMIDECOLLECTIONSAREAUNIQUEBLENDOF VALUESANDCOMPETENCESTHECOMPANYSAPPROACHTOHUMAN ANDRESPONSIBLELIGHTISCOMBINEDWITHDESIGNANDMATERIAL SAVOIRFAIRETOCREATEAMIXOFNEXT GENERATIONTECHNOLOGYAND ANCIENTWISDOMSnAPERFECTEXPRESSIONOFSUSTAINABLEDESIGN !RTEMIDEHOLDSTHEWISDOMOFTHEPRESENTANDOFTHEFUTURE WHILEVALORIZINGTHEKNOW HOWOFTHEPAST SUCHASCRAFTGLASS PROCESSING WITHACONTEMPORARYAPPROACH%ACHNEWPRODUCT ISDEVELOPEDANDFINE TUNEDnFROMITSCONCEPTTOINDUSTRIAL MANUFACTURINGnATTHEHEADQUARTERSIN0REGNANA-ILANESE THUS ENSURINGTHEBESTRESULTSINTERMSOFQUALITYANDCOMPLIANCEWITH INTERNATIONALSTANDARDS #ERTIFIEDLABORATORIESSUPPORTALLTHEPHASESOFPRODUCT DEVELOPMENT FROMEARLYSTUDIESTOMARKETRELEASE /NGOINGRESEARCHEXPANDSTHEMANUFACTURINGKNOW HOW DEVELOPEDINTIME WHICHISCONSTANTLYUPDATEDINTHELIGHTOF NEWTECHNOLOGIES BOTHATTHEMANUFACTURINGUNITIN0REGNANA -ILANESEANDINTHEOTHER%UROPEANFACILITIESOFTHEGROUP 4ELGATE "' AND6ENICEIN)TALY 3T&LORENTIN&RANCE 0AKSIN (UNGARY 7ITHINTHEFRAMEWORKOFATHOROUGHENVIRONMENTAL POLICY QUALITYISSEENASAFUNDAMENTALRIGHTFORALONG LASTING RELATIONWITHTHEPRODUCTCAREFULDESIGNOFTHEENTIRELIFECYCLE ISAPREREQUISITEFORALONGLIFEANDFORTRUEENVIRONMENTAL INNOVATION-AXIMUMCAREISGIVENTOTHEDESIGNANDPRODUCTION PROCESSWITHAFOCUSONARESPONSIBLEUSEOFRESOURCESANDAN ACCURATECHOICEOFPROCESSESANDTECHNOLOGIESINVIEWOFENERGY BALANCE

?


,IGHTIN 9EARS4IME ,I&I !RTEMIDEOPENSUPIMPORTANTRESEARCHISSUESCONNECTEDWITHPHOTONICSANDNEW TECHNOLOGIESTOOUTLINEAFUTUREVISION ANEWWAYTOINTERPRETANDEXPERIENCELIGHT 4HECOMPANYISMOVINGTOWARDSTHENEWFRONTIERSOFDESIGNnFROMTHEATOMTOTHE BITnWHERETHECOREISNOLONGERJUSTTHEPRODUCTASSUCH!REVIEWOFTHEROLEAND POTENTIALSOFLIGHT WHICHSTARTSFROMITSDUALCONNOTATIONASBOTHANUNDULATINGANDA CORPUSCULARPHENOMENON PASSESTHROUGHIDEASTHATREACHBEYONDTHEPRODUCT TOWARDS ANEWMANAGEMENTANDINFORMATIONINTELLIGENCE$ESIGNTODAYSHOULDPROVIDEABETTER ALTERNATIVETOEXISTINGITEMS ANINTERACTIVEDESIGNHALF WAYBETWEENTECHNOLOGICAL FRONTIERSANDTHECONTEMPORARYHUMANCULTURE CAPABLETOPROMOTEEXPERIENCESAND TOCAPTURETHEBEHAVIOURSANDEMOTIONSOFPEOPLE4HE)NTERNETOF4HINGSPROVIDESAN OPPORTUNITYTOGENERATENEWRELATIONSANDNEWFORMSOFENVIRONMENTALAWARENESS ANDCONTROL ANDALLOWSTODEVELOPPROJECTSFORADYNAMICANDINTERACTIVEEXPERIENCE WITHLIGHTINADIGITALDIALOGUEAIMEDATSOCIALLIGHTING4HISTECHNOLOGICALACCELERATION PROVIDESMULTIPLEOPPORTUNITIES4HETIMEFORTECHNOLOGICALTRANSFERnFROMRESEARCH TOIMPLEMENTATIONnISGRADUALLYSHRINKING4HISHASOPENEDUPNEWREALFRONTIERSFOR DESIGNAT!RTEMIDE,I&I SMARTANDDIGITALMANAGEMENTSYSTEMS ASWELLASTHEDESIGN OFTRUESOFTWAREAPPLICATIONS LIKE,O4


!MELUNA!PP

?


4ARGET0OINT .ATURALANDENVIRONMENTALPHENOMENACANINTERACTWITHARTIFICIALLIGHTACCORDINGTO MEASUREDPARAMETERS4HE)O4ENABLESATWO WAYDIALOGUEBETWEENLIGHTINGAPPLIANCES SENSORS ANDCONTROLSYSTEMS CAPABLETORECORDANDINTEGRATEAMBIENTVARIATIONSTO PRESERVEADYNAMICBALANCEWITHRESPECTTOPRE SETTARGETVALUES


,OT3OFTWARE !NINNOVATIVEOPERATINGINTELLIGENCEFORTHE,O4FAMILYOFPROJECTORS3OFTWARE PRODUCTINTERACTIONOCCURSINREALTIME EITHERTHROUGH 3CHEDULINGORWITHRESPECTTOEXTERNALVARIABLES4HEUNIQUENUANCESOFNATURALLIGHTAREREPRODUCEDINREALTIMEBYMEANSOF ALGORITHMSFORINSTANTCALCULATIONOFSCHEMES PATTERNS ANDLIGHTINGEFFECTS4HESYSTEMISPROGRAMMEDBYMEANSOFASIMPLEANDUSER FRIENDLYDRAGDROPINTERFACE Patching

Content

Scheduling

Playback

Settings

Patching

Credits

Real time geometrical for complex light patterns

Ceiling Scene 1 Floor

Ceiling

Scene 23 Group Scene 34 Group

Light Sythesizer

Ceiling

Light Geometry

Scene 1 Floor

Light Biomimicry

Scene 23 Group

Curated Content

Scene 45 Group

Scene 56 Group

Scene 56 Group

Scene 67 Group

Scene 67 Group

Group 8

Group 8

Group 9

Group 9

Save

Playback

Settings

Credits

Content Generated White Light Geometry Intensity

Light Sythesizer

White Angle

Light Geometry

Ceiling

Color

Light Biomimicry

Curated Content

Group 10

Clear

Save Save

Floor

Content

Clear

Floor

SCENE LIBRARY

SCENE LIBRARY

Patching

Scheduling

Scene 34 Group

Scene 45 Group

Group 10

ZV

LV

Scheduling

Playback

ZV

LV

Scheduling

Playback

TEST

Settings

Credits

Patching

Content

Settings

Scene Library

Content Generated

Groups

TEST

Credits

Thursday / Febrary 25 / 2016

Controlers

Scene 1

Light Sythesizer

White Angle Light Sythesizer

Scene 23 Group

Light Geometry

Ceiling

Color

Light Biomimicry

Scene 2 Scene 3

Surrise

White Intensity

Ceiling Scene 1 Floor

Scene 4

Scene 5

Scene 34 Group

Curated Content

Scene 6

Morning

Scene 45 Group Scene 56 Group Scene 67 Group Group 8

Sunset

Group 9 Group 10 Save

Clear

Lateral group

SCENE LIBRARY

Midnight

From title

Content

Groups

Content Generated

Groups

ZV

LV

TEST

?


7EBSERVICES VœÕ`

CLOUDARTEMIDECOM ARTEMIDECOM


4HE $ $ FILES OF OUR PRODUCTS ARE AVAILABLE FOR YOUR LIGHTING PROJECT AND ARE COMPATIBLE WITH THEMOSTPOPULAR#!$SOFTWARE APPLICATIONS DWG DXF $S STP 

4HE PHOTOMETRIC DATA OF OUR PRODUCTS CAN BE DOWNLOADED FROMOURWEBSITEINTHELDT IES %5 IES53 ULDFORMATS

#!$FILES

0HOTOMETRICDATA

$ $

-OUNTINGINSTRUCTION

#ERTIFICATIONS

!RTEMIDE PROVIDES STEP BY STEP SUPPORTFORPRODUCTINSTALLATION n FROM SIMPLE TABLE APPLIANCES TO MORE COMPLEX AND INTRICATE LIGHTINGSYSTEMS

#ERTIFICATIONS FOR THE DIFFERENT MARKETS ARE AVAILABLE TO SUPPORT INTERNATIONALSALES

?


!RTEMIDEHASALWAYSPROVIDEDHIGHQUALITYPRODUCTS !SARESULT WEAREGLADTOINFORMYOUTHATFROM!PRIL STWEWILLOFFERTOALLOURENDUSERSWORLDWIDE PRIVATE CONSUMERS ONLY A FREE  YEAR EXTENDED WARRANTY VALID ONLY IF THE PRODUCT IS SUCCESSFULLY REGISTEREDONLINEWITHINTWOMONTHSFROMTHEDATE OFPURCHASE #ONDITIONSFORTHE YEAREXTENDEDWARRANTYAREAS FOLLOWS "EINGANENDUSERPRIVATECONSUMER  0URCHASINGTHE!24%-)$%PRODUCTAFTER!PRILST 2EGISTERING THE PRODUCT ONLINE WITHIN  MONTHS FROMTHEDATEOFPURCHASE 4HEPRODUCTMUSTBENEWNOTSECOND HAND  "EINGTHEFIRSTOWNEROFTHEPRODUCTTHEWARRANTY ISNOTTRANSFERABLE  &OLLOWINGSUCCESSFULONLINEACTIVATIONANDCLAIM THE EXTENDEDWARRANTYWILLENTITLETHEPRIVATECUSTOMER TO A FREE REPAIR OR REPLACEMENT WHEN THE PRODUCT IS DETERMINED TO BE FAULTY DUE TO MANUFACTURING DEFECT ASSTATEDONITSTERMSANDCONDITIONS

CLOUDARTEMIDECOM YEARS WARRANTY


!RTEMIDE4#/ISAPROFESSIONALTOOLFORTHEIMPLEMENTATIONOFENERGY PERFORMANCEANDECONOMICEVALUATIONSOFYOURLIGHTINGPROJECTS

?0ROJECT

%NTERGENERALINFORMATIONTOWN BUILDINGTYPE ETC ADDINGQUALITATIVE DETAILSSUCHASHOWTHEAREAISOCCUPIEDANDTHESUPPLYOFNATURAL DAYLIGHT

?3OLUTION

#REATETWOORMORESIMPLEALTERNATIVEPROJECTSOLUTIONSWHILEDEFINING SUITABLEMANUALORAUTOMATICCONTROLSYSTEMS SUCHASPRESENCEDETECTORS ANDLIGHTSENSORS FOREACHFIXTURE

?%NERGY

!RTEMIDE4#/COMPARESALTERNATIVESOLUTIONS CLEARLYDISPLAYINGTHOROUGH ENERGYRESULTSCOMPLIANTTO%.STANDARDS #/EMISSIONSAND ENERGYSAVINGPERCENTAGES

?4#/

!RTEMIDE4#/COMPARESALTERNATIVELIGHTINGSOLUTIONSALSOTHROUGH INTUITIVECHARTSANDGRAPHS DISPLAYING4#/DETAILSAND2/)SPREADOVER TIME

?2EPORT

&INALLY YOUCANGENERATEANDEXPORTAPDFRECAPPROJECTREPORTWHICH CANBECUSTOMIZEDWITHYOURLOGO DETAILSANDASELECTIONOFTHEENERGY PERFORMANCEANDECONOMICINFORMATIONYOUWOULDLIKETOHIGHLIGHT

4#/€SYSTEM € MAINTENANCE 7L T 7P T s€K7H 4#/4OTAL#OST/WNERSHIP 7L TABSORBEDENERGYWITHLAMPSON0.sT Ds&Ds&Os&C 0NsT Ns&Os&C ;K7H= 7P TABSORBEDPARASITICENERGYWITHLAMPSOFF0PCs;TnT D T N = 0EMsT E;K7H=

TCOARTEMIDECOM

?


"ESPOKE PRODUCTS !RTEMIDEOFFERSCOMPREHENSIVESERVICEFORCONTRACTPROJECTS DEVELOPEDONMULTIPLELEVELS 4HECOMPANYCANDESIGNCUSTOMIZEDSOLUTIONSSTARTINGFROM EXISTINGPRODUCTS ASWELLASDESIGNANDMANUFACTUREBESPOKE SOLUTIONS !DEDICATEDIN HOUSEDEPARTMENTTAKESCAREOFCUSTOM DESIGNED PROJECTSANDDEVELOPSINDIVIDUALSOLUTIONSINCOOPERATIONWITHTHE STAFFINCHARGEOFRESEARCH DEVELOPMENT ANDINNOVATION 4HEOPTOELECTRONICINNOVATIONSKILLS THETECHNOLOGICALKNOW HOW ANDTHEHIGH QUALITYMANUFACTURINGOF!RTEMIDEAREAVAILABLE FORCUSTOMERSANDDESIGNERSTOIMPLEMENTªPROJECTS TOHELP DESIGNPRODUCTS ASWELLASTHEBEHAVIOUROFLIGHTINSPACE #USTOM DESIGNEDSOLUTIONSMAYINVOLVEEXISTINGPRODUCTS INNEWVERSIONS FORMS DIMENSIONS CONTROLMODES LIGHTING

PERFORMANCES TECHNICALSPECIFICATIONS ORINSTALLATIONFEATURES )NPARTICULAR THE!RTEMIDECOLLECTIONSINCLUDEAVARIETYOF PRODUCTSTHATARECONCEIVEDTOACTASOPENANDMODULAR PLATFORMS INORDERTOMEETTHEREQUIREMENTSOFINDIVIDUAL ARCHITECTURALANDFUNCTIONALSPACESWITHUTMOSTFLEXIBILITY !RTEMIDETRADITIONALLYESTABLISHESIMPORTANTPARTNERSHIPSWITH INTERNATIONALARCHITECTUREORLIGHTINGDESIGNFIRMSANDWITHTOP BRANDS WHICHRESULTINTOUNIQUESOLUTIONS OFTENINTERESTINGFROM THECULTURALVIEWPOINTANDFORTHERESEARCHTHEYSTIMULATE-ANY OFTHESEHAVETRIGGEREDTHEPROCESSFORDEVELOPMENTOFSOMEOF THEEXISTINGPRODUCTS


?


)NDOOR

?


0ROJECTOR            

,O4 #ATA 0ICTO 6ECTOR /LMO #AELUM !IRLITE 4RACKS 5NA0RO #UBE 0!$ 3OL

?


,O4 4APIO2OSENIUS 

0ATENT0ENDING.ª-)


?


,O4

sMAXPEAKPOWER7 MAXCONTINOUSPOWER7 sMAXLUMINOUSFLUXLUMEN s-AC!DAM3$#s"EAM3&7&8& s##4+ s#2)TYP s,IFE,+ H s#ONTROL$-82$s$-8FOOTPRINT s)0

s,O4ISAUNIVERSALPROJECTORTHATCHANGESTHE s!WELL CALIBRATEDMIXOFCURRENTSONTHE BEAMANGLESOFEMISSIONSANDFLOWSDYNAMICALLY DIFFERENTCHANNELSALLOWSTOADJUSTTHEBEAM ANDPRODUCESCOLOUREDAMBIENTLIGHT ANGLESOFTHEEMISSIONSANDTOMANAGEALL INTERMEDIATEANGLESWITHAVERYHIGHRESOLUTION s)TISAMULTI FOCALPROJECTORTHATENSURESUTMOST &LUIDANDGRADUALCHANGESARETHUSPERCEIVED FLEXIBILITYWITHMINIMALDIMENSIONS &OOTPRINTWHITEEMISSIONBEAMANGLE s)TSDYNAMICLUMINOUSBEAMDOESNOTIMPLYANY &OOTPRINTWHITEEMISSIONINTENSITY MECHANICALMOVEMENTS BUTISRATHERTHERESULT &OOTPRINTREDEMISSIONINTENSITY OFINNOVATIVEOPTOELECTRONICDESIGN3EVEN &OOTPRINTGREENEMISSIONINTENSITY LENSESDEFINEFOURBASEBEAMANGLESAND WHEN &OOTPRINTBLUEEMISSIONINTENSITY COMBINED CANMODULATECOUNTLESSBEAMANGLES &OOTPRINTWHITEEMISSIONINTENSITY ANDINTENSITIESTHROUGHCURRENTCHANGE s)NADDITIONTOTHEWHITELIGHTPROJECTORFUNCTION s%ACHBASEBEAMANGLEHASDIFFERENTOPTICAL ,O4CANPRODUCECOLOUREDAMBIENTLIGHTINTHE UNITTYPESFORTHENARROWBEAM FORTHE 2'"7MODETHROUGHADDITIONALDEDICATED FLOODBEAM FORTHEWIDEFLOODBEAMAND CHANNELS FORTHEEXTRAFLOODBEAM s5SES4)2LENSES s4HESPECIALHEATSINKALLOWSTOADJUSTTHE LIGHTINGPOWERTOENSUREEXCELLENTILLUMINATION UPTOAMDISTANCE s3PECIFICATIONSANDDETAILSCANBEOBTAINEDFROM THE!RTEMIDESALESOFFICE


?


,O42EmECTOR

sMAXPOWER7 sMAXLUMINOUSFLUXLUMEN s-AC!DAM3$#s"EAM3&7& s##4+ s#2)TYP s,IFE,+ H s#ONTROL$-82$s$-8FOOTPRINT s)0

s,O42EFLECTORISAUNIVERSALPROJECTORTHAT CHANGESTHEBEAMANGLESOFEMISSIONSAND FLOWSDYNAMICALLY s)TISAMULTI FOCALPROJECTORTHATENSURESUTMOST FLEXIBILITYWITHMINIMALDIMENSIONS s)TSDYNAMICLUMINOUSBEAMDOESNOTIMPLYANY MECHANICALMOVEMENTS BUTISRATHERTHERESULT OFINNOVATIVEOPTOELECTRONICDESIGN3EVEN LENSESDEFINEBASEBEAMANGLESAND WHEN COMBINED CANMODULATECOUNTLESSBEAMANGLES ANDINTENSITIESTHROUGHCURRENTCHANGE s%ACHBASEBEAMANGLEHASDIFFERENTOPTICAL UNITTYPESFORTHENARROWBEAM FORTHE FLOODBEAM ANDFORTHEEXTRAFLOODBEAM s!WELL CALIBRATEDMIXOFCURRENTSONTHE DIFFERENTCHANNELSALLOWSTOADJUSTTHEBEAM

ANGLESOFTHEEMISSIONSANDTOMANAGEALL INTERMEDIATEANGLESWITHAVERYHIGHRESOLUTION &LUIDANDGRADUALCHANGESARETHUSPERCEIVED &OOTPRINTWHITEEMISSIONBEAMANGLE &OOTPRINTWHITEEMISSIONINTENSITY s5SESREFLECTIVEOPTICALUNITS s4HESPECIALHEATSINKALLOWSTOADJUSTTHE LIGHTINGPOWERTOENSUREEXCELLENTILLUMINATION UPTOAMINSTALLATIONHEIGHT s3PECIFICATIONSANDDETAILSCANBEOBTAINEDFROM THE!RTEMIDESALESOFFICE


?


,O4

33POT ª

&&LOOD ª

7&7IDEmOOD ª

8&%XTRAmOOD ª


,O42EmECTOR

33POT ª

&&LOOD ª

7&7IDEmOOD ª

-AX0OWER3POT ª

?


?


,O4

7HITE

4RACK

"LACK

$-8 #2) 

7 MAX7

7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

301

#ODE !! !!

330

234

4OBEUSEDINCOMBINATIONWITHTHREE PHASE$!,)TRACKSFOR$-8USE

)0

ª

ø 338

&LUXTOT LM

##4 2ECCESED "ODY +

#ODE !! !! !!

240

53

247

7EIGHT  KG

190

#2) 

ª

$-8

2ECESSED4RIM 7 MAX7

ª

)0

ª

ª

$-8 &LUXTOT LM

##4 2ECCESED "ODY +

#ODE !! !! !!

240

53

247

7EIGHT  KG

ø 338

190

2ECESSED4RIMLESS #2) 7 MAX7 

ª

)0

ª

ª

$-8

#EILING #2) 

7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

301

#ODE !! !!

240

61

237

7 MAX7

ª

ø 185

)0

ª

301

7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

#ODE !! !!

240

MAX. 2000

#2) 

ª

$-8

3USPENSION 7 MAX7

ª

)0

ª

ª

ª 301

$-8

3USPENSIONTRACK 7 MAX7

#2) 

7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

#ODE !! !!

330

MAX. 2242

4OBEUSEDINCOMBINATIONWITHTHREE PHASE$!,)TRACKSFOR$-8USE

)0

ø 185

ª

ª

ª


,O42EmECTOR

3ILVER

4RACK 7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

190

#2) 

#ODE !-

330

225

7 MAX7

$-8

4OBEUSEDINCOMBINATIONWITHTHREE PHASE$!,)TRACKSFOR$-8USE ø 210

)0

ª

ø 338

7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

#ODE !-

190

#2) 

ª

$-8

2ECESSED4RIM 7 MAX7

ª

62

248

240

)0

ª

7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

ø 338

#ODE !-

190

#2) 

ª

$-8

2ECESSED4RIMLESS 7 MAX7

ª

62

248

240

)0

ª

ª

7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

#ODE !-

274

225

#2) 

190

$-8

#EILING 7 MAX7

ª

ø 210

)0

ª

ª

314

#2) 

7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

190

$-8

3USPENSION 7 MAX7

ª

#ODE !-

240

ø 210

)0

ª

314

7EIGHT  KG

&LUXTOT LM

##4 +

#OLOR

190

#2) 

ª

$-8

3USPENSIONTRACK 7 MAX7

ª

#ODE !-

330

4OBEUSEDINCOMBINATIONWITHTHREE PHASE$!,)TRACKSFOR$-8USE

)0

ø 210

ª

ª

ª

?


?


#ATA #ARLOTTADE"EVILACQUA  

Patent pending (IT) n° MI2012A000605 Patent pending (US) n° 13/863.246 Patent pending (EU) n° 13163623.5






?


#ATA/PTICAL3YSTEM

#ATA

#ATA4)2

#ATADIOPTRIC

4OTAL)NTERNAL2EmECTION

s(IGHAXIALINTENSITIESWITHCONSIDERABLE BEAMCOLLIMATION

s%XTREMELYCOMPACTDIMENSIONS

s(IGH PRECISIONACCENTLIGHTING

s7IDEAVAILABILITYOFBEAMANGLES

s7ELLDEFINEDNARROWBEAMS

s-AXIMUMCONTROLOFLIGHTEMISSION

s%XCELLENTLIGHTBLENDING

s7IDERANGEOFOPTICALACCESSORIES

s(IGHEFFICIENCY

PRIMARYMIRROR

OPTICSHOLDER

LIGHTPIPE

SECONDARYOPTICS FHOLOGRAPHICFILTERS

SECONDARYMIRROR

PRIMARYOPTICS SILICONELENSES


#ATA7IDE 2EmECTIVE2EFRACTIVE s3OFT HOMOGENOUSLIGHT s(IGHEFFICIENCY s$IFFUSEDLIGHTEFFECTPRODUCEDBY TRANSPARENTMATERIAL

INTERNALMICROLENSES

EXTERNALPRISMSATª

?


#ATA s)NTERCHANGEABLEOPTICALUNITA@TWISTLOCK MECHANISM

FORSUSPENSIONINSTALLATIONINTHEADJUSTABLE VERSION

s$EFINED CONCENTRATEDLIGHTBEAMSTHANKSTOAN INNOVATIVECOLLIMATIONSYSTEM

s5LTRA FLATPOWERSOURCEMMHEIGHT $!,) DIMMABLEASSTANDARD $!,)INTERFACEHUB FOR4UNABLE7HITEVERSION

sBEAMANGLESNARROWª SPOTª FLOOD ª 

s)FMOUNTINGONATRACK ITCANBEUSEDWITH BUTTONONBOARDUNITWITHMEMORYFUNCTION

s%XCELLENTQUALITYOFLIGHT

s)NALLTHEOTHERMOUNTINGMODES OPTIONAL 3WITCH$IMMOPERATIONANDRESIDENTBUTTONWITH MEMORYFUNCTION

s#ATA4UNEABLE7HITEADJUSTABLECOLOUR TEMPERATUREFROM+TO+ #2)MIN 

s-ATERIALSOPTICINTRANSPARENTANDMETALLIC POLYCARBONATE HEATSINKINDIE CASTPOLISHED ALUMINIUM FEEDERPOWERSUPPLYINTRANSPARENT POLYCARBONATE ARMINDIE CASTPOLISHED ALUMINIUM

s#ATA3TABLE7HITEAVAILABLEASWARMWHITE + ANDNEUTRALWHITE+ n#2) MIN  s2OTATIONOFª TILTANGLEOF ª ª sINSTALLATIONOPTIONSWITHADAPTORFOR CIRCUIT TRACKCEILINGONLYASENVISAGEDBYLEGISLATION WITHPOWERUNITFORCEILINGINSTALLATIONINTHE ADJUSTABLEANDFIXEDVERSION WITHPOWERUNIT

s#OMPLIESWITH%. STANDARDANDOTHER SPECIFICSTANDARDS

/PTICALUNIT #ATAISEQUIPPEDWITHASYSTEMOFINTERCHANGEABLEOPTICS VIAA@TWISTANDLOCKMECHANISM

SPOTª

NARROWª

mOODª


0ATENTPENDING)4 Nª-)! 0ATENTPENDING53 Nª 0ATENTPENDING%5 Nª

?


#ATA4UNABLE7HITE

+

+

s#ATAPROJECTORINITS4UNABLE7HITEVERSION ISEQUIPPEDWITHANINNOVATIVE#/"WITH ADJUSTABLECOLOURTEMPERATURE4HEWHITECOLOUR TEMPERATURECANBEADJUSTEDFROM+TO + WITHANIMPRESSIVE#2)MIN s)TSLIGHTINGPERFORMANCELOOKSTOREPRODUCE THEBESTPROFESSIONALHALOGENSOURCESINTERMS THEQUALITYOFLIGHT WITHTHEADDEDBENEFIT OFNON EXISTENTULTRAVIOLETANDINFRAREDEMISSIONS s#ATAPROJECTORISEQUIPPEDWITHCUSTOMELECTRONICS SPECIFICALLYDESIGNEDTOINTERFACEWITHDIFFERENT CONTROLDEVICESTHROUGHTHE$!,)PROTOCOL

CCTK CCTK

#ATA47  



















 





  

LUMINOUSmUX



#2)

POWERSPECTRALDENSITY7NM

#ATA47

















WAVELENGHTNM







 











CORRELATEDCOLORTEMPERATURE+



     











CORRELATEDCOLORTEMPERATURE+




#ATATUNABLEWHITE

0OLISHEDALUMINIUM

7 #2) 7 

7EIGHT  KG

##4 + +



$IMMABLE$!,)

4RACK

#ODE - Œ

ª

ª

7EIGHT  KG

##4 + +



$IMMABLE$!,)

#EILING #2) 7 7 

ª

)0 ª

Œ

#ODE - Œ

ª

Œ

ª

ª

)0 ª

$IMMABLE$!,) BIANCOl SSO 7EIGHT  KG

##4 + +

#ODE -



7 #2) 7 



3USPENSION

)0 ª Œ

ª

ª

ª

?


#ATACATADIOPTRIC

0OLISHEDALUMINIUM

4RACK #2) 

7EIGHT  KG

##4 + +



7 7

$!,) #ODE - - Œ

Œ

4OBEUSEDINCONJUNCTIONWITH$!,) CIRCUITTRACKS )NABSENCEOF$!,)BUS #!4!CANBEDIMMEDUSINGTHEBUTTON ONTHELIGHTlTTING

)0 ª

ª

ª

#2) 

7EIGHT  KG

##4 + +



$!,) 3WITCH$IM

#EILING 7 7

ª

#ODE - - Œ

)0 ª

ª

ª

7EIGHT  KG

##4 + +

#ODE -7 -. 

#2) 

ª

BIANCOlSSO $!,) 3WITCH$IM

3USPENSION 7 7

Œ



)NABSENCEOF$!,) 3WITCH$IMBUS #!4!CANBEDIMMEDUSINGTHEBUTTON ONTHELIGHTlTTING

)0 ª

ª

ª

7EIGHT  KG

##4 + +

#ODE -7 -.



#2) 

Œ

$!,) 3WITCH$IM

#EILINGlX 7 7

ª

Œ

)0 ª


/PTIC

7EIGHT  KG

"EAM

##4 + +

&LUX LM LM

7EIGHT  KG

"EAM

##4 + +

&LUX LM LM

ª

#ODE -



/PTICALUNITª

Œ

ª

#ODE -



/PTICALUNITª

Œ

7EIGHT  KG

##4 + +

"EAM ª

#ODE -

108

/PTICALUNITª

Ø125

&LUX LM LM

?


#ATA4)2 s)NTERCHANGEABLEOPTICALUNITA@TWISTLOCK MECHANISM

s5LTRA FLATPOWERSOURCEMMHEIGHT $!,) DIMMABLEASSTANDARD

sAVAIBLEBEAMSNARROWª SPOTª FLOOD ª WIDEFLOODª WALLWASHER

s)FMOUNTINGONATRACK ITCANBEUSEDWITH BUTTONONBOARDUNITWITHMEMORYFUNCTION

sCOLORTEMPERATURESWARMWHITE+ #2) MIN NEUTRALWHITE+ #2)MIN

s)FUSINGACEILINGANDSUSPENSIONMOUNT ITCAN BEUSEDIN3WITCH$IMMOPTIONANDWITHBUTTON ONBOARDUNITWITHMEMORYFUNCTION

s2OTATIONOFª TILTANGLEOF ª ª

s-ATERIALSOPTICINTRANSPARENTPOLYCARBONATE ANDSILICONE HEATSINKINDIE CASTPOLISHED ALUMINIUM FEEDERPOWERSUPPLYBODYIN TRANSPARENTPOLYCARBONATE ARMINDIE CAST POLISHEDALUMINIUM

sINSTALLATIONOPTIONSWITHADAPTORFOR CIRCUIT TRACKCEILINGONLYASENVISAGEDBYLEGISLATION WITHPOWERUNITFORCEILINGINSTALLATIONINTHE ADJUSTABLEANDFIXEDVERSION WITHPOWERUNIT FORSUSPENSIONINSTALLATIONINTHEADJUSTABLE VERSION

s#OMPLIESWITH%. STANDARDANDOTHER SPECIFICSTANDARDS

/PTICALUNIT #ATA,ENSISEQUIPPEDWITHASYSTEMOFINTERCHANGEABLEOPTICS VIAA@TWISTANDLOCKMECHANISM

NARROW

SPOT

FLOOD

WIDEFLOOD

WALLWASHER


?


#ATA4)2

0OLISHEDALUMINIUM

4RACK #2) 7EIGHT   KG

##4 + +



7  7

$!,) #ODE -7 -. Œ

Œ

4OBEUSEDINCONJUNCTIONWITH$!,) CIRCUITTRACKS )NABSENCEOF$!,)BUS #!4!CANBEDIMMEDUSINGTHEBUTTON ONTHELIGHTlTTING

)0 ª

ª

ª

$!,) 3WITCH$IM #2) 7EIGHT   KG

##4 + +

#ODE -7 -.



#EILING 7  7

ª

Œ

)0 ª

ª

ª

#2) 7EIGHT   KG

ª

BIANCOlSSO $!,) 3WITCH$IM

3USPENSION 7  7

Œ

##4 + +

#ODE -7 -.

)0 ª

ª

ª

##4 + +

#ODE -7 -.



#2) 7EIGHT   KG

ª

$!,) 3WITCH$IM BIANCOlSSO

#EILINGlX 7  7





)NABSENCEOF$!,) 3WITCH$IMBUS #!4!CANBEDIMMEDUSINGTHEBUTTON ONTHELIGHTlTTING

Œ

)0 ª


/PTIC

/PTICALUNITNARROW "EAM ª

#ODE -



7EIGHT  KG

Œ

##4 + +

&LUX LM LM

7EIGHT  KG

##4 + +

"EAM ª

#ODE -



/PTICALUNITSPOT

Œ

&LUX LM LM

7EIGHT  KG

##4 + +

"EAM ª

#ODE -



/PTICALUNITmOOD

Œ

&LUX LM LM

7EIGHT  KG

##4 + +

"EAM ª

#ODE -



/PTICALUNITWIDEmOOD

Œ

&LUX LM LM

7EIGHT  KG

##4 + +

"EAM WW

#ODE -



/PTICALUNITWW

Œ

&LUX LM LM

?


!CCESSORIESCONlGURATION

NARROW 'LASSlLTER ,ENSFORELLITTICALEMISSION 3OFTlLTER #HROMATIClLTER !NTI DAZZLELOUVRE

!DJUSTABLEDOWSERS

!NTI DAZZLELOUVRE !DJUSTABLEDOWSERS

+

+

!NTI DAZZLELOUVRE 'LASSlLTER ,ENSFORELLIPTICALEMISSION 3OFTlLTER #HROMATIClLTER

+

!DJUSTABLEDOWSERS 'LASSlLTER ,ENSFORELLIPTICALEMISSION 3OFTlLTER #HROMATIClLTER

+

'LASSlLTERS ,ENSFORELLIPTICALEMISSION 3OFTlLTER #HROMATIClLTER

#OLOR !CCESSORIESHOLDER

#ODE -

,ENSFORELLITTICALEMISSION

-

3OFTlLTER

-

#HROMATIClLTER

- - -

!NTI DAZZLELOUVRE

-

!DJUSTABLEDOWSERS

-

SPOT

mOOD

WIDEmOOD


?


?


0ICTO 3TUDIO!RTEMIDE ,%$

s,%$#/"

s3ERIESOFHIGH OUTPUT,%$ADJUSTABLEPROJECTORS

s7 7 7 7

sCOLOURSAVAILABLE

sLUMEN

s/PTICALUNITSAVAILABLEINSIZES DEPENDINGON THELIGHTSOURCEMM MM MM

s-AC!DAM3$#

s7IDERANGEOFACCESSORIES56FILTERS CHROMATIC FILTERS LOUVRES ASYMMETRICDIFFUSER ADJUSTABLE DOWSERS 'OBOTOPROJECTIMAGESORCONTROLSHAPE OFBEAM

s$EFINEDNARROWBEAMSINTHE,%$VERSION THANKS TOTHEHYBRIDOPTICALSYSTEM0ICTO 

sINSTALLATIONOPTIONSWITH CIRCUITTRACKADAPTER AVAILABLEFORCEILINGMOUNTEDOPTION ORBASE PLATEFORCEILINGMOUNTING

s0ICTO(IGH&LUXUSESAHIGH YIELDREFLECTIVE OPTICALUNIT

s%LECTRONICPOWERSUPPLYWITH$!,)DIMMABLE OR NON DIMMABLEOPTIONS

s4HENEW0ICTO(IGH&LUXIMPROVESTHE PERFORMANCETHANKSTOTHEHIGHINSTALLEDPOWER ANDITSHIGHEFFICIENCY

s-ATERIALSINJECTION MOULDEDALUMINIUMHEAD ALUMINIUMORPOLYMERBODY PUREALUMINIUM REFLECTORS

s##4++

s0ICTO4UNEABLE7HITE,%$ COLOUR TEMPERATURECANBEADJUSTEDFROM +TO  +n#2)MIN 

s#OMPLIANTTO%. STANDARDANDOTHER SPECIFICREGULATIONS

s#2)MIN

s!DJUSTABILITY ª ª ROTATIONUPTOª

s"EAM&7&8& s##4++ s#2)MIN s,IFE,+  s)0 0ICTO4UNABLE7HITE

ª

ª

s0RECISEAIMINGOFTHEPROJECTORS THANKSTO ADVANCEDLOCKINGSYSTEM


?


3HOWROOM0OLTRONA&RAU


4YPOLOGY #OLOUR

4RACK

7HITE

#EILINGVERSIONWITHADAPTER

"LACK

!CCESSORY HOLDERCOLOUR 7HITE

"LACK

0ROJECTORCORRESPONDINGCOLOUR "LACK

7HITE

?


?


0ICTO

7HITE

&LUX LM

##4 +

LM

+

ª

LM

+ +

ª

LM LM LM

"EAM ª

#OLOR

+ +

#ODE !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$

#ODE !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$

)0 ª ª

ª

ª 

7EIGHT  KG

$!,)DIMMABLE





7 #2) 7 

.ONDIMMABLE



,%$6ERTICAL

"LACK









,%$(ORIZONTAL 7EIGHT  KG

&LUX LM

##4 +

LM

+

ª

LM

+ +

ª

LM LM LM

"EAM ª

#OLOR

+ +

$!,)DIMMABLE

#ODE !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$

#ODE !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$

)0 ª ª

ª

ª



7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

!CCESSORIES0ICTO !CCESSORY HOLDER ASYMMETRICDIFFUSER BLACK

!CCESSORY HOLDER ADJUSTABLEDOWSERS BLACK

!CCESSORY HOLDER PROJECTIONLENS TOCONTROLSHAPE OFBEAM !CCESSORY HOLDER PROJECTIONLENS FORGOBO 'OBOTOBEORDERED SEPARATELY

 

0ROJECTOR #OLOR

- -

#ODE - -

- -

- -

, ,

!CCESSORYFORCEILING INSTALLATION











#2) 7 7 

.ONDIMMABLE


7HITE

0ICTO

7EIGHT  KG

"EAM ª

ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

#OLOR

$!,)DIMMABLE

#ODE !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$

#ODE !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$

)0 ª ª

ª

ª 

7 #2) 7 

.ONDIMMABLE









,%$6ERTICAL

"LACK





 

#2) 7 7 

7EIGHT  KG

"EAM ª

ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

#OLOR

.ONDIMMABLE

$!,)DIMMABLE

#ODE !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$

#ODE !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$

)0 ª ª

ª

ª 

,%$(ORIZONTAL

















7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

!CCESSORIES0ICTO !CCESSORY HOLDER ASYMMETRICDIFFUSER BLACK

!CCESSORY HOLDER ADJUSTABLEDOWSERS BLACK

0ROJECTOR #OLOR

- -

#ODE - -

- -

!CCESSORY HOLDER ANTI DAZZLELOUVRE

56&ILTER

-

!CCESSORYFORCEILING INSTALLATION

, ,

?


0ICTO

7HITE

0ICTO(IGH&LUX,%$ 7 7

#2) 

7EIGHT  KG

"EAM &LUX LM ª

##4 +

LM

+

LM

+

LM

+

ª

#OLOR

NONDIMMABLE

$!,)DIMMABLE

#ODE !$ !$ !$ !$ !$ !$ !$ !$

#ODE !$ !$ !$ !$ !$ !$ !$ !$

"LACK

)0 ª ª

ª

ª

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

0ICTO #2) 

7EIGHT  KG

"EAM ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

NONDIMMABLE

$!,)DIMMABLE

#ODE !$ !$ !$ !$ !$ !$ !$ !$

#ODE !$ !$ !$ !$ !$ !$ !$ !$

)0 ª ª

ª

ª









7BD)[FMFDUSPOJDCBMMBTUJODMVEFE





Π

!CCESSORIES !CCESSORY HOLDER ASYMMETRIC DIFFUSERBLACK

0ROJECTOR #OLOR

!CCESSORY HOLDER ADJUSTABLE DOWSERSBLACK

#ODE - -

0ROJECTOR #OLOR !CCESSORY HOLDER CHROMATIClLTER 7ARMTONE

#ODE - -

- -

!CCESSORY HOLDER CHROMATIClLTER #OLDTONE

- -

!CCESSORY HOLDER ANTI DAZZLE LOUVRE

!CCESSORY HOLDER LENSFORELLITTICAL EMISSION

- -

56&ILTER

-

- -

!CCESSORYFOR CEILING INSTALLATION

, ,

!CCESSORY HOLDER )2lLTER

- -



7 7


7HITE

0ICTO4UNABLE7HITE

7EIGHT  KG

7 7

"EAM ª

&LUX LM

ª

LM

##4 + + + +

#OLOR

MANUALADJUSTMENT

$!,)

#ODE !$ !$ !$ !$

#ODE !$ !$ !$ !$

"LACK

)0 ª 7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

ª

ª











ª



+



Π

+

CCT+ !RTEMIDE47

     

 

LUMINOUSmUXLM





!RTEMIDE47



COLORRENDERINGINDEX2A

POWERSPECTRALDENSITY7NM

CCT+ 

















WAVELENGTHNM







   

 



 









CORRELATEDCOLORTEMPERATURE+















CORRELATEDCOLORTEMPERATURE+

?


?


6ECTOR #ARLOTTADE"EVILACQUA 


?


s,%$#/"

s4WOSIZESWITHFOURDIFFERENTBEAMANGLESEACH SPOT FLOOD WIDEFLOOD OBTAINEDBYMEANSOF REFRACTIVEORHYBRIDOPTICALUNITS

s 7 7  7 sLUMEN

s4WOTRACKADAPTEROPTIONSDNARROWSPOT VERSIONAVAILABLEWITHMAGNETICADAPTERONLY 

s-AC!DAM3$# s"EAM3&7&

s*UNCTIONARMINTEGRATEDINTHESPOTLIGHTSBODYTO KEEPTHEBARYCENTREALIGNEDWITHTHETRACKAND PREVENTANYIMBALANCEINPOSSIBLESUSPENSION VERSIONSOFTHEFRAME

s##4++ s#2)MIN s)0

ª

s4HEJUNCTIONALLOWSªROTATIONANDªTILTING FORMAXIMUMEMISSIONADJUSTMENTFREEDOM s6ERSIONWITH$ALIADJUSTABLEMAGNETICTRACK ADAPTERENSURINGUTMOSTFLEXIBILITYINTHE OPERATIONOFTHEINDIVIDUALLIGHTSOURCES

ª

s6ERSIONWITHCOMPACT CONDUCTORP N ADAPTER WITHHIDDEN,%$DRIVERANDNON DIMMERABLE PHASESELECTOR

33POT ª ª

&&LOOD ª ª

7&7IDEmOOD ª ª


?


$ALI 3%,6DIMMABLE $IMMINGCONDUCTORSONTRACKAREACCESSIBLETOFINGERS SOITIS MANDATORYTOCARRY3%,6VOLTAGES6$# $ALIISNOT3%,6 !RTEMIDEHASDEVELOPEDANINTERFACELOCATEDINTOTHECANOPY THATTRANSFORM$ALINOT3%,6 INTOAh3%,6$!,)v


?


6ECTOR-AGNETIC


6ECTOR

#2) 

$IMMABLE "EAM ª

&LUX LM

##4 +

#OLOR

+

 7

3ILVER

ª

LM

+

+

ª

LM

+

+

ª

LM

+

+

#ODE !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0

)0 ª

ª

ª





-AGNETIC6DC 7 7

"LACK

7HITE



'PSPQFSBUJPOPOMZVTFUIF"SUFNJEFQPXFSTVQQMZLJU

6ECTOR

7 7

#2) 

$IMMABLE "EAM ª

&LUX LM

##4 +

+

7

ª

LM

+

+

ª

LM

+

+

ª

LM

+

+

#OLOR

#ODE !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0 !0

)0 ª

ª

ª





-AGNETIC6DC



'PSPQFSBUJPOPOMZVTFUIF"SUFNJEFQPXFSTVQQMZLJU

?


6ECTORTRACK


6ECTOR

"EAM ª

&LUX LM

##4 +

#OLOR

+

 7

ª

LM

+

+

ª

LM

+

+

ª

LM

+

+

#ODE !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !.

)0 ª

ª

ª





#2) 

3ILVER

.ONDIMMABLE

4RACKSLIMADAPTER 7 7

"LACK

7HITE



7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

6ECTOR

.ONDIMMABLE

7 7

#2) 

"EAM ª

&LUX LM

##4 +

+

7

ª

LM

+

+

ª

LM

+

+

ª

LM

+

+

#OLOR

#ODE !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !. !.

)0 ª

ª

ª





4RACKSLIMADAPTER



7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

?


6ECTORRECESSED


6ECTORRECESSED

3ILVER

7HITE

4RIM #2) 

"EAM ª

&LUX LM

##4 +

#OLOR

+ LM

ª

7

+ +

LM

ª

+ +

LM

ª

+ +

#ODE !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2

)0 ª

ª

ª



7 7

 

Œ

Œ Œ

4RIMLESS #2) 

"EAM ª

&LUX LM

##4 + +

7

ª

LM

+ +

ª

LM

+ +

ª

LM

+ +

#OLOR

#ODE !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2 !2

)0 ª

ª

ª



7 7

 

Œ

$RIVER  7M! 7M!

6AC    

,MM 7MM     

(MM   

/PTICUNITS XXX X

3IZERECESSEDMM  

$!,) .ONDIMMABLE

Œ

#ODE $6 $6

?


6ECTORMAGNETICTRACK


?


-AGNETIC4RACKSUSPENSION CEILING

"LACK

7HITE

3ILVER

$IMMABLE

4RACK #OLOR

,ENGTH MM

MM

#ODE !1 !1 !1 !1 !1 !1  



 



$IMMABLE #OLOR

+

+

+

MM

+

+

#ODE !1 !1 !1 !1 !1 !1 !1 !1 !1 !1 !1 !1 !1 !1 !1 !1 !1 !1







##4 +

,ENGTH MM







4RACK DIRECTANDINDIRECTDIFFUSING

!CCESSORIES







#EILING3UPPLY+IT 76WITHAPOWER SUPPLYCABLEAND$!,)SIGNAL INPUT

+ITMECHANICALCONNECTION 4OCONNECTTWOMODULES WITHDIFFERENTPOWER



!1 !1 !1

3USPENSION+IT #ABLE CEILINGADJUSTMENT DEVICE

!1 !1 !1

#EILING+IT &ORTRACKMODULES DIFFUSING ELEMENTS CORNERS

!1

&EEDINGCORNER 4OCONNECTTWOMODULESON THESAMELEVEL



+ITELECTRICALANDMECHANICAL CONNECTION 4OCONNECTTWOMODULESONTHE SAMELEVEL



4RIMLESSKIT TORECECESSPOWERSUPPLY

#ODE !1

!1 !1 !1

!1





%NDCAP

#ODE !1 !1 !1











!1

 

#OLOR 0OWERSUPPLYENDCAP





!1 !1 !1


-AGNETIC4RACKRECESSED

4RIMLESS ,ENGTH MM

#ODE !1

MM

!1

!CCESSORIESTRIMLESS 



#ODE !1





!1

+ITELECTRICALANDMECHANI CALCONNECTION 4OCONNECTTWORECESSED MODULESONTHESAMELEVEL

!1

!1

+ITMECHANICALCONNECTION 4OCONNECTTWORECESSEDMODULES WITHDIFFERENTPOWER

!1



%NDCAP

4OUCHPANEL$!,)$!,)







&EEDINGCORNER 4OCONNECTTWOMODULESON THESAMELEVEL

4RIMLESS3UPPLY+IT 76WITHAPOWER SUPPLYCABLEAND$!,)SIGNAL INPUT





#ODE !1





0OWERSUPPLYENDCAP PCS

$6

?


/LMO 'IULIO)ACCHETTI 

3POT s,%$#/" s7 sLUMEN s-AC!DAM3$# s"EAMª ª ª

s6MAGNETICTRACK MAXMODULESAND WITHONEPOWERUNIT s4HEJUNCTIONALLOWSTOJOINTHEPARTSATª HORIZONTALLYORVERTICALLY s!DJUSTABLEMAGNETIC,%$PROJECTORS

s,+ H

s,INEARDIFFUSINGMMANDMMMAGNETIC MODULE

s##4++

s$!,)DIMMERABLEANDNON DIMMERABLEVERSION

s#2)MIN

s-ATERIALSBLACKANDWHITEPAINTEDALUMINIUM BODY

,INEARMODULE s,%$7 sMM MM sLUMEN s-AC!DAM3$# s##4++ s#2)MIN

&&LOOD ª ª

7&7IDEmOOD ª ª


?


?


/LMO

/LMOISASYSTEMBASEDONACOMBINATIONOFPLAIN OPTICALANDMECHANICALELEMENTSALINEARTRACK MODULE AMAGNETICJUNCTIONANDTHREELUMINOUS HEADSTHATOFFERDIFFERENTPERFORMANCES4HETRACKS STRUCTUREHASA# SECTIONTOENSUREAPPROPRIATE STRUCTURALPROPERTIESANDACCOMMODATEAN INNOVATIVEPRINTEDCIRCUITBOARDWITHINFORPOWER SUPPLY5NDERNEATHISATHINIRONEDGETHATSUPPORTS THELUMINOUSBODIESWITHAMAGNETICJOINT4HE SUSPENSIONTRACKSENSUREMAXIMUMMOUNTING mEXIBILITY INTHATTHEYCANBEEITHERCONNECTEDWITH EACHOTHERORINSTALLEDVERTICALLYORHORIZONTALLY ASARE CONNECTEDVIAANELEMENTTHATENSURESPOWERAND MECHANICALCONNECTION/LMOISTHEREFOREASYSTEM THATGROWSFREELYANDUNPREDICTABLYTOADJUSTITS GEOMETRY LOOK ANDLIGHTINGPERFORMANCETOSPACE

?


/LMO#OMPONENTS

*OINTED KITSUSPENSION )NTERMEDIATE CONNECTION


+ITSUSPENSION OPENCONlGURATION

4RACK

0#"

3POT LINEARMODULES

,INEARSUSPENSION

?


4RACK

"LACK

#OLOR

7EIGHT  KG

,ENGTH MM

7HITE

#ODE $')! $')!







)0

3POT

#2) 

"EAM ª

ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

#OLOR

#ODE $')"9 $')"9 $')"7 $')"7 $')"9 $')"9 $')"7 $')"7 $')"9 $')"9 $')"7 $')"7

)0  

7 7



,INEARMODULE

,ENGTH MM

#2) 

&LUX LM

##4 + +

7

MM

LM

+ +

#OLOR

#ODE $')#9 $')#9 $')#7 $')#7 $')$9 $')$9 $')$7 $')$7

)0 

7 7






"LACK

7HITE

!CCESSORIES #OLOR

#ODE $')( $')(

#OLOR

#ODE $')& $')&

#OLOR

#ODE $')%$ $')%$ $')% $')%

#OLOR

#ODE $')' $')'

3USPENSIONKIT







3USPENSIONJUNCTION

$!,)

.ONDIMMABLE



$RIVER

 













%LECTRICALCONNECTIONKIT

?


#AELUM %RNESTO'ISMONDI 

s#AELUMISDESIGNEDTOPROVIDEAVERSATILELIGHTING SOLUTIONFORTHERETAILSECTOR)TISAHIGHLYFLEXIBLE MULTI FUNCTIONALSYSTEM WITHAHIGHAESTHETIC ANDEXCEPTIONALLYHIGHPERFORMANCE

s,%$#/" s7 7 sLUMEN s-AC!DAM3$#

s#AELUMISAMODULARLIGHTINGSYSTEMWITHAN OPENRECESSEDPROFILECHANNEL WHICHINTEGRATES PERFECTLYWITHTHEARCHITECTURALDESIGN

s"EAM&7&8& s##4++

s/PTIONALCOVERSTODELINEATETHECHANNEL

s#2)TYP s)0

ª ª

ªª

ª

s4HESPOTLIGHTKITSAREAVAILABLEINSIZESŒ MMANDŒMMDIAMETEROFTHEOPTICAL ASSEMBLY ANDAREPROVIDEDWITHASWIVELARM WHICHALLOWSTOTALCONCEALMENTOFTHESPOTLIGHT OR IFOPEN ALLOWSTHEPARTIALORTOTALEXTRACTION OFTHESPOTLIGHTFROMTHECHANNEL s!DOUBLEHINGESYSTEMPROVIDESAHIGHDEGREE OFREGULATIONOFTHEBEAMDIRECTION s4HESPOTLIGHTSAREPROVIDEDWITHANELECTRONIC POWERSUPPLY s4HEEXTRUDEDELEMENTSAREINSTALLEDALONGBOTH EDGESOFTHECEILINGCUT CREATINGACHANNELTHAT CANBEFINISHEDWITHANOPTIONALTOPCOVER


&LOOD& ª ª

7IDEmOOD7& ª ª

%XTRAmOOD8& ª

?


#AELUMSTRUCTURALCOMPONENTS

#ARTERFORFALSECEILING

,INEARPROlLES MMLONG MMLONG MMLONG

,EFTINNERPROlLE &ORJOININGTWOLINEARPROlLES ONTHESAMELEVEL

2IGHTINNERPROlLE &ORJOININGTWOLINEARPROlLES ONTHESAMELEVEL

%NDCAP

(-).

(-).

3PECIALAPPLICATIONWITHOUT #ARTERAGAINSTTHEWALL

!LUMINIUMTRIMPROlLES

,INEARALUMINIUMTRIM PROlLES MMLONG MMLONG MMLONG MMLONG

#LOSINGENDCAPS

ªINNERCOUPLING &ORJOININGTWOTRIMPROlLES ONTHESAMELEVEL

ªOUTERCOUPLING &ORJOININGTWOTRIMPROlLES ONTHESAMELEVEL


#AELUMCONlGURATION

%NDCAP

,EFTINNERPROlLE

,INEARPROlLES ,INEARPROlLES

,INEARPROlLES

2IGHTINNERPROlLE

,INEARPROlLES

%NDCAP

ªINNERCOUPLING

,INEARALUMINIUMTRIMPROlLES

,INEARALUMINIUMTRIMPROlLES

#LOSINGENDCAPS

ªOUTERCOUPLING

,INEARALUMINIUMTRIMPROlLES

#LOSINGENDCAPS

?


#AELUMPROlLE

7HITE

"LACK

"LUE

'OLD

0ROlLE

MM

 KG

MM

 KG

#OLOR

#ODE - - - - - - - - - - - -





7EIGHT  KG



,ENGTH MM

ªPROlLE

RIGHT

7EIGHT  KG

#OLOR

 KG









#ODE - - - - - - - -



!NGLE LEFT



%NDCAP #OLOR

 

#ODE - - - -



7EIGHT  KG


#AELUMSTRUCTURALMODULES

7HITE

"LACK

,INEARSTRUCTURALMODULESETOF 7EIGHT  KG

MM

 KG

MM

 KG

MM

 KG

#OLOR

#ODE - - - - - - - -



,ENGTH MM



ªSTRUCTURALMODULE 7EIGHT  KG

OUTER

 KG

#OLOR





#ODE - - - -



!NGLE INNER





7EIGHT  KG



%NDCAPSSTRUCTURALMODULESETOF #OLOR

#ODE - -



     

#ONNECTORS +ITPOWERCONNECTORSPZ +ITSPACERSCONNECTORPZ

#ODE - -

?


#AELUM,%$

7 7

#2) 7EIGHT TYP  KG

7HITE

"EAM ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

#ODE - - - - - - - -

"LACK

)0 ª

ª ª

ª

ª



6AC(ZELECTRONICBALLASTINCLUDED







!CCESSOIRES #OLOR ,ENSFORELLITTICALEMISSION

#ODE -

#HROMATIClLTER

- - -

!NTI DAZZLELOUVRE

-

3OFTlLTER

-

)2lLTER

-

!DAPTERRING

-

3PACINGRING

-


7HITE

#AELUM,%$

7 #2) 7EIGHT 7 TYP  KG

"EAM ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

"LACK

#ODE - - - - - - - - )0 ª

ª ª

ª

ª



6AC(ZELECTRONICBALLASTINCLUDED







!CCESSOIRES #OLOR ,ENSFORELLIPTICALEMISSION

#ODE -

#HROMATIClLTER

- - -

!NTI DAZZLELOUVRE

-

3OFTlLTER

-

56lLTER

-

)2lLTER

-

3PACINGRING

-

?


!IRLITE #ARLOTTADE"EVILACQUA 0AOLADI!RIANELLO 

s5NIQUEMINIMALDIMENSIONSANDVIRTUALLY WEIGHTLESSMAXDIAMETERMMXHEIGHT MM7EIGHTOFTHEDIE CASTHEADISG

s,%$#/" s77 sLUMEN

s(IGHENERGYEFFICIENCYBETWEENAND LUMENSPERWATTINTHESPOTLIGHTVERSION

s-AC!DAM3$# s"EAM3&

s)NNOVATIVE,%$THERMALMANAGEMENTPASSIVE HEATDISSIPATIONSYSTEMBASEDONACHIMNEY EFFECT

s##4++ s#2)MIN s!IRLITE4UNABLE7HITE++ s#2)MIN

3POT3 ª ª

s4HIN EXTREMELYDEFINEDBEAMS THANKSTOTHE HYBRIDOPTICALSYSTEM s!VAILABLEACCESSORIESINCLUDEELLIPTICALREFRACTOR SOFTANDCOLOUREDFILTERS ASYMMETRICTUBE ANTI DAZZLELOUVRE ADJUSTABLEDOWSERS

s)0 ª

s)NADDITIONTOADJUSTABLEDOWSERSORASYMMETRIC TUBE ITISPOSSIBLETOINSTALLUPTOFILTERS REFRACTORSATTHESAMETIME ORONEFILTERPLUS THEANTI DAZZLELOUVRE

ª

&LOOD& ª ª

sINSTALLATIONOPTIONSWITHADAPTORFOR CIRCUIT TRACKCEILINGMOUNTEDVERSIONONLY WITH BASEPLATEFORSEMI RECESSEDMOUNTING OR SUSPENSION s3TANDARDVERSION$!,)DIMMABLE 4UNEABLE7HITEVERSION$!,) s-ATERIALSBODYINDIE CASTALUMINIUM REFLECTOR INOPTICALALUMINIUM LENSINPOLYCARBONATE s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICREGULATIONS


)NNOVATIVETHERMALMANAGEMENT 4HEDIE CASTALUMINIUMBODYHASADISTINCTIVE DESIGN INCREASINGTHERMALDISSIPATION !IRISCIRCULATEDTHROUGHOPENGAPS ALLOWING HEATTOTRAVELOUTOFTHEFITTING ENSURINGEFFICIENCY ANDLONGLIFEOFTHE,%$MODULE 4HISSOLUTIONENABLESTHEINTEGRATIONOFCONSIDERABLE POWERINTOANEXTREMELY COMPACTANDVIRTUALLYWEIGHTLESSDESIGN $IMENSIONSMAXDIAMETERMMXHEIGHTMM 7EIGHTDIE CASTHEADG

(YBRIDOPTICALSYSTEMLENSREmECTOR !IRLITEUSESHIGHPOWER,%$MODULESWITHIN AHYBRIDOPTICALSYSTEMLENSANDREFLECTOR PRODUCINGDEFINEDNARROWBEAMS 4HE!IRLITE@HYBRIDOPTICTECHNOLOGYPROVIDES INDIRECTLIGHTVIAACOMPACTREFLECTORADJUSTED ANDREDIRECTEDTHROUGHTHELENS !NINNOVATIVESOLUTIONALLOWINGCONSIDERABLY REDUCEDPRODUCTDIMENSIONS

POWERSPECTRALDENSITY7NM

,%$

!IRLITE4UNEABLE7HITEPROJECTORISEQUIPPED WITHANINNOVATIVE,%$!22!9OFVARYINGCOLOUR TEMPERATURES4HE,%$DIODESCOMBINETOACHIEVE EFFICIENT CHROMATICUNIFORMITY ALLOWINGUSERSTO ADJUSTTHECOLOURTEMPERATUREVIAANELECTRONIC CONTROLDEVICE

       



















WAVELENGTHNM

COLORRENDERINGINDEX2A

4HE!IRLITE4UNEABLE7HITEPROJECTORISAPERFECT FIXTUREFORTHERETAILENVIRONMENT4HEABILITYTO ADJUSTCOLOURTEMPERATURESFROM+TO+ ALLOWSFORVARIATIONSINLIGHTANDATMOSPHERE GIVING USERSTHEOPPORTUNITYTOHIGHLIGHTDIFFERENTCOLOURS WHILEGUARANTEEINGAHIGHCOLOURRENDERINGINDEXING #2)MIN WITHANEFFICIENTPRODUCTABOVE ,M7 ACROSSTHEENTIRESPECTRUM 4HEUNIQUEMIXOF,%$SHASBEENSELECTEDTOENSURE PERFECTPOSITIONINGOFTHISLIGHTSOURCEON THEBLACKBODYLOCUS









!IRLIGHT4UNEABLE7HITEPROJECTORISEQUIPPEDWITH CUSTOMELECTRONICS SPECIFICALLYDESIGNEDTOINTERFACE WITHDIFFERENTCONTROLDEVICESVIATHE$!,)PROTOCOL













CORRELATEDCOLORTEMPERATURE+

LUMINOUSmUXLM

       

+

+











CORRELATEDCOLORTEMPERATURE+

?


!IRLITE

"LACK

7HITE

4RACK 7 #2) 7EIGHT "EAM 7 MIN  KG ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

.ONDIMMABLE

$!,)

#ODE - - - - - - - -

#ODE - - - - - - - -

)0 ª

ª

ª





6AC(ZELECTRONICBALLASTINCLUDED



3EMI RECESSED 7 #2) 7EIGHT 7 MIN  KG

"EAM ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

.ONDIMMABLE

$!,)

#ODE - - - - - - - -

#ODE - - - - - - - -

)0 ª

Œ

ª

ª

∅

Œ





6AC(ZELECTRONICBALLASTINCLUDED



#EILING 7 #2) 7EIGHT 7 MIN  KG

"EAM ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

.ONDIMMABLE

$!,)

#ODE - - - - - - - -

#ODE - - - - - - - -

)0 ª

ª

ª









Œ



6AC(ZELECTRONICBALLASTINCLUDED

Œ


"LACK

7HITE

.ONDIMMABLE

4RACK #2) 7 7EIGHT 7 MIN  KG

"EAM ª

&LUX LM

##4 +

LM

+

#OLOR

#ODE - - - -

-AX 

)0 ª 6AC(ZELECTRONICBALLASTINCLUDED



Œ

!IRLITETUNABLEWHITE

4RACK

$!,)DIMMABLE

#2) 7EIGHT 7 7 MIN  KG

"EAM ª

&LUX LM

ª

LM

##4 + + + +

#OLOR

#ODE - - - -

)0 ª

ª  



ª



6AC(ZELECTRONICBALLASTINCLUDED



!CCESSORIES

Œ

!CCESSORIES #OLOR !CCESSORIESHOLDER

#ODE - -

#OLOR !NTI DAZZLELOUVRE

#ODE -

,ENSFORELLIPTICALEMISSION

-

!SYMMETRICLENSSHIELD

-

3OFTlLTER

-

!DJUSTABLEDOWSERS

-

#HROMATIClLTER

- - -

?


6ALEXTRA -ILAN)TALY !RCH3TUDIO#ERRI!SSOCIATI0HOTO&EDERICO6ILLA

?


%XTERNALTHREE CIRCUITTRACK

s4HREE CIRCUITTRACKFORSURFACEMOUNTING

7HITE

%XTERNALTHREE CIRCUITTRACK

s%XTRUDEDALUMINIUMPROFILEINWHITE BLACKORALUMINIUMFINISH

3TANDARD

$!,)

#ODE , , , , , , , , , , , ,

#ODE , , , , , , , , , , , ,

0OWERSUPPLYENDCAP %ARTHCONDUCTOR ONTHELEFT

, , ,

, , ,

0OWERSUPPLYENDCAP %ARTHCONDUCTOR ONTHERIGHT

, , ,

, , ,

#LOSUREENDCAP

, , ,

#LIPFORSTEELCABLES ORPENDANTCOUPLER

, , ,

3TEMŒMM,MM

, , , ,

#OLOR MM  KG

s3UPPLIEDINLENGTHSOFUPTOM CUTTOMEASURE sVERSIONSSTANDARDVERSIONWITHCONDUCTORS EARTH NEUTRAL PHASES EACHWITH AMM§SECTION OR$!,)VERSIONWITH ADDITIONALCONDUCTORSALLOWINGDIMMINGOF LIGHTSFITTEDWITH$!,)DIMMABLECONTROLGEAR

MM  KG



s-AXIMUMINTENSITYAACROSSTHECIRCUITS s4RACKISPRE CUTEVERYCMFORFIXING



MM  KG MM  KG

s7IDERANGEOFACCESSORIES POWERSUPPLY COMPONENTSANDELECTRICALANDMECHANICAL CONNECTORS

 

"LACK

 

  



 



3TEMŒMM,MM #ANBECUTTOMEASURE &ORUSEWITHPENDANTCLIP ORPENDANTCOUPLER ONREQUEST  3USPENSIONCABLES ,MM%UTRAC ,MM%UTRAC ,MM%UTRAC

, , ,

!LUMINIUM


*OINTS

3TANDARD

$!,)

#ODE , , ,

#ODE , , ,

,INEARJOINT

, , ,

, , ,

ªJOINT )NTERNAL EARTHCONDUCTOR

, , ,

, , ,

ªJOINT %XTERNAL EARTHCONDUCTOR

, , ,

, , ,

&LEXIBLEJOINT

, ,

, ,

 WAYJOINT %ARTHCONDUCTOR ONLEFT

, , ,

, , ,

 WAYJOINT %ARTHCONDUCTOR ONRIGHT

, , ,

, , ,

 WAYJOINT

, , ,

, , ,

#OLOR 2ECESSEDJOINT





      

  

 

NJO NBY 

 

   





   



!CCESSORIES

3TANDARD

$!,)

5NIVERSALADAPTER 6 !

#ODE , ,

#ODE , ,

!DAPTERWITHTERMINAL RESISTANCEFOR$-8SIGNAL

, ,

5NIVERSALHOOK -AXIMUMLOADKG

, ,

!CCESSORYFORCEILING INSTALLATION

, , ,

#OLOR





?


2ECESSEDTHREE CIRCUITTRACK

s4HREE CIRCUITTRACKFORRECESSMOUNTING

7HITE

2ECESSEDTHREE CIRCUITTRACK

s%XTRUDEDALUMINIUMPROFILEINWHITE BLACK ORALUMINIUMFINISH

sVERSIONSSTANDARDVERSIONWITH CONDUCTORS EARTH NEUTRAL PHASES EACHWITH AMMยงSECTION OR$!,)VERSIONWITH ADDITIONALCONDUCTORSALLOWINGDIMMING OFLIGHTSFITTEDWITH$!,)DIMMABLECONTROL GEAR

MM  KG

,

,

MM  KG

,

,

0OWERSUPPLYENDCAP %ARTHCONDUCTORONLEFT

,

,

0OWERSUPPLYENDCAP %ARTHCONDUCTORONRIGHT

,

,

2ECESSEDJOINT

,

,

#LOSUREENDCAP

,

#LIPFORSUSPENSIONCABLE PIECES

,



X, 

s-AXIMUMINTENSITYAACROSSTHE CIRCUITS s7IDERANGEOFACCESSORIES POWERSUPPLY COMPONENTSANDELECTRICALANDMECHANICAL CONNECTORS

$!,) #ODE ,

MM  KG

s3UPPLIEDINLENGTHSOFUPTOM CUTTO MEASURE

s4RACKISPRE CUTEVERYCMFORFIXING

3TANDARD #ODE ,

#OLOR

 



















!CCESSORIES

3TANDARD

$!,)

5NIVERSALADAPTER 6 !

#ODE , ,

#ODE , ,

-ULTI!DAPTER $-84ERMINATOR

, ,

5NIVERSALHOOK -AXIMUMLOADKG

, ,

#OLOR

ย



"LACK


)NSTALLATIONDIAGRAMS

,OADOFTRACKSWITHSPOTLIGHTSINRELATIONTOlXINGPOINTS INCLUDESTHEWEIGHTOFTHETRACK



KG

s4HREE CIRCUITTRACKFORPENDANT MOUNTINGWITHFIXINGPOINTS EVERYM #ANALSOBEUSEDFORRECESSED INSTALLATION 



KG

KG

%ARTHCONDUCTORDIAGRAMS









KG 

 



s4HREE CIRCUITTRACKFORCEILING MOUNTINGWITHFIXINGPOINTS EVERYM





%ARTH 

KG

3TANDARDTHREE CIRCUITTRACK   0OWERSUPPLYENDCAP EARTHCONDUCTORONLEFT  ªJOINT INTERNALEARTHCONDUCTOR

KG

KG

s4HREE CIRCUITTRACKFORRECESSED INSTALLATIONWITHFIXINGPOINTS EVERYMETRE #ANALSOBEUSEDFORPENDANT MOUNTING 



%LECTRICALDIAGRAMFORALTERNATINGCURRENT6 6

KG

KG

KG

  WAYJOINT EARTHCONDUCTOR ONLEFT   WAYJOINT  #LOSUREENDCAP

"

- -

KG

7

- 7 /

7

/

-AXIMUM7ALLOWED7MAX!TOTAL  4HELOADCANBEDISTRIBUTEDOVERTHECIRCUITSASREQUIRED 0ROTECTIONFUSEX! 0OWERSUPPLYCABLESECTIONMINXMM§ MAXXMM§

?


5NA0RO #ARLOTTADE"EVILACQUA  


?


5NA0RO s,%$ 7 ,%$7 ,%$7

s(IGH POWER,%$LIGHTINGAPPLIANCEMOUNTED ONATHINMM FLATALUMINIUMSHEETWITH IMPROVEDHEATDISSIPATION

sLUMEN

s4HEPATENTEDDISSIPATIONSYSTEMALLOWS TOTOUCHTHELIGHTINGBODYATALLTIMESFOR ADJUSTINGINSPACE THUSESTABLISHINGANEW RELATIONWITHLIGHT

s-AC!DAM3$#s"EAM83 & 7& s##4++ s#2) s,IFE,+ H s)0

s4HEHEADSCANACCOMMODATE  OR  ,%$CIRCUITS s!VAILABLEWITHTHREEDIFFERENTEMISSIONSª ª ª s4HEJUNCTIONVIRTUALLYALLOWSªROTATIONON TWOAXESANDªROTATIONONTHETHIRDONE

?


ª %XTRA3POT

ª ª

ª

TOPTRANSPARENT back

 

"EAM!NGLE

 

ª ª

ª

TOPSATIN back

 

ª &LOOD

83EXTRASPOTª

 

ª 7IDE&LOOD ª ª ª

TOPSATIN

back

 

 

&mOODª ª

7&WIDEmOODª ª

(EADANDHOLDERSCOLORVERSIONS 7HITE

7HITE

!LUMINIUM

"LACK


5NA0RO*OINT

4HEUTMOSTFLEXIBILITYOF5.!02/ISENSUREDBYA SMALLJUNCTIONTHATVIRTUALLYALLOWSªROTATION ONTWOAXESANDªROTATIONONTHETHIRDONE THUSPROVIDINGFULLFREEDOMOFMOVEMENTOF THETHREEHEADSINSPACE!DJUSTMENTISEASY BASEDONTHESTUDYOFHEATDISSIPATION THE SHEETCONSTITUTINGTHELAMPSBODYCANBEFREELY TOUCHEDFOREASYANDINTUITIVEADJUSTMENTOFTHE LIGHTBEAM &LEXIBILITYALSOHELPSENSUREPERFECTINTEGRATION WITHANYSPACEANDARCHITECTURALAPPROACH5NA 0ROCANBECONCEALEDANDEVENDISAPPEARSIN THEBUILT INVERSION ANUNOBTRUSIVEENTITYTHAT STRESSESTHEIMPORTANCEOFTHEEMITTEDLIGHT RATHERTHANOFTHEAPPLIANCE

X

Z

358°

X

Y

Z

X 358°

180°

Y

Z

Y

?


7HITE

!LUMINIUM

5NA0RO 5NA0RO7ALL#EILING "EAM ª

 

ª

 

ª

 ,%$ 7



 KG

ª

 

ª

 

ª

 ,%$ 7



 KG

ª

 

ª

 

ª



&LUX LM

##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

&LUX LM

##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

(EAD

(OLDER

#ODE $$"!7 $$"!7 $$"! $$"! $$"!7 $$"!7 $$"! $$"! $$"!7 $$"!7 $$"! $$"! $$""7 $$""7 $$"" $$"" $$""7 $$""7 $$"" $$"" $$""7 $$""7 $$"" $$"" $$"#7 $$"#7 $$"# $$"# $$"#7 $$"#7 $$"# $$"# $$"#7 $$"#7 $$"# $$"#

)0 



 

7EIGHT  KG

ª ª 



 

#2) 

ª ª 



 

7 ,%$  7

ª ª

5NA0RO3EMI RECESSED "EAM ª

 

ª

 

ª

 ,%$ 7



 KG

ª

 

ª

 

ª

 ,%$ 7



 KG

ª

 

ª

  

ª

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

(EAD

(OLDER

#ODE $$'!7 $$'!7 $$'! $$'! $$'!7 $$'!7 $$'! $$'! $$'!7 $$'!7 $$'! $$'! $$'"7 $$'"7 $$'" $$'" $$'"7 $$'"7 $$'" $$'" $$'"7 $$'"7 $$'" $$'" $$'#7 $$'#7 $$'# $$'# $$'#7 $$'#7 $$'# $$'# $$'#7 $$'#7 $$'# $$'#

)0 

’¢MM 











 

7EIGHT  KG



ª

ª



 









 

#2) 



ª

ª





  

7 ,%$  7











ª

ª


!LUMINIUM

5NA0RO

7HITE

5NA0RO4RACK

 

ª

 ,%$ 7



 KG

 

ª

 

ª

 ,%$ 7



 KG

 

ª

  

ª

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

LM

+

(OLDER

#ODE $$$!7 $$$!7 $$$! $$$! $$$!7 $$$!7 $$$! $$$! $$$!7 $$$!7 $$$! $$$! $$$"7 $$$"7 $$$" $$$" $$$"7 $$$"7 $$$" $$$" $$$"7 $$$"7 $$$" $$$" $$$#7 $$$#7 $$$# $$$# $$$#7 $$$#7 $$$# $$$# $$$#7 $$$#7 $$$# $$$#

)0  





 

ª 

ª 

 

ª 

ª 



ª

ª

Villa Regina Margherita, Bordighera | 2011

ª

LM

(EAD





##4 +





&LUX LM



"EAM ª



7EIGHT  KG



#2) 



7 ,%$  7

?


&LORIM3HOWROOM -ILAN\


?

Larte, Milan | 2013


#UBE #ARLOTTADE"EVILACQUA 0AOLADI!RIANELLO 

s,%$7 sXLUMEN s-AC!DAM3$# s"EAM3&7& s##4++ s#2)MIN s,IFE,+ H s)0

ª

s-INIMALDIMENSIONS MATERIALANDENERGY CONSUMPTIONMMXMMXMM s%FFECTIVEANDPRECISEACCENTLIGHTINGWITHONLY 7OFTOTALPOWERCONSUMPTION s-AXIMUMFLEXIBILITYROTATIONª TILTANGLE ª ª

s/PTIONOFINSTALLATIONINSIDE!LGORITMOMODULES s-ATERIALSBODYINANODISEDALUMINIUM TRANSLUCENTCOVERINPOLYCARBONATE s#OMPLIESWITH%. STANDARDANDOTHER SPECIFICSTANDARDS

sINSTALLATIONOPTIONSAVAILABLEWITHCONTROL GEARFORMOUNTINGWITHIN!LGORITMOPRODUCT RANGEORBASEPLATEFORSEMI RECESSED INSTALLATION

ª

3POT3 ª ª

&LOOD& ª ª

7IDEmOOD7& ª ª


ª

ª

ª

?


#UBESEMI RECESSED

!NODISEDALUMINIUM

.ONDIMMABLE #2) 7 7 MIN

7EIGHT  KG

"EAM ª ª ª

&LUX LM LM LM LM LM LM

##4 + + + + + +

#OLOR

#ODE - - - - - -

6AC(ZELECTRONICBALLASTINCLUDED 0ROTECTIONCLASS#LASS))3%,6)0

)0 ª ª

ª



∅





















+ITCONTAININGPROJECTORSFOR!LGORITMO3YSTEM

.ONDIMMABLE #2) 7EIGHT 7 X7 MIN  KG

"EAM ª

&LUX XLM XLM XLM XLM XLM XLM

ª ª

##4 + + + + + +

#OLOR

#ODE - - - - - -

)0 ª

&OR!LGORITMO PLEASESEEPAGE

ª

!LGORITMOSTRUCTURALMODULE









 



 

ª


!RTS&OODS 4RIENNALEDI-ILANO -ILANO)T  3TUDIO)TALO2OTA PH&EDERICO6ILLA

?


0!$0!$3QUARE ,EPOÃ’MEDELANGLEDROIT #ARLOTTADE"EVILACQUA 0!$ 0!$3QUARE

s,%$ 7 sLUMEN s-AC!DAM3$# s"EAM3&7& s##4++ s#2)TYP s,IFE,+ H s)0

ª ª

ª

s#OMPACTDIMENSIONS 0!$ MMXMMXMMn0!$ 3QUARE MMXMMXMM s5LTRA FLATPOWERSOURCEMMHEIGHT HIGH EFFICIENCYANDEXTRAORDINARYVERSATILEPOWER INPUTFROMTOV AND(Z s/PTIMIZEDTHERMALMANAGEMENTPASSIVE COOLINGSYSTEMBASEDONTHEEXTENSIONOF ALUMINIUMSURFACEANDPARTITIONOFTHE,%$ SOURCES0!$,%$ 70!$315!2% ,%$ 7  sSIZESANDPOWER0!$,%$  7TOTAL LOAD MMXMMXMM AND0!$3QUARE,%$ 7TOTALLOAD

MMXMMXMM 

sINSTALLATIONOPTIONSWITHADAPTORFOR CIRCUIT TRACK WITHGEARPLATEFORMOUNTINGWITHIN !LGORITMOPRODUCTRANGE WALLCEILINGMOUNTED VERSION ORBASEPLATEFORSEMI RECESSED MOUNTING s7ALLCEILINGANDSEMI RECESSEDVERSIONSAVAILABLE WITH3WITCH$IM s-ATERIALSBODYINEXTRUDEDALUMINIUM TRANSPARENTCOVERINPOLYCARBONATE TRANSLUCENT COVERINPOLYCARBONATE JOINTINDIE CAST ALUMINIUM s#OMPLIESWITH%. STANDARDANDOTHER SPECIFICSTANDARDS


3POT3 ª ª

&LOOD& ª ª

7IDEmOOD7& ª ª

?


4HERMALMANAGEMENT 4HEUNIFORMFRAGMENTATIONOF,%$SOURCESPROVIDESOPTIMIZEDHEATDISSIPATION  ª#

 ª#


*OINT %XCELLENTmEXIBILITYOFLIGHTADJUSTMENT

358° ª

ª 358° ª

x

x

y z

x

y z

y z

?


0!$TRACK

'LOSSANODISED

ª



#OLOR

#ODE - - - - - -



##4 + + + + + +



ª

&LUX LM LM LM LM LM LM



#2) 7EIGHT "EAM 7  7 TYP  KG ª



.ONDIMMABLE





)0 ª

6AC(ZELECTRONICBALLASTINCLUDED

ª ª

ª

0!$KITFOR!LGORITMO3YSTEM

.ONDIMMABLE

ª

#ODE - - - - - -





#OLOR



##4 + + + + + +



ª

&LUX LM LM LM LM LM LM



#2) 7EIGHT "EAM 7  7 TYP  KG ª





6AC(ZELECTRONICBALLASTINCLUDED

)0 ª

&OR!LGORITMO PLEASESEEPAGE

ª ª

ª

0!$CEILING

ª

#ODE - - - - - -



#OLOR



##4 + + + + + +



ª

&LUX LM LM LM LM LM LM



#2) 7EIGHT "EAM 7  7 TYP  KG ª

Π

3WITCH$IM





)0 ª 6AC(ZELECTRONICBALLASTINCLUDED

ª ª

ª

0!$SEMIRECESSED

ª

#OLOR

#ODE - - - - - -





##4 + + + + + +



ª

&LUX LM LM LM LM LM LM



#2) 7EIGHT "EAM 7  7 TYP  KG ª

Œ



3WITCH$IM



)0 ª 6AC(ZELECTRONICBALLASTINCLUDED

ª ª

ª


0!$3QUARETRACK

'LOSSANODISED

ª ª

#OLOR

#ODE - - - - - -



LM LM LM LM LM

##4 + + + + + +



&LUX LM



"EAM ª



7EIGHT #2) 7 7 TYP  KG



.ONDIMMABLE





)0 ª

6AC(ZELECTRONICBALLASTINCLUDED

ª ª

ª

0!$3QUAREKITFOR!LGORITMO3YSTEM

7EIGHT #2) TYP  KG

"EAM ª ª ª

&LUX LM

LM LM LM LM LM

##4 + + + + + +

#OLOR

#ODE - - - - - -



7 7





.ONDIMMABLE





)0 ª

6AC(ZELECTRONICBALLASTINCLUDED &OR!LGORITMO PLEASESEEPAGE

ª ª

ª

0!$3QUARECEILING

.ONDIMMABLE

ª

##4 + + + + + +

#OLOR

#ODE - - - - - -



ª

&LUX LM LM LM LM LM LM

 

"EAM ª



7EIGHT #2) 7 7 TYP  KG

Œ





)0 ª

ª ª

ª

0!$3QUARESEMI RECESSED

Œ

ª ª

&LUX LM

LM LM LM LM LM

##4 + + + + + +

#OLOR

#ODE - - - - - -



"EAM ª



7EIGHT #2) 7 7 TYP  KG



.ONDIMMABLE





)0 ª 6AC(ZELECTRONICBALLASTINCLUDED

ª ª

ª

?


?


3/, -ARCO:ANUSO*R #HRISTOPHE-ATHIEU 

s,%$7 sLUMEN s"EAM&7&8&

s6ARYINGCOMPOSITIONSOFTHEOPTICALUNITRESULT INTOTHREEEMISSIONSªªª s.OSHADOWSANDHIGH DEFINITIONPROJECTION

s#2)

s4HESPOTVERSIONALLOWSBEAMADJUSTMENTBYª ONTHEHORIZONTALAXISANDBYªONTHEVERTICAL ONE

s,IFE,+ H

s!LUMINIUMBODY

s)0

s0--!LENS

s##4+


?


3OLOPTICS

&LOODANDWIDEmOODBEAM

%XTRAmOODBEAM

#ONDENSERLENS

/LOGRAPHIClLTER

0ROJECTORLENS

&LOOD& ª ª

7IDEmOOD7& ª ª

%XTRAmOOD8& ª


3OLSUSPENSION

7 7

#2) 

##4 +

'LOSSANODISED

7EIGHT  KG

&LUX LM LM LM

"EAM ª ª ª

#OLOR

#ODE $-:!! $-:!! $-:!!

)0



MAX



Œ

3OLSPOT Œ

#2) 

##4 +

7EIGHT  KG

&LUX LM LM LM

"EAM ª ª ª

#OLOR

#ODE $-:#! $-:#! $-:#!

)0 Œ



7 7

Œ

?


$OWNLIGHTING

          

3HARP %VERYTHING 0!$ 5NA0RO 5NA0RO ,UCERI *AVA 0ARABOLA 2ASTAF :ENO50 :ENO5P&ROSTED

?


3(!20 #ARLOTTADE"EVILACQUA 

0ATENT0ENDING.ª-)


?


3HARP

s,%$7 sLUMEN s"EAMªªª s##4+++ s#2)MIN s)0

s!PATENTEDHIGH EFFICIENCYOPTICALSYSTEM COMBININGAPOLYNOMIALOPTICALUNITWITH GEOMETRICSCREENINGOFTHEBEAMSVIEWING ANGLE s(IGHLYUNIFORMLIGHTINGANDFULLEMISSION CONTROL s4OTALABSENCEOFANYLIGHTINGDEFECTS SUCHAS SPOTSORMULTIPLESHADOWS s2ECESSDEPTHMM s3UITEDFORTOMMCEILINGS s!VAILABLEINTHETRIM TRIMLESSAND3-$VERSIONS


?


3HARP

4RIMLESS

4RIM

X

X

X

X

X

X


?


3HARP

3HARP4RIM

-INIMUMDISTANCEFROMTHE WALL

60

3HARP4RIMLESS

-INIMUMDISTANCEBETWEENTHEDEVICES

120

120


?


3HARPTRIM#OMPONENTS

/PTICUNIT

3CREEN

3CREEN

$RIVER  7M!  7M! 7M! 7M! 7M!  7M! 7M!

6AC              

,MM 7MM               

(MM         

/PTICUNITS XX X X XX XX XXXX XX

40 40

148 24

8

74

3IZERECESSEDMM       

40

8

24

8

37

#ODE !& !& !& !& !& !&

24

#OLOR

.ONDIMMABLE .ONDIMMABLE .ONDIMMABLE .ONDIMMABLE .ONDIMMABLE $!,) $!,)

#ODE $6 $6 $6 $6 $6 $6 $6


7HITE

3HARP4RIM

3ILVER

4RIM

ª

LM

+ +

OPTICUNITS

 7 

ª

LM

+ +

ª

LM

+ +

ª

LM

+ +

OPTICUNITS

7 

ª

LM

+ +

ª

LM

+

LM

+ +

ª

LM

+

LM

+ +

LM OPTICUNITS

7 

ª

+

LM + LM +

ª

LM + LM +

ª

LM + LM +

OPTICUNITS

7 

ª

LM + LM +

ª

LM + LM +

ª

LM + LM +

OPTICUNITS

7 

ª

LM + LM +

ª

LM + LM +

ª

LM + LM +

55

46x45 45 55

+

53

55

90

)0

46x80 45 55

+

55

55

164 46x155

45 55

LM

45

55

312 46x302

45 55

+

#ODE !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !&

55

460 46x450

45 55

#OLOR

55,5

##4 +

55,5

ª

&LUX LM

55,5

"EAM ª

55,5

#2) 

55,5

7 7

55,5

OPTICUNIT

55

608 46x600

$RIVERM!3%,6ANDSCREENSUPPLIEDSEPARATELY

?


3HARPTRIMLESS#OMPONENTS

&RAMEFORRECESSED INSTALLATION

/PTICUNIT

3CREEN

3CREEN

8

40

24

37

74 40

8

#ODE !& !& !& !& !& !&

24

#OLOR 8

$RIVER  7M!  7M! 7M! 7M! 7M!  7M! 7M!

6AC              

,MM 7MM               

(MM         

/PTICUNITS XX X X XX XX XXXX XX

3IZERECESSEDMM       

40

24

148

.ONDIMMABLE .ONDIMMABLE .ONDIMMABLE .ONDIMMABLE .ONDIMMABLE $!,) $!,)

#ODE $6 $6 $6 $6 $6 $6 $6


3HARP4RIMLESS

7HITE

OPTICUNITS

7



ª

LM

ª

LM

ª

LM

ª

LM

ª

LM LM

ª

LM LM

ª ª ª

OPTICUNITS

7



ª ª ª

OPTICUNITS

7



ª ª ª

LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM

38

43 43

LM

34

38 34,5 38

ª

34,5

71

38 34,5 43

LM

#ODE !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !&

)0 38

ª

##4 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +

38

145

34,5 43



&LUX LM

38

7



"EAM ª

293

38 34,5 43

OPTICUNITS

 7

#2) 

38

OPTICUNITS

7 7

38

441

34,5 43

OPTICUNIT

4RIMLESS

38

,%$OPTICUNIT

"LACK

38

589

31

53,5

83

$RIVERM!3%,6ANDSCREENSUPPLIEDSEPARATELY

83

40

&RAMEFORRECESSEDINSTALLATION

83

77

31

53,5

83

55x80

83

151

31

53,5

83

55x155

83

299

31

53,5

83

55x302

83

447

53,5

83

55x450

31

8 8 8 8 8 8

31

53,5

#ODE !& !& !& !& !& !&

83

55x45

83

595 55x600

?


3HARP3-$


?


7HITE

3HARP3-$

##4 +

+

ª

LM

+

+

ª

LM

+

+

OPTICUNITS

 7 

ª

LM

+

+

ª

LM

+

+

ª

LM

+

+

OPTICUNITS

7 

ª

LM

+

+

+

ª

LM

+

+

+

ª

LM

+

+

+

$RIVERM!3%,6SUPPLIEDSEPARATELY

#OLOR

#ODE !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !&

45

&LUX LM

41

45

)0

45

"EAM ª

78

45

45

#2) 

90

7 7

90

OPTICUNIT

90

,%$OPTICUNIT

45

152

"LACK

3ILVER


7HITE

3HARP3-$

"LACK

3ILVER

ª

LM +

LM +

ª

LM +

LM +

7 

ª

LM +

OPTICUNITS LM +

ª

LM +

LM +

ª

LM +

LM +

7

ª

LM +

OPTICUNITS LM +

ª

LM +

LM +

ª

LM +

LM +

$RIVER  7M!  7M!  7M!

6AC      

,MM 7MM      

(MM    

#ODE !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !& !&

/PTICUNITS XX X XXX

3IZERECESSEDMM   

45

LM +

#OLOR

300

45

45

&LUX ##4 LM +

45

448

45

"EAM ª

90

#2) 7 7 

90

OPTICUNITS

90

,%$OPTICUNIT

45

.ONDIMMABLE .ONDIMMABLE $!,)

596

#ODE $6 $6 $6

?


%VERYTHING %RNESTO'ISMONDI 

%VERYTHING ROUND SQUARE

s,%$#/" s 7 77 7 sLUMEN s-AC!DAM3$# s"EAM3&7& s##4++ s#2)MIN MIN s,IFE,+ H s)0)0

ª

ª

%VERYTHING ROUND SQUARE

sDIMENSIONSMM MM MM MM MM s$IFFERENTOPTIONSAVAILABLEFIXEDORADJUSTABLE EXCLUDING%VERYTHING ROUNDORSQUARE TRIM ORTRIMLESS s,%$VERSIONSUSEANOPTICALSYSTEMBASEDONA HYBRIDTECHNOLOGYLENSANDREFLECTOR PRODUCING DEFINEDBEAMSWITHHIGH POWER,%$S s4HEEXTRUDEDALUMINIUMHEATSINKGUARANTEES GREATTHERMALMANAGEMENT LONGLIFEANDHIGH EFFICIENCY WHILEPROVIDINGMAXIMUMLUMINOUS FLUX

%VERYTHING ROUND SQUARE

s!DJUSTABLEVERSIONSEXCLUDING%VERYTHINGOPTION AREEQUIPPEDWITHABLOCKINGSYSTEMTOGUARANTEE PERFECTFRAMING s2OTATIONUPTOª BEAMANGLE ª ª s3EPARATEELECTRONICDRIVERNON DIMMABLEOR$!,) DIMMABLEOPTIONSFOR,%$PRODUCTS s#OMPLIANTWITHSTANDARD%. ANDOTHER SPECIFICREGULATIONS


%VERYTHING ROUND SQUARE

%VERYTHING ROUND SQUARE

?


%VERYTHING ROUND SQUARE

%VERYTHING ROUND SQUARE

%VERYTHING ROUND SQUARE


%VERYTHING ROUND SQUARE

3POT3 ª ª

%VERYTHING ROUND SQUARE

&LOOD& ª ª

7IDEmOOD7& ª ª

?


%VERYTHING

7HITE

"LACK

3ILVER

2OUND 7EIGHT "EAM  KG ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

#OLOR

+

#ODE .,9 .,9 .,9 .,+ .,+ .,+ .,9 .,9 .,9 .,+ .,+ .,+

)0 Â’MM



7 #2)  7 

$RIVERM!3%,6SUPPLIEDSEPARATELY

Â’

3QUARE 7EIGHT "EAM  KG ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

#OLOR

+

#ODE .,9 .,9 .,9 .,+ .,+ .,+ .,9 .,9 .,9 .,+ .,+ .,+

)0

$RIVERM!3%,6SUPPLIEDSEPARATELY



$RIVER 6AC ,MM 7MM (MM CC7M!SLIM      MAX CC7M!      MAX

.ONDIMMABLE 053( 6DIMMABLE

#ODE ., -

XMM 

7 #2)  7 


%VERYTHING

7HITE

LM +

ª

LM +

LM +

 7   KG ª

#ODE .,9 .,9 .,9 .,+ .,+ .,+ .,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+ .,9 .,9 .,9 .,+ .,+ .,+

LM +

LM +

ª

#ODE .,9 .,9 .,9 .,+ .,+ .,+ .,9 .,9 .,9 .,+ .,+ .,+

LM +

LM +

)0 Â’MM

 7

 7

$RIVERM!3%,6SUPPLIEDSEPARATELY

Œ



#OLOR

!DJUSTABLE



7 #2) 7EIGHT "EAM &LUX ##4 LM +  7   KG ª

&IXED

3ILVER



2OUND

"LACK

Œ

Â’

ª

#OLOR

LM +

LM +

LM +

 7   KG ª

#ODE .,9 .,9 .,9 .,+ .,+ .,+ .,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+ .,9 .,9 .,9 .,+ .,+ .,+

LM +

LM +

ª

#ODE .,9 .,9 .,9 .,+ .,+ .,+ .,9 .,9 .,9 .,+ .,+ .,+

LM +

LM +

)0

 7

 7





$RIVERM!3%,6SUPPLIEDSEPARATELY

$RIVER CC7M! CC7M! CC7M! CC7M! CC7M!

6AC          

,MM     

7MM (MM          

XMM



ª

!DJUSTABLE



#2) 7EIGHT "EAM &LUX 7 ##4  7   KG ª LM +

&IXED



3QUARE



ª

MAX MAX MAX MAX MAX

%VERYTHING  7 %VERYTHING  7 %VERYTHING  7 %VERYTHING  7 %VERYTHING  7

.ONDIMMABLE .ONDIMMABLE 053( 6DIMMABLE 053( 6DIMMABLE $!,)DIMMABLE

#ODE - ., - - -

?


4RIM 7 #2) 7EIGHT 7   KG

"EAM &LUX ª LM

4RIM $EmECTOR ##4 +

LM +

ª

LM +

LM +

ª

LM

+

LM +

&IXED

!DJUSTABLE

#ODE - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

#ODE - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

&IXED

!DJUSTABLE

#ODE - - - - - - - - - - - - - - - - - -

#ODE - - - - - - - - - - - - - - - - - -

"LACK

3ILVER

0OLISHEDMETAL

)0

)0 ª

Â’MM



7HITE



%VERYTHINGROUND

Œ



Œ

Œ



Œ

ª

$RIVERM!3%,6SUPPLIEDSEPARATELY

"EAM &LUX ª LM

##4 +

LM +

ª

LM +

LM +

ª

LM

+

LM +

$EmECTOR

)0

)0 ª

Â’MM



7 #2) 7EIGHT 7   KG



4RIMLESS

$RIVERM!3%,6SUPPLIEDSEPARATELY

Œ

$RIVER CC7M! CC7M!

6AC    

,MM 7MM (MM  MAX.ONDIMMABLE  MAX$!,)053( 6DIMMABLE

Œ

ª

#ODE - -


4RIM #2) 7 7 

7EIGHT  KG

4RIM $EmECTOR "EAM &LUX ##4 ª LM +

LM +

ª

LM +

LM +

ª

LM +

LM +

&IXED

!DJUSTABLE

#ODE - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

#ODE - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

&IXED

!DJUSTABLE

#ODE - - - - - - - - - - - - - - - - - -

#ODE - - - - - - - - - - - - - - - - - -

"LACK

3ILVER

0OLISHEDMETAL

)0

)0 ª

XMM

X



7HITE



%VERYTHINGSQUARE



X

X



X

ª

$RIVERM!3%,6SUPPLIEDSEPARATELY

##4 +

LM +

ª

LM +

LM +

ª

LM

+

LM +

$EmECTOR

)0

)0 ª

XMM



#2) 7EIGHT "EAM &LUX 7 7   KG ª LM



4RIMLESS

$RIVERM!3%,6SUPPLIEDSEPARATELY

X

$RIVER CC7M! CC7M!

6AC    

,MM 7MM (MM  MAX.ONDIMMABLE  MAX$!,)053( 6DIMMABLE

X

ª

#ODE - -

?


?


2OUND 7 7

#2) 7EIGHT "EAM &LUX LM   KG ª

ª

ª

4RIM ##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

$EmECTOR

&IXED

!DJUSTABLE

#ODE - - - - - - - - - - - - - - - - - - - -

#ODE - - - - - - - - - - - - - - - - - - - -

"LACK

3ILVER

0OLISHEDMETAL

)0

)0 ª

Â’MM



7HITE



%VERYTHINGTRIM

$RIVERM!3%,6SUPPLIEDSEPARATELY Œ

Œ





Œ

Œ

ª

#2) 7EIGHT "EAM &LUX   KG ª LM

ª

ª

4RIM ##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

$EmECTOR

!DJUSTABLE

#ODE - - - - - - - - - - - - - - - - - - - -

#ODE - - - - - - - - - - - - - - - - - - - -

)0

)0 ª

XMM



7 7

&IXED



3QUARE

ª

$RIVERM!3%,6SUPPLIEDSEPARATELY

X



X



 X 

X

ª

$RIVER CC7M! CC7M!

6AC    

,MM  

7MM (MM    

MAX MAX

.ONDIMMABLE $!,)053( 6DIMMABLE

#ODE - -

Xª


%VERYTHING+ITTRIMLESS

"LACK

2OUNDOPTICALUNITTRIMLESS 7 7

#2) 7EIGHT   KG

"EAM &LUX ª LM

##4 +

LM

+

LM

+

LM

+

LM LM

+ +

ª

ª

$EmECTOR

&IXED

!DJUSTABLE

#ODE - - - - - - - - - -

#ODE - - - - - - - - - -

0OLISHEDMETAL

)0

)0 ª

Â’MM

$RIVERM!3%,6SUPPLIEDSEPARATELY





&ITTINGTOBECOMPLETEDWITHINSTALLATIONFRAMEFORRECESSINGINTOCEILING

&RAME #ODE -

2OUNDFRAME FORRECESSEDINSTALLATION Â’MM

Œ

Œ

ª

3QUAREOPTICALUNITTRIMLESS 7 7

#2) 7EIGHT   KG

"EAM &LUX ª LM

##4 +

LM

+

LM

+

LM

+

LM LM

+ +

ª

ª

$EmECTOR

&IXED

!DJUSTABLE

#ODE - - - - - - - - - -

#ODE - - - - - - - - - -

)0

ª

)0 ª

XMM

$RIVERM!3%,6SUPPLIEDSEPARATELY &ITTINGTOBECOMPLETEDWITHINSTALLATIONFRAMEFORRECESSINGINTOCEILING



#ODE -

3QUAREFRAME FORRECESSEDINSTALLATION



&RAME

XMM

X

X

ª

$RIVER CC7M! CC7M!

6AC    

,MM  

7MM (MM    

MAX MAX

.ONDIMMABLE $!,)053( 6DIMMABLE

Xª

#ODE - -

?


7HITE

2OUND 4RIM #2) 7EIGHT "EAM &LUX 7 ##4  7   KG ª LM +

$EmECTOR

LM +

ª

LM +

LM +

ª

LM + LM +

&IXED

!DJUSTABLE

#ODE - - - - - - - - - - - - - - - - - - - -

#ODE - - - - - - - - - - - - - - - - - - - -

"LACK

3ILVER

0OLISHEDMETAL

)0

)0 ª

Â’MM

 

%VERYTHINGTRIM

$RIVERM!3%,6SUPPLIEDSEPARATELY

Œ

Œ

ª

4RIM #2) 7EIGHT "EAM &LUX 7 ##4  7   KG ª LM +

$EmECTOR

LM +

ª

LM +

LM +

ª

LM + LM +

&IXED

!DJUSTABLE

#ODE - - - - - - - - - - - - - - - - - - - -

#ODE - - - - - - - - - - - - - - - - - - - -

)0

)0 ª

XMM

 

3QUARE

ª

$RIVERM!3%,6SUPPLIEDSEPARATELY

Œ

Œ

ª

$RIVER CC7M! CC7M! CC7M!

6AC      

,MM 7MM (MM         

MAX MAX MAX

.ONDIMMABLE $!,)DIMMABLE 053( 6DIMMABLE

#ODE - - -

Xª


%VERYTHING+ITTRIMLESS

"LACK

2OUNDOPTICALUNITTRIMLESS #2) 7  7 

7EIGHT "EAM &LUX LM  KG ª

##4 +

LM

+

LM

+

LM

+

LM LM

+ +

ª

ª

$EmECTOR

&IXED

!DJUSTABLE

#ODE - - - - - - - - - -

#ODE - - - - - - - - - -

0OLISHEDMETAL

)0

)0 ª

Â’MM

$RIVERM!3%,6SUPPLIEDSEPARATELY &ITTINGTOBECOMPLETEDWITHINSTALLATIONFRAMEFORRECESSINGINTOCEILING

 

&RAME #ODE -

2OUNDFRAME FORRECESSEDINSTALLATION

Â’MM

Œ

Œ

ª

3QUAREOPTICALUNITTRIMLESS 7 #2)  7 

7EIGHT "EAM &LUX LM  KG ª

##4 +

LM

+

LM

+

LM

+

LM LM

+ +

ª

ª

$EmECTOR

&IXED

!DJUSTABLE

#ODE - - - - - - - - - -

#ODE - - - - - - - - - -

)0

ª

)0 ª

XMM

$RIVERM!3%,6SUPPLIEDSEPARATELY &ITTINGTOBECOMPLETEDWITHINSTALLATIONFRAMEFORRECESSINGINTOCEILING

&RAME  

#ODE -

3QUAREFRAME FORRECESSEDINSTALLATION XMM

Œ

$RIVER CC7M! CC7M! CC7M!

6AC      

,MM 7MM (MM         

MAX MAX MAX

.ONDIMMABLE $!,)DIMMABLE 053( 6DIMMABLE

#ODE - - -

Œ

ª

Xª

?


0!$ #ARLOTTADE"EVILACQUA 

s,%$ 7 s LUMEN

s%FFICIENT CLEARACCENTLIGHTING FIXEDANDADJUSTABLE

s-AC!DAM3$#

s%XCELLENTLIGHTINGEFFICIENCYLM7

s"EAM3&7&

s(IGHADJUSTABILITYªROTATION ª ªTILTANGLE

s##4++ s#2)MIN s,IFE,+ H s)0)0

ª

s&IXEDVERSIONAVAILABLEAS)0 s%ASYINSTALLATIONOFLIGHTMODULES NOTOOLSREQUIRED s,IGHTINGUNITSAVAILABLEINFINISHES GLOSSALUMINIUM PAINTEDWHITE PAINTEDBLACK

ª

s3TRUCTURALELEMENTSOFRECESSED MOUNTEDVERSION AVAILABLEINSIZES FORUSEWITH  ANDX MODULESCOMPATIBLEFINISHESPOLISHED ALUMINIUM WHITE ANDBLACK 

s(OUSINGOFCEILING MOUNTEDVERSIONAVAILABLE INSIZES  LIGHTINGUNITS AND COMPATIBLEFINISHESPOLISHEDALUMINIUM WHITE ANDBLACK  s2ECESSED MOUNTEDVERSIONAVAILABLEASTRIMLESS ORFRAMED s-ATERIALSBODYINANODISEDEXTRUDED ALUMINIUM DIFFUSERINOPALPOLYCARBONATE s#OMPLIESWITHSTANDARD%.  ANDOTHERSPECIFICSTANDARDS


3SPOT ª ª

&mOOD ª ª

7&WIDEmOOD ª ª

?


0!$


?


0!$2ECESSED

7HITE

&RAMEFORRECESSEDINSTALLATION #OLOR FOROPTICUNIT

X

FOROPTICUNITS

X

FOROPTICUNITS

X

FOROPTICUNITS

X

4RIM

4RIMLESS

#ODE - - - - - - - - - - - -

#ODE - -

"LACK

'LOSSANODISED

- - - - - -

)NDEPENDENTPOWERSUPPLYANDOPTICUNITS TOBEORDEREDSEPARATELY 0LASTERBOARDTHICKNESSFROMMMTOMM



 

0!$#EILING

&RAMEFORCEILINGVERSION #OLOR XXH

FOROPTICSUNITS

7

XXH

FOROPTICSUNITS

7

XXH

/PTICUNITS TOBEORDEREDSEPARATELY













6AC(ZELECTRONICBALLASTINCLUDED

  

  

 



7

 

  

FOROPTICUNIT

 



 









 













4RIMLESS



4RIM

#ODE - - - - - - - - -


0!$,%$WITHlXEDLENSES

7HITE

"LACK

'LOSSANODISED

7,%$  7

#2) 

7EIGHT "EAM  KG ª

ª

ª

&LUX LM

,IGHTUNIT ##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

#ODE - - - - - - - - - - - - - - - - - -



,%$OPTICUNIT



)0 ª

)0

0!$,%$WITHADJUSTABLELENSES

7EIGHT "EAM  KG ª

ª

ª

&LUX LM

,IGHTUNIT ##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

&LUX LM

,IGHTUNIT ##4 +

LM

+

#ODE - - - - - - - - - - - - - - - - - -



#2) 



7,%$  7

  

,%$OPTICUNIT

  

)0 ª

ª

ª

0!$lXEDDIFFUSER

#ODE - - - - - -



7EIGHT "EAM  KG ª

  

,%$OPTICUNIT 7,%$ #2)   7



)0 ª

$RIVER 7M!3%,6 7M!3%,6 7M!3%,6 7M!3%,6 7M!3%,6 7M!3%,6

6AC            

OPITCUNIT  .ONDIMMABLE X .ONDIMMABLE  .ONDIMMABLE  $!,)  $!,) X $!,)

)0

#ODE - - - - - -

?


0RIVATERESIDENCE -ILAN)TALY


?


5NA0RO #ARLOTTADE"EVILACQUA  


 ?


5NA0RO

s,%$7X,%$7

s(IGH POWER,%$LIGHTINGAPPLIANCEMOUNTED ONATHINMM FLATALUMINIUMSHEETWITH IMPROVEDHEATDISSIPATION

sLUMEN s-AC!DAM3$#-

s%ACHHEADACCOMMODATES ,%$CIRCUITS

s"EAM83 & 7& s##4++

s!VAILABLEWITHTHREEDIFFERENTEMISSIONSª ª ª

s#2)

s4HEDIFFERENTVERSIONSFEATUREORHEADS

s,IFE,+ H

s4HEJUNCTIONALLOWSªROTATIONANDª TILTINGINALLDIRECTIONS

s)0)0 s5NA0RO!$*RECESSED 5NA0RO3-$

s4HEADDITIONOFACLEARCAPWITHMAGNETIC JOINTALLOWSTOREACHPROTECTIONRATING)0

?


"EAM!NGLE .

ª %XTRA3POT

358° 6° 6°

250

TOPTRANSPARENT

.

back

.

150

.

.

ª &LOOD

83EXTRASPOTª

358° 20° 20°

250

TOPSATIN

.

back

150

.

&mOODª ª

.

.

ª 7IDE&LOOD 358° 38° 38°

250

TOPSATIN

.

back

.

150

.

7&WIDEmOODª ª

(EADANDHOLDERS "LACKONLYFOR5NA0RO3-$

7HITE

!LUMINIUM

"LACK

7HITE

"LACK


5NA0RO*OINT 4HEJUNCTIONALLOWSªROTATIONANDªTILTING INALLDIRECTIONS4HISMOVEMENTISSUITEDEITHER TOREACHANYINDIVIDUALPOINTSONHORIZONTALOR VERTICALSURFACESREQUIRINGACCENTLIGHTORTOEVENLY DISTRIBUTETHEEMITTEDLIGHTTHROUGHSPACE %ACH ,%$HEADINTHEMULTIPLECOMPOSITIONSCAN BEADJUSTEDINDIVIDUALLY SOTHATEACHLIGHTBEAM CANBEDIRECTEDINDEPENDENTLYOFTHEOTHERSTO STRESSDIFFERENTPOINTSINSPACEBYINSTALLINGONE APPLIANCE

X

X

360°

360° Y

Z

30°

X

Y

Z

30°

Z

Y

30°

?


!LUMINIUM

5NA0RO

7HITE

5NA0RO!DJUSTABLE2ECESSED

ª

X,%$ 7

 KG

ª

ª

ª

&LUX LM

##4 +



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

"OX

(EAD

(OLDER

+

#ODE $$)$7 $$)$"7 $$)$ $$)$" $$)$7 $$)$"7 $$)$ $$)$" $$)$7 $$)$"7 $$)$ $$)$" $$,$7 $$,$"7 $$,$ $$,$" $$,$7 $$,$"7 $$,$ $$,$" $$,$7 $$,$"7 $$,$ $$,$"

)0

,%$XMM X,%$XMM



ª

#2) 

  



"EAM ª





7EIGHT  KG

 





7 ,%$ 7

 

!CCESSORIES

&RAME5NA0RO!$*X,%$

)0#OVER5NA0RO!$*,%$X,%$

$$)#,4

 

 

 

  

&RAME5NA0RO!$*,%$

#ODE $$)&2 $$)&2 $$,&2 $$,&2

 

#OLOR


!LUMINIUM

5NA0RO

"LACK

7HITE

5NA0RO3-$ "EAM ª

ª

ª

X,%$  KG 7

ª

ª

ª

#2) 

&LUX LM

##4 +



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+



LM

+

"OX

(EAD

(OLDER

#ODE $$)$37 $$)$37 $$)$37 $$)$3 $$)$3 $$)$3 $$)$37 $$)$37 $$)$37 $$)$3 $$)$3 $$)$3 $$)$37 $$)$37 $$)$37 $$)$3 $$)$3 $$)$3 $$,$37 $$,$37 $$,$37 $$,$3 $$,$3 $$,$3 $$,$37 $$,$37 $$,$37 $$,$3 $$,$3 $$,$3 $$,$37 $$,$37 $$,$37 $$,$3 $$,$3 $$,$3

)0



 

7EIGHT  KG



7 ,%$ 7

!CCESSORIES )0#OVER5NA0RO!$*,%$X,%$

#ODE $$)#,4

?


5NA0RO #ARLOTTADE"EVILACQUA  


s,%$ 7 sLUMEN s-AC!DAM3$#- s"EAM83 & 7& s##4++ s#2) s,IFE,+ H

s(IGH POWER,%$LIGHTINGAPPLIANCEMOUNTED ONATHINMM FLATALUMINIUMSHEETWITH IMPROVEDHEATDISSIPATION s4HEHEADACCOMMODATESA ,%$CIRCUIT s!VAILABLEWITHTHREEDIFFERENTEMISSIONS ª ª ª s!VAILABLEINTWODIFFERENTHEIGHTS CMORCM

s)0

?


"EAM!NGLE .

ª %XTRA3POT

358° 6° 6°

250

TOPTRANSPARENT

.

back

.

150

.

.

ª &LOOD

83EXTRASPOTª

358° 20° 20°

250

TOPSATIN

.

back

150

.

&mOODª ª

.

.

ª 7IDE&LOOD 358° 38° 38°

250

TOPSATIN

.

back

.

150

.

7&WIDEmOODª ª

(EADANDHOLDERSCOLORVERSIONS "LACK

7HITE

!LUMINIUM

"LACK

7HITE

"LACK


!LUMINIUM

5NA0RO

"LACK

7HITE

( "EAM ª

ª

#2) 

&LUX LM

##4 +



LM

+



LM

+



ª

LM

"OX

(EAD

(OLDER

+



LM

+



LM

+

#2) 

&LUX LM

##4 +



LM

+



LM

+



LM

+



LM

+



LM

+

#ODE $$!!#7 $$!!#7 $$!!#7 $$!!# $$!!# $$!!# $$!!#7 $$!!#7 $$!!#7 $$!!# $$!!# $$!!# $$!!#7 $$!!#7 $$!!#7 $$!!# $$!!# $$!!#

)0

#ODE $$!!,7 $$!!,7 $$!!,7 $$!!, $$!!, $$!!, $$!!,7 $$!!,7 $$!!,7 $$!!, $$!!, $$!!, $$!!,7 $$!!,7 $$!!,7 $$!!, $$!!, $$!!,

)0

 

7EIGHT  KG



7 ,%$  7

( "EAM ª

ª

ª

"OX

(EAD

(OLDER





7EIGHT  KG



7 ,%$  7

?


,UCERI,%$ 3TUDIO!RTEMIDE ,UCERI,%$ ,UCERI+ADRO,%$

s,%$#/" s7 7 s LUMEN s-AC!DAM3$#-3$#- (IGH 0ERFORMANCEVERSIONS s"EAM8& s##4++ s#2) s,IFE,+ H s5'2 s)0)0

8&%XTRA&LOOD ª

s2ECESSEDFIXEDDOWNLIGHTERSUSINGHIGH OUTPUT ,%$S s4WOVERSIONSTRIMWITHBEZEL AND4RIMLESS RECESSEDCEILINGMOUNTEDWITHOUTBEZEL s!VAILABLEINVERSIONS EACHWITHLEVELSOF POWER 3TANDARDVERSIONNONDIMMABLE #2)MIN (IGH PERFORMANCEVERSIONWITHNETEFFICIENCYUP TOLM7 $!,) #2)MIN WITH#REE4RUE 7HITE2 TECHNOLOGY#OLOURTEMPERATUREAND COLOURRENDERINGINDEXCONSTANTTHROUGHOUTTHE PRODUCTLIFESPAN s-ATERIALSBEZEL WHITEREFLECTORANDSCREENSIN POLYCARBONATE REFLECTORSINVACUUM METALLED POLYCARBONATEWITHANTI SCRATCHSURFACETREATMENT

s3TANDARDVERSION)0 )0WITHTHEADDITIONOFANOPTIONAL SCREEN s#OMPLIANTTOSTANDARD%.  %.ANDOTHERSPECIFICSTANDARDS


 ?


,UCERI,%$

,UCERI,%$TRIM

7HITEFRAME 'REYFRAME

,UCERI,%$TRIM s#OMPLETEWITHOPTICHOUSINGANDTRIM s4RIMAVAILABLEINWHITEORGREY s0ROFESSIONALMIRROROPTICWITH5'2,UMINANCE #ONTROLFOROFFICESPACESWITHCOMPUTER SCREENS s)NSTALLATIONBRACKETSFORANEASY TOOL FREE INSTALLATIONONFALSECEILINGSOFTHICKNESSES BETWEENANDMM s/PTIONALSCREENSINTRANSPARENTPOLYCARBONATE EASYTOINSTALL OPALANDPRISMOPTICDIFFUSER WITH ADEGREETURN s)NTEGRALPOWERSUPPLY s7IDEBEAMSYMMETRICALDISTRIBUTION


,UCERI,%$TRIMLESS

3HARPEDGETRIM

2OUNDEDEDGETRIM

,UCERI,%$TRIMLESS sAVAILABLETRIMS 3HARPEDGE 2OUNDEDEDGE sAVAILABLEOPTICHOUSINGS s0ROFESSIONALMIRROROPTICWITH5'2,UMINANCE #ONTROLFOROFFICESPACESWITHCOMPUTER SCREENS s#OMFORTWHITEOPTICS s/PTICSHOUSINGSANDTRIMTOBEORDERED SEPARATELY s/PTIONALSCREENSINTRANSPARENTPOLYCARBONATE EASYTOINSTALL OPALANDPRISMOPTICDIFFUSER WITHADEGREETURN s)NTEGRALPOWERSUPPLY s7IDEBEAMSYMMETRICALDISTRIBUTION

?


,UCERI,%$TRIMLESS2OUNDEDEDGETRIM

,%$COMFORTWHITEOPTICS

NOTDIMMABLE

7 7

#2) 

7EIGHT  KG

"EAM ª

7



 KG

ª

&LUX LM LM LM LM

##4 + + + +

#ODE - - - -

,IGHTINGUNIT4OBECOMPLETEDWITHROUNDEDEDGETRIMSUPPORT ,%$(IGH 0ERFORMANCECOMFORTWHITEOPTICS 7 7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

7



 KG

ª

LM

$!,) ##4 + + + +

)0 )0 SCREENLESS

#ODE - - - -

)0 )0 WITHSCREEN

∅

,IGHTINGUNIT4OBECOMPLETEDWITHROUNDEDEDGETRIMSUPPORT 6AC(ZELECTRONICBALLASTINCLUDED SUPPORTWITHROUNDEDEDGETRIM

-











7



77













&RAMEEXT  &RAMEINT  2EFLECTOREXT 

,UCERI,%$TRIMLESS3HARPEDGETRIM

,%$FACETEDMIRROROPTICS

&RAMEEXT  &RAMEINT  2EFLECTOREXT 

NOTDIMMABLE

7 7

#2) 

7EIGHT  KG

"EAM ª

7



 KG

ª

&LUX LM

LM LM LM

##4 + + + +

#ODE - - - -

,IGHTINGUNIT4OBECOMPLETEDWITHSHARPEDGETRIMSUPPORT ,%$(IGH 0ERFORMANCEFACETEDMIRROROPTICS 7 7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

7



 KG

ª

LM

$!,) ##4 + + + +

)0 )0 SCREENLESS

#ODE - - - -

)0 )0 WITHSCREEN

∅

,IGHTINGUNIT4OBECOMPLETEDWITHSHARPEDGETRIMSUPPORT 6AC(ZELECTRONICBALLASTINCLUDED -







 

-



 

!CCESSORYFORCEILINGINSTALLATION

7



77



3HARPEDGETRIM





&RAMEEXT  &RAMEINT  2EFLECTOREXT 

&RAMEEXT  &RAMEINT  2EFLECTOREXT 


,UCERI,%$TRIM

'RAY

 KG

"EAM ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

,%$(IGH 0ERFORMANCEFACETEDMIRROROPTICS 7 7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM



 KG

ª

LM

)0 )0 SCREENLESS

$!,) ##4 + +

7

#ODE - - - - - - - -

+

)0 )0 WITHSCREEN

#ODE - - - - - - - -

77

 

6AC(ZELECTRONICBALLASTINCLUDED

∅

7



+

#OLOR





7EIGHT  KG



7

#2) 



 



7 7

.ONDIMMABLE



,%$FACETEDMIRROROPTICS

7HITE





 &RAMEEXT  &RAMEINT  2EFLECTOREXT 

 &RAMEEXT  &RAMEINT  2EFLECTOREXT 

!CCESSORIES 4RANSPARENTSCREEN INPOLYCARBONATE

#ODE -

/PALSCREENIN0--!

-

0RISMOPTICSCREEN INPOLYCARBONATE

-

7ITHSCREEN

3CREENLESS

?


"ANCADI#ARAGLIO #REDITO#OOPERATIVO#ARAGLIO#. )TALY !RCH3TUDIO+UADRA 0HOTO&EDERICO6ILLA


#ENTRO3TUDIDELLO3TUDENTATO5NIVERSITARIODI4RENTO 4RENTO)TALY 3TUDIO0ALERM4ABARESDE.AVA3,!RQUITECTOS 0HOTO&EDERICO6ILLA


,UCERI+ADRO,%$

,UCERI,%$TRIM

7HITEFRAME 'REYFRAME

,UCERI+ADRO,%$TRIM s#OMPLETEWITHOPTICHOUSINGANDTRIM s4RIMAVAILABLEINWHITEORGREY s0ROFESSIONALMIRROROPTICWITH5'2,UMINANCE #ONTROLFOROFFICESPACESWITHCOMPUTER SCREENS s)NSTALLATIONBRACKETSFORANEASY TOOL FREE INSTALLATIONONFALSECEILINGSOFTHICKNESSES BETWEENANDMM s/PTIONALSCREENSINTRANSPARENTPOLYCARBONATE EASYTOINSTALLOPALANDPRISMOPTICDIFFUSER WITHA DEGREETURN s)NTEGRALPOWERSUPPLY s7IDEBEAMSYMMETRICALDISTRIBUTION


,UCERI,%$TRIMLESS

3HARPEDGETRIM

2OUNDEDEDGETRIM

,UCERI+ADRO,%$TRIMLESS sAVAILABLETRIMS 3HARPEDGE 2OUNDEDEDGE sAVAILABLEOPTICHOUSING s0ROFESSIONALMIRROROPTICWITH5'2,UMINANCE #ONTROLFOROFFICESPACESWITHCOMPUTER SCREENS s#OMFORTWHITEOPTICS s/PTICSHOUSINGSANDTRIMTOBEORDERED SEPARATELY s/PTIONALSCREENSINTRANSPARENTPOLYCARBONATE EASYTOINSTALLOPALANDPRISMOPTICDIFFUSER WITHADEGREETURN s)NTEGRALPOWERSUPPLY s7IDEBEAMSYMMETRICALDISTRIBUTION

?


,UCERI+ADRO,%$TRIMLESS2OUNDEDEDGETRIM

,%$COMFORTWHITEOPTICS

NOTDIMMABLE

#2) 7 7 

7EIGHT  KG

"EAM ª

7 

 KG

ª

&LUX LM LM LM LM

##4 + + + +

#ODE - - - -

,IGHTINGUNIT4OBECOMPLETEDWITHROUNDEDEDGETRIMSUPPORT ,%$(IGH 0ERFORMANCECOMFORTWHITEOPTICS #2) 7 7 

7EIGHT  KG

"EAM ª

&LUX LM

7 

 KG

ª

LM

$!,) ##4 + + + +

)0 )0 SCREENLESS

#ODE - - - -

)0 )0 WITHSCREEN

XMM

,IGHTINGUNIT4OBECOMPLETEDWITHROUNDEDEDGETRIMSUPPORT 6AC(ZELECTRONICBALLASTINCLUDED 7











77

- 

3UPPORTWITHROUNDEDEDGETRIM













&RAMEEXT  &RAMEINT  2EFLECTOREXT 

&RAMEEXT  &RAMEINT  2EFLECTOREXT 

,UCERI+ADRO,%$TRIMLESS3HARPEDGETRIM

,%$FACETEDMIRROROPTICS

NONDIMMABLE

#2) 7 7 

7EIGHT  KG

"EAM ª

7 

 KG

ª

&LUX LM LM LM LM

##4 + + + +

#ODE - - - -

,IGHTINGUNIT4OBECOMPLETEDWITHSHARPEDGETRIMSUPPORT ,%$(IGH 0ERFORMANCEFACETEDOPTICS #2) 7 7 

7EIGHT  KG

"EAM ª

&LUX LM

7 

 KG

ª

LM

$!,) ##4 + + + +

)0 )0 SCREENLESS

#ODE - - - -

)0 )0 WITHSCREEN

XMM

,IGHTINGUNIT4OBECOMPLETEDWITHSHARPEDGETRIMSUPPORT 6AC(ZELECTRONICBALLASTINCLUDED







-



!CCESSORYFORCEILINGINSTALLATION

7



- 

77

3HARPEDGETRIM













&RAMEEXT  &RAMEINT  2EFLECTOREXT 

&RAMEEXT  &RAMEINT  2EFLECTOREXT 


,UCERI+ADRO,%$CONTRIM

'RAY

##4 +

LM

+

LM

+

LM

+

#OLOR

,%$(IGH 0ERFORMANCEFACETEDMIRROROPTICS 7 #2) 7 

7EIGHT  KG

"EAM ª

&LUX LM

 KG

ª

LM

)0 )0 SCREENLESS

$!,) ##4 + +

7 

#ODE - - - - - - - -

+

#ODE - - - - - - - -

)0 )0 WITHSCREEN

77

XMM

7



+

#OLOR



ª

&LUX LM



 KG

"EAM ª



7 

7EIGHT  KG



7 #2) 7 

NOTDIMMABLE



,%$FACETEDMIRROROPTICS

7HITE





 

6AC(ZELECTRONICBALLASTINCLUDED





 &RAMEEXT  &RAMEINT  2EFLECTOREXT 

 &RAMEEXT  &RAMEINT  2EFLECTOREXT 

!CCESSORIES 4RANSPARENTSCREEN INPOLYCARBONATE

/PALSCREENIN0--!

0RISMOPTICSCREEN INPOLYCARBONATE

#ODE -

-

-

7ITHSCREEN

3CREENLESS

?


?


,UCERI&LUO 3TUDIO!RTEMIDE 

s&LUOX7 X7 sLUMEN s"EAM8& s)0)0

s!RANGEOFRECESSEDDOWNLIGHTSFLUORESCENT LAMPS

s%LECTRICALCONNECTIONBYMEANSOFQUICK CONNECTORS

s"ODYMADEFROMTECHNOPOLYMERS2EFLECTORIN VACUUM METALLISEDPOLYCARBONATEWITHANTI SCRATCHSURFACETREATMENT

s"RIDGINGCONNECTIONPOSSIBLE

s$ECORATIVERINGMADEFROMALUMINIUMOR INJECTIONMOULDEDPLASTIC AVAILABLEINCOLOUR OPTIONS WITHORWITHOUTSCREEN&ITTINGISMADE BYONEQUARTERTURNROTATION s4HE,UCERISCREENDARKLIGHTOPTICENSURESA CONTROLLEDLUMINANCELEVELOFLESSTHANCD M§FORANOBSERVATIONANGLEOFªORABOVE WITHRESPECTTOTHEVERTICALAXIS WELLWITHINTHE LIMITSSETBYSTANDARD%.  8&%XTRAmOOD ª

s,OWRECESSDEPTHFORCEILINGSOFMMTOMM THICK s%LECTRONICBALLASTANDEMERGENCYLIGHTING

s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS


?


7HITE

,UCERI&LUO

4# $%,'Q 

.ONDIMMABLE

EMERGENCYH

7 7EIGHT X7'Q    KG

"EAM ª

&LUX LM

X7'Q    KG

ª

LM

#ODE , , , ,

#ODE , , , ,

#OLOR

'REY

3UPPLIEDWITHPLASTICFRONTANDFROSTEDGLASS 6AC(ZELECTRONICBALLASTINCLUDED )0

)0

∅

ª







Œ

4# $%,'Q 

.ONDIMMABLE

EMERGENCYH

7 7EIGHT X7'Q    KG

"EAM ª

&LUX LM

X7'Q    KG

ª

LM

#ODE , , , ,

#ODE , , , ,

#OLOR

3UPPLIEDWITHPLASTICFRONTANDANTI DAZZLE CROSS BLADELOUVRE 6AC(ZELECTRONICBALLASTINCLUDED )0

)0

∅

ª







Œ

4# $%,'Q  7 7EIGHT X7'Q    KG

"EAM ª

&LUX LM

X7'Q    KG

ª

LM

#OLOR

.ONDIMMABLE

EMERGENCYH

#ODE , , , ,

#ODE , , , ,

3UPPLIEDWITHPLASTICFRONTANDFROSTEDGLASS 6AC(ZELECTRONICBALLASTINCLUDED )0

)0

∅

ª 






?


*AVA %RNESTO'ISMONDI 

s,%$#/"

s4RIMORTRIMLESSADJUSTABLEDOWNLIGHTSUSING,%$

s7

sMODELSSQUAREWITHLAMP RECTANGULARWITH ANDLAMPS

sLUMEN

s%ACHSPOTLIGHTMAYBEADJUSTEDINDIVIDUALLYWITHA TILTANGLERANGINGFROM ªTO ª ANDROTATION OFUPTOª

s-AC!DAM3$# s"EAM3&7& s##4+ s#2)MIN s,IFE,+ H s)0

3SPOT ª ª

&mOOD ª ª

7&WDEmOOD ª ª


7HITE

7 7

"EAM ª ª ª

#2) MIN

&LUX LM LM LM

##4 + + +

4RIM

4RIMLESS

#ODE -7 -7 -7

#ODE -7 -7 -7

%LECTRONICBALLASTM!3%,6SUPPLIEDSEPARATELY

$!,) ONOFF

)0 ª

#ODE - -



6AC ,MM 7MM(MM NªDEVICE      MAX







$RIVER CC7M! CC7M!





X

7 X7

#2) MIN

"EAM ª ª ª

&LUX LM LM LM

##4 + + +

4RIM

4RIMLESS

#ODE -7 -7 -7

#ODE -7 -7 -7

X

%LECTRONICBALLASTM!3%,6SUPPLIEDSEPARATELY

6AC ,MM 7MM(MM NªDEVICE      MAX

$!,) ONOFF

#ODE - -

)0 ª









$RIVER CC7M! CC7M!





X

7 X7

#2) MIN

"EAM ª ª ª

&LUX LM LM LM

##4 + + +

4RIM

4RIMLESS

#ODE -7 -7 -7

#ODE -7 -7 -7

X

%LECTRONICBALLASTM!3%,6SUPPLIEDSEPARATELY

)0 ª

#ODE - -



X

 

$!,) ONOFF



6AC ,MM 7MM(MM NªDEVICE      MAX



$RIVER CC7M! CC7M!



X

?


0ARABOLA 

s,%$77 s LUMEN

s,IGHTFIXTUREWITHHIGH PERFORMANCE ,%$LIGHTSOURCES

s-AC!DAM3$#

s#ONSISTSOFFRAME BODY LENS FIXING SPRINGS

s"EAM8& s,+ H s##4++ s#2)MIN s)0

s&RAMEININJECTIONMOULDOF ALUMINIUM s(EATSINKBODYINEXTRUDED ALUMINIUM s,ENSINPOLICARBONATEWITHDIFFERENT VERSIONSOFBEAM s&IXINGSPRINGSINHARMONICSTEEL

ª ª

s%LECTRICALCONNECTIONTOTHEDRIVERBY MEANSOFA&%0 &%0CABLE ANDATERMINALBOARD s4ECHNICALFEATURESOFLIGHTFIXTURESIN COMPLIANCEWITH%. 

8&%XTRAmOOD ª


?


0ARABOLA

7HITE

#2) 7 7 

7EIGHT  KG

"EAM ª

&LUX LM

#OLOR ##4 +

LM +

ª

LM

+

LM +

ª

LM

+

LM +

&IXED

!DJUSTABLE

#ODE .,9 .,9 .,9 .,+ .,+ .,+

#ODE .,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+

3ILVER

)0 ’¢ 

2OUND

"LACK

Â’

$RIVERM!3%,6SUPPLIEDSEPARATELY

)0



’¢

ª ª ’

#2) 7 7 

&IXED 7EIGHT "EAM  KG ª

ª

ª

&LUX LM

#OLOR ##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

#ODE .,9 .,9 .,9 .,+ .,+ .,+ )0

.,9 .,9 .,9 .,+ .,+ .,+

X¢ 

3QUARE

.,9 .,9 .,9 .,+ .,+ .,+



$RIVERM!3%,6SUPPLIEDSEPARATELY

$RIVER 6AC CC7M!   CC7M!  

,MM 7MM (MMNªDEVICE   MAX.ONDIMMABLE   MAX$!,)053( 6DIMMABLE

#ODE - .,


7HITE

2OUND #2) 7EIGHT 7 7   KG

"EAM ª

ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

#OLOR

&IXED

!DJUSTABLE

#ODE .,9 .,9 .,9 .,+ .,+ .,+

#ODE .,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+

.,9 .,9 .,9 .,+ .,+ .,+

"LACK

3ILVER

)0 ’¢



0ARABOLA



$RIVERM!3%,6SUPPLIEDSEPARATELY

)0



’¢

ª ª ’

#2) 7EIGHT 7 7   KG

&IXED "EAM ª

ª

ª

&LUX LM

#OLOR ##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

#ODE .,9 .,9 .,9 .,+ .,+ .,+ .,9 .,9 .,9 .,+ .,+ .,+

)0 X¢ 

3QUARE

.,9 .,9 .,9 .,+ .,+ .,+



$RIVERM!3%,6SUPPLIEDSEPARATELY

$RIVER 6AC CC7M!   CC7M!   CC7M!  

,MM 7MM      

(MMNªDEVICE MAX.ONDIMMABLE MAX053( 6DIMMABLE MAX$!,)$IMMABLE

#ODE - - -

?


,E2OLAND'ARROS2ESTAURANT 0ARIS &2


)BIS(OTEL (EILBRONN $%

?


2ASTAF 3TUDIO!RTEMIDE  

s,%$7 sLUMEN

s3ERIESOF,%$RECESSEDLUMINAIRES

s-AC!DAM3$#s"EAM& 7&

s.OACCESSORIESNEEDEDINTHE)0FIXEDVERSION )0FROMBELOW

s,+ H

s4ILTANGLEUPTOª

s&IXEDANDADJUSTABLEVERSIONSAVAILABLE

s##4++ s#2)MIN

s7HITESTEELRECESSINGPLATEAVAILABLESEPARATELY FORORDOWNLIGHTERS s2ANGEOFRECESSINGACCESSORIESAVAILABLE

s)0

s3EPARATEPOWERSUPPLY s#OMPLIANTWITH%. STANDARD ANDOTHERSPECIFICSTANDARDS

ª

&&LOOD ª ª

7&7IDEmOOD ª ª


?


2ASTAF

7 7

7HITE

#2) 

7EIGHT  KG

"EAM ª ª

&LUX LM LM LM LM

##4 + + + +

#OLOR

&IXEDOPTIC

!DJUSTABLEOPTIC

#ODE - - - -

#ODE - - - -

$RIVERM!3%,6SUPPLIEDSEPARATELY

7EIGHT  KG

 6

#OLOR



MAX 

Œ

,%$'5

)0

∅MM





)0

Œ

&IX

!DJUSTABLE

#ODE -

#ODE -

)0 ª

Œ









∅MM

Œ

!CCESSORIES

2ECESSINGRINGFORMINERALlBERFALSE CEILINGSFOR2ASTAFlXEDORADJUSTABLE

#ODE -

3TEELRECESSINGPLATEFORSPOTS FOR2ASTAFlXEDORADJUSTABLE

∅MM

#ODE -



!LUMINIUMRECESSINGRING FOR2ASTAFlXEDORADJUSTABLE

-

 

X∅MM ∅MM 3TEELRECESSINGRINGWITHSPRINGS FORPLASTERBOARDFALSE CEILINGSFOR2ASTAFlXEDORADJUSTABLE

-

3TEELRECESSINGPLATEFORSPOTS FOR2ASTAFlXEDORADJUSTABLE   

X∅MM

$RIVER CC7M! CC7M!

6AC    

,MM 7MM (MM  MAX.ONDIMMABLE  MAX$!,)053( 6DIMMABLE

#ODE - -

-


2ISTORANTE,ARTE -ILANO)TALY )NTERIORPROJECT,ORENZO-ORGANTI 'RIXONI3ERVICE 0HOTO&EDERICO6ILLA

?


:ENO50 *AN6AN,IERDE 

s,%$ 7 sLUMEN s-AC!DAM3$# s"EAM3 & s,+ 

s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHT SOURCES s,OWRECESSEDDEPTH s#ONSISTSOFBODY FRAME BLACKSILKSCREENED TEMPEREDGLASS FIXINGSPRINGS

s##4++

s"ODYIN%.!"ALUMINIUM SILICONE GASKETS

s#2)

s&RAMEINALUMINIUM

s)0

s"LACKSILKSCREENEDTEMPEREDGLASS MM THICK s&IXINGSPRINGSINHARMONICSTEEL s0OWERCONNECTIONTOTHEMAINSBYMEANSOF A(2. RCABLEAND)0ELECTRICALTERMINAL BOARD SUPPLIEDWITHTHEFIXTURE

33POT ª ª

&&LOOD ª ª

s'LASSSURFACETEMPERATURELOWERTHANª# s&IXEDOPTICS0--!LENSESINDIFFERENT VERSIONSOFBEAMS s0AINTEDDIE CASTALUMINIUMWITH STAGE OUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXYDANTPRIMER POLYESTERPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. 


?


9ACHT3AN,ORENZO3,


:ENO5P

7 7

7HITE

#2) 7EIGHT "EAM   KG ª

ª

&LUX LM

##4 +

LM

+

#OLOR

3ILVER

#HROME

#ODE .,+ .,+ .,+ .,+ .,+ .,+ )0



X

$RIVER 6AC ,MM 7MM (MM )0NªDEVICE CC7M!  MIN MAX.ONDIMMABLE CC7M!  MIN MAX.ONDIMMABLE CC 7M! MIN MAX$!,)

., ., -



:ENO5P

7 7

#2) 7EIGHT "EAM   KG ª

ª

&LUX LM

##4 +

LM

+

#OLOR

#ODE .,+ .,+ .,+ .,+ .,+ .,+ )0 X

$RIVER 6AC ,MM 7MM (MM )0NªDEVICE CC7M!  MIN MAX.ONDIMMABLE CC7M!  .ONDIMMABLE CC7M! MIN MAX$!,)

., ., -



:ENO5P

)0 7 #2) 7EIGHT "EAM  7   KG ª

ª

&LUX LM

##4 +

LM

+

#OLOR

#ODE .,+ .,+ .,+ .,+ .,+ .,+ )0

$RIVER 6AC ,MM 7MM (MM )0NªDEVICE CC7M!  .ONDIMMABLE CC7M!SLIM  .ONDIMMABLE CC7M! MIN MAX$!,)



X

., ., -



?


:ENO5P&ROSTED *AN6AN,IERDE 

s,%$77 sLUMEN

s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHTSOURCES

s-AC!DAM3$#

s&RAMEINFROSTEDOPALGLASS MMTHICK

s"EAM8&

s"ODYININJECTIONMOULDOFALUMINIUM

s##4+

s&IXINGSPRINGSINHARMONICSTEEL

s#2)MIN

s%LECTRICALCONNECTIONTOTHEDRIVERBYMEANSOFA&2/2CABLE ANDATERMINALBOARD

s,+  s)0

8&%XTRAmOOD ª

s#ONSISTSOFFRAME BODY FIXINGSPRINGS

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH %. 


7 7

#2) 

7EIGHT  KG

"EAM 8&

&LUX LM

##4 +



:ENO5P&ROSTED

#ODE .,+ ’

$RIVER CC7M! CC M!

6AC ,MM 7MM (MM )0NªDEVICE  MAX.ONDIMMABLE     MAX$!,) PUSH    

., -

)0

∅

)0

∅

:ENO5P&ROSTED

#2) 

7EIGHT  KG

"EAM 8&

&LUX LM

##4 +

#ODE .,+



7 7

’

$RIVER 6AC ,MM 7MM (MM )0NªDEVICE CC7M!SLIM  MAX.ONDIMMABLE

.,

?


0ROFESSIONAL,IGHTING

                 

!LGORITMO !3MART .OTHING 'RAFA 0AD3YSTEM 3MART/FlCE 'RADIAN 5GLARE 3USPENSION .OTA"ENE )NCIPIT %GGBOARD 3ILENT&IELD .UR!COUSTIC #HOCOLATE ª +ALIFA 3URF

?


!LGORITMO #ARLOTTADE"EVILACQUA 0AOLADI!RIANELLO 




!TELIER%ERA #AVAIONVERONESE)TALY !RCH!LBERTO3ALVADORI0HOTO-ARCO:ANTA

?


!LGORITMO'UIDETOCOMPLETINGTHEINSTALLATION

!LGORITMO)NSTALLATION !LGORITMO&LOOR mOORRECESSED

!LGORITMO3YSTEM WALL ORCEILINGRECESSED

!LGORITMO3YSTEM 7ALLCEILING SURFACE MOUNTED CONlGURATIONS LINEAR ORATADEGREEANGLE

!LGORITMO3YSTEM 3USPENSION ,INEARORATADEGREE ANGLEINSTALLATIONS

!LGORITMO3TAND ALONE 3USPENSION 3URFACE MOUNTED CEILINGINSTALLATION


&LUORESCENTEMISSION

,%$2'",%$EMISSION

,%$2'",%$EMISSION ,%$INDIRECT

!CCENTLIGHTING

)NDIRECTEMISSION WHITEOR2'"DIFFUSED,%$

$IFFUSEDORDARKLIGHTmUORESCENTEMISSION %MISSIONWHITEOR2'",%$ DIFFUSEDORWALLWASHER %MISSIONWHITE,%$PRISMOPTICANDCONTROLLEDEMISSION !CCENTLIGHTING

$IFFUSEDORDARKLIGHTmUORESCENTEMISSION %MISSIONWHITEOR2'",%$ DIFFUSEDORWALLWASHER %MISSIONWHITE,%$PRISMOPTICANDCONTROLLEDEMISSION !CCENTLIGHTING

$IFFUSEDORDARKLIGHTmUORESCENTDIRECTANDINDIRECTEMISSION $IRECTANDINDIRECTEMISSIONWHITEOR2'",%$ DIFFUSEDORWALLWASHER $IRECTEMISSIONWHITE,%$PRISMOPTICANDCONTROLLED EMISSIONAND)NDIRECTEMISSIONWHITE,%$ !CCENTLIGHTING %MISSIONWHITE,%$

?


!LGORITMO3YSTEM


?


0RE WIREDBOARD

$IFFUSER


0RE WIREDBOARD

7ALLORCEILING RECESSED MOUNTED STRUCTURALMODULE

$IFFUSER

?


!LGORITMO3YSTEM #OMPONENTS

3530%.3)/. #%),).' 7!,,

&IXINGCOMPONENTS

*UNCTION COMPONENTS

2%#%33%$

*UNCTION COMPONENTS

0RE WIREDGEARPLATES

3TRUCTURALMODULE 4RIMLESS 7ALLBRACKETTOCONNECTA SUSPENDEDMODULE TOTHEWALL

%NDCAPS SETOF

%NDCAPS

0RE WIREDGEARTRAYFORWHITE ,%$DIFFUSED PRISMOTIC CON TROLLEDANDWALLWASHER -6THROUGH WIRINGINCLUDED

3TRUCTURALMODULE 4RIM

3TRUCTURALMODULE SUSPENSION CEILING WALL

7ALLCEILINGlXINGBRACKET

,INEARCONNECTOR

6ERTICALJOINTTOCONNECT TWORECESSEDMODULESON THESAMEPLANE

0RE WIREDGEARTRAY FOR2'",%$DIFFUSED ,6THROUGH WIRINGINCLUDED

3USPENSIONCABLE NOSUPPLY 

ªANGLEFORTHEMECHANICAL CONNECTIONOFTWORECESSED MODULESONONESAMEPLANE

%NDCAPS

0RE WIREDGEARTRAY FORTRACK

3USPENSIONKITWITHSUPPLY

ªANGLE &ORTHEMECHANICAL CONNECTIONOFMODULES ONTWOPERPENDICULAR PLANES

6ERTICALJOINTTOCONNECTTWO RECESSEDMODULESONTHE SAMEPLANE

0RE WIREDGEARTRAY FORACCENTLIGHTINGUNIT 0!$ 0!$SQUARE AND#UBETOBEORDERED SEPARATELY -6THROUGH WIRINGINCLUDED

(ORIZONTALJOINTTO MECHANICALLYCONNECTTWO RECESSEDMODULESONTHE SAMEPLANE

0RE WIREDGEARTRAYFOR mUORESCENTTUBES4 3,3 -6THROUGH WIRINGINCLUDED

s!LGORITMOSYSTEMISPARTICULARLYFLEXIBLEITALLOWS DIFFERENTLIGHTINGSOLUTIONSTOBECOUP,%$THROUGH THESAMESHAREDELECTRICALSYSTEM&LUORESCENT DIFFUSEDORDARKLIGHTVERSION ,%$DIFFUSEDOR WALLWASHERINWARM+ ORNEUTRALWHITE + 2'",%$ ,%$CONTROL,%$ANDPRISMOPTIC ACCENTLIGHTING s)NSTALLATIONINLINEORATAªANGLE s!LGORITMOSYSTEMISCOMPOSEDOF s3TRUCTURALMODULESINEXTRUDEDALUMINIUM AVAILABLE INDIFFERENTLENGTHSDEPENDINGONTHEINSTALLATION OPTIONANDFINISHES WHITE BLACKANDSILVER s'EARPLATESWITHTHROUGH WIRINGANDRAPID CONNECTORS s3UPPLEMENTARYTHROUGH WIRINGWITHRAPID CONNECTION s/PTICALSYSTEMSDIFFUSERS DARKLIGHTOPTICSFOR FLUORESCENTVERSION CONTROLLEDOPTICSFOR,%$ WALL WASHEROPTICSFOR,%$ WHITE,%$MONOCHROMATIC PROJECTORSPAD PADSQUAREANDCUBE  s%NDCAPSANDJOINTS s3UPPLYINGCABLES s0RE CAB,%$WHITE,%$-6 PLATESEQUIPPEDWITH ELECTRONICORELECTRONICDIMMERABLEDRIVER$!,)  0RE CAB,%$2'",%$,6 PLATES s&LUORESCENTGEARPLATESWITHELECTRONICOR@MULTIWATT DIMMABLEELECTRONICSUPPLYERW$!,) 4 SEAMLESSTUBESTOBEORDEREDSEPARATELY s0OWERSUPPLYAND,%$MANAGEMENTSYSTEMS,6 TOBEORDEREDSEPARATELY s#OMPLIANTWITHSTANDARD%.  ANDOTHERSPECIFICSTANDARDS


%LECTRICAL #OMPONENTS

/PTICALSYSTEMS

/PTIONALTHROUGH WIRING 4OBEUSEDWITHMIXED INSTALLATIONSCOMBINING ,6AND-6PRE WIRED GEARTRAYS

/PALPOLYCARBONATE DIFFUSERFORWHITE,%$ ANDDIFFUSED2'"VERSIONS

$ARK,IGHTOPTICS FORmUORESCENTVERSIONS

0OWERSUPPLYKIT

#ONTROL,%$/PTICS FORWHITE,%$VERSION

0-!!OPALDIFFUSER FORmUORESCENTVERSIONS

%LECTRICALCONNECTOR TOCOUPLE!LGORITMO,%$ 3YSTEM,6 WITHWALL ANDmOOR RECESSEDMODULES OF!LGORITMO&LOOR,6 POWEREDTHROUGHTHESAME SHAREDELECTRICALCIRCUIT

0RISMOPTICSOPTICSFORWHITE ,%$VERSIONS

*UNCTION COMPONENTS

*UNCTIONTOBElTTED TOTHEMODULEONTHESAME PLANE #OMPATIBLEWITHTHEJUNCTION FORTHESAMEPLANE

3POTLIGHTS

0OWERSUPPLIES ANDCONTROLSYSTEMS

#UBE FOR!LGORITMO3YSTEM

%LECTRONICPOWERSUPPLY )0

0!$ FOR!LGORITMO3YSTEM

#ONTROLINTERFACE )0AND)0 !LLOWSMANAGEMENT OFMULTIPLE,6 !LGORITMO 3YSTEMANDOR!LGORITMO&LOOR

0!$3QUARE FOR!LGORITMO3YSTEM

/NLYFOR2'",%$

0OLYCARBONATEOPTICS FORWHITE,%$ WALLWASHERVERSIONS

?


!LGORITMO3YSTEM $IFFUSEDEMISSION


?


3TRUCTURALMODULERECESSED

7HITE

4RIMLESS 7EIGHT  KG

#ODE -

MM

 KG

-

3ILVER

X∑, MM



,ENGTH MM

"LACK







4RIM ,ENGTH MM

7EIGHT  KG

MM

 KG

#OLOR

MM

#ODE - - - - - - - - - - - -



MM

X∑, MM



!CCESSORIESTRIMLESS



!CCESSORIESTRIM

6ERTICALJOINT TOMECHANICALLYCONNECTTWORECESSED MODULESONTHESAMEPLANE

#ODE -

#ODE - - -



 

#OLOR 6ERTICALJOINT TOMECHANICALLYCONNECT TWORECESSEDMODULES ONTHESAMEPLANE

 

 

%NDCAPS SETOF

-

(ORIZONTALJOINT TOMECHANICALLYCONNECT TWORECESSEDMODULES ONTHESAMEPLANE

- - -

%NDCAPS SETOF

- - -


3TRUCTURALMODULESUSPENSION CEILING WALL

"LACK

7HITE

3ILVER

'LOSSANODISED

3USPENSION CEILING WALL 7EIGHT  KG

MM

 KG

MM

 KG

MM

 KG

#OLOR

#ODE - - - - - - - - - - - - - - - -



,ENGTH MM



 

!CCESSORIES #OLOR ªANGLE 4OMECHANICALLYCONNECT TWORECESSEDMODULESON ONESAMEPLANEKG

 

#ODE - - - -

3TEELSUSPENSIONCABLE WITHQUICKADJUSTMENT ,ENGTHMETERS

 





ªANGLE 4OMECHANICALLYCONNECT OFMODULESONONE SAMEPLANE)NCLUDES THROUGH WIREEXTENSIONS KG

- - - -

  



7ALLBRACKET 4OMECHANICALLYCONNECTA WALL MOUNTEDMODULE

-

%NDCAPS SETOF

- - - -

,INEARCONNECTOR

-

MV

LV

,ENGTH OFASINGLEMODULE

NOPIECESREQUIRED FOREACHMODULE

MM MM MM MM

   

#ODE -

0LEASECHECKON!RTEMIDECOM FORCONTINUOUSSYSTEMINSTALLATIONS WITH CONNECTEDMODULES

3USPENSIONKITWITHPOWERSUPPLY )NCLUDESSINGLESTEELSUSPENSION CABLE POWERSUPPLYCABLE ,ENGTHMETERS ,6X MM &ORSUPPLYING,%$MODULES2'"

-

-6X MM  X MM 4OPOWERmUORESCENTMODULES WHITE,%$PLATESANDACCENTMODULES

-

"RACKETFORlXINGTOWALLCEILING PIECE

-

,ENGTH OFASINGLEMODULE

NOPIECESREQUIRED FOREACHMODULE

MM MM MM MM

   

!PPLICABLEALSOFORSYSTEM INSTALLATIONS

?


7IREDGEARPLATESWHITE,%$

$IRECTEMISSION

NONDIMMABLE

,ENGTH MM

7 7

7EIGHT  KG

MM

7

 KG

##4 + + + +

$!,)

#ODE -7 -. -7 -.

#ODE -7 -. -7 -.

NONDIMMABLE

$!,)

#ODE -7 -. -7 -.

#ODE -7 -. -7 -.

MV

-6INTEGRATEDTHROUGH CABLE

$IRECTEMISSION INDIRECT ,ENGTH MM

7 7

7EIGHT  KG

MM

7

 KG

##4 + + + +

MV

-6INTEGRATEDTHROUGH CABLE

$IRECTEINDIRECTEMISSIONDIMMABLE 0ROTECTIONSCREENFORINDIRECTCABLED,%$PLATEINCLUDED /CCUPIES$!,)DESTINATION

$IFFUSEDEMISSION

/PALDIFFUSERINPOLYCARBONATE ,ENGTH MM MM MM MM

7EIGHT  KG  KG  KG  KG

#2) ,ENGTH 7 MM 7  MM 7 

#ODE - - - - ##4 + + + +

&LUX LM LM LM LM

ª



 

7ALL7ASHER

,ENGTH MM MM

7EIGHT  KG  KG

,ENGTH 7 MM 7

#2) 

MM 7



#ODE - -

##4 + + + +

&LUX LM LM LM LM

ª



 


?


7IREDGEARPLATES&LUO

$IRECTEMISSION 7 X7 X7

,ENGTH MM MM

7EIGHT  KG  KG

NONDIMMABLE

$!,)

#ODE - -

#ODE - -

MV

-6INTEGRATEDTHROUGH CABLE

$IRECT INDIRECTEMISSION 7 X74 3,3' X74' X74 3,3' X74'

,ENGTH MM MM

7EIGHT  KG  KG

NONDIMMABLE

$!,)

#ODE - -

#ODE - -

MV

ª

)NDIRECT&LUXLM

-6INTEGRATEDTHROUGH CABLE

/NLYDIRECTEMISSIONISDIMMABLE 5PPERSCREENIN0--!INCLUDED

$IFFUSEDEMISSION

/PALDIFFUSERIN0--!FOR&,5/PLATES ,ENGTH MM MM MM MM

7EIGHT  KG  KG  KG  KG

&LUX LM LM LM LM

#ODE - - - -

ª



 

$ARKLIGHTEMISSION

$ARKLIGHTOPTICSINMETALPOLYCARBONATE ,ENGTH MM MM

5'2 θª %HM %HM

7EIGHT  KG  KG

&LUX LM LM

7

7

LUX

LUX

LUX

LUX

#ODE - -

ª

  


?


!LGORITMO3TAND ALONEWHITE,%$DIFFUSEDEMISSION

7HITE

3USPENSION $IRECTEMISSION

7 ,ENGTH #2) 7 MM 

7EIGHT &LUX  KG LM LM  KG LM LM

7 MM 

##4 + + + +

#OLOR

NONDIMMABLE

$!,)

#ODE -7 -. -7 -.

#ODE -7 -. -7 -.

)0

7EIGHT  KG

7 MM 

 KG

&LUX LM LM LM LM

##4 + + + +

#OLOR

$!,)

#ODE -7 -. -7 -.

#ODE -7 -. -7 -.





7 ,ENGTH #2) 7 MM 

NONDIMMABLE

NBY 

$IRECT )NDIRECTEMISSION

ªDIRECT ªDIRECT INDIRECT



/NLYDIRECTEMISSIONISDIMMABLE 5PPERSCREENIN0--!INCLUDED

$IRECTEMISSION

7 ,ENGTH #2) 7 MM 

7EIGHT  KG

7 MM 

 KG

&LUX LM LM LM LM

##4 + + + +

#OLOR

NONDIMMABLE

$!,)

#ODE -7 -. -7 -.

#ODE -7 -. -7 -.

)0 ª

 

7ALLCEILING




?


7IREDGEARPLATES2'",%$

$IFFUSEDDIRECTEMISSION 7 7 7

,ENGTH MM MM

LV 7EIGHT  KG  KG

#ODE - -

,6INTEGRATEDTHROUGH WIRING 0OWERSUPPLYANDLIGHTMANAGEMENTSYSTEMTOBEORDEREDSEPARATELY

$IFFUSEDDIRECT,%$ mUORESCENTINDIRECT 7 7,%$ X74' 7,%$ X74'

LV+MV

,ENGTH MM

7EIGHT  KG

#ODE -

MM

 KG

-

,6 -6INTEGRATEDTHROUGH WIRING 5PPERSCREENIN0--!INCLUDED 0OWERSUPPLYANDLIGHTMANAGEMENTSYSTEMTOBEORDEREDSEPARATELY

/PALDIFFUSERINPOLYCARBONATE ,ENGTH MM MM MM MM

7EIGHT  KG  KG  KG  KG

#ODE - - - -

ª



 


?


0RE 7IREDGEARFOR0!$AND0!$3QUAREPROJECTORS

$!,)

$IRECTEMISSION ,ENGTH MM

'LOSSANODISED

7EIGHT  KG

MV

ª

#ODE -

!LLOWSINSTALLATIONANDSUPPLYINGOF 0!$6PROJECTORS -6THROUGH WIRINGINCLUDED

$IRECT INDIRECTEMISSION 7 7

,ENGTH MM

7EIGHT  KG

##4 + +

NONDIMMABLE

$!,)

#ODE -7 -.

#ODE -7 -.

MV

ª

!LLOWSINSTALLATIONANDPOWERINGOF 0!$6 INDIRECTPROJECTORS -6THROUGH WIRINGINCLUDED

/NLYDIRECTEMISSIONISDIMMABLE

$OUBLEEMISSIONVERSION WITHUPPERSCREENIN0--! 0!$PROJECTORSTOBEORDEREDSEPARATELY

NONDIMMABLE

7  7

7EIGHT  KG

"EAM ª ª ª

&LUX LM LM LM LM LM LM

##4 + + + + + +

#OLOR

#ODE - - - - - -





0!$





)0 ª

4OBECOUPLEDWITHPRE WIREDGEARPLATE

ª

NONDIMMABLE 7EIGHT  KG

"EAM ª ª ª

&LUX LM

LM LM LM LM LM

##4 + + + + + +

#OLOR

#ODE - - - - - -



ª

ª



ª

!CCESSORIES

)NTERMEDIATElNISHINGCAPSETOF INPOLISHEDMETALGREYSTEEL 4OBEUSEDATTHEJUNCTIONOF0!$ MODULESWITH&,5/OR,%$MODULES

ª



)0 ª

4OBECOUPLEDWITHPRE WIREDGEARPLATE

"LINDPANEL INPOLISHED METALGREYSTEEL PIECEREQUIREDFOREACH0!$ EMPTYPOSITION



0!$3QUARE 7 7

ª

#ODE -

-


0RE 7IREDGEARFOR#UBEPROJECTORS

'LOSSANODISED

$!,)

$IRECTEMISSION ,ENGTH MM

7EIGHT  KG

ª

MV

#ODE -

!LLOWSINSTALLATIONANDSUPPLYINGOF#UBE ORGROUPS OFPROJECTORSEACHMAXPROJECTORSINTOTAL  -6THROUGH WIRINGINCLUDED

$IRECT INDIRECTEMISSION 7 7

$!,)

7EIGHT  KG

,ENGTH MM

##4 + +

ª

MV

#ODE -7 -.

!LLOWSINSTALLATIONANDSUPPLYINGOF#UBE ORGROUPSOFPROJECTORSEACH MAXPROJECTORSINTOTAL  -6THROUGH WIRINGINCLUDED

/NLYDIRECTEMISSIONISDIMMABLE $OUBLEEMISSIONVERSION WITHUPPERSCREENIN0--! #UBEPROJECTORSTOBEORDEREDSEPARATELY

#UBE 7,%$ X7

)0 ª

NONDIMMABLE 7EIGHT  KG

"EAM ª ª ª

&LUX XLM XLM XLM XLM XLM XLM

##4 + + + + + +

#OLOR

#ODE - - - - - -

ª

ª









 



 

!CCESSORIES "LINDPANEL INPOLISHED METALGREYSTEEL ,ENGTHMM PIECEREQUIREDFOREACH#UBE EMPTYPOSITION )NTERMEDIATElNISHINGCAPSETOF INPOLISHEDMETALGREYSTEEL 4OBEUSEDATTHEJUNCTIONOF#UBE MODULESWITH&,5/OR,%$MODULES

#ODE -

-

?


"LACK

0RE WIREDGEARTRAYFOR2AIL

NONDIMMABLE

$IRECTRAIL ,ENGTH MM

7EIGHT  KG

MM

 KG

2AILCOLOR

NONDIMMABLE

$IRECTRAIL INDIRECTEMISSION 7 7

,ENGTH MM

7EIGHT  KG

##4 + +

7

MM

 KG

+ +

$OUBLEEMISSIONVERSION WITHUPPERSCREENIN0--!

/NLYDIRECTEMISSIONISDIMMABLE

#ODE - - - -

2AILCOLOR

#ODE -7 -7 -. -. -7 -7 -. -.

$!,) #ODE - - - -

$!,)

#ODE -7 -7 -. -. -7 -7 -. -.

MV

ª

7HITE


?


!LGORITMO#ONTROLLED 0RISMOPTIC%MISSION


?


?


!LGORITMO#ONTROLLED%MISSION 0ATENTPENDING)4 Nª-)!

#ONTROLLEDEMISSION,%$OPTIC3YSTEM 5'2 INDEX CONTROL AND ª LUMINANCE %. 

/PERATINGDIAGRAMOFTHEOPTICALDEVICE USEDON!LGORITMO

0ATENT PENDINGPROPRIETARYOPTICSYSTEMMADEBY ATHINBLACKSQUARE MESHEDGRIDANDBYASYSTEM OFSQUAREPLANO CONVEXLENSESOFAPPROPRIATEBEAM ANGLE4HEINTERNALPARTOFTHEGRIDISWHITEPAINTED ANDHASAHIGHREmECTIONCOEFlCIENT SOTHATTHELIGHT INCIDENTONTHEGRIDISRETRIEVEDWITHINTHE!LGORITMO BODY

4HEGRIDPOSITIONEDOVERTHELENSESALLOWSONLY THERAYSFALLINGINTOTHEREQUIREDOUTPUTANGULAR LIMITSTOBEINCIDENTTOTHELENSES 4HERAYSBEYONDTHESELIMITSARERECOVEREDAND REDIRECTEDINSIDETHELIGHTBOXIFTHERAYISINCIDENT TOTHEWHITESURFACE ORCANCELLEDIFTHERAY ISINCIDENTTOTHEBLACKEDGE 

!NET@CUTOFFATTHEREQUIREDANGLEISOBTAINED THROUGHTHISSYSTEM 4HECONVEXPROlLEOFTHELENSISDESIGNEDWITHIMAGES OPTICTECHNIQUES SOTHATTHEEMISSIONISLIMITEDWITHIN THEªREQUIREDBYSTANDARD%.

&UNCTIONINGSCHEME

'RID

5'2 !NGLELUMINANCEEQUALSTOªANDBEYOND  CDM

ª

ª

 MM ª

ª

,ENSX MM





 

   

LIGHT/.

LIGHT/&&

$IRECTEMISSION

 

$IRECTEMISSION INDIRECT


!LGORITMO0RISMOPTIC%MISSION

#OMFORTEMISSION

4HEAPPLIANCEISlTTEDWITHACLEARPLASTICSCREEN FEATURINGANOUTERMICRO PRISMPATTERNDESIGNEDIN ORDERTOOBTAINAFOCUSEDLUMINOUSEMISSIONMOSTLY WITHINAXªCONE 7ITHTHISTECHNOLOGY !LGORITMO0RISMOPTICPROVIDES COMFORTLIGHTINGEVENWHENTHEAPPLIANCEFALLSWITHIN THEOBSERVERSVISUALCONE 





 

   

$IRECTEMISSION

 

$IRECTEMISSION INDIRECT

?


3TRUCTURALMODULERECESSED

7HITE

4RIMLESS ,ENGTH MM

7EIGHT  KG

#ODE -

MM

 KG

-

"LACK

3ILVER

X∑, MM

4RIMLESSMODULEFORSENSORSANDCONTROLBOARDS 4RIMLESS 7EIGHT  KG

#ODE - 

,ENGTH MM







4RIM ,ENGTH MM

7EIGHT  KG

MM

 KG

#OLOR

#ODE - - - - - - - - - - - -

#OLOR

#ODE - - -

MM



MM

X∑, MM

4RIMMODULEFORSENSORSANDCONTROLBOARDS 7EIGHT  KG

,ENGTH MM

!CCESSORIESTRIMLESS





!CCESSORIESTRIM

6ERTICALJOINT TOMECHANICALLYCONNECTTWORECESSED MODULESONTHESAMEPLANE

#ODE -

#ODE - - -



 

#OLOR 6ERTICALJOINT TOMECHANICALLYCONNECT TWORECESSEDMODULES ONTHESAMEPLANE

 

 

%NDCAPS SETOF

-

(ORIZONTALJOINT TOMECHANICALLYCONNECT TWORECESSEDMODULES ONTHESAMEPLANE

- - -

%NDCAPS SETOF

- - -


3TRUCTURALMODULESUSPENSION CEILING WALL

"LACK

7HITE

3ILVER

'LOSSANODISED

3USPENSION CEILING WALL 7EIGHT  KG

MM

 KG

MM

 KG

MM

 KG

#OLOR

#ODE - - - - - - - - - - - - - - - -



,ENGTH MM



 

3TRUCTURALMODULEFORSENSORSANDCONTROLBOARDS #OLOR

7EIGHT  KG

,ENGTH MM

#ODE - - - -

!CCESSORIES #OLOR ªANGLE 4OMECHANICALLYCONNECT TWORECESSEDMODULESON ONESAMEPLANEKG

 

#ODE - - - -

3TEELSUSPENSIONCABLE WITHQUICKADJUSTMENT ,ENGTHMETERS

 





ªANGLE 4OMECHANICALLYCONNECT OFMODULESONONE SAMEPLANE)NCLUDES THROUGH WIREEXTENSIONS KG

- - - -

  



7ALLBRACKET 4OMECHANICALLYCONNECTA WALL MOUNTEDMODULE

-

%NDCAPS SETOF

- - - -

,INEARCONNECTOR

-

MV

LV

,ENGTH OFASINGLEMODULE

NOPIECESREQUIRED FOREACHMODULE

MM MM MM MM

   

#ODE -

0LEASECHECKON!RTEMIDECOM FORCONTINUOUSSYSTEMINSTALLATIONS WITH CONNECTEDMODULES

3USPENSIONKITWITHPOWERSUPPLY )NCLUDESSINGLESTEELSUSPENSION CABLE POWERSUPPLYCABLE ,ENGTHMETERS ,6X MM &ORSUPPLYING,%$MODULES2'"

-

-6X MM  X MM 4OPOWERmUORESCENTMODULES WHITE,%$PLATESANDACCENTMODULES

-

"RACKETFORlXINGTOWALLCEILING PIECE

-

,ENGTH OFASINGLEMODULE

NOPIECESREQUIRED FOREACHMODULE

MM MM MM MM

   

!PPLICABLEALSOFORSYSTEM INSTALLATIONS

?


7IREDGEARPLATESWHITE,%$

$IRECTEMISSION

NONDIMMABLE

,ENGTH MM

7 7

7EIGHT  KG

MM

7

 KG

##4 + + + +

$!,)

#ODE -7 -. -7 -.

#ODE -7 -. -7 -.

NONDIMMABLE

$!,)

#ODE -7 -. -7 -.

#ODE -7 -. -7 -.

MV

-6INTEGRATEDTHROUGH CABLE

$IRECTEMISSION INDIRECT ,ENGTH MM

7 7

7EIGHT  KG

MM

7

 KG

##4 + + + +

-6INTEGRATEDTHROUGH CABLE

$IRECTEINDIRECTEMISSIONDIMMABLE 0ROTECTIONSCREENFORINDIRECTCABLED,%$PLATEINCLUDED /CCUPIES$!,)DESTINATION

7IREDGEARPLATESTUNABLEWHITE

$IRECTEMISSION ,ENGTH MM

7 7

$IMMABLE$!,) 7EIGHT ##4  KG + +

$IRECTEMISSION INDIRECT ,ENGTH MM

7 7

7EIGHT ##4  KG + +

#ODE -

$IMMABLE$!,) #ODE -

4UNABLEWHITECONTROLUNIT

7IRELESSCONTROLUNIT

$IMMABLE$!,)

,ENGTH MM

#ODE -

4OBEORDEREDWITHSPECIlCSTRUCTURALMODULES

MV


#ONTROLLEDEMISSION

0ATENTPENDING)4 Nª-)! ,ENGTH MM MM

#ODE - -

7EIGHT  KG  KG

#2) ,ENGTH 7 MM 7  MM 7 

5'2 DIRECTEMISSION DOUBLEEMISSION DIRECTEMISSION DOUBLEEMISSION

##4 + + + +

&LUX LM LM LM LM



 

0RISMOTIC

,ENGTH MM MM

7EIGHT  KG  KG

#2) 5'2 ,ENGTH 7 MM 7  DIRECTEMISSION DOUBLEEMISSION MM 7  DIRECTEMISSION DOUBLEEMISSION

#ODE - -

##4 + + + +

&LUX LM LM LM LM

ª



 

0RESENCEDETECTOR

$!,)

,ENGTH MM

#ODE -



0RESENCEDETECTOR





4OBEORDEREDWITHSPECIlCSTRUCTURALMODULES

?


!3HARPING


?


!UTOSALONE*2,)NTERNAZIONALE 6ARESE)TALY 0HOTO-ICHELE.ASTASI

?


!3HARPING 0ATENT0ENDING.ª-)

s!LGORITMO3HARPINGISVERYFLEXIBLEANDITALLOWSTO COMBINEINCONTINUITY3HARPLIGHTMODULES WITHINDIRECT ANDDIFFUSED,%$LIGHTINGINWARMWHITE+ AND NEUTRALWHITE+  s3TRUCTURALMODULESAREINEXTRUDEDALUMINUM AVAILABLE INDIFFERENTLENGTHSDEPENDINGONTHEINSTALLATIONOPTION THREEFINISHESWHITE BLACK SILVERORGLOSSANODIZED TWO OPTICFINISHESBLACKANDWHITE ANDTHREEBEAMS ª ªANDª 


/PTICALUNITSX

/PTICALUNITSX

/PTICALUNITSX

/PTICALUNITSX

?


!3HARPING#OMPONENTS

3TRUCTURALMODULE

7IREDGEARPLATESWHITE,%$

3CREEN


?


Structural module recessed

White

Black

Silver

Trimless Weight 1,80 kg

Code M204800

2368 mm

3,60 kg

M204900

62x(∑L+10 mm)

85

Length 1184 mm

40

1184 / 1384 / 2368

100

Trim Length 1184 mm

Weight 1,80 kg

2368 mm

3,60 kg

Color

3552 mm

98

4736 mm

54x(∑L+3 mm)

Code M293420 M293410 M293490 M293520 M293510 M293590 M293620 M293610 M293690 M293720 M293710 M293790

1184 / 1384 / 2368 / 3552 / 4736

Accessories trimless

60

Accessories trim

90° angle to mechanically connect two recessed modules on the same plane.

Code M196600

Color

Code M293920 M293910 M293990

107

30 85

90° angle to mechanically connect two recessed modules on the same plane.

40 98

10 40

End caps (set of 2)

282

M197300

90° angle to mechanically connect two recessed modules on perpendicular plans.

M293820 M293810 M293890

End caps (set of 2)

M294020 M294010 M294090


3TRUCTURALMODULESUSPENSION CEILING WALL

"LACK

7HITE

3ILVER

'LOSSANODISED

3USPENSION CEILING WALL 7EIGHT  KG

MM

 KG

MM

 KG

MM

 KG

#OLOR

#ODE - - - - - - - - - - - - - - - -



,ENGTH MM



 

!CCESSORIES #OLOR ªANGLE 4OMECHANICALLYCONNECT TWORECESSEDMODULESON ONESAMEPLANEKG

 

#ODE - - - -

3TEELSUSPENSIONCABLE WITHQUICKADJUSTMENT ,ENGTHMETERS

 





ªANGLE 4OMECHANICALLYCONNECT OFMODULESONONE SAMEPLANE)NCLUDES THROUGH WIREEXTENSIONS KG

- - - -

  



7ALLBRACKET 4OMECHANICALLYCONNECTA WALL MOUNTEDMODULE

-

%NDCAPS SETOF

- - - -

,INEARCONNECTOR

-

MV

LV

,ENGTH OFASINGLEMODULE

NOPIECESREQUIRED FOREACHMODULE

MM MM MM MM

   

#ODE -

0LEASECHECKON!RTEMIDECOM FORCONTINUOUSSYSTEMINSTALLATIONS WITH CONNECTEDMODULES

3USPENSIONKITWITHPOWERSUPPLY )NCLUDESSINGLESTEELSUSPENSION CABLE POWERSUPPLYCABLE ,ENGTHMETERS ,6X MM &ORSUPPLYING,%$MODULES2'"

-

-6X MM  X MM 4OPOWERmUORESCENTMODULES WHITE,%$PLATESANDACCENTMODULES

-

"RACKETFORlXINGTOWALLCEILING PIECE

-

,ENGTH OFASINGLEMODULE

NOPIECESREQUIRED FOREACHMODULE

MM MM MM MM

   

!PPLICABLEALSOFORSYSTEM INSTALLATIONS

?


7IREDGEARPLATESSHARPING,%$

$IRECTEMISSION ,ENGTH MM

/PTIC 7 XOPTICS 7

$!,) #2) 

"EAM ª ª ª

XOPTICS 7



ª ª ª

MM

XOPTICS 7



ª ª ª

XOPTICS 7



ª ª ª

&LUX LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM

##4 + + + + + + + + + + + + + + + + + + + + + + + +

#ODE !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !%

-6INTEGRATEDTHROUGH CABLE

$!,)

$IRECTEMISSION INDIRECT ,ENGTH MM

/PTIC 7 XOPTICS 7

#2) 

"EAM ª ª ª

XOPTICS 7



ª ª ª

MM

XOPTICS 7



ª ª ª

XOPTICS 7



ª ª ª

&LUX LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM

##4 + + + + + + + + + + + + + + + + + + + + + + + +

#ODE !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !% !%

3CREEN ,ENGTH MM

/PTIC XOPTICS XOPTICS

MM

XOPTICS XOPTICS

#OLOR

#ODE !% !% !% !% !% !% !% !%

)0

1188

1188

2372

2372


?


!LGORITMO,%$MANAGEMENT

3TEELCASEHEADQUARTERSANDSHOWROOM-ADRID !RCH*OHN3MALL ARCHITECTANDDIRECTOROFDESIGNFOR3TEELCASE)NTERNATIONAL 0HOTO*UANJO&ERNÃŒNDEZ


?


!LGORITMO,%$-ANAGEMENT,6 ELECTRICALDIAGRAM

#LOSURESCREENSFORªANGLES

0OWERSUPPLYLIGHTMANAGEMENTSYSTEMFOR,%$

#ODE LV

#ODE

%LECTRONICPOWERSUPPLY )0)NPUTVOLTAGERANGE  6!# 6$# /UTPUTVOLTAGE6$#0ROTECTION AGAINSTOVERCURRENT OVERVOLTAGE SHORT CIRCUITANDOVERTEMPERATURE WITHAUTOMATICRESTART

*UNCTIONTOBElTTED TOTHEMODULEONTHESAMEPLANE #OMPATIBLEWITHTHEJUNCTION FORTHESAMEPLANE &ORCONTINUITYBETWEEN,%$DIFFUSED EMISSIONMODULES

7 &ORVOLTAGEUPTOATOTAL7 XXMM

-

7 &ORVOLTAGEUPTOATOTAL7 XXMM

-

7 &ORVOLTAGEUPTOATOTAL7 XXMM

-

&ORCONTINUITYBETWEENDARKLIGHTmUOEMISSION - ,%$EMISSIONMODULESANDSPOTMODULES





)0 LV

)0

#ONTROLINTERFACE #ONTROLINTERFACE &ORMANAGINGGROUPS OF!LGORITMO3YSTEM,%$2'" ANDORWHITE,%$2'"!LGORITMO &LOORLIGHTINGUNITS )NTEGRATEDSEQUENCERFORSTAND ALONE OPERATIONWITHPREDElNEDCOLOUR SEQUENCE0OSSIBILTYOFMASTER SLAVE CONlGURATION $!,)OR$-8LIGHTMANAGEMENT SYSTEMSARENOTINCLUDED



)0#OMPATIBLE$!,) 3WITCH$IMM XXMM

-

)0#OMPATIBLE$!,) 3WITCH$IMM OR$-8 XXMM

-

)0#OMPATIBLE$!,) 3WITCH$IMM 3UITABLEFOR$).RAILMOUNTING XXMM

-

)0#OMPATIBLE$!,) 3WITCH$IMM OR$-8 3UITABLEFOR$).RAILMOUNTING XXMM

-

&ORCONTINUITYBETWEENWALL WASHER,%$ EMISSIONMODULES

-

&ORCONTINUITYBETWEEN&LUODIFFUSEDEMIS SIONMODULES

-

 PLANEJOINT 4OBECLIPPEDTOTHEMODULE #OMPATIBLEWITHCONNECTORSFOR MODULESONPERPENDICULARPLANES &ORCONTINUITYBETWEEN,%$DIFFUSEDEMIS SIONMODULES 

LV

-

-

&ORCONTINUITYBETWEENDARKLIGHTmUOEMIS - SION ,%$EMISSIONMODULES ANDSPOTMODULES &ORCONTINUITYBETWEENWALL WASHER,%$ EMISSIONMODULES

-

&ORCONTINUITYBETWEEN&LUODIFFUSEDEMIS SIONMODULES

-

&ORELECTRICALDIAGRAM PLEASESEEPAGE

%LECTRICALCOMPONENTS

,IGHTSOURCES #ODE

MV

LV

,6 ,6 -6 -6 LV

MM MM MM MM

%LECTRICALCONNECTOR

4OCOUPLEWALL SURFACE ORmOOR RECESSED,%$!LGORITMO3YSTEM MODULES POWEREDTHROUGH THESAMEELECTRICALCIRCUIT

- - - - -

/NLYFOR2'",%$

MV

LV

#ODE 4 3%!-,%33' mUORESCENTTUBE PIECE

3UPPLEMENTARYTHROUGH WIRING OPTIONAL  4OBEUSEDINMIXEDCONlGURATION WITH,6AND-6PRE CAB,%$ GEARTRAYS

3UPPLY+IT !LLOWSFORCONNECTIONOFTHEMAINS TOTHElRSTPRE WIREDGEARPLATE OFTHEINITIALMODULE4OBEUSEDONLY WITHRECESSEDANDSURFACEINSTALLATION ,6XMAX MM§ 4OPOWER,%$2'"TRAYS

-

-6XMAX MM§ 4OPOWERmUORESCENTMODULES WHITE,%$PLATESANDACCENTMODULES

-

7+ 7+

- -


!LGORITMO,%$-ANAGEMENT,6 ELECTRICALDIAGRAM

3TAND ALONE

"%4*

7"$

1

%"-* %.9 4XJUDI%JNN

"

7$$

0OWERSUPPLYUNIT -07 -07 -07

#ONTROLINTERFACE -- $!,) -- $!,)OR$-8

# 8

8

,%$lTTING

,%$lTTING

8O

,%$lTTING

8O

â&#x2C6;&#x2018;W < 0,8P 2A + B < 50m n < 24 units

,%$lTTING

3TAND ALONE

#

" "%4*

7"$

1

%.9 %"-* 4XJUDI%JNN

8

8

8O

8

8

8N

â&#x2C6;&#x2018;W < 0,8P 2(A +A ) + B ¹ + B² < 50m ¹ < 24 ² units n+m

7$$

#

"

0OWERSUPPLYUNIT -07 -07 -07

#ONTROLINTERFACE -- $!,) -- $!,)OR$-8

8N

,%$lTTING

,%$lTTING

,%$lTTING

,%$lTTING

-AXIMUMVALUES &ORLIGHTINGDESIGN PLEASESEEDATAINTHECONTROLINTERFACEMANUAL

-ASTER SLAVE

"%4*

7"$

1

%"-* %.9 4XJUDI%JNN

#

"

7$$

8

8

8O

8O

â&#x2C6;&#x2018;W < 0,8P ¹ 2A + B < 50m n <¹ 24 ¹units

"%4* #

" 7"$

1

7$$

8

8

â&#x2C6;&#x2018;W < 0,8P ² 2A + B < 50m ² 24²units m<

8N

"%4* #

" 7"$

1

0OWERSUPPLYUNIT -07 -07 -07

7$$

8

#ONTROLINTERFACE -- $!,) -- $!,)OR$-8

,%$lTTING

8

,%$lTTING

8L

,%$lTTING

8L

â&#x2C6;&#x2018;W < 0,8P ³ 2A + B < 50m ³ k <³ 24 units

,%$lTTING

?


!LGORITMO&LOOR


?


!LGORITMO&LOOR#OMPONENTS

2ECESSINGPROlLE

s!LGORITMOFLOORISAFLOORRECESSED MOUNTED,%$ LIGHTINGSYSTEMDESIGNEDTOCREATENARROW LIGHTLINES s)DEALTOSTRUCTURESPACES DRAWBORDERSWITHIN ARCHITECTUREORCREATEORIENTATIONLIGHTING s)0!VAILABLEONLYFORINDOORUSE s3YSTEMINCLUDING2'",%$BODYLAMPS AVAILABLE ASMONOCHROMATICWARMORNEUTRALWHITE ANDA RECESSINGPROFILE s4HEEXTREMELYCOMPACTDIMENSIONSALLOWAMINIMAL VISUALIMPACTONTHEARCHITECTURE s,IGHTFITTINGINEXTRUDEDALUMINIUMWITHANODISED FINISH SEA,%$BYAN MMTHICKDIFFUSERINTEMPERED GLASS s!VAILABLEINLENGTHSMM MM MM s0OWERSUPPLYANDLIGHTMANAGEMENTSYSTEMTOBE ORDEREDSEPARATELY s2ECESSINGPROFILEINEXTRUDEDALUMINIUMTOBE ORDEREDSEPARATELY s!VAILABLEINTWOLENGTHSANDMM TOBE CUTONSITETOTHEREQUIREDCONFIGURATION s3TATICLOADRESISTANCEN s,IGHTINGUNITPROVIDEDWITHQUICK CONNECTORSYSTEM FOREASYBRIDGINGCONNECTION s!PROPRIETARYLOWTENSIONBUSENABLESLONGDISTANCES TOBECOVEREDWITHOUTADDITIONALELECTRICALSUPPLY s.OTSUITABLEFORWALLORCEILINGINSTALLATION s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS

2ECESSINGPROlLE INEXTRUDEDALUMINIUM 4OBECUTONSITE TOTHEREQUIREDDIMENSION ,ENGTHMM ,ENGTHMM


2ECESSING COMPONENTS

"ODYLAMPS

LV

%NDCAPSSETOF 

7HITE,%$BODYLAMP ,6INTEGRATED THROUGH WIRING

#ABLES %LECTRICALCOMPONENTS

LV

2'",%$BODYLAMP ,6INTEGRATED THROUGH WIRING

LV

0OWERSUPPLYCABLESET #ONSISTSOFONEPOWER SUPPLYCABLEXMM  BLANKINGPLUGFORSEALINGTHE LASTLUMINAIREOFTHEROW

LV

&IXINGBRACKETSSETOF 

0OWERSUPPLIES ANDCONTROLSYSTEMS

LV

%LECTRONICPOWERSUPPLY )0

LV

#ONTROLINTERFACE )0AND)0 !LLOWSMANAGEMENT OFMULTIPLE2'",6 !LGORITMO 3YSTEMANDOR!LGORITMO&LOOR

%XTENSIONCABLE XMM

LV

3TRAIGHTMECHANICAL CONNECTORSETOF 

%LECTRICALCONNECTOR

FORCOUPLINGWALL SURFACE MOUNTED,%$MODULES OF!,'/2)4-/3934%-,%$ 2'"WITHmOOR RECESSEDMO DULESOF!,'/2)4-/&,//2 POWEREDTHROUGHTHESAME SHAREDELECTRICALCIRCUIT /NLYFOR2'",%$

?


!LGORITMO&LOOR)NSTALLATION

0OWERSUPPLYCABLESET INSIDEACORRUGATED TUBINGCONNECTED TOTHECONTROLINTERFACE %NDCAP

2ECESSINGPROlLE

,IGHTINGUNIT

%NDCAP

&IXINGBRACKET

%XTENSIONCABLE M MORCUSTOM MADE WITHINCORRUGATEDTUBING

3INGLELIGHTINGUNITS ORTHELIGHTINGUNITSSTARTINGANDENDINGAROWCANBEORMM BUTNEVERMM

MM MM MM

MM MM MM

MM MM MM

MM MM MM

MM MM MM

MM MM MM


&IXINGBRACKETS

2ECESSINGPROlLECUTONSITE TOTHEREQUIREDDIMENSION

%NDCAP

3TRAIGHTCONNECTOR

"LANKINGPLUG PROVIDEDWITH THESUPPLYCABLESET

?


!LGORITMO&LOOR 2ECESSINGUNIT #ANBECUSTOMCUT

,ENGTH MM MM

#ODE - -

   

"ODYLAMP ,%$7HITE

LV

7,%$ 7

,ENGTH MM

 7

MM

7

MM

7EIGHT  KG  KG  KG  KG  KG  KG

&LUX LM LM LM LM LM LM

##4 + + + + + +

#ODE -7 -. -7 -. -7 -.

)0)+ ª -AXIMUMLOAD.

,6INTEGRATEDTHROUGH WIRING 0OWERSUPPLYANDLIGHTMANAGEMENTSYSTEMTOBEORDEREDSEPARATELY





 



"ODYLAMP ,%$2'" 7,%$ 7  7 7

LV ,ENGTH MM MM MM

7EIGHT  KG  KG  KG

#ODE - - -

-AXIMUMLOAD.





,6INTEGRATEDTHROUGH WIRING 0OWERSUPPLYANDLIGHTMANAGEMENTSYSTEMTOBEORDEREDSEPARATELY

)0)+ ª

 




#ONNECTIONCOMPONENTSANDFORMWORKlNISH

0OWERSUPPLY LIGHTMANAGEMENTSYSTEMFOR,%$ #ODE LV

%NDCAPSETOF INALUMINIUM

%LECTRONICPOWERSUPPLY )0 )NPUTVOLTAGERANGE  6!# 6$# /UTPUTVOLTAGE6$#0ROTECTION AGAINSTOVERCURRENT OVERVOLTAGE SHORT CIRCUITANDOVERTEMPERATURE WITHAUTOMATICRESTART 7 4OSUPPLYUPTOATOTAL7 XXMM

-

7 4OSUPPLYUPTOATOTAL7 XXMM

-

7 4OSUPPLYUPTOATOTAL7 XXMM

-

#ODE -

&IXINGBRACKETSETOF INSTAINLESSSTEEL #ANSLIDEALONGTHEPROlLE (EIGHTADJUSTMENTRANGINGMM

-

3TRAIGHTMECHANICALCONNECTOR SETOF INSTAINLESSSTEEL &ORTHEMECHANICALCONNECTION OFTHERECESSINGPROlLES

-

#ODE LV

)0 LV

)0

#ONTROLINTERFACE &ORMANAGINGGROUPS OF!LGORITMO3YSTEM ANDOR!LGORITMO&LOORLIGHTINGUNITS )NTEGRATEDSEQUENCERFORSTAND ALONE OPERATIONWITHPREDElNEDCOLOUR SEQUENCE0OSSIBILTYOFMASTER SLAVE CONlGURATION $!,)OR$-8LIGHTMANAGEMENT SYSTEMSARENOTINCLUDED

)0#OMPATIBLE$!,) 3WITCH$IMM XXMM

-

)0#OMPATIBLE$!,) 3WITCH$IMM OR$-8 XXMM

-

)0#OMPATIBLE$!,) 3WITCH$IMM 3UITABLEFOR$).RAILMOUNTING XXMM

-

)0#OMPATIBLE$!,) 3WITCH$IMM OR$-8 3UITABLEFOR$).RAILMOUNTING XXMM

-

&ORELECTRICALDIAGRAM PLEASESEEPAGE

%LECTRICALCOMPONENTS #ODE LV

LV

LV

0OWERSUPPLYCABLESET #ONSISTSOFONEM LONGPOWER SUPPLYCABLEX MMยง TOCONNECT THElRSTLUMINAIRETOTHECONTROLINTER FACE BLANKINGPLUGTOSEALTHELAST LUMINAIREOFTHEROW ,ENGTHM ,ENGTHM ,ENGTHM

- - -

%XTENSIONCABLE X MMยง ,ENGTHM ,ENGTHM

- -

%LECTRICALCONNECTOR 4OCOUPLEWALL SURFACEANDWALL RECESSEDMOUNTED,%$MODULESOF ALGORITMOSYSTEM,%$2'"LV WITH mOOR RECESSEDMODULESOFALGORITMO mOORLV POWEREDTHROUGHTHESAME SHAREDELECTRICALCIRCUIT

-

?


!3MART #ARLOTTADE"EVILACQUA 

s,%$ s77 7 s LUMEN s##4++ s#2) s)0

s/PTIMIZEDVERSIONINLINEAPPLICATIONSWITHWIDE LENGHTS s$IFFUSINGDIRECTANDDIRECT INDIRECTEMISSION s2ECESSEDTRIM TRIMLESS SUSPENSIONANDCEILING VERSIONS s$IMMABLEANDNONDIMMABLEINTWO##4+ AND+VERSIONS


?


3TRUCTURALMODULERECESSED

"LACK

4RIMLESS 7 7

,ENGTH MM

&LUX LM

7

MM

LM

##4 + + + +

4RIM 7 7

,ENGTH MM

&LUX LM

##4 +

#OLOR

+ 7

MM

LM

+ +

!CCESSORIESTRIMLESS

$IMMABLE

.ONDIMMABLE

#ODE !4 !4 !4 !4

#ODE !4 !4 !4 !4

$IMMABLE

.ONDIMMABLE

#ODE !4 !4 !4 !4 !4 !4 !4 !4

#ODE !4 !4 !4 !4 !4 !4 !4 !4

!CCESSORIESTRIM #ODE !4 !4

$IFFUSINGELEMENT,MM $IFFUSINGELEMENT,MM

#ODE !4 !4

$IFFUSINGELEMENT,MM $IFFUSINGELEMENT,MM

%NDCAP

!4

%NDCAP

!4 !4

3UPPLYKITPOLES RECESSEDCEILING

!4

3UPPLYKITPOLES RECESSEDCEILING

!4

$!,)3UPPLYKITPOLES RECESSEDCEILING

!4

$!,)3UPPLYKITPOLES RECESSEDCEILING

!4

$IFFUSINGELEMENT ,M

!4

+ITFRAMETRIMLESS ,MM

!4

#OLOR

7HITE


3TRUCTURALMODULESUSPENSION CEILING

"LACK

3USPENSION $IRECTEMISSION 7 7

,ENGTH MM

&LUX LM

##4 +

$IMMABLE

.ONDIMMABLE

#OLOR

#ODE !4 !4 !4 !4 !4 !4 !4 !4

#ODE !4 !4 !4 !4 !4 !4 !4 !4

$IMMABLE

.ONDIMMABLE

#OLOR

#ODE !4 !4 !4 !4 !4 !4 !4 !4

#ODE !4 !4 !4 !4 !4 !4 !4 !4

+ 7

MM

LM

+ +

3USPENSION $IRECT INDIRECTEMISSION 7 7

,ENGTH MM

&LUX LM

##4 + +

7

MM

LM

+ +

7HITE







#EILING 7 7

,ENGTH MM

&LUX LM

##4 +

#OLOR

+ 7

MM

LM

+ +

$IMMABLE

.ONDIMMABLE

#ODE !4 !4 !4 !4 !4 !4 !4 !4

#ODE !4 !4 !4 !4 !4 !4 !4 !4







!CCESSORIESCEILING

!CCESSORIESSUSPENSION #ODE !4 !4

#ODE !4 !4

$IFFUSINGELEMENT,MM $IFFUSINGELEMENT,MM

%NDCAP

!4 !4

,INEARJOINT SUSPENSIONCEILING

!4

3UPPLYKITPOLES RECESSEDCEILING

!4

3UPPLYKITPOLES SUSPENSION

!4

$!,)3UPPLYKITPOLES RECESSEDCEILING

!4

$!,)3UPPLYKITPOLES SUSPENSION

!4

,INEARJOINT SUSPENSIONCEILING

!4

3TEELSUSPENSIONCABLE WITHQUICKADJUSTMENT ,ENGTHMETERS

-

$IFFUSINGELEMENT,MM $IFFUSINGELEMENT,MM

#OLOR

?


#EILING RECESSED MOUNTED STRUCTURALMODULE

0RE WIREDBOARD

$IFFUSER


?


.OTHING3YSTEM %RNESTO'ISMONDI 


!TELIER%ERA #AVAION6ERONESE)TALY !RCH!LBERTO3ALVADORI 0HOTO-ARCO:ANTA

? ?   


.OTHING3YSTEM2ECESSEDCEILING#OMPONENTS

3TRUCTURALMODULES

*UNCTION COMPONENTS

3TRUCTURALMODULE FORRECESSEDWALLINSTALLATION 4RIMLESSRING NEEDSPLASTERlNISH %NDCAPS ANGLES INTERMEDIATECONNECTORS ANDOPTICSTOBEORDERED SEPARATELY

%NDCAPS SETOF

)NTERMEDIATECONNECTOR TOBEUSEDFORCOMBINING SPOTLIGHTINGMODULES WITHDARKLIGHTORDIFFUSING EMISSION 

s2ECESSEDCEILINGANDSUSPENSIONMODULARSYSTEM s#OMPONENTSSTRUCTURALMODULESINEXTRUDED ALUMINIUM PRE WIREDGEARTRAYSANDOPTICS s3TRUCTURALMODULESAVAILABLEINLENGTHSFROM TOMM AND THANKSTOTHEIRFLEXIBILITY CANHOUSEANDFREELYALTERNATELIGHTSOURCES s4HEORIGINALSEQUENCECANBEMODIFIEDOVERTIME PROVIDEDTHETOTALLENGTHOFTHESYSTEMISKEPTTHE SAME s,INEARFLUORESCENTSOURCESWITHDIFFUSEDORDARK LIGHTEMISSIONS WHITEOR2'",%$SWITHDIFFUSED EMISSION SPOTMODULESFORACCENTLIGHTINGCAN BEALTERNATEDTOCUSTOMIZETHESEQUENCE WITHOR WITHOUTFLUORESCENTINDIRECTEMISSION s&EEDINGPLATESWITHTHROUGH CABLINGANDRAPID CONNECTORS s4OREMOVESHADOWSINTHEJOININGAREABETWEEN FLUORESCENTLIGHTS 4 3EAMLESSLAMPSOR TRADITIONAL4FLUORESCENTTUBESWITHOVERLAPPING ARRANGEMENTSFORUNINTERRUPTEDLIGHTLINES s,%$VERSIONSWITHMONOCHROMATICWARMWHITE EMISSIONS+ NEUTRALWHITEEMISSION+ AND2'"EMISSION s3AME PLANEANGULARCONFIGURATIONSAVAILABLE PERPENDICULARANGULARCONFIGURATIONSAVAILABLE ONREQUEST s#OMPLIANTWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS

ªANGLE TOMECHANICALLYCONNECT RECESSEDMODULESONTHE SAMEPLANE 


0RE WIREDGEARTRAYS

-6

,%$

0RE WIREDGEARTRAY FORWHITE,%$DIRECT DIFFUSEDEMISSION PRISMOPTIC )NTEGRATED -6THROUGH WIRING

,6

,%$

0RE WIREDGEARTRAY FORWHITE2'",%$DIRECT DIFFUSEDEMISSION )NTEGRATED ,6THROUGH WIRING

-6

-6

0RE WIREDGEARTRAY FORmUORESCENT4TUBES $IFFUSEDDIRECTEMISSION )NTEGRATED -6THROUGH WIRING

0RE WIREDGEARTRAY FORmUORESCENT4TUBES $ARKLIGHTDIFFUSED DIRECTEMISSION )NTEGRATED -6THROUGH WIRING

-6

0RE WIREDGEARTRAYFOR mUORESCENT4 3,3TUBES $IFFUSEDDIRECTEMISSION )NTEGRATED -6THROUGH WIRING

%LECTRICAL COMPONENTS

-6

,6

3UPPLEMENTARY THROUGH WIRING/PTIONAL  4OBEUSEDINCONlGURATION WITH,6AND-6PRE CABLED GEARTRAYS

-6

0OWERSUPPLYKIT

/PTICALSYSTEM

#LOSINGJOINING SCREENS

,%$

/PALDIFFUSERINPOLYCARBONATE FOR,%$DIFFUSEDVERSIONS

,6

,%$POWERSUPPLIES ANDCONTROLSYSTEMS

,6

*UNCTIONTOBElTTED TOTHEMODULEONTHESAME PLANE #OMPATIBLEWITHTHEJUNCTION FORTHESAMEPLANE

%LECTRONICPOWERSUPPLY UNIT)0

,6

/PAL0--!DIFFUSER FORmUORESCENTVERSIONS

#ONTROLINTERFACE )0AND)0 !LLOWSMANAGEMENT OFGROUPSOF,6lTTINGS

-6

!CCENTMODULES

$ARKLIGHTOPTICS FORmUORESCENTVERSIONS

0RISMOPTICSOPTICSFORWHITE ,%$VERSIONS

?


.OTHING3YSTEM2ECESSEDCEILING

3TRUCTURALMODULES

,ENGTH

0RE WIREDGEARTRAYS

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

$,

MM

$,

,ENGTH !CCENTMODULE

MM

,

,%$PRE WIREDGEARTRAY

MM

,

,%$PRE WIREDGEARTRAY

MM

,

4 3,3DIFFUSEDPRE WIREDGEARTRAY

MM

,

$IFFUSEDmUO4GEAR

MM

,

$ARK LIGHTmUO4GEARSINGLE

MM

$,

$ARK LIGHTmUO4GEARDUAL

MM

$,

$IFFUSORFOR,%$OR&LUO

MM

,

$IFFUSORFOR,%$OR&LUO

MM

,

$IFFUSORFOR,%$OR&LUO

MM

,

$IFFUSORFOR,%$OR&LUO

MM

,

$IFFUSORFOR,%$OR&LUO

MM

,

$ARKLIGHT&LUO/PTIC

MM

$,

0RISMOPTICFORWHITE,%$

MM

,

0RISMOPTICFORWHITE,%$

MM

,

/PTICS

,ENGTH


3TRUCTURALMODULE ,ENGTH MM

,

#ODE -

MM

,

-

MM

,

-

MM

,

-

MM

,

-

MM

,

-

MM

,

-

MM

,

-

MM

$,

-

MM

$,

-

Xâ&#x2C6;&#x2018;, MM

!CCESSORIES #OLOR %NDCAPS SETOF

#ODE -

)NTERMEDIATEJOINT 5SEDTOCONNECTACCENTLIGHTING MODULESTODARKLIGHTORDIFFUSED MODULES

- -

ªJOINT 4OCONNECTTWORECESSEDMODULES ONTHESAMEPLANE

-

 

  

?


.OTHING3YSTEM#EILING3USPENSION#OMPONENTS

3TRUCTURALMODULES

)NSTALLATION COMPONENTS

*UNCTION COMPONENTS

3TRUCTURALMODULE FORCEILING ORSUSPENDED MOUNTING %NDCAPS ANGLES lXING COMPONENTS PLATES ANDOPTICSTOBEORDERED SEPARATELY

s#EILING MOUNTEDANDSUSPENDEDMODULARSYSTEM s#OMPONENTSSTRUCTURALMODULESINEXTRUDED ALUMINIUM PRE WIREDGEARTRAYSANDOPTICS

#EILINGlXINGBRACKET PIECE

%NDCAPS SETOF

3TEELSUSPENSIONCABLE PIECE

)NTERMEDIATEJOINT TOBEUSEDFORCOMBINING SPOTLIGHTINGMODULESWITH mUORESCENTMODULESWITH DARKLIGHTORDIFFUSING EMISSION

-6

,6

s3TRUCTURALMODULESAVAILABLEINLENGTHSFROM TOMM AND THANKSTOTHEIRFLEXIBILITY CANHOUSEANDFREELYALTERNATELUMINAIRES s4HEORIGINALSEQUENCECANBEMODIFIEDOVERTIME PROVIDEDTHETOTALLENGTHOFTHESYSTEMISKEPTTHE SAME s,INEARFLUORESCENTSOURCESWITHDIFFUSEDORDARK LIGHTEMISSIONS WHITEOR2",%$SWITHDIFFUSED EMISSIONANDPRISMOPTIC SPOTMODULESFORACCENT LIGHTINGCANBEALTERNATEDTOCUSTOMIZETHE SEQUENCE WITHORWITHOUTFLUORESCENTINDIRECT EMISSION

3USPENSIONSETWITHSTEEL CABLEANDPOWERSUPPLY CABLEPIECE ,ENGTHMM

,INEARCONNECTOR

s3UPPLYPLATESWITHTHROUGH WIRINGANDRAPID CONNECTORS s4OREMOVESHADOWSINTHEJOININGAREABETWEEN FLUORESCENTLIGHTS 4 3EAMLESSLAMPSOR TRADITIONAL4FLUORESCENTTUBESWITHOVERLAPPING ARRANGEMENTSFORUNINTERRUPTEDLIGHTLINES s,%$VERSIONSWITHMONOCHROMATICWARMWHITE EMISSIONS+ NEUTRALWHITEEMISSION+ AND2'"EMISSION s3AME PLANEANGULARCONFIGURATIONSAVAILABLE PERPENDICULARANGULARCONFIGURATIONSAVAILABLE ONREQUEST s#OMPLIANTWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS

ªJOINT TOCONNECTTWOMODULES ONONESAMEPLANE 


0RE WIREDGEARTRAYS

-6

,%$

0RE WIREDGEARTRAY FORWHITE,%$DIRECT DIFFUSEDEMISSIONAND PRISMOPTIC )NTEGRATED -6THROUGH WIRING

,6

,%$

0RE WIREDGEARTRAY FORWHITE2'",%$DIRECT DIFFUSEDEMISSION )NTEGRATED ,6THROUGH WIRING

-6

-6

0RE WIREDGEARTRAY FORmUORESCENT4TUBES $IFFUSEDDIRECTEMISSION )NTEGRATED -6THROUGH WIRING

0RE WIREDGEARTRAY FORmUORESCENT4TUBES )NDIRECTEMISSION

-6

,6

3UPPLEMENTARYTHROUGH WIRING /PTIONAL  4OBEUSEDINCONlGURATION WITH,6AND-6PRE CABLED GEARTRAYS

-6

0OWERSUPPLYKIT

/PTICALSYSTEM

#LOSINGJOINING SCREENS

,%$

/PALDIFFUSERINPOLYCARBONATE FOR,%$DIFFUSEDVERSIONS

,6

,%$POWERSUPPLIES ANDCONTROLSYSTEMS

.6

*OINTSBETWEENEACHTWO MODULESONTHESAMELEVEL #OMPATIBLEWITHJOINTSFOR CONNECTIONONTHESAME LEVEL

%LECTRONICPOWERSUPPLY UNIT)0

,6

/PAL0--!DIFFUSER FORmUORESCENTVERSIONS

#ONTROLINTERFACE )0AND)0 !LLOWSMANAGEMENT OFGROUPSOF,6lTTINGS

-6

-6

0RE WIREDGEARTRAYFOR mUORESCENT4 3,3TUBES $IFFUSEDDIRECTEMISSION )NTEGRATED -6THROUGH WIRING

%LECTRICAL COMPONENTS

0RE WIREDGEARTRAY FORmUORESCENT4TUBES $ARKLIGHTDIRECTEMISSION )NTEGRATED -6THROUGH WIRING

$ARKLIGHTOPTICS FORmUORESCENTVERSIONS

-6

!CCENTMODULES

0--!PRISMOPTICSOPTICS

?


.OTHING3YSTEM#EILING3USPENSION

3TRUCTURALMODULES

,ENGTH

0RE WIREDGEARTRAYS

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

$,

MM

$,

MM

$,

,ENGTH !CCENTMODULE

MM

,

,%$PRE WIREDGEARTRAY

MM

,

,%$PRE WIREDGEARTRAY

MM

,

4 3,3DIFFUSEDPRE WIREDGEARTRAY

MM

,

0IASTRA&LUODIFFUSER4

MM

,

0IASTRA&LUODARK LIGHT4SINGLE

MM

$,

0IASTRA&LUODARK LIGHT4DOUBLE

MM

$,

$IFFUSERFOR,%$OR&LUO

MM

,

$IFFUSERFOR,%$OR&LUO

MM

,

$IFFUSERFOR,%$OR&LUO

MM

,

$IFFUSERFOR,%$OR&LUO

MM

,

$IFFUSERFOR,%$OR&LUO

MM

,

$ARKLIGHT&LUO/PTIC

MM

$,

0RISMOPTICFORWHITE,%$

MM

,

0RISMOPTICFORWHITE,%$

MM

,

/PTICS

,ENGTH


7HITE

'LOSSANODISED

3TRUCTURALMODULE ,ENGTH MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

,

MM

$,

MM

$,

MM

$,

#OLOR

#ODE - - - - - - - - - - - - - - - - - - - - - - - -

#OLOR

#ODE - -

!CCESSORIES %NDCAPS SETOF

,INEARCONNECTOR PIECE

-

#EILINGlXINGBRACKET PIECE

-

)NTERMEDIATEJOINT 4OBEUSEDFORCOMBININGSPOTLIGHTING MODULESWITHmUORESCENTMODULES WITHDARKLIGHTORDIFFUSINGEMISSION

- -

ยชJOINT 4OMECHANICALLYCONNECTMODULESONONESAME PLANE

- -









3TEELSUSPENSIONCABLE PIECE  ,ENGTHMM

-6

,6

-

3USPENSIONSETWITHSTEELCABLE ANDPOWERSUPPLYCABLE,ENGTHMM ,6X MMยง  &ORPOWERING,%$2'"PLATES

-

-6X MMยง X MMยง  &ORPOWERINGmUORESCENTMODULES WHITE,%$PLATESANDACCENTMODULES

-

?


.OTHINGSYSTEM3TRUCTURALMODULES

,INEWITHmUORESCENT4 DIFFUSERMODULES

,

,

,

,

,

, , O, ,

,INEWITHmUORESCENT4 3,3DIFFUSERMODULES

,

,

X, OX, OX,

-IXEDLINEWITHmUORESCENT4 3,3DIFFUSERMODULESANDSPOTLINGACCENTUNITS

,

, , O, , ,

,

,

,




,

,

,

,

,

,

,

?


7IREDGEARPLATES

7HITE,%$DIRECTEMISSION 7 7

,ENGTH MM ,

7

MM ,

##4 + + + +

NONDIMMABLE

$ALI 3WITCH$IM

#ODE - - - -

#ODE - - - -

-6

,%$

,6

,%$

)NTEGRATED-6THROUGH CABLING

2'",%$DIRECTEMISSION 7,%$ 7

,ENGTH MM ,

#ODE -

)NTEGRATED,6THROUGH CABLING 0OWERSUPPLYGROUPSANDLIGHTINGMANAGEMENTKITSAREREQUIRED4OBEORDEREDSEPARATELY

$IRECTDIFFUSEDEMISSION4'

NONDIMMABLE

7 X7

#ODE -

,ENGTH MM ,

$IRECTDIFFUSEDEMISSION4'

$ALI 3WITCH$IM

7 X

#ODE -

,ENGTH MM ,

-6

)NTEGRATED-6THROUGH CABLING

$IRECTDIFFUSEDEMISSION4 3,3'

NONDIMMABLE

7 X7

#ODE -

,ENGTH MM ,

$IRECTDIFFUSEDEMISSION4'

$ALI 3WITCH$IM

7 X

#ODE -

,ENGTH MM ,

-6

)NTEGRATED-6THROUGH CABLING

)NDIRECTEMISSION4' 7 X7 X7

NONDIMMABLE ,ENGTH MM MM

-6

#ODE - -

5PPERSCREENIN0-!!INCLUDED

ª


$IFFUSEDEMISSION

$IFFUSERFOR,%$MODULES ,ENGHT MM MM MM MM MM

, , , , ,

#ODE - - - - -

ª

$IFFUSERFORmUORESCENTMODULES ,ENGTH MM MM MM MM MM

, , , , ,

#ODE - - - - -

ª

0RISMOTIC

$IFFUSERFOR,%$MODULES ,ENGTH MM MM

, ,

#ODE - -

ª

?


7IREDGEARPLATESmUODIRECTEMISSIONDARK LIGHT

$IRECTEMISSION4' 7 X7 X7

NONDIMMABLE ,ENGTH MM $, MM $,

$IRECTEMISSION4' 7 X7 X7

-6

#ODE - -

$ALI 3WITCH$IM ,ENGTH MM $, MM $,

#ODE - -

)NTEGRATED-6THROUGH CABLING

$ARK,IGHT/PTICS

,ENGTH MM

5'2 θª %HM %HM

#ODE -

$,

7 LUX

ª

LUX

"LACK

!CCENTMODULES

,%$'5 7 X7

-6 ,ENGTH MM

#OLOR ,

#ODE -

)NTEGRATEDELECTRONICPOWERSUPPLY )NTEGRATED-6THROUGH CABLING

ª ª

ª


3HOWROOM6ODAFONE-ILAN)TALY

?


!CCESSORIES

0OWERSUPPLYLIGHTMANAGEMENTSYSTEMFOR,%$

#OLOR

#ODE ,6

#LOSUREPANEL ,ENGTHMM, 

%LECTRONICPOWERSUPPLY )0)NPUTVOLTAGERANGE  6!# 6$# /UTPUTVOLTAGE6$#0ROTECTION AGAINSTOVERCURRENT OVERVOLTAGE SHORT CIRCUITANDOVERTEMPERATURE WITHAUTOMATICREACTIVATION 7 &ORFEEDINGUPTOATOTAL7 XXMM

-

7 &ORFEEDINGUPTOATOTAL7 XXMM

-

7 &ORFEEDINGUPTOATOTAL7 XXMM

-

#LOSURESCREENSFORªJOINTS #ODE *UNCTIONTOBElTTEDFORMODULES ATªONTHESAMEPLANE #OMPATIBLEWITHTHEJUNCTION FORTHESAMEPLANE



,6

#ODE -

#ONTROLINTERFACE )TALLOWSTHEMANAGEMENTOF,%$RGB GROUPSOF.OTHING3YSTEMDEVICES THROUGH$ALIOR$MXLIGHTMANAGE MENTSYSTEMSNOTINCLUDED 



&ORCONTINUITYBETWEEN,%$DIFFUSED EMISSIONMODULESANDSPOT MODULES

-

&ORCONTINUITYBETWEEN mUODIFFUSEDEMISSIONMODULES

-

&ORCONTINUITYBETWEEN mUODARKLIGHTEMISSIONMODULES

-

,IGHTSOURCES

)0 ,6

)0

)NTEGRATEDSEQUENCERFORSTAND ALONE OPERATIONWITHPREDElNEDCOLOUR SEQUENCE0OSSIBILTYOFMASTER SLAVE CONlGURATION

#ODE &LUORESCENTTUBE 4 3%!-,%33' PIECE -

)0#OMPACTIBLE$!,) 3WITCH$IMM OR$-8 XXMM

-

)0#OMPACTIBLE$!,) 3WITCH$IMM 3UITABLEFOR$).RAILMOUNTING XXMM

-

&LUORESCENTTUBE4' PIECE

)0#OMPACTIBLE$!,) 3WITCH$IMM OR$-8 3UITABLEFOR$).RAILMOUNTING XXMM

-

7+ DIRECT 7+ DIRECT 7+ DIRECT 7+ DIRECT 7+ INDIRECT 7+ INDIRECT

&ORELECTRICALSCHEME PLEASESEEPAGE

%LECTRICALCOMPONENTS #ODE -6

-6

,6

,6

7+ 7+ 7+ 7+

)0#OMPACTIBLE$!,) 3WITCH$IMM XXMM

/PTIONALTHROUGH WIRING OPTIONAL  2EQUIREDFORCONlGURATIONS INCLUDING,6AND-6PRE CABLED GEARTRAYS ,6 MM ,6 MM ,6 MM INTHEEVENTOF@NCABLED GEARPLATESOFMLENGTH THElRST@. WILLUSEOPTIONAL THROUGH WIRINGL WHEREASTHELASTGEARPLATEWILLUSE ANOPTIONALCABLE,

- - -

,6 MM -6 MM -6 MM

- - -

0OWERSUPPLYKIT %NABLESCONNECTIONTOTHElRSTPRE WIREDGEARTRAYOFTHEINITIALMODULE 4OBEUSEDONLYWITHCEILING RECESSED ANDCEILING MOUNTEDINSTALLATIONS ,6XMAX MM§ &ORPOWERING,%$2'"TRAYS

-

-6XMAX MM§ &ORPOWERINGmUORESCENTMODULES WHITE,%$PLATESANDACCENTMODULES

-

- -

- - - - - -


.OTHING,%$MANAGEMENT,6 ELECTRICALSCHEME

3TAND ALONE

"%4*

7"$

1

%"-* %.9 4XJUDI%JNN

"

7$$

0OWERSUPPLYUNIT -07 -07 -07

#ONTROLINTERFACE -- $!,) 3WITCH$IM -- $!,) 3WITCH$IMOR$-8

# 8

8

8O

,%$lTTING

,%$lTTING

,%$lTTING

8O

â&#x2C6;&#x2018;W < 0,8P 2A + B < 50m n < 24 units

,%$lTTING

3TAND ALONE

#

" "%4*

7"$

1

%.9 %"-* 4XJUDI%JNN

8

8

8O

8

8

8N

â&#x2C6;&#x2018;W < 0,8P 2(A +A ) + B ¹ + B² < 50m ¹ < 24 ² units n+m

7$$

#

"

0OWERSUPPLYUNIT -07 -07 -07

#ONTROLINTERFACE -- $!,) 3WITCH$IM -- $!,) 3WITCH$IMOR$-8

8N

,%$lTTING

,%$lTTING

,%$lTTING

,%$lTTING

8O

8O

-AXIMUMVALUES &ORLIGHTINGDESIGN PLEASEUSEDATAAVAILABLE ONTHECONTROLINTERFACEMANUAL

-ASTER SLAVE

"%4*

7"$

1

%"-* %.9 4XJUDI%JNN

#

"

7$$

8

8

â&#x2C6;&#x2018;W < 0,8P ¹ 2A + B < 50m n <¹ 24 ¹units

"%4* #

" 7"$

1

7$$

8

8

â&#x2C6;&#x2018;W < 0,8P ² 2A + B < 50m ² 24²units m<

8N

"%4* #

" 7"$

1

0OWERSUPPLYUNIT -07 -07 -07

7$$

8

#ONTROLINTERFACE -- $!,) 3WITCH$IM -- $!,) 3WITCH$IMOR$-8

,%$lTTING

8

,%$lTTING

8L

,%$lTTING

8L

â&#x2C6;&#x2018;W < 0,8P ³ 2A + B < 50m ³ k <³ 24 units

,%$lTTING

?


?


'RAFA3YSTEM *EAN-ICHEL7ILMOTTE 

s%DGE"ACKLIGHTING4ECNOLOGY7 s LUMEN

s-ODULARSYSTEMWITHDIRECTEMISSIONANDINDIRECTWITH ,%$HIGHEFFICIENCY

s-AC!DAM3$#

s)NSTALLATIONWITHSUSPENSION

s"EAM8&

s3INGLEMOUNTING INCONTINUOUSLINEBYANGLEª FREE COMPOSITION

s,+ H s#2)++

s$IMMABLEELECTRONICPOWERSUPPLY$!,)

s#2)TYP

s-ATERIALSSTRUCTUREINEXTRUDEDALUMINUMANODISEDMATTE TOP SCREENWITHANTI DUSTPOLYCARBONATE STAPLESINDIFFERENTTONES

s5'2

s1UICKADJUSTMENTSTEELSUSPENSIONCABLES

s)0

s#OMPLIESWITH%. %. ANDOTHERSPECIFICSTANDARDS

8&%XTRAmOOD ª


?


'RAFA3YSTEM

3YSTEM-ODULES -ODULE X SINGLE

-ODULE X MODULAR

-ODULE X SINGLE

-ODULE X MODULARLINEAR

-ODULE X MODULARANGULAR

3USPENDED!CCESSORIES 3INGLE#LIP

!NGULAR"RACKETS

$OUBLE#LIP

-IXED-ODULES"RACKETS

!NGULAR#LIP


$RIVER,INKS

!

"

+ITDRIVER8 ENDLINKS POSSIBLEPOSITIONS! "

!

+ITDRIVER8 CENTRALLINKS POSSIBLEPOSITIONS! " #

!

!

"

"

"

!

#

#

"

+IT8CENTRALLINKS POSSIBLEPOSITIONS! "

!

"

!

+IT8CENTRALLINKS ONEPOSSIBLEPOSITION!

!

?


'RAFA3YSTEM

%XAMPLEOFACOMPLEXCONlGURATION -ODULES

LINEARMODULESX

ANGULARMODULESXANGOLARI

COMPOSABLEMODULESX

0OWERSUPPLIES

0OWERSUPPLYFOR LINKINGXMODULES

0OWERSUPPLYFOR LINKINGXMODULES

0OWERSUPPLYFOR LINKINGXMODULES


'RAFA3YSTEM

%XAMPLEOFACOMPLEXCONlGURATION #LIPS

#LIPMODULE

#LIPMODULE

#LIPMODULE

3USPENSIONKITMODULES

#LIPLINKINGMODULES

3USPENSION

0OINTSOFCABLEPOSITIONING

?


'RAFA3YSTEM

3TRUCTURAL-ODULEX #ABLES LINEAR

7 7

#2) TYP

7EIGHT  KG

"EAM 8&

ANGULAR

&LUX LM LM LM LM

##4 + + + +

#ODE -7 -. -7 -.

,INKINGCLIPSSEPARATELY $RIVER3%,6SUPPLIEDSEPARATELY



)0





3TRUCTURAL-ODULEX #ABLES LINEAR

7 7

#2) TYP

7EIGHT  KG

"EAM 8&

&LUX LM LM

##4 + +

#ODE -7 -.

,INKINGCLIPSSEPARATELY $RIVER3%,6SUPPLIEDSEPARATELY



)0






'RAFA3YSTEM

#LIPS #OLOR #LIPS SINGULARMODULE

,INKING#LIPS MODULES

,INKING#LIPS MODULES

,INKING#LIPS MODULES

,INKING#LIPS MODULESXWITH X

2OSEXMODULE POWERCABLEnMAXLENGTHMM /CCUPIES$!,)ADDRESS

%ND

$IMMABLE$!,) #ODE -

2OSEXMODULES POWERCABLEnMAXLENGTHMM CONNECTIONCABLE POWERCONNECTIONCOVER /CCUPIES$!,)ADDRESS

%NDAND#ENTRAL

-

2OSEXMODULES POWERCABLESnMAXLENGTHMM CONNECTIONCABLE POWERCONNECTIONCOVER /CCUPIES$!,)ADDRESSES

#ENTRAL

-

2OSEXMODULES POWERCABLESnMAXLENGTHMM CONNECTIONCABLES POWERCONNECTIONCOVERS /CCUPIES$!,)ADDRESSES

#ENTRAL

-

65

$RIVER



74

424

X

#ODE - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

2ECESSKITFORROSES MODULES

-

XMM

?


'RAFA3TAND!LONE


3TRUCTURALMODULEX3TAND !LONE 7EIGHT "EAM 7 #2) 7 TYP  KG 8&

&LUX LM LM

##4 + +

$!,)

$!,) 3WITCH$IM

#ODE -7 -.

#ODE -7 -.



,INKINGCLIPSSEPARATELY 6AC(ZELECTRONICBALLASTINCLUDED /CCUPIES$!,)DESTINATION

)0



MAX



$!,)

$!,) 3WITCH$IM

#ODE -7 -.

#ODE -7 -.

3TRUCTURALMODULEX3TAND !LONE 7 7

7EIGHT #2) TYP  KG

"EAM 8&

&LUX LM LM

##4 + +



,INKINGCLIPSSEPARATELY 6AC(ZELECTRONICBALLASTINCLUDED /CCUPIES$!,)DESTINATION

)0



MAX



#LIPS #OLOR



#LIPSSINGULARMODULE

X

2ECESSKITFORROSES MODULES

#ODE - - - - - - #ODE -

XMM

?


0AD3YSTEM #ARLOTTADE"EVILACQUA 

s%DGE"ACKLIGHTING4ECNOLOGY7 7 s LUMEN

s-ODULARSYSTEMWITHDIRECTEMISSIONANDINDIRECT WITH,%$HIGHEFFICIENCY

s-AC!DAM3$#

s5LTRATHINPROFILE

s"EAM8&

s%DGE"ACKLIGHTING4ECHNOLOGY

s,+ H

s)NSTALLATIONWITHSUSPENSION

s##4++ s#2)TYP

s3INGLEMOUNTING INCONTINUOUSLINEBYANGLEª

FREECOMPOSITION

s5'2

s.ONDIMMABLE DIMMABLEELECTRONICPOWERSUPPLY $!,)

s)0

s-ATERIALSSTRUCTUREINEXTRUDEDALUMINUM s3USPENSIONCABLESINSTEELWITHQUICKADJUSTMENT s#OMPLIESWITH%. %. ANDOTHER SPECIFICSTANDARDS

8&%XTRAmOOD ª


?


0AD3YSTEM#ONlGURATION +ITDRIVERLINEARCONNECTOR -- X- X-. X- X-

X- X-. X- X-

X- X-. X- X-

+ITDRIVERLINEARAND ANGULARCONNECTOR - -- - - - ,INEARCONNECTOR !NGULARCONNECTOR

X- X- X-. X- X-

X- X-. X- X-

X- X-. X- X-

X- X-. X- X-

X- X-. X- X- X-

X- X-. X- X-

X- X- X-. X- X- X-

X- X-. X- X- X-

X- X-. X- X- X-


?


0AD3YSTEM

7HITE 'LOSSANODISED

$!,) 7 7

#2) 

7EIGHT  KG

"EAM 8&

&LUX ##4 LM +

#OLOR

6(3

LM +

#ODE -7 -7 -. -.

190

)0

16,5

1200

190

!CCESSORIES

1200

!CCESSORIES #ODE - -

#ODE 65

#OLOR

424 74

%NDCAP

, SHAPEDCONNECTOR

- -



CONNECTOR

-

+ITDRIVERLINEARCONNECTOR/CCUPIES$!,)DESTINATION

-

+ITDRIVERLINEARANDANGULARCONNECTOR- /CCUPIES$!,)DESTINATION

-

+ITDRIVERLINEARANDANGULARCONNECTOR- /CCUPIES$!,)DESTINATION

-

+ITDRIVERLINEARANDANGULARCONNECTOR- - - /CCUPIES$!,)DESTINATION

- -

ªSHAPED

+ITDRIVERLINEARCONNECTOR/CCUPIES$!,)DESTINATION

X

2ECESSKITFORROSES MODULES

-

XMM

0AD3YSTEM3TAND ALONE

$!,) 7 7

#2) 

7EIGHT  KG

"EAM 8&

&LUX ##4 LM +

#OLOR

LM +

#ODE -7 -7 -. -.

6(3 7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

)0

7EIGHT "EAM  KG 8&

&LUX ##4 LM + LM +

#OLOR

#ODE -7 -7 -. -. 190

6(3 7BD)[FMFDUSPOJDCBMMBTUJODMVEFE



#ODE - X

XMM

1200 16,5

#2) 

190

$!,) 3WITCH$IM 7 7

1200


?


3MART/FlCE $ESIGN/FFICE 


s,%$7 sLUMEN s##4 s"EAM8& s#2) s5'2 s)0

s$EDICATEDOFFICESUSPENSIONENSURINGTOP PERFORMANCEWITHUTMOSTFORMALSIMPLICITY s(IGHLYUNIFORMEMISSION WITHOUTMULTIPLE SHADOWSORSPOTS s)NNOVATIVEOPTICALSYSTEMTHELIGHTEMITTEDBY A,%$STRIPISCONTROLLEDBYAMIXINGCHAMBER BEFOREEMISSIONTHROUGHATRADITIONALLAMELLAR OPTICALUNIT s%LECTRONICANDELECTRONICDIMMERABLE$!,) POWERING s4WOSIZESANDTWOPOWEROPTIONS

8&%XTRAmOOD ª

?


3MART/FlCE

7HITE

$OUBLEEMISSION 7 ,ENGTH #2) 7 MM 

7 MM 

7EIGHT  KG

 KG

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

.ONDIMMABLE

$!,)

#ODE !' !' !' !' !' !' !' !'

#ODE !' !' !' !' !' !' !' !'

"LACK

)0

/CCUPIES$!,)DESTINATION







NBY













NBY







?


'RADIAN *-7ILMOTTE 

s%DGE"ACKLIGHTING4ECNOLOGY7 7 sLUMEN s-AC!DAM3$# s"EAM8& s,+ H s##4+ s#2) s)0

s!SYSTEMOFDIRECT EMISSIONPANELSWITH TWOMOUNTINGOPTIONSnCEILINGORWALLnIN INDIVIDUALORMULTIPLECONFIGURATIONS s(IGH EFFICIENCY,%$%DGE"ACKLIGHTING TECHNOLOGY s4HEOUTERFRAMECONSISTSOFASETOFPROTRUDING WINGSTHATCOLLECTTHEEMITTEDLIGHT THUS ENSURINGMAXIMUMVISUALCOMFORTWITHLIMITED CONTRASTBETWEENTHEAPPLIANCEANDITS BACKGROUND s%XTRUDEDALUMINIUMFRAMEAVAILABLEIN COLOURSWHITE GREY REDANDBLUE s#OMPLIESWITHTHE%.NORM 5'2

8&%XTRAmOOD ª


?


'RADIAN

'RADIAN8

$IMMABLE6 "EAM 8&

&LUX LM

##4 +

#OLOR

#ODE -7 -7 -7 -7



7EIGHT KG



)0

6AC(ZELECTRONICBALLASTINCLUDED

'RADIAN8 "EAM 8&

&LUX LM

##4 +

#OLOR

#ODE -7 -7 -7 -7



7EIGHT KG

$IMMABLE6

 

#2) 7 7 

2ED



#2) 7 7 

'REY

7HITE

)0

6AC(ZELECTRONICBALLASTINCLUDED

'RADIAN8 7EIGHT KG

"EAM 8&

##4 &LUX LM +

#OLOR

#ODE -7 -7 -7 -7



#2) 7 7 

$IMMABLE6





6AC(ZELECTRONICBALLASTINCLUDED

'RADIAN8 "EAM 8&

&LUX LM

##4 +

#OLOR

#ODE -7 -7 -7 -7



7EIGHT  KG

$IMMABLE6

 

7 #2) 7 

)0

)0

6AC(ZELECTRONICBALLASTINCLUDED

'RADIAN8 7EIGHT KG

$IMMABLE6 "EAM 8&

&LUX LM

##4 +

#OLOR

#ODE -7 -7 -7 -7 

7 #2) 7 

 

6AC(ZELECTRONICBALLASTINCLUDED

)0

"LUE


?


5GLARE 

s%DGE"ACKLIGHTING4ECNOLOGY7 sLUMEN s5'2 s-AC!DAM3$# s"EAM8& s##4++ s,IFE,+  s#2)MIN s)0

8&%XTRAmOOD ª

s5GLAREISXANDXRECESSEDCEILING LIGHT SUITEDTOILLUMINATEWORKINGAREASWITH VIDEO TERMINALS s)TSSTRONGSTEELANDALUMINIUMMECHANICAL CONSTRUCTIONANDHIGHPERFORMANCEOVER LM7FORTHE+VERSION ASWELLASTHE POSSIBILITYTOADJUSTTHELUMINOUSFLOW MAKE THISAPPLIANCEIDEALTOILLUMINATEWORKAREASTHAT REQUIREMINIMUMINCIDENCEINTERMSOFACTUALAND PERCEIVEDVOLUMESOFLIGHTINGSYSTEMS


?


5GLARE


5GLARE

'LOSSYWHITE

X #2) 7 7 

7EIGHT  KG

"EAM 8&

&LUX LM LM

##4 + +

#OLOR

#ODE - -

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

)0 )+ª









X #2) 7 7 

7EIGHT  KG

"EAM 8&

&LUX LM LM

##4 + +

#OLOR

#ODE - -

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

)0 )+ª









4"!2

4"!2

)NSTALLATIONWITHLUMINAIREINCORPORATED INTOTHEMODULARCEILINGSTRUCTURE

?


3USPENSION 2OSS,OVEGROVE 

0ATENT0ENDING.ª-)!


s,%$7

s/NLYMMTHICKALUMINIUMBODY

sLUMEN

s#ONTROLLEDDIRECTANDDIFFUSEDINDIRECTEMISSION

s-AC!DAM3$#

s4OUCHDIMMERONTHEMODULESBODYFOR 3USPENSIONONLY 

s##4+ s#2)MIN s)0

s)NDEPENDENTADJUSTMENTOFEACHINDIVIDUAL MODULE ALSOINMULTIPLECONFIGURATIONSFOR 3USPENSIONONLY  s0OSSIBILITYTOCONNECTUPTOMODULESWITHA SINGLEPOWERUNIT s-ECHANICALMAGNETIC ANDELECTRICCONNECTION ELEMENTSATTHETERMINALSOFEACHMODULE sªANDªCONNECTIONJOINTS s"OTH3USPENSIONAND3USPENSION "ASICCANBEUSEDINTHESAMECONFIGURATION

8&EXTRAmOOD ª

?


3USPENSION

$OUBLESIDEEMISSION


3USPENSION

7HITE

"LACK

3ILVER

$IMMABLE



#ODE $2,! $2,!. $2,!" $2,!"



7 #2) 7EIGHT "EAM &LUX ##4 3TRUCTURE #IRCUIT 7   KG 8& LM +



)0

3USPENSION"ASIC

.ONDIMMABLE



#ODE $2," $2,". $2,"" $2,""



7 #2) 7EIGHT "EAM &LUX ##4 3TRUCTURE #IRCUIT 7   KG 8& LM +



)0

0OWER SUPPLYKIT

7 MODULE

7 MODULES 7 MODULES

 

#ODE $2,!+! $2,!+! $2,!+! $2,!+! $2,!+" $2,!+" $2,!+" $2,!+" $2,!+# $2,!+# $2,!+# $2,!+#



3TRUCTURE #IRCUIT





#ODE $2,!+4# $2,!+4#. $2,!+4#" $2,!+4#"

 

3TRUCTURE #IRCUIT



 WAYCONNECTOR



  

#ODE $2,!+4# $2,!+4#. $2,!+4#" $2,!+4#"



3TRUCTURE #IRCUIT , SHAPEDCONNECTOR



 

#ODE $2,!40# $2,!40# $2,!40#



#OLOR %NDCAP

?


.OTA"ENE3YSTEM 

s&LUO7 sLUMEN

s0ENDANTSYSTEMWITHDIRECT INDIRECTLIGHTING USING7AND74FLUORESCENTLAMPS

s%LECTRONICBALLASTOR$!,)DIMMABLE ELECTRONICBALLAST

s"EAM!3

s!VAILABLEASASINGLEPENDANTLIGHTORASA MODULARSYSTEM

s4HESYSTEMCONSISTSOFPOWERSUPPLYUNITS WITHCEILINGPLATEANDPOWERSUPPLYCABLE ANDCONTINUITYMODULES

s5'2,CDM s)0

s3TEELBODYWITHAWHITEORGREYPAINTFINISH AVAILABLEINLENGTHSOFMMANDMM s$ARKLIGHTOPTICMADEFROMSUPERPURE ALUMINIUM s$ARKLIGHTEMISSIONISINCOMPLIANCEWITH %. STANDARD WITHAVERAGELUMINANCE LEVELSLOWERTHANTHECDM§LIMITFORAN OBSERVATIONANGLEOFªORABOVEWITHRESPECT TOTHEVERTICALAXIS s,IGHTOUTPUTRATIOX4 AND X4 

$ARKLIGHT ª

s,IGHTDISTRIBUTIONINDIRECTANDDIRECT X4 INDIRECTANDDIRECTX4 

s)NTERMODULEMECHANICALCONNECTIONBYLINEAROR ªCONNECTORS s%LECTRICALCONNECTIONVIAQUICKCONNECTORS s1UICKADJUSTMENTSTEELSUSPENSIONCABLES s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS


?


7HITE

.OTA"ENESUSPENSION

'REY

.OTA"ENEDARKLIGHT 4' 7 X7

,ENGTH MM

7EIGHT  KG

&LUX LM

X7

MM

 KG

LM

X7

MM

 KG

LM

X7

MM

 KG

LM

#OLOR

.ONDIMMABLE

$!,)

#ODE - - - - - - - -

#ODE

- -

- -

)0 ª

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE



MAX

Â&#x152;





.OTA"ENEDARKLIGHT 4' 7 ,ENGTH X7 MM

7EIGHT  KG

&LUX LM

X7 MM

 KG

LM

X7 MM

 KG

LM

X7 MM

 KG

LM

#OLOR

.ONDIMMABLE

$!,)

#ODE - - - - - - - -

#ODE

- -

- -

)0 ª

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE



MAX

Â&#x152;






7HITE

.OTA"ENE3YSTEM 0OWERMODULESDARKLIGHT 4' 7 X7

,ENGTH MM

7EIGHT  KG

&LUX LM

X7

MM

 KG

LM

X7

MM

 KG

LM

X7

MM

 KG

LM

#OLOR

'REY

.ONDIMMABLE

$!,)

EMERGENCYH

#ODE - - - - - - - -

#ODE

#ODE

- -

- -

- -

#ONTINUITYMODULESDARKLIGHT 4' 7 X7

,ENGTH MM

7EIGHT  KG

&LUX LM

X7

MM

 KG

LM

X7

MM

 KG

LM

X7

MM

 KG

LM

#OLOR

.ONDIMMABLE

$!,)

EMERGENCYH

#ODE - - - - - - - -

#ODE

#ODE

- -

- -

- -

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

)0 ª







#OMPONENTS #OLOR $ECORATIVEENDCOVER SETOF XXMM

CODE -

, SHAPEDCONNECTOR XXMM

- -

,INEARCONNECTOR XXMM

- -

3TEELSUSPENSIONCABLE #EILINGPLATEâ&#x2C6;&#x2026;MM LMM

-

?


)NCIPIT #ARLOTTADE"EVILACQUA &ABIO:ANOLA 

s,%$#/" s7 7 s LUMEN s-AC!DAM3$# s"EAM8& s#2)+ s#2)MIN s,IFE,+ H s)0

s!NALUMINIUMBODY FEATURINGALTERNATING VERTICALANDHORIZONTALELEMENTS ACCOMMODATES THE,%$ s4HEHORIZONTALBANDSWORKASOPTICALSECTORS APPROPRIATELYCALIBRATEDVSEACHOTHER s4HEINTERTWINEDVERTICALANDHORIZONTAL ELEMENTSARETHERESULTOFACCURATEOPTICAL ANDTECHNOLOGICALFEASIBILITYRESEARCHFORDIE CASTINGPRODUCTION4HEYALSOPROMOTEAIR CIRCULATIONWHENTHEAPPLIANCEISARRANGEDBOTH VERTICALLYANDHORIZONTALLY ANDALLOWNATURAL VENTILATIONBYCONVECTIONINALLPOSSIBLE USAGECONFIGURATIONS s#ALIBRATIONOFTHISSTRUCTURE INBOTHTHESMALL ANDLARGEVERSION RESULTSINOPTIMALOPTICAL DARKLIGHTINGANDDOWNLIGHTINGPERFORMANCE THUSENSURINGHIGHVISUALCOMFORT

7&7IDEmOOD ª ª

8&%XTRAmOOD ª

s!SMALL SIZEDMIXINGCHAMBERENSURESTHE CONTROLLEDDIRECTEMISSIONOFLIGHTRAYS s4HEOPTICALPERFORMANCEOFITSMECHANICAL SURFACESISADIRECTRESULTOFTHEPRODUCTION PROCESS WHICHINCLUDESTHEOPTIONALFINISHING OFSURFACESEITHERWITHSUBSEQUENTPROCESSING FINISHORWITHWHITEPAINT s4HEWHITEVERSION WITHWIDE APERTUREBEAMS ISSUITEDFORSOFTDOWNLIGHTING4HEDIFFUSING POWEROFTHEWHITESURFACESENSURESMINIMAL LEAKAGEOFLIGHTEMISSIONFROMWITHINTHEMESH TOGIVEALUMINOUSFOOTPRINTTOTHEBODY


?


)NCIPIT

$IFFUSEDANDREPROCESSEDRAYS

2EFLECTEDRAYSIN NARROW MEDIUMCONE

,IGHTEMISSIONCOMPLIANTWITH%. 5'2 ,UMINANCECDM ª!LUMINIUMVERSION

0!4%.40%.$).'

-ECHANIC -OREWITHLESS

/PTIC

4WOOPTICPERFORMANCES

4HERMAL

3TRUCTURE OPTICANDHEATSINK INONELIGHTENGINE

2EFLECTEDRAYS INWIDECONE


)NCIPIT

7HITE

3USPENSION

0USHDIMM "EAM ª ª

&LUX LM LM

##4 + +

#OLOR

#ODE -7 -7



#2) 7EIGHT 7 7 MIN  KG

0OLISHED!LUMINUM



6AC(ZELECTRONICBALLASTINCLUDED

)0

0USHDIMM "EAM ª ª

&LUX LM LM

##4 + +

#OLOR

#ODE -7 -7



#EILING #2) 7EIGHT 7 7 MIN  KG



)0

6AC(ZELECTRONICBALLASTINCLUDED

)NCIPIT

3USPENSION "EAM ª ª

&LUX LM LM

##4 + +

#OLOR

#ODE -7 -7 155

#2) 7EIGHT 7 7 MIN  KG

0USHDIMM

344

6AC(ZELECTRONICBALLASTINCLUDED

)0

0USHDIMM "EAM ª ª

&LUX LM LM

##4 + +

#OLOR

#ODE -7 -7

155

#EILING #2) 7EIGHT 7 7 MIN  KG

344

6AC(ZELECTRONICBALLASTINCLUDED

)0

?


%GGBOARD 'IACOBONE2OJ #-20ROJECT 


?


%GGBOARD

s,%$7DIRECT7INDIRECT ,%$7DIRECT7INDIRECT sLUMENDIRECTLUMENINDIRECT LUMENDIRECTLUMENINDIRECT s-AC!DAM3$# s"EAM8& s##4++ s#2)MIN s,IFE,+ H s5'2

s3USPENSIONAPPLIANCEWITHSOUND ABSORBING PROPERTIESENSUREDBYANUNUSUALSINUSOIDAL CROSS SECTIONDESIGNOFTHELOWERSURFACEAND THEUSEOFASOUND ABSORBINGMATERIAL s!COUSTICEFFICIENCYISENSUREDWITHINALIMITED SPACEBYPOSITIONINGATAPPROXIMATELYONEMETRE ABOVETHEHEADOFTHESPEAKERANDLISTENER s$IRECTEMISSIONABOARDWITHAHIGHNUMBEROF LOW VOLTAGE,%$SENSURESMAXIMUMLIGHTING COMFORT s2EFLECTORSCANBEROTATEDFORUSEONSINGLEOR COUNTERPOSEDDOUBLEDESK s#OMPLIESWITHTHENORMSONOFFICEACTIVITIESTHAT INVOLVETHEUSEOFVIDEO TERMINALS5'2 

s)0

s!VAILABLEINCOLOURSWHITE GREY GREEN AND DIFFERENTSIZES8MM 8MM 

8&%XTRAmOOD ª

8&%XTRAmOOD ª


?


?


%GGBOARDACOUSTICPANEL


0%4WADDINGPANEL

0%47ADDINGPANEL COMBINEDWITHFABRIC 4HESOUND ABSORBINGMATERIALACTSBYREDUCING THEREVERBERATIONTIMEIETHETIMEREQUIREDTO REDUCEANYNOISEINSIDETHEROOMBYDB SOAS TOENSURETHATANYECHOESDUETOREFLECTIONSON THEWALLSAREINAUDIBLE  4HEFREQUENCYOFHUMANVOICETYPICALLYRANGES FROMTOK(Z 4HEUSEOFMATERIALSCAPABLETOREDUCETHESE FREQUENCIESALLOWSBETTERUNDERSTANDINGOF SPEECHANDPREVENTSTHENEEDTOTALKLOUDLYTO COVERTHEBACKGROUNDNOISE 4HESOUND ABSORBINGAPPLIANCESHOULDBELOCATED  MMOFFTHECEILINGTOENSUREOPTIMAL OPERATION

.OSOUND ABSORBINGMATERIAL .OISEREDUCTIONWITH %GGBOARDINSTALLEDCMOFF THECEILING (Z

(Z

(Z

(Z

(Z

(Z

(Z

#-

?


%GGBOARD-ATRIXDESK

0%4WADDINGPANEL

/PTIONALINDIRECTLIGHTSOURCE

0%47ADDINGPANEL COMBINEDWITHFABRIC

,%$SOURCEANDREFLECTOR

9 2OTATINGTHEELLIPTIC BEAMREFLECTORALONGTHE9 AXISALLOWSTOUSETHEPRODUCTTOILLUMINATEONE WORKSTATION

5'2





  




%GGBOARD-ATRIXDESK

0%4WADDINGPANEL

/PTIONALINDIRECTLIGHTSOURCE

0%47ADDINGPANEL COMBINEDWITHFABRIC

,%$SOURCEANDREFLECTOR

8

2OTATINGTHEELLIPTIC BEAMREFLECTORALONGTHE8 AXISALLOWSTOUSETHEPRODUCTTOILLUMINATETWO WORKSTATIONS

5'2













?


%GGBOARD

7HITE

%GGBOARD-ATRIX$IRECT8 7 7

#2) 

7EIGHT KG

"EAM 8&

'REY

'REEN

$IMMABLE &LUX LM

##4 +

LM

+

#OLOR

#ODE -7 -7 -7 -. -. -.

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

)0













%GGBOARD-ATRIX$IRECT )NDIRECT8 #2) 7EIGHT "EAM 7 8& 7DIRECT  KG 7INDIRECT

$IMMABLE

#OLOR &LUX ##4 LMDIRECT + LMINDIRECT LMDIRECT + LMINDIRECT

#ODE -7 -7 -7 -. -. -.

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

)0













%GGBOARD8WITHOUTLIGHT #ODE - - -

)0

 

 

#OLOR



7EIGHT KG




%GGBOARD

7HITE

%GGBOARD-ATRIX$IRECT8 7 7

#2) 7EIGHT  KG

"EAM 8&

'REY

'REEN

$IMMABLE &LUX LM

##4 +

LM

+

#OLOR

#ODE -7 -7 -7 -. -. -.

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

)0



%GGBOARD-ATRIX$IRECT )NDIRECT8 #2) 7EIGHT "EAM &LUX 7 ##4 7DIRECT   KG 8& LMDIRECT + 7INDIRECT LMINDIRECT











$IMMABLE #OLOR

LMDIRECT + LMINDIRECT

#ODE -7 -7 -7 -. -. -.

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

)0













%GGBOARD8WITHOUTLIGHT #ODE - - -

)0









#OLOR



7EIGHT KG



?


?


3ILENT&IELD #ARLOTTADE"EVILACQUA ,AURA0ESSONI 


?


s,%$7 sLUMEN s"EAM8& s##4+ s#2) s)0

s3USPENSIONAPPLIANCEWITHSOUNDABSORPTION PROPERTIESTHEMATERIALSCHARACTERISTICSAND THEAPPLIANCESGEOMETRYENSUREAREDUCED REVERBERATIONTIME s4HESOUNDABSORPTIONEFFECTISOPTIMIZEDFORTHE FREQUENCIESOFHUMANVOICE s4HEVARYINGDENSITIESOFTHEMATERIALUSEDFORTHE LOWERPANELPROMOTETHEABSORPTIONOFDIFFERENT FREQUENCIES s"OTHTHEUPPERANDTHELOWERSURFACEOFTHE APPLIANCEFEATURESOUND ABSORBINGPROPERTIES !PPROPRIATEPOSITIONINGOFTHEAPPLIANCEINSPACE ISCRUCIALTOOPTIMIZESOUNDABSORPTION s%ACHUNITISEQUIPPEDWITHª ADJUSTABLE,%$ SPOTLIGHTSBASEDONAPATENTEDSYSTEM

8&EXTRAmOOD ª

s!VAILABLEINFIVECOLOURCOMBINATIONS


3ILENT&IELDS

7 7

#2) 

"LACK

"EAM 8&

&LUX LM

##4 +

#OLOR/PTICS

7HITE

/RANGE

#ODE ! ! ! ! !



NBY

)0



,OWDENSITY (IGHFREQUENCIES

6ERYHIGHDENSITY 6ERYLOWFREQUENCIES

-EDIUMDENSITY -EDIUMFREQUENCIES

#ONTROLLEDEMISSON SUITABLEFORWORK ENVIROMENTS

(IGHDENSITY ,OWFREQUENCIES

?


.UR!COUSTIC %RNESTO'ISMONDI 

s,%$7 sLUMEN s##4+ s#2) s)0

s3USPENSIONAPPLIANCEWITHSOUND ABSORBING PROPERTIESTHEMATERIALSCHARACTERISTICSANDTHE GEOMETRYOFTHEDOMETHATCAPTURESSOUNDWAVES REDUCETHEREVERBERATIONTIME s4HESOUND ABSORPTIONEFFECTISOPTIMIZEDFORTHE FREQUENCIESOFHUMANVOICE s$IRECTANDINDIRECTEMISSION s4WO COLOURTHEWHITEINSIDEOPTIMIZESLIGHT DIFFUSION

8&EXTRAmOOD ª


$ARKGREY

’

&LUX LM

##4 +

#OLOR

#ODE !

MAX

#2) 



7 7,%$

’

)0

?


#HOCOLATEmOOR AG,ICHT ,%$

#HOCOLATETERRA,%$ s#/",%$7INDIRECT ,%$7DIRECT sLUMENINDIRECT LUMENDIRECT s5'2 s-AC!DAMINDIRECT3$# -AC!DAMDIRECT3$#

s,UMINOUSFLUXDISTRIBUTION6ERSIONDESKn XMM4OTALFLUXPRODUCEDCONSISTS OFDIRECTEMISSIONANDINDIRECT EMISSION s6ERSIONDESKnXMM4OTALFLUX PRODUCEDCONSISTSOFDIRECTEMISSIONAND INDIRECTEMISSION

s#2)INDIRECTTYP #2)DIRECTMIN 

s4WOOPTIONSOFLIGHTMANAGEMENTDIMMABLE WITHMANUALINDEPENDENTCONTROLOFDIRECTAND INDIRECTEMISSION OR)NTERACTIVE$!,)SYSTEM OFFERINGAUTOMATICCONTROLOFILLUMINATION ONTHEWORKINGPLANE!SINGLEBUTTONALLOWS YOUTOSETTHEDESIREDLIGHTWITH )NTERACTIVE$!,)OPTION

s )0

sCOLOURSBROWNANDWHITE

s,+ INDIRECT ,+ DIRECT s##4++

s-ATERIALSHEADANDSTEMINPOLISHED ALUMINIUM BASEINPOLISHEDALUMINIUM OPTICSINMETALLIZEDPLASTIC DIFFUSERINCLEAR POLYCARBONATE s#OMPLIANTWITHSTANDARD%. ANDOTHER SPECIFICREGULATIONS

8&EXTRAmOOD ª

#HOCOLATETERRA&LUO s&LOORLAMPWITHDIRECT INDIRECTLIGHTINGUSING X7ORX74ANDXW4# ,%, LIGHTSOURCE s,IGHTOUTPUTRATIO4# ,%,VERSION AND 4  s,IGHTDISTRIBUTIONDIRECTANDINDIRECT 4# ,%,VERSION DIRECTANDINDIRECT 4  sLEVELSOFELECTRONICLIGHTMANAGEMENT DEPENDINGONTHEVERSIONELECTRONICBALLASTWITH POWERSWITCH DIMMINGCONTROLWITHMANUAL LIGHTINTENSITYADJUSTMENT SIMPLEMOTIONSENSOR WITHAUTOMATICONOFFSWITCHINGBASEDON PRESENCEANDLIGHTLEVEL ANDINTERACTIVE $!,) SYSTEMCOMBININGAMOVEMENTDETECTORANDA DAYLIGHTSENSORFORAUTO REGULATIONINRELATIONTO PEOPLEPRESENCEANDVARIATIONSINDAYLIGHT s/PTICALUNITANDPOLEMADEOFPAINTED ALUMINUM0AINTEDSTEELBASE sCOLOURSBROWNANDWHITE s/PTICSMADEOFTRANSPARENTPOLYCARBONATE FITTEDWITHAPRISMOPTICTYPEDIFFUSER s0OLYCARBONATEDUSTPROTECTIONSCREENTOBE ORDEREDSEPARATELY s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS


?


#HOCOLATETERRA,%$ DESK

#HOCOLATETERRA,%$ DESKS

4HEINNOVATIVEOPTICSYSTEM

SPECIlCALLYMADEWITH MICRO REmECTORS ALLOWS ADAZZLE FREE CONTROLLED ANDCONCENTRATEDLIGHTEMISSION FORSINGLEWORKSPACES XMM  DESKVERSION ORDOUBLEWORKSPACES XMM

 DESKSVERSION 

4HEALUMINIUMPROlLEWORKS ASHEATSINKTODISSIPATEHEAT $RIVERANDCOMPONENTS ARELOCATEDINTHECENTRAL COMPARTMENT 4HE,%$SLOCATED INEACHCORNERAREPROTECTED BYANINTEGRALANTI DUSTSCREEN

?


#HOCOLATETERRA,%$

"ROWN

,%$DESK 7 7EIGHT #2) &LUX 7INDIRECT KG MIN LM 7DIRECT LM LM LM

$IRECTEMISSION

##4 +

#OLOR

+

$IMMABLE

)NTERACTIVE$!,)

#ODE - - - -

#ODE - - - -

)NDIRECTEMISSION







  

)0

$OUBLEEMISSION



7HITE





  







5'2TRANSVERSELYTOATABLE

,%$DESKS &LUX 7EIGHT #2) 7 MIN LM 7INDIRECT KG LM 7DIRECT LM LM

$IRECTEMISSION

##4 +

#OLOR

+

$IMMABLE

)NTERACTIVE$!,)

#ODE - - - -

#ODE - - - -

)NDIRECTEMISSION



$OUBLEEMISSION



























5'2TRANSVERSELYTOATABLE

%COCOMFORT 7 7

&LUX 7EIGHT #2) MIN LM KG

##4 +

LM

+

#OLOR

.ONDIMMABLE

$IMMABLE

-OTIONDETECTOR

#ODE -7 -7 -. -.

#ODE -7 -7 -. -.

#ODE -7 -7 -. -.




#HOCOLATETERRA&LUO

#HOCOLATEmOOR4# ,%, HASBEENCERTIlEDACCORDINGTOTHE3WISS TOP QUALITY-INERGIEÂ&#x161;STANDARD

4' 7 X7

7EIGHT  +G

&LUX LM

X7

 +G

LM

7 X7

7EIGHT  +G

&LUX LM

X7

 +G

LM

#OLOR

#OLOR

.ONDIMMABLE

$IMMABLE

#ODE - - - -

#ODE - - - -

)NTERACTIVE $!,)

-OTIONDETECTOR

#ODE - - - -

#ODE - - - -

-OCHA

)0 ª



.ONDIMMABLE

$IMMABLE

#OLOR

#ODE - -

#ODE - -

#OLOR

#ODE - -

4# ,%,' 7EIGHT  +G

7 X7

&LUX LM

7HITE





)NTERACTIVE $!,)

!CCESSORIES





#ODE -

0OLYCARBONATEDUST PROTECTIONSCREEN SETOF  )NTERACTIVE $!,) REMOTECONTROL

-

)SOLUX

#ALCULATIONPARAMETERSTOISSUEISOLUXCURVE DIAGRAMS/FlCEWITHONEWORKSTATION ,ENGTHXWIDTHXHEIGHT X X M 2EmECTANCEFACTORSCEILINGWALLSmOOR 7ORKINGPLAN X X M -AINTENANCEFACTOR 7&

#HOCOLATEmOOR4

#HOCOLATEmOOR4# ,%,

4' X7 %MDESK LUX

4' X7 %MDESK LUX

4# ,%,' X7 %MDESK LUX

M

M

M

M



M

M 

 

M

M



M



 



MMMM

M

MMMM

M

MMMM

M

?


#HOCOLATESOSPENSIONE AG,ICHT 

s,%$7 sLUMEN s-AC!DAM3$# s,+ H s##4++ s#2)MIN s&LUO7 sLUMEN s)0

s3INGLEPENDANTLIGHTWITHDIRECT INDIRECTLIGHTING USING,EDANDX7ANDX74FLUORESCENT LAMPS s!LUMINIUMBODY sCOLOURSMOCHAANDWHITE s/PTICSMADEOFTRANSPARENTPOLYCARBONATEFITTEDWITH APRISMOPTICDIFFUSER s%LECTRONICCONTROLGEAR OR$!,) 3WITCH$IMDIMMABLE ELECTRONICCONTROLGEAR s%MERGENCYLIGHTINGONREQUEST s0OLYCARBONATEDUSTPROTECTIONCOVER s1UICKADJUSTMENTSTEELSUSPENSIONCABLES s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS

8&%XTRAmOOD ª


-OCHA

#HOCOLATESOSPENSIONE

,%$ 7 #2) 7 

.ONDIMMABLE 7EIGHT &LUX ##4  +G LM + LM

#OLOR

+

7HITE

$!,)DIMMABLE #ODE - - - -

#ODE - - - -

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE







MAX

)0 ª





4' 7 X7

%# 

7EIGHT  +G

&LUX LM

X7



 +G

LM

#OLOR

.ONDIMMABLE

$!,)DIMMABLE

#ODE - - - -

#ODE - -

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

?


#HOCOLATEPARETE AG,ICHT 

s,%$7 sLUMEN s-AC!DAM3$# s##4++ s#2)MIN

s7ALLLAMPWITHDIRECT INDIRECTLIGHTINGUSING,%$ ORX7ANDX74FLUORESCENTLIGHT SOURCE s0AINTEDALUMINUMBODY sCOLOURSMOCHAANDWHITE

s&LUO7

s/PTICSMADEOFTRANSPARENTPOLYCARBONATEFITTED WITHAPRISMOPTICTYPEDIFFUSER

sLUMEN

s%LECTRONICCONTROLGEAR

s)0

s0OLYCARBONATEDUSTPROTECTIONSCREEN s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS

8&%XTRAmOOD ª


#HOCOLATEPARETE

-OCHA

.ONDIMMABLE

,%$, 7 7

#2) 

7HITE

7EIGHT  +G

&LUX LM

##4 +

#OLOR

#ODE - - - -

#OLOR

#ODE - - - -

+ 7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

7EIGHT  +G

&LUX LM

##4 +

LM

+

)0 ª



#2) 

 

.ONDIMMABLE

,%$, 7 7

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE











4'

.ONDIMMABLE

7 X7

7EIGHT  +G

&LUX LM

X7

 +G

LM

#OLOR

#ODE - - - -

0OLYCARBONATEDUSTPROTECTIONSCREENINCLUDED

)0 ª







?


ª %RNESTO'ISMONDI 

s,%$7 sLUMEN s-AC!DAM3$# s"EAM8& s,+  s##4+ s#2) s)0

8&EXTRAmOOD ª

s7HILETHEARMHASAFIXEDªANGLE THEHEADCAN BEADJUSTEDTODIRECTEMISSIONTOWARDSTHEWORKING TOP s/FFICEVERSIONDIRECTEMISSION CONTROLLEDBYMEANS OF&RESNELLENSESCOMPLIESWITHOFFICEANDINDIRECT EMISSIONRULES s(OMEVERSIONBROAD ANGLEDIRECTEMISSIONAND INDIRECTEMISSION


2ED7HITE

ª(OME 7EIGHT  KG

"EAM 8&

&LUX LM

##4 +

#OLOR

#ODE !

7EIGHT  KG

"EAM 8&

&LUX LM

##4 +

#OLOR

#ODE !



#2) 



7 7

ª

7 7

#2) 



ª/FlCE



)0 6AC(ZELECTRONICBALLASTINCLUDED

?


+ALIFAmOOR %RNESTO'ISMONDI 

s!RANGEOFFLOORLAMPSWITHDIRECT INDIRECT LIGHTINGUSINGWANDW4# ,%,FLUORESCENT LAMPS

s&LUO4# ,%,' X7

&LUO4# ,%,' X7 sLUMEN

AUTOMATICONOFFSWITCHINGBASEDONPRESENCE ANDLIGHTLEVEL ANDINTERACTIVE $!,)SYSTEM COMBININGAMOVEMENTDETECTORANDADAYLIGHT SENSORFORAUTO REGULATIONINRELATIONTOPEOPLE PRESENCEANDVARIATIONSINDAYLIGHT

s/PTICALUNITANDPOLEINEXTRUDEDALUMINIUM WITHAWHITEORGREYPAINTFINISH

s5'2 ,CDM ª

s0OLYCARBONATEDUST PROTECTIONSCREENASAN OPTIONALEXTRA

s3TEELBASE

s)0

sVERSIONSCOMFORTANDPRISMOPTIC

s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS

sMMTHICKSCREEN PRINTEDTEMPEREDGLASS COMFORTDIFFUSERLIGHTDISTRIBUTIONINDIRECT ANDDIRECT s0OLYCARBONATEPRISMOPTICDIFFUSERLIGHTOUTPUT RATIOOFUPTOLIGHTDISTRIBUTION INDIRECTANDDIRECTKALIFAFLOORPRISMOPTIC )))  sLEVELSOFELECTRONICLIGHTMANAGEMENT ELECTRONICBALLASTWITHTWINSWITCH  DIMMINGCONTROLWITHMANUALLIGHT INTENSITYADJUSTMENT SIMPLEMOTIONSENSORWITH

8&%XTRAmOOD ª

)SOLUX

+ALIFATERRAPRISMOPTIC) 4# ,%,' X7 %MDESK LUX

#ALCULATIONPARAMETERSTOISSUEISOLUX M DIAGRAMS /FlCEWITHONEWORKSTATION ,ENGTHXWIDTHXHEIGHT M  X X M 2EmECTANCEFACTORSCEILINGWALLSmOOR  7ORKINGPLANE X X M M -AINTENANCEFACTOR 7&

+ALIFATERRAPRISMOPTIC))) 4# ,%,' X7 %MDESK LUX

+ALIFATERRACOMFORT 4# ,%,' X7 %MDESK LUX M

M 











M





M

MMMM

MMMM



MMMM

M


#"2ICHARD%LLIS &RANKFURT-AIN'ERMANY 0HOTO&ABIAN!UREI(ID




7HITE

+ALIFAmOORCOMFORT

4# ,%,' 7 X7

7EIGHT KG

"EAM 8&

&LUX LM

.ONDIMMABLE

$IMMABLE

#OLOR

#ODE - -

#ODE - -

)NTERACTIVE$!,)

0RESENCEDETECTOR

#OLOR

#ODE - -

#ODE - -

'REY

)0 









+ALIFAmOORPRISMOPTIC)

4# ,%,' 7 X7

7EIGHT KG

3TAND LATERAL

"EAM 8&

&LUX LM

#OLOR

#OLOR

.ONDIMMABLE

$IMMABLE

#ODE - -

#ODE - -

)NTERACTIVE$!,)

0RESENCEDETECTOR

#ODE - -

#ODE - -

)0 







+ALIFAmOORPRISMOPTIC)))

4# ,%,' 7 X7

7EIGHT  KG

"EAM 3TAND LATERAL 8&

&LUX LM

.ONDIMMABLE

$IMMABLE

#OLOR

#ODE - -

#ODE - -

#OLOR

#ODE - -



)NTERACTIVE$!,)

)0 





#OMPONENTS 0OLYCARBONATEDUST PROTECTION SCREENFOR+ALIFAmOORCOMFORT ANDDARKLIGHT

)NTERACTIVE $!,) REMOTECONTROL

#ODE - 

-




#"2ICHARD%LLIS &RANKFURT-AIN'ERMANY 0HOTO&ABIAN!UREI(ID

?


+ALIFAWALL %RNESTO'ISMONDI 

s&LUO4# ,%,' X7 47 sLUMEN s)0

s!RANGEOFWALLLAMPSWITHDIRECT INDIRECT LIGHTINGUSINGX7ANDX74 AND XW4# ,%,FLUORESCENTLAMPS s%XTRUDEDALUMINIUMBODYWITHWHITEORGREY PAINTFINISH ANDMMTHICKSCREEN PRINTED TEMPEREDGLASS sSIZEOPTIONSXMM XMMAND XMM s,IGHTDISTRIBUTIONINDIRECTAND DIRECT s%LECTRONICCONTROLGEAR s/PTIONALEMERGENCYLIGHTING

8&%XTRAmOOD ª

s0OLYCARBONATEDUST PROTECTIONSCREEN s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS


7HITE

4# ,%,' 7EIGHT  KG

7 X7

"EAM 8&

&LUX LM

#OLOR

.ONDIMMABLE

EMERGENCYH

#ODE - -

#ODE - -

'REY

7BD)[FMFDUSPOJDCBMMBTUJODMVEFE

)0 ª

.ONDIMMABLE

4' 7 7

,ENGTH MM

7EIGHT  KG

"EAM 8&

&LUX LM

7

MM

 KG

8&

LM

#OLOR

#ODE - - - -

)0 ª

?


)NNOWATIOSPA +ILOMETRO2OSSO3CIENCE4ECHNOLOGY0ARK "ERGAMO)TALY !RCH'IOVANNI2IZZI!RCHITETTO


)NNOWATIOSPA +ILOMETRO2OSSO3CIENCE4ECHNOLOGY0ARK "ERGAMO)TALY !RCH'IOVANNI2IZZI!RCHITETTO

?


3URF3YSTEM .EIL0OULTON 


?


3URF3YSTEM

3URF3YSTEMSUSPENSION

 



  



 

3URF3YSTEMWALL      

s,%$7 sLUMEN s"EAM8& s-AC!DAM3$# s,+ H s##4++ s#2)MIN s&LUO4' XX7 sLUMEN s)0

s(IGH PERFORMING,%$ANDX7TOX74 FLUORESCENTLAMPSMODULARSYSTEM WITHINDIRECTEMISSION s#EILING MOUNTEDORSUSPENDED s3INGLEINSTALLATION INLINEORANGLED , SHAPEDª  WAYS  WAYS  WAYS  s&OR,%$NON DIMMABLEELECTRONICPOWERSUPPLY $!,)DIMMABLEORINTERACTIVE$!,)SYSTEM COMBININGPRESENCEDETECTORANDDAYLIGHTSENSOR s&OR&LUO%LECTRONICBALLAST OR$!,)DIMMABLE ELECTRONICBALLAST ORINTERACTIVE $!,)SYSTEM COMBININGAMOVEMENTDETECTORANDADAYLIGHT SENSORFORAUTO REGULATIONINRELATIONTOPEOPLE PRESENCEANDVARIATIONSINDAYLIGHT %MERGENCYLIGHTINGASANOPTIONALEXTRA s-ATERIALSWHITEORGREYPAINTEDEXTRUDED ALUMINIUMBODY EXTRUDEDPOLYCARBONATEDUST PROTECTIVESCREEN s@1UICK ADJUSTABLESTEELSUSPENSIONCABLES

8&%XTRAmOOD ª

s#OMPLIANTTOSTANDARD%. %.  ANDOTHERSPECIFICREGULATIONS


%URIZON#APITAL -ILAN)TALY !RCH3ILVIA3UARDI 3EGZIN!KSU 0HOTO"EPPE2ASO

?


3URF3YSTEM

7HITE

,%$ 7 ,ENGTH #2) 7EIGHT &LUX 7 MM MIN  KG LM

##4 +

LM

+

#OLOR

.ONDIMMABLE

$!,)DIMMABLE

#ODE - - - -

#ODE - - - -

'REY

6AC(ZELECTRONICBALLASTINCLUDED



)0 ª



4' X7

,ENGTH MM

7EIGHT  KG

&LUX LM

X7

MM

 KG

LM

X7

MM

 KG

LM

X7

MM

 KG

LM

X7

MM

 KG

LM

#OLOR

.ONDIMMABLE

$!,)

)NTERACTIVE $!,)

#ODE - - - - - - - - - -

#ODE

#ODE

6AC(ZELECTRONICBALLASTINCLUDED 3URFMODULEX7ISEQUIPPEDWITHPOWERSUPPLIESANDTHEREFOREITOCCUPIES$!,)ADDRESSES

EMERGENCYH

4' X7

,ENGTH MM

7EIGHT  KG

&LUX LM

X7

MM

 KG

LM

X7

MM

 KG

LM

6AC(ZELECTRONICBALLASTINCLUDED

#OLOR

#ODE - - - - - -

- - - - - - - -

- -




7HITE

'REY

!CCESSORIES #OLOR %NDCAP XMM  KG

#ODE - -

, SHAPEDCONNECTOR XMM  KG

- -

 WAYCONNECTOR XMM  KG

- -

 WAYCONNECTOR XMM  KG

- -

3TEELSUSPENSIONCABLE CEILINGPLATEâ&#x2C6;&#x2026;MM

- -

CORESUSPENSIONCABLE X MM CEILINGPLATEâ&#x2C6;&#x2026;MM ,MM

- -

CORESUSPENSIONCABLE X MM X MM CEILINGPLATEâ&#x2C6;&#x2026;MM ,MM

- -

7ALLlXINGWITHOUTPOWERSUPPLY XMM PROTUSIONMM

- -

7ALLlXINGWITHPOWERSUPPLY X MM XMM PROTUSIONMM

)NTERACTIVE $!,) REMOTECONTROL

)NTERACTIVE $!,)KIT â&#x2C6;&#x2026;MM WHITE RECESSED #ANBECONNECTEDTOAMAX$!,) DIMMABLEUNITSSLAVEMODULES  /PERATEDTHROUGHAN)NTERACTIVE $!,)REMOTECONTROLOROPTIONAL

- -

-

-

â&#x2C6;&#x2026; 2ECESSEDMOTIONSENSOR FOR)NTERACTIVE $!,)SYSTEM

-

â&#x2C6;&#x2026;

?


?


3URFWALL .EIL0OULTON 

s,%$7 sLUMEN

s(IGH PERFORMING,%$WALL MOUNTEDLIGHTFITTING

s"EAM8&

s(IGHEFFICIENCYMORETHANLUMENPERWATT

s-AC!DAM3$#

s-ATERIALSBODYINWHITEORGREYPAINTED ALUMINIUM

s,+ H s##4++ s#2)TYP s)0

8&%XTRAmOOD ª

s-ORETHANLMFLUXINSTALLED

s.ON DIMMABLEELECTRONICPOWERSUPPLY ORDIMMABLE$!,)OPTIONS s#OMPLIANTTOSTANDARD%. %.  ANDOTHERSPECIFICREGULATIONS


7HITE

3URFWALL

'REY

3URFWALL ,%$ 7 7

#2) 

7EIGHT  KG

"EAM 8&

&LUX LM

##4 +

LM

+

#OLOR

.ONDIMMABLE

$!,)

#ODE - - - -

#ODE - - - -

6AC(ZELECTRONICBALLASTINCLUDED

)0

ª

,%$RETROlT2S 7 MAX72S

7EIGHT  KG

"EAM 8&

#OLOR

#ODE - -











?


'ENERAL,IGHTING

            

!LPHABETOF,IGHT !MELUNA 4AGORA 5NA0RO0UTRELLA +AO -OUETTE 4WIST !BSOLU .UBOLI #ALENDA 3OLAR,%$ +ALIFA2ECESSED 0IXEL-ESH

?


!LPHABETOF,IGHT ")' 


?


?


!LPHABETOF,IGHT

s")'STARTSFROMANABACUSOFPLAINELEMENTSTO DESIGNANEWFONTTHATTURNSINTOLIGHTANDGIVES LIFETOUPPER CASELETTERS LOWERCASELETTERS ANDNUMBERS s4HELUMINOUSELEMENTSANDTHEJOINTSAREMADEOF INJECTION MOULDEDOPALINE0--! s4HEINNERELEMENTSSUPPORTINGTHE,%$STRIPSARE MADEOFWHITEINJECTION MOULDED0# s4HESUPPORTINGPINSAREMADEOFPOLISHED ALUMINIUM s4HEPATENTEDOPTICALPRINCIPLEALLOWSTOOBTAIN UNIFORMªEMISSION THUSENSURINGHIGHSYSTEM EFFICIENCY

5PPERCASE

,OWERCASE

.UMBERS

s,%$7 sLUMEN

s,%$7 sLUMEN

s,%$7 sLUMEN

s##4+

s##4+

s##4+

s#2)

s#2)

s#2)


?


!LPHABETOF,IGHT


?


!LPHABETOF,IGHT#OMPONENTS

#REATETHESUPPORTINGFRAMEANDPROVIDEFOR POWERCONNECTIONSFORTHEINDIVIDUALLETTERS

i

g

b

b

#ONNECTPANELTOPOWERSOURCE

i

&IXPANELANDCONNECTPANELTOPOWERSOURCE

g

&IXPANELANDCONNECTPANELTOPOWER SOURCE

&IXPANELANDCLOSEUSINGTHESUPPLIEDPANELS

#OMPLETECLOSINGUSINGTHESUPPLIEDPANELS

&RAMEREADYFORlNISHING

!PPLYTHEGAUZEANDPLASTERmUSHWITHTHEGAPS BETWEENPANELS

&INALPAINTING















4HELETTERSAREPROVIDEDMOUNTEDON-$&PANELS TOALLOWINSTALLATIONONANYKINDOFWALL)NSTALLATION REQUIRESCREATINGACOUNTER FRAMETOACCOMMODATE THEDRIVERS SUPPLIEDSEPARATELY ANDTHEPOWER CABLES !CONFIGURATIONSOFTWAREISAVAILABLETOCALCULATETHE NECESSARYUSABLESURFACE ASWELLASTOIDENTIFYTHE CODESREQUIREDTOIMPLEMENTTHEDESIREDPROJECT

?


!LPHABETOF,IGHT

5PPERCASE ,ETTER 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7

A B C D E F G H I J K L M N O P Q R S T U V W X Y Æ Ø A Z

&LUX LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM

/PALWHITE

$!,)

(X, X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

#ODE !! "! #! $! %! &! '! (! )! *! +! ,! -! .! /! 0! 1! 2! 3! 4! 5! 6! 7! 8! 9! !%! e! a! :!

,OWERCASE ,ETTER

a b c d e f g h i j k l m n o p q r s t u v w x y æ ø a z

$RIVER 7

7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7

&LUX LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM LM

.UMBERS

3IZE

3IZE

$!,)

(X, X X X X X X X X X X X X X X X X X X X X X X X X X X X X X

#ODE A! B! C! D! E! F! G! H! I! J! K! L! M! N! O! P! Q! R! S! T! U! V! W! X! Y! AE! e! a! Z!

6AC  

,MM 7MM  

(MM 

3UPPORT !! "! #! $! %! &! '! (! )! *! +! ,! -! .! /! 0! 1! 2! 3! 4! 5! 6! 7! 8! 9! !%! e! a! :!

,ETTER

0 1 2 3 4 5 6 7 8 9

7 7 7 7 7 7 7 7 7 7 7

&LUX LM LM LM LM LM LM LM LM LM LM

3IZE

$!,)

(X, X X X X X X X X X X

#ODE ! ! ! ! ! ! ! ! ! !

3UPPORT ! ! ! ! ! ! ! ! ! !

3UPPORT A! B! C! D! E! F! G! H! I! J! K! L! M! N! O! P! Q! R! S! T! U! V! W! X! Y! AE! e! a! Z!

)0 

.ªDEVICE MIN MAX

.ONDIMMABLE

#ODE $6
































 







 









































































































 





 



















































 















 





































































 



































 



















 

































































 





 







 





?


!MELUNA -ERCEDES "ENZ3TYLE 

0ATENTPENDING)4 Nª-)

h-ERCEDES "ENZvANDTHESTYLINGOF!MELUNA AREINTELLECTUALPROPERTYOF$AIMLER!' 4HEYAREUSEDBY!RTEMIDE3P!UNDERLICENSE


?


!MELUNA

s7 sLUMEN s-AC!DAM3$# s"EAM8& s##4+ s#2)TYP s,IFE,+  )0

!MELUNADISCLOSESANINNOVATIVEOPTOELECTRONIC SYSTEMINTEGRATEDINTHETRANSPARENTFRAME !NALUMINIUMBAND APATENTOFINNOVATION WHICHISWELDEDWITHTHEOPTICS SUPPORTSTHELED STRIP4HELATTERISALSOHIDDENBEHINDTHELOWER PROFILE INORDERTOMAINTAINTHEPURITYOFTHE FORM4HETRANSPARENTBODYALLOWSTHELIGHTTOBE BOTHDIRECTANDPARTIALLYREFRACTED

s4HEGEOMETRICSECTIONANDTHEOPTICALFEATURES OFTHEMATERIALSGIVELIFETOAhLIGHTBOXvTHAT ENSURESPERFECTCONTROLOFTHEEMISSION DESPITE TRANSPARENCY s!SETOF,%$SOURCESISINSTALLEDALONGTHELOWER PROFILE ONARINGMADEOFATHERMO CONDUCTIVE POLYMER ANINNOVATIVEMATERIALTHATALLOWS EXCELLENTHEATDISSIPATION s%MISSIONISPERFECTLYDESIGNEDTHROUGHCAREFUL SELECTIONOFTHEMATERIALSCONSTITUTINGTHEhLIGHT BOXv4HESPECIALREFLECTANCEANDTRANSMITTANCE PROPERTIES COMBINEDWITHAVERYLOWABSORPTION COEFFICIENT ENSURETHATTHELIGHTREFLECTEDFROM THEINNERSURFACESOFTHESECTIONISSCATTERED ACROSSTHEENVIRONMENTINACONTROLLEDAND MOSTLYDIRECTWAY s!MELUNACANBECONTROLLEDWITHAN/N/FF SWITCHORUSINGA0USHTOADJUSTSITSLUMINOUS INTENSITY s!MELUNA2'"CANBECONTROLLEDUSING DIFFERENT0USHONEFORWHITELIGHTANDONE FORTHE2'"SPOTLIGHT ANDTHE!MELUNA!PP #ONTROLVIAPUSHBUTTONHASALWAYSPRIORITY OVERCONTROLWITHTHE!PPWHENTHE0USHARE OPERATED THECOMMANDSSENTVIABLUETHOOTH FROMTHESMARTPHONEORTABLETAREIGNORED 

4RANSPARENT"ODY

2EmECTIVE2ING

(EAT 3INK2ING

$IFFUSING2ING


!MELUNAWHITE

?


!MELUNA2'"


?


!MELUNA2'"


?


!MELUNA!00

4HEHIGH TECHCOMPETENCEOF!MELUNA2'" IS CONVEYEDBOTHBYOPTOELECTRONICINNOVATIONAND BYTHE)O4INTERACTION,IGHTINEVERYINTERIOR BEITA CARORAPERSONALORPUBLICSPACE CANBEPARTOFTHE )NTERNETOF4HINGSANDFOLLOWHUMANPERCEPTIONAND EXPERIENCEASSCENARIOSCHANGE!NEWDESIGNFRONTIER WHERELIGHTCREATESBOTHEXPERIENCEANDINTERACTION 4HE!MELUNA!PPENABLESANUTTERLYNEWEXPERIENCE WITHLIGHTHROUGHASURPRISING SIMPLE ANDINTUITIVE APPROACH!",%MESHPROTOCOLBASEDONHIGHSAFETY STANDARDSALLOWSTOCONNECTWITH!MELUNAUSINGA VARIETYOFMOBILEDEVICES ASWELLASTOCREATE CHANGE ORSETUPDIFFERENTLIGHTINGSCENARIOSMATCHINGEVERY OCCASIONANDTOCHOOSETHEINTENSITYOFWHITELIGHT ANDCOLOUR

$OWNLOADLINK HTTPSITUNESAPPLECOMITAPPAMELUNAIDMT


72'" 3INGLELAMP

3INGLELAMP LIGHTCONTROL

!PPLY 3CENARIO

.ETWORK CREATION !PPLY 3CENARIO

3INGLELAMP OFTHEGROUP LIGHTCONTROL

72'" 3CENARIO CREATION

'ROUP CREATION !PPLY 3CENARIO

'ROUP LIGHTCONTROL

!PPLY 3CENARIO

?


!MELUNA!00

.%47/2+#2%!4)/.!.$-/$)&)#!4)/.

.ETWORKNAMING

0ASSWORDCREATION

!UTO3CANNINGPHASE

&INDPHYSICALLAMPPHASE 4HELAMPWILLSIGNALITSELFBYBLINKING

!SSIGNINGALAMPTOTHENETWORK

,AMPNAMING

44APONTHEh"INv,OGOTOREMOVEALAMPS TH h"I v , T L  FROMTHENETWORK

#HOOSETHELAMPS YOUWANTTOREMOVE #H TH L  TT FROMTHENETWORK

'2/50#2%!4)/.!.$-/$)&)#!4)/.

#OMPLETENETWORKSCREEN

#REATEANEWGROUPPOPUP TRIGGEREDBYTAPPINGONTHEh v NEXTTOTHE!MELUNAICON 

4HELAMPHASBEENREMOVEDFROMTHE 4H L H B DF TH .ETWORK4APONTHECIRLCEARROWTOGO BACKTOTHENETWORKSCREEN ANDSCANTHEAREAAGAIN

#OMPLETENEWGROUPLAMPSASSOCIATION


,)'(4#/.42/,

#HOOSETHEGROUPORLAMPTOCONTROL

#ONTROLTHEWHITEANDRGBEMISSION BYUSINGTHELATERALBARSONTHESCREEN

4APTHEh#ONTROLASINGLELAMPOFTHE 'ROUPvTOCREATEADIFFERENTSETTING ONASINGLELAMPOFTHEGROUP

#HOOSETHESINGLELAMPOFTHEGROUP TOCONTROL

4RIGGERTHE/PTIONS-ENUTOAPPLYEXISTING SCENARIOSORSAVEANEWONEWITHTHE CONlGURATIONSJUSTSET

3AVINGASCENARIOWITHTHESETTINGS APPLIEDONTHESINGLELAMP

%XITTHESINGLELAMPSETTINGS BYTAPPINGONh$/.%v

4RIGGERTHE/PTIONS-ENU

#ONTROLTHEWHITEAND2'"EMISSIONBYUSINGTHE LATERALBARSONTHESCREEN CONlRMSETTINGSANDTURN BACKCOMPLETENETWORKSCREENTAPPINGh$/.%v

#HOOSETHESCENARIOTOOVERWRITE WITHTHENEWSETTINGS

4HESINGLELAMPWITHINTHEGROUPIS NOWSAVEDWITHDIFFERENTSETTINGS 4APh"ACKvTOGOTOTHE.ETWORKSCREEN

?


!MELUNA

,%$WHITE "EAM ª

&LUX LM

##4 +

#ODE !

46

#2) TYP

max 2000

7 7

250

150

Ã&#x2DC; 750

)0

,%$WHITE SPOT2'" "EAM ª

&LUX LM

##4 +

#ODE !

50

#2) TYP

100

7 7

300

Ã&#x2DC;55 800 150

Ã&#x2DC; 750

)0


"OTTOMVIEW

?


?


4AGORA 32#ORNELISSEN  


s,%$7 7 sLUMEN s-AC!DAM3$#s"EAM& 8& s##4++ s#2) s,IFE,+ 

&mOOD ª ª

7&WIDEmOOD ª ª

8&EXTRAmOOD ª

s)0)0

?


4AGORARECESSED


s3ERIESOFCEILINGMOUNTEDLUMINAIRESAVAILABLE INDIAMETERSMM MM MM  MM USINGHIGH OUTPUT,%$S 2ETROFIT,%$SAND FLUORESCENTSOURCES s#ONSISTSOFATRIMLESSRECESSEDFRAMEFITTEDINTO THECEILINGANDANOPTICALUNITWITHANALUMINIUM BODYPAINTEDINARANGEOFCOLOURS s4AGORAANDOFFERHIGH OUTPUTSPOTLIGHT WITHALUMINIUMOPTICS s4AGORA,%$USESAPROPRIETARYSYSTEMBASED ONAHYBRIDCOMBINEDLENSANDREFLECTOROPTIC 4HISSYSTEMHELPSTOCREATEDEFINEDNARROW BEAMSUSINGHIGH POWERED,%$MODULESOFLARGE DIMENSIONS

s4AGORAANDCONEWITHA0--!DIFFUSER OFFERINGACOMFORTABLEDIFFUSEDLIGHT ,%$VERSIONSUSEHIGH OUTPUTSOURCES s)NTEGRATEDELECTRONICPOWERSUPPLY DIMMABLE ORNON DIMMABLEOPTIONS DEPENDINGONTHE VERSION s%MERGENCYLIGHTINGAVAILABLEON4AGORA FLUORESCENTOPTION s/NLYCEILINGRECESSEDINSTALLATIONALLOWED s#OMPLIANTWITHSTANDARD%.  ANDOTHERSPECIFICSTANDARDS

?


4AGORARECESSED,%$

/RANGE

7HITE

'REEN

,%$ 7EIGHT  KG

"EAM ª

ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

#OLOR

#ODE !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !"

%LECTRONICBALLASTM!3%,6SUPPLIEDSEPARATELY

$RIVER6A,MM7MM(MMNªDEVICE CC7M! MAX$!,) DIMMABLE

#ODE -

,%$'5 7EIGHT 6  KG 6

-AXMMOVERALL

#OLOR

#ODE - - - -

)0 ,%$'5 ª ∅





#2) 



7 7

"LUE


"!3&,UKIDS ,UDWIGSHAFEN$EUTSCHLAND !RCH3ANDER(OFRICHTER 0HOTO,IOBA3CHNEIDER

?


4AGORARECESSED,%$

/RANGE

LED

'REEN

"LUE

$!,)DIMMABLE #2) 

7EIGHT  KG

"EAM ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

#ODE - - - - - - - - - - - - - - - -

)0 ª

∅



7 7

7HITE

6AC(ZELECTRONICBALLASTINCLUDED$IMMABLE$ALI 3WITCH$IM 3UPPLYVOLTAGE 6)NSULATIONCLASS))3%,6)0



4# $%,'Q  7 X7

7EIGHT  KG

"EAM 8&

.ONDIMMABLE

$!,)DIMMABLE

&LUX LM

#OLOR

#ODE - - - -

#ODE - - - -

.ONDIMMABLE

$!,)DIMMABLE

&LUX LM

#OLOR

#ODE - - - -

#ODE - - - -



4AGORARECESSED()4&LUO

6AC(ZELECTRONICBALLASTINCLUDED

4# 4%,'2Q  7 X7

7EIGHT  KG

"EAM 8&




4AGORARECESSED

/RANGE

,%$ #2) 

7EIGHT  KG

"EAM 8&

&LUX LM

##4 +

LM

+

#OLOR

4# ,%,' 7EIGHT  KG

"EAM 8&

&LUX LM

#OLOR

"LUE



#ODE - - - - - - - -

)0 ª

6AC(ZELECTRONICBALLASTINCLUDED$IMMABLE$ALI 3WITCH$IM 3UPPLYVOLTAGE 6)NSULATIONCLASS))3%,6)0

7 X7

'REEN



7 7

$!,)DIMMABLE

7HITE

∅



.ONDIMMABLE

EMERGENCYH

$!,)DIMMABLE

#ODE - - - -

#ODE - - - -

#ODE - - - -

6AC(ZELECTRONICBALLASTINCLUDED

4AGORARECESSED

,%$ 7 7



$!,)DIMMABLE #2) 

7EIGHT KG

"EAM 8&

&LUX LM

##4 +

LM

+

#OLOR

#ODE - - - - - - - -

)0 ª

∅

6AC(ZELECTRONICBALLASTINCLUDED$IMMABLE$ALI 3WITCH$IM 3UPPLYVOLTAGE 6)NSULATIONCLASS))3%,6)0



4' 7 X7 X7

7EIGHT  KG

"EAM 8&

&LUX LM

#OLOR

.ONDIMMABLE

$!,)DIMMABLE

#ODE - - - -

#ODE - - - -

6AC(ZELECTRONICBALLASTINCLUDED

?


4AGORACEILING

s3ERIESOFCEILINGMOUNTEDLUMINAIRESAVAILABLE INDIAMETERSMM MM MM  MM USINGHIGH OUTPUT,%$S 2ETROFIT,%$S AND FLUORESCENTSOURCES s!LUMINIUMBODYAVAILABLEINDIFFERENTTWO COLOURED VERSIONSBEIGEWHITE GREYWHITE BLACKORANGE BLACKVERTANDBLACKBLUE s4AGORAANDOFFERHIGH OUTPUTSPOTLIGHT WITHALUMINIUMOPTICS s4AGORA,%$USESAPROPRIETARYSYSTEMBASED ONAHYBRIDCOMBINEDLENSANDREFLECTOROPTIC 4HISSYSTEMHELPSTOCREATEDEFINEDNARROW BEAMSUSINGHIGH POWERED,%$MODULESOFLARGE DIMENSIONS

s4AGORAANDCOMEWITHA0--!DIFFUSER OFFERINGACOMFORTABLEDIFFUSEDLIGHT ,%$VERSIONSUSEHIGH OUTPUTSOURCES s)NTEGRATEDELECTRONICPOWERSUPPLY DIMMABLE ORNON DIMMABLEOPTIONS DEPENDINGONTHE VERSION s%MERGENCYLIGHTINGAVAILABLEON4AGORA FLUORESCENTOPTION s/NLYCEILINGMOUNTEDINSTALLATIONALLOWED s#OMPLIANTWITHSTANDARD%.  ANDOTHERSPECIFICSTANDARDS


?


LED 7 7

#2) 

7EIGHT  KG

"EAM ª

ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

LM

+

LM

+

#OLOR

$!,)DIMMABLE

#ODE !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !"

#ODE !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !"

LED (GU10) 7EIGHT  KG

-AXMMOVERALL

#OLOR

"LACK/RANGE

.ONDIMMABLE

6AC(ZELECTRONICBALLASTINCLUDED

6 6

"LACK"LUE

#ODE - - - - -

'REY 7HITE

"EIGE  7HITE

)0 ª



"LACK'REEN



4AGORACEILING,%$

Â&#x152;


4AGORACEILING,%$

"LACK'REEN

"LACK/RANGE

'REY 7HITE

"EIGE  7HITE

$!,)DIMMABLE #2) 

7EIGHT  KG

"EAM ª

ª

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

#ODE - - - - - - - - - - - - - - - - - - - -

)0 ª



LED 7 7

"LACK"LUE

6AC(ZELECTRONICBALLASTINCLUDED



4# $%,'Q  7 X7

7EIGHT  KG

"EAM 8&

"EAM 8&

6AC(ZELECTRONICBALLASTINCLUDED

#ODE - - - - -

#OLOR

#ODE - - - - -

.ONDIMMABLE

$!,)DIMMABLE

&LUX LM

#OLOR

#ODE - - - - -

#ODE - - - - -

4# 4%,'2Q  7EIGHT  KG

$!,)DIMMABLE

&LUX LM

6AC(ZELECTRONICBALLASTINCLUDED

7 X7

.ONDIMMABLE

?


6ODAFONE#AMPUS $USSELDORF'ERMANY !RCH(00(ENTRICH 0ETSCHNIGG0ARTNER 0HOTO7ERNER(UTHMACHER

?


4AGORACEILING

"LACK'REEN

LED

"LACK/RANGE

'REY 7HITE

$!,)DIMMABLE #2) 

7EIGHT  KG

"EAM 8&

&LUX LM

##4 +

LM

+

#OLOR

#ODE - - - - - - - - - -



7 7

"LACK"LUE

)0 ª

6AC(ZELECTRONICBALLASTINCLUDED



4' 7 X7

7EIGHT  KG

"EAM 8&

&LUX LM

#OLOR

.ONDIMMABLE

EMERGENCYH

#ODE - - - - -

#ODE - - - - -

$!,)DIMMABLE #ODE - - - - -

6AC(ZELECTRONICBALLASTINCLUDED

4AGORACEILING

$!,)DIMMABLE

#2) 7 7 

7EIGHT  KG

"EAM 8&

&LUX LM

##4 +

LM

+

#OLOR

#ODE - - - - - - - - - -



LED

)0 ª

6AC(ZELECTRONICBALLASTINCLUDED 

4' 7 X7 X7

7EIGHT  KG

"EAM 8&

&LUX LM

6AC(ZELECTRONICBALLASTINCLUDED

#OLOR

.ONDIMMABLE

$!,)DIMMABLE

#ODE - - - - -

#ODE - - - - -

"EIGE  7HITE


6ODAFONE#AMPUS $USSELDORF'ERMANY !RCH(00(ENTRICH 0ETSCHNIGG0ARTNER 0HOTO7ERNER(UTHMACHER

?


4AGORASUSPENSION

s3ERIESOFSUSPENDEDLUMINAIRESAVAILABLEIN DIAMETERSMM MM MM  MM USINGHIGH OUTPUT,%$S 2ETROFIT,%$S AND FLUORESCENTSOURCES s!LUMINIUMBODYAVAILABLEINDIFFERENTTWO COLOURED VERSIONSBEIGEWHITE GREYWHITE BLACKORANGE BLACKVERTANDBLACKBLUE s3TEELSUSPENSIONCABLESALLOWINGQUICKADJUSTMENT METRELENGTH s4AGORAANDOFFERAHIGH OUTPUTSPOTLIGHT WITHALUMINIUMOPTICS s4AGORA,%$USESAPROPRIETARYSYSTEMBASED ONAHYBRIDCOMBINEDLENSANDREFLECTOROPTIC 4HISSYSTEMHELPSTOCREATEDEFINEDNARROW BEAMSUSINGHIGH POWERED,%$MODULESOFLARGE DIMENSIONS

s4AGORAANDCOMEWITHA0--!DIFFUSER OFFERINGACOMFORTABLEDIFFUSEDLIGHT,%$VERSIONS USEHIGH OUTPUTSOURCES s)NTEGRATEDELECTRONICPOWERSUPPLY DIMMABLE ORNON DIMMABLEOPTIONS DEPENDINGONTHE VERSION s%MERGENCYLIGHTINGAVAILABLEON4AGORA FLUORESCENTOPTION s/PTIONOFDOUBLELIGHTEMISSIONAVAILABLEON4AGORA ANDFLUORESCENTMODULES s#OMPLIANTWITHSTANDARD%.  ANDOTHERSPECIFICSTANDARDS


?


LED 7 7

#2) 

7EIGHT  KG

"EAM ª

ª

ª

&LUX LM

##4 +

LM

+

LM

#OLOR

+

LM

+

LM

+

LM

+

"LACK"LUE

"LACK/RANGE

.ONDIMMABLE

$!,)DIMMABLE

#ODE !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !"

#ODE !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !" !"

'REY 7HITE

)0 ª

Œ

Œ



6AC(ZELECTRONICBALLASTINCLUDED

,%$'5 6 6

7EIGHT  KG

-AXMMOVERALL

#OLOR

#ODE - - - - -

"EIGE  7HITE

NBY

"LACK'REEN



4AGORASUSPENSION,%$


4AGORASUSPENSION,%$

"LACK'REEN

"LACK/RANGE

'REY 7HITE

"EIGE  7HITE

$!,)DIMMABLE 7EIGHT  KG

"EAM ª

ª

&LUX LM

##4 +

LM

+

LM

LM

#OLOR

+

+

#ODE - - - - - - - - - - - - - - - - - - - -

)0 ª



NBY

LED 7,ED #2)  7

"LACK"LUE



6AC(ZELECTRONICBALLASTINCLUDED





4# $%,'Q  7 X7

7EIGHT  KG

"EAM 8&

.ONDIMMABLE

$!,)DIMMABLE #ODE - - - - -

&LUX LM

#OLOR

#ODE - - - - -

.ONDIMMABLE

$!,)DIMMABLE

&LUX LM

#OLOR

#ODE - - - - -

#ODE - - - - -

6AC(ZELECTRONICBALLASTINCLUDED

4# 4%,'2Q  7 X7

7EIGHT  KG

"EAM 8&

6AC(ZELECTRONICBALLASTINCLUDED

?


4AGORASUSPENSION,%$

"LACK'REEN

,%$$IRECTEMISSION 7 7

#2) 

7EIGHT  KG

"LACK"LUE

"LACK/RANGE

'REY 7HITE

"EIGE  7HITE

$!,)DIMMABLE "EAM 8&

&LUX LM

##4 +

M

+

#OLOR

#ODE - - - - - - - - - -

)0 ª

6AC(ZELECTRONICBALLASTINCLUDED

NBY



,%$$IRECT INDIRECTEMISSION #2) 

7EIGHT  KG

"EAM 8&

&LUX LM

M

##4 +

#OLOR

+

#ODE - - - - - - - - - -



7 7

$!,)DIMMABLE



6AC(ZELECTRONICBALLASTINCLUDED



.ONDIMMABLE

EMERGENCYH

$!,)DIMMABLE

#OLOR

#ODE - - - - -

#ODE - - - - -

#ODE - - - - -

.ONDIMMABLE

EMERGENCYH

$!,)DIMMABLE

#OLOR

#ODE - - - - -

#ODE - - - - -

#ODE - - - - -

4# ,%,' $IRECTEMISSION 7 X7

7EIGHT  KG

"EAM 8&

&LUX LM

6AC(ZELECTRONICBALLASTINCLUDED

4# ,%,' $IRECT INDIRECTEMISSION 7 X7

7EIGHT  KG

"EAM 8&

&LUX LM

6AC(ZELECTRONICBALLASTINCLUDED 3INGLEPOWERSUPPLYFORBOTHDIRECTANDINDIRECTEMISSION


4AGORASUSPENSION,%$

"LACK'REEN

,%$$IRECTEMISSION 7 7

#2) 

7EIGHT KG

"LACK"LUE

"LACK/RANGE

'REY 7HITE

"EIGE  7HITE

$!,)DIMMABLE "EAM 8&

&LUX LM

##4 +

LM

+

#OLOR

#ODE - - - - - - - - - -

)0 ª

6AC(ZELECTRONICBALLASTINCLUDED

7 7

#2) 

7EIGHT KG

"EAM 8&

$!,)DIMMABLE &LUX LM

##4 +

#OLOR

 LM +

#ODE - - - - - - - - - -



,%$$IRECT INDIRECTEMISSION

NBY





6AC(ZELECTRONICBALLASTINCLUDED



.ONDIMMABLE

$!,)DIMMABLE

#OLOR

#ODE - - - - -

#ODE - - - - -

.ONDIMMABLE

$!,)DIMMABLE

#OLOR

#ODE - - - - -

#ODE - - - - -

4' $IRECTEMISSION 7 X7 X7

7EIGHT  KG

"EAM 8&

&LUX LM

6AC(ZELECTRONICBALLASTINCLUDED

4' $IRECT INDIRECTEMISSION 7 X7 X7

7EIGHT  KG

"EAM 8&

&LUX LM

6AC(ZELECTRONICBALLASTINCLUDED 3INGLEPOWERSUPPLYFORBOTHDIRECTANDINDIRECTEMISSION

?


5NA0RO0UTRELLA #ARLOTTADE"EVILACQUA  


sX,%$7 sLUMEN s-AC!DAM3$#s"EAM83 & 7& s##4++ s#2) s,IFE,+ H s)0

s(IGH POWER,%$LIGHTINGAPPLIANCEMOUNTED ONATHINMM FLATALUMINIUMSHEETWITH IMPROVEDHEATDISSIPATION s)TSGEOMETRICSHAPEREPRODUCESABUILDING ELEMENTCALLEDJOIST ACCOMMODATING ADJUSTABLESPOTLIGHTSOF5NA0RO s4HEFRAMEISPAINTEDINASINGLECOLOUR nTEXTURIZEDWHITEnORINTWOCOLOURSn TEXTURIZEDWHITEOUTSIDEANDTEXTURIZEDBLACK INSIDE s!VAILABLEWITHTHREEDIFFERENTEMISSIONSª ª ª s4HEJUNCTIONOFEACHHEADALLOWSª ROTATIONANDªTILTINGINALLDIRECTIONS

?


!LUMINIUM

5NA0RO0UTRELLA

"LACK

3USPENSION 7EIGHT KG

"EAM ª

ª

&LUX LM

##4 +



LM

+



LM

+



LM

+



LM

+



LM

+

"OX

(EAD

(OLDER

#ODE $$:$7 $$:$7 $$:$ $$:$ $$:$7 $$:$7 $$:$ $$:$ $$:$7 $$:$7 $$:$ $$:$

)0



ª

#2) 

MAX

7 X,%$ 7



#EILING 7EIGHT KG

"EAM ª

ª

ª

#2) 

&LUX LM

##4 +



LM

+



LM

+



LM

+



LM

+



LM

+

"OX

(EAD

(OLDER

#ODE $$9$7 $$9$7 $$9$ $$9$ $$9$7 $$9$7 $$9$ $$9$ $$9$7 $$9$7 $$9$ $$9$

)0



7 X,%$ 7



7HITE


?


+AO "RUNO(OUSSIN 


s&,5/7 sLUMEN s)0

s3ERIESOFSUSPENDEDANDWALL ORCEILING MOUNTEDLIGHTINGSTRUCTURESWITHINDIRECT LIGHTING INTENDEDTOILLUMINATEOFSPACES SUCHASENTRANCEHALLS RECEPTIONAREAS CORRIDORS MEETINGROOMS ETC s,UMINAIRESAREMADEFROMALUMINUM WITHWHITEPAINTFINISH sXMMSQUARESECTIONMODULES s$ISTANCETOWALLORCEILINGMM s%ACHSTRUCTURECONSISTSOFPRE ASSEMBLED ANDPRE WIREDSUB UNITS

8&%XTRAmOODª

s%LECTRICALCONNECTIONISMADEVIAQUICK CONNECTORS s%LECTRONICCONTROLGEAR s$USTPROTECTIONSCREENINTRANSPARENT POLYCARBONATE s4HEKITSAREDELIVEREDWITHADRILLINGSTENCIL FORPLACINGTHEFIXINGPOINTS s#OMPLIESWITHSTANDARD%.  ANDOTHERSPECIFICSTANDARDS

?


+AOSUSPENSION

7HITE

+IT! 4' 7 X7 X7

7EIGHT  +G

&LUX LM LM

#ODE -

6AC(ZELECTRONICBALLASTINCLUDED

)0 ª







+IT" 4' 7 X7 X7

7EIGHT  +G

&LUX LM LM

#ODE -

6AC(ZELECTRONICBALLASTINCLUDED

)0 ª







+IT# 4' 7 X7

7EIGHT  +G

&LUX LM

#ODE -

6AC(ZELECTRONICBALLASTINCLUDED



)0 ª



+IT$ 4' 7 X7

7EIGHT  +G

&LUX LM

#ODE -

6AC(ZELECTRONICBALLASTINCLUDED



)0 ª




+AOWALLCEILING

7HITE

+IT% 4' 7 X7

7EIGHT  +G

&LUX LM

#ODE -

6AC(ZELECTRONICBALLASTINCLUDED







)0 ª



+IT& 4' 7 X7 X7

7EIGHT  +G

&LUX LM LM

#ODE -

6AC(ZELECTRONICBALLASTINCLUDED







)0 ª



+IT' 4' 7 X7 X7

7EIGHT  +G

&LUX LM LM

#ODE -

6AC(ZELECTRONICBALLASTINCLUDED







)0 ª



?


?


-OUETTE 7ILMOTTE)NDUSTRIES   

s,%$777 sLUMEN

s3USPENSIONLIGHTFITTINGWITHDIFFUSEDEMISSION

s-AC!DAM3$#

s6ERSIONS-OUETTESYMMETRIC -OUETTE ASYMMETRIC

s"EAM8&

s3OLIDOPALDIFFUSERINMOULDEDPOLYPROPYLENE

s,+ H

s,UMINOUSFLUXDISTRIBUTIONINDIRECT EMISSION ININDIRECTEMISSION

s##4+ s#2)MIN s&LUOX7 sLUMEN s)0)0

8&%XTRAmOOD ª

s-OUETTE$!,)DIMMABLE s4HEUPPERSTRUCTUREOFTHELIGHTFITTINGPRESENTS ANACCESSHATCHFORTHEINSTALLATIONOFTHELIGHT SOURCESANDTHEIRREPLACEMENT s4HELIGHTFITTINGISEQUIPPEDWITHQUICK ADJUSTMENTSTEELSUSPENSIONCABLES CEILINGPLATE ANDPOWERCABLE

s#ABLELENGTH-OUETTEMORM -OUETTEMINIM s#OMPLIESWITHSTANDARD%.  ANDOTHERSPECIFICSTANDARDS


?


-OUETTESYMMETRIC

/PALWHITE

,%$ #2) &LUX ##4 7 7  LM +

7EIGHT  KG

#ABLELENGTH MM

 KG

MM

#OLOR

4' 7 X7

&LUX LM

.ONDIMMABLE

$!,)DIMMABLE

#ODE !+

#ODE !+

!+

!+

.ONDIMMABLE

$!,)DIMMABLE

7EIGHT  KG

#ABLELENGTH #OLOR MM

#ODE ,

#ODE ,

 KG

MM

,

,

)0

ª



MAX MAX



,IGHTSOURCES+ INCLUDED 6AC(ZELECTRONICBALLASTINCLUDED



-OUETTESYMMETRIC ,%$ #2) &LUX ##4 7 7  LM +

7EIGHT  KG

#ABLELENGTH MM

 KG

MM

#OLOR

4' 7 X7

&LUX LM





7EIGHT #ABLELENGTH  KG MM  KG

#OLOR

MM

Â&#x152;









.ONDIMMABLE

$!,)DIMMABLE

#ODE !+

#ODE !+

!+

!+

.ONDIMMABLE

$!,)DIMMABLE

#ODE ,

#ODE ,

,

,

)0

ª



MAX MAX



,IGHTSOURCES+ INCLUDED 6AC(ZELECTRONICBALLASTINCLUDED





-OUETTEASYMMETRIC ,%$ #2) &LUX ##4 7 7  LM +

7EIGHT  KG

#ABLELENGTH MM

 KG

MM

#OLOR

4' 7 X7 X7

&LUX LM







7EIGHT  KG

#ABLELENGTH MM

 KG

MM

#OLOR

NONDIMMABLE

$!,)DIMMABLE

#ODE !+

#ODE !+

!+

!+

NONDIMMABLE

$!,)DIMMABLE

#ODE ,

#ODE ,

,

,







)0

ª



MAX MAX



,IGHTSOURCES+ INCLUDED 6AC(ZELECTRONICBALLASTINCLUDED



 



 

Â&#x152; 


?


?


4WIST $ESIGN/FFICE 

s&,5/X7X7 sLUMEN s"EAM8& s)0)0

s#OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS

""OCHUM 'ERMANY0HOTO,INUS,INTNER

8&%XTRAmOOD ª

s4WISTISAPENDANTLIGHTUSING4 3EAMLESS FLUORESCENTTUBES s4HELUMINAIRECONSISTSOFAONE PIECE ROTOMOULDEDOPALINEDIFFUSERINPOLYETHYLENE ANDBALLAST HOLDERINEXTRUDEDALUMINIUM s,AMPMAINTENANCEISPARTICULARLYEASY LAMPSAREACCESSEDINDIVIDUALLYFROMABOVEEACH SIDEWITHOUTTHENEEDTOREMOVETHEDIFFUSER s%LECTRONICANDDIMMABLEELECTRONICCONTROLGEAR $!,)  s1UICKADJUSTMENTM LONGSTEELSUSPENSION CABLES s4HANKSTOTHEUSEOFASPECIFICMECHANICAL CONNECTORTHATCANBEATTACHEDTOONEORMORE CORNERSOFTHELUMINAIRE VARIOUSLIGHTSHAPES CANBECREATEDINLINE CLUSTERSORINARANDOM PATTERN s,IGHTSOURCESTOBEORDEREDSEPARATELY


/PALWHITE

4 3,3' 7 X7 X7

7EIGHT  KG  KG

&LUX LM LM

#OLOR

.ONDIMMABLE

$IMMABLE$!,)

#ODE -

#ODE - -

6AC(ZELECTRONICBALLASTINCLUDED







MAX

)0 ª



?


!BSOLU $ESIGNOFFICE 

s&,5/X7X7 sLUMEN

s3INGLEPENDANTLUMINAIREWITHDIFFUSEDLIGHTING USING4 3EAMLESSFLUORESCENTLAMPS

s"EAM8&

sLENGTHOPTIONSMMX7 ANDMMX7 

s)0

s#ONTINUOUSSOLIDDIFFUSERINOPALINE POLYCARBONATE s3TRUCTUREMADEFROMEXTRUDEDALUMINIUM s4 SEAMLESSEQUIPMENTGIVESAUNIFORM LIGHTEMISSIONWITHOUTSHADOWS s!SIMPLELOCKINGUNLOCKINGSYSTEMWITHSMART HINGEALLOWSFOREASYLAMPMAINTENANCE s%LECTRONICBALLASTOR$!,) SWITCHDIMDIMMABLE MULTIWATTELECTRONICBALLAST

8&%XTRAmOOD ª

s,UMINAIRECOMESCOMPLETEWITHM LONG QUICK ADJUSTMENTSTEELSUSPENSIONCABLES CEILINGPLATEANDPOWERCABLE s#OMPLIESWITHSTANDARD%.  ANDOTHERSPECIFICSTANDARDS


/PALWHITE

4 3EAMLESS' 7 X7 X7

,ENGTH MM MM

7EIGHT  +G  +G

"EAM 8& 8&

&LUX #OLOR LM LM

.ONDIMMABLE

$!,)

#ODE - -

#ODE - -

6AC(ZELECTRONICBALLASTINCLUDED !BSOLU-LIGHTlTTINGSAREEQUIPPEDWITHPOWERSUPPLIES ANDTHEREFOREOCCUPY$!,)ADDRESSES

ª



MAX 

)0





MAX 







,IGHTSOURCES #ODE &LUORESCENTTUBE 4 3EAMLESS' PIECE 7 + +

- -

?


.UBOLI 'UIDO-ATTA %NRICO'IROTTI 

s&,5/X7 sLUMEN s"EAM8& s)0

8&%XTRAmOOD ª


/PALWHITE

s 0ENDANTLIGHTUSING4# ,%, FLUORESCENTLAMPS s 4HELUMINAIRECONSISTSOFAONE PIECE ROTOMOULDEDOPALINEDIFFUSERINPOLYETHYLENE ANDBALLAST HOLDERINEXTRUDEDALUMINIUM

MIN MAX

s %LECTRONICANDDIMMABLEELECTRONICCONTROLGEAR $!,) 



s #OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS

â&#x2C6;&#x2026;

)0

4# ,%,' 7 X7

7EIGHT  KG

$IMMABLE$!,) "EAM 8&

&LUX ##4 LM +

#OLOR

#ODE !

6AC(ZELECTRONICBALLASTINCLUDED

?


#ALENDA )TALO2OTA !LESSANDRO0EDRETTI 


/PALWHITE

s 0ENDANTLIGHTUSING4# ,%, FLUORESCENTLAMPS s 4HELUMINAIRECONSISTSOFAONE PIECE ROTOMOULDEDOPALINEDIFFUSERINPOLYETHYLENE ANDBALLAST HOLDERINEXTRUDEDALUMINIUM s %LECTRONICANDDIMMABLEELECTRONICCONTROLGEAR $!,) 

 

8&%XTRAmOOD ª

â&#x2C6;&#x2026;

4# ,%,' ,%$ 7"LUE 7 X7

7EIGHT  KG

&LUX LM

$!,) #OLOR

#ODE !

)0

6AC(ZELECTRONICBALLASTINCLUDED

?

MIN MAX

s #OMPLIESWITHSTANDARD%. ANDOTHER SPECIFICSTANDARDS


""OCHUM 'ERMANY0HOTO,INUS,INTNER

?


3OLAR,%$ %RIC3OLÏ 




(EAT3INKINALUMINIUM

3YSTEMOFRAPIDCONNECTORS FOREASIERINSTALLATION

0OWERSUPPLYUNIT

3TEELBODY

,IGHTHOUSEOPTIC

3ECONDARYREFLECTORWITHHIGHLY EFFICIENT DIFFUSINGPAINT

0RIMARYREFLECTORINHIGH REFLECTIVE THERMOPLASTICMATERIAL

s,%$7 sLUMEN s-AC!DAM3$# s"EAM8& s##4++ s#2)MIN s,IFE,+ H s)0

s)NSTALLATIONONMODULARFALSECEILING XMMANDXMM WITHVISIBLE SUPPORTINGSTRUCTUREOR BYMEANSOFASUSPENSION KIT WITHCONCEALEDSTRUCTURE s)NSTALLATIONALSOPOSSIBLEINPLASTERBOARDCEILING BYMEANSOFARECESSINGFRAME AVAILABLEASACCESSORY  s3USPENSIONKITSANDFRAMESNEEDTOBEORDERED SEPARATELY s%LECTRONICPOWERSUPPLY ORDIMMABLEELECTRONIC POWERSUPPLY s#OMPLIANTWITHTHESTANDARD%5  ANDOTHERSPECIFICREGULATIONS

8&%XTRAmOOD ª

?


3OLAR,%$

7 7

'LOSSYWHITE

7EIGHT  KG

#EILING XMM

 KG

XMM

&LUX LM LM LM

##4 + + +

#OLOR

.ONDIMMABLE

$!,)

#ODE - - -

#ODE - - -

6AC(ZELECTRONICBALLASTINCLUDED )0

ª

!CCESSORIES 3USPENSIONKITSPIECES 4OBEUSEDWHENTHEFALSECEILING ISACCESSEDFROMABOVE

#ODE -

&RAMEFORINSTALLATION ONPLASTERFALSECEILING XMM XMM  +G

-

&RAMEFORINSTALLATION ONPLASTERFALSECEILING XMM XMM  +G

-

MIN MM

)NSTALLATIONONPLASTERBOARDFALSECEILINGTHROUGH RECESSFRAME-OR- AVAILABLEASACCESSORIES

MIN MM

)NSTALLATIONONPANELFALSECEILINGSXMM ORXWITHAPPROPRIATEBRACKETS - TOBEORDEREDSEPARATELY ONARECESSEDSTRUCTURE





 



Â&#x152; 

MIN MM

)NSTALLATIONONPANELFALSECEILING XMMORXMMWITHEXPOSED SUPPORTINGFRAMEWORK


(1-ASERATI -ODENA)TALIEN !RCH3TUDIO!RCHITECTS$ESIGNERS

?


+ALIFARECESSED %RNESTO'ISMONDI 

s&LUOX7 sLUMEN s-AC!DAM3$# s"EAM8& s)0

s !RANGEOFRECESSEDLUMINAIRESUSINGFLUORESCENT LAMPS SOFTLIGHTXW4# ,%,  s 3UITABLEFORINSTALLATIONINTOFALSECEILINGSYSTEMS WITHXMMANDXMMMODULES ORINTOPLASTERBOARDFALSECEILINGSUSING ASPECIALRECESSINGFRAMEOPTIONAL  s %LECTRONICORDALI SWITCHDIMDIMMABLE ELECTRONICBALLAST OREMERGENCYLIGHTING s #OMPLIESWITHSTANDARD%.  ANDOTHERSPECIFICSTANDARDS s 3TEELMAINREFLECTOR WITHWHITEPAINTFINISH MMTHICKSCREEN PRINTEDTEMPEREDGLASS

8&%XTRAmOOD ª


7HITE

.ONDIMMABLE

EMERGENCYH

#OLOR

#ODE - -

#ODE -

#OLOR

#ODE - -

4# ,%,' 7 "EAM X7 8&

7EIGHT  KG  KG

#EILING XMM XMM

&LUX LM LM

$ALI 3WITCH$IM

6AC(ZELECTRONICBALLASTINCLUDED

)0)+J

2ECESSFRAMEFORINSTALLATION ONPLASTERBOARDFALSECEILING XMM XMM  KG 2ECESSFRAMEFORINSTALLATION ONPLASTERBOARDFALSECEILING XMM XMM  KG

)NSTALLATIONWITHLUMINAIREINCORPORATED INTOTHEMODULARCEILINGSTRUCTURE



#OMPONENTS





ª

#ODE - 

-

)NSTALLATIONINTOPLASTERCEILINGWITHOPTIONALRECESS FRAME-OR- 

?




-OTEL/NE +ÚLN $%

0IXEL-ESH


s4HE0IXEL-ESHISAMATRIXOF2'",%$THATCANBECONTROLLEDTOCREATEANYKIND OFSIGNAGE IMAGE ORSCENARIOACCORDINGTOTHEREQUESTOFTHECLIENT s4HE0IXEL-ESHCANBEUSEDINDOORSANDOUTDOORS ANDSEVERALBASICMODULES CANBECOMBINEDTOEXTENDTHESYSTEMTOTHEDESIREDAREA s4HEBASICMODLEHASADENSITYOF,%$SQMPITCHMM WITHATOTAL POWER OF7SQM s4HECONTROLSYSTEMISINTEGRATEDINTHEPRODUCTANDCANBERE PROGRAMMED EVENAFTERINSTALLATION s4RANSPARENCYFACTOR s&LEXIBLEMODULE s0LUG  PLAYINSTALLATION

3INGLEMODULE ,%$IN3-$ 2ESOLUTION  4RANSAPRENCY 2EFRESHRATE(Z )NPUTFREQUENCY (Z $ATACONNECTION2* 4ESTEDINEVIRONMENTS WITHTEMPERATUREFROM ª#TO ª# )0

7,%$ 7MAX

7EIGHT  KG

2'"

!REA  M

6AC(ZMAINVOLTAGE 0IXELMESHNEEDSTOBEPERMANENTLYCONNECTEDTOA0#WITH$6)OUTPUTTOPLAYVIDEOANDIMAGESOFANYGIVENDIGITALFORMAT



4HEPRODUCTCANBECUSTOMIZEDTORESPONDTODIFFERENTPROJECTNEEDS&ORDEDICATEDQUOTATIONANDFURTHERENQUIRIES PLEASE CONTACT!RTEMIDESALESOFlCE





?


/UTDOOR

?


3CENOGRAPHIC,IGTHING

    

3PIKE 3UPERSPIKE ,INEA,ED ,ABEL,IGHT $EDALO

?


3PIKE 


s,%$7 7 sLUMEN s-AC!DAM3$# s"EAM3 & 7& %,ELLIPTICAL

s,IGHTINGAPPLIANCEWITHHIGH YIELD,%$SOURCES s7ALLORCEILINGMOUNTED s-ONOCHROMEOR2'"LIGHT s%.!74EXTRUDEDALUMINIUMBODY

s##4+

sMM THICKMETHACRYLATEDIFFUSER s$IE CASTALUMINIUMCAPSWITHSILICONRIM

s#2)

s%.!"ALUMINIUMADJUSTMENTBRACKETS

s,IFE,+ 

s0OWERUNITCONNECTIONWITHBIPOLAR(2. & CABLEMONOCHROME ORQUADRIPOLARSILICON RUBBERCABLE2'" WITHSTANDARD)0CLAMP s2EMOTE6DCPOWERUNIT

s2'"

s)0

3SPOT ª ª

&mOOD ª ª

7&WIDEmOOD ª ª

s"ODYINANODIZEDEXTRUDEDALUMINIUM#APS ANDBRACKETSINPAINTEDDIE CASTALUMINIUMWITH  STAGEOUTDOORTREATMENTNANOTECHNOLOGIES ANTI OXIDANTPRIMER POLYESTERPAINT s/PTIONALPAINTEDEXTRUDEDALUMINIUMANTI GLARESCREEN s/PTICALUNITS0--!LENSESWITHDIFFERENT BEAMOPTIONS s2'"VERSIONMADEUPOFMONOCHROMERED GREENANDBLUE,%$S s4ECHNICALSPECIFICATIONSOF%.  COMPLIANTAPPLIANCES

77WALLWASHER

?


3ILVERGREY

3PIKE

,ENGTH ,MM

#2) 

7

,MM



7

,MM



7

,MM



7EIGHT "EAM  KG ª ª %,  KG ª ª %,  KG ª ª %,  KG ª ª %,

&LUX LM LM LM LM LM LM LM LM LM LM LM LM

##4 + + + + + + + + + + + +

#ODE 47 47 4%,7 47 47 4%,7 47 47 4%,7 47 47 4%,7

)0

$RIVER7 $RIVER7 $RIVER7

7777

6DC)0 6DC)0 6DC)0



â&#x2C6;&#x2026;



6DCPOWERSUPPLIEDSEPARATELY



7 7

., ., .,

â&#x2C6;&#x2026; 



#OMPONENTSNEEDEDFORDIMMINGAREAVAILABLEUPONREQUEST

!NTIDAZZLESCREEN

MM MM MM MM

4 4 4 4

3PIKE2'"

7 72'"

,ENGTH ,MM

7EIGHT  KG

#ODE .,# .,# .,%,# .,#

"EAM ª ª %, ª

 -



)0



,%$DRIVER.,8 )076DC ,%$DRIVER.,8 )076DC ,%$DRIVER.,8 )076DC

07- 07- 07-

MAX MAX MAX

., ., .,

07-DRIVERFORFIXTURESWITHAUTONOMOUSCOLOURPROGRAMMEFORSTAND ALONEOR CONTROLLED WORKINGBYMEANSOF$-8PROTOCOLFORINSTALLATIONSOFALLSIZES

$3#53"INTERFACED$-8STANDALONE

.,

$IGITALINTERFACEPROVIDEDWITHSOFTWARE)FCONNECTEDTOTHE0#53"PORT IT TRANSFORMSTHEPROGRAMMEINSTRUCTIONSINTO$-8CONTROLSIGNALS $3#$-8CONTROLLABLECHANNELS REAL TIMECLOCK LOCALUSE ALLOWS COMPUTER INTERACTIVEPROGRAMMINGANDSTAND ALONEMODE THATISTHEPOSSIBILITYOF AUTONOMOUSINTERFACEREPETITIONWITHOUT0#CONNECTION

6M!BALLASTWITHMINI53"CONNECTORFOR$3# CM LONGCABLEWITH(%CONNECTORFORCONNECTIONTOAKEYBOARD !NTIDAZZLESCREEN

., ., .,

â&#x2C6;&#x2026; 


0ALAZZO"IANDRÃ&#x152; -ILAN )4



?


3UPERSPIKE 


s,%$7 7

s,IGHTINGAPPLIANCEWITHHIGH YIELD,%$SOURCES

s2EMOTE6DCPOWERUNIT

sLUMEN

s7ALLORCEILINGMOUNTED

s-AC!DAM3$#

s-ONOCHROMEOR2'"LIGHT

s/PTICS0--!LENSESWITHDIFFERENTBEAM VERSIONS

s"EAM3 7&

s-ADEUPOFABODY ADIFFUSER ANDAPROTECTION FRAME

s##4+ s2'" s#2) s,IFE,+  s)0

s%.!74ALUMINIUMEXTRUSIONBODY s#LEARANTI 56MM THICKPOLYCARBONATEDIFFUSER s$IE CASTALUMINIUMCAPSWITHSILICONGASKET

s2'"VERSIONMADEOFMONOCHROMERED GREEN ANDBLUE,%$S s0ROFILEFINISHEDWITH STAGEOUTDOORTREATMENT PRIMER OUTDOORPAINT s4HETECHNICALSPECIFICATIONSOFTHEAPPLIANCES COMPLYWITH%. 

s0AINTEDALUMINIUMBRACKETS s#ONNECTIONWITHPOWERUNITVIABIPOLAR (2. &CABLEWITHSTANDARD)0CLAMP INCLUDED

3SPOT ª ª

7&WIDEmOOD ª ª

?


3ILVERGREY

3UPERSPIKE

7 7

,ENGTH ,MM

#2) 7EIGHT   KG

7

,MM

  KG

"EAM ª ª ª ª ª ª

&LUX LM LM LM LM LM LM

#ODE .,+ .,+ .,+ .,+ .,+ .,+

##4 + + + + + +



)0

  

$RIVER $RIVER

7 7

6DC 6DC

#ODE ., .,

3UPER3PIKE3UPER3PIKE

 



3UPERSPIKE2'"

7 7 7

,ENGTH ,MM ,MM

"EAM ª ª ª ª ª ª

#ODE .,# .,# .,# .,# .,# .,#

 -



)0

3UPER3PIKE

,%$DRIVER.,8 )076DC ,%$DRIVER.,8 )076DC ,%$DRIVER.,8 )076DC

07- 07- 07-

  

3UPER3PIKE

 

  

#ODE ., ., .,

07-DRIVERFORFIXTURESWITHAUTONOMOUSCOLOURPROGRAMMEFORSTAND ALONEORCONTROLLED WORKINGBYMEANSOF$-8PROTOCOLFORINSTALLATIONSOFALLSIZES

$3#53"INTERFACED$-8STANDALONE

.,

$IGITALINTERFACEPROVIDEDWITHSOFTWARE)FCONNECTEDTOTHE0#53"PORT ITTRANSFORMS THEPROGRAMINSTRUCTIONSINTO$-8CONTROLSIGNALS $3#$-8CONTROLLABLECHANNELS REAL TIMECLOCK LOCALUSE ALLOWSCOMPUTER INTERACTIVEPROGRAMMING ANDSTAND ALONEMODE THATISTHEPOSSIBILITYOFAUTONOMOUSINTERFACEREPETITIONWITHOUT0#CONNECTION

6M!BALLASTWITHMINI53"CONNECTORFOR$3# CM LONG#ABLEWITH(%CONNECTORFORCONNECTIONTOAKEYBOARD

., .,


%X-ANIFATTURE4ABACCHI,OCAL'OVERNMENTDEPARTMENTS 2OME )4 3ESTE%NGINEERING

?


,INEA,ED $RIVE OVER #ARLOTTADE"EVILACQUA 


s7 7 sLUMEN s-AC!DAM3$#s"EAM8& s##4+ s#2) s,IFE,+ H s)0)0

s 7ALKOVERANDDRIVEOVERAPPROVEDUPTO +G

s 2ECESSINGBOXENDCAPSANDJUNCTIONINSTAINLESS STEEL!)3)

s ,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHT SOURCES

s %LECTRICALCONNECTIONTOTHEBALLASTBYMEANS OFATWO POLECABLE(2. & WITH)0QUICK RELEASETERMINALBLOCKWHICHISSUPPLIEDWITHTHE FIXTUREANDCANBEHOUSEDINTHERECESSINGBOX

s 7ALK OVERANDDRIVE OVERRECESSEDFLOOR INSTALLATION s -ONOCHROMATICOR2'"LIGHT s #OMPOSEDOFBODY DIFFUSER RECESSINGBOX CLOSINGENDCAPS JUNCTIONS s "ODYINEXTRUDED%.!74ALUMINUM s /PALNON SLIPPERYTEMPEREDGLASSMM THICK s 'LASSSURFACETEMPERATURELOWERTHANª s 0ROFILEENDCAPSINALUMINUM%.!7 s 2ECESSINGBOXFORLAYINGINSTAINLESSSTEEL !)3)

s 6DCREMOTEBALLAST s "ODYFASTENEDTOTHERECESSINGBOXBYMEANSOF PROPERPRE STRESSEDSTEELSPRINGSSUPPLIEDWITH THEFIXTURE s 0AINTEDPROFILEWITH STAGEOUTDOORTREATMENT PRIMER OUTDOORPAINT s 2'"VERSIONWITH&ULL#OLOUR2'",%$S s 4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. 

?


,INEA,ED

7 7 7

,ENGHT MM MM

#2)  

"EAM 8& 8&

&LUX LM LM

##4 + +

#ODE .,63+ .,63+

$RIVER6DC3%,6SUPPLIEDSEPARATELY

$RIVER $RIVER $RIVER

7 7 7

6DC 6DC 6DC

7

7

MAX MAX MAX

MAX MAX MAX

., ., ., )0)0

-AXIMUMLINEARLENGTHOFASERIESOFPRODUCTSWITHONESUPPLYLINEM&OR LINESOIFLENGTHEXCEEDINGM PROVIDEMULTIPLESUPPLYLINES

 

 

., ., ., ., ., ., .,

  

(OUSING ,MM (OUSING ,MM #ONTINUITYJOINT XX MM (OUSINGENDCAPPAIR  X X MM 0OWERFEEDCONNECTORCONNECTORENDCAP &EMALEPOWERCONNECTORFORDISCONTINUOUSCONNECTION -ALEPOWERCONNECTORFORDISCONTINUOUSCONNECTION

 

,INEA,ED2'"

7 7 7

,ENGTH MM MM

#ODE ., .,

$RIVER6DC3%,6SUPPLIEDSEPARATELY

 7 ,%$DRIVER.,8 )076DC07- MAX ,%$DRIVER.,8 )076DC07- MAX ,%$DRIVER.,8 )076DC07- MAX

7

MAX MAX MAX

., ., ., )0)0

07-DRIVERFORFIXTURESWITHAUTONOMOUSCOLOURPROGRAMMERSFORSTAND ALONE

 -

ORCONTROLLEDWORKINGBYMEANSOF$-8PROTOCOLFORINSTALLATIONSOFALLSIZES

 

$3#53"INTERFACED$-8STANDALONE

 

.,  



$IGITALINTERFACEPROVIDEDWITHSOFTWARE)FCONNECTEDTOTHE0#53"PORT IT TRANSFORMSTHEPROGRAMMERSINSTRUCTIONSINTO$-8CONTROLSIGNALS $3#$-8CONTROLLABLECHANNELS REAL TIMECLOCK LOCALUSE ALLOWS COMPUTER INTERACTIVEPROGRAMMINGANDSTAND ALONEMODE THATISTHE POSSIBILITYOFAUTONOMOUSINTERFACEREPETITIONWITHOUT0#CONNECTION

 

6M!BALLASTWITHMINI53"CONNECTORFOR$3# CM LONG#ABLEWITH(%CONNECTORFORCONNECTIONTOA KEYBOARD

., .,

(OUSING ,MM (OUSING ,MM #ONTINUITYJOINT XX MM (OUSINGENDCAPPAIR  X X MM 0OWERSUPPLYCONNECTORCONNECTORENDCAP &EMALEPOWERCONNECTORFORDISCONTINUOUSCONNECTION -ALEPOWERCONNECTORFORDISCONTINUOUSCONNECTION

., ., ., ., ., ., .,


4WIRL 5NIVERSITÃ&#x152;3TATALEDI-ILANO -ILAN )4 0ROJECT:AHA(ADID

?


,INEA,ED 7ALLWASHER #ARLOTTADE"EVILACQUA 

s 77 sLUMEN s-AC!DAM3$#s"EAM3 & %, s##4+ s#2) s,IFE,+ s)0)0

s7ALKOVERANDDRIVEOVERAPPROVEDUPTO+G s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHT SOURCES s,INEA,ED7ALLWASHERWALK OVERANDDRIVE OVERRECESSEDFLOORINSTALLATION#ONSISTOF BODY DIFFUSER RECESSINGBOX CLOSINGENDCAPS JUNCTIONS"ODYFASTENEDTOTHERECESSINGBOX BYMEANSOFPROPERPRE STRESSEDSTEELSPRINGS SUPPLIEDWITHTHEFIXTURE s,INEA,ED7ALLWASHERADJUSTABLE7ALLOR CEILINGINSTALLATION#ONSISTBYBODYINEXTRUDED ALUMINIUM PROTECTIONGLASS ADJUSTABLEDIE CAST ALUMINIUMBRACKETS s"ODYINEXTRUDED%.!74ALUMINUM s4RANSPARENTNON SLIPPERYTEMPEREDGLASS MM THICK'LASSSURFACETEMPERATURELOWERTHAN ª

s0ROFILEENDCAPSININJECTION MOULDPOLYCARBONATE WITHSILICONEGASKET s2ECESSINGBOXFORLAYING RECESSINGBOXENDCAPS ANDJUNCTIONINSTAINLESSSTEEL!)3) s%LECTRICALCONNECTIONTOTHEBALLASTBYMEANSOFA TWO POLECABLE(2. &WITH)0QUICK RELEASE TERMINALBLOCKWHICHISSUPPLIEDWITHTHEFIXTURE ANDCANBEHOUSEDINTHERECESSINGBOX,INEA,ED 7ALLWASHER ORWITH)0TERMINALBOARDSUPPLIED WITHTHEFIXTURE,INEA,ED7ALLWASHERADJUSTABLE  s6DCREMOTEBALLAST s/PTICS0--!LENSESINDIFFERENTVERSIONSOF BEAMS s0AINTEDPROFILEANDBRACKETSWITH STAGEOUTDOOR TREATMENTPRIMER OUTDOORPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. 


0ALAZZO6IA-ANZONI -ILAN )4 0ROJECT3TUDIO0IVATO3!3 ARCH#RISTINA0IVATO

?


,INEA,ED7ALLWASHER

3POTOPTIC

&LOODOPTIC

%LLIPTICALOPTIC

#ONCENTRATEDLUMINOUSFLOWTOHIGHLIGHT DETAILSAVOIDINGUNWANTEDLIGHTDISPERSION

-EDIUMLUMINOUSFLUXTOHIGHLIGHTDETAILS LARGE SECTIONSOFWINDOWS

%LLIPTICALDISTRIBUTIONOFTHELUMINOUSFLOW SUITABLEFORWALLWASHEREFFECT

ªOPTIC

ªOPTIC

ELLIPTICALOPTIC77

#HIESADI#APALBIO3CALO #APALBIO )4


3ILVERGREY

,INEA,ED7ALLWASHER

,%$ 7  7

,ENGHT MM

#2) 

7EIGHT  KG

7

MM



 KG

7

MM



 KG

7

MM



 KG

"EAM ª ª %, ª ª %, ª ª %, ª ª %,

&LUX LM LM LM LM LM LM LM LM LM LM LM LM

##4 + + + + + + + + + + + +

#ODE .,+ .,+ .,%,+ .,+ .,+ .,%,+ .,+ .,+ .,%,+ .,+ .,+ .,%,+

)0)+



 

$RIVER6DC3%,6SUPPLIEDSEPARATELY    

$RIVER $RIVER $RIVER

7 7 7

)0 )0 )0

6DC 6DC 6DC

 7

7 7 7

MAX MAX MAX MAX MAX MAX MAX MAX MAX MAX MAX MAX

#ODE ., ., .,

-AXIMUMLINEARLENGTHOFASERIESOFPRODUCTSWITHONEFEEDINGLINEM&OR LINESOIFLENGTHEXCEEDINGM PROVIDEMULTIPLEFEEDINGLINES

., ., ., ., ., ., ., ., .,

(OUSING ,MM ,MM ,MM ,MM #ONTINUITYJOINT XX MM (OUSINGENDCAPPAIR  X X MM 0OWERFEEDCONNECTORCONNECTORENDCAP &EMALEPOWERCONNECTORFORDISCONTINUOUSCONNECTION -ALEPOWERCONNECTORFORDISCONTINUOUSCONNECTION

,INEA,ED7ALLWASHERADJUSTABLE

,%$ 7  7

,ENGHT #2) MM 

7EIGHT  KG

7

MM 

 KG

7

MM 

 KG

7

MM 

 KG

"EAM ª ª %, ª ª %, ª ª %, ª ª %,

&LUX LM LM LM LM LM LM LM LM LM LM LM LM

##4 + + + + + + + + + + + +

#ODE .,+ .,+ .,%,+ .,+ .,+ .,%,+ .,+ .,+ .,%,+ .,+ .,+ .,%,+

)0)+



$RIVER6DC3%,6SUPPLIEDSEPARATELY

$RIVER $RIVER $RIVER

7 7 7

)0 )0 )0

6DC 6DC 6DC

 7

7 7 7

MAX MAX MAX MAX MAX MAX MAX MAX MAX MAX MAX MAX

#ODE ., ., .,

   



?


,ABEL,IGHT 

s77

s,IGHTFIXTUREWITHMM,%$LIGHTSOURCES

s/PTIONAL)0TERMINALBOARDS

sLUMEN

s7ALLANDCEILINGINSTALLATIONBYMEANSOFSPECIAL ACCESSORIESCLIPS 

s06#CLIPSFORFIXINGANDADJUSTMENTSTANDARD SUPPLY 

sMM DIAMETERBODYIN56 STABILISED TRANSPARENTPOLYCARBONATE

s'LOWWIRETESTª#

s"EAM!3ASYMMETRICAL s#2) s##4+ s)0

s%NDCAPSIN06#WITHO RINGGASKETAND INSULATINGRESIN s)0CABLEGLAND0'INPOLYAMIDE s%LECTRICALCONNECTIONTOTHEMAINSBYMEANSOF CABLE(2. & MONOCHROMATICVERSION 

!3!SYMMETRICAL

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. ANDPART 


7 7 7

,ENGHT MM MM

#2)  

7EIGHT "EAM  KG !3  KG !3

&LUX LM LM

##4 + +

3INGLECONNECTION

$OUBLECONNECTION

#ODE !) !)

#ODE !) !)

$RIVER6DC3%,6SUPPLIEDSEPARATELY

$RIVER CV76DC CV76DC CV76DC CV76DC

6AC  6  6  6  6

)0    

7    

7    

#ODE 4 4 4 $6

)0

!CCESSORIES

Â&#x2019;

 

#ODE !) .,

7ALLlXING 3MALLCLAMPS)0

 



Â&#x2019;

 

3INGLECONNECTION #ONNECTORCABLELENGTHMM



 

$OUBLECONNECTION #ONNECTORCABLELENGTHXMM -AXIMUMTOTALLENGTHOFlXTURESCONNECTEDINSERIESMETERS

?


0IAZZADEI'UIDI 6INCI&LORENCE )4,IGHTING$ESIGN3TUDIO#ANNATAE0ARTNERS

?


$EDALO 


s,%$7 7 7

s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$ LIGHTSOURCES

sLUMEN

s#EILING WALLORFLOORINSTALLATION

s-C!DM3$#-

s&LEXIBLEPROFILE

s##4+

s&LEXIBLE56 RESISTANTPOLYURETHANERESIN RIM

s2'" s#2)

s!CCURATELEDSELECTIONEQUALTO 3TEP -AC!DAM ENSURINGCOLOURCONSISTENCY

s)0)0

s%LECTRICALCONNECTIONTOTHEDRIVERBY MEANSOF(2. &)0 OR&%0 &%0CABLE )0 ANDAPPROPRIATETERMINALBOARD PROVIDEDWITHTHEFIXTURE s2'"&ULLCOLOUR,%$ s/PERATINGTEMPERATURE ª# ª# s4ECHNICALFEATURESOFLIGHTFIXTURESIN COMPLIANCEWITH%. 

s-ADHESIVEFILMTOFIXTHEPRODUCT SUPPLIEDWITHTHEFIXTURE s2EMOTEDRIVER

7 ,MM #2) 7,%$   7,%$  

7EIGHT  KG  KG

&LUX ##4 LM + LM +

)0

)0

#ODE .,64+ .,64+

#ODE .,64+ .,64+

7DIVISIBLEEVERYMM 7DIVISIBLEEVERYMM

$RIVER6DC3%,6SUPPLIEDSEPARATELY

,MM 7MM      

(MM )0      

7 MAX MAX MAX

7 MAX MAX

#ODE ., ., ., .,



$RIVER 6AC CV76DC   CV76DC   CV76DC   #ONNECTION+ITMALE FEMALE



2'" 7 ,MM #2) 7,%$  

7EIGHT  KG

2'"  M

)0

)0

#ODE .,

#ODE .,



7DIVISIBLEEVERY MM

$RIVER 6AC )0 ,MM 7MM (MM CV76DC07-   )0    MAX CV76DC   )0   MAX

#ODE ., ., ., ., .,



$3#53"INTERFACE$-8STANDALONE 6M!BALLASTWITHMINI53"CONNECTORFOR$3# CMCABLEWITH(%CONNECTORFORKEYBOARDOPTIONAL





?


0ROJECTOR

    

-INISPOT %GO3POT %PULO &ALANGE /BICE

?


-INISPOT 

s,%$7

s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHTSOURCES

sLUMEN

s'ROUND FLOOR WALLINSTALLATION

s-AC!DAM3$#

s#ONSISTSOFBODY METALRING DIFFUSERINOPALINEPOLYCARBONATE MMTHICK

s"EAM&7&

s"ODYANDMETALRINGINANTICORODALALUMINIUM ANODIZED

s##4+

s3ILICONEO RINGGASKETS

s#2)

s2EMOTEDRIVERSUPPLIEDSEPARATELY

s,IFE,+ 

s0OWERCONNECTIONTOTHEDRIVERBYMEANSOF(2. &CABLEAND)0ELECTRICAL TERMINALBOARD SUPPLIEDWITHTHEFIXTURE

s)0

s&IXEDOPTIC0--!LENSESINDIFFERENTVERSIONSOFBEAMS s0ICKETFORGROUNDINSTALLATION

 ª

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH%. ANDPART  s)NSTALLATIONMUSTBECARRIEDOUTBYSPECIALIZEDPERSONNEL

&mOOD ª ª

7&WIDEmOOD ª ª


-INISPOT

3ILVER

)0 7EIGHT  KG

&LUX LM LM LM

"EAM ª ª ª

##4 + + +

#ODE .,+ .,+ .,%,+





#2) 

7 7





$RIVERM!3%,6SUPPLIEDSEPARATELY

$RIVER

6AC

,MM 7MM (MM

CC7M!

 





 MAX

#ODE .,

CC7M!

 







.,

CC7M!

 





 MAX

.,

0ICKETINANODISEDMETALXMM

.,

0RIVATERESIDENCE -ILAN )4 INTERIORDESIGN%RNA#ORBETTA0H"EPPE2ASO

?


0RIVATERESIDENCE -ILAN )4 INTERIORDESIGN%RNA#ORBETTA0H"EPPE2ASO


?


%GO3POT 

s,%$7WHITE

s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHTSOURCES

sLUMEN

s'ROUND FLOOR WALLINSTALLATION

s-AC!DAM3$#

s#ONSISTSOFBODY FRAME GLASSANDBRACKET

s"EAM3 & %,ELLIPTICAL

s!LUMINIUMFOLDEDSHEETBRACKET!LLALUMINIUM COMPONENTSAREANODIZED

s##4+ s#2) s,IFE,+  s)0  ª

s$IFFUSERINGLASS MM THICK s'ASKETSIN%0$- s2EMOTEDRIVERSUPPLIEDSEPARATELY s0OWERCONNECTIONTOTHEDRIVERBYMEANSOF(2. & CABLEAND)0ELECTRICALTERMINALBOARD SUPPLIEDWITH THEFIXTURE

s&IXEDOPTIC0--!LENSESINDIFFERENTVERSIONSOF BEAMS s0ICKETFORGROUNDINSTALLATIONINGALVANIZEDSHEETIRON s0AINTEDALUMINIUMWITH STAGEOUTDOORTREATMENT ANTIOXIDANTPRIMER POLYESTERPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH %. ANDPART  s)NSTALLATIONMUSTBECARRIEDOUTBYSPECIALIZED PERSONNEL


3POTOPTIC #ONCENTRATEDLUMINOUSFLOWTO HIGHLIGHTDETAILSAVOIDINGUNWANTED LIGHTDISPERSION ªOPTIC

&LOODOPTIC -EDIUMLUMINOUSFLUXTOHIGHLIGHT DETAILS LARGESECTIONSOFWINDOWS

%LLIPTICALOPTIC %LLIPTICALDISTRIBUTIONOFTHELUMINOUS FLOWSUITABLEFORWALLWASHEREFFECT

ªOPTIC

ELLIPTICALOPTIC77

3ILVERGREY

%GO3POT6DC 7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

6DC 6DC 6DC

)0 )0 )0

MAX MAX MAX

##4 + + +

#ODE 4307 4&,7 4%,047

$RIVER6DC3%,6SUPPLIEDSEPARATELY )0

., ., ., .,

 

7 7 7



$RIVER $RIVER $RIVER 0ICKET





?


(OTEL#HÃ&#x160;TEAU-ONFORT -ILAN )4 !RCH3OFIA6EDANI &:))NTERIORS PH3TEFANO/PPO


?


%PULO %RNESTO'ISMONDI 

s,%$7 7 sLUMEN s-AC!DAM3$#

s&LOOR WALLANDEAVESINSTALLATION

s)0CONNECTORFORELECTRICCONNECTIONTOTHEMAINS ITCANBEHOUSEDINTHETERMINALBOARDCOMPARTMENT ANDISSUITABLEFORCABLESWITHADIAMETEROF  MM

s!VAILABLEINTWOFINISHESGREY WHITEPAINTED2!,  ANDANTHRACITEGREYPAINTED

s##4+ s#2)

s#ONSISTSOFLIGHTINGUNIT TERMINALBOARDANDFIXING BRACKET2OTATIONONTHEBASE  ª SIDEBODY TILT  ªANDFRONTBODYTILT  BYMEANSOFA SPHERICALJOINTALLOWINGANACCURATEADJUSTMENT

s,IFE,+  s)0  ª RIGHTLEFT

s4HEDEVICEISPROVIDEDWITHASAFETYCABLEWITHHOOKTO ALLOWEASYWIRINGDURINGITSINSTALLATIONINANYPOSITION

sSIZES%PULOAND%PULO

s"EAM83 7& %,ELLIPTICAL

 ª UPDOWN

s,IGHTFIXTUREWITHADJUSTABLEDIRECTEMISSION WITHHIGH PERFORMANCE,%$LIGHTSOURCES

 ª

s"ODYANDTERMINALBOARDIN%.!" ALUMINIUM FIXINGBRACKETINSTAINLESSSTEEL SILICONEGASKETS %LECTRONICBALLASTINTEGRATEDINTHEBODY s3ILKSCREENEDTEMPEREDGLASSSILICONEDFLUSHWITHTHE BODYTOAVOIDBACKWATER

s0--!LENSESINDIFFERENTVERSIONSOFBEAMS s3CREWSIN!)3)STAINLESSSTEEL s4HECOMPONENTSINDIE CASTALUMINIUMANDTHESTEEL BRACKETAREPAINTEDWITH STAGEOUTDOORTREATMENT NANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH %. ANDPART 


%XTRA3POTOPTIC

7IDE&LOODOPTIC

%LLIPTICALOPTIC

#ONCENTRATEDLUMINOUSFLOW TOHIGHLIGHTDETAILSAVOIDING UNWANTEDLIGHTDISPERSION

7IDELUMINOUSFLOWSUITABLE FORLIGHTINGLARGEAREAS

%LLIPTICALDISTRIBUTIONOFTHE LUMINOUSFLOWSUITABLEFOR WALLWASHEREFFECT

ªOPTIC

ELLIPTICALOPTIC77

ªOPTIC

'REY WHITE2!,

!NTHRACITEGREY

%PULO 7 7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

##4 +

ª

LM

+

%,

LM

+

#OLOR

#ODE 47 47 47 47 4%,7 4%,7 )0)+

156

313

130

6AC(ZELECTRONICBALLASTINCLUDED

%PULO 7 7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

##4 +

ª

LM

+

%,

LM

+

#OLOR

#ODE 47 47 47 47 4%,7 4%,7 )0)+

156

387

180

6AC(ZELECTRONICBALLASTINCLUDED

?


!RTEMIDE/FFICES -ILAN )4


$ANESE-IANO -ILAN )4

?


&ALANGE 7ILMOTTE)NDUSTRIES 


s,%$7 7 sLUMEN s-AC!DAM3$# s"EAM3 7& %,ELLIPTICAL s##4+ s#2) s,IFE,+  s)0

s!DJUTABLELIGHTFIXTUREWITHDIRECTEMISSION WITH HIGH PERFORMANCE,%$LIGHTSOURCES

s0--!LENSESINDIFFERENTVERSIONSOFBEAMS

s'ROUND WALL EAVESINSTALLATION

s0AINTEDDIE CASTALUMINIUMWITH STAGEOUTDOOR TREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT

sSIZES X  XMM s#OMPOSEDBYADJUSTABLELIGHTINGUNITANDSUPPORT HOUSINGTHEWIRING BYMEANSOFAGRADUATEDMETAL RINGALLOWINGANACCURATEADJUSTMENT0OSITIONINGIS MAINTAINEDBYMEANSOFLOCKINGDOWELS

s!)3)STAINLESSSTEELSCREWS

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH %. ANDPART 

s"ODYANDSUPPORTIN%.!"ALUMINIUM SILICONEGASKETS s%LECTRONICBALLASTINTEGRATEDINTHEBODY

 ª

s3ILKSCREENEDTEMPEREDGLASSSILICONEDTOASECONDARY FRAME  ª

s7IRINGTOBECARRIEDOUTBYMEANSOFPLUG)0

?


3POTOPTIC

7IDE&LOODOPTIC

%LLIPTICALOPTIC

#ONCENTRATEDLUMINOUSFLOW TOHIGHLIGHT DETAILSAVOIDINGUNWANTED LIGHTDISPERSION

7IDELUMINOUSFLOWSUITABLE FORLIGHTINGLARGEAREAS

%LLIPTICALDISTRIBUTIONOFTHE LUMINOUSFLOWSUITABLEFORWALL WASHEREFFECT

3SPOT ª ª

7&WIDEmOOD ª ª

%,ELLIPTICAL77

'REY WHITE2!,

!NTHRACITEGREY

&ALANGE 7 7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

##4 +

ª

LM

+

%,

LM

+

#OLOR

#ODE .,+ .,+ .,+ .,+ .,%,+ .,%,+





)0

6AC(ZELECTRONICBALLASTINCLUDED 



&ALANGE 7 7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

##4 +

ª

LM

+

%,

LM

+

#OLOR

#ODE .,+ .,+ .,+ .,+ .,%,+ .,%,+



)0

6AC(ZELECTRONICBALLASTINCLUDED 



?


/BICE !LESSANDRO0EDRETTI 3TUDIO2OTA0ARTNERS  

s,%$7 7

s,IGHTSFIXTUREWITHHIGH PERFORMANCE,%$LIGHTSOURCES

sLUMEN

s7ALLCEILINGINSTALLATION

s-AC!DAM3$#/BICE/BICE-INI 3$#/BICE -ICRO

s-ONOCHROMATICLIGHT

s"EAM& 7& %,ELLIPTICALACCESSORY

s"ODYININJECTIONMOULDOFALUMINIUM

s##4+

s4ERMINALBASEANDADJUSTABLEJOINTININJECTIONMOULDOFALUMINIUM

s#2)

s&LANGE PROTECTIONSCREENINTEMPEREDGLASS MM THICK WITHBLACKOPALSERIGRAPHY

s,IFE,+ /BICE /BICE-INI

s)NTEGRATEDPOWERSUPPLY/BICEE/BICE-ICRO 6DCREMOTEDRIVERINCLUDED /BICEMINI 

s,IFE,+ /BICE-ICRO s)0 )0/BICI-ICRO s/BICE /BICE-INI /BICE-ICRO)0 ª ª

&mOOD ª ª

/BICE-ICRO)0

ª

7&WIDEmOOD ª ª

s#ONSISTOFBODY ADJUSTABLEJOINT TERMINALBOARDANDPROTECTIVESCREEN

s7IRINGTOBECARRIEDOUTBYMEANSOFAPLUG)0 LOCATEDINTHETERMINALBASE ONLYFOR/BICEAND/BICE-ICRO  s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH%. 


?


/BICE

7HITE

"LACK

/BICE 7 7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

##4 +

ª

LM

+

#OLOR

#ODE 47 47 47 47

)0)+

Â&#x2019;





6AC(ZELECTRONICBALLASTINCLUDED

 

/BICE-INI 7EIGHT  KG

"EAM ª

&LUX LM

##4 +

ª

LM

+

#OLOR

#ODE 47 47 47 47

$RIVER6DC3%,6SUPPLIEDSEPARATELY

$RIVER CV76DC CV76DC CV76DC CV76DC

6AC        

,MM    

)0)+ 7MM    

(MM    



)0    

MAX MAX MAX MAX

#ODE ., ., ., .,

Â&#x2019;

#2) 



7 7

 

/BICE-ICRO 7 7

#2) 

)0

7EIGHT  KG

##4 "EAM &LUX ª LM + ª

LM +

#OLOR

#ODE -&,7 -&,7 -7&,7 -7&,7

6AC(ZELECTRONICBALLASTINCLUDED

)0

#ODE 4&,7 4&,7 47&,7 47&,7

)0)0)+

ø   ø 

!CCESSORIES !CCESSORIESHOLDER

#ODE 4 4

,ENSFORELLIPTICALEMISSION

4

#OLOR

114

105


?


$OWNLIGHTING 7ALK OVER$RIVE OVER      

%GODOWNLIGHT %GOWALK OVERDRIVE OVER -EGARA -ICROLED !RIA &ACI

?


%GODOWNLIGHT 

s,%$7 7 sLUMEN s-AC!DAM3$# s"EAM83 7& %,ELLIPTICAL 777ALL7ASHER s##4+ s#2) s,IFE,+  s)0)0 s%GO  %GO&LAT%GO  s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHT SOURCES s#EILINGINSTALLATION s4WODIFFERENTHOUSINGDEPTHS s2OUNDANDSQUAREVERSIONINFIVESIZES s#ONSISTSOFBODY FRAME GLASSDIFFUSER FIXING SPRINGS%GO&LATAND%GO  FIXINGBRACKETS %GO    s"ODYIN%.!" ALUMINIUM SILICONE GASKETS s&RAMEINALUMINIUMORSTAINLESSSTEEL!)3) s"LACKSILKSCREENEDTEMPEREDGLASS MM THICK s&IXINGSPRINGSINHARMONICIRON

s0OWERCONNECTIONTOTHEMAINSBYMEANSOF A(2. RCABLEAND)0ELECTRICALTERMINAL BOARD SUPPLIEDWITHTHEFIXTURE s'LASSSURFACETEMPERATURELOWERTHANª# s&IXEDANDADJUSTABLEOPTICS0--!LENSESIN DIFFERENTVERSIONSOFBEAMS s0AINTEDDIE CASTALUMINIUMWITH STAGE OUTDOORTREATMENTNANOTECHNOLOGIES ANTI OXYDANTPRIMER POLYESTERPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. ANDPART 


?


%GODOWNLIGHT

%GODOWNLIGHT 2ECESSEDDEPTHMM

%GODOWNLIGHT 2ECESSEDDEPTHMM

%GODOWNLIGHT 2ECESSEDDEPTHMM

â&#x2C6;&#x2026;¢MM

â&#x2C6;&#x2026;¢MM

â&#x2C6;&#x2026;¢MM

max 35 mm

max 35 mm

%GODOWNLIGHT 2ECESSEDDEPTHMM

%GODOWNLIGHT 2ECESSEDDEPTHMM

%GODOWNLIGHT 2ECESSEDDEPTHMM

â&#x2C6;&#x2026;¢MM

â&#x2C6;&#x2026;¢MM

â&#x2C6;&#x2026;¢MM

max 40 mm

max 35 mm

2EMOTEBALLAST SUPPLIEDSEPARATELY %GO&LAT %GO 

,IGHTINGUNIT WITHBUILT INSPRINGS

2OUNDORSQUAREFRAMEINALUMINIUM ORSTAINLESSSTEEL 3ILKSCREENEDTEMPEREDGLASS

¢MM

¢MM

max 40 mm

max 35 mm


%GODOWNLIGHT 2ECESSEDDEPTHMM

∅¢MM

¢MM

max 40 mm

%GODOWNLIGHT 2ECESSEDDEPTHMM

∅¢MM

¢MM

83EXTRASPOT ª

3SPOT ª ª

max 35 mm

&mOOD ª ª

7&WIDEmOOD ª ª

77WALLWASHER

?


#ENTRO3ERVIZIDELLO3TUDENTATO5NIVERSITARIO 4RENTO )4 0ROGECT3TUDIO0ALERMAND4ABARESDE.AVAS,!RQUITECTOS #,!3D3%NGENEERING ING,UCA-ASINI

?


%GODOWNLIGHTROUND

7 #2)  7 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

!LUMINIUM)+

3TAINLESSSTEEL)+

#ODE 4307 47&,7 4%,047

#ODE 4307 47&,7 4%,047

%LECTRONICBALLAST63%,6SUPPLIEDSEPARATELY

Â&#x2019;¢

4 4 4

7)0XXMM 7)0XXMM 7)0XXMM



$RIVER $RIVER $RIVER

)0)0

â&#x2C6;&#x2026;

max 35 mm

6ERIFYDRIVERRECESSEDHOLESDIMENSIONS 0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS &IXEDBEAM

%GO&LATDOWNLIGHTROUND

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3TAINLESSSTEEL)+

#ODE 4307 47&,7 4%,047

#ODE 4307 47&,7 4%,047

)0)0

%LECTRONICBALLAST63%,6SUPPLIEDSEPARATELY

$RIVER $RIVER

7 7

M! )0 M! )0

MAX MIN MAX

., .,



7 7

!LUMINIUM)+

Â&#x2019;¢

Â&#x2019;

max 40 mm

0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

&IXEDBEAM


%GODOWNLIGHTSQUARE

7 #2)  7 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

!LUMINIUM)+

3TAINLESSSTEEL)+

#ODE 4307 47&,7 4%,047

#ODE 4307 47&,7 4%,047

)0)0



%LECTRONICBALLAST63%,6SUPPLIEDSEPARATELY

$RIVER $RIVER $RIVER

4 4 4

7)0XXMM 7)0XXMM 7)0XXMM

Â&#x2019;¢



max 35 mm

6ERIFYDRIVERRECESSEDHOLESDIMENSIONS 0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS &IXEDBEAM

%GO&LATDOWNLIGHTSQUARE

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

!LUMINIUM)+

3TAINLESSSTEEL)+

#ODE 4307 47&,7 4%,047

#ODE 4307 47&,7 4%,047

)0)0

%LECTRONICBALLAST63%,6SUPPLIEDSEPARATELY

7 7

M! )0 M! )0

MAX MIN MAX

., .,

Â&#x2019;¢ 

$RIVER $RIVER

Â&#x2019;

0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

max 40 mm &IXEDBEAM

?


%GODOWNLIGHTROUND

!LUMINIUM)+ 7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

#ODE 4307 4&,7 4%,047

3TAINLESSSTEEL)+ #ODE 4307 4&,7 4%,047

%LECTRONICBALLAST63%,6SUPPLIEDSEPARATELY

)0)0 4 4 4

7)0XXMM 7)0XXMM 7)0XXMM

Â&#x2019;¢ 

$RIVER $RIVER $RIVER

â&#x2C6;&#x2026;

max 35 mm

6ERIFYDRIVERRECESSEDHOLESDIMENSIONS 0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS !DJUSTABLEBEAM  ª

%GO&LATDOWNLIGHTROUND

!LUMINIUM)+ #2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

)0)0

%LECTRONICBALLAST63%,6SUPPLIEDSEPARATELY

$RIVER $RIVER

7 7

M! )0 M! )0

3TAINLESSSTEEL)+ #ODE 4307 4&,7 4%,047

MAX MAX

., .,



7 7

#ODE 4307 4&,7 4%,047

Â&#x2019;¢

Â&#x2019;

max 35 mm 0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

&IXEDBEAM


%GODOWNLIGHTSQUARE

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

!LUMINIUM)+

3TAINLESSSTEEL)+

#ODE 4307 4&,7 4%,047

#ODE 4307 4&,7 4%,047

%LECTRONICBALLAST63%,6SUPPLIEDSEPARATELY

)0)0 4 4 4

7)0XXMM 7)0XXMM 7)0XXMM

Â&#x2019;¢



$RIVER $RIVER $RIVER



max 35 mm

6ERIFYDRIVERRECESSEDHOLESDIMENSIONS 0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS !DJUSTABLEBEAM  ª

%GO&LATDOWNLIGHTSQUARE

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

!LUMINIUM)+

3TAINLESSSTEEL)+

#ODE 4307 4&,7 4%,047

#ODE 4307 4&,7 4%,047

%LECTRONICBALLAST63%,6SUPPLIEDSEPARATELY

7 7

M! )0 M! )0

)0)0 MAX MAX

., ., 

$RIVER $RIVER

Â&#x2019;¢

Â&#x2019;

max 35 mm

0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

&IXEDBEAM

?


%GODOWNLIGHTROUND

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

!LUMINIUM)+

3TAINLESSSTEEL)+

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

)0)0 Â&#x2019;¢ 

6AC(ZELECTRONICBALLASTINCLUDED

â&#x2C6;&#x2026;

max 40 mm

!DJUSTABLEBEAM  ª

%GO&LATDOWNLIGHTROUND

!LUMINIUM)+ #2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

#ODE 4.307 47&,7 4%,047

)0)0

%LECTRONICBALLASTM!3%,6SUPPLIEDSEPARATELY

$RIVER $RIVER

7 7

M! )0 M! )0

MAX MAX

#ODE 4.307 47&,7 4%,047

Â&#x2019;¢

., .,



7 7

3TAINLESSSTEEL)+



max 35 mm

&IXEDBEAM


%GODOWNLIGHTSQUARE

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

!LUMINIUM)+

3TAINLESSSTEEL)+

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

)0)0



6AC(ZELECTRONICBALLASTINCLUDED

X¢



max 40 mm

!DJUSTABLEBEAM  ª

%GO&LATDOWNLIGHTSQUARE

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3TAINLESSSTEEL)+

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

)0)0

%LECTRONICBALLASTM!3%,6SUPPLIEDSEPARATELY

$RIVER $RIVER

7 7

M! )0 M! )0

MAX MAX

., .,



7 7

!LUMINIUM)+

X¢



max 35 mm

&IXEDBEAM

?


%GODOWNLIGHTROUND

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

!LUMINIUM)+

3TAINLESSSTEEL)+

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047



)0)0

6AC(ZELECTRONICBALLASTINCLUDED â&#x2C6;&#x2026;

Â&#x2019;¢ max 40 mm

!DJUSTABLEBEAM  ª

%GO&LATDOWNLIGHTROUND

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3TAINLESSSTEEL)+

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

%LECTRONICBALLASTM!3%,6SUPPLIEDSEPARATELY

$RIVER

7

M! )0

MAX

.,

)0)0)+ 

7 7

!LUMINIUM)+

Â&#x2019;

Â&#x2019;¢ max 35 mm &IXEDBEAM


%GODOWNLIGHTSQUARE

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

!LUMINIUM)+

3TAINLESSSTEEL)+

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

)0)0



6AC(ZELECTRONICBALLASTINCLUDED 

X¢ max 40 mm

!DJUSTABLEBEAM  ª

%GO&LATDOWNLIGHTSQUARE

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3TAINLESSSTEEL)+

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

)0)0)+

%LECTRONICBALLASTM!3%,6SUPPLIEDSEPARATELY

$RIVER

7

M! )0

MAX

.,



7 7

!LUMINIUM)+

Â&#x2019;

X¢ max 35 mm

&IXEDBEAM

?


%GOGLASSDOWNLIGHT

3POTOPTIC

&LOODOPTIC

%LLIPTICALOPTIC

#ONCENTRATEDLUMINOUSFLOWTOHIGHLIGHT DETAILSAVOIDINGUNWANTEDLIGHTDISPERSION

7IDELUMINOUSFLOWSUITABLEFORLIGHTING LARGEAREAS

%LLIPTICALDISTRIBUTIONOFTHELUMINOUS FLOWSUITABLEFORWALLWASHEREFFECT


%GOGLASSDOWNLIGHT

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

)0)0)+

6AC(ZELECTRONICBALLASTINCLUDED

4

0LATEFORPLASTERBOARD

4

 Â&#x2019;¢MM 

¢MM !DJUSTABLEBEAM  ª

%GO&LATGLASSDOWNLIGHT

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

)0)0)+

%LECTRONICBALLASTM!SUPPLIEDSEPARATELY

$RIVER $RIVER

7 7

M! )0 M! )0

MAX MIN MAX

., .,

 â&#x2C6;&#x2026;

Â&#x2019;¢MM

¢MM &IXEDBEAM

?


%GOGLASSDOWNLIGHT

2OUND 7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

#ODE 4.307 47&,7 4%,047

3QUARE #ODE 4.307 47&,7 4%,047

)0)0)+

6AC(ZELECTRONICBALLASTINCLUDED

4

0LATEFORPLASTERBOARD

4



â&#x2C6;&#x2026;

Â&#x2019;¢MM !DJUSTABLEBEAM  ª

¢MM

%GO&LATGLASSDOWNLIGHT

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

)0)0)+

%LECTRONICBALLASTM!3%,6SUPPLIEDSEPARATELY

$RIVER

7

M! )0

MIN

.,

 â&#x2C6;&#x2026;

Â&#x2019;¢MM &IXEDBEAM

¢MM


?


%GOWALK OVER %GODRIVE OVER 

s,%$77 sLUMEN s-AC!DAM3$# s"EAM. 7&, %ELLIPTICAL 777ALL7ASHER s##4+ s#2) s,IFE,+  s)0)0 s%GO 7/$/ %GO&LAT7/

%GO7/$/


s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHT SOURCES

s(OUSINGINCOMPOSITETECHNOPOLYMER TOBE ORDEREDSEPARATELY

s2ECESSEDGROUNDINSTALLATION

s%GO&LAT7/(2. &FEEDINGCABLELENGTH CM %GO7/$/FEEDINGCABLE (2.&XFOR%GO 

(2.&XFOR%GO

(2.&XFOR%GO  CABLELENGTHCM

s7ALK OVERANDDRIVE OVERVERSIONS s$EPTHOFRECESSBOX %GO7/$/ MM %GO&LAT7/MM s7/$/ROUNDANDSQUAREVERSION EACHONEIN DIFFERENTSIZES s&IXTURECONSISTINGOFBODY FRAME GLASSDIFFUSER HOUSING s!LUMINIUMBODY%.!" WITHSILICONE GASKETS s!LLVERSIONSAREAVAILABLEWITHSTAINLESSSTEEL FRAMES %GO %GOFLAT ALSOAVAILABLEWITH POLISHEDALUMINIUMFRAME %GO %GOFLAT ALSOAVAILABLE WITHMM THICKGLASSFLUSHWITHTHEFLOOR

s'LASSSURFACETEMPERATUREBELOWª# s&IXEDANDADJUSTABLELENSESIN0--!INVERSIONS WITHDIFFERENTBEAMANGLES s$IE CASTPAINTEDALUMINIUMWITH STAGEOUTDOOR TREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. ANDPART 

s!LL%GOVERSIONSEXCLUDING&LATVERSION ARE SUPPLIEDWITHELECTRONICPOWERSUPPLYINSIDE THELUMINAIREBODY&ORANDVERSIONS 6POWERSUPPLYANDREMOTEPOWERSUPPLYTOBE ORDEREDSEPARATELY s!LL%GO&LATCANBEOPERATEDBYAREMOTEPOWER SUPPLYTOBEORDEREDSEPARATELY#ONNECTION CABLEINCLUDESA)0ELECTRICALTERMINALBOARD s(OUSINGLOCKEDBYANTI VANDAL4/28SCREWSIN !)3)STAINLESSSTEEL

?


%GOWALK OVER %GODRIVE OVER

%GO 4EMPEREDGLASSmUSH WITHTHEmOOR

2OUNDORSQUAREFRAME INSTAINLESSSTEEL 3ILKSCREENEDTEMPEREDGLASS

,IGHTINGUNIT

)NTEGRATEDDRIVER

0OLYMERRECESSINGBOX 2ECESSEDDEPTH %GO %GO %GO %GO

MM MM MM MM

3POT

&LOOD

7ALL7ASHER

#ONCENTRATEDLUMINOUSmOWTOHIGHLIGHTDETAILSAVOIDING UNWANTEDLIGHTDISPERSION

7IDELUMINOUSmOWSUITABLEFORLIGHTINGLARGEAREAS

%LLIPTICALDISTRIBUTIONOFTHELUMINOUSmOW SUITABLEFORWALLWASHEREFFECT


%GO&LAT 3ILKSCREENEDTEMPEREDGLASSTHICKNESSMM 4GLASSª# 3TATICLOAD+G

2OUNDORSQUAREFRAMEWITHPAINTED ALUMINIUMMM ORSTAINLESSSTEEL !)3)MM RING 3ILKSCREENEDTEMPEREDGLASSTHICKNESSMM 4GLASSª# 3TATICLOAD+G

%LECTRONICBALLASTSUPPLIEDSEPARATELY

,IGHTINGUNIT

0OLYMERRECESSINGBOX

2EDUCEDRECESSEDDEPTHMM

?


%GOWALK OVERALUMINIUM

7 #2)  7 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4307 47&,7 4%,047

#ODE 4307 47&,7 4%,047

%LECTRONICBALLAST6DCSUPPLIEDSEPARATELY

)0)0)+ â&#x2C6;&#x2026; 





4 4 4 4

2ECESSINGBOX $RIVER 7)0XXMM $RIVER 7)0XXMM $RIVER 7)0XXMM



&IXEDBEAM

â&#x2C6;&#x2026;



0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

%GO&LATWALK OVERALUMINIUM

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3QUARE

#ODE 4307 47&,7 4%,047

#ODE 4307 47&,7 4%,047

)0)0)+

%LECTRONICBALLASTM!SUPPLIEDSEPARATELY

M! )0 M! )0

MAX MIN MAX

0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

.,( ., .,





Â&#x2019;

2ECESSINGBOX $RIVER 7 $RIVER 7



7 7

2OUND

&IXEDBEAM Â&#x2019;

Â&#x2019;


%GODRIVE OVER3TAINLESSSTEEL

7 #2)  7 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4307 47&,7 4%,047

#ODE 4307 47&,7 4%,047

%LECTRONICBALLAST6DCSUPPLIEDSEPARATELY

)0)0)+ â&#x2C6;&#x2026; 







4 4 4 4

2ECESSINGBOX $RIVER 7)0XXMM $RIVER 7)0XXMM $RIVER 7)0XXMM

&IXEDBEAM

â&#x2C6;&#x2026;



0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

%GO&LATWALK OVER3TAINLESSSTEEL

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3QUARE

#ODE 4307 47&,7 4%,047

#ODE 4307 47&,7 4%,047

)0)0)+

%LECTRONICBALLASTM!SUPPLIEDSEPARATELY

M! )0 M! )0

MAX MIN MAX

.,( ., .,





Â&#x2019;

2ECESSINGBOX $RIVER 7 $RIVER 7



7 7

2OUND

&IXEDBEAM Â&#x2019;

Â&#x2019;

0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

?


%GOWALK OVERALUMINIUM

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4307 4&,7 4%,047<

#ODE 4307 4&,7 4%,047

%LECTRONICBALLAST6DCSUPPLIEDSEPARATELY

)0)0)+

4 4 4 4

â&#x2C6;&#x2026; 





2ECESSINGBOX $RIVER 7)0XXMM $RIVER 7)0XXMM $RIVER 7)0XXMM 0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

!DJUSTABLEBEAM  ª

â&#x2C6;&#x2026;



7 7



%GO&LATWALK OVERALUMINIUM

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4307 4&,7 4%,047

#ODE 4307 4&,7 4%,047

)0)0)+ %LECTRONICBALLASTM!SUPPLIEDSEPARATELY

M! )0 M! )0

MAX MIN MAX

.,( ., .,

Â&#x2019;



0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS





2ECESSINGBOX $RIVER 7 $RIVER 7

&IXEDBEAM Â&#x2019;

Â&#x2019;


%GODRIVE OVERSTAINLESSSTEEL

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4307 4&,7 4%,047

#ODE 4307 4&,7 4%,047

%LECTRONICBALLAST6DCSUPPLIEDSEPARATELY

)0)0)+

4 4 4 4

â&#x2C6;&#x2026; 





2ECESSINGBOX $RIVER 7)0XXMM $RIVER 7)0XXMM $RIVER 7)0XXMM 0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS

!DJUSTABLEBEAM  ª

â&#x2C6;&#x2026;



7 7



%GO&LATWALK OVERSTAINLESSSTEEL

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4307 4&,7 4%,047

#ODE 4307 4&,7 4%,047

)0)0)+ %LECTRONICBALLASTM!SUPPLIEDSEPARATELY

M! )0 M! )0

MAX MIN MAX

.,( ., .,

Â&#x2019;



0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS



&IXEDBEAM

Â&#x2019;



2ECESSINGBOX $RIVER 7 $RIVER 7

Â&#x2019;

?


%GODRIVE OVERSTAINLESSSTEEL

2OUND 7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

#ODE 4.307 47&,7 4%,047

3QUARE #ODE 4.307 47&,7 4%,047

)0)0)+

6AC(ZELECTRONICBALLASTINCLUDED

4

2ECESSINGBOX

4

â&#x2C6;&#x2026; 

!DJUSTABLEBEAM  ª







â&#x2C6;&#x2026; 



%GO&LATWALK OVERSTAINLESSSTEEL

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

.,( ., .,

.,(

%LECTRONICBALLASTM!SUPPLIEDSEPARATELY

M! )0 M! )0

MAX MIN MAX

)0)0)+

Â&#x2019;





2ECESSINGBOX $RIVER 7 $RIVER 7



7 7

2OUND

&IXEDBEAM Â&#x2019;

Â&#x2019;


%GODRIVE OVERSTAINLESSSTEEL

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

)0)0)+

6AC(ZELECTRONICBALLASTINCLUDED

4

2ECESSINGBOX

4 â&#x2C6;&#x2026; 

!DJUSTABLEBEAM  ª







â&#x2C6;&#x2026; 



%GO&LATWALK OVERSTAINLESSSTEEL

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

.,( .,

.,(

%LECTRONICBALLASTM!SUPPLIEDSEPARATELY

M! )0

MAX

)0)0)+

Â&#x2019;





2ECESSINGBOX $RIVER 7



2OUND

&IXEDBEAM Â&#x2019;

Â&#x2019;

?


?


%GOGLASSWALK OVER

7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

2OUND

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

4

4

6AC(ZELECTRONICBALLASTINCLUDED

2ECESSINGBOX

)0)0)+ â&#x2C6;&#x2026; 







!DJUSTABLEBEAM  ª

â&#x2C6;&#x2026; 

â&#x2C6;&#x2026; 

%GO&LATGLASSWALK OVER

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

.,( ., .,

.,(

%LECTRONICBALLASTM!SUPPLIEDSEPARATELY

M! )0 M! )0

)0)0)+ MAX MIN MAX

Â&#x2019;





2ECESSINGBOX $RIVER 7 $RIVER 7

&IXEDBEAM

Â&#x2019;



7 7

2OUND

Â&#x2019;


%GOGLASSWALK OVER

2OUND 7 7

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

4

4

6AC(ZELECTRONICBALLASTINCLUDED

2ECESSINGBOX

)0)0)+ â&#x2C6;&#x2026; 

!DJUSTABLEBEAM  ª







â&#x2C6;&#x2026; 

â&#x2C6;&#x2026; 

%GO&LATGLASSWALK OVER

#2) 

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

3QUARE

#ODE 4.307 47&,7 4%,047

#ODE 4.307 47&,7 4%,047

.,( .,

.,(

%LECTRONICBALLASTM!SUPPLIEDSEPARATELY

M! )0

MIN MAX

)0)0)+ Â&#x2019;





2ECESSINGBOX $RIVER 7

&IXEDBEAM

Â&#x2019;



7 7

2OUND

Â&#x2019;

?


?


-EGARA -ICHELE$E,UCCHI 


s,%$777 s LUMEN

s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHT SOURCES

BEHOUSEDINTHERECESSINGBOXANDISSUITABLEFOR CABLESWITHADIAMETERFROMTOMM s&IXINGTOTHERECESSINGBOXISENSUREDBYMEANS OFANTI VANDALSCREWS4/28

s#2)

s$RIVE OVERRECESSEDFLOORINSTALLATIONWITHFLOOR PROTRUDINGCAP!LLTHEVERSIONSAREDRIVE OVERUPTO +G$UETOTHELOWHEIGHTOFTHECAP -EGARA ISALSOSUITABLEFORINSTALLATIONINWALK OVERAREAS BEINGCAREFULTOAVOIDAREASOFDIRECTTRANSITNEAR WALLS BUILDINGS ETC #APSTEMPERATUREª#

s,IFE,+ -EGARA

sSIZES  MM 

s  BEAMANDFULLCONFIGURATIONS

s,IFE,+ -EGARA

s#OMPOSEDBYBODY CAP DIFFUSER RECESSINGBOX

s3CREWSIN!)3)STAINLESSSTEEL

s)0)0

s"ODYANDCAPINPAINTED%.!"ALUMINIUM SILICONEGASKETSPROVIDEDWITHCM LONG PRE RESINEDTHREE POLECONNECTIONCABLE(2. &FOR VERSIONSQND (2. &FORVERSION 

s0AINTEDDIE CASTALUMINIUMWITH STAGEOUTDOOR TREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT

s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+

s%LECTRONICBALLASTINTEGRATEDINTHEBODY

s2ECESSINGBOXFORLAYINGINREINFORCEDPOLYMERTOBE ORDEREDSEPARATELY s2ADIALEMISSIONBEAMOPTIC

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH %. ANDPART 

s$IFFUSERIN56RESISTANTPOLYCARBONATE s0OWERCONNECTIONTOTHEMAINSBYMEANSOFTHE)0 CONNECTORSUPPLIEDWITHTHELIGHTFIXTURE WHICHCAN

?


-EGARA BEAM

-EGARA BEAM

-EGARA BEAM

-EGARA BEAMS

-EGARA BEAMS

-EGARA BEAMS

-EGARA BEAMS

-EGARA FULL

-EGARA BEAMS

-EGARA FULL

-EGARA BEAMS

-EGARA FULL


0AINTEDALUMINIUMCAP

$IFFUSERIN56RESISTANTPOLYCARBONATE

2ECESSINGBOXINPOLYMER 2ECESSEDDEPTH -EGARA -EGARA -EGARA

MM MM MM

?


-EGARA

"EAM 7  7



#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#ODE 47

 

â&#x2C6;&#x2026;

6AC(ZELECTRONICBALLASTINCLUDED

)0)0)+

"EAMS 7  7



#2) 

7EIGHT "EAM  KG !3

&LUX LM

##4 +

#ODE 47

 

â&#x2C6;&#x2026;

6AC(ZELECTRONICBALLASTINCLUDED

)0)0)+ "EAMS 7  7



#2) 

7EIGHT "EAM  KG !3

&LUX LM

##4 +

#ODE 47

 

â&#x2C6;&#x2026;

6AC(ZELECTRONICBALLASTINCLUDED

)0)0)+

"EAMS 7  7

#2) 

7EIGHT "EAM  KG !3

&LUX LM

##4 +

#ODE 47

  

6AC(ZELECTRONICBALLASTINCLUDED â&#x2C6;&#x2026;

)0)0)+ 2ECESSINGBOX

#ODE 4


-EGARA

"EAM 7 7

#2) 

7EIGHT KG

"EAM !3

&LUX LM

##4 +

#ODE 47

  

6AC(ZELECTRONICBALLASTINCLUDED â&#x2C6;&#x2026; 

)0)0)+

"EAMS 7 7

#2) 

7EIGHT KG

"EAM !3

&LUX LM

##4 +

#ODE 47

  

6AC(ZELECTRONICBALLASTINCLUDED â&#x2C6;&#x2026; 

)0)0)+

"EAMS 7 7

#2) 

7EIGHT "EAM KG !3

&LUX LM

##4 +

#ODE 47

  

6AC(ZELECTRONICBALLASTINCLUDED â&#x2C6;&#x2026; 

)0)0)+

"EAMS 7 7

#2) 

7EIGHT "EAM KG !3

&LUX LM

##4 +

#ODE 47

  

6AC(ZELECTRONICBALLASTINCLUDED â&#x2C6;&#x2026; 

)0)0)+

2ECESSINGBOX

#ODE 4

?


-EGARA

"EAM 7  7

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#ODE 47

  

6AC(ZELECTRONICBALLASTINCLUDED â&#x2C6;&#x2026; 

)0)0)+

"EAMS 7  7

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#ODE 47

  

â&#x2C6;&#x2026; 

)0)0)+

"EAMS 7  7

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#ODE 47

  

â&#x2C6;&#x2026; 

)0)0)+

"EAMS 7  7

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#ODE 47

  

6AC(ZELECTRONICBALLASTINCLUDED â&#x2C6;&#x2026; 

)0)0)+ 2ECESSINGBOX

#ODE 4


?


-ICROLED 

s,%$77 s LUMEN s"EAM8& s##4+ s#2)MIN s)0)0

8&%XTRAmOOD ª

s,IGHTFIXTUREWITHHIGH PERFORMANCES,%$LIGHT SOURCES

s(OUSINGINPLASTICMATERIALAVAILABLESEPARATELY 

s&LOORINSTALLATION

s%LECTRICALCONNECTIONTOTHEBALLASTBYMEANSOF ATWO POLE(2. &CABLEANDAPPROPRIATE)0 TERMINALBOARD

s#ONSISTSOFDIFFUSER BODY RING HOUSING s$IFFUSERINGLASS MM THICK s"ODYINTECHNOPOLYMER WITHORWITHOUTFRAME s2INGINSTAINLESSSTEEL!)3),

s2EMOTEDRIVER


?


-ICROLED

7  7

#2) 

7EIGHT  KG

"EAM 8&

&LUX  LM

##4 +

#ODE .,63+

$RIVER6DC3%,6SUPPLIEDSEPARATELY 7ALKABLEKG

$RIVER CC76DC CC76DC 2ECESSINGBOX

6AC    

,MM 7MM (MM )0        

MAX MAX

#ODE ., ., .,(

)0)0)+ Â&#x2019; Â&#x2019;

 





Â&#x2019;

-ICROLEDmANGIA 7  7

#2) 

7EIGHT  KG

"EAM 8&

&LUX  LM

##4 +

#ODE .,63+

$RIVER6DC3%,6SUPPLIEDSEPARATELY 7ALKABLEKG

$RIVER CC76DC CC76DC 2ECESSINGBOX

6AC    

,MM 7MM (MM )0        

MAX MAX

#ODE ., ., .,(

)0)0)+ Â&#x2019; Â&#x2019;

 

Â&#x2019;






-ICROLED2'"

7  7

7EIGHT  KG

#ODE .,

"EAM 8&

$RIVER6DC3%,6SUPPLIEDSEPARATELY 7ALKABLEKG

$RIVER.,8  7 6DC 07- )0 $RIVER.,8  7 6DC 07- )0 $3#53"INTERFACE$-8STANDALONE 6M!BALLASTWITHMINI53"CONNECTORFOR$3# CMCABLEWITH(%CONNECTORFORKEYBOARDOPTIONAL 2ECESSINGBOX

MAX MAX

., ., ., ., ., .,(

)0)+ Â&#x2019;

Â&#x2019;

 





Â&#x2019;

-ICROLED2'"mANGIA 7  7

7EIGHT  KG

#ODE .,

"EAM 8&

$RIVER6DC3%,6SUPPLIEDSEPARATELY 7ALKABLEKG

$RIVER.,8  7 6DC 07- )0 $RIVER.,8  7 6DC 07- )0 $3#53"INTERFACE$-8STANDALONE 6M!BALLASTWITHMINI53"CONNECTORFOR$3# CMCABLEWITH(%CONNECTORFORKEYBOARDOPTIONAL 2ECESSINGBOX

MAX MAX

., ., ., ., ., .,(

)0)+ Â&#x2019; Â&#x2019;

 

Â&#x2019;





?


!RIA -ASSIMO3ACCONI 

s,%$#/"!RIA-ICRO

s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHTSOURCES

s,%$777

s7ALLORCEILINGINSTALLATION

sLUMEN

s#OMPOSEDBYFRAMEALUMINIUM BODYINJECTIONMOULDOFALUMINIUM ASYMMETRICALREFLECTOR FIXINGSPRINGSORHOUSINGBENDMETAL TOBE ORDEREDSEPARATELY 

s-AC!DAM3$#-3$#-3$#- s"EAM!3ASYMMETRICAL s##4+

s"ODYANDFRAMEAREPAINTEDWITHOUTDOORTREATMENTTHREESTAGES NANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT

s#2)

s-ETALIZEDPOLYCARBONATEREFLECTOR

s,IFE,+ !RIA-INI

s3ILICONEGASKET

s,IFE,+ !RIA-ICRO

s0ROTECTIONSCREENINTEMPEREDGLASS MM THICK

s)0)0

s%LECTRICALCONNECTIONTOTHEBALLASTBYMEANSOFACABLEWITHAPPROPRIATE TERMINALBOARDSUPPLIEDWITHTHEFIXTURE s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH%. 

!3!SYMMETRICAL


!RIA

7HITE

!RIA-INI

3ILVER

)0 #2) 

7 7

"LACK

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE !* !* !*

%LECTRONICBALLASTM!SUPPLIEDSEPARATELY

X¢

)0 )0 #2) 

"EAM !3

7EIGHT  KG

&LUX LM

##4 +

#OLOR

%LECTRONICBALLASTM!SUPPLIEDSEPARATELY

2ECESSINGBOX

!RIA-INI

#2) 

#ODE !* !* !*



!*

!RIA-ICRO 7  7



!RIA-INI 7 7

7EIGHT "EAM  KG !3

&LUX LM

##4 +

#OLOR

)0

)0

#ODE .,64+ .,64+ .,64+

#ODE .,64+ .,64+ .,64+

2ECESSINGBOX

.,(

!RIA-ICRO

X¢

$RIVER CC7M! CC7M! CC7M! CC7M! CC7M! CC7M!

6AC            

,MM 7MM            

(MM )0 7   MAX      MAX  

7

 7

MAX MAX

 MAX  MAX

MAX MAX

 MAX  MAX

#ODE ., ., ., ., ., .,

 

)0



6ERIFYDRIVERRECESSEDHOLESDIMENSIONS %LECTRONICBALLASTM!SUPPLIEDSEPARATELY

?


!RTEMIDE3HOWROOM &RANKFURTA- $%

?


&ACI

MM

%RNESTO'ISMONDI 

 ª

 MM

2ECESSEDHOLE &ACI XXMM &ACI XXMM &ACI XXMM

2ECESSINGBOX &ACI XXMM &ACI XXMM &ACI XXMM

"ODYINNYLON 2EFLECTORINOPTIC REINFORCEDWITHFIBRE ALUMINIUMWITHHIGH GLASS COEFFICIENTOF REFLECTION STRIP,%$

4EMPEREDGLASSAND CROMEDZAMAKFRAME


s,%$777 sLUMEN s"EAM!3ASYMMETRICAL s##4+ s)0

s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHT SOURCES

s2ECESSINGBOXFORLAYINGINREINFORCEDPOLYMER WITH LOWDEPTH CANBEORDEREDSEPARATELY

s2ECESSEDWALLINSTALLATION

s7IRINGINSIDETHELAMPBODYWITH)0GROMMET SUITABLEFORCABLESWITHADIAMETEROF MMFOR THECONNECTIONTOTHEMAINS

sSIZES ANDMMLENGTH  s#ONSISTOFBYLAMPBODYANDRECESSINGBOX s"ODYINHIGH RESISTANCEREINFORCEDPOLYMER4HELAMP BODYISSNAP FITTEDINTOTHERECESSINGBOX THENITIS FIXEDBYMEANSOFTWOANTI VANDALSCREWS4ORX4HIS PRODUCTISSUITABLEFORAREASATRISKOFVANDALISM s!LUMINIUMREFLECTORCONVEYINGANDDIFFUSINGTHELIGHT FLOWDOWNWARDSTOENSUREANEVENFLOORLIGHTING ANDVISUALCOMFORTWITHOUTGLARE

!3!SYMMETRICAL

s!)3)SETSCREWSANDSILICONESEALGASKETS s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH %.  s)NSTALLATIONMUSTBECARRIEDOUTBYSPECIALIZED PERSONNEL#AREFULLYFOLLOWTHEINSTRUCTIONS

s$IFFUSERINMM THICKSILKSCREENEDTEMPEREDGLASSTO ENSUREHIGHERVANDAL PROOFRESISTANCE s&RONTFRAMEINCHROMEDZAMAC

?


0OLISHED

&ACI

&ACI 7 7

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47

6AC(ZELECTRONICBALLAST(ZINCLUDED

4

2ECESSINGBOXXXMM

124

)0)+

124

63

&ACI 7 7

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47

6AC(ZELECTRONICBALLAST(ZINCLUDED

4

2ECESSINGBOXXXMM

124

)0)+

243

63

&ACI 7 7

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47

6AC(ZELECTRONICBALLAST(ZINCLUDED

4 )0)+

124

2ECESSINGBOXXXMM

363

63


#ENTRO3ERVIZIDELLO3TUDENTATO5NIVERSITARIO 4RENTO )4 0ROGECT3TUDIO0ALERMAND4ABARESDE.AVAS,!RQUITECTOS #,!3D3%NGENEERING ING,UCA-ASINI

?


&ACIVETRO %RNESTO'ISMONDI 

2ECESSEDHOLE &ACI XXMM &ACI XXMM &ACI XXMM

2ECESSINGBOX &ACI XXMM &ACI XXMM &ACI XXMM

,IGHTINGUNIT


s,%$7 7 sLUMEN s"EAM!3ASYMMETRICAL s##4+ s)0

s,IGHTFIXTUREWITHHIGH PERFORMANCE,%$LIGHT SOURCES s2ECESSEDWALLINSTALLATION s#ONSISTOFSIZES ANDMMLENGTH  s#OMPOSEDBYLAMPBODYANDRECESSINGBOX s"ODYINHIGH RESISTANCEREINFORCEDPOLYMER4HE LAMPBODYISSNAP FITTEDINTOTHERECESSINGBOX SOTHEFINALPRODUCTHASNOVISIBLESCREWSANDTHE GLASSISFLUSHWITHTHEWALL

s$IFFUSERINMM THICKSILKSCREENEDTEMPEREDGLASS s2ECESSINGBOXFORLAYINGINREINFORCEDPOLYMER WITHLOWDEPTH CANBEORDEREDSEPARATELY s7IRINGINSIDETHELAMPBODYWITH)0GROMMET SUITABLEFORCABLESWITHADIAMETEROF MMFOR THECONNECTIONTOTHEMAINS s!)3)SETSCREWSANDSILICONESEALGASKETS s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. 

s!LUMINIUMREFLECTORCONVEYINGANDDIFFUSINGTHE LIGHTFLOWDOWNWARDSTOENSUREANEVENFLOOR LIGHTINGANDVISUALCOMFORTWITHOUTGLARE !3!SYMMETRICAL

?


&ACIVETRO

&ACIVETRO 7 7

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47

6AC(ZELECTRONICBALLAST(ZINCLUDED

4

2ECESSINGBOXXXMM

114

)0)+

114

63

&ACIVETRO 7 7

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47

6AC(ZELECTRONICBALLAST(ZINCLUDED

4

2ECESSINGBOXXXMM

114

)0)+

63

233

&ACIVETRO 7 7

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47

6AC(ZELECTRONICBALLAST(ZINCLUDED

4 )0)+

114

2ECESSINGBOXXXMM

353

63


#ENTRO3ERVIZIDELLO3TUDENTATO5NIVERSITARIO 4RENTO )4 0ROGECT3TUDIO0ALERMAND4ABARESDE.AVAS,!RQUITECTOS #,!3D3%NGENEERING ING,UCA-ASINI

?


'ENERAL,IGHTING 0ATH,IGHTING

                   

%FFETTO #ALUMET -OLLA 0ANTAREI .IKI $IOSCURI #UNEO /BLIQUE "ASOLO .UDA #ICLOPE #HILONE 4ETRAGONO )PPOLITO ,OGICO'ARDEN 0IROSCAFO 'RANITO 2EEDS 4OLOMEO/UTDOOR 4OLOMEO88,

?


%FFETTO %RNESTO'ISMONDI 


s,IGHTFIXTUREWITH ORLIGHTBEAMSUSING MONOCHROMATIC,%$LIGHTSOURCESTOGETHER WITHLIGHT DIFFUSINGLENSESWHICHOPTIMIZETHE OPTICAL PERFORMANCEOFTHEBEAMSANDESTABLISHTHEIR WIDTH$ESIGNEDTOCREATEGEOMETRICLIGHTSOF SCENICEFFECT ITISAVAILABLEWITHBEAMSOFTHE SAMESPREADORWITHCOMBINEDBEAMS

s,%$ 777 sLUMEN s-AC!DAM3$# s"EAM837&8& s##4+ s#2)

s"EAMSPREAD ªª%FFETTO2OUND AND  ªª%FFETTO3QUARE 

s,IFE,+  s)0

s7ALLINSTALLATION s!VAILABLEINTWOSHAPESSQUAREANDROUND ANDINTWOFINISHESGREY WHITEPAINTEDAND RUSTPAINTED s#ONSISTSOFLIGHTINGCAPUNITANDTERMINAL BOARDFIXEDTOGETHERBYMEANSOFLOCKING DOWELS

s0--!LENSESSILICONEDFLUSHWITHTHECAPTO OBTAINTWODIFFERENTBEAMANGLEOPENING NARROWANDWIDE  s7IRINGTOBECARRIEDOUTINSIDETHETERMINAL BOARDBYPIERCINGAN)0MEMBRANE GROMMETSUITABLEFORCABLESWITHADIAMETER OF MM s,OCKINGDOWELSUSEDOUTSIDETHEFIXTUREIN !)3)STAINLESSSTEEL s0AINTEDDIE CASTALUMINIUMWITH STAGE OUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESIN COMPLIANCEWITH%. 

s#APINDIE CAST%.!" ALUMINIUM s4ERMINALBOARDINREINFORCEDPOLYMER s7ATERTIGHTGASKETINSILICONERUBBER 83%XTRASPOT ª

7&7IDEmOOD ª ª

8&%XTRAmOOD ª

s%LECTRONICBALLASTINTEGRATEDINTHEFIXTURE

?


%FFETTO


?


%FFETTO

!NTHRACITEGREY

NARROWBEAM 7

#2)

7EIGHT "EAM 3QUARE  KG X ª

 7 

"EAM 2OUND X ª

&LUX &LUX ##4 3QUARE 2OUND LM  LM +

#OLOR

3QUARE

2OUND

#ODE

#ODE 4.7 4.7 4.7

4.7 4.7 4.7

'REY WHITE2!,

)0)+

)0)+

)0)+

)0)+



6AC(ZELECTRONICBALLASTINCLUDED





LARGEBEAM 7

#2)

 7 

7EIGHT "EAM 3QUARE  KG Xª

"EAM 2OUND Xª

#OLOR &LUX &LUX ##4 3QUARE 2OUND  LM LM +

3QUARE

2OUND

#ODE

#ODE 4,7 4,7 4,7

4,7 4,7 4,7

Â&#x2019;



6AC(ZELECTRONICBALLASTINCLUDED





NARROWBEAMS 7

#2)

7



7EIGHT "EAM 3QUARE  KG X ª

"EAM 2OUND X ª

#OLOR &LUX &LUX ##4 3QUARE 2OUND  LM  LM +

3QUARE

2OUND

#ODE

#ODE 4.7 4.7 4.7

4.7 4.7 4.7

Â&#x2019;



6AC(ZELECTRONICBALLASTINCLUDED





NARROWBEAMLARGEBEAM 7

#2)

7 

7EIGHT "EAM 3QUARE  KG X ª X

#OLOR "EAM &LUX &LUX ##4 2OUND 3QUARE 2OUND X ª  LM  LM + Xª

3QUARE

2OUND

#ODE

#ODE 4.,7 4.,7 4.,7

4.,7 4.,7 4.,7

Â&#x2019;



6AC(ZELECTRONICBALLASTINCLUDED





Â&#x2019;

2UST


%FFETTO

!NTHRACITEGREY

LARGEBEAMS 7

#2)

7



7EIGHT "EAM "EAM 3QUARE 2OUND  KG Xª Xª

&LUX &LUX 3QUARE 2OUND LM  LM

##4

#OLOR

3QUARE

2OUND

#ODE

#ODE 4,7 4,7 4,7

4,7 4,7 4,7

+

'REY WHITE2!,

)0)+

)0)+

)0)+



6AC(ZELECTRONICBALLASTINCLUDED

2UST





NARROWBEAMS 7

#2)

7



7EIGHT "EAM 3QUARE  KG X ª

"EAM 2OUND X ª

&LUX 3QUARE  LM

&LUX 2OUND LM

##4

#OLOR

3QUARE

2OUND

#ODE

#ODE 4.7 4.7 4.7

4.7 4.7 4.7

+

Â&#x2019;



6AC(ZELECTRONICBALLASTINCLUDED





LARGEBEAMS 7

#2)

7



7EIGHT "EAM "EAM 3QUARE 2OUND  KG Xª Xª

&LUX 3QUARE LM

&LUX 2OUND LM

##4 +

#OLOR

3QUARE

2OUND

#ODE

#ODE 4,7 4,7 4,7

4,7 4,7 4,7

Â&#x2019;



6AC(ZELECTRONICBALLASTINCLUDED





Â&#x2019;

?


#ALUMET %RNESTO'ISMONDI 

s7 77 sLUMEN s-AC!DAM3$#-3$#- s"EAM83 7& s##4+ s#2) s,IFE,+ #ALUMET s,IFE,+ #ALUMET s)0

83%XTRASPOT ª

&&LOOD ª ª

7&7IDEmOOD ª ª

$OUBLEEMISSION


s,IGHTINGSYSTEMWITHSINGLEORDOUBLEEMISSION WITH HIGH PERFORMANCE,%$LIGHTSOURCESCOMBINEDWITH LENSESWHICHOPTIMIZETHELIGHTEMITTINGEFFICIENCYOF THEBEAMSANDDETERMINETHEIRSPREAD s!VAILABLEINTWOSIZESÂ&#x2019;EÂ&#x2019;CM s#EILINGANDWALLINSTALLATION s!VAILABLEINTWOFINISHESLIGHTGREYANDANTHRACITEGREY PAINTED s7ALLVERSIONWITHSINGLEORDOUBLEEMISSION s#ONSISTOFLIGHTINGBODY LIGHTINGCAPANDWALL FIXINGBRACKETCEILINGFIXINGFLANGEIN%.!7  ALUMINIUM s#YLINDRICALBODYIN%.!7 ALUMINIUMCONTAINING THEELECTRONICPOWERSUPPLYCOMPONENTS s/PTICALLIGHTINGBODYIN%.!7 ALUMINIUM s,EDANDCOLLIMATORLENSESWHICHSWINGBYMEANSOFAN ALUMINIUMBRACKET s$IFFUSERINTOUGHENEDGLASS

s7ATERTIGHTSILICONEGASKETS s%LECTRONICBALLASTINTEGRATEDINTHEBODY s0--!LENSESWITHNARROWWALL VERSION ORWIDE CEILING VERSION BEAM s7ALLVERSION)0ELECTRICALCONNECTIONDEVICESUITABLE FORCABLESWITHADIAMETERBETWEENANDMMAND ALLOWINGTHEELECTRICALINTERFACINGWITHTHEEXTERNAL MAINSWITHOUTNEEDOFOPENINGTHEFIXTURE s#EILINGVERSIONWIRINGTOBEMADEINSIDETHEFIXTURE BYPIERCINGAMEMBRANEFAIRLEAD)0SUITABLEFOROF  MMDIAMETERCABLES s!LLFIXINGDOWELSUSEDOUTSIDETHEFIXTUREAREIN!)3) STAINLESSSTEEL s4HECOMPONENTSINDIE CASTALUMINIUMANDTHESTEEL BRACKETFORWALLFIXINGAREPAINTEDBYMEANSOF STAGE OUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXIDANT PRIMER POLYESTERPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH %. 

s7ALLFIXINGBRACKETINBENTSTEEL

?


'REY WHITE2!,

#ALUMETWALL

!NTHRACITEGREY

/NEEMISSION 7 7

#2) 

7EIGHT  KG

"EAM  ª

&LUX LM

##4 +

#OLOR

#ODE 4.7 4.7

7EIGHT  KG

"EAM X ª

&LUX LM

##4 +

#OLOR

#ODE 4.7 4.7

$OUBLEEMISSION #2) 

)0)+

Â&#x2019;



7  7



6AC(ZELECTRONICBALLASTINCLUDED



#ALUMETWALL /NEEMISSION 7  7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

##4 +

#OLOR

#ODE 4.7 4.7

7EIGHT  KG

"EAM Xª

&LUX LM

##4 +

#OLOR

#ODE 4.7 4.7

$OUBLEEMISSION 7 7

#2) 

)0)+

Â&#x2019;





6AC(ZELECTRONICBALLASTINCLUDED




'REY WHITE2!,

#ALUMETCEILING

7 7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

##4 +

#OLOR

!NTHRACITEGREY

#ODE 4,7 4,7

6AC(ZELECTRONICBALLASTINCLUDED



)0)+

Â&#x2019;

#ALUMETCEILING 7  7

#2) 

7EIGHT  KG

"EAM ª

&LUX LM

##4 +

#OLOR

#ODE 4,7 4,7

6AC(ZELECTRONICBALLASTINCLUDED



)0)+

Â&#x2019;

?


-OLLA %RNESTO'ISMONDI 


'REY WHITE2!,

s,IGHTFIXTUREWITHCOMBINEDLIGHTBEAMSTHE LARGEONEWITHLIGHTINGFUNCTIONANDTHENARROW ONEWITHDECORATIVEFUNCTION

s7 sLUMEN s"EAM!3ASYMMETRICAL

s7ALLINSTALLATION4HEFIXTURECANBEINSTALLEDWITH THEMAINBEAMPOINTEDEITHERDOWNWARDSOR UPWARDSACCORDINGTOTHEKINDOFLIGHTINGDESIRED DIRECTORINDIRECT 

s-AC!DAM3$#s##4+ s#2)

s4HELARGEBEAMISOBTAINEDBYTHECOMBINATION OFAMONOCHROMATIC,%$LIGHTSOURCEWITHA REFLECTOR4HENARROWBEAMISOBTAINEDBYTHE COMBINATIONOFAMONOCHROMATIC,%$LIGHTSOURCE WITHAHIGH PERFORMANCEPROJECTOR

s)0

s!VAILABLEINTWOFINISHESLIGHTGREYANDANTHRACITE GREYPAINTED s#ONSISTSOFLIGHTINGCAPUNITANDTERMINALBOARD FIXEDTOGETHERBYMEANSOFLOCKINGSCREWS s#APANDTERMINALBOARDINDIE CAST %.!" ALUMINIUM

!NTHRACITEGREY

s0ROJECTORCONSISTSOFABODYINREINFORCEDPOLYMER AND0--!LENSES s4EMPEREDANDSILKSCREENEDLIGHT DIFFUSINGGLASSES SILICONEDFLUSHWITHTHELIGHTINGCAP s0OWERCONNECTIONTOTHEMAINSTOBECARRIEDOUT OUTSIDETHEFIXTURE WITHOUTTHENEEDTOOPEN IT BYMEANSOFAPRE INSTALLED)0CONNECTION DEVICESUITABLEFORCABLESWITHADIAMETER BETWEENANDMM s7ALLFIXINGBYMEANSOFABRACKETINFOLDEDSTEEL SHEETTOWHICHTHEFIXTUREISFASTENEDWITHTWO SCREWS s,OCKINGSCREWSUSEDOUTSIDETHEFIXTUREIN !)3)STAINLESSSTEEL s$IE CASTALUMINIUMANDBRACKETPAINTEDWITH  STAGEOUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. 

s7ATERTIGHTGASKETINSILICONERUBBER s%LECTRONICBALLASTINTEGRATEDINTHEFIXTURE

7 7

#2) 

7EIGHT KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4.,7 4.,7

6AC(ZELECTRONICBALLASTINCLUDED



)0





?


0ANTAREI %RNESTO'ISMONDI  


s,%$7 7 sLUMEN s"EAM8& s-AC!DAM3$#s##4+ s#2) s)0

s3ERIESOFLIGHTFIXTURESWITHDIFFUSEEMISSION WITH,%$ SOURCES s7ALLANDCEILINGINSTALLATION sSIZESANDMM  s!VAILABLEINTWOFINISHESSILVERGREYANDBLACKPAINTED s!VAILABLEWITHTWOTYPESOFDIFFUSERS (ONEYCOMBMOULDEDDIFFUSERININTERNALLYSANDED SODIUM CALCIUMGLASS (ONEYCOMBMOULDEDPRISMATICSHOCKRESISTANTDIFFUSER INOPALPOLYCARBONATE

s0ANTAREICANBEPROVIDEDWITHHALF LIGHTSCREEN s,AMPUNITINDIE CAST%. !"ALUMINIUM WITH STAGEOUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT s!)3)STAINLESSSTEELSCREWSANDSILICONESEALGASKETS s3UITABLEFORWATERTIGHTCONNECTION s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH %. 

8&EXTRAmOOD ª

?


!NTHRACITEGREY

0ANTAREI

"LACK

3ILVERGREY

3ANDEDGLASS)+

7 7

#2) 

7EIGHT "EAM  KG 8&

&LUX LM

##4 #OLOR +

#ODE 4 4 4

3ANDEDGLASS DIFFUSER

/PALPOLYCARBONATE)+

#2) 

7EIGHT "EAM  KG 8&

&LUX LM

##4 #OLOR +

#ODE 4 4 4

)0)+)+

/PALPOLYCARBONATE DIFFUSER

Â&#x2019;

7 7

6AC(ZELECTRONICBALLASTINCLUDED 

0ANTAREI,%$ 3ANDEDGLASS)+

7 7

#2) 

7EIGHT  KG

"EAM 8&

&LUX LM

##4 #OLOR +

#ODE 4 4 4

3ANDEDGLASS DIFFUSER

/PALPOLYCARBONATE)+

#2) 

7EIGHT  KG

"EAM 8&

&LUX LM

##4 #OLOR +

#ODE 4 4 4

)0)+)+

/PALPOLYCARBONATE DIFFUSER Â&#x2019;

7 7

6AC(ZELECTRONICBALLASTINCLUDED 

0ANTAREI,%$

,&,

3ANDEDGLASS)+

7 7

#2) 

7EIGHT  KG

"EAM 8&

&LUX LM

##4 #OLOR +

#ODE 4 4 4

3ANDEDGLASS DIFFUSER

/PALPOLYCARBONATE)+

7 7

#2) 

7EIGHT  KG

"EAM 8&

6AC(ZELECTRONICBALLASTINCLUDED

&LUX LM

##4 #OLOR +

#ODE 4 4 4

/PALPOLYCARBONATE DIFFUSER


?


.IKI %RNESTO'ISMONDI  

s,%$7 ,%$RETROFITMAXX7 sLUMEN s-AC!DAM3$# s"EAM8& s##4+ s#2) s)0

s,IGHTFIXTUREWITHDIFFUSEEMISSION WITH,%$ SOURCES s7ALLANDCEILINGINSTALLATION s,AMPUNITIN!)3)STAINLESSSTEEL s-OULDEDCOVERINGFRAMEIN!)3)STAINLESSSTEEL SATINYORPOLISHEDFINISH s!)3)STAINLESSSTEELSCREWSANDPOLYURETHANE SEALGASKETS s3UITABLEFORWATERTIGHTCONNECTION s%LECTRONICBALLAST

8&%XTRAmOOD ª


3ATINY

,%$

7 7

#2) 

7EIGHT KG

"EAM 8&

&LUX LM

##4 +

,%$ ,&,

7



KG

8&

LM

+

,%$2%42/&)4 MAXX7%

6AC(ZELECTRONICBALLASTINCLUDED

#OLOR

0OLISHED

#ODE !( !( !( !( !( !( )0)+

Â&#x2019;



?


?


$IOSCURI -ICHELE$E,UCCHI 




s,%$2ETROFIT  777

s7ALLANDCEILINGLIGHTFIXTUREWITHDIFFUSE EMISSION

s&,5/77

s!VAILABLEINSIZESÂ&#x2019; Â&#x2019; Â&#x2019;EÂ&#x2019;CM 

s)0

s7ALLSUPPORTINTHERMOPLASTICRESIN s!CID ETCHEDBLOWNGLASSDIFFUSER MILKWHITE COLOUR s3ILICONESEALGASKETS s3UITABLEFORWATERTIGHTCONNECTION s4ECHNICALFEATURESOFLIGHTFIXTURESIN COMPLIANCE WITH%. 

8&%XTRAmOOD ª

7HITE

$IOSCURI ,%$2%42/&)4 &LUX LM

##4 +

#OLOR

#ODE ! 

7 MAXX 7'

Â&#x2019;

6OLTAGE6DC(Z

)0

$IOSCURI ,%$2%42/&)4&,5/ ##4 +

#OLOR

#ODE !



7 ,%$2ETROlTMAXX7% &,5/X7%

Â&#x2019;

6OLTAGE6DC(Z

)0

$IOSCURI ,%$2%42/&)4&,5/ ##4 +

#OLOR

#ODE !



7 ,%$2ETROlTMAXX7% &,5/X7%

Â&#x2019;

6OLTAGE6DC(Z

)0

$IOSCURI ,%$2%42/&)4&,5/ ##4 +

#OLOR

#ODE ! 

7 ,%$2ETROlTMAXX7% &,5/X7%

6OLTAGE6DC(Z Â&#x2019;

)0

?


#UNEO #UNEO-INI +LAUS"EGASSE  


s,%$#/"#UNEO-INI s77 sLUMEN s-AC!DAM3$#- s"EAM%,ELLIPTICAL !3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0

s,IGHTFIXTUREWITHDIRECTSIDEEMISSION WITHHIGH PERFORMANCE,%$LIGHTSOURCES -ONOCHROMATIC,%$SAREUSEDTOGETHERWITH COLLIMATORSANDALIGHT DIFFUSINGPRISMATIC SCREENTOOBTAINANOPTIMUMLIGHTINGBEAM s&LOORORWALLINSTALLATION)NTHEWALL INSTALLATION THELIGHTCANBEPOINTEDEITHER UPWARDSORDOWNWARDS s!VAILABLEINFINISHESLIGHTGREY DARKGREY ANDRUSTPAINTED s#ONSISTSOFLIGHTINGCAPANDTERMINALBOARD FIXEDTOGETHERBYMEANSOFLOCKINGSCREWS s#APANDTERMINALBOARDINDIE CAST%. !" ALUMINIUM GASKETSINSILICONE RUBBER%LECTRONICBALLASTINTEGRATEDINTHE FIXTURE s#UNEO0--!COLLIMATORSINSTALLEDONTHE ,%$LIGHTSOURCES,IGHT DIFFUSINGPRISMATIC SCREENIN0--!SILICONEDFLUSHWITHTHE LIGHTINGCAP

s#UNEO-INI(IGH YIELD#/",%$SOURCEWITH HIGH REFLECTIONANODIZEDALUMINIUMBODY %TCHEDTEMPEREDGLASSSCREENGLUEDFLUSHTO THELIGHTINGBODYWITHSILICON s0OWERCONNECTIONTOTHEMAINSTOBECARRIED OUTOUTSIDETHEFIXTURE WITHOUTTHENEED TOOPEN BYMEANSOFAPRE INSTALLED)0 CONNECTIONDEVICESUITABLEFORCABLESWITHA DIAMETERBETWEENANDMM s7ALLINSTALLATIONBYMEANSOFABRACKETIN FOLDEDSTEELSHEETTOWHICHTHEFIXTUREIS FASTENEDWITHTWOSCREWS s3CREWSIN!)3)STAINLESSSTEEL s!LLTHECOMPONENTSINDIE CASTALUMINIUM ANDTHESTEELBRACKETFORWALLORFLOORFIXING AREPAINTEDBYMEANSOF STAGEOUTDOOR TREATMENTNANOTECHNOLOGIES ANTIOXIDANT PRIMER POLYESTERPAINT s4ECHNICALFEATURESOFLIGHTFIXTURESIN COMPLIANCEWITH%.  s%.%#APPROVED

4HEELLIPTICALLIGHTEMISSIONANDTHEFLATSHAPE OFTHEFIXTUREMAKEITPARTICULARLYSUITABLEFORFLOORS ORSPACIOUSAREASINGARDENSTOPROVIDEASIDELIGHTING

?


!NTHRACITEGREY

#UNEO

7EIGHT  KG

"EAM %,

&LUX LM

##4 +

#OLOR

#ODE 4 4 4

%LECTRONICPOWERSUPPLY6AC(ZINCLUDED



#2) 



7 7

'REY WHITE2!,



)0

)0

#UNEOMINI

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

%LECTRONICPOWERSUPPLY6AC(ZINCLUDED

#OLOR

#ODE 4 4 4



#2) 



7 7



2UST


4RIENNALE2OOFTOP2ESTAURANT /"23TUDIO -ILAN )TALY 

?


/BLIQUE !RIK,EVY 

s,%$#/" s77 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0

s3ERIESOFDIRECT LIGHTAPPLIANCESFITTEDWITH HIGH YIELD,%$SOURCES s&LOOR BOLLARD ORWALLFITTING

s-ADEUPOFLIGHTINGBODY WALLMOUNTWALL VERSION LIGHTINGBODY BOLLARDAVAILABLEINTWO HEIGHTS FLOORFIXINGFLANGEBOLLARDVERSION

s!VAILABLEWITHFINISHESPAINTEDGREY WHITE2!, ANDCHARCOALGREY

s!CCESSORIESAVAILABLEFORTHEWALLVERSION INCLUDECM HIGHBOLLARDFLOORFIXINGPEG

s0RE TREATEDWITHHARDANODICOXIDECOATING FORENHANCEDRESISTANCETOCORROSION AND SUBSEQUENTPOLYESTERPAINTING

s%. !7 ALUMINIUMEXTRUDEDBOLLARD

s4HETECHNICALSPECIFICATIONSOFTHE APPLIANCESCOMPLYWITH%. 

s%. !"DIE CASTALUMINIUMLIGHTINGBODY s3UPPLIEDWITH)0CONNECTORFORCONNECTION WITHMAINS


?


/BLIQUE

!NTHRACITEGREY

7HITE

/BLIQUE"OLLARD 7 7

#2) 

7EIGHT KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4

!CCESSORIESSUPPLIEDSEPARATELY

4

GROUNDPICKET

)0)+















/BLIQUE"OLLARD 7 7

#2) 

7EIGHT KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4

!CCESSORIESSUPPLIEDSEPARATELY

4

GROUNDPICKET

)0)+















/BLIQUEWALL 7 7

#2) 

7EIGHT KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4

!CCESSORIESSUPPLIEDSEPARATELY

4 4 )0)+







GROUNDPICKET POLE

 


?


"ASOLO %RNESTO'ISMONDI 


!NTHRACITEGREY

s&LOORANDCEILINGASYMMETRICALWALLWASHERLIGHTFIXTURE WITHAROTO SYMMETRICALOPTION ONLYAVAILABLEFORTHE CEILINGVERSION4HECEILINGVERSIONISALSOAVAILABLEWITH DOWNLIGHTOPTICSWITHHIGHVISUALCOMFORT5'2 

s,%$#/" s7 sLUMEN s-AC!DAM3$#-

s&IXTURECONSISTINGOFCUBICBODYANDFLOORCEILINGFIXING PLATE#EILINGVERSIONINCLUDESASECURITYCABLE 7ALLWASHER VERSIONALSOAVAILABLEINMOVABLEVERSION

s"EAM!3ASYMMETRICAL 77 8& s##4+ s,IFE,+ 

s"ODYMADEINDIE CASTALUMINIUM %. !"WITH STAGEOUTDOORTREATMENT NANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT

s)0

s)NCLUDESAMETAL FINISHPOLYCARBONATEREFLECTOR

s#2)

s$IFFUSERINTEMPEREDSILK SCREENEDGLASS s!)3)FIXINGSCREWSANDSILICONGASKETS s3UPPLIEDWITH(2. &8CABLEAND)0NETWORK CONNECTORUSING DIAMETERCABLES HOUSEDINA COMPARTMENTINTHELOWERPARTOFTHEFIXTURE s4ECHNICALFEATURESINCOMPLIANCETO%.  777ALLWASHER

8&%XTRAmOOD ª

"ASOLOWALLWASHER 7 7

#2) 

7EIGHT  KG

&IXED "EAM &LUX ##4 !377 LM +

#OLOR

#ODE 47

-OBILE #ODE 47

6AC(ZELECTRONICBALLASTINCLUDED



)0)+



"ASOLOCEILING 7 7

#2) 

7EIGHT "EAM  KG 8&

&LUX ##4 LM +

#OLOR

#ODE 47

6AC(ZELECTRONICBALLASTINCLUDED



)0)+



?


.UDA %RNESTO'ISMONDI 

s,%$7 7 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0 .UDAFLOOR s3ERIESOFLIGHTFIXTURESWITHDIRECTUNILATERALOR BILATERALEMISSION WITHHIGH PERFORMANCE,%$ LIGHTSOURCES

s!VAILABLEINUNILATERALANDBILATERALEMISSION VERSIONANDINTWOHEIGHTSHCMANDH CM 

s&LOORANDRECESSEDINSTALLATION

s#ONSISTOFLAMP SUPPORTPOLEANDGROUND MOUNTINGPLATE

s!VAILABLEINFINISHESGREY WHITEPAINTED2!,  DARKGREYANDRUSTPAINTED

.UDARECESSED s#ONSISTOFLAMPANDRECESSINGBOXFORRECESSED WALLINSTALLATION s,AMPUNITINPAINTEDDIE CAST%. !" ALUMINIUM COMPLETEWITHHOLDINGPLATEFOR ELECTRICALCOMPONENTS

s56RESISTANTDIFFUSERINSHOCKRESISTANT POLYCARBONATEWITHSATINFINISH

s3PECULARREFLECTORINALUMINIUM)TCONVEYSAND DIFFUSESTHELUMINOUSFLOWDOWNWARDSTOENSURE VISUALCOMFORT

s!)3)STAINLESSSTEELSCREWSANDSILICONESEAL GASKET

s3PECULARREFLECTORINALUMINIUM)TCONVEYSAND DIFFUSESTHELUMINOUSFLOWDOWNWARDSTOENSURE VISUALCOMFORT

s56RESISTANTDIFFUSERINSHOCKRESISTANT POLYCARBONATEWITHSATINFINISH s!ESTHETICCOVERINPAINTEDALUMINIUM

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. 

s3UPPORTPOLEINEXTRUDED%. !7  ALUMINIUM CHROMATETREATEDANDPAINTED

s%.%#APPROVED

s-OUNTINGPLATEINFOLDED WELDEDANDPAINTED STEEL WITHHOLESFORGROUNDFIXINGBYMEANSOF LOGBOLTSORDOWELS

s0ROVIDEDWITH)0CABLEANDCONNECTORSUITABLE FOR(2. &CABLESWITHADIAMETERFROMTO MMFORTHEMAINSCONNECTION

s0AINTINGISOBTAINEDBYMEANSOF STAGEOUTDOOR TREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT

s,AMPUNITINDIE CAST%. !"ALUMINIUM

s0ROVIDEDWITH)0CABLEANDCONNECTORFORTHE MAINSCONNECTION

s2ECESSINGBOXINREINFORCEDPOLYMER CANBE ORDEREDSEPARATELY


?


.UDA

.UDAmOORUNILATERAL ,%$ 7

H ,IGHTINGAPPLICATION

A

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

,

.UDAmOORUNILATERAL ,%$7

,IGHTINGAPPLICATION

H M

,

A

%M

%MAX

%MIN

M

M

LUX

LUX

LUX

.UDAmOORBILATERAL ,%$ 7

H A

,IGHTINGAPPLICATION

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

,

.UDAmOORBILATERAL ,%$7

,IGHTINGAPPLICATION

H M

,

A

%M

%MAX

%MIN

M

M

LUX

LUX

LUX

2ECESSEDHOLE XXMM

2ECESSINGBOX XXMM

,IGHTINGUNIT

!ESTHETICCOVER


?


.UDA

!NTHRACITEGREY

.UDARECESSED

#2) 



7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

2UST



#ODE 4 4 4



7 7

'REY WHITE2!,

6AC(ZELECTRONICBALLASTINCLUDED

4

2ECESSINGBOX

)0)+

.UDAmOORUNILATERAL

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4







7 7

6AC(ZELECTRONICBALLASTINCLUDED 



)0)+

.UDAmOORBILATERAL

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4







7 7

6AC(ZELECTRONICBALLASTINCLUDED 



)0)+

.UDAmOORUNILATERAL

7 7

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4







6AC(ZELECTRONICBALLASTINCLUDED





)0)+

.UDAmOORBILATERAL

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4







6AC(ZELECTRONICBALLASTINCLUDED



)0)+



7 7


?


#ICLOPE !LESSANDRO0EDRETTI 3TUDIO2OTA0ARTNERS 


s 77 sLUMEN s-AC!DAM3$#s"EAM!3ASYMMETRICAL s##4+ s#2) s)0

s,IGHTINGSYSTEMWITHDIFFUSEUNILATERALORBILATERAL EMISSION WITHHIGH PERFORMANCE,%$LIGHT SOURCES s,IGHTEMISSIONISOBTAINEDBYTHECOMBINATIONOF SIXMONOCHROMATIC,%$LIGHTSOURCES AREFLECTOR ANDANOPALINEDIFFUSER s&LOORINUNILATERALANDBILATERALEMISSION WALLOR RECESSEDINSTALLATION s!VAILABLEINFINISHESLIGHTGREY2!, ANTHRACITEGREYANDRUSTPAINTED s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%.  s%.%#APPROVED s,IGHTINGUNITCONSISTSOFFRAMEINREINFORCED POLYMERDIFFUSERINLIGHT DIFFUSINGPOLYCARBONATE PLATEINPICKLED MACHINEDANDGALVANISEDSTEEL WATERTIGHTGASKETINSILICONERUBBER,%$CIRCUIT ELECTRONICBALLASTREFLECTORINPAINTEDSPUN ALUMINIUM0'CABLEGLAND (2. &CABLE AND)0ELECTRICALCONNECTIONDEVICESUITABLEFOR CABLESWITHADIAMETERBETWEENANDMMTO ALLOWELECTRICALINTERFACINGWITHTHEEXTERNALMAINS WITHOUTTHENEEDTOOPENTHEFIXTURE

s4HELIGHTINGUNITHOUSESTHEELECTRICALCOMPONENTS ANDSOURCES s!ESTHETICCOVERINDIE CAST%.!"  ALUMINIUM4HECOMPONENTSINDIE CAST EXTRUDED ALUMINIUMANDSTEELAREPAINTEDBYMEANSOF  STAGEOUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT s4HEELEMENTSAREFIXEDTOGETHERBYMEANSOF SCREWS!LLTHELOCKINGSCREWSUSEDOUTSIDE THEFIXTUREANDINSIDETHESTEMAREIN!)3) STAINLESSSTEEL s#ICLOPEFLOORAVAILABLEINTWOHEIGHTSHCM ANDHCM STEMINEXTRUDED%.!7  ALUMINIUM'ROUNDMOUNTINGPLATEINFOLDED WELDEDANDPAINTEDSTEEL WITHHOLESFORGROUND FIXINGBYMEANSOFLOGBOLTSORDOWELS s#ICLOPERECESSEDRECESSINGBOXINREINFORCED POLYMER CANBEORDEREDSEPARATELY s#ICLOPEWALLBOXINEXTRUDED%.!7  ALUMINIUM

?


#ICLOPE

#ICLOPEmOORUNILATERAL

H ,%$7

,IGHTINGAPPLICATION

A

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

,

#ICLOPEmOORUNILATERALBILATERAL

H ,%$7

,IGHTINGAPPLICATION

A

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

,

H A ,

#ICLOPEWALLRECESSED

,%$7

,IGHTINGAPPLICATION

H

A

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

,


?


!NTHRACITEGREY

#ICLOPE

2UST

'REY WHITE2!,

#ICLOPEmOOR5NILATERAL #2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

6AC(ZELECTRONICBALLASTINCLUDED -OUNTINGPLATEINCLUDED

#ODE 4 4 4



7  7

 



)0)+

#ICLOPEmOOR"ILATERAL #2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4



7 7

6AC(ZELECTRONICBALLASTINCLUDED -OUNTINGPLATEINCLUDED







)0)+

#ICLOPEmOOR5NILATERAL #2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4



7  7

6AC(ZELECTRONICBALLASTINCLUDED -OUNTINGPLATEINCLUDED

 



)0)+


!NTHRACITEGREY

#ICLOPE

'REY WHITE2!,

2UST

#ICLOPEmOOR"ILATERAL #2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR











6AC(ZELECTRONICBALLASTINCLUDED -OUNTINGPLATEINCLUDED

#ODE 4 4 4



7 7

)0)+

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4



7  7



#ICLOPERECESSED

6AC(ZELECTRONICBALLASTINCLUDED 2ECESSINGBOXSUPPLIEDSEPARATELY

4

2ECESSINGBOX

)0)+

2ECESSEDHOLE XXMM

2ECESSINGBOX XX MM

,IGHTINGUNIT

!ESTHETICCOVER

#ICLOPEWALL 7EIGHT KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4



#2) 



 

7  7

6AC(ZELECTRONICBALLASTINCLUDED 7ALLSUPPORTINCLUDED

)0)+

?


#HILONE %RNESTO'ISMONDI 

s77 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0

s3ERIESOFLIGHTFIXTURESWITHDIRECTEMISSION WITHHIGH PERFORMANCE,%$LIGHTSOURCES

s,AMPUNITINDIE CAST%. !"ALUMINIUM

s&LOOR POLEORWALLINSTALLATION

s56RESISTANTDIFFUSERINSHOCKRESISTANT POLYCARBONATEWITHSATINYFINISH

s!VAILABLEINFINISHESLIGHTGREYPAINTED2!,  ANTHRACITEGREYANDRUSTPAINTED

s,AMPSUPPORTINEXTRUDED%. !7  ALUMINIUM

s0AINTINGISOBTAINEDBYMEANSOF STAGE OUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT

s#HILONEWALLITCANBEINSTALLEDWITHTHELIGHT POINTEDEITHERDOWNWARDSORUPWARDS7ALL SUPPORTINSTEELINCLUDED

s!)3)STAINLESSSTEELSCREWSANDSILICONESEAL GASKET

s#HILONEPOLEHEIGHTCM GROUNDFIXING POLEINPAINTEDEXTRUDED%. !7  ALUMINIUM)TMUSTBEINSTALLEDBYMEANSOFA PROPERFOUNDATIONPLINTH

s0ROVIDEDWITH)0CABLEANDCONNECTORFORTHE MAINSCONNECTION s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%.  s%.%#APPROVED s#ONSISTSOFLAMP LAMPSUPPORTANDWALL SUPPORT#HILONEWALL GROUNDFIXINGPOLE #HILONEPOLE GROUNDMOUNTINGPLATE#HILONE FLOOR 

s#HILONEFLOORAVAILABLEWITHDOWNWARD EMISSIONINTWOHEIGHTSHCMANDH CM ANDWITHUPWARDEMISSION#HILONE 5P 3UPPORTPOLEINEXTRUDED%. !7  ALUMINIUM CHROMATETREATEDANDPAINTED -OUNTINGPLATEINFOLDED WELDEDANDPAINTED STEEL WITHHOLESFORGROUNDFIXINGBYMEANSOF LOGBOLTSORDOWELS


?


#HILONE

#HILONEmOOR

H ,%$7

,IGHTINGAPPLICATION

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

A ,

#HILONEmOOR

H ,%$7

,IGHTINGAPPLICATION

A

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

,

#HILONEPOLE

H ,%$7

,IGHTINGAPPLICATION

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

A ,


!NTHRACITEGREY

#HILONE

'REY WHITE2!,

2UST

#HILONEmOOR #2) 7EIGHT   KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4 

7 7

6AC(ZELECTRONICBALLASTINCLUDED -OUNTINGPLATEINCLUDED )0





#HILONEmOOR #2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4



7 7

6AC(ZELECTRONICBALLASTINCLUDED -OUNTINGPLATEINCLUDED

)0





#HILONEUP #2) 7EIGHT   KG

"EAM !3

&LUX LM

##4 #OLOR +

#ODE 4 4 4





7 7

6AC(ZELECTRONICBALLASTINCLUDED -OUNTINGPLATEINCLUDED

)0





#HILONEWALL #2) 7EIGHT   KG



"EAM !3

&LUX LM

##4 #OLOR +

#ODE 4 4 4



7 7





6AC(ZELECTRONICBALLASTINCLUDED 7ALLSUPPORTINCLUDED

)0

)0

#HILONEPOLE 7 7

#2) 7EIGHT   KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 4

6AC(ZELECTRONICBALLASTINCLUDED



'ROUNDPOLEINCLUDED





?


2ANCO6ARESE )4

?


4ETRAGONO %RNESTO'ISMONDI 


s,%$#/" s7 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL

s,IGHTINGFIXTURESWITHDIRECTASYMMETRICALLIGHTFLOOR VERSION ANDRADIALEMISSIONWALLVERSION WITH MONOCHROMATIC,%$LIGHTSOURCES s&LOORORWALLINSTALLATION &INISHINGANTHRACITEGREYPAINTED

s##4+

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. 

s#2)

s%.%#APPROVED

s,IFE,+  s)0

s4ETRAGONOFLOORCONSISTSOFLAMPANDSUPPORTING POLEINEXTRUDED%. !7 ALUMINIUM SUBJECTED TOCHROMATETREATMENTANDPAINTED HEIGHT ANDMM WITHPAINTEDSTEELBASEFLANGE WITH HOLESFORFLOORINSTALLATIONBYMEANSOFLOGBOLTSOR DOWELS s4ETRAGONOWALLLIGHTFIXTUREWITHRADIALLIGHT EMISSION CONSISTSOFBODYANDWALLFIXINGPLATE ,AMPSUPPORTINEXTRUDED%. !7 ALUMINIUM SUBJECTEDTOCHROMATETREATMENTANDPAINTED WITHPAINTEDSTEELBASEFLANGE WITHHOLESFORWALL INSTALLATION s,IGHTINGUNITINDIE CAST%. !"ALUMINIUM PAINTEDWITH STAGEOUTDOORTREATMENT NANOTECHNOLOGIES ANTI OXIDISINGPRIMER POLYESTER PAINT s0ROVIDEDWITHMETALISEDPOLYCARBONATEREFLECTORS s56RESISTANTDIFFUSERINSHOCKRESISTANT POLYCARBONATEWITHBRIGHTFINISH s!)3)FIXINGSCREWSANDSILICONEGASKETS s0ROVIDEDWITHCABLEAND)0CONNECTORFORTHE CONNECTIONTOTHEMAINSSUITABLEFOR MM DIAMETERCABLESFLOORVERSION ORFORMAX MM DIAMETERCABLESWALLVERSION 

?


4ETRAGONO

!NTHRACITEGREY

4ETRAGONOmOOR #2) 

7EIGHT  KG

"EAM &LUX !3 LM

##4 +

#OLOR

#ODE 47  

7 7



6AC(ZELECTRONICBALLASTINCLUDED



)0)+



4ETRAGONOmOOR #2) 

7EIGHT  KG

"EAM &LUX !3 LM

##4 +

#OLOR

#ODE 47  

7 7



6AC(ZELECTRONICBALLASTINCLUDED





)0)+

#2) 

7EIGHT  KG

"EAM &LUX !3 LM

##4 +

#OLOR

#ODE 47



7 7

 

4ETRAGONOWALL



6AC(ZELECTRONICBALLASTINCLUDED

)0)+


?


)PPOLITO !LESSANDRO0EDRETTI 3TUDIO2OTA0ARTNERS 

s,%$#/" s7 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0

s,IGHTFIXTUREWITHDIRECTEMISSION WITHAUNIQUE HIGH PERFORMANCEMONOCHROMATIC#/",%$ s&LOORINSTALLATION s!VAILABLEINTWOHEIGHTSHCMANDHCM  s#ONSISTSOFSUPPORTWITHLAMPCOMPARTMENTAND BALLASTCOMPARTMENT s#YLINDRICALLAMPSUPPORTINENGINEERINGPOLYMER COMPACTPOLYURETHANE 0AINTEDWITH POLYURETHANERESISTANTTOATMOSPHERICAND CHEMICALAGENTS s&IXTUREHEADINDIE CAST%. !"ALUMINIUM PAINTEDWITH STAGEOUTDOORTREATMENT NANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTER PAINT s56RESISTANTDIFFUSERINTRANSPARENTSHOCKRESISTANT POLYCARBONATE s!CCESSORYCOMPARTMENTINPOLYMERSWITHCLOSURE COVERIN!)3) s(OTGALVANISEDSTEELMOUNTINGPLATE WITHHOLES FORGROUNDFIXINGBYMEANSOFLOGBOLTSORDOWELS s!)3)STAINLESSSTEELSCREWSANDSILICONESEAL GASKET s0ROVIDEDWITHCABLEAND)0CONNECTORFOR CONNECTIONTOTHEMAINSCABLESWITHTO MM DIAMETERS s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. 


!NTHRACITEGREYLIGHTGREY

)PPOLITO 7 7

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4

6AC(ZELECTRONICBALLASTINCLUDED



)0)+

â&#x2C6;&#x2026; 

)PPOLITO 7 7

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4

6AC(ZELECTRONICBALLASTINCLUDED



)0)+

â&#x2C6;&#x2026; 

?


,OGICO'ARDEN -ICHELE$E,UCCHI $ANIELE-OIOLI 




s,%$#/"

s&LOORFITTING

s7 7

s$ESIGNEDFORGARDENORPEDESTRIANPATHLIGHTING

sLUMEN

s4HEAPPLIANCECONSISTSOFALAMPANDASUPPORTINGPOLE

s-AC!DAM3$#

s4HELAMPSUPPORT   ORMMHIGH IS MADEOFCHROMEDANDPAINTED%. !7 EXTRUDED ALUMINIUM4HEBASEFLANGEISMADEOFPAINTEDELECTRO GALVANIZEDIRON WITHHOLESFORGROUNDFIXINGBYMEANS OFSCREWSORPLUGS

s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0

s4HELAMPBODYISMADEOF%. !"DIE CAST ALUMINIUMWITH STAGEOUTDOORTREATMENT NANOTECHNOLOGIES ANTI OXIDISINGPRIMER POLYESTERPAINTING s-ETALLISEDPOLYCARBONATEREFLECTORS(IGHLYTRANSPARENT METHACRYLATESCREEN WITHSHINYSHOCK RESISTANTANDANTI 56FINISH s!)3)FIXINGSCREWSANDSILICONSEALS s0ROVIDEDWITHCABLEAND)0CONNECTORFORCONNECTION TOTHEMAINSCABLESWITHTO MMDIAMETERS s4ECHNICALSPECIFICATIONSCOMPLYWITH%. 

?


,OGICO'ARDEN

!NTHRACITEGREY

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47



#2) 



7 7

 

,OGICO'ARDEN

Œ

)0)+

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47



#2) 



7 7

 

,OGICO'ARDEN

Œ

 

)0)+

,OGICO'ARDEN 7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47 

#2) 



7 7

)0)+ Œ

,OGICO'ARDENX "EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47

)0)+

Œ



7EIGHT  KG



#2) 



7 7


?


0IROSCAFO %RNESTO'ISMONDI 

s,%$#/" s7 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0

s,IGHTINGAPPLIANCEFORGROUNDFIXINGWITHDIRECTIONALLIGHT EMISSION USINGMONOCHROME,%$LIGHTSOURCES s4HEAPPLIANCECONSISTSOFABODYANDAFIXINGBASEOF %. !"DIE CASTALUMINIUMFINISHEDWITHA STAGE OUTDOORTREATMENTNANOTECHNOLOGIES ANTI OXIDISING PRIMER POLYESTERPAINTING s3HOCK RESISTANTTEMPEREDGLASSSCREEN s!)3)STAINLESSSTEELSCREWSANDSILICONESEALGASKETS s0ROVIDEDWITHCABLEAND)0CONNECTORFORCONNECTION TOTHEMAINS3UPPORTSCABLESWITHTOMM DIAMETERS s4ECHNICALSPECIFICATIONSCOMPLYWITHTHE%.  NORM


!NTHRACITEGREY

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

2UST

#ODE 4 4 4



7 7

'REEN

6AC(ZELECTRONICBALLASTINCLUDED Â&#x2019;



)0



?


?


'RANITO %RNESTO'ISMONDI 

s-ETALHALIDE7

s,IGHTFIXTUREWITHMETALHALIDESOURCES

s)0

s4HEFOURLIGHTBEAMSPROJECTEDTHROUGHTHE FISSURESONTHESIDESMAKEITPARTICULARLYSUITABLE FORLIGHTINGDRIVESORCREATINGLIGHTEFFECTSINPARKS ANDGARDENS s!VAILABLEINTWOHEIGHTSHCMANDHCM  s!VAILABLEINFINISHESANTHRACITEGREYAND #OR TENWEATHERINGSTEEL  s4RANSPARENTSODIUM CALCIUMBULBPROTECTIONGLASS s'ROUNDMOUNTINGPLATEINSTEELWITH STAGE OUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXIDANT PRIMER POLYESTERPAINT s!)3)STAINLESSSTEELSCREWSANDSILICONESEAL GASKETS s%LECTRONICBALLAST s3UITABLEFORWATERTIGHTCONNECTION s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%.  s%.%#APPROVED


'RANITO

!NTHRACITEGREY

2UST#OR TEN

'RANITO 7 -%4!,(!,)$%X7' n()4

#OLOR

#ODE 4 4

6AC(ZELECTRONICBALLASTINCLUDED



)0)+



'RANITO 7 -%4!,(!,)$%X7' n()4

#OLOR

#ODE 4 4

6AC(ZELECTRONICBALLASTINCLUDED



)0)+



4HECOLOUROF#OR TENSTEELMAYCHANGEINTIME DEPENDINGONWEATHERCONDITIONS"EFORESTABILIZATION #OR TENSTEELMAYRELEASERUSTPOWDERTHATMAYSTAIN THESURFACEWHEREITISPLACED !RTEMIDERECOMMENDSNOTTOPOSITIONITONSENSITIVE SURFACES SUCHASCLEARSTONES MARBLES ETC

?


2ANCO6ARESE )4

?


2EEDS +LAUS"EGASSE 

s 7 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0)0)0

s&LOORLIGHTFIXTUREWITHDIFFUSEEMISSION WITH MONOCHROMATIC,%$LIGHTSOURCES s!VAILABLEWITH)0PROTECTIONRATINGFORINDOORS )0AND)0FOROUTDOORS)0AND)0 VERSIONSAREAVAILABLEIN3INGLEOR4RIPLESHAPE s,IGHTISDIFFUSEDTHROUGH0--!RODSWITH DIFFERENTHEIGHTSTOGIVETHEIMPRESSIONOFAREED BEDANDWHICHCANBESCREWEDTOTHEBASEBY MEANSOF!)3)STAINLESSSTEELBUSHES0ARTOF THELIGHTISALSODIFFUSEDONTHEFLOORAROUNDTHE BASE s4HEBASEHASANIRREGULARSHAPE WHICHHASBEEN DESIGNEDTOALLOWAiMOSAICwCONNECTIONWITH OTHERLIGHTFIXTURESSOASTOCREATEANELABORATE COMPOSITIONASNEEDED s4ECHNICALFEATURESINCOMPLIANCEWITH%.  )0 )0 ANDSECTION )0 

2EEDS)0 s #ONSISTSOFABASEMADEUPOFATRANSPARENT POLYCARBONATECASING s )NSTALLEDBETWEENALUMINIUMPLATESANDANTI SCRATCHSUPPORTFEET s 4ECHNOPOLYMERAESTHETICCOVER s #OMPLETEWITHINTEGRATEDBALLASTANDPLUG WITHTRANSPARENTCABLE3WITCHINGONANDOFFARE PERFORMEDBYMEANSOFTHEPEDALPUSHBUTTON LOCATEDONTHECABLE 2EEDS)0 s#ONSISTSOFABASEMADEUPOFATRANSPARENT POLYCARBONATECASINGINSTALLEDBETWEEN!)3) STAINLESSSTEELPLATESFIXEDBYMEANSOF!)3) STAINLESSSTEELSCREWS7ATERSEALINGISASSUREDBY ASILICONEGASKET4HELIGHTFIXTURECANBEFASTENED TOTHEFLOORBYMEANSOFTHEHOLESINTHELOWER PLATE4ECHNOPOLYMERAESTHETICCOVER s#OMPLETEWITHINTEGRATEDBALLASTANDSUPPLIED WITHAM LONG(2. &XCABLEPROVIDED WITH)0CONNECTORFORTHEELECTRICALCONNECTION TOTHEMAINSSUITABLEFOR MMDIAMETER CABLES 2EEDS)0 s#ONSISTSOFABASEMADEUPOFATRANSPARENT POLYCARBONATECASINGINSTALLEDBETWEEN!)3) STAINLESSSTEELPLATESFIXEDBYMEANSOF!)3) STAINLESSSTEELSCREWS7ATERSEALINGISASSUREDBY ASILICONEGASKET4HELIGHTFIXTURECANBEFASTENED TOTHEFLOORBYMEANSOFTHEHOLESINTHELOWER PLATE4ECHNOPOLYMERAESTHETICCOVER s4HELIGHTFIXTUREISSUPPLIEDWITH6$#POWER ANDISPROVIDEDWITHAM LONG(2. &X CABLEWITH)0CONNECTORFORTHEELECTRICAL CONNECTIONTOTHEMAINSSUITABLEFOR MM DIAMETERCABLES


?


2EEDS

!NTHRACITEGREY

)0 #2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 1499

7  7

54

6AC(ZELECTRONICBALLASTINCLUDED

224

)0)+

219

)0 7  7

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4

54

1499

6AC(ZELECTRONICBALLASTINCLUDED

224

)0)+

219

)0 #2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 1499

7  7

6ACIN 6ACOUT         

,MM 7MM (MM         

)0   

#ODE 4 4 4

)0)+

224

$RIVER 76DC 76DC 76DC

54

%LECTRONICBALLAST6DCSUPPLIEDSEPARATELY

219

0LEASESEEPAGEFORDRIVERSINSTALLATIONDETAILS


2EEDS

!NTHRACITEGREY

)0TRIPLE #2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 1499

7 7

54

6AC(ZELECTRONICBALLASTINCLUDED

418

)0)+

423

)0TRIPLE #2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 1499

7 7

6ACIN 6ACOUT ,MM 7MM (MM            

)0  

#ODE 4 4

)0)+ 418

$RIVER 76DC 76DC

54

%LECTRONICBALLAST6DCSUPPLIEDSEPARATELY

423

?


?


4OLOMEO/UTDOOR -ICHELE$E,UCCHI

'IANCARLO&ASSINA 


s,%$#/" s7 sLUMEN s-AC!DAM3$# s"EAM8& s##4+ s#2) s,IFE,+  s)0FLOORHOOKVERSION )0SUSPENDEDVERSION

&LOORVERSIONS

s&LOOR SUSPENSION ANDHOOK ASWELLASLAMPSHADEAND LAMPPOSTVERSIONS MADEWITHMATERIALSANDFINISHES SUITEDFOROUTDOORUSE s4HE,%$SOURCEISCONTAINEDWITHINADIFFUSINGCAP FITTEDINSIDEACLEAR)0PLASTICELEMENT s4HESUSPENSIONVERSIONHASPROTECTIONRATING)0 WHEREASTHEFLOORANDHOOKVERSIONSHAVEPROTECTION RATING)0 s4HEDIFFUSERISMADEOF4HUIAFABRICBY0AOLA,ENTI A DURABLEANDWASHABLEPLASTICMATERIALTHATLOOKSLIKE NATURALJUTE s!LLTHEVERSIONSOF4OLOMEO/UTDOORAREAVAILABLEWITH ORWITHOUTLAMPSHADE s4HEFRAMESWITHLIGHTINGBODYOFTHELAMPPOSTAND LAMPSHADEVERSIONSHAVEDIFFERENTFEATURES

ª

8&EXTRAmOOD ª

4OLOMEO/UTDOOR0ARALUME

?


4OLOMEO/UTDOOR,AMPIONE


?


4OLOMEO/UTDOOR0ARALUME

!LUMINIUM



4OLOMEO/UTDOOR0ARALUMEmOOR #2) 

7EIGHT "EAM  KG 8&

&LUX LM

##4 #OLOR +

#ODE 4



7 7

Â&#x2019;





!CCESSORIESSUPPLIEDSEPARATELY

!CCESSORIES #OLOR BASE ROD DIFFUSERø

4 4 4

)0

)0

)0

Â&#x2019;

4OLOMEO/UTDOOR0ARALUMESUSPENSION 7EIGHT "EAM KG 8&

&LUX LM

Â&#x2019;

##4 #OLOR +

#ODE 4

Â&#x2019; MAX

#2) 



7 7

!CCESSORIESSUPPLIEDSEPARATELY Â&#x2019;

!CCESSORIES #OLOR 4 4

DIFFUSERø

4OLOMEO/UTDOOR0ARALUMEHOOK 7EIGHT "EAM KG 8&

&LUX LM

##4 #OLOR +



#2) 

Â&#x2019;

#ODE 4



7 7



Â&#x2019;

!CCESSORIESSUPPLIEDSEPARATELY

!CCESSORIES #OLOR DIFFUSERø

4 4


4OLOMEO/UTDOOR,AMPIONE

!LUMINIUM

1080

4OLOMEO/UTDOOR,AMPIONEmOOR #2) 

7EIGHT  KG

"EAM 8&

&LUX ##4 #OLOR LM +

#ODE 4 161

7 7

665

ø146

!CCESSORIES #ODE 4

)0

)0

)0

1322

#OLOR BASE ROD

2185

2320

!CCESSORIESSUPPLIEDSEPARATELY

ø600

ø180

4OLOMEO/UTDOOR,AMPIONESUSPENSION "EAM 8&

&LUX ##4 #OLOR LM +

ø142

#ODE 4

47

7EIGHT KG

max 2000

#2) 

161

7 7

ø146

4OLOMEO/UTDOOR,AMPIONEHOOK 7EIGHT KG

"EAM 8&

&LUX ##4 #OLOR LM +

#ODE 4

ø37 236

#2) 

161

7 7

131

ø146 5m

?


?


4OLOMEO88, -ICHELE$E,UCCHI 'IANCARLO&ASSINA 

s&,5/7 s)0

 ªBASE  ªPERNO

s,IGHTFIXTUREWITHDIRECTEMISSION WITHFLUORESCENT ORMETALHALIDESOURCES s!VAILABLEWITHBASEORFIXEDSUPPORTPIVOT MADE OFMASS COLOUREDCONCRETE s$IFFUSERINMASS PIGMENTEDPOLYPROPYLENE SCREENINLIGHT DIFFUSINGSILKSCREENEDMETHACRYLATE REFLECTORINPAINTEDALUMINIUM s-OBILE ARMSTRUCTUREINEXTRUDED%. !7  ALUMINIUMWITHBRIGHTANODIZINGTREATMENT s0OLISHED PAINTEDARTICULATIONSINDIE CAST %. !"ALUMINIUM s!DJUSTMENTSYSTEMIN!)3)STAINLESSSTEEL s3ILICONESEALGASKETS s3UITABLEFORWATERTIGHTCONNECTION s%LECTRONICBALLAST s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%.  s%.%#APPROVED


-EET$ESIGN 2OME )4

?


4OLOMEO88,

3ILVERGREY

4OLOMEO88,WITHBASE 7 &,5/X7'8Q 

#OLOR

).$//2

/54$//2

#ODE !

#ODE !

)0

MIN MAX

6AC(ZELECTRONICBALLASTINCLUDED

Â&#x2019; MIN MAX

7 &,5/X7'8Q 

6AC(ZELECTRONICBALLASTINCLUDED

#OLOR

).$//2

/54$//2

#ODE !

#ODE !

)0

MIN MAX

4OLOMEO88,WITHlXEDSUPPORT

MIN MAX


?


0LACESAND 3TREET,IGHTING

           

)NDICTA 3OSTITUTO 3OSTITUTO0OLE #ElSO #ElSO0OLE #ARIDDI #ARIDDI0OLE (ILA 0ROVOCA 0OTO 3OLAR4REE $IAMANTE

?


%RNESTO'ISMONDI 

$ANESE-IANO -ILAN )4

)NDICTA


s7 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4++ s#2) s,IFE,+  s)0

s,IGHTFIXTUREWITHDIRECTEMISSION WITHHIGH PERFORMANCE,%$LIGHTSOURCES

s(IGH EFFICIENCYASYMMETRICALOPTICSINMETALISED POLYCARBONATE

sÂ&#x2019;MMPOLEINSTALLATIONWITHÂ&#x2019;XMMSHANK NOTSUPPLIED 

s/PTICALHOUSINGSUPPORTINHIGH RESISTANCE MASS COLOUREDREINFORCEDPOLYMERS

s!NTHRACITEGREYFINISH

s!)3)STAINLESSSTEELSCREWSANDSILICONESEALGASKETS

s#ONSISTSOFOPTICALHOUSINGANDSUPPORTFORPOLE INSTALLATION

s0ROVIDEDWITH)0CABLEANDCONNECTORFORTHEMAINS CONNECTION

s/PTICALHOUSINGINEXTRUDED%. !7  ALUMINIUM CHROMATETREATEDANDPAINTEDWITH  STAGEOUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCEWITH %.  s%.%#APPROVED

s56RESISTANTDIFFUSERINSHOCKRESISTANT POLYCARBONATE

Lighting application

,%$7

h

L

A

Em

Emax

Emin

M

M

M

LUX

LUX

LUX

H A ,

!NTHRACITEGREY

7 7

#2) 

7EIGHT  KG

&LUX LM LM

##4 + +

#OLOR

#ODE 4 4



Â&#x2019;



"EAM !3

)0







Â&#x2019;

ª 

â&#x2C6;&#x2026;  



Â&#x2019;

?


3OSTITUTO3POT %RNESTO'ISMONDI 

s7 sLUMEN s-AC!DAM3$# s"EAM3 & %,ELLIPTICAL s##4+ s#2)MIN s,IFE,+  s)0

 ª

s,IGHTFIXTUREWITHDIRECTEMISSION WITHMONOCHROMATIC ,%$LIGHTSOURCES s&LOOR WALL EAVESINSTALLATION s#ONSISTSOFLIGHTINGUNITCOMPOSEDBYINTERCHANGEABLE OPTICALUNITS WIRINGTERMINALBOARDANDFIXINGPLATE 0OSITIONINGISMAINTAINEDBYMEANSOFLOCKINGDOWELS 4ILTINGWITHªADJUSTMENTS0OSITIONINGISENSUREDBY MEANSOFFASTENINGSCREWS s%.!"ALUMINIUMBODYANDTERMINALBOARD SILICONEGASKETS s%LECTRONICBALLASTINTEGRATEDINTHEBODY s0OLYCARBONATEDIFFUSERSILICONE SEALEDTOTHELENS SUPPORTINGUNIT s)0CONNECTORFORTHEELECTRICALCONNECTIONTOTHE MAINS WHICHCANBELOCATEDINTHEBASECOMPARTMENT ANDISSUITABLEFOR MMDIAMETERCABLES s,%$CIRCUITSWITH0--!LENSESINBEAMVERSIONSª ªANDELLIPTICALXª s!LLTHESCREWSUSEDOUTSIDETHEPRODUCTAREIN!)3) STAINLESSSTEEL s!LLTHECOMPONENTSINDIE CASTALUMINIUMAREPAINTED WITH STAGEOUTDOORTREATMENTNANOTECHNOLOGIES ANTI OXIDIZINGPRIMER POLYESTERPAINT s4ECHNICALFEATURESOFTHELIGHTINGFIXTURESINCOMPLIANCE WITH%. ANDSECTION  s0ROTECTIONLEVELFROM+6IMPULSEOVERVOLTAGE


3OSTITUTO3POT

7 7

#2) 

!NTHRACITEGREY

7EIGHT  KG

"EAM ª ª %,

&LUX LM LM LM

##4 + + +

#OLOR

#ODE 47 47 4%,7

6AC(ZELECTRONICBALLASTINCLUDED

)0)+







3POTOPTIC

&LOODOPTIC

#ONCENTRATEDLUMINOUSmOW TOHIGHLIGHTDETAILSAVOIDING UNWANTEDLIGHTDISPERSION

7IDELUMINOUSmOWSUITABLE FORLIGHTINGLARGEAREAS

ªOPTIC

ªOPTIC

?


3OSTITUTO0ALO %RNESTO'ISMONDI 

s7 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0

s,IGHTFIXTUREWITHDIRECTEMISSION WITH MONOCHROMATIC,%$LIGHTSOURCES s0OLEINSTALLATIONPOLENOTSUPPLIED  s4HEAPPLIANCEISMADEUPOFALIGHTINGBODYANDA POLEJOINT ADJUSTABLEWITHªANGLESUPTOªFOR USEWITHHORIZONTALTERMINALPOLES0OSITIONINGIS ENSUREDBYMEANSOFFASTENINGSCREWS s$IE CAST%. !"ALUMINIUMLIGHTINGUNITWITH  STAGEOUTDOORTREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT s!SYMMETRICALHIGH EFFICIENCY0--!OPTICALUNITS (IGH TRANSPARENCYSHOCK RESISTANTPOLYCARBONATE SCREENS#ONSISTSOFINTERCHANGEABLEOPTICAL UNITS

s%LECTRONICBALLASTINTEGRATEDINTHEBODY s)0CONNECTORFORCONNECTIONWITHTHEMAINS INSIDETHEPOLEJOINT ACCOMMODATESCABLESWITHA  MMDIAMETER s!)3)FIXINGSCREWSANDSILICONEGASKETS s3UITABLEFOR-%AAND-%AROADLIGHTING s4ECHNICALFEATURESINCOMPLIANCEWITH%.    s0ROTECTIONLEVELFROM+6IMPULSEOVERVOLTAGE s%.%#APPROVED


3OSTITUTO0ALO

,%$7

!NTHRACITEGREY

,IGHTINGAPPLICATION

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

H A ,

3TANDARD



7EIGHT  KG

"EAM !3

&LUX ##4 LM +

#OLOR

#ODE 4%,.



#2) 

6AC(ZELECTRONICBALLASTINCLUDED

 ª

(IGH&LUX 7 7

#2) 

7EIGHT "EAM  KG !3

&LUX ##4 LM +

#OLOR

#ODE 4%,(

)0)+



7 7

ª



Â&#x2019;

6AC(ZELECTRONICBALLASTINCLUDED Â&#x2019;





Â&#x2019;

?


?


#ElSO !LESSANDRO0EDRETTI 3TUDIO2OTA0ARTNERS 

s7 7 sLUMEN s-AC!DAM3$# s"EAM. 7&, %ELLIPTICAL 77 s##4+ s#2) s,IFE,+  s)0

s,IGHTFIXTUREWITHADJUSTABLEDIRECTEMISSION WITH HIGH PERFORMANCE,%$LIGHTSOURCES

s3ILKSCREENEDTEMPEREDGLASSSILICONEDFLUSHWITHTHE BODYTOAVOIDBACKWATER

s&LOOR WALLANDEAVESINSTALLATION

s7IRINGTOBECARRIEDOUTINSIDETHETERMINALBOARD BYPIERCINGAN)0GROMMETSUITABLEFORCABLESWITHA DIAMETEROF MM

sSIZES#EFISO #EFISO s!VAILABLEINTWOFINISHESGREY WHITEPAINTED2!,  ANDANTHRACITEGREYPAINTED

s0--!LENSESINDIFFERENTVERSIONSOFBEAMS

s#ONSISTSOFADJUSTABLELIGHTINGUNITANDTERMINAL BOARD!GRADUATEDMETALRINGALLOWSANACCURATE ADJUSTMENT0OSITIONINGISMAINTAINEDBYMEANSOF LOCKINGDOWELS

s3CREWSIN!)3)STAINLESSSTEEL

s"ODYANDTERMINALBOARDIN%.!"ALUMINIUM SILICONEGASKETS

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. ANDPART 

s0AINTEDDIE CASTALUMINIUMWITH STAGEOUTDOOR TREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT

s%LECTRONICBALLASTINTEGRATEDINTHEBODY  ª

 ª

83EXTRASPOT ª

7&WIDEmOOD ª ª

%,ELLIPTICAL 77




?


#ElSO

'REY WHITE2!,

!NTHRACITEGREY

.ARROWOPTIC

7IDE&LOODOPTIC

%LLIPTICALOPTIC

#ONCENTRATEDLUMINOUSFLOW TOHIGHLIGHTDETAILSAVOIDING UNWANTEDLIGHTDISPERSION

7IDELUMINOUSFLOWSUITABLE FORLIGHTINGLARGEAREAS

%LLIPTICALDISTRIBUTIONOFTHE LUMINOUSFLOWSUITABLEFOR WALLWASHEREFFECT

 ªOPTIC

ªOPTIC

ELLIPTICALOPTIC77

#ElSO

7 7

#2) 

7EIGHT  KG

"EAM  ª

&LUX LM

##4 +

ª

LM

+

%,77

LM

+

#OLOR

#ODE 47 47 47 47 4%,7 4%,7 )0)+





6AC(ZELECTRONICBALLASTINCLUDED 

#ElSO

7 7

#2) 

7EIGHT  KG

"EAM  ª

&LUX LM

##4 +

ª

LM

+

%,77

LM

+

#OLOR

#ODE 47 47 47 47 4%,7 4%,7 )0)+





6AC(ZELECTRONICBALLASTINCLUDED




#ENTRO3ERVIZIDELLO3TUDENTATO5NIVERSITARIO 4RENTO )4 0ROGECT3TUDIO0ALERMAND4ABARESDE.AVAS,!RQUITECTOS #,!3D3%NGENEERING ING,UCA-ASINI

?


#ENTRO3ERVIZIDELLO3TUDENTATO5NIVERSITARIO 4RENTO )4 0ROGECT3TUDIO0ALERMAND4ABARESDE.AVAS,!RQUITECTOS #,!3D3%NGENEERING ING,UCA-ASINI

?


#ElSO0ALO !LESSANDRO0EDRETTI 3TUDIO2OTA0ARTNERS 

s7 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0

s,IGHTFIXTUREWITHADJUSTABLEDIRECTEMISSION WITH HIGH PERFORMANCE,%$LIGHTSOURCES s0OLEINSTALLATION s!VAILABLEINTWOFINISHESLIGHTGREYPAINTEDAND ANTHRACITEGREYPAINTED s#ONSISTSOFLIGHTINGUNITANDPOLESUPPORT&IXINGIS MAINTAINEDBYMEANSOFLOCKINGDOWELS

s4HELIGHTFIXTUREISPROTECTEDFROMIMPULSE OVERVOLTAGEUPTO+6BOTHINDIFFERENTIALAND COMMONMODE s3ILICONE SEALEDSILK SCREENEDTEMPEREDGLASS s)0CONNECTORFORELECTRICCONNECTIONTOTHEMAINS ITCANBEHOUSEDINTHEPOLECOMPARTMENTANDIS SUITABLEFORCABLESWITHADIAMETEROF MM

s4HEPOLE NOTSUPPLIED MUSTHAVEAÂ&#x2019;MMAND HMMSHANKTOCORRECTLYFIXTHEHEAD POLE 4HEPOLEHEIGHTMUSTBEMFROMTHEGROUND TOPROVIDEACORRECTSURFACELIGHTING)NTHISWAY THEPOLESCANBEINSTALLEDATADISTANCEOFM SUITABLETOLIGHTAMCARRIAGEWAYINCOMPLIANCE WITH3CLASSFORCYCLETRACKS

s,%$CIRCUITSWITH0--!LENSESWITHROADEMISSION BEAM

s"ODYIN%.!"ALUMINIUM POLESUPPORTIN GALVANIZEDIRON SILICONEGASKETS

s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%. 

s%LECTRONICBALLASTINTEGRATEDINTHEBODY

s3CREWSIN!)3)STAINLESSSTEEL s!LLPARTSINDIE CASTALUMINIUMANDGALVANISED IRONAREPAINTEDWITH STAGEOUTDOORTREATMENT NANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTER PAINT


'REY WHITE2!,

,%$7

,IGHTINGAPPLICATION

H M

,

A

%M

%MAX

%MIN

M

M

LUX

LUX

LUX

!NTHRACITEGREY

H A ,

3UITABLEFORSTREETLIGHTINGINTHECLASS3BIKEPATHS 

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 47 47



#2) 



7 7





Â&#x2019;

)0)+

6AC(ZELECTRONICBALLASTINCLUDED



Â&#x2019;



Â&#x2019;





Â&#x2019;

?


#ARIDDI %RNESTO'ISMONDI  #!2)$$)#!2)$$) /04)#3ª

#!2)$$) /04)#3ª ª #!2)$$) /04)#3ª ª


!NTHRACITEGREY

s,%$#/"

s,%$PROJECTORS

s7 7

s&LOOR WALL CEILING EAVESINSTALLATION

sLUMEN

s#ONSISTSOFANADJUSTABLELIGHTINGUNITAND TERMINALBOARD0OSITIONINGISMAINTAINEDBY MEANSOFLOCKINGDOWELS

s-AC!DAM3$#s"EAM3 7&

s,%$#/"WITH0--!LENSANDANODIZED ALUMINIUMREFLECTORINDIFFERENTBEAM VERSIONS s4HEOPTICALUNITINTHENARROW BEAMVERSION ISMADEUPOFA. 3&OPTICALGLASS CONDENSATIONLENSANDANEXTERNAL0--! PROJECTIONLENSGLUEDFLUSHWITHTHECLOSING BEZELOFTHELIGHTINGBODY

s4HEBASEANDTHELIGHTINGUNITARECONNECTED BYA(2. &XCABLE

s##4+

s%.!"ALUMINIUMHEADANDTERMINAL BOARD %.!7ALUMINIUMBODY SILICONE GASKETS

s#2)MIN s,IFE,+  s)0

s!VAILABLEINDIFFERENTPOWERS s!LLTHESCREWSUSEDOUTSIDETHEPRODUCTARE IN!)3)STAINLESSSTEEL

s%LECTRONICBALLASTINTEGRATEDINTHEBODY

s!LLTHECOMPONENTSINDIE CASTALUMINIUM AREPAINTEDWITH STAGEOUTDOORTREATMENT NANOTECHNOLOGIES ANTI OXIDIZINGPRIMER POLYESTERPAINT

s3ILICONE SEALEDSILK SCREENEDTEMPEREDGLASS  ª

3SPOT ª ª

s7IRINGTOBEPERFORMEDINSIDETHETERMINAL BOARDBYPIERCINGAN)0GROMMETSUITABLE FOR MMDIAMETERCABLES

 ª

&mOOD ª ª

s4ECHNICALFEATURESOFTHELIGHTFIXTURESIN COMPLIANCEWITH%. ANDSECTION 

7&WIDEmOOD ª ª

256

#ARIDDI &LUX LM LM LM

##4 + + +

#OLOR

#ODE 47 47 47

260

"EAM ª ª ª

Ã&#x2DC;135

7EIGHT  KG

41

7,%$#/" #2) 7

76

6AC(ZELECTRONICBALLASTINCLUDED

160

)0)+

)0)+

256

#ARIDDI &LUX LM LM LM

##4 + + +

#OLOR

#ODE 47 47 47

260

"EAM ª ª ª

Ã&#x2DC;135

7EIGHT  KG

41

7,%$#/" #2) 7 

6AC(ZELECTRONICBALLASTINCLUDED

76

160

?


#ARIDDI0ALO %RNESTO'ISMONDI 


!NTHRACITEGREY

s,%$#/"

s!NADJUSTABLEDIRECTLIGHTINGAPPLIANCETHAT CONSISTSOFAPOLEJOINTANDANADJUSTABLE LIGHTINGBODY&IXEDINTOPOSITIONWITHGRUB SCREWS

s7 sLUMEN s-AC!DAM3$#

BODYANDGLASS HOLDINGRING SILICONGASKETS %LECTRONICPOWERUNITINSIDETHEBODY s3UITEDFORPUBLICUSE PROTECTEDFORK6 SURGES BOTHINTHECOMMONANDINTHE DIFFERENTIALMODE

s4HEPOLE NOTINCLUDED SHOULDHAVEAMM SPIGOTTOALLOWAPPROPRIATEFIXINGOFTHEPOLE HEAD4HEPOLESHOULDBEMHIGHTOENSURE APPROPRIATESURFACEILLUMINATION5NDERTHESE CONDITIONS POLESCANBEINSTALLEDMAPART TOILLUMINATEAMLANE INORDERTOENSURE COMPLIANCEWITHCLASS3FORCYCLINGLANES

s"EAM!3ASYMMETRICAL s##4+ s#2) s,IFE,+  s)0

ª

s-OULDEDSILICONROADLIGHTINGAPPLIANCE4HE TEMPEREDGLASSDIFFUSERGLUEDFLUSHTOTHE LIGHTINGBODYENSURESTHEABSENCEOFLIGHTING POLLUTION s)./8!)3)STEELSCREWS

s#ABLINGSHOULDBEACCOMMODATEDWITHINTHE POLEHEAD ACCESSIBLETHROUGHALID USINGAN )0SEALEDCONNECTORFITFORCABLESWITHTO MMDIAMETERS

s$IE CASTALUMINIUMELEMENTSPAINTED WITH STAGEOUTDOORTREATMENT NANOTECHNOLOGIES ANTI OXIDIZINGPRIMER POLYESTERPAINT

s4HELIGHTINGBODYISPOWEREDTHROUGHA (2. &XCABLE

s4HETECHNICALFEATURESOFTHEAPPLIANCES COMPLYWITHTHE%.  NORM

##4 +

#OLOR

#ODE 47

142

&LUX LM

ø137

ø76

170

"EAM !3

255

#2) 

76

7,%$#/" 7

160

s!LUMINIUM%.!"HEAD POLEJOINT ANDSEALINGCAPSALUMINIUM%.!7

IP65 IK07

280

?


(ILA #ARLO#OLOMBO 

s7 7 sLUMEN

s3ERIESOFLIGHTFIXTURESWITHDIRECTEMISSION WITHHIGH PERFORMANCE,%$LIGHTSOURCES

s"EAM!3ASYMMETRICAL

s#ONSISTSOFLAMPANDWALLSUPPORT(ILAWALL OR SUPPORTPOLEANDGROUNDMOUNTINGPLATE(ILA FLOOR 

s##4++

s,AMPUNITINDIE CAST%. !"ALUMINIUM

s#2)

s56RESISTANTDIFFUSERINSHOCKRESISTANT POLYCARBONATEWITHSATINYFINISH PROVIDEDWITH HIGH EFFICIENCYLIGHT DIFFUSINGLENSES

s-AC!DAM3$#-

s)0

s(ILAWALLWALLSUPPORTINPAINTEDSTEEL s(ILAFLOORSUPPORTPOLEHCMINEXTRUDED %. !7 ALUMINIUM CHROMATETREATEDAND PAINTED-OUNTINGPLATEINPAINTEDSTEEL WITH HOLESFORGROUNDFIXINGBYMEANSOFLOGBOLTSOR DOWELS

s0AINTINGISOBTAINEDBYMEANSOF STAGEOUTDOOR TREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT s!)3)STAINLESSSTEELSCREWSANDSILICONESEAL GASKET s0ROVIDEDWITH)0CABLEANDCONNECTORFORTHE MAINSCONNECTION s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%.  s%.%#APPROVED


?


(ILA

!NTHRACITEGREY

'REY WHITE2!,

(ILA&LOOR0OLE

H (),!7

,IGHTINGAPPLICATION

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

,IGHTINGAPPLICATION

A

(!,/7

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

,



7 7

#2) 

7EIGHT "EAM &LUX  KG !3 LM

##4 +

7



 KG !3

+

LM

#OLOR



(ILA0OLE #ODE 4 4 4 4





)0)+



6AC(ZELECTRONICBALLASTINCLUDED





#2) 

7EIGHT  KG

"EAM &LUX !3 LM

##4 +

#OLOR

#ODE 4 4



7 7



(ILA&LOOR

6AC(ZELECTRONICBALLASTINCLUDED )0)+



(ILA7ALL 7EIGHT "EAM &LUX  KG !3 LM

##4 +

#OLOR

#ODE 4 4

 

#2) 



7 7

6AC(ZELECTRONICBALLASTINCLUDED



)0)+


?


0ROVOCA %RNESTO'ISMONDI 

s7 sLUMEN s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4++ s#2) s,IFE,+  s)0

s,IGHTINGUNITINPAINTEDDIE CAST%. !" ALUMINIUM s(IGH PERFORMANCEASYMMETRICALOPTICSIN METALISEDPOLYCARBONATE s3CREENSINSHOCKRESISTANT HIGHTRANSPARENT TEMPEREDGLASS s0AINTINGISOBTAINEDWITH STAGEOUTDOOR TREATMENTNANOTECHNOLOGIES ANTIOXIDANTPRIMER POLYESTERPAINT s!)3)STAINLESSSTEELSCREWSANDSILICONESEAL GASKETS s0ROVOCAWALLCONSISTSOFLIGHTINGUNITANDWALL SUPPORTINPAINTEDSTEEL s0ROVOCAPOLEHEAD POLEFIXTURECONSISTSOFLIGHTING UNITANDPOLECONNECTIONXMMSQUAREPOLE INSTALLATIONWITHXMMSQUARESHANKNOT SUPPLIED (EAD POLEFITTINGINPAINTEDSTEEL s4ECHNICALFEATURESOFLIGHTFIXTURESINCOMPLIANCE WITH%.  s%.%#APPROVED


!NTHRACITEGREY

'REY WHITE2!,

H ,%$7

,IGHTINGAPPLICATION

H

,

A

%M

%MAX

%MIN

M

M

M

LUX

LUX

LUX

A ,

0ROVOCAWALL 7 7

#2) 

7EIGHT KG

"EAM &LUX ##4 !3 LM +

#OLOR

#ODE 4 4

4 4

7ALLSUPPORT

6AC(ZELECTRONICBALLASTINCLUDED )0)+







 

0ROVOCAPOLE 7EIGHT "EAM &LUX ##4 #OLOR KG !3 LM +



KG

!3

LM +

0OLECONNECTION 0OLE(CM

#ODE 4 4 4 4

4 4 4 4

)0)+

6AC(ZELECTRONICBALLASTINCLUDED









#2) 



7 7



?


0OTO %RNESTO'ISMONDI 


!NTHRACITEGREY

7HITE

s,%$#/"

s0OLEAPPLIANCEFORDIRECTLIGHTING

s7

s#ONSISTSOFAPOLEHEADATTACHEDTOTHEPOLEWITH GRUBSCREWS

sLUMEN

s4HEPROVIDED%.!7ALUMINIUMPOLESHOULDBE BATHEDINCONCRETEFORMANDRISEMUPFROM THEGROUND

s-AC!DAM3$# s"EAM!3ASYMMETRICAL s##4+

s4HELIGHTINGBODYISFITTEDWITHAN)0CONNECTOR SUPPORTINGCABLESWITHTOMMDIAMETERS TO BEFITTEDINSIDETHEPOLE

s#2) s,IFE,+ 

s4HEHEADHASATRANSPARENTDIFFUSERANDAMATT WHITETOPCAPBOTHINIMPACTRESISTANT0--!4HE BODYFITTEDINSIDETHEPOLEISMADEOF%.!7 ALUMINIUM3ILICONSEALS

s)0

s%LECTRONICPOWERPACKFITTEDINSIDETHEBODYSUITED FORK6SURGES s)NTERNALREFLECTOROFMETALLISEDZAMACFITTEDBY SANDEDGLASSFILTER s!LLTHESCREWSUSEDFORTHEOUTSIDEOFTHEPRODUCT AREMADEOF!)3))./8STEEL s!LLTHEALUMINIUMPARTSAREFINISHEDWITHA STAGE OUTDOORTREATMENTNANOTECHNOLOGIES ANTI OXIDANT PRIMER POLYESTERPAINT

490

#2) 

7EIGHT  KG

"EAM !3

&LUX LM

##4 +

#OLOR

#ODE 4 4 2784

7 7

6AC(ZELECTRONICBALLASTINCLUDED

500

)0)+

ø 130

?


3OLAR4REE 2OSS,OVEGROVE 

3OLAR4REEISCONCEIVEDASALIGHTINGAPPLIANCECOMBIN INGTHE,%$ BASEDLIGHTINGTECHNIQUEWITHTHESOLAR PHOTOVOLTAICTECHNOLOGYINAVERYPECULIARANDINNOVA TIVEDESIGN 4HEPROJECTISAIMED ONONEHAND ATMINIMIZINGTHE ENVIRONMENTALIMPACTOFTHEPRODUCTSUSEDERIVING INPARTICULAR FROMREDUCEDCONSUMPTIONOFENERGY OBTAINEDFROMFOSSILFUELS WHILEENSURINGTHATTHE APPLIANCECANPROVIDESERVICECONTINUITYAND THERE FORE THEEXPECTEDLUMINOUSPERFORMANCE WITHOUT BEINGVULNERABLETORANDOMWEATHERAGENTSORSUFFER DESIGNIMBALANCENUMBEROFPANELS ACCUMULATORSIZE CALCULATEDFORWINTERMONTHS3UCHIMBALANCEIMPLIES SIGNIFICANTDIMENSIONS WEIGHTS ANDCOSTSANDWOULD NOTENSURECONTINUOUSOPERATIONINOFF AVERAGEWEATH ERCONDITIONS 4HESAMELOGICALPRINCIPLESIMPLEMENTEDINTHEAUTO MOTIVESECTORONELECTRICCARS WITHHYBRIDVERSIONS TAKINGTHELEADOVERPUREELECTRICBATTERY BASEDONES FORANUMBEROFREASONS SUCHASCOSTS PERFORMANCE ANDSTATEOFTHEARTOFCERTAINTECHNOLOGIES WEREUSED TODEVELOPTHE3OLAR4REEPROJECTBY!RTEMIDE7ITHITS MIXEDACCUMULATORSOLARANDNETWORKCONFIGURATION IT PROVIDESTHEBESTPOSSIBLEENERGYSAVINGANDFUNCTION ALITYCOMBINATION


?


3OLAR4REE

s4HESTRUCTURECONSISTSOFCURVEDSTEELPOLESOF DIFFERENTDIAMETERSANDHEIGHTS REACHINGA MAXIMUMTOTALMHEIGHTABOVEROADLEVEL 4HESYSTEMINCLUDEShGRASSBLADESvWITH MM THICKPOLESWITHAMMDIAMETER FITTED WITH7TERMINAL,%$PROTECTEDBYA0--! DIFFUSERSCREEN ANDMM THICKPOLESWITHA MMDIAMETERSUPPORTINGTHE0%4'HEADSWITH THESOLARPANELS%MISSIONISDIFFUSED s4HEPOLESARECOATEDWITHPALEGREENOUTDOOR EPOXYPAINTFADINGTOWHITE ANDFINISHEDWITHA TRANSPARENTLAYER s&OUROFTHETENHEADSALLWITHPHOTOVOLTAICCELLS ONTHETOP AREFITTEDWITHA,%$UNIT,%$S WITHANEUTRALWHITECOLOURTEMPERATURE POWERED WITHUPTOM! ATTHEBOTTOMFORDIRECT DOWNWARDEMISSION SEALEDWITHAPLASTICSCREEN TOENSUREPROTECTIONFROMWATERANDDUST s4HEBASEISMADEOFHOT ZINCCOATEDSHEET STEELDESIGNEDFORENCLOSUREINAPLINTHOFTHE APPROPRIATESIZE NOTPROVIDEDWITHTHEAPPLIANCE TOBESUNKINTOTHEGROUND!LTERNATIVELYABASE ISAVAILABLE ALSOMADEOFZINC COATEDSTEELWITH REINFORCEDCONCRETESTABILIZINGUNITSFORMINGA ROUNDSEAT)NTHISCASETHEBASECANSIMPLYREST ONTHEGROUND EVENIFGROUNDFIXINGISALWAYS RECOMMENDED s4HECONNECTIONCABLINGELEMENTS ASWELLASTHE CONTROLANDCHARGINGBOARDS ARECONTAINEDIN MULTIPLEWATER TIGHTBOXESWITHPLUG AND SOCKET CONNECTORSWITHPROTECTIONRATING)0ORHIGHER ANDLOCATEDEITHERINAPPROPRIATESPOTSATTHEFOOT OFTHEBASEFOREASYINSPECTIONANDMAINTENANCE ORINSIDETHECONCRETESTABILIZINGUNIT ASSPECIFIED INDETAILFORTHE3OLAR4REEVERSIONCONSTITUTINGTHE OBJECTOFTHESUPPLY s4HEAIRTIGHTACCUMULATORSARECONTAINEDINSPECIFIC BOXESTHATALLOW ONONEHAND TOPROTECTTHE BATTERYMECHANICALLYANDFROMOUTERAGENTSAND ONTHEOTHERTORELEASEANYGASDISCHARGES TOBE PROVIDEDFORBYTHELAW

#ONFIGURATION

4ECHNICALDATA

4HELIGHTFITTINGCONFIGURATIONINCLUDESANANALYSISOF THEPOTENTIALINCOMINGENERGYGEOGRAPHICALLOCATION OFTHELIGHTFITTING ANDADETAILEDANALYSISOFTHE PHYSICALLOCATIONOFTHELIGHTFITTINGPROXIMITYOF BUILDINGSORTREES ,ASTLY ANANALYSISOFTHELEVELOF REQUESTEDSERVICEANDPERFORMANCEWILLBEIMPLE MENTEDLUMINANCELEVELS OPERATIONHOURS POTENTIAL DISCONTINUITYINTHESERVICE IFANY 

4OTALNUMBEROFHEADSWITHSOLARPANELS

!VERAGERECEIVEDSOLARRADIATIONINHOURS  3YSTEMCONVERSIONEFFICIENCY .OMINALOPERATINGTEMPERATURE %XPOSUREFACTOR

HEQUIVALEN SYSTEM NOCT

TILTANGL

"ATTERIES

)NSTALLEDPOWERFOREACHLIGHTHEAD ABOUT7ATM!BASECURRENTDRIVE MAXCURRENTDRIVEM!

"ATTERYVOLTAGE6 3INGLEBATTERYCAPACITY!H

POWER,%$SFOREACHHEADINNEUTRAL LIGHTTONALITY+

"OXWITH53"CONNECTIONFORDIAGNOSTICS  SETTING  SERVICINGACCESS

-AXIMUMLUMINOUSFLUXFOREACHHEAD MINIMUM,M 3OLARPANELVOLTAGEINOPENCIRCUITABOUT6

4ECHNICALFEATURESOFTHELIGHTFIXTUREINCOM PLIANCE WITH%. 

0EAKPOWERFOREACHPANELABOUT7

)02ATING)0

4OTALNUMBEROFhSTEMSv

)NSULATIONCLASS))

%INâ&#x2C6;&#x2018;0PEAKPOWERsHEQUIVALENTs 0PEAKPOWER  -AXIMUMPOWERINPUT

,%$POWERFOREACHhSTEMv ABOUT7WITHAPOWERSUPPLYOFM!

.UMBEROFHEADSWITH,%$S

s

SYSTEM

s

NOCT

TILTANGLE


3OLAR4REE









7ORKING 3OLAR4REEWASDESIGNEDFOROPERATIONINTHE(9"2)$ CONFIGURATIONINADDITIONTOTHEBATTERIES GENERALLY OFTHEAPPROPRIATECAPACITYTOCONTAINENERGYFOR AUTONOMOUSOPERATIONFORUPTO DAYSWITHAN ENERGY SAVINGOPERATIONCYCLE BETTERSPECIFIEDBELOW WITHFULLCHARGE CONNECTIONWITHTHEMAINSISPROVIDED FORENERGYSUPPLYTOTHEAPPLIANCESVIAANAPPROPRIATE $#POWERUNITCONNECTEDWITHTHEMAINS WHENTHE BATTERIESAREDEPLETED4HISISTOENSUREFULLSERVICE AVAILABILITYEVENINCASEOFPERSISTENTBADWEATHER ANDORREDUCEDSUNIRRADIATIONORUSEOFTHE LUMINOUSPERFORMANCEOFTHEAPPLIANCE ORANYWAY WHENTHEENERGYBALANCEISNEGATIVE

!TDUSKRECOGNIZEDBYDETERMINATIONOFTHEDAWN ANDSUNSETTIMEENTEREDINTOTHECALCULATIONROUTINEOF THEMANAGEMENTPROGRAMMEOROTHERWISE THE,%$ SOURCESARETURNEDONUNTILDAWNACCORDINGTOTHE PRE SETDUTY CYCLE )Nh(9"2)$vAPPLIANCES THESYSTEMDRAWSENERGY FROMTHEBATTERIESUNTILTHESEFALLTOTHELOWERCHARGE LIMIT THENSWITCHESAUTOMATICALLYTOTHEMAINS

&ORAPPLIANCESBASEDONTHISCONFIGURATION IFMAINS CONNECTIONSCOINCIDEDWITHTHEDESIREDSWITCHINGTIME OFTHEPUBLICLIGHTINGAPPLIANCESTOWHICHTHE3OLAR4REE FUNCTIONALLYREFERS APPROPRIATESETTINGSWOULDENSURE THATTHEVOLTAGEAVAILABLEUPONPOWERINGISINTERPRETED ASASTARTSIGNALFORTHE3OLAR4REE ANDVICEVERSAINCASE OFDISCONNECTIONFROMTHEMAINS

7ORKINGPROGRAMS 4WOOPERATINGMODESAREAVAILABLETOSATISFYINDIVIDUAL NEEDSn-ANUALAND!UTOMATIC4HE!UTOMATICMODE CAN INTURN BECONFIGUREDINTHREEDIFFERENTWAYS ACCORDINGTOTHEDESIREDPERFORMANCEANDENERGY SAVINGATTITUDE-ORESPECIFICALLY!54/%#/ OPERATIONATTIMESOFMAXIMUMATTENDANCEOFTHE VENUE LIMITEDOPERATIONOFTHE,%$HEADSONLYIN THEMIDDLEOFTHENIGHTTOENSUREAVERAGELUX GROUNDILLUMINATION THE,%$SOURCESARETURNEDON ANDADJUSTEDTOAPPROXIMATELYOFTHEIRNOMINAL OPERATINGPOWERFROMSUNSETTODAWN4HISMODEIS RECOMMENDEDTOTENDTOFULLOPERATIONCOVERAGEEVEN DURINGTHEFALLWINTERINVIEWOFENERGYBALANCE 

!54/ANOPERATIONMODETHATTENDSTOENSURE MAXIMUMOPERATINGPERFORMANCEOFTHEAPPLIANCE ADJUSTINGTOTHEINCREASEDINPUTOFSOLARENERGYIF ANY  #534/-):%$THEUSERCANSELECTTHEDESIRED OPERATINGTIMESANDPROFILES 4HEABOVE DESCRIBEDPROFILESCANBEASSOCIATEDWITH DEADLINESAND THEREFORE BESELECTEDALTERNATIVELY

-!.5!,CANBEENABLEDBYTHEUSERINCASEOF SPECIALEVENTSANDORNEEDS4HEUSERCANACCESSTHE hFINEvADJUSTMENTMENUFORSELECTIONONA  SCALEOFTHEFLOWEMITTEDBYTHEINDIVIDUAL,%$ HEADSANDBYTHEBUNCHOFSTEMS4HESOURCESTHEN REMAINSWITCHEDONANDADJUSTEDACCORDINGTOTHE USERSSETTINGSUNTILSWITCHINGOFFORRETURNINGTOTHE AUTOMATICMODEUNDERTHEUSERSCONTROL

?


0IAZZA'AE!ULENTI -ILAN )4 0ROJECT0ELLI#LARKE0ELLI!RCHITECTS

PHOTOVOLTAICCELLSWITH,%$SEACH

hSTEMSv,%$EACH

PHOTOVOLTAICCELLS DISSIPATORS


3OLAR4REE

,%$ Â&#x2019;

#ODE

4 4



##4 + +



7 #2) &LUX HEADS,%$ 774OT LMLM4OT STEMS,%$ 774OT ,IGHTINGUNITS CURVEDPOLES hSTEMSvANDBATTERIES 0OLESUPPORTSTRUCTURE BENCHES



)0POWERBOXANDPOLEHEADS )0BATTERYCOMPARTMENT

?


$IAMANTE #HARLES+ELLER $ANIEL-ARQUES !DRIAN3CHIESS 

s4HE$IAMANTEISALIGHTELEMENTTHATCANCREATELIGHTSCENESOFGREATVISUAL IMPACT DUETOTHEAVAILABILITYOFhDIAMONDSvOFDIFFERENTCOLORSORBYMEANS OFTHEUSEOFPRISMATICFILTERS s4HEVERTICALDROPCANBEREALIZEDWITHDIFFERENTCONFIGURATIONSOFTHENUMBER OFhDIAMONDSvANDHEIGHTS4HEOPTIONAL DYNAMICLIGHTCONTROLGIVESTHE INSTALLATIONAMAGICALANDMOVINGCHARACTER s%ACH$IAMANTECONSISTSOFADOUBLE FACED,%$CIRCUITBOARDANDAPRISMIN INJECTIONMOULDOF!"3 CONNECTEDBYMEANSOFASPECIALELECTRICALCABLE WITHHIGHRESISTANCEANDLIGHTNESSWHICHALLOWSTHEFLOWOFDATACONTROLAND ELECTRICALCURRENT s3PECIFICMOUNTINGANDCONNECTIONDEVICESGIVEAPPROPRIATEEASEFOR MOUNTINGANDMAINTENANCEOFTHESYSTEM


#HRISTMAS,IGHTING ,UZERN #(

?


#HRISTMAS,IGHTING :URICH #(


$IAMANTE

"ODYININJECTIONMOULDOF!"3 %LECTRICALCABLEWITHHIGHRESISTANCE TOWIND )0ELECTRICALCONNECTORS -ECHANICALJOINTSANDHOOKSIN STAINLESSSTEEL

7,%$  7

7EIGHT  KG

#OLOUR #ASCADEhDIAMANTIhTRANSPARENT #ASCADEhDIAMANTIhTRANSPARENTANDCOLOUR #ASCADEhDIAMANTIhMULTICOLOUR

6DCELECTRONICBALLAST

)0



4HEPRODUCTCANBECUSTOMIZEDTORESPONDTODIFFERENTPROJECTNEEDS&ORDEDICATEDQUOTATIONANDFURTHERENQUIRIES PLEASE CONTACT!RTEMIDESALESOFlCE





?


4ECHNICAL

?


(OWTOREADTHECATALOGUE

4HECAREFULNESSOF!RTEMIDEFORNEWTECHNOLOGIESANDFORTHEIMPROVEMENTOFITSPRODUCTSIMPLIESA CONTINUOUSUPDATINGOFTECHNICALINFORMATION &ORIN DEPTHANDDETAILEDPRODUCTSSPECIFICATIONS !RTEMIDERECOMMENDSTOREFERTOTHEWEBSITEAND !RTEMIDE#LOUDPLATFORM TOOLSTHATARECONSTANTLYUPDATED

WWWARTEMIDECOM CLOUDARTEMIDECOM

0RODUCTTABLE

"EAM ª

ª

$%6)#% ,5-)./53 &,58

,)'(4 $%6)#% #/,/2 #/,/2 4%-0%2!452%

&LUX LM

##4 +

LM

+

LM

+

LM

+

#OLOR

02/$5#4 #/$% 6%23)/.!

6!4%8#,5$%$ 02)#%3

02/$5#4 #/$% 6%23)/."

NONDIMMABLE

$ALI 3WITCH$IM

#ODE - - - - - - - -

#ODE - - - - - - - -

02/$5#40(/4/ )0$%'2%%/&02/4%#4)/. !002/6!,3 /2)%.4!4)/.!.$2/4!4)/.6!,5%3 3),(/5%44%

)0 ª

ª

ª

â&#x2C6;&#x2026;

Â&#x152; 

7 #2) 7EIGHT 7 MIN  KG

,5-)./53 "%!- /0%.).'



0/7%2 7%)'(4 7%)'(4 /&$%6)#%/&$%6)#%/&$%6)#%



Â&#x152;


+EY

Â&#x152; 

#LASS) $EVICEINWHICHELECTRICALSAFETYISPROVIDED BYANADDITIONALPROTECTIVECONDUCTOREARTH CONNECTEDTOTHEMETALFRAMEOFTHELAMP

2ATES



#LASSIFICATIONS



#LASS)) $EVICEINWHICHPROTECTIONAGAINSTELECTRICSHOCKS ISNOTPROVIDEDSOLELYBYTHEBASICINSULATION BUTWHICHHASADDITIONALSAFETYMEASURESSUCH ASDOUBLEORREINFORCEDINSULATION 4HESEMEASURESDONOTINVOLVEEARTHINGDEVICES ANDDONOTDEPENDONTHEINSTALLATIONCONDITIONS

#LASS))) $EVICEINWHICHPROTECTIONAGAINSTELECTRICSHOCKS ISBASEDONASAFETYEXTRA LOWVOLTAGEPOWER SOURCEANDINWHICHNOVOLTAGESGREATERTHAN THISCANBEGENERATED !CLASS)))DEVICEDOESNOTNEEDEARTHPROTECTION

!PPROVALS

%.%#CERTIFICATIONOF%UROPEANCONFORMITY

&EEDINGTENSION ,6 ,OW6OLTAGE #OMPONENTSELECTRIFIEDPLATES OPTIONALEXTENSIONS CABLESANDFEEDINGKITS WITH WIRECABLES SIGNAL AND6$#FEEDINGTENSION&EEDINGUNIT ANDCONTROLINTERFACESARENEEDEDINADDITION 'ENERALLYUSEDFOR2'",%$S WITHTHEEXCEPTION OF3TAND!LONEVERSIONS

-6 -EDIUM6OLTAGE #OMPONENTSELECTRIFIEDPLATES OPTIONALEXTENSIONS CABLESANDFEEDINGKITS WITH WIRECABLES .EUTRAL $IRECT,INE )NDIRECT,INE !UXILIARY,INE %ARTH $!,)AND$!,) AND6!#FEEDINGTENSION )FDIMMINGISREQUIRED ANEXTERNAL$!,)CIRCUIT COMPLETEWITH$!,)POWERSUPPLY GROUPCONTROLLER ANDSCENECONTROLLERISNEEDED5SEDFORFEEDING ANDDIMMINGFLUORESCENTLAMPS WHITE,%$S SPOTGROUPSAND2'"3TAND!LONE,%$VERSIONS

Â&#x152;

4HEDIAGRAMSSHOWNINTHISCATALOGUE AREEXPRESSEDINMILLIMETRES

)0DEGREEOFPROTECTION %LECTRICALFITTINGSAREDESIGNEDTOPREVENT THEINTRUSIONANDCONTACTOFSOLIDSANDLIQUIDS WITHLIVEPARTS 2ESISTANCETOTHEPENETRATIONOFSOLIDS ANDLIQUIDSISEXPRESSEDBYTHEACRONYM)0 FOLLOWEDBYTWODIGITSTHATSHOWTHEDEGREE OFPROTECTIONTHEFIRSTDIGITREFERS TOSOLIDBODIES THESECONDTOLIQUIDS &IRSTDIGIT  .OPROTECTION  0ROTECTEDAGAINSTTHEPENETRATION OFSOLIDBODIESLARGERTHANMM  0ROTECTEDAGAINSTTHEPENETRATION OFSOLIDBODIESLARGERTHANMM  0ROTECTEDAGAINSTTHEPENETRATION OFSOLIDBODIESLARGERTHANMM  0ROTECTEDAGAINSTTHEPENETRATION OFSOLIDBODIESLARGERTHANMM  0ROTECTEDAGAINSTDUST  4OTALLYDUST TIGHT 3ECONDDIGIT  .OPROTECTION  0ROTECTEDAGAINSTDRIPPINGWATER  0ROTECTEDAGAINSTDRIPPINGWATER UPTOªFROMTHEVERTICAL  0ROTECTEDAGAINSTRAIN  0ROTECTEDAGAINSTSPLASHINGWATER  0ROTECTEDAGAINSTWATERJETS  0ROTECTEDAGAINSTWAVES  7ATER TIGHTONIMMERSION  7ATER TIGHTONSUBMERSION

?


#HARACTERISTICSOF,%$ANDCOMPONENTS

!RTEMIDEALWAYSDEVELOPSITSPRODUCTSWITHSPECIALATTENTIONTOTHEmEXIBILITY OFUSINGALLPOSSIBLEINNOVATIONSINTHElELDOF,%$S-ANYARE INFACT AVARIETY OFCOMPONENTSAVAILABLEONTHEMARKET EACHWITHITSOWNSPECIALFEATURESAND SUITABLEFORDIFFERENTPURPOSES

!RTEMIDEMANUFACTURESITSCIRCUITSWITHPOWERSIGNALSINCONSTANTCURRENTOR CONSTANTVOLTAGE EQUIVALENTTOACONNECTIONINSERIESORINPARALLELTOTHEPRODUCTS RESPECTIVELY&ORTHECORRECTSELECTIONOFTHETRANSFORMERORPOWERSUPPLYREQUIREDTO OPERATETHELIGHTING WERECOMMENDYOUFOLLOWTHESEGUIDELINES

!RTEMIDEDESIGNSANDMANUFACTURESALLTHE,%$CIRCUITSREQUIREDTOTURNONTHE PRODUCTANDOPERATEITCORRECTLYOVERTIME INORDERTOPREVENTANYPROBLEMSAND QUICKLYREPAIRANYPOSSIBLEDEFECTS

0OWERCALCULATIONFORELECTRONICDRIVERWITHCONSTANTCURRENT 4OPROPERLYSELECTTHEDRIVERNECESSARYFORELECTRICALINSTALLATION ITISSUFlCIENTTO SUMUPTHEPOWERVALUESOFEACHlXTURE EXPRESSEDIN77ATT ASINDICATEDINTHE CATALOGUE ANDTOSELECTABALLASTWITHARATEDPOWERHIGHERTHANTHERESULTING TOTALPOWERVALUE X,INEA,%$7 6DC X77  7 0OWERSUPPLY4

!MONGTHEMOSTIMPORTANTTYPESOF,%$USEDARE sMM,%$ WHICHOFFERSTHEHIGHESTAVERAGELIFESPANWITHINTERMEDIATELIGHT LEVELS s3-$ ,%$ WHICHENABLESTHESIZETOBEMINIMISEDWHILEMAINTAININGGOODVALUES OFLUMINOUSmUX s0OWER,%$ CHARACTERISEDBYAWIDECHOICEOFPOWERANDLUMINOUSmUXANDHIGH LIFEEXPECTANCY sMULTI CHIP,%$ CHARACTERISEDBYHIGHPOWER UPTOOVER7PERMODULE WITH HIGHLUMINOUSmUX

0OWERCALCULATIONFORELECTRONICDRIVERWITHCONSTANTCURRENT 4OPROPERLYSELECTTHEDRIVERWITHCONSTANTCURRENTM! CHOOSETHE DRIVERFOLLOWINGTHEINDICATIONh.ª,%$MAXvINTHERELEVANTDRIVERTABLE X:ENO5P M! X,%$X7 0OWERSUPPLY.,

!RTEMIDEOFFERSTHEPOSSIBILITYOFUSINGDIMMABLESYSTEMS 6 053(BUTTON $!,) ORHOMEAUTOMATIONCONTROLANDLIGHTINGMANAGEMENTSYSTEMSBYMEANSOF SPECIlCDRIVERSORAD HOCSOLUTIONS4HEDIMMINGOFTHE,%$ALLOWSYOUTOCREATE USER CONTROLLEDLIGHTINGSCENARIOSANDADJUSTTHEBRIGHTNESSFORBETTERVIEWING COMFORT !RTEMIDEISABLETOCCUSTOMISEANDTAILORTHEIRPRODUCTSTOMEETTHEVARIOUS DESIGNREQUIREMENTS THANKSTOTHEELECTRONICCONTROLANDTHEmEXIBILITYINTHE CHOICEOF,%$4OREQUESTANYTYPEOFSPECIlCORSPECIALPROJECT YOUCANCONTACT OURTECHNICALDEPARTMENT

$RIVERS

#ONSTANTCURRENTDRIVERFORSERIESCONNECTIONINDOORUSE #ODE

$ESCRIPTION

66AC

)M!

07

.ª,EDMAX

,MM

7MM

.,

$RIVER7M!3,)-

 











(MM  INDIPUSE

.,

$RIVER7M!

 





 





 INDIPUSE

#ONSTANTCURRENTDRIVERFORSERIESCONNECTIONOUTDOORUSE #ODE

$ESCRIPTION

66AC

)M!

07

.ª,EDMAX

,MM

7MM

(MM

)02ATE

.,

$RIVER7M!

 



 

 







)0

.,

$RIVER7M!

 



 

 







)0

.,

$RIVER7M!

 



 

 







)0

.,

$RIVER7M!

 





 







)0

#ONSTANT POWERBALLASTSWITHPLASTICWRAPPERFORPARALLELCONNECTION #ODE

$ESCRIPTION

6IN6AC

6OUT6AC

06!

,MM

7MM

(MM

)02ATE

4

$RIVER76DC

 











)0

4

$RIVER76DC

 











)0

4

$RIVER76DC

 











)0


$RIVERS

3PECIlCATIONSFOR.AIADEAND.AIADEPOWERSUPPLY .UMBEROFFIXTURESWHICHCANBEINSTALLEDACCORDINGTO0OWER #ABLESECTION ,INELENGT %GO #ODE

%GO 0OWER

,INELENGTH

#ABLE  MM 

#ABLE  MM 

76DC

M







76DC

M







4

#ABLE MM 

#ODE

0OWER

,INELENGTH

#ABLE  MM 

#ABLE  MM 

4

76DC

M







76DC

M







M







76DC

M







76DC

76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







M







M







4

4

76DC

M







76DC

76DC

M







76DC

76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







,INELENGTH

#ABLE  MM 

#ABLE  MM 

4

#ABLE MM 

4

3PECIlCATIONSFOR2EEDS)0AND2EEDS)0TRIPLEPOWERSUPPLY .UMBEROFFIXTURESWHICHCANBEINSTALLEDACCORDINGTO0OWER #ABLESECTION ,INELENGT 2EEDS)0TRIPLE

2EEDS)0 #ODE

0OWER

,INELENGTH

4

#ABLE  MM 

#ABLE  MM 

#ABLE MM 

#ODE

4

#ABLE MM 

76DC

M







76DC

M





76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M





76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







76DC

M





76DC

M







76DC

M







76DC

M







76DC

M







76DC

M







4

0OWER



4

4

s-AXSURGESUPPORTEDBYTHEBALLASTSK6 s7ORKINGTEMPERATUREOFTHEBALLASTS ª# ª# s4HEBALLASTSMUSTNOTBEDIRECTLYEXPOSEDTO56 RAYS s7HENCALCULATINGSECTIONSLENGTHS ALLTHEFIXTURESSHOULDSUPPLIEDWITHPOWERATTHELINEEND s4HE)0CONNECTORSUPPLIEDWITHTHEFIXTURESISSUITABLEFORSECTIONSFROMTOMM s)NSULATIONCLASS))%ARTHINGISNOTREQUIRED

?


#ONSTANTCURRENTREGULATORS

$IMMABLECONSTANTCURRENTREGULATORSFORINDOORUSE #ODE

$ESCRIPTION

66AC

,MM

7MM

(MM

.,

#ONSTANTCURRENTREGULATORM!



)M! 

.ª,EDMAX  











 







.,

#ONSTANTCURRENTREGULATORM!





 











 







.,

#ONSTANTCURRENTREGULATORM!





 











 







.ª,EDMAX

$IMMABLECONSTANTCURRENTREGULATORSFOROUTDOORUSE #ODE

$ESCRIPTION

66AC

,MM

ŒMM

)02ATE

.,

#ONSTANTCURRENTREGULATORM!)0



)M! 

 





)0





 





)0

.,

#ONSTANTCURRENTREGULATORM!)0





 





)0





 





)0

.,

#ONSTANTCURRENTREGULATORM!)0





 





)0





 





)0

$RIVER 6DC IN6AC

2EGULATOR

2EGULATOR

2EGULATOR


2'"CONTROLSYSTEMS

!RTEMIDE$RIVERSANDCONTROLLERALLOWAmEXIBLEANDFULLYPROGRAMMABLEDYNAMIC LIGHTING3YSTEM4HE,%$$RIVERSARECOMPATIBLEWITHTHE53)44$-83TANDARD WHICHISASIMPLE RELIABLEANDECONOMICLIGHTMANAGEMENTANDCANBEEASILY INTERFACEDWITHMODERNDOMOTIC3YSTEMS4HE$-8DATALINESAREELECTRICALLY OPTO ISOLATEDTOENSURETHEMAXIMALRELIABILITYANDTOAVOIDDISTURBANCES

7IRINGDIAGRAMFOR2'",%$SYSTEMS2'"

$-8LIGHTINGCONTROLLER

,%$ $RIVER.,8  XX

2'",%$S

-AXDISTANCEMT MAXIMUMNªOFPRODUCTS DEPENDSONTHETOTALPOWER

$ATACABLE$-8

,%$ $RIVER.,8  XX

2'",%$S

MAXIMUMNªOFPRODUCTS DEPENDSONTHETOTALPOWER

$ATACABLE$-8

,%$ $RIVER.,8  XX

2'",%$S

MAXIMUMNªOFPRODUCTS DEPENDSONTHETOTALPOWER

?


#ONTROLLERS$-8

.,

$3#53"INTERFACE $-8STANDALONE

$ATA)N

$ATA/UT $-8CH

3CENES

$RIVER

53"

$-8

XSTANDALONE



  6DC M!EXCL $-8M8,2 53"

XX

 

53"

$-8

XLIVE



  6DC M!EXCL $-8M8,2 53"

XX

 

.,

6DCM!PLUG INPOWERSUPPLY-INI 53"

.,

CMCABLEWITH(%CONNECTORFORKEYBOARDOPTIONAL

$ATACABLE

,X7X(MM 7EIGHTKG

3TANDARD53" $-8h3TAND!LONEvINTERFACECHANNELS REAL TIMECLOCK ,OCALUSE SOFTWARE 53"CABLE,IVEMODEWITHACOMPUTER3TAND!LONEMODE 3CENESCANBETRIGGEREDINSEQUENTIALORUSINGEXTERNALPUSH BUTTONSTOTRIGGERFORINSTANCE3CENES5PONREQUESTCONNECTIONTOEXTERNALKEYBOARDOR TODOMOTICS3YSTEMS.EEDSANEXTERNALPOWERSUPPLYFORTHE3TAND!LONEMODE5PONREQUESTCONNECTIONTOEXTERNALKEYBOARDORTODOMOTICS3YSTEMS

.,

$3#53"%THERNET)NTERFACE

$ATA)N

$ATA/UT $-8CH

3CENES

$RIVER

%THERNET

$-8



  6DC M!EXCL $-8M8,2 %THERNET

.,

6DCM!PLUG INPOWERSUPPLY-INI 53"

X

$ATACABLE

,X7X(MM 7EIGHTKG XX

 

3TANDARD53"AND%THERNET$-8h3TAND!LONEv)NTERFACEXCHANNELS WITHSOFTWARE 53"CABLE $-8UNIVERSESINLIVEMODEWITHACOMPUTER NOTINCLUDED $-8UNIVERSESINSTAND ALONEMODE-ICROSD CARDMEMORYFORSTAND ALONEUSE DRYCONTACTTRIGGERPORTSVIA(%CONNECTORUPON REQUEST #LOCKCALENDARFUNCTION3TAND ALONEMODEWITHAREASANDSCENES7)&)REMOTECONTROLOPTIONWITHSMARTPHONETABLET)/3 !.$2/)$ 7INDOWS ,INUX TOTRIGGERSCENE3IMPLYCONNECTTOYOURWIRELESSLOCALNETWORK THE7)&)REMOTECONTROLAPPWILLAUTOMATICALLYlNDTHEINTERFACEANDALLOW YOUTOCONTROLIT!SECONDAPPLICATION COMPATIBLEWITHANY)/3AND!.$2/)$SMARTPHONESORTABLETS ALLOWSYOUTOEASILYCREATEORCHANGETHELIGHTING SURROUNDINGSINEACHAREA)NJUSTAFEWSTEPS YOULLBEABLETOTAKECONTROLOFALLYOUR$-8lXTURESINLIVE OR3TAND!LONEMODE4HESIMPLEAPPLICATION CANBEUSEDBYJUSTABOUTEVERYONEINANYSITUATION4HEINTERFACENEEDSANEXTERNALPOWERSUPPLYFORTHE3TAND!LONEMODE

.,

$3#53"'LASS4OUCH3ENSITIVE#ONTROL+EYPAD

$ATA)N

$ATA/UT $-8CH

3CENES

$RIVER

$ATACABLE

,X7X(MM 7EIGHTKG

53"

$-8



 6DC M!EXCL

2* 53"

XX

.,

6DCM!PLUG INPOWERSUPPLY



 

4HANKSTOTHEh!LL IN /NEvTECHNOLOGY THE$3#INCLUDESAHIGH TECHKEYPAD STAND ALONEMEMORYSTORAGEANDAPOWERFUL$-8LIGHTINGSOFTWARE PACKAGE )T OFFERS THE BEST SOLUTION FOR PROJECTS REQUIRING A LARGE AMOUNT OF SCENES ALONG WITH AN UNCLUTTERED AND INTUITIVE INTERFACE 4HE COMPUTER PROGRAMMABLE mATWALLMOUNTEDLIGHTINGCONTROLLERISIDEALFOR,%$ 2'"$-8LIGHTINGANDCAPABLEOFPLAYINGUPTOSCENES EACHOFWHICHCANBE MODIlEDBYTOUCHINGTHEMODEBUTTONTOCHANGETHEDIMMERANDCOLOR4HE,%$DISPLAYMAKESITEASYTOTELLWHICHSCENENUMBERISPLAYING4HEWALL PANELALLOWSITTOBEMOUNTEDONANYSINGLEGANGWALLSOCKETAROUNDTHEWORLD,ARGEMEMORYCAPACITY TOUCHSENSITIVEBUTTONS GLASSWALL MOUNTED $-8CONTROLLER-ICRO 53"FORPROGRAMMING&OR0# -AC4ABLETWITH53"BIT2-TECHNOLOGY SOFTWAREINCLUDED3TANDALONEOPERATION2EADYTO USEPRE LOADED 4HEINTERFACENEEDSANEXTERNALPOWERSUPPLYWHICHCANBEPLACEDINTHEGANGWALLSOCKET

.,

$3#53"INTERFACE $-8STANDALONE

$ATA)N

$ATA/UT $-8CH

3CENES

$RIVER

$ATACABLE

,X7X(MM 7EIGHTKG

53"

$-8



53"

M8,2

XX



 

4HE$3#PERMITSSYNCHRONISATIONOFLIGHTSCENARIOWITHAUDIOSIGNALBYMEANSOFTHESPECIlCINTERFACE4HISFEATUREMAKESITIDEALFORALLINSTALLATIONS WHERELIGHTMUSTACTTOGETHERWITHTHESOUNDTRACK5PTO$-8INTERFACESCANBECONNECTEDTOASINGLE53"HOSTCONTROLLERWITHOUTHAVINGANY FRAMERATELOSS FORAMAXIMUMOF$-8CHANNELS!VAILABLEWITHADVANCED,IGHT#ONTROL3OFTWARE CANBEFULLYSYNCHRONISEDPER$-8 ). !RT .ET 2EMOTE 2EMOTE(440 -)$)AND4OUCH3CREEN


$RIVERS,%$

,%$$RIVER.,8)0 #ODE

$ESCRIPTION

07

6IN

6OUT6DC

,X7X(MM

7EIGHTKG

.,

.,8 



 6AC



XX

 

.,

.,8 



 6AC



XX

 

.,

.,8 



 6DC

 

XX

 

.,

.,8 



 6AC



XX

 

.,

.,8 



 6AC



XX

 

,%$$RIVER.,8)0 #ODE

$ESCRIPTION

07

6IN

6OUT6DC

,X7X(MM

7EIGHTKG

.,

.,8 



 



XX

 

.,

.,8 



 



XX

 

.,

.,8 



 



XX

 

07-$RIVERFOR,%$UNITSWITHPRE INSTALLEDCOLOUR PROGRAMMESFORANINDEPENDENTSTAND ALONE-ODEOROPERATIONTHROUGHTHE$-8 PROTOCOL4HE$-8INTERFACEALLOWSLIGHTINGSYSTEMSOFANYSIZEANDCANBEEASILYINTEGRATEDWITHDOMOTIC3YSTEMS -AXDISTANCEBETWEEN,%$DRIVERAND2'"PRODUCTS &IXTURE

-AXDISTANCEFROMDRIVER

&IXTURE

-AXDISTANCEFROMDRIVER

3PIKE2'"

M

2IGA0LUS2'"

M

3PIKE)02'"

M

3TARLED2'"

M

3UPER3PIKE2'"

M

2IGA2'"

M

%XAMPLEOF7I &ICONTROLOFTHE2'"SYSTEM

7I &I.ETWORKWITH$3#AND$#3 !RT .ETTO$-8CONVERTERDIRECTLYWIRED VIAETHERNETTOA7I &I2OUTER

!PP!NDROID I0ODTOUCHI0HONE

,%$ $RIVER$-8COMPATIBLEEQUIPMENT

3PECIALDEVICESFORPROJECTS

#ODE

$ESCRIPTION

.,

3PLITTER$-8INTOOUT

$EVICEINORDERTOREALIZESTARWIRINGBETWEEN3YSTEMSDRIVER2'"ANDCONTROLLER$-8CABLECM8,2FEMALE CABLESCM8,2 MALEINCL3TANDARD2ACKXXMM 6AC CAM-AX CAM-AX CAM-AX CAM-AX $-8#ONTROLLER

CAM-AX

$-83PLITTER

CAM-AX CAM-AX CAM-AX CAM-AX

2'"3YSTEM 2'"3YSTEM 2'"3YSTEM 2'"3YSTEM 2'"3YSTEM 2'"3YSTEM 2'"3YSTEM 2'"3YSTEM

,IGHTINGMANAGEMENT $IMMER$!,) #ODE

$ESCRIPTION

3IGNAL

66DC

)!

07

,MM

7MM

.,

$IMMER$!,)

$!,) 0USH

 



MAX





(MM 

)0

.,

$IMMER-ASTER

$!,)  6 0USH

 



MAX







)0

.,

$IMMER3,!6% .,

$!,)  6 0USH

 



MAX







)0

?


0RESENCEANDBRIGHTNESSSENSORS

2OOMINUSE /PERATIONWITHMOVEMENTDETECTOR ANDDAYLIGHTCONTROL 4OCOMPLEMENTTHESTANDARDVERSIONSWITHOR WITHOUTADIMMER !RTEMIDE!RCHITECTURALIS SHOWCASINGTHE)NTERACTIVE $ALI ASYSTEMTHAT COMBINESPERSONALISEDCONTROLOFLIGHTING ENSURING OPTIMUMCONVENIENCEOFUSE ANDAUTOMATIC MANAGEMENTOFTHESWITCHINGONANDOFFCYCLESFOR ARATIONALUSEOFENERGY -ULTIPLEOPERATINGSITUATIONSCANBESETDUETOTHE INTEGRATIONOFINTERACTIVEANDADJUSTABLEELECTRONIC COMPONENTS SUCHASAMOVEMENTDETECTOR AMBIENT LIGHTSENSORANDINFRAREDRECEIVER 7ITH)NTERACTIVE $ALI LIGHTINGISACTIVATED AUTOMATICALLYWHENTHEROOMISINUSEANDTHEREIS NOTENOUGHNATURALLIGHT

%MPTYROOM 4IMEDLOWERINGOFLIGHTINTENSITY

$EPENDINGONPERSONALCHARACTERISTICSCLEARNESSOF VISION REQUIREDCONCENTRATION POSSIBLETIREDNESS ETC ORTHENATUREOFTHEACTIVITIESBEINGCARRIEDOUT PERSONALWORK MEETING VIDEOPROJECTION ETC THEUSERCANOPTIMISETHECOMFORTLEVELBYREGULATING THEAMOUNTOFLIGHT SIMPLYBYUSINGASWITCHORAN OPTIONALREMOTECONTROL!FTERTHISSIMPLESETTING THESYSTEMWILLAUTOMATICALLYMANAGETHEOPERATION OFTHEDEVICETOKEEPTHEAMOUNTOFLIGHTCONSTANT ACCORDINGTOTHEDAYLIGHT 7HENTHEROOMISNOTBEINGUSED THELIGHTIS AUTOMATICALLYLOWEREDANDTHENSWITCHEDOFFBYA PROGRAMMABLETIMER

%MPTYROOM #OMPLETESWITCHOFF


)NTERACTIVE $ALITECHNOLOGYISUSEDINSTAND ALONEDEVICES INSOMEDEVICESBELONGINGTO THESAMEFAMILYCONNECTEDTOEACHOTHEROR TOEXTERNAL)NTERACTIVE $ALICOMPONENTSSUCH ASASUPPLEMENTARYMOVEMENTDETECTOR .O INTERCONNECTIONISTHEREFOREREQUIREDTOA$ALI SYSTEMALREADYINTHEROOM -AINADVANTAGES (IGHLEVELOFPERSONALISEDOPERATIONh0LUGANDPLAYv CONNECTIONWITHOUTTHENEEDTOCHANGETHEEXISTING ELECTRICALSYSTEM/PTIONTOMANAGEUPTOTENDEVICES WHICHMAYBEDIVIDEDINTOTWOGROUPS%NERGYSAVINGS WILLBRINGARETURNONTHEINVESTMENT

  

)NTERACTIVE$ALI$EVICES 4HEMASTERMODULEFITTEDWITH THE)NTERACTIVE $ALISYSTEM CAN BECONNECTEDTOUPTOOTHER DIMMABLE$ALIDEVICES)TISOPERATED BYAN)NTERACTIVE $ALIREMOTECONTROL ORANEXTERNALORINTEGRATEDBUTTON

)NFRAREDDETECTOR  $AYLIGHTSENSOR -OVEMENTDETECTOR 3ERVICEBUTTON FORPROGRAMMESELECTION 

$ALI$EVICES

)NTERACTIVE $ALICOMPONENTS )NTERACTIVE $ALIKIT Â&#x152;MM

WHITE RECESSED #ANBECONNECTEDTOUPTO DIMMABLE$ALIUNITS )TISOPERATEDBYAN)NTERACTIVE $ALI REMOTECONTROLORBUTTON

#ODE -

&ORPRODUCTSWITHA$IMMABLE $ALI POWERSUPPLYUNIT ANEXTERNAL )NTERACTIVE $ALIKITCANBEUSED WHICHCANBEFITTEDINTOTHECEILING 4HISKITCANCONTROLUPTO$ALI DEVICESSLAVEMODULES )TIS OPERATEDBYAN)NTERACTIVE $ALI REMOTECONTROLORBUTTON

â&#x2C6;&#x2026;MM 3UPPLEMENTARYMOVEMENTDETECTOR WHITE RECESSED &ORUSEWHENTHEAREATOBECOVEREDIS GREATERTHANXMXHM 4OBECONNECTEDTOONEOFTHEOUTPUTS OFTHE)NTERACTIVE $ALICONTROLMODULE .OFURTHERCONNECTIONSARENEEDED

-

â&#x2C6;&#x2026;MM )NTERACTIVE $ALIREMOTECONTROL

-

?


#ODESINDEX

!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!!



!"



!$



!$



!&



!&



!&



!



!"



!"



!$



!$



!&



!&



!&



!



!"



!"



!$



!$



!&



!&



!&



!



!"



!"



!$



!$



!&



!&



!&



!



!"



!"



!$



!$



!&



!&



!&



!



!"



!"



!$



!$



!&



!&



!&



!



!"



!"



!$



!$



!&



!&



!&



!



!"



!"



!$



!$



!&



!&



!&



a!



!"



!"



!$



!$



!&



!&



!&



e!



!"



!"



!$



!$



!&



!&



!&



!!



!"



!"



!$



!$



!&



!&



!&



!%!



!"



!"



!$



!%



!&



!&



!&



"!



!"



!"



!$



!%



!&



!&



!&



#!



!"



!"



!$



!%



!&



!&



!&



$!



!"



!"



!$



!%



!&



!&



!&



%!



!"



!"



!$



!%



!&



!&



!&



&!



!"



!"



!$



!%



!&



!&



!&



'!



!"



!"



!$



!%



!&



!&



!&



(!



!"



!"



!$



!%



!&



!&



!&



)!



!"



!"



!$



!%



!&



!&



!&



*!



!"



!"



!$



!%



!&



!&



!&



+!



!"



!"



!$



!%



!&



!&



!&



,!



!"



!"



!$



!%



!&



!&



!&



-!



!"



!"



!$



!%



!&



!&



!&



.!



!"



!"



!$



!%



!&



!&



!&



/!



!"



!"



!$



!%



!&



!&



!&



0!



!"



!"



!$



!%



!&



!&



!&



1!



!"



!"



!$



!%



!&



!&



!&



2!



!"



!"



!$



!%



!&



!&



!&



3!



!"



!"



!$



!%



!&



!&



!&



4!



!"



!"



!$



!%



!&



!&



!&



5!



!"



!"



!$



!%



!&



!&



!&



6!



!"



!"



!$



!%



!&



!&



!&



7!



!"



!"



!$



!%



!&



!&



!&



8!



!"



!"



!$



!%



!&



!&



!&



9!



!"



!"



!$



!%



!&



!&



!&



:!



!"



!"



!$



!%



!&



!&



!&



a!



!"



!"



!$



!%



!&



!&



!&



e!



!"



!"



!$



!%



!&



!&



!&



A!



!"



!"



!$



!%



!&



!&



!&



AE!



!"



!"



!$



!%



!&



!&



!'



B!



!"



!"



!$



!%



!&



!&



!'



C!



!"



!"



!$



!%



!&



!&



!'



D!



!"



!"



!$



!%



!&



!&



!'



E!



!"



!"



!$



!%



!&



!&



!'



F!



!"



!"



!$



!%



!&



!&



!'



G!



!"



!"



!$



!%



!&



!&



!'



H!



!"



!"



!$



!%



!&



!&



!'



I!



!"



!"



!$



!%



!&



!&



!'



J!



!"



!"



!$



!%



!&



!&



!'



K!



!"



!"



!$



!%



!&



!&



!'



L!



!"



!"



!$



!%



!&



!&



!'



M!



!"



!"



!$



!%



!&



!&



!'



N!



!"



!"



!$



!%



!&



!&



!'



O!



!"



!"



!$



!%



!&



!&



!'



P!



!"



!$



!$



!%



!&



!&



!'



Q!



!"



!$



!$



!%



!&



!&



!(



R!



!"



!$



!$



!%



!&



!&



!(



S!



!"



!$



!$



!%



!&



!&



!(



T!



!"



!$



!$



!%



!&



!&



!(



U!



!"



!$



!$



!%



!&



!&



!(



V!



!"



!$



!$



!%



!&



!&



!(



W!



!"



!$



!$



!%



!&



!&



!)



X!



!"



!$



!$



!%



!&



!&



!)



Y!



!"



!$



!$



!%



!&



!&



!)



Z!



!"



!$



!$



!%



!&



!&



!)



!



!"



!$



!$



!%



!&



!&



!)



!



!"



!$



!$



!&



!&



!&



!*



!



!"



!$



!$



!&



!&



!&



!*



!



!"



!$



!$



!&



!&



!&



!*



!



!"



!$



!$



!&



!&



!&



!*



!



!"



!$



!$



!&



!&



!&



!*



!



!"



!$



!$



!&



!&



!&



!*



!



!"



!$



!$



!&



!&



!&



!*



!



!"



!$



!$



!&



!&



!&



!+



!



!"



!$



!$



!&



!&



!&



!+



!



!"



!$



!$



!&



!&



!&



!+



!!



!"



!$



!$



!&



!&



!&



!+



!!



!"



!$



!$



!&



!&



!&



!+




#ODESINDEX

!+



!0



!1



!4



$$$!

$')!



,



!+



!0



!1



!4



$$$!7 

$$,$3 

$')"7



,



!+



!0



!1



!4



$$$!



$$,$37

$')"9



,



!+



!0



!1



!4



$$$!7 

$$,$7 

$')"7



,



!+



!0



!1



!4



$$$"

$')"9



,



!+



!0



!2



!4



$$$"7 

$$,$3 

$')"7



,



!+



!0



!2



!4



$$$"



$$,$37

$')"9



,



!-



!0



!2



!4



$$$"7 

$$,$7 

$')"7



,



!-



!0



!2



!4



$$$"



$$,$3 

$')"9



,



!-



!0



!2



!4



$$$"7 

$$,$37

$')"7



,



!-



!0



!2



!4



$$$#



$$,$3 

$')"9



,



!-



!0



!2



!4



$$$#7 

$$,$37

$')"7



,



!-



!0



!2



!4



$$$#



$$,$3 

$')"9



,



!.



!0



!2



!4



$$$#7 

$$,$37

$')#7



,



!.



!0



!2



!4



$$$#



$$,$" 

$')#9



,



!.



!0



!2



!4



$$$#7 

$$,$"7

$')#7



,



!.



!0



!2



!4



$$'!



$$,$3 

$')#9



,



!.



!0



!2



!4



$$'!7 

$$,$37

$')$



,



!.



!0



!2



!4



$$'!



$$,$" 

$')$7



,



!.



!0



!2



!4



$$'!7 

$$,$"7

$')$9



,



!.



!0



!2



!4



$$'!



$$,$3 

$')$



,



!.



!0



!2



!4



$$'!7 

$$,$37

$')$7



,



!.



!0



!2



!4



$$'"



$$,$" 

$')$9



,



!.



!0



!2



!4



$$'"7 

$$,$"7

$')%$



,



!.



!0



!2



!4



$$'"



$$,$3 

$')%$



,



!.



!0



!2



!4



$$'"7 

$$,$37

$')&



,



!.



!0



!2



!4



$$'"



$$,&2



$')&



,



!.



!0



!2



!4



$$'"7 

$$,&2



$')'



,



!.



!0



!2



!4



$$'#

$$9$

!.



!0



!2



!4



$$'#7 

!.



!0



!2



!4



$$'#

!.



!0



!2



!4



$$'#7 

!.



!0



!2



!4



$$'#

!.



!0



!2



$$"! 

$$'#7 

!.



!0



!2



$$"!7

$$'!

!.



!0



!2



$$"! 

$$'!7 

!.



!0



!2



$$"!7

$$'!

!.



!0



!4



$$"! 

$$'!7 

!.



!0



!4



$$"!7

$$'!

!.



!0



!4



$$"" 

$$'!7 

!.



!0



!4



$$""7

$$'"

!.



!0



!4



$$"" 

$$'"7 

!.



!1



!4



$$""7

$$'"

!.



!1



!4



$$"" 

$$'"7 

!.



!1



!4



$$""7

$$'"

!.



!1



!4



$$"# 

$$'"7 

!.



!1



!4



$$"#7

$$'#



$$:$

!.



!1



!4



$$"# 

$$'#



!.



!1



!4



$$"#7

$$'#7 

!.



!1



!4



$$"# 

$$'#

!.



!1



!4



$$"#7

$$'#7 

$$:$

!.



!1



!4



$$"! 

!.



!1



!4



$$"!7

!.



!1



!4



!.



!1



!4

!.



!1



!4

!.



!1



!.



!1

!.



!.





    

$$,$

$$,$







$')'



,



$$9$7 

$')(



,





$')(



,



$$9$7 

$-:!! 

,





$-:!! 

,



$$9$7 

$-:!! 

,





$-:#! 

,



$$9$7 

$-:#! 

,





$-:#! 

,



$$9$ $$9$ $$9$ $$9$

$2,!



,





$2,!"



,



$$9$7 

$2,!.



,





$2,!"



,



$$:$7 

$2,!+! 

,





$2,!+! 

,



$$:$7 

$2,!+! 

,





$2,!+! 

,



$$:$7 

$2,!+" 

,





$2,!+" 

,



$$:$7 

$2,!+" 

,





$2,!+" 

,



$$:$7 

$2,!+# 

,





$2,!+# 

,



$$'#7 

$$:$7 

$2,!+# 

,



$$)$



$$!!# 

$2,!+# 

,



$$"! 

$$)$3



$$!!#7

$2,!+4#

,





$$"!7

$$)$37 

$$!!, 

$2,!+4#"

,





$$"! 

$$)$7 

$$!!,7

$2,!+4#.

,



!4



$$"!7

$$)$



$$!!# 

$2,!+4#"

,





!4



$$"" 

$$)$3



$$!!#7

$2,!+4#

,



!1



!4



$$""7

$$)$37 

$$!!, 

$2,!+4#"

,





!1



!4



$$"" 

$$)$7 

$$!!,7

$2,!+4#.

,



!.



!1



!4



$$""7

$$)$



$$!!# 

$2,!+4#"

,



!0



!1



!4



$$"" 

$$)$3



$$!!#7

$2,!40# 

,



!0



!1



!4



$$""7

$$)$37 

$$!!, 

$2,!40# 

,



!0



!1



!4



$$"# 

$$)$7 

$$!!,7

$2,!40# 

,



!0



!1



!4



$$"#7

$$)$3



$$!!# 

$2,"



,



!0



!1



!4



$$"# 

$$)$37 

$$!!#7

$2,""



,



!0



!1



!4



$$"#7

$$)$3



$$!!, 

$2,""



,



!0



!1



!4



$$"# 

$$)$37 

$$!!,7

$2,".



,



!0



!1



!4



$$"#7

$$)$3



$$!!# 

$6



,



!0



!1



!4



$$$! 

$$)$37 

$$!!#7

$6



,



!0



!1



!4



$$$!7

$$)$"



$$!!, 

$6



,



!0



!1



!4



$$$! 

$$)$"7 

$$!!,7

$6



,



!0



!1



!4



$$$!7

$$)$3



$$!!# 

$6



,



!0



!1



!4



$$$! 

$$)$37 

$$!!#7

$6



,



!0



!1



!4



$$$!7

$$)$"



$$!!, 

$6



,



!0



!1



!4



$$$" 

$$)$"7 

$$!!,7

$6



,



!0



!1



!4



$$$"7

$$)$3



$$!!# 

$6



,



!0



!1



!4



$$$" 

$$)$37 

$$!!#7

,



,



!0



!1



!4



$$$"7

$$)$"



$$!!, 

,



,



!0



!1



!4



$$$" 

$$)$"7 

$$!!,7

,



,



!0



!1



!4



$$$"7

$$)$3



$$!!# 

,



,



!0



!1



!4



$$$# 

$$)$37 

$$!!#7

,



,



!0



!1



!4



$$$#7

$$)#,4



$$!!, 

,



,



!0



!1



!4



$$$# 

$$)&2



$$!!,7

,



,



!0



!1



!4



$$$#7

$$)&2



$$!!# 

,



,



!0



!1



!4



$$$# 

$$,$



$$!!#7

,



,



!0



!1



!4



$$$#7

$$,$3 

$$!!, 

,



,



!0



!1



!4



$$$! 

$$,$37

$$!!,7

,



,



!0



!1



!4



$$$!7

$$,$7 

$')!

,



,

   



$$9$7  $$9$ $$:$ $$:$ $$:$

$$:$





?


#ODESINDEX

,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-.



-



-



-



-



,



-



-



-.



-



-



-



-



,



-



-



-.



-



-



-



-



,



-



-



-.



-



-



-



-



,



-



-



-.



-



-



-



-



,



-



-



-.



-



-



-



-



,



-



-



-7



-



-



-



-



,



-



-



-7



-



-



-



-



,



-



-



-7



-



-



-



-



,



-



-



-7



-



-



-



-



,



-



-



-7



-



-



-



-



,



-



-



-7



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-.



-



-



-



-



,



-



-



-.



-



-



-



-



,



-



-



-7



-



-



-



-



,



-



-



-7



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



,



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-.



-



-



-



-



-



-



-



-7



-



-



-



-



-



-



-



-.



-



-



-



-



-



-



-



-7



-



-



-



-



-



-



-



-.



-



-



-



-



-



-



-



-7



-



-



-



-



-



-



-



-.



-



-



-



-



-



-



-



-7



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-




#ODESINDEX

-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-.



-



-



-



-



-



-



-



-7



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



-



?


#ODESINDEX

-



-7



-.



-.



-



-



-



.,+

-



-7



-7



-7



-



-



.,



.,9

-



-.



-



-7



-



-



.,



.,9

-



-.



-



-7



-



-



.,



.,9

-



-7



-



-.



-



-



.,



.,+

-



-7



-



-.



-



-



.,



.,+

-



-.



-



-.



-



-



.,



.,+

-



-.



-



-7



-



-



.,



.,9

-



-7



-



-7



-



-



.,



.,9

-



-7



-



-7



-



-



.,



.,9

-



-.



-



-



-



-



.,



.,+

-



-.



-



-



-



-



.,



.,+

-



-7



-



-



-



-



.,64+



.,+

-



-7



-



-



-



-



.,64+



.,9

-



-.



-



-



-



-



.,



.,9

-



-.



-



-



-



-



.,64+



.,9

-



-7



-



-&,7



-



-



.,64+



.,+

-



-7



-



-&,7



-



-



.,



.,+

-



-.



-



-7&,7 

-



-



.,



.,+

-



-.



-



-7&,7 

-



-



.,+

.,9

-



-7



-



-7



-



-



.,+

.,9

-



-7



-



-7



-



-



.,+

.,9

-



-.



-



-7



-



-



.,+

.,+

-



-7



-



-7



-



-



.,+

.,+

-



-.



-



-7



-



-



.,+

.,+

-



-7



-



-7



-



-



.,+

.,9

-



-.



-



-7



-



-



.,+

.,9

-



-7



-



-7



-



-



.,+

.,9

-



-



-



-7



-



-



.,+

.,+

-



-



-



-7



-



-



.,+

.,+

-



-



-



-7



-



-



.,+

.,+

-



-



-



-7



-



-



.,+

.,9

-



-



-



-7



-



-



.,+

.,9

-



-



-



-7



-



-



.,+

.,9

-



-



-



-7



-



-



.,+

.,+

-



-



-



-7



-



-



.,+

.,+

-



-



-



-7



-



-



.,+

.,+

-



-



-



-7



-



-



.,+



.,9

-



-



-



-7



-



-



.,7



.,9

-



-



-



-7



-



-



.,+



.,9

-



-



-



-



-



-



.,+



.,+

-



-



-



-



-



-



.,%,+



.,+

-



-



-



-



-



-



.,+



.,+

-



-



-



-



-



-



.,+



.,9

-



-



-.



-



-



-



.,%,+



.,9

-



-



-.



-



-



-



.,+



.,9

-



-



-.



-



-



-



.,+



.,+

-7



-



-.



-



-



-



.,%,+



.,+

-7



-



-7



-



-



-



.,+



.,+

-7



-



-7



-



-



-



.,+



.,9

-7



-



-7



-



-



-



.,%,+



.,9

-7



-



-7



-



-



-



.,+



.,9

-7



-



-.



-



-



-



.,+



.,+

-7



-



-.



-



-



-



.,%,+



.,+

-7



-



-7



-



-



-



.,+



.,+

-7



-



-7



-



-



-



.,+



.,9

-7



-



-



-



-



-



.,%,+



.,9

-7



-.



-



-



-



-



.,+



.,9

-7



-.



-



-



-



-



.,+



.,+

-7



-.



-



-



-



-



.,%,+



.,+

-7



-.



-



-



-



-



.,+



.,+

-7



-7



-



-



-



-



.,+



.,9

-7



-7



-



-



-



-



.,%,+



.,9

-7



-7



-



-



-



-



.,



.,9

-7



-7



-



-



-



-



.,



.,+

-.



-.



-



-



-



-



.,



.,+

-.



-.



-



-



-



-



.,



.,+

-7



-.



-7



-



-



-



.,



.,9

-7



-.



-7



-



-



-



.,



.,9

-.



-7



-7



-



-



-



.,



.,9

-.



-7



-7



-



-



-



.,



.,+

-7



-7



-7



-



-



-



.,



.,+

-7



-7



-7



-



-



-



.,



.,+

-.



-.



-7



-



-



-



.,



.,9

-.



-.



-7



-



-



-



.,



.,9

-7



-7



-.



-



-



-



.,



.,9

-7



-7



-.



-



-



-



.,



.,+

-.



-.



-.



-



-



-



.,



.,+

-.



-.



-7



-



-



-



.,



.,+

-7



-7



-7



-



-



-



.,



.,9

-7



-7



-7



-



-



-



.,



.,9

-



-.



-.



-



-



-



.,+

.,9

-



-7



-.



-



-



-



.,+

.,+

-



-.



-.



-



-



-



.,+

.,+

-



-.



-7



-



-



-



.,9

.,+

-



-7



-7



-



-



-



.,9

.,9

-



-7



-7



-



-



-



.,9

.,9

-.



-.



-.



-



-



-



.,+

.,9

-.



-7



-.



-



-



-



.,+

.,+


#ODESINDEX

.,+

.,+

.,



4



4.307 

4%,047 

4%,(



47&,7 

.,+

.,9

.,



4



47&,7 

4.307 

4%,.



4%,047

.,9

.,9

.,



4



4%,047

47&,7 

47



4.307 

.,9

.,9

.,



4



4.307 

4%,047 

47



47&,7 

.,9

.,+

.,



4



47&,7 

4.307 

4%,7



4%,047

.,+

.,+

.,



4



4%,047

47&,7 

47



4.307 

.,+

.,+

.,



4



4.307 

4



47



47&,7 

.,+

.,9

.,



4



47&,7 

4



47



4%,047

.,9

.,9

.,



4



4%,047 

4



47



4.307 

.,9

.,9

.,



4



4307



4



47



47&,7 

.,9

.,+

.,



4



47&,7 

4



47



4%,047

.,



.,+

.,



4



4%,047

4



47



4.307 

.,



.,+

.,



4



4.307 

4



47



47&,7 

.,



.,9

.,



4



47&,7 

4



47



4%,047

.,



.,9

4



4



4%,047 

4



47



4.307 

.,



.,9

4



4



4307



4



4%,7



47&,7 

.,+

.,+

4



4



47&,7 

4



4%,7



4%,047

.,+

.,+

4



4



4%,047 

4



47



4.307 

.,+

.,+

4



4



4&,7



4



47



47&,7 

.,+

.,9

4



4



4307



4



47



4.,7



.,%,+ 

.,9

4



4



4%,047 

4



47



4.,7



.,%,+ 

.,9

4



4



4&,7



4



4%,7



4.,7



.,+

.,+

4



4



4307



4



4%,7



4%,047

.,+

.,+

4



4



4%,047 

4



4.,7



4.307 

.,+

.,+

4



4



4.307 

4



4.,7



47&,7 

.,+

.,9

4



4



47&,7 

4



4.7



4,7



.,%,+ 

.,9

4



4



4%,047 

4%,047 

4.7



4,7



.,%,+ 

.,9

4



4



4.307 

4.307 

4.7



4,7



.,64+

.,63+



4



4



47&,7 

47&,7 

4.7



4.7



.,64+

.,63+



4



4



4%,047 

4%,047 

4,7



4.7



.,64+

.,



4



4



4307



4.307 

4,7



4.7



.,64+

.,



4



4



47&,7 

47&,7 

4.7



4,7



.,64+

.,(



4



4



4%,047 

4%,047 

4.7



4,7



.,64+

.,+

4



4



4307



4.307 

4.7



4,7



.,(



.,+

4



4



47&,7 

47&,7 

4.7



4.7



.,(



.,+

4



4



4%,047 

4%,047 

4,7



4.7



.,(



.,9

4



4



4&,7



4.307 

4,7



4.7



.,(



.,9

4



4



4307



47&,7 

47



4,7



.,(



.,9

4



4



4%,047 

4%,047 

47



4,7



.,(



.,+

4



4



4&,7



4.307 

4%,047

4,7



.,(



.,+

4



4



4307



47&,7 

4307 

4.7



.,(



.,+

4



4



4%,047 

4%,047 

47&,7 

4.7



.,(



.,9

4



4



4.307 

4.307 

4%,047

4.7



.,(



.,9

4



4



47&,7 

47&,7 

4307 

4.,7



.,(



.,9

4



4



4%,047 

4%,047 

47&,7 

4.,7



.,+

.,+

4



4



4.307 

4.307 

4%,047

4.,7



.,+

.,+

4



4



47&,7 

47&,7 

4&,7



4,7



.,+

.,+

4



4



4%,047 

4%,047 

4307 

4,7



.,9

.,9

4



4



4307



4.307 

4%,047

4,7



.,9

.,9

4



4



47&,7 

47&,7 

4&,7



4.7



.,9

.,9

4



4



4%,047 

47



4,7



4.7



.,+

.,+

4



4



4307



47



4,7



4.7



.,+

.,+

4



4%,047

47&,7 

47



4,7



47



.,+

.,+

4



4307 

4%,047 

47



4.7



47



.,9

.,9

4



47&,7 

4&,7



47



4.7



4%,7



.,9

.,9

4



4%,047

4307



47



4.7



47



.,9

.,9

4



4307 

4%,047 

47



4307 

47



.,+

.,#

4



47&,7 

4&,7



47



4%,047

4%,7



.,+

.,#

4



4307 

4307



47



4.307 

47



.,+

.,#

4



47&,7 

4%,047 

47



47&,7 

47



.,9

.,%,#

4



47&,7 

4.307 

47



4%,047

4%,7



.,9

.,



4



4%,047

47&,7 

47



4.307 

47



.,9

.,



4



4307 

4%,047 

47



47&,7 

47



.,+

.,



4



47&,7 

4.307 

47



4%,047

4%,7



.,+

.,



4



4%,047

47&,7 

47



4.307 

47



.,+

.,



4



4&,7



4%,047 

47



47&,7 

47



.,9

.,+



4



4307 

4.307 

47



4%,047

47



.,9

.,+



4



4%,047

47&,7 

47



4.307 

47



.,9

.,%,+



4



4&,7



4%,047 

47



47&,7 

47



.,+

.,+



4



4307 

4.307 

47



4%,047

47



.,+

.,+



4



4%,047

47&,7 

47



4307 

47



.,+

.,+



4



4&,7



4%,047 

47



47&,7 

47



.,9

.,+



4



4307 

4307



47



4%,047

4



.,9

.,+



4



4%,047

47&,7 

47



4307 

4



.,9

.,+



4



4&,7



4%,047 

47



47&,7 

4



.,+

.,63+



4



4307 

4307



47



4%,047

4



.,+

.,63+



4



4%,047

47&,7 

47



4&,7



4



.,+

.,



4



4.307 

4%,047 

47



4307 

4



.,9

.,#



4



47&,7 

4&,7



47



4%,047

4



.,9

.,#



4



4%,047

4307



4%,7



4&,7



4&,7



.,9

.,#



4



4.307 

4%,047 

4%,7



4,7



4&,7



.,+

.,#



4



47&,7 

4&,7



47



4,7



47&,7 

.,+

.,#



4



4%,047

4307



47



4,7



47&,7 

.,+

.,#



4



4.307 

4%,047 

47



4.7



47



.,9

.,



4



47&,7 

4.307 

47



4.7



47



.,9

.,



4



4%,047

47&,7 

4%,7



4.7



4%,047 

.,9

.,



4



4.307 

4%,047 

4%,7



4307 

4&,7



.,+

.,



4



47&,7 

4.307 

47



4%,047

4307



.,+

.,



4



4%,047

47&,7 

47



4.307 

?


(EADQUARTERS !RTEMIDE3P! 6IA"ERGAMO  0REGNANA-ILANESE-) )TALY 4EL   .UMEROVERDE FROM)TALYONLY INFO ARTEMIDECOM WWWARTEMIDECOM #OMMUNICATIONAND-ARKETING $EPARTMENT 6IA#ANOVA  -ILAN-) )TALY 4EL  COMMUNICATION ARTEMIDECOM WWWARTEMIDECOM

%UROPE

)TALY

(EADOFFICE !RTEMIDE)TALIASRL 6IA"ERGAMO 0REGNANA-ILANESE-) 4EL  4EL  .UMERO6ERDE ARTEMIDEITALIA ARTEMIDECOM

-ILANO-ONFORTE3HOWROOM #ORSO-ONFORTE -ILANO 4EL  4EL  MONFORTE ARTEMIDECOM -ILANO-ANZONI3HOWROOM 6IA-ANZONI -ILANO 4EL  4EL  MANZONI ARTEMIDECOM -ILANO$ANESE3HOWROOM 0IAZZA3AN.AZAROIN"ROLO -ILANO 4EL  SHOWROOMDANESE ARTEMIDECOM 2OMA-ARGUTTA3HOWROOM 6IA-ARGUTTA 2OMA 4EL  4EL  MARGUTTA ARTEMIDECOM 4REVISO3HOWROOM 6IA#AMPANA ANG0IAZZA3AN&RANCESCO 4REVISO 4EL  TREVISO ARTEMIDECOM

-ILANO,IGHTING#ONSULTANCY #ENTER 6IA-ANZONI -ILANO 4EL  4EL  MANZONILIGHTING ARTEMIDECOM 2OMA,IGHTING#ONSULTANCY #ENTER 6IA0ISANELLI 2OMA 4EL  PISANELLI ARTEMIDECOM

&ORINFORMATIONREGARDINGDISTRIBUTORS ANDPOINTSOFSALEINCOUNTRIESNOT LISTEDINTHESEPAGES PLEASEVISIT OURWEBSITEARTEMIDECOMOREMAIL INFO ARTEMIDECOM

!LBANIA 0RINCIPALDEALER !"I%SSE 3UPERSTRADA4IRANE $URRESKM 9RSHEK 4IRANE 4EL  INFO ABIESSEAL !USTRIA (EADOFFICEAND3HOWROOM !RTEMIDE(ANDELSGESELLSCHAFTMB( 'ONZAGAGASSE-ORZINPLATZ 7IEN 4EL  INFO ARTEMIDEAT !ZERBAIJAN 0RINCIPALDEALER 3TUDIO 0ORT"AKU2ESIDENCE 5ZEYIR(ACIBEYOVSTR "AKU 4EL  STUDIO OFFICEAZ "ENELUX "ELGIUM(OLLAND,UXEMBURG (EADOFFICE (ORAS3! "EEMDSTRAAT 2UISBROEK "ELGIUM 4EL  ARTEMIDE?BENELUX ARTEMIDECOM "RUSSELSSHOWROOM AND,IGHTING#ONSULTANCY#ENTER #HAUSSÏEDE7ATERLOO "RUSSELS "ELGIUM 4EL  ARTEMIDEBRUSSELS SKYNETBE !MSTERDAMSHOWROOM AND,IGHTING#ONSULTANCY#ENTER (OBBEMAKADE 82!MSTERDAM(OLLAND 4EL  ARTEMIDEAMSTERDAM ARTEMIDENL "OSNIAAND(ERZEGOVINA 3ALES/FFICES !RTEMIDE3P! 6IA"ERGAMO  4EL  4EL  INFO ARTEMIDECOM "ULGARIA 3ALES/FFICES !RTEMIDE3P! 6IA"ERGAMO  4EL  4EL  INFO ARTEMIDECOM


#ZECH2EPUBLIC 0RINCIPALDEALER 3ELENESPOLSRO .EUMANNOVA 0RACHATICE 4EL  SELENE IOLCZ 3HOWROOM -YSLIKOVA 0RAHA

3HOWROOM 3AZAVSKA 6INOHRADY0RAHA

'REECE (EADOFFICE !RTEMIDE(ELLAS3!  3OLONOS3T !THENS 4EL  INFO ARTEMIDEGR

#ROATIA 3ALES/FFICES !RTEMIDE3P! 6IA"ERGAMO  4EL  4EL  INFO ARTEMIDECOM

.ORTH'REECE"RANCH/FFICES 3HOWROOM  '0APANDREOU3T 4HESSALONIKI 4EL  THESSALONIKI ARTEMIDEGR

%STONIA 0RINCIPALDEALER ,ATERNA-AGICA +REUTZWALDI 4ALLIN 4EL  INFO LATERNAEE &RANCE (EAD/FFICEAND3HOWROOM !RTEMIDE&RANCE3!3  AVENUE$AUMESNIL 0ARIS 4EL  ARTEMIDE ARTEMIDEFR &INLAND (EAD/FFICE !RTEMIDE3CANDINAVIA!3 3KUDEHAVNSVEJ $+ #OPENHAGEN 4EL  INFO ARTEMIDEDK

-àNCHEN/FFICE ,UISE 5LLRICH 3TRA”E -àNCHEN 4EL  MUENCHEN ARTEMIDEDE &RANKFURT3HOWROOM "ASELER3TRA”E &RANKFURT 4EL  FRANKFURT ARTEMIDEDE

#YPRUS 3ALES/FFICES !RTEMIDE(ELLAS3!  3OLONOS3T !THENS 4EL  INFO ARTEMIDEGR

$ENMARK (EAD/FFICE3HOWROOM !RTEMIDE3CANDINAVIA!3 3KUDEHAVNSVEJ $+ #OPENHAGEN 4EL  INFO ARTEMIDEDK

'ERMANY (EADOFFICEAND3HOWROOM !RTEMIDE'MB( (ANS "ÚCKLER 3TRA”E &RÚNDENBERG 4EL  INFO ARTEMIDEDE

(UNGARY 0RINCIPALDEALERAND3HOWROOM 2IO,ÉMPASTÞDIØ+FT 2ÉDAYU ( "UDAPEST 4EL  RIO LAMPASTUDIOHU )RELAND 3ALES/FFICES !RTEMIDE'",TD 4EL  INFO ARTEMIDECOUK +OSOVO 0RINCIPALDEALER ,IGHT(OUSE3TUDIO 6ETERNIKNN 0RISHTINE 4EL  INFO LIGHTHOUSE KOSCOM ,ATVIA 0RINCIPALDEALER 4RENTINI'ROUP ,ACPLESAIELA 2IGA 4EL  INFO ARTEMIDELV

3ERBIA 3ALES/FFICES !RTEMIDE3P! 6IA"ERGAMO  4EL  4EL  INFO ARTEMIDECOM

,ITHUANIA 0RINCIPALDEALER $ELIGHT,45!" 6YTENYO ,ITUANIA 4EL  INFO DELIGHTLT -ALTA 3ALES/FFICES !RTEMIDE)TALIASRL 4EL  4EL  INFO ARTEMIDECOM

3LOVAKIA 0RINCIPALDEALER !KLSRO 6IETNAMSKÉ "RATISLAVA 4EL  INFO AKLSROSK

-ONTENEGRO 0RINCIPALDEALER !RTEFACTO $ESIGN#ENTER "ULEVAR3VETOG0ETRA#ETINJSKOG 5LICA 0ODGORICA 4EL   INFO ARTEFACTOPLUSME .ORWAY $ISTRIBUTOR ,IMELIGHT!3 3ANDAKERVEIEN# INNG$ .O /SLO 4EL  INFO LIMELIGHTNO

3LOVENIA 0RINCIPALDEALER !RCADIA ÁMARTINSKAHALA%  ,JUBLJANA 4EL  4EL  INFO ARCADIA SVETILASI

0OLAND (EAD/FFICE !RTEMIDE$YSTRYBUCJA0OLSKASPZOO 5L3APEROW  %LBLAG 4EL  INFO LIRALIGHTINGPL 3HOWROOM 5L2YDYGIERA 7ARSAW 0ORTUGAL $ISTRIBUTOR &LUXOGRAMA3! 2UADA'ARAGEMNŽ  #ARNAXIDE 4EL  FLUXOGRAMA FLUXOGRAMACOM

2OMANIA 0RINCIPALDEALER (ELIOSPLS (ELIADEINTRE6II NR %TAJ "UCAREST 2USSIA (EADOFFICE !RTEMIDE!GENCY/// "OLSHOJ:LATOUSTINSKIJ0EREULOK "LDG OFFICE -OSCOW 4EL  INFO ARTEMIDE AGENCYRU

3PAIN (EADOFFICE !RTEMIDE3! #6ICO  BAJOS  "ARCELONA 4EL  ARTEMIDE ARTEMIDEES 3WEDEN (EADOFFICE !RTEMIDE3CANDINAVIA!3 3KUDEHAVNSVEJ $+ #OPENHAGEN 4EL  INFO ARTEMIDEDK

3WITZERLAND (EADOFFICEAND3HOWROOM !RTEMIDE)LLUMINAZIONE3! "ËRENGASSE :àRICH 4EL  INFO ARTEMIDECH 4URKEY 0RINCIPALDEALER /ZTAS!YDINLATMA 9SKENDER#AD  )STANBUL 3ISHANE 4EL  INFO OZTASAYDINLATMACOM 5NITED+INGDOM (EADOFFICE 3HOWROOM AND,IGHTING#ONSULTANCY#ENTER !RTEMIDE'",TD 'REAT2USSELL3TREET ,ONDON7#"." 4EL  INFO ARTEMIDECOUK

?


!MERICA #ANADA (EADOFFICE !RTEMIDE,TรE,TD  RUE2ENAUDE,APOINTE -ONTRรAL 1UรBEC(*4 4EL  4OLLFREE  INFOCANADA ARTEMIDENET WWWARTEMIDENET

53! (EADQUARTERS !RTEMIDE )NC +ARIN,ANE (ICKSVILLE .9 4EL  4OLLFREE !RT INFOUSA ARTEMIDENET WWWARTEMIDENET

#ENTRAL3OUTH!MERICA !RGENTINA $ISTRIBUTOR (EAD/FFICE3HOWROOM %DIMETRA3! 0ARAGUAYยช0ISO "UENOS!IRES 4EL   INFO ARTEMIDECOMAR

&LAGSHIP3TORE

&LAGSHIPSTORES

4ORONTO /. -ILL3TREET 4ORONTO /NTARIO-!2 4EL  TORONTO ARTEMIDENET

#HICAGO ), 7(UBBARDSTREET #HICAGO ), 4EL  CHICAGO ARTEMIDENET

"OLIVIA 3HOWROOM 3TUDIO4ESSUTO ,OCAL 5RUBร˜"USINESS#ENTER 3ANTA#RUZ "OLIVIA 4EL  INFO STUDIOTESSUTOCOM

3ALESOFFICES -ONTRรAL 1# 4EL  MONTREAL ARTEMIDENET 4ORONTO /. 4EL  TORONTO ARTEMIDENET

,OS!NGELES #! "EVERLY"OULEVARD 7EST(OLLYWOOD #! 4EL  LOSANGELES ARTEMIDENET .EW9ORK .9 'REENE3TREET .EW9ORK .9 4EL  NEWYORK ARTEMIDENET 3ALESOFFICES $ENVER #/ 7(UBBARDSTREET #HICAGO ), 4EL  DENVER ARTEMIDENET #HICAGO ), 4EL  CHICAGO ARTEMIDENET ,OS!NGELES #! 4EL  LOSANGELES ARTEMIDENET -IAMI &, 4EL  MIAMI ARTEMIDENET .EW9ORK .9 4EL  NEWYORK ARTEMIDENET

0ANAMA 3HOWROOMS )DEA$ESIGN#ENTER !V3AMUEL,EWISCON#ALLE +ENEXPLAZA /BARRIO 0ANAMA#ITY 2EPDE0ANAMA 4EL  INFO IDEAPANAMACOM

"RASIL $ISTRIBUTOR (EAD/FFICE3HOWROOM #YNTHRON 2UADO2ร˜CIO  ยŽANDAR

6ILA/LIMPIA  3รŽO0AULO 4EL  CYNTHRON CYNTHRONCOMBR

,UMICENTRO !VE*USTO!ROSEMENA %SQUINA#ALLE !VE%CUADOR%DIFICIO,UMICENTRO !PARTADO  0ANAMA#ITY 2EPDE0ANAMA 4EL  INFO LUMICENTROCOM

#HILE 3HOWROOM )NTERDESIGN )SIDORA'OYENECHEA ,AS#ONDES 3ANTIAGO 4EL  INFO INTERDESIGNCL #OLOMBIA 3HOWROOM 1$ESIGN(OME #RA.O  ! ,OCAL "OGOTA #OLOMBIA 4EL  WWWQDESIGNHOMECOM

-EXICO $ISTRIBUTOR (EAD/FFICE 3HOWROOM #USTOMER3ERVICE 3CULTURA,UMINOSA 3UDERMAN #OL#HAPULTEPEC -ORALES -EXICO$& 4EL  INFO ARTEMIDEMX

0ERU 3HOWROOM (ILITE !V,OS#ONQUISTADORES 3AN)SIDRO 0ERรก 4EL  VENTAS HILITEPERUCOM

$OMINICAN2EPUBLIC $ISTRIBUTOR 3PAZIODI#ASA !VE-AX(ENRIQUEZ5REร—A.O %NSANCHE.ACO 3ANTO$OMINGO 4EL  INFO SPAZIODICASACOM %CUADOR 3HOWROOM )NTEGRAL)LUMINACION +M6IA3AMBORONDON4ORNERO -Z3OLAR 'UAYAQUIL %CUADOR 4EL  INFO INTEGRALCOMEC WWWINTEGRALCOMEC .ICARAGUA 3HOWROOM -ICHEL0IERSON %DIFICIO#!2 DAPLANTA 0LANESDE!LTAMIRA -ANAGUA .ICARAGUA 4EL  WWWMICHELPIERSONCOMNI

5RUGUAY 3HOWROOM 42)/3,IGHTING ,UISDELA4ORREB -ONTEVIDEO 5RUGUAY 4EL  INFO TRIOSLIGHTINGCOM 6ENEZUELA 3HOWROOM )LUMINACIร˜N(%,)/3 !V3AN&ELIPE #ENTRO#OINASA -EZZANINA,A#ASTELLANA #ARACAS 6ENEZUELA 4EL  INFORMACION HELIOSCOMVE

&ORINFORMATIONREGARDINGDISTRIBUTORS ANDPOINTSOFSALEFOR#ENTRAL 3OUTH!MERICANCOUNTRIESNOTLISTED ABOVE PLEASEEMAIL INFOLATAM ARTEMIDENET


!SIA/CEANIA !USTRALIA (EADOFFICEAND3HOWROOM !DELAIDE /RNARE)MPORTS0TY,TD &ULLARTON2D .ORWOOD3! 4EL  INFO ARTEMIDECOMAU WWWARTEMIDECOM /FFICEAND3HOWROOMS 3YDNEY  #LEVELAND3T 3URRY(ILLS.37 4EL  SYDNEY ARTEMIDECOMAU -ELBOURNE  2ATHDOWNE3T #ARLTON6)# 4EL  MELBOURNE ARTEMIDECOMAU #HINA (EADOFFICE !RTEMIDE4RADING 3HANGHAI #O ,TD 2OOM & .EW(UALIAN -ANSION %AST7ING -IDDLE(UAI (AI2OAD (UANG0U$ISTRICT 3HANGHAI 4EL  INFO ARTEMIDECN !FFILIATED3HOWROOMS "EIJING 5NIT "  )NTERNATIONAL&URNITURE (ALL %ASY(OME .O.ORTHTH 2ING2OAD #HAOYANG$ISTRICT "EIJING 4EL  JINHONGSHIJIA COM

-IDDLE%AST!FRICA )NDIA (EADOFFICE !RTEMIDE,IGHTING)NDIA0VT,TD 5NIT.ª NDFLOOR 2AGHUVANSHI -ILLS#OMPOUND 3ENAPATI"APAT -ARG ,OWER0AREL -UMBAI  -AHARASHTRA 4EL  4EL  INFO ARTEMIDEIN ANINDYA ARTEMIDEIN 2EGION7EST 3HOWROOMAND2EGISTERED/FFICE 5NIT.ª NDFLOOR 2AGHUVANSHI -ILLS#OMPOUND 3ENAPATI"APAT -ARG ,OWER0AREL -UMBAI  -AHARASHTRA 4EL  4EL  PRAMODTAMBE ARTEMIDEIN ANINDYA ARTEMIDEIN ARUNKHATTRI ARTEMIDEIN 2EGION3OUTH 4EL  4EL  ARUNKHATTRI ARTEMIDEIN RAVI ARTEMIDEIN

2EGION$ELHI.#2 3HOWROOM .ª 2ETREAT&ARMS +HULLAR&ARMS !SHOK,ANE -ANDI2OAD -EHRAULI .EW$ELHI  4EL  4EL  4EL  ASHWANIGUPTA ARTEMIDEIN DHEERAJKAPOOR ARTEMIDEIN SUMIT ARTEMIDEIN

2EGION.ORTH ! ST&LOOR 2ED3TAR-ACALLINE 4EL  .ª%ASTTH2ING2OAD 4EL  #HAOYANG$ISTRICT "EIJING ASHWANIGUPTA ARTEMIDEIN 4EL  DHEERAJKAPOOR ARTEMIDEIN (ONG+ONGAND-ACAO

(EAD/FFICE !RTEMIDE,TD 5NIT & 2UTTONJEE(OUSE 2UTTONJEE#ENTRE $UDDELL3TREET #ENTRAL (ONG+ONG 4EL  INFO ARTEMIDECOMHK 3HOWROOM 3HOP  2UTTONJEE#ENTRE $UDDELL3TREET #ENTRAL (ONG+ONG 4EL 

2EGION%AST 4EL  4EL  ARUNKHATTRI ARTEMIDEIN ASHWANIGUPTA ARTEMIDEIN

)NDONESIA 3ALES/FFICES !RTEMIDE,TD 4EL  INFO ARTEMIDECOMHK *APAN (EADOFFICE !RTEMIDE*APAN++   4OMIGAYA3HIBUYA KU  4OKYO*APAN 4EL  INFO ARTEMIDECOJP

-ALAYSIA $ISTRIBUTOR ,IGHTCRAFT+, 3DN"HD   *ALAN3UNGAI"ESI +UALA,UMPUR -ALAYSIA 4EL  INFO LIGHTCRAFTCOMMY

(EADOFFICE3HOWROOM !RTEMIDE-IDDLE %AST $UBAI$ESIGN$ISTRICT$ "UILDING RD&LOOR /FFICES! $UBAI 5!% 4EL  INFO ARTEMIDEAE

.EW:EALAND $ISTRIBUTOR %##,IGHTING .UGENT3TREET !UCKLAND 4EL  INFO ECCCONZ 4HORNDON1UAY 4EL  7ELLINGTON INFO ECCCONZ

0HILIPPINES 3ALES/FFICES !RTEMIDE,TD 4EL  INFO ARTEMIDECOMHK 3INGAPORE $ISTRIBUTOR -ILLION,IGHTING#O0TE,TD +ALLANG"AHRU -ILLION"UILDING 3INGAPORE 4EL  ENQUIRY MILLIONLIGHTINGCOM SHOWROOMS MILLIONLIGHTINGCOM WWWMILLIONLIGHTINGCOM 3OUTH+OREA $ISTRIBUTOR $UOMO#O  .ONHYUN RO 'ANGNAM GU 3EOUL +OREA 4EL  INFO DUOMOKOREACOM WWWDUOMOKOREACOM

4HAILAND 3ALES/FFICES !RTEMIDE,TD 4EL  INFO ARTEMIDECOMHK 4AIWAN $ISTRIBUTOR -ITHUS#O,TD & .O ,IANCHENG2D

:HONGHE$IST.EW4AIPEI#ITY  4AIWAN 4EL  ALLENCHANG BRAVOCASACOMTW WWWMITHUSTW 6IETNAM $ISTRIBUTOR #AO4RAN#O ,TD 4RAN0HU 0 1 (O#HI-INH#ITY 6IETNAM 4EL  CAOTRAN CARACOMVN WWWCARACOMVN

&ORINFORMATIONREGARDINGDISTRIBUTORS ANDPOINTSOFSALEFOR-IDDLE%AST !FRICACOUNTRIES PLEASEEMAIL INFO ARTEMIDEAE


Â¥!RTEMIDE3P! !RTDIRECTIONEDITING 3TUDIODE"EVILACQUA #ARLOTTADE"EVILACQUA WITH )PPOLITA#IAMPINI $IEGO-ARTINELLI !LESSANDRA$E6ECCHI 3ARA2IVA !RTEMIDE2ESEARCH)NNOVATION &ABIO:ANOLA

#OMPASSO$ORO    

7INNER%UROPEAN $ESIGN0RIZE@

)MAGEEDITING AND$VISUALIZATION 0AOLA-ONACODI!RIANELLO 3IMONE&ANTONI !LESSANDRO0ECCATI 3TILLLIFES *EAN0IERRE-AURER -ANUEL-AURER 'IO0INI &EDERICO6ILLA -IRO:AGNOLI -ICHELE.ASTASI 0REPRESS !CTUALTYPESRL 0RESS 2OTOLITO,OMBARDA

)3/

)3/

!RTEMIDE3P! RESERVESTHERIGHTTOCHANGE ATANYTIME ANDWITHOUTPRIORWARNING THETECHNICAL SPECIFICATIONSOFANYPRODUCTILLUSTRATED INTHISCATALOGUE


WWWARTEMIDECOM

Architectural 2017 EN  
Architectural 2017 EN