Page 1

Add some “Hi-Lights” to your breeding program ...

Appri rill 20 2010 10 $7.5 7.500

www.ahtimes.com

STANDING AT:

ARABIANS INTERNATIONAL

Magnum Psyche x MA Unique, by Bey Shah • Multi-program Nominated • SCID clear

Proudly owned by John Nord, Bloomington, IL For breeding information contact trainer João Rodrigues 480.889.4393 • www.PomeroyArabians.com judith photo

April 2010

PA Hi-Countessa (PA Hi-Noon x La Countesa)


Spring Sales Offering Leading Sire for the 12th year in a row!

Winner of the Arabian Horse Times 2009 Readers' Choice

Zee Fire Dancer CMS Brownie Hesa Zee+/ x Fire Musc by Crown Musc+ 2006 Bay Arabian Mare Her siblings have been US Reserve National Champion Reining Futurity, Scottsdale Futurity (4th), and Regional Winners. Her dam has many reining Youth and Canadian National Top Ten awards. Sweepstakes.

Crown Musc+ x Chex Ten San (AQHA) 2007 Bay Half-Arabian Gelding Well started under saddle, he lopes, circles, stops, rates well, is quiet and national quality. A Scottsdale Futurity candidate! Crown Musc+ is the sire of national reining winners. Sweepstakes.

Sire Of The Year Award.

CMS Super Chick Palomino Filly Crown Musc+ x Super Cindy Brick (AQHA) 2004 Chestnut Half-Arabian Mare Tall, very well-bodied mare. Can carry a big man and make it a pretty picture. Shown western. Will be a superb amateur horse. Sweepstakes.

CG Colonel Jac (AQHA) x Zee Precious Gem 2010 Palomino Half-Arabian Filly Gorgeous filly with partial low blaze and no other white. Bred and built to rein. A Standout. Full sister to the buckskin being shown by Gary Ferguson. Sire: NRHA $10,000 earnings. Sweepstakes

above: Zee Fire Dancer right: CMS Super Chick far right: reference sire, CG Colonel Jac

Eleanor Hamilton, Owner Rogers, Minnesota Rod Matthiesen, Trainer Mark Coombs, Breeding Manager

763.767.1381 1.800.328.9923 www.EleanorsArabianFarm.com


I should have bred to *Bask ... I should have bred to Huckleberry Bey ... I should have bred to Afire Bey V ...

YOU STILL CAN

Inquire about our breeding stimulus package.

Owned by Maroon Fire Arabians, Dave & Gail il L Liniger iniger For breeding information, contact: Shea Stables, Tim & Marty Shea • St. Clair, MI • 810-329-6392

www.afirebeyv.com


We are thrilled with the success of these two sires & invite you to look at our 2010 foals now on the ground!

bernier photos

Above: 2010 Filly (Ever After NA x EA Gypsy Echo) Right: 2010 Filly (Ever After NA x EA Miracle) Far Right: 2010 Filly (Ever After NA x Indianne Psylk)

2 | AR ABIAN HORSE TIMES


A 2010 SCOTTSDALE LEADING SIRE OF HALTER WINNERS CONGRATULATIONS SCOTTSDALE WINNERS SIRED BY BOTH SIR FAMES HBV & EVER AFTER NA ROHARA MADEMOISELLE—CHAMPION SF SIR REAL—CHAMPION ROHARA ZOHAR—RESERVE CHAMPION CANDELARIA VF—RESERVE CHAMPION ULTRA FANCY BX—RESERVE JR. CHAMPION NOVELLA SF—TOP TEN KA ROUNDABOUT MIDNITE—TOP TEN ANGELLINAH WLF—TOP TEN ISABELLA WA—TOP TEN SF INFAMOUS—TOP TEN RA KOHINOOR—TOP TEN ADAM RTA—TOP TEN OPUS ONE ROA—TOP TEN LOVE SWEET LOVE—TOP TEN INSPIRATION NA—TOP TEN KYNGDOM—TOP TEN

Proudly owned & offered at stud by Robert & Dixie North Breeding Manager Mike McNally, 760.789.3208 Top: 2010 Filly (Sir Fames HBV x Psyches Nova) Bottom: 2010 Filly (Sir Fames HBV x Promises Psy)

WWW.NORTHARABIANS.COM APR IL 2010 | 3


April 2010

Contents 48

Cover Story: DaVinci FM by Mary Kirkman

68

68

The 2009 Arabian Horse Times Readers’ Choice Awards— Celebrating The Industry by Colleen Scott

90

2010 Scottsdale Leading Sires by Christy Egan

102

Scottsdale—Perfect Venue For Marketing Horses by Colleen Scott

128

The Working Western Phenomenon by Linda White and Mary Kirkman

140

One Man’s Opinion—Thoughts On The State Of The Arabian Horse Industry, Part I by Bob Battaglia

144

Arabian Horse Photographers In Focus—April Visel by Mary Kirkman

144

161

2010 Ohio Buckeye Sweepstakes Preview—May 27-30, 2010 by Linda White

162

Leaders Of The Times—Bey Ambition & Rae-Dawn Arabians by Colleen Scott

166

The Arabian Horse In History—The Wahhabi Wars, Part II by Andrew K. Steen

172

Getting Into Shape For Show Season by Hillary Hoffman

180

*Napitok—From Russia With Love by Linda White

184

192

In Memoriam: Harold Orr (1923-2010)

193

2010 Regional Judges

212

The Arabian & Half-Arabian Futurity Continues To Impress by Barb Anderson

On The Cover: DaVinci FM (Versace x Full Moon Astar), owned by Gemini Acres. See story on page 48. 4 | AR ABIAN HORSE TIMES

6

Comments From The Editor

184

A Lifetime With Arabians by Sheila Varian

194

A Leg Up by Heather Smith Thomas

198

Times For Amateurs by Keri Schenter

201

Handy Horse Tips by Lee Bolles

202

Calendar Of Events

220

Looking Ahead

223

Index Of Advertisers


APR IL 2010 | 5


Comments From Mike Villaseñor Publisher Lara Ames Editor Kevin Ludden Contributing Writers Linda White Mary Kirkman Colleen Scott Advertising Account Executives Mike Villaseñor Kandi Menne John Diedrich Production Manager Jody Thompson Senior Designer Marketing Director Wayne Anderson Graphic Designers Tony Ferguson Tammi Stoffel Design Support Jan Hunter Editorial Coordinator Proofreader Charlene Deyle Office Manager Circulation Robin Matejcek Accounts Receivable Circulation Editorial Assistant Karen Fell Director of Interactive Bill Konkol © Copyright AHT, Inc. dba Arabian Horse Times. All rights reserved. Reproduction in whole or in part without permission is prohibited. Articles or opinions published by the AHT, Inc. dba Arabian Horse Times are not necessarily the expressed views of the AHT, Inc. dba Arabian Horse Times. AHT, Inc. dba Arabian Horse Times. is not responsible for the accuracy of advertising content or manipulation of images that are provided by the advertiser. ARABIAN HORSE TIMES (ISSN 0279-8125) Volume 40, No. 11, is published monthly by AHT, Inc. dba Arabian Horse Times, 299 Johnson Ave., Suite 150, Waseca, Minnesota 56093. Periodical postage paid at Waseca, Minnesota 56093 and at additional entry offices. Single copies in U.S. and Canada $7.50. Subscription in U.S. $40 per year, $75 two years, $105 three years. Canada $65 one year, $125 two years, $170 three years, U.S. funds. Foreign Subscriptions: $95 one year, $185 two years, $280 three years, payable in advance, U.S. funds. Sorry, no refunds on subscription orders. For subscription and change of address, please send old address as printed on last label. Please allow four to six weeks for your first subscription to be shipped. Occasionally ARABIAN HORSE TIMES makes its mailing list available to other organizations. If you prefer not to receive these mailings, please write to ARABIAN HORSE TIMES, Editorial Offices, 299 Johnson Ave., Suite 150, Waseca, MN 56093. The publisher is not responsible for unsolicited manuscripts or photographic materials. Printed in U.S.A. • POSTMASTER: Send address changes to the ARABIAN HORSE TIMES, 299 Johnson Ave., Suite 150, Waseca, MN 56093. For subscription information, call 1-800-AHTIMES (in the U.S.A.) or 507-835-3204 (for outside of the U.S.A.) Arabian Horse Times • 299 Johnson Ave., Suite 150, Waseca, MN 56093 • Tel: (507) 835-3204 • Fax: (507) 835-5138 1-800-AHTIMES • www.ahtimes.com

6 | AR ABIAN HORSE TIMES

The recent Scottsdale All-Arabian Horse Show reminded me that those of us in the horse business are really in the recreation and entertainment business. We compete for the same dollars as boat and RV sales. We compete with ocean cruises and ski vacations for the spare time of thousands of people. With that in mind we here at Arabian Horse Times are committed to a renewed focus on the entertainment and social aspects of our horse shows. We need to make our shows fun for the people who invest their time to come out and support our beautiful breed. This thinking was the genesis for the creation of the Arabian Horse Times Readers’ Choice Awards Celebration. (See page 68 for full story.) We have always felt that social awareness is a huge part of who we are as a community of like-minded folks. At Arabian Horse Times we have done our fair share of supporting causes of great concern to our breed. The Horsemen’s Distress Fund is one of them. We naturally sought to couple that fine program with our Readers’ Choice Awards Celebration to raise funds so their good work continues. The evening made for a perfect combination of an awards program and a social gathering where exhibitors, owners, trainers and spectators could support each other, as well as a very worthy cause in a relaxed social situation. Let us all resolve to make 2010 the year we muster our pride in our breed and bring back horse shows that are fun and exhibitor-friendly.

Mike Villaseñor


*Ali Jamaal *Dakar El Jamaal Dakharo

The Next Generation … FSF FS SF

Dakaros Enchanter

Dakharo x Enchantingly Shai

Owned by Jerry & Ann Riles Fern Springs Farm, Douglasville, GA Managed by Chris Anckersen Standing at Chattooga Ridge Arabians 864-647-7588 • anckersen@aol.com

APR IL 2010 | 7


WHY does Midwest

Midwest Congratulates the buyers an

consistently

of horses offered in the White D

m a r k e t sCollection o m aSale n yand new purchas

Midwest breeding stallions in Sc

horses month after month?

Fantastica HVP to Argentina

Ames Starlight to Colorado, U.S.A.

Heires To Marc to Middle East

Capone SSR to New Zealand

HP Martina

www.MidwestArabian.com 8 | AR ABIAN HORSE TIMES


KNOWLEDGE ...

yers and sellers

White Diamond

purchases to the

s in Scottsdale.

QUALITY PRODUCT ...

D E D I C AT I O N !

APR IL 2010 | 9


Midwest congratulates the buyers and sellers of horses offered in the White Diamond Collection Sale and new purchases to the Midwest breeding stallions in Scottsdale.

WHY? Because Midwest clients reach their goals, achieve success and have fun!

Mulawa Arabians Oak Ridge Arabians Haras Mayed The Farm Haras Vila Dos Pinheiros Running Horse Ranch Eduardo Pires Barbosa Brookeville Arabians Mario Zerlotti Rinaldo Longuini Mme. Israa Waleed Giuma Ben Zaied Gemini Arabians Steven Miles Rohara Arabians Barbara Jarabek Freeland Farms Weston Farm Arabians Dan and Lori Whitt Haras Boa Vista White Rock Ranch LLC Rancho Las Potrancas Craig Demerly Les and Diane Van Dyke

Roger Moore Lutetia Arabians Fabio Diniz Aburrazag Habeil Desert Horse Production Regina Wifling Janusz Ryzkowski Miguel Boto Alena Janow Podlaski Reinhard Kurtz Al Hambra Arabians Great White London Strawberry Banks Farm Michael Womble Cedar Ridge Arabians Don Manuel Farm Jahangir Azimi Salim Mattar Michael Bills Ken & Joann White Paul Glans John & Sharon Ames

MIDWEST BREEDING AND TRAINING STATIONS ELK RIVER, MINNESOTA DAVID BOGGS ~ 612-328-8312 MIDWEST@SBWIRELESS.NET TRAVIS RICE ~ 612-919-6134 TRAVISMIDWEST@SBWIRELESS.NET HP Martina to Belgium

Major Surprise H to Brazil

OFW Chianti to Middle East

HP Martina

www.MidwestArabian.com 10 | AR ABIAN HORSE TIMES


MIDWEST ...

BREEDING, TRAINING, SHOWING,

& MARKETING YOUR ARABIAN HORSE!

APR IL 2010 | 11


N o t e t h e obvio u s . . .

12


Arabian Horse Times Readers’ Choice Purebred Horse of The Year & Purebred Saddle Seat Horse of the Year!

It is no accident... It is why it works!

3x Unanimous U.S. National Arabian English Pleasure Champion

APR IL 2010 | 13


SMP Arabians is proud to add these two National Champions

ML Afire Dream x Fire Essense by Pro-Fire

2009 U.S. National Champion English Pleasure Futurity 2010 Scottsdale Reserve Champion Junior English Now owned by and standing at SMP!

14 | AR ABIAN HORSE TIMES


to their collection of talented, high-trotting breeding and show horses.

Afire Bey V x Sable SMA by JJ Saber

U.S. National Champion English Pleasure AAOTR 40 & Over Region 15 Champion English Pleasure Open and Jr. Horse

SMOKY MOUNTAIN PARK Rod & Jacqueline Thompson • Trainer, Mike Miller 1558 Muddy Creek Road, Lenoir City, TN 37772 865.388.0507 • www.SmokyMountainParkArabians.com APR IL 2010 | 15


16 | AR ABIAN HORSE TIMES


17


C R E AT I N G E X C I T E M E N T AT S C O T T S D A L E

Black Daniels

18 | AR ABIAN HORSE TIMES

SA Rapid Fire


GETTING THE JOB DONE! SCOTTSDALE SALES ...

Baske Is A Genius

Congratulations to new owners. ADMIRE THE FIRE (Baske Afire x Admiral’s Lotus Blossom) BASKE IS A GENIUS (Baske Afire x Winning Asset)

WCF Mata Hari

BEN ANZA (Anza Padron x Eloquent-Godiva) CHAIRMAN OF THE BASK (Attache’s Born Believer x Mac Baske) CP SHENANIGAN (Anza Padron x CP Dance Card) FESTIVAL OF LIGHTS (Baske Afire x St Pat's Irish Supreme) FIRE BERRY BASKE (Baske Afire x Morgan Le Fay) Hometown Hero

GHAZIMOTO (El Ghazi x Princess Greystone) HOMETOWN HERO (Scrimmage x On Fyre) JB SHE GOT GAME (Baske Afire x My Magical Mood) JMA BRENTWOOD (Baske Afire x Bing Barbary) SOMTHIN SPECIAL (Baske Afire x Endless Legacy) STRAPLESS (Baske Afire x Callaway’s Princess Eugenia)

JB She Got Game

WCF MATA HARI (Zodiac Matador x Refina) WILAMENIA (Baske Afire x Calaways Princess Eugenia) VIN DIESEL (Baske Afire x Precisely Poppy) PUCKER UP PF (Baske Afire x Miz Marguerita V) EVIDIENCE (Allience x White Zinfandal)

Ghazimoto

MISS VIVIANA (ASB) DON'T TOUCH MY CASH (ASB)

STACHOWSKI FARM INC. Mantua, Ohio • 330-274-2494 • E-mail: info@stachowski.com Jim Stachowski: 330-603-2116 • Peter Stachowski: 330-620-0194

www.Stachowski.com

APR IL 2010 | 19


BREEDING, SHOWING, SALES ... A PLAN THAT WORKS!

Thursday evening presentation during Scottsdale show.

Stachowski Farm will be opening their Scottsdale facility - November 1, 2010 Our first year offering a facility in Scottsdale was a great success. Call Jim or Peter to set your long term goals and establish a plan for your breeding, training and marketing program. 20 | AR ABIAN HORSE TIMES


PLAN NOW FOR SCOTTSDALE 2011!

SF Specs Shocwave

Accepting horses for training and sales at our facility in Scottsdale & Ohio. Standing at stud: SF Specs Shocwave Black Daniels

STACHOWSKI FARM INC. Mantua, Ohio • 330-274-2494 • E-mail: info@stachowski.com Jim Stachowski: 330-603-2116 • Peter Stachowski: 330-620-0194

www.Stachowski.com

APR IL 2010 | 21


for the extreme . .

Shael dream desert Ansata Shaamis x Elettra

22 | AR ABIAN HORSE TIMES


Shaella

FT

Shael Dream Desert x Soul Pretty

Champion Junior Mare 2010 Dubai International Championships Congratulations to Dubai Arabian Stud Make Arrangements for your visit to Freeland Farms today and experience some of the finest Arabian breeding stock available in the world.

Freeland F A R M S

Contact Pam Jump ~ 260-341-4047 ~ pam@freelandfarms.com www.freelandfarms.com

APR IL 2010 | 23


B RAS S . . . Available through modern technology Cedar Ridge is excited to announce that limited breedings to Brass are available. Thanks to the use of "Intracytoplasmic Sperm Injection (ICSI), you can have a foal sired by the immortal Brass.

Contact Mike Brennan, breeding manager for details at 952-492-6590 Jordan, Minnesota

www.Cedar-Ridge.com

24 | AR ABIAN HORSE TIMES


A Leading sire of Arabian and Half-Arabian National Champions Brass Chief Ames Queen Poise And Ivy SG Brass Prince Brass Star Afire Storrm Up Your Brass Ames Deja Vu A Piece of Brass Ames Fire Devil Pain In The Brass CR Havana Cabana Ames Ragtime Ames Cassanova Ames Brass Door Brass Glamor Shot CR Simply Marvelous Ames Lucky Affair Ames Symbolic CRF Barenaked Lady EC Brass Knuckles Ames City Slicker Kickin Brass

APR IL 2010 | 25


Sales Offerings

Visit our website to view sale horse videos

www.BattagliaFarms.com

GSF Ohmy Ghaz

26 | AR ABIAN HORSE TIMES

Heritage Bey Kat

HL Dakota Chief


AFIRES ENCORE (Afire Bey V x Matoskette) 4-year-old chestnut Arabian stallion • Shows great potential as a top country horse. Ready to show this spring. BG MIZ FIRE (Baske Afire x Waffles) 7-year-old chestnut H/A mare • A country/ equitation mare that shows great potential. Champion halter and country English pleasure. GSF OHMY GHAZ (El Ghazi x Crimsonn Bay) 12-year-old bay Arabian gelding • National champion country pleasure. National champion English pleasure futurity. Perfect AOTR/youth. 2010 winner Scottsdale Show Hack 13 & under. HERITAGE BEY KAT (Heritage Bey King x Cats Alectra Heir) 7-year-old grey H/A mare • 2010 Scottsdale champion equitation, Scottsdale top ten country pleasure AOTR, champion English pleasure AOTR, and multiple regional top five English pleasure. Suitable for any level rider open/ AOTR/JOTR and qualified for nationals.

Inittowinit

HL DAKOTA CHIEF (HL Spellcaster x HCF Pocketful of Starlike) 5-year-old bay H/A gelding • Very upright with great motion to show English or country junior horse open/amateur. Full sibling to National reserve champion HL Copperfield. Sired by son of The Chief Justice. INITTOWINIT (Baske Afire x Kimberly) 7-year-old bay H/A gelding • Regional champion pleasure driving, multiple regional winner in English pleasure junior horse and regional top five H/A English pleasure AOTR. Suitable for open/AOTR and qualified for nationals. PENELOPE KREWSE (Krewe x Sultan's Final Dawn) 9-year-old black H/A mare • Regional champion country pleasure AOTR and show hack open/ AOTR; regional top five side saddle and U.S. national top ten halter. Suitable for open/JOTR and qualified for nationals. PA ELUSIVE (Emanor x PA Screen Play) 8-year-old grey gelding • Multi regional country pleasure winner open, AOTR and JOTR. Will step up to be English pleasure.

Penelope Krewse

PA Elusive

BATTAGLIA FARMS ~ Scottsdale, Arizona ~ 480-585-9112 Bob Battaglia • Russ Vento Jr. (In memoria in aeterna) APR IL 2010 | 27


Proven Champions ... Proven Sires

7-Time National Champion

Leading Sire of Champions

6-Time National Champion

A TEMPTATION

BASKE AFIRE

HEY HALLELUJAH

Tempter x A Love Song

Afire Bey V x Mac Baske

Huckleberry Bey x Hallelujah Bask

Free Breeding

For any mare that has won a U.S. National Championship Half-Price fee for any mare that has won a U.S. National Reserve Championship Includes Purebreds and Half-Arabians • For details:

www.StrawberryBanksFarm.com

28 | AR ABIAN HORSE TIMES


Some of the proof ...

Scottsdale Champion

Scottsdale Champion

MISTER HALLELUJAH

ERA THRILLICIOUS

NYTE OF TEMPTATION

Hey Hallelujah x Justice N Liberty

Baske Afire x Koriene

A Temptation x Toi Jabaska

National Champion

National Champion

Scottsdale Champion

IN THE LINE AFIRE

READ ALL ABOUT IT

BONFIRE ROF

Baske Afire x El Milagro's California Capers

Baske Afire x Read My Mind

Baske Afire x Sing For Joy

Strawberry

Scottsdale Champion

Banks Farm

Barbara Chur • East Aurora, NY • 716-652-9346 Michele Valone, breeding mgr. • Brian Murch, trainer 716-983-3099

APR IL 2010 | 29


WH AT ’S

BETTER THAN

...

Springtime & Foals?

30 | AR ABIAN HORSE TIMES


WE’VE

GOT SOM E GR E AT ONES. A FEW ARE AVAILABLE.

2010 FILLY FILLY COLT COLT FILLY FILLY COLT COLT COLT

Sire x Dam (Breeding of Dam) Afire Bey V x PF Im flattered (Dark Harbor x Pure Flattery, by Andreanov) Afire Bey V x MWF Elzbieta (Barbary+++ x Evening Breeze, by *Bask) Afires Heir x VTM Pistachia (MHR Nobility x RY Fire Ghazi, by El Ghazi) Baske Afire x Baby Im A Star (Sultan’s Starmaker x Amber Minx, by Harlem Globetrotter) Majesteit x Glitter Girl S (Nicklebey Berry x HL Justa Sparkle, by The Chief Justice) MHR Nobility x Neveah (Matoi x Justice N Liberty, by MC Sir Hope) MHR Nobility x HF Luck Bea Lady (Baske Afire x Play Annies Song [dam of HF Mister Chips], by *Bask) SF Specs Shocwave x Catt (JF Magnificat++ x DG Serinett, by Serinask) Vegas x A Blessing (Afire Bey V x Mac Baske, by Baskevich)

STILL TO COME Afires Heir x Miz Margarita V (El Ghazi x Miz Margeaux V, by Huckleberry Bey) Majesteit x Made You Look (Afire Bey V x Bold Love, by *Bask) Mamage x Catt (JF Magnificat++ x DG Serinett, by Serinask) Hucks Connection V x Goodie Two Shoes (Baske Afire x Harghaza, by El Ghazi) Undulatas Nutcracker x Afires Quintina (Afire Bey V x FR Quintessa, by Barbary+++) OFFERING TALENTED PROSPECTS SHE’S A HOTTY Afire Bey V x She’s A High Roller, 2/17/2006, Bay, H/A Mare PERI HEIRESS Periaptor x Pro Mahagony Lady, 1/21/2005, Bay, H/A Mare MESQUITE HEAT PF Baske Afire x Cactus Rose JK, 5/24/2007, Bay, Arabian Gelding ESPIONAGE PF Mamage x Empress of Bask, 2/25/2007, Chestnut, Arabian Gelding MD BELLAMESA MHR Nobility x MC Bellasera, 4/8/2007, Chestnut, Arabian Mare OUTLAWS EXPRESS Afire Bey V x Express Yourself, 2/24/2007, Bay, H/A Gelding CANT CONTROLLER PF Baske Afire x Shes A High Roller, 4/1/2007, Chestnut, H/A Mare MACHINE GUN FIRE PF Baske Afire x Lady Machine, 4/20/2007, Bay, H/A Gelding HORNS AND HALOS PF Baske Afire x Petite Sweet, 5/3/2007, Bay, H/A Mare Full sister to National Champion JB Hometown Hottie TORNADO WARNING PF Sir William Robert x Erinne, 4/17/2007, Grey, H/A Gelding

Contact us for complete sales list. Irwin Schimmel • 360-256-9432 • Cell: 503-367-4997 P.O. Box 814, Hillsboro, Oregon 97123

APR IL 2010 | 31


YOUR CHANCE TO WIN THE

PICK OF THE PASTURE!

VCP Magnifire

JR Maximilian

Clout

(Afire Bey V x RY Fire Ghazi)

(Apollopalooza x Matariaelle Girl)

(Supreme Delivery x DHH Jonker daughter)

50% of the proceeds will be donated to THE HORSEMEN’S DISTRESS FUND. The winner of this once in a lifetime opportunity will earn the right to walk Rooker’s FIELD OF DREAMS and choose their perfect horse from the entire 2009 foal crop. The winner will be announced during the U.S. Nationals in Tulsa, OK. Need not be present to win.

Become a fan of the “Pick Of The Pasture” on Facebook.

For information or ticket sales, please call Terri Delbridge at 586-668-6246 Action Max

Love Drunk

(JR Maximilian x Callaway’s Bright Star)

(JR Maximilian x Hightime Rose)

CHESTNUT HALF-ARABIAN GELDING

CHESTNUT HALF-ARABIAN FILLY

Bawitdaba

Mag Neato

(JR Maximilian x LBC Isabeaux)

(VCP Magnifire x Coyote Ugly)

CHESTNUT HALF-ARABIAN GELDING

BAY HALF-ARABIAN GELDING

Berry Extrodinary

Mag Wheels

(JR Maximilian x Blackberry Twist)

(VCP Magnifire x AA-Balais)

BAY ARABIAN FILLY

BAY ARABIAN COLT

Blue Jean Baby

Max Azria

(JR Maximilian x Shiloh’s Folly)

(JR Maximilian x Bey Melodye)

CHESTNUT HALF-ARABIAN FILLY

CHESTNUT ARABIAN COLT

Dress To Impress

Meringue Kisses

(JR Maximilian x Nobilitys Lady Di)

(JR Maximilian x Pavlova X)

CHESTNUT ARABIAN FILLY

BAY ARABIAN FILLY

Goose Bumps

Modern Girl

(Clout x Ambitions Afire)

(JR Maximilian x My Spa Day)

CHESTNUT HALF-ARABIAN GELDING

BAY HALF-ARABIAN FILLY

Imax

Ride Captain Ride

(JR Maximilian x Top Line) BAY HALF-ARABIAN GELDING

(JR Maximilian x Samantha DGL)

CHESTNUT ARABIAN COLT

Lady Ga Ga

X File

(JR Maximilian x Karen)

(JR Maximilian x KRA Runaround Sue)

BLACK HALF-ARABIAN FILLY

BAY ARABIAN COLT

JR Maximilian

ONLY 1,000 TICKETS WILL BE SOLD AT $250 EACH OR 10 FOR $2,000. Recipient is purchasing option(s) on one foal from the breeding stock of Rooker Training Stable. One randomly selected Recipient will have the opportunity to execute their option in November 2010. At the time the winner is selected, all other nonrefundable option purchases will be deemed withdrawn. Questions regarding the purchase should be directed to Jennifer Foster, President of EQ Bookkeeping at (877) 399-8920.

32 | AR ABIAN HORSE TIMES


Preparing and polishing one star after another...

*SVSZIV½JXIIR]IEVW'LIWXRYXLMPP%VEFMERWLEWFIIRTVITEVMRKTSPMWLMRKERHWLS[MRK %VEFMERERH,EPJ%VEFMERLSVWIWXS6IKMSREP2EXMSREPERH7GSXXWHEPI'LEQTMSRWLMTW 7TIGMEPM^MRKMREPPJEGIXWSJ%VEFMERLSVWIXVEMRMRKERHQEVOIXMRK[IMRZMXI]SYVZMWMXERH MRUYMVMIWXS½RHSYXLS[[IGERLIPTTSPMWL]SYVRI\XFMK[MRRMRKWYTIVWXEV

&KHVWQXWKLOO .SI%PFIVXMb3[RIV8VEMRIV .SI%PFIVXMb3[RIV ..IWWMGE&IPXb%WWMWXERX8VEMRIVˆ+VIK&VMRIVb .IWWMGE&IPXb%WWMWXERX8VEMRIVˆ+VIK&VMRIVb3[RIV 43&S\ˆ+MPFIVX4% 43 43 &S\  ˆ +MPFIVX +MPFIVX 4% ZSMGIˆJE\

',)78298,-00%6%&-%27'31


&KHVWQXWKLOO HVWWQXWWKLOOO HVWQXWKLOO Arab A rabiians ans

4VITEVMRKERHTSPMWLMRK SRIWXEVEJXIVERSXLIV

2008 Canadian Reserve National Champion Stallion

GLEQTMSRYRHIVER]SXLIVWGSVMRKW]WXIQ

.YWXE½VI(+0\6'SPIXXIF]4EHVS SR RW4W]GLI 4YVIFVIH7XEPPMSRˆ1YPXMTVSKVEQ2SQMREXIHˆ7'-('PIEVˆ3[RIHF] 7XERHMRKEX'LIWXRYXLMMPP%VEFMERW

972EXMSREP8ST8IR.V7XEPPMSR VH 972EXMSREP8ST8IRR7V7XEPPMSR8[S8MQI6IKMSR9RREERMQSYW 'LEQTMSR7XEPPMSR9RERMQSYYW&YGOI]I'LEQTMSR*MZI=IEV3PH7XXEPPMSRW 7GSXXWHEPI6IWIVZI'LEQTMSR7M\ 7IZIR=IEV3PH7XEPPMSRW 7 34 | AR ABIAN HORSE TIMES

 SJXLI7LEHHSJE\JSEPWWLS[RRXSHEXIEVI'PEWW%6IKMSREPERH7GSXXWHEPI[MRRIVW


7,%((378%66'%

7LEHHSJE\\%8%%REWXE^ME 7GSXXWHEPI8ST8IR VH =IEVPMRK+IPHMRK %ZEMPEFPIJSVTYVGLEWI

His time has come ...

GSRJSVQEXMSRYREPXIVIHMREPPTLSXSW

APR IL 2010 | 35


&KHVWQXWKLOO HVWQXWKLOO HVW WQXWW LO LOO OO Arab A rabiians an s

4VITEVMRKERHTSPMWLMRK SRIWXEVEJXIVERSXLIV

2010 Scottsdale Grand Champion Stallion %38,

 1EKRYQ'LEPP,: :4\4VIXX]8VMGO]F]4EHVS SR RW4W]GLI 4YVIFVIH7X  4YVIFVIH 4Y 4 Y 7XXEPPMSR XEPPMSRˆ1YPXMTVSKVEQ2SQMREXIHˆ7'-(

ˆ 1YPXMTVSK 1YPXM TVSK

' '%'PIEV 3[RIHF];MRHVMHKI)UYIWXVMER'IRXIVERH7XERHMRKEX'LIWXRYXLMPP%VEFMERW

7GSXXWHEPI9RERMQS SYW'LEQTMSR7XEPPMSRW*MZIERH3ZIIVV%38, 7GSXXWHEPI6IWIVVZI'LEQTMSR7XEPPMSRW7M\ 7IZIR= =IEV3PHW

36 | AR ABIAN HORSE TIMES

;EXGLJSV1MWXIV1EKRYQEXXXLMW]IEV´W'EREHMERERH972EXMSREP'LEQ QTMSRWLMTW [MXL.SI%PFIVXMMR77IRMSV7XEPPMSRWERH1MGLIPPI%QVMGOMR%38, ,7XEPPMSRW


&RQWDFWXVWRGD\IRUPRUHLQIRUPDWLRQRQRXUYHU\ H[FLWLQJIUHHEUHHGLQJLQFHQWLYHV

APR IL 2010 | 37


&KHVWQXWKLOO HVWQXWKLOO HVW WQXWW LO LOO OO Arab A rabiians an s

4VITEVMRKERHTSPMWLMRK SRIWXEVEJXIVERSXLIV

2010 U.S. & Canadian National Futurities Bound

[MXL.SI%PFIVXM

va

ѱѱѱ ѱɜɜȣ ɜȣȐɉ ɉɄɬȐɑɄ ɄȘ4 4ɄȽȐɜѳ 7MV**EQIW,&:\'LEQTEMRI26SWIWF]1EKRYQ Q4W]GLI 4YVIFVIH7XEPPMSRˆ1YPXMTVSKVEQ2SQMREXIHˆ77' '-('PIEV 3[RIHFF]:ER]E%VEFMERWERH7XERHMRKEX'LIWXRYXLMPP%VEFMERW

6IKMSR'LEQTMSR8[S=IEV3 3 3PH'SPX 8[S8MQI+VERH'LEQTMSRR7XEPPMSR

38 | AR ABIAN HORSE TIMES

;EXGLJSV:%8LSQEW'VS[RIEXXXLMW]IEV´W'EREHMERERH972EXMSREP'LEQ QTMSRWLMTW [MXL.SI%PFIVXMMR*YXYYVMX]'SPXW


6SHFLDOEUHHGLQJLQFHQWLYHVIRUEUHHGLQJVERRNHG EHIRUH-XQH&RQWDFWXVIRUH[FLWLQJGHWDLOV

APR IL 2010 | 39


&KHVWQXWKL &KHVWQXWKLOO HVWQXWKL HVW WQXWW LO LOO OO Arabiannss Arabian

4VITEVMRKERHTSPMWLMRK SRIWXEVEJXIVERSXLIV

2010 Scottsdale Reserve Grand Champion Gelding

7MV*EQIW,&:\76%%WLPI]&I]F]&I]7LEL 4VSYHP]S[RIHF].EQMI1ERKER

7GSXXWHEPI'LEQTMSR8LVII=IEV3PH+IPHMRKW ;EXGLJSV6SLEVE>S SLEEVEXXLMW]IEV´W'EREHMERERH972EXMSREP'LEQTMSRWLMTW [MXL.SI%PFIVVXMMR*YXYVMX]+IPHMRKWERH.EQMI1ERKERMR%38,+IPHMRKW 40 | AR ABIAN HORSE TIMES


42 | AR ABIAN HORSE TIMES


APR IL 2010 | 43


Eric finishes up at Cedar Ridge ...

TOP BRASS CRF Brass x Ferachask 2010 Reserve Champion AEPA English Futurity Available for purchase

For your next prospect or proven show horse — call 952-492-6590 or visit www.cedar-ridge.com

Jordan, Minnesota ~ The Ames Family

44 | AR ABIAN HORSE TIMES


he starts them too!

Making it happen — Eric Krichten APR IL 2010 | 45


S F

S p e c s

SHOCW T r o t t i n g

y e a r l i n g s

SF NITRO SHOC (SF Specs Shocwave x Doubletrees Lady Of Intrigue)

SF UNDER THE INFLUENCE (SF Specs Shocwave x SF La Reina)

SF SWEET INSPIRATION (SF Specs Shocwave x SF Sweet Elegance)

SF STONE WOODS N COOK (SF Specs Shocwave x Doubletrees Lady Of Intrigue)

W W W . S P E C S S H O C WAV E . C O M 46 | AR ABIAN HORSE TIMES

. . .


WAVE . .

G r o w u p t o b e t r o t t i n g s h o w h o r s e s ! Please ask about our sale horses.

2004 U.S. National Champion English Pleasure Junior Horse 2005 & 2006 U.S. National Reserve Champion English Pleasure

SF STICKER SHOC (SF Specs Shocwave x Shes Real Bad) 2009 U.S. National Reserve Champion Half-Arabian English Pleasure Futurity

SF AFTERSHOC (SF Specs Shocwave x SF Sweet Elegance) Unanimous 2009 Scottsdale Champion Arabian Performance Association Saddle Seat Pleasure Futurity

Limited breedings available

FOR BREEDING AND SALES INFORMATION, CONTACT: JACK OR ALICIA PACE STONEHEDGE FARMS, LLC METAMORA, MICHIGAN PH: 810-441-1065 OR 248-240-2124 JACK403234@YAHOO.COM STANDING AT STACHOWSKI FARM, INC. JIM & PETER STACHOWSKI MANTUA, OHIO PH: 330-274-2494 INFO@STACHOWSKI.COM

APR IL 2010 | 47


DAVINCI FM

Cover Story:

Da Vinci FM by Mary Kirkman not surprising; already, It was rainy in Paris on through the week, curious Saturday, December 5, horsemen had drifted over 2009. At Paris-Nord to the Lutetia stalls for Villepinte Exhibition a glimpse of Da Vinci. Centre, not far from Anticipation was Charles DeGaulle running high. Airport, the modern glass and steel exhibition “It was the Salon,” says halls were colorless Lutetia Arabians’ Gerald against the cold sky. Kurtz, who represents Inside Hall 5, however, the stallion in Europe. where the Arabian “Everyone was looking for World Championships a stallion for the breeding were going on, the season. Everybody was atmosphere was electric. really, really interested to Exotic horses posed for see Da Vinci; he attracted the judges, one even people like a magnet. better than the next, When they saw him, and the crowd hummed many said they couldn’t with appreciation. And believe how beautifully there was an added his eyes were set, how big excitement: This was the they are, and how typey day that the American he is.” stallion Da Vinci FM, brought all the way from Why send an the United States just to Da Vinci FM (Versace x Full Moon Astar) already-successful stallion meet European horsemen 4,500 miles away, when the miracles of transported in person, would be presented after the show. and frozen semen could satisfy breeders? The trip was the brainchild of Kurtz and Midwest’s Travis Rice, When the last class of the afternoon was over, nearly who noticed that the few sources of Versace blood in 400 people, almost all owners and breeders, headed for Europe had been very well received. The Versace son the area assigned to Lutetia Arabians. Among them Da Vinci FM, already building a strong stud career in were Jim and Sally Bedeker of Morris, Ill., Da Vinci the United States and proving a reliable source of his FM’s owners, and Midwest’s David Boggs, who has attributes, seemed especially qualified to nick well with managed the stallion’s breeding career since the couple many European-preferred bloodlines. And while videos acquired him in December, 2007. The Bedekers with might provide a record of his quality, they did not always several family members were making their first trip to deliver what Kurtz calls his “character”—that intangible France and to the Salon, and the warm welcome of the assurance a stallion can offer simply with his presence. continental Arabian owners pleased them. But it was

48 | AR ABIAN HORSE TIMES


DAVINCI FM

When the Americans came home, Da Vinci FM remained in France for three months at Lutetia Arabians, in the picturesque Normandy countryside, banking semen. “We were able to freeze about 45 to 50 portions,” Kurtz says. “During his stay, all were sold; only a handful are left, which we are reserving for very special mares. He’s an outstanding horse, and he really has it in his bloodline.”

years, so even at home in the U.S., there is only his more limited earlier exposure to go on. But so far, overseas interest reflects a high number of Polish and Polishrelated mares, along with straight Egyptian individuals. Bookings range from Sweden to the Middle East, along with Janów Podlaski and a selection of private breeders in Poland.

At home in Minnesota, Midwest watched the stallion’s book bloom with increased awareness from overseas. “There was some interest before he went to Europe,” concedes Midwest Breeding Manager Judi Anderson. “But seeing the stallion in person makes a big difference.”

“Da Vinci is a horse that fits very much for European breeders,” observes Gerald Kurtz. “He has something that we have lost a little bit here—size and frame, and that kind of beautiful type. And he has not only Versace, but also a different female line. It’s a good combination.”

Most impressively, among the new clients was Poland’s venerable Janów Podlaski State Stud; its director, Marek Trella, had been at the Salon, and the introduction resulted in an order for 20 Da Vinci FM breedings. Trella, who had noted the presence of an important Janów mare generations back in the stallion’s tail female line, had been following Da Vinci for some time—watching his foals to see how they expressed his pedigree—and needed only to see him in person. “Marek told me that when he saw him in the flesh, he was very impressed because Da Vinci is very athletic and of good character,” reports Kurtz. “He was fascinated with Da Vinci’s eyes, and felt he would fit very well with Janów’s mares.”

Da Vinci FM returned to the U.S. at the end of February and passed a month of regulation quarantine in Florida, where Jim and Sally Bedeker got to see him more often than they are able to when he is at home in Minnesota. Then he returned to Midwest and took up his stud duties for the 2010 season. With Scottsdale in the record books, there was buzz on a number of fronts: Presented at a Midwest gala, Goddess of Marwan’s 2010 filly by Da Vinci FM brought down the house; in the show ring, the stallion’s daughter Da Joia (from the Magnum Psyche daughter, DD Crown Jewel) was named Scottsdale Champion Yearling Filly. She was subsequently sold to Brazil—where, last fall, the Da Vinci FM daughter Gabriella ORA, out of the Padrons Mahogany mare Mahogany Saarah, had been named a champion. The records are piling up, along with the statistical data to determine the bloodlines that work best with him.

Cathy Murphy Wright, who bred Da Vinci FM and has studied his influence, nods that the Polish interest is understandable. “I’ve always thought Da Vinci would do well with the Polish horses,” she says. “The Polish people have a certain kind of horse, and Da Vinci, to me, has the physical characteristics to complement them—and he backs that up genetically. They have attributes that can help him and he has things that will help them.” Asked for specifics, she replies, “He is very consistent. His shoulder will generally complement; he has a great shoulder and wither. He has the size, he’s got really good legs (nice, short cannons, long forearms and good joints), and a big, long hip. And then those faces—the beautiful eyes, set low, the real wide forehead, and the shortness of the muzzle. He’s so dominant in that sort of thing.” It is too early to tell yet which European-oriented crosses will work best with Da Vinci FM; he has been bred extensively (crops of roughly 100 each year) for only two

So far, Da Vinci FM has demonstrated his value through his quality. He burst on the national scene when he was named 2007 U.S. National Reserve Champion Stallion, showing with Dan Bergren. His stud career was launched with his first crop of foals, which yielded such stars as MPA Giovanni, U.S. National Champion Futurity Colt and Scottsdale Champion Colt, and now a successful sire in his own right. And day to day, despite his ability to dazzle in the show ring and at presentations like the one at the Salon du Cheval, Da Vinci FM exhibits the tractable temperament prized by horsemen at home and abroad. “He’s wonderful,” says Judi Anderson, who handles the stallion. “He’s very laid-back and mellow.” Da Vinci FM has done his job. Now he’s just waiting, as the breeders come to him.

APR IL 2010 | 49


Spring is Magical ... as the Foals arrive at Midwest

50 | AR ABIAN HORSE TIMES


UNITED STATES NATIONAL RESERVE CHAMPION STALLION

VERSACE

X

FULL MOON ASTAR

APR IL 2010 | 51


52 | AR ABIAN HORSE TIMES


Sired by

APR IL 2010 | 53


JIM & SALLY BEDKER GEMINI ACRES

54 | AR ABIAN HORSE TIMES


David Boggs, the man at the helm of Da Vinci’s career today, expresses well, the foundation and the hope: “Da Vinci FM is truly a gift from God to Jim and Sally Bedeker—and they to him. He is just the right horse for just the right people at just the right time. We all know we have something very special in our hands and every day is thrilling! “When did it all begin? I had always admired Da Vinci from a distance. I knew almost every horse in his dam’s pedigree, many from my beginnings in this world of the Arabian horse. One stallion that stands out in my memory is Heritage Elegant—the consummate model Arabian horse of his era. (For a time he was a Minnesota stallion and later played an important role in the Wright family’s breeding program.) “Da Vinci has been uniquely blessed from the beginning, by the people who surround and support him. His breeder, Cathy Murphy Wright; is an extremely accomplished horsewoman, a great breeder, and an ambassador for our breed. Cathy is dedicated to the well-being of this stallion—then, now and forever. “Most importantly, Da Vinci is a very powerful and prepotent stallion—He is a Genetic Giant! There are no words to express how spectacular our second Da Vinci foal crop is, here at Midwest. We invite you to come visit and see for yourselves ... you won’t believe your eyes."

APR IL 2010 | 55


56 | AR ABIAN HORSE TIMES


Gemini Acres J IM

F OR

AND

S ALLY B EDEKER ~ M ORRIS , I LLINOIS

~ M IDWEST B REEDING AND T RAINING S TATIONS DAVID BOGGS ~ 612-328-8312 ~ MIDWEST@SBWIRELESS.NET TRAVIS RICE ~ 612-919-6134 ~ TRAVISMIDWEST@SBWIRELESS.NET JUDI ANDERSON ~ 612-328-1057 ~ JUDIMIDWEST@SBWIRELESS.NET

BREEDING INFORMATION

WWW.MIDWESTARABIAN.COM APR IL 2010 | 57


E

L

E

C

T

R

I

F

Y

I

N

G

EF Kingston x Angelina DPA

Scottsdale Champion Breeders Sweepstakes • Scottsdale Signature Stallion • Iowa Gold Star Stallion owned by: OAK RIDGE ARABIANS • Don & Janey Morse • Freeport, IL

www.MidwestArabian.com 58 | AR ABIAN HORSE TIMES


2010 Scottsdale Champion Three & Four-Year-Old Colt AAOTH Scottsdale Reserve Champion Stallion AAOTH with Donny Morse APR IL 2010 | 59


The 2009 United States National Champion

... Invites your inspection and welcomes your mare to his Harem. Thank you to the purchasers of the first 20 breeding rights now subscribed.

60 | AR ABIAN HORSE TIMES


DA VALENTINO x Sol Natique, sired by Solstice Scottsdale Signature Stallion • Iowa Gold Star Stallion

owned by: OAK RIDGE ARABIANS • Don & Janey Morse • Freeport, IL STONE RIDGE ARABIANS • Dan & Maureen Grossman • Bloomington, IN

For more information please contact:

www.MidwestArabian.com

APR IL 2010 | 61


E-MARKETING 2010 foal in due to 9!!!! s e r a 0 ur m , 20 ate yo ber 3e1at the Nomin fore Decemco Futurity mpet -Hand Be er to

“Quit Beeatin’ Your G ums And n Nominate Your Dames Now!”

g In In ord Yearlin AEPA ckeye hio Bu

O

2010 Ma are N

ominations

Due December 31, 20

09

CLLICK HERE

FOR NOMINATION F

ORM

22010 THEME:

Roaring 20’s

“It’s The Berries” l

as wel

s tallion ailable at: ated S rms av Nomin ing of omination fo st li ll Fu le n nloadab as dow .com

turity

Labor Day Weekend - Des Moines, Iowa

www.goldstarfuturity.com

asurefu

glishple

en rabian www.a

IOWA GOLD STAR FUTURITY

Call for pricing and e-blast scheduling today!

800-248-4637 Kandi Menne ~ kandi@ahtimes.com Mike Villaseñor ~ mikev@ahtimes.com John Diedrich ~ johnd@ahtimes.com

62 | AR ABIAN HORSE TIMES


EASY, EFFECTIVE, ECONOMICAL

WWW.AHTIMES.COM APR IL 2010 | 63


Ready to win Roses for Youth or Amateur rider Nyte of Temptation

+

(A Temptation x Toi Jabaska+//) Sire and Dam are both National Champion English horses $25,000

2009 Canadian National Champion Arabian English Pleasure Junior Horse 2009 Region 3 Champion Arabian English Pleasure Junior Horse 2009 Region 3 Champion Arabian English Pleasure AAOTR 2009 Region 5 Champion Arabian English Pleasure Junior Horse 2009 Region 4 Reserve Champion Arabian English Pleasure Junior Horse 2008 Region 5 Champion Arabian English Pleasure Junior Horse 2008 Region 3 Champion Arabian English Pleasure Junior Horse

Blazin Hearts (Pension CAHR x Jeweled Spirit) Sire is a National Champion English Pleasure horse and dam is the producer of Multi-National Champion Blazin Fire $25,000 2008 Region 3 Champion Half-Arabian English Pleasure Junior Horse 2008 Region 4 Champion Half-Arabian Park 2008 Region 4 Reserve Champion Half-Arabian English Pleasure Junior Horse 2008 Region 5 Champion Half-Arabian Park 2008 Region 5 Reserve Champion Half-Arabian English Pleasure Junior Horse

Contact: Michael Whelihan 6620 320th Street East • Eatonville, WA 98328 (253) 875-5033 ~ Barn • (253) 224-4073 ~ Cell 64 | AR ABIAN HORSE TIMES

Owned by: Richard & Janet Thompson Park City, Utah


APR IL 2010 | 65


The ne xt

g e n e r at i o n

NOW ARRIVING! sired by the Varian stallions *Jullyen El jamaal and Audacious PS

Sweet Carolline V / 2010 colt by *Jullyen El Jamaal

2010 filly (Audacious

PS x La Kijan)

2010 colt Sweet Silk V) (*Jullyen El Jamaal x

SC Crystal Pistol / 2010 colt by Audacious PS

We invite your inquiries and visit ... www.VarianArabians.com 66 | AR ABIAN HORSE TIMES


Extreme yearling fillies sired by *Jullyen El Jamaal ... Kwesturas Juell V (*Jullyen El Jamaal x Kashmir NA) Watch for her at the World Cup show with Matthew Gale

*Jullyen El Jamaal x Sweet Shalimar V

Santa Barbara Juell V - Waiting for her debut in the 2012 Arabian Futurity Filly class ... before establishing herself in the Varian Arabians broodmare band. VARIAN ARABIANS

SHEILA VARIAN ~ 805-489-5802 ~ ARROYO GRANDE, CALIFORNIA APR IL 2010 | 67


Celebrating The Industry by Colleen Scott

photos by Victor and Lori Ricigliano Jeffrey Carter Mason

68 | AR ABIAN HORSE TIMES

There is much to love about the annual Scottsdale Show—location, weather, competition, food, shopping—the list is endless. This year, the Arabian Horse Times added yet another element—the Readers’ Choice Awards Celebration. Organizers of the first-ever extravaganza were Times Publisher Lara Ames and long-time Advertising Account Executive Mike Villaseñor. They pulled out all the stops and created an one-of-a-kind event that not only celebrated the breed, but also provided a great opportunity for fellowship. The evening’s proceeds (including table sales and a live auction) were all contributed to the Horsemen’s Distress Fund—just more icing on the cake.


APR IL 2010 | 69


READERS' CHOICE AWARDS

uests were welcomed to the cocktail hour with a sky-sweeping movie premiere-type spotlight, red carpet, and live video interviews at the hacienda-style Monterra at WestWorld. (See www.ahtimes.com for Scottsdale video coverage.) For many who remember a time when parties were the norm and not the exception, the return to providing opportunities for celebration and networking is a welcome one. “I’m thrilled,” said industry leader Sheila Varian (who would later be named Breeder of the Year) in a red carpet interview as she arrived. “It makes me feel terrific. It makes me feel like maybe we’re gathering a little bit of our chutzpa back again.” The combination of recognizing the best in the industry, the camaraderie with fellow horsemen, and giving back to the community via the Horsemen’s Distress Fund made the first-ever event something memorable and one many in attendance hope the Times repeats in future years.

70 | AR ABIAN HORSE TIMES


READERS' CHOICE AWARDS

2009 A R A B I A N H O R S E T I M E S R E A D E R S ' C H O I C E A W A R D W I N N E R S Breeder Of The Year • Varian Arabians

Half-Arabian Hunter Horse Of The Year • Everlastin Love

Horseman Of The Year • Gordon Potts

Purebred Halter Horse Of The Year • Bey Ambition

Horsewoman Of The Year • Vicki Humphrey

Half-Arabian Halter Horse Of The Year • Shutup And Dance

Trainer Of The Year • Jim Stachowski

Purebred Sport Horse Of The Year • OKW Entrigue

Adult Amateur Of The Year • Robin Porter

Half-Arabian Sport Horse Of The Year • Lord Of The Ring

Youth Exhibitor Of The Year • Jessica Medved

Purebred Working Western Horse Of The Year • Al-Marah Matt Dillon

Show Official Of The Year • Cindy Clinton

Half-Arabian Working Western Horse Of The Year • BSF Gunsmoke

Instructor Of The Year • Lisa Jo White Purebred Horse Of The Year • Afires Heir Half-Arabian Horse Of The Year • Revelation JF

Purebred Specialty Horse Of The Year (Driving, Show Hack, Side Saddle, Native Costume)

• Afires Vision Half-Arabian Specialty Horse Of The Year (Driving, Show Hack, Side Saddle, Native Costume)

• Capt Jack Sparrow PGA

Sire Of The Year • Afire Bey V

Photographer Of The Year • Mike Ferrara

Rising New Star Award

Show Of The Year • Iowa Gold Star

(Trainer Under 30 Years Of Age)

• Jason Krohn Best Team (Farm) Spirit Award • Midwest Training Centre Purebred Saddle Seat Horse Of The Year • Afires Heir Half-Arabian Saddle Seat Horse Of The Year • Revelation JF Purebred Western Horse Of The Year • Sunsational Kid Half-Arabian Western Horse Of The Year • Ima Rock Star

In 2009, what was your favorite advertisement featured in the Arabian Horse Times? • Strawberry Banks Farm Stallion Section August 2009 issue, Arabian Horse Times In 2009, what was your favorite editorial story of the year in the Arabian Horse Times? • An Amateur Point Of View Articles by Russ Vento Since last year's Arabian Horse Times Readers' Choice awards, what has been your favorite front cover? • March 2009 - DA Valentino

Purebred Hunter Horse Of The Year • KM Bugatti

APR IL 2010 | 71


READERS' CHOICE AWARDS

72 | AR ABIAN HORSE TIMES


READERS' CHOICE AWARDS

Besides the Arabian Horse Times commitment to the event, many patrons stepped up to make the evening possible. Jay Allen, president of the Arabian Horse Association of Arizona, says sponsoring the event was a natural for the club. “We feel that it is important to support events that honor outstanding horses, events and people in the industry. The Readers’ Choice Awards were held during the Scottsdale Arabian Horse Show, and there is no better time for the horse community to come together to celebrate the accomplishments of the greats in the industry than during this wonderful show.” The National Show Horse Registry and Ohio Buckeye Show were also sponsors, a commitment easy to make says Cindy Clinton, who handles public relations and promotions for the NSH Registry and manages the Ohio Buckeye. “The NSHR and the Buckeye are dependent upon the people that make up our industry, and any way we can help reward them for their accomplishments can only help our industry. This program also gave back to those that supported them, which made it a much easier financial decision,” she says. Melissa Holmes of Show Season concurs. “We get a lot from the horse community. This was a great way to give back to them. It was also a very positive way to start the show,” she says. The Minnesota Breeders Association also supported the event as a sponsor, with president Tom Mensing saying, “We try to be supportive of anything in the industry that is supportive of our community and our breeders.” APR IL 2010 | 73


READERS' CHOICE AWARDS

The Awards With 32 categories, emcee and auctioneer Greg Knowles had his work cut out for him to keep the crowd of 400 engaged and entertained. Knowles capably rose to the occasion, with his quick wit and comedic timing. One of the biggest laughs of the entire evening came when Gordon Potts was announced as Horseman Of The Year. Knowles kept encouraging Potts to run to the podium “like a halter guy would.” However, Potts continued at what might be called more of a western jog. When he did reach the podium, Potts kept the crowd laughing as he shared that many times he had written and rehearsed speeches, but he rarely had the opportunity to deliver them. Other award recipients included Robin Porter as Adult Amateur Of The Year. Pitted against some stiff competition in Mike Beethe, Joe Frizzell, Katie Harvey, Lori Lawrence and Carol Skeuse-Hart, Porter said she was surprised when her name was called. She shouldn’t have been too surprised given the year she had in both the English and western divisions aboard Toi Store CRF, Gotta Wear Shades, Caliente Virtuoso and Arktik CAHR. Porter, who grew up showing, says success in the show ring is about multitasking. “You’ve got to be able to ride the horse, get seen, watch the judges—really pay attention,” she relates. “You’ve also got to listen to your trainers.” Fellow nominee Joe Frizzell walked home with the award for his horse Sunsational Kid V in the Purebred Western Horse Of The Year

74 | AR ABIAN HORSE TIMES


READERS' CHOICE AWARDS

category. The dynamic duo had a sensational year, winning every class at the Ohio Buckeye Show, every championship at Region 11, and championship and reserve titles at the U.S. Nationals. “He’s such a fun horse to ride,” says Frizzell of the stallion. “He always seems to be in a good mood and makes me smile when I just ride him into the arena.” In the Rising New Star Award category, trainer Jason Krohn got the nod and gave his father a lot of the credit. “As trainers we are nothing without our great horses, and we are nothing without our great customers. That being said, I would also be nothing without my dad.” Krohn’s year was a memorable one in that he captured his first professional U.S. National Championship title in the Half-Arabian Country English Pleasure Junior Horse class aboard KRA Im On Fire. “Taking the victory pass with that rose blanket was the biggest moment of my career, and it is one that I will never forget,” he says. Krohn also

APR IL 2010 | 75


READERS' CHOICE AWARDS

points out an amateur title as a big moment in 2009. “Martha McCollough was U.S. National Champion in the Half-Arabian Country English Pleasure Maturity. Not only was it her first national title, but it was also my first amateur client championship. Martha was a star.” Another star of the evening was Afires Heir, who won in two categories—Purebred Saddle Seat Horse of the Year and Purebred Horse of the Year. In accepting the award on behalf of Afires Heir, Joel Kiesner gave a very convincing whinny. While the Afires Heir team was excited about his victory in the Saddle Seat category, it was the win in the overall Purebred Horse Of The Year category that was really special. “To have people from across the disciplines vote for him says a lot about him. He is such a special animal to us; it warms our hearts that other people see in him what we see,” says Kiesner. “We’d like to thank the Arabian Horse Times and all the people that voted for him.” Besides honoring horsemen, horsewomen and horses, the Readers’ Choice Awards also included recognition for those who contribute to the industry in other ways. Cindy Clinton, who manages the Ohio Buckeye, Region 14 and the National Show Horse Finals, was named Show Official Of The Year. “It means more than people realize,” Clinton says of the award. “I love managing horse shows and to be recognized for doing something you love makes it so much more special.” Mike Ferrara, voted Photographer Of The Year, echoes Clinton. “The awards are a wonderful way to give recognition to some people who never get any recognition. It is nice that people notice your hard work.” Ferrara was also an event patron, and says he can’t think of a better cause to support than the Horsemen’s Distress Fund. When it came to the Best Team (Farm) Spirit Award, Team Midwest took home the honors with Don Morse accepting the award on behalf of Midwest Training Centre. “We have a lot of fun together,” he says. “All the Midwest

76 | AR ABIAN HORSE TIMES


READERS' CHOICE AWARDS

customers get along really well. We don’t just hang out at the horse shows together; we also hang out at the farm a lot together.” Show Of The Year went to the Iowa Gold Star Futurity, who had a large Roaring 20s contingency in attendance. Organizers have centered the show on a theme since 2007, and this year the lead characters are already stirring up trouble. Golden Johnny Star (Russ Reynolds) and Diamond Rita (Kelly Reynolds) head up “The Gold Star Gang,” which also includes: “Lucky” Lonnie Malloy, Candy “Stats” Malloy, Mikey “The Bruiser,” Lola “The Showgirl,” and a couple known as “The Cleaners.” Other characters ready to debut at the September show include “The Joker” and “Lady Jade,” as well as “The Ladykiller,” “Krazy Katie,” and “Major Mikey O’Neil.” Each of the characters has its own story accessible through the show’s website. As if managing the show isn’t enough work, organizers spend countless hours on the themes each year. “It keeps things fresh and fun. It’s something no other show does, and it allows people to let down their guard and relax at the show. This is a horse show, and the bottom line is that we’re all here to have fun. Isn’t that really why we do all of this?”

APR IL 2010 | 77


READERS' CHOICE AWARDS

The Horsemen’s Distress Fund Auction Although all proceeds from table sales were contributed to the Fund, event organizer Mike Villaseñor took things a step further by introducing an auction of one-of-a-kind unique opportunities for Arabian horse enthusiasts. The items offered for purchase were truly priceless, and the generosity of the bidders reinforced the Arabian horse industry’s commitment to one another (Table sales and auction items contributed a combined total of $44,000 to the Fund.) One unique auction item was dinner for 10 at Cedar Ridge Arabians along with a ride in the wagon pulled by the famous Percheron draft horse hitch. Bidding was fast and furious, with a conglomerate of Don & Janey Morse, Roger & Stephanie McMahon, Dan & Maureen Grossman, and Jim & Sally Bedeker eventually beating out the competition. “We haven’t been to the Ames place yet,” says Don Morse, “but we are all very much looking forward to it. The Ames family has been in this business a long time, and we all really like the whole family. The money went to a great cause, and we’re really excited.” Other once-in-a-lifetime opportunities included rides on the national champion horses Revelation JF (National Champion HalfArabian English Pleasure Horse) and Gotta Wear Shades (National Champion English Pleasure Junior Horse). Ken, Diane and Loren Hicks and Robin Porter donated the rides, respectively. Besides the opportunity to ride these spectacular horses, the chance to drive and handle national champions was also offered during the evening. Strawberry Banks Farm and Barbara Chur donated the chance to drive A Temptation. Taking things a step further, David and Terry Anne Boggs contributed their training services and the opportunity to show multi-titled Shutup And Dance at Youth Nationals in 2010.

78 | AR ABIAN HORSE TIMES


READERS' CHOICE AWARDS

Other auction items included a breeding to Hucks Connection V (who would capture the Scottsdale Liberty Championship title later in the week) and a breeding to the American Saddlebred Undulata’s Nutcracker, who at 9 has already sired 16 World Champions and five Reserve World Champions. Derek Molina of Molina Fine Jewelers in Scottsdale contributed a set of men’s and ladies’ stainless steel watches. When a bidding war broke out between Annette Stevens and Andrew Sellman, he graciously contributed a second set. “I wanted to be a part of the Readers’ Choice Awards because of my daughter Athena North Molina, my wife, Myranda Molina, and Taryl Pearson, the executive director of the Arabian Horse Association of Arizona,” states Molina. The three of them got me involved in the horse world and made me love and appreciate the companionship that a girl or boy can have with these amazing horses. I relate my daughter’s horse shows to my jewelry business. Spectators only see the end result, but they rarely see the hard work and training that goes behind the finished product. Molina Fine Jewelers and I are committed to supporting the Arabian horse community. It’s just a little of what we can do to give back to the Arabian horse community and its amazing people.” Molina also donated goody bags for the award recipients.

APR IL 2010 | 79


READERS' CHOICE AWARDS

The Horsemen’s Distress Fund Auction “There is a little bit of a misconception out there that the Horsemen’s Distress Fund, because it was started under the auspices of the Arabian Professional and Amateur Horseman’s Association (APAHA), is only available to professional horsemen,” states Mary Trowbridge. “That is not the case. The fund has always been intended to be very broad-based, industry-wide and available to trainers, riders, breeders— anyone who needs assistance during a time of unexpected crisis.” The fund is a separate 501 ( c) 3 organization from the APAHA and managed by an independent Board of Directors, which includes: Mary Trowbridge, Mary Jane Brown, Stan Morey, Van Jacobsen, and Reverend G.T. Schramm. While many fund-raising events and drives have been conducted in the past for specific individuals, Trowbridge says the Readers’ Choice Awards was the first event to raise funds for the Distress Fund as a whole. She describes the event as being one that not only provided fellowship, but also an opportunity to give back to the entire Arabian horse community.

80 | AR ABIAN HORSE TIMES


READERS' CHOICE AWARDS

“We’ve all spent a lot of money back and forth with each other,” she says. “Yet, what happened as a result of this event is that we spent money giving back to the whole community. We had people investing money that went toward the common good. The donors of the auction items and the bidders and buyers were truly heroic in the amounts of money they spent,” she says. “I can’t thank the Arabian Horse Times, Lara Ames and Mike Villaseñor enough for organizing and hosting this event. The night was a win-win for everyone. It was a fun evening and got people involved—just a great night of fellowship and celebrating the Arabian horse.” ■

APR IL 2010 | 81


READERS' CHOICE AWARDS

Patrons The event celebrating the Arabian Horse Times’ Readers’ Choice Award recipients would not have been possible without the support of the following patrons. Platinum Patrons

Markel Iowa Gold Star Futurity Gold Patrons

Schneiders Show Season Minnesota Breeders Association National Show Horse Registry Ohio Buckeye Show Arabian Horse Association of Arizona Silver Patron

Ferrara Photography

The Arabian Horse Times would also like to thank everyone who purchased a table, as the entire table sale proceeds were contributed to the Horsemen’s Distress Fund. The following also participated in the Horsemen’s Distress Fund Auction, helping raise a combined total of $44,000 in contributions to the Fund. A special thanks to both the donors of these incredible once-in-a-lifetime opportunities and their purchasers. Breeding to Undulata’s Nutcracker, contributed by Kris Swanson & David Jampsa, Swanson & Jampsa, LLC, purchased by Dick & Lollie Ames. Ride on reigning National Champion Half-Arabian English Pleasure Horse Revelation JF, under the direction of Vicki Humphrey, contributed by Ken, Diane and Loren Hicks, Baywood Farms, purchased by Burrline, LLC, Cole, Tracy & Katie Burr. Ride on reigning National Champion English Pleasure Junior Horse Gotta Wear Shades, under the direction of Shawn Rooker, contributed by Robin Porter, Crescent Creek Farms, purchased by Whispering Pines Arabians, John & Sharon Ames. 82 | AR ABIAN HORSE TIMES

Opportunity to drive National Champion English Pleasure and Pleasure Driving A Temptation, contributed by Barbara Chur, Strawberry Banks Farm, purchased by Joni Hyrick. Breeding to Hucks Connection V, contributed by Jacques Lapointe, Diamond Hill Arabians, purchased by Eric Rosa. Men’s and Ladies’ Molina Watches, two sets contributed by Molina Fine Jewelers, purchased by Andrew Sellman and Annette and Brent Stevens. Opportunity to show Multi-National Champion Shutup and Dance at Youth Nationals in 2010, under the guidance of Midwest Training Centre, contributed by David and Terry Anne Boggs and Family, purchased by Whispering Pines Arabians, John & Sharon Ames. Dinner for 10 at Cedar Ridge Arabians and a ride in the World Famous Ames Percheron Hitch, donated by Dick and Lollie Ames, Cedar Ridge Arabians, purchased by Don & Janey Morse, Roger & Stephanie McMahon, Dan & Maureen Grossman, and Jim & Sally Bedeker.


READERS' CHOICE AWARDS

Arabian Horse Times' staff (l to r) John Diedrich, Lara Ames, Wayne Anderson, Kandi Menne, Colleen Scott, and Mike Villaseñor.

The Readers’ Choice Awards 2011 Three years ago, the Arabian Horse Times instituted the Readers’ Choice Awards as a way to recognize excellence in the Arabian horse industry. The program is unique in that it provides a venue in which to recognize the horses, riders and trainers, as well as all those things that support the industry such as advertising, photography, show management and team spirit. The Readers’ Choice Awards is unique in that it allows everyone an opportunity to vote. Readers of the Arabian Horse Times can not only nominate their favorite people and horses, but they can also vote for them. No membership or subscription is required—merely a love for the Arabian horse. Have a favorite in a category we’ve discussed here? Be sure to watch for the call for nominations in October and cast your vote.

APR IL 2010 | 83


I would like to take this opportunity to thank the readers for the great honor of being named Arabian Horse Times’ Instructor of the Year. Thank you also to the many individuals who made this award possible, including my incredibly talented riders, and especially to all of my friends and colleagues in the Arabian Horse Community. Your outpouring of love and support, and the many efforts and kind gestures that you have extended to my family and me this past year are very much appreciated and will never be forgotten. Although there will always be sadness in our hearts for what we have lost, we are looking forward to a bright future and a year full of continued success. ~ Lisa Jo White

John W hite Stables

Lisa Jo White • www.johnwhitestables.com • Woodstock, IL 60098 815-648-4458 • 815-648-1304 fax • E-mail: whitelisajo@aol.com 84 | AR ABIAN HORSE TIMES


2009 Readers' Choice Award

ADULT AMATEUR OF THE YEAR

Robin Porter would like to dedicate this honor to my Mother whose love of the Arabian horse gave me my start at a very early age in this amazing breed. This year I realized one of my lifelong dreams, winning my first U.S. National Championship. Most importantly, I was able to look up in the stands and wave to my mother. Sadly, that would be the last time. I have also been blessed with great horses and extremely dedicated and talented trainers, Shawn and Carmelle Rooker and Josh Quintus. Without the love and support of my husband, Mike and my Mother-in-law, Maudi, none of this would have been possible. Thanks to all of you who have made my dreams come true. Robin CRESCENT CREEK FARMS Robin Porter 2357 Advance Rd, Weatherford, TX 76088 817-594-7027 crescentcrkfarms@aol.com www.crescentcreekfarms.com

APR IL 2010 | 85


2009 Readers' Choice Award

RISING NEW STAR

Jason Krohn hank you to everyone who took the time to vote for the RCA. A special thanks goes out to all my great customers– without them none of this would be possible. I have also been blessed with a barn full of talented horses who have contributed to my success. I want to dedicate this New Rising Star Award to my dad. He has put his heart and soul into the Arabian breed and all though he has not been recognized with awards, my sucessful career is proof of his dedication. Without his tutelage and guidance, I would not be where I am today! Jason

Megan Veitenheimer and Jason Krohn on the Arabian Horse Times Readers' Choice Awards Red Carpet

OAK HAVEN ARABIAN HORSE FARM Trainers: Blake & Jason Krohn 17645 CR 4104, Lindale, TX 75771 903-882-5205 barn • 903-882-1400 fax www.oakhavenarabians.com Jason Krohn and 4 Time National Champion KRA Im on Fire 86 | AR ABIAN HORSE TIMES


Voted the 2009 Readers' Choice Award

SHOW OF THE YEAR

HEME: 2009 T

i ld W d l i W We st

The Gold Star Gang dressed to kill in their Roaring 20's attire for the 2009 Arabian Horse Times Readers' Choice Awards Ceremony.

MAKE PLANS TO ATTEND THIS YEAR'S SHOW!

20

Roa10riTng : 20’s HEME

Labor Day Weekend Sept 2-6, 2010 Iowa State Fairgrounds, Des Moines, Iowa

www.GoldStarFuturity.com APR IL 2010 | 87


Thank you to everyone who helped make Matt Dillon the AHT Purebred Working Western Horse Of The Year!

2002 Chestnut Purebred Arabian Stallion by AM Good Oldboy+ out of Al-Marah Dorer Proudly owned by: Linda & Bill Jacobs (603) 327-9444 Trainer: Gary Ferguson (903) 348-2700 For Breeding Information: Contact Linda Jacobs lrj448@aol.com • www.AlMarahMattDillon.com

88 | AR ABIAN HORSE TIMES

AHA Breeders Sweepstakes Nominated Sire Iowa Gold Star Nominated Stallion Colorado Breeders Cup Nominated Stallion *SCID Clear *Frozen Semen Available/Multiple Mare Discount

+


Arabian horse times Western

just five Years Old!

MultiNational Champion

ferarra

10 National Titles at

Pleasure Horse of the Year

A bright spot for today’s breeders! Proudly owned by Joe & Debbie Frizzell of Ames, Iowa • (515) 231-1297 For information on breeding to this sensational young stallion contact Jody Strand (319) 393-4816 www.StrandsArabians.com Sundance Kid V x Mane Street • Breeders Sweepstakes Nominated • IA Gold Star Stallion • SCID Clear

APR IL 2010 | 89


2010

SCOTTSDALE

Th e 2 0 10 Scot tsdale Leading Sir es by Christy Egan

Not only is the Scottsdale All-Arabian Show the largest and one of the most important Arabian horse shows in the world, it is also the first major American Arabian show of the year. It attracts the best of the current halter and performance show horses and allows thousands of breeders and owners to make astute evaluations of sires and their progeny all in one place at the beginning of the breeding season. The Scottsdale Leading Sire report is an important tool for mare owners internationally. This year, as always, these listings will confirm some of our expectations about established breeding sires and surprise us with revelations regarding those up-and-coming.

90 | AR ABIAN HORSE TIMES


2010

LEADING SIRES

Afire Bey V The 2010 Scottsdale Leading Sire of Halter and Performance is not a surprise. Afire Bey V (Huckleberry Bey x Autumn Fire) has been at the top of the listings for many years now and is again the leading all-time sire of champions in the Arabian breed. In the Arabian Horse Times Leading Sire lists, he is first on five, second on three and listed on 10 of the total 14 charts. His top Scottsdale stars were among the big winners on the first weekend at the youth show. Winning Afire (x Win Me Ribbons) won the Country English Pleasure Championship JOTR 14-17 and the English Show Hack JTR 17 & Under; Thee Aristocrat (x Just Aristocratic) was Champion in both the Western Pleasure JOTR and the JTR 13 & Under; Maverick Afire (x Mattabach) was Reserve Champion in both the Country English Pleasure JTR 13 & Under and the English Show Hack JTR 17 & Under, and Afires Freedom (x Just Alluring) was Reserve Champion in the Country English Pleasure, JOTR 14-17 and the English Show Hack AAOTR. AFIRE BEY V Naturally that was just the beginning. By the end of the 11 days of competition, 2010 Scottsdale champions sired by Afire Bey V included Accent Afire (x Autumn Flower), Champion Half-Arabian Mounted Native Costume JTR 17 & Under; Alexandria WB (x CW Basquelle), Mounted Native Costume AATR Champion; Afire Phantom BF (x Clover Hill’s Blazing Luck), Half-Arabian Country English Pleasure Junior Horse Champion; Americanbeautie (x Kelly Le Brock), HalfArabian Country English Pleasure Champion; Afires Vision (x Matoskette), Pleasure Driving Champion; Good Vibrationss (x The Small Town Blues), HalfArabian Pleasure Driving Champion; SA Rapid Fire (x PF Lady Cameo), Half-Arabian English Pleasure Champion; SF Spellbound (x Spectra PR), English Pleasure Champion AAOTR, and Valentino Afire (x Mattafoxx), English Pleasure Walk/Trot Champion 10 & Under. All together, 41 Afire Bey V get competed successfully, and his top sons and daughters won 13 championships and nine reserve championships at Scottsdale, all in performance competition. BASKE AFIRE

APR IL 2010 | 91


2010

SCOTTSDALE

Baske Afire Following closely behind his illustrious sire, Baske Afire (x Mac Baske) sent 30 sons and daughters into the fray at Scottsdale and ended up on 12 of the Arabian Horse Times Leading Sire charts led by five firsts and five seconds. Special Scottsdale week moments included a big championship win for Bonfire ROF (x Sing For Joy) in the Country English Pleasure and by ERA Thrillicious (x Koriene KWPN), who took the rose blanket in the HalfArabian English Pleasure Junior Horse. In The Line Afire (x El Milagro’s California Capers) won both the HalfArabian English Pleasure JTR and JOTR 17 & Under Championships, but perhaps the most talked about win of the show for Baske Afire was the important victory by ROL Fire Mist (x Firelite DGL) in the AEPA Saddle Seat Pleasure Futurity Championship. Baske Afire Scottsdale champions were almost evenly divided between Half-Arabians and purebreds this year, though the performance to halter ratio was two to one. Halter is where the Baske Afire get got their start and his daughter GA Clio Dulaine (x Flameworthy) was Scottsdale Champion Half-Arabian Saddle/Pleasure Type Senior Mare AAOTH and then stood reserve behind her three-time national champion paternal half-sister JB Hometown Hottie (x Petite Sweet) in the Half-Arabian Saddle/Pleasure Type Senior Mare Championship. GA Clio Dulaine won this same championship at Scottsdale in 2008. Also a big winner at the show for Baske Afire was Rohara Americanlegacy, one of numerous famous offspring of leading all-time Half-Arabian champion producer, Miz American Pie. Rohara Americanlegacy was Scottsdale Reserve Champion in both the Half-Arabian Stock/Hunter Type Halter Gelding and the AAOTH. At 11, Baske Afire is less than half the age of his famous sire and has only 65% of the registered offspring. His get were a dynamic and competitive presence at the 2010 Scottsdale show and together they won nine championships and seven reserves. In the final chart tallies, Baske Afire was just 70 points and 11 offspring behind Afire Bey V.

Magnum Psyche Magnum Psyche (Padrons Psyche x A Fancy Miracle) now has winning offspring that are evenly divided between performance and halter. This level of across-the-board breeding maturity from a longtime leading halter sire is pleasing and impressive. There were 30 Magnum Psyche get entered, and shown successfully at Scottsdale, winning three championships and four reserve championships (four in halter and three in performance). The group also accumulated over 30 top ten and top five awards. Additionally, Magnum’s offspring won eight first place ribbons, seven seconds and a dozen other ribbons. Magnum Psyche’s Scottsdale champions included DC Magnum Storm (x Rohara Eclipse), winner of the 5-YearOld Geldings both open and AAOTH and Champion Gelding AAOTH. SKF Magnum PI (x Jackie Monasis) won the Half-Arabian Stock/Hunter Two-Year-Old Gelding and the Half-Arabian Stock/Hunter Junior Champion Gelding title. In performance, JK Magnetic (x JK Angelbasksko) won the SSS Champion Western Pleasure Maturity ATR (5-Year-Olds). Magnums Fire At Will (x By The Grace), one of Magnum Psyche’s most impressive Scottsdale winners, loped off with reserve honors in the very competitive Half-Arabian Hunter Pleasure, AAOTR 36-54 Championship. He was also top ten in the Half-Arabian Geldings 4 & Older, JTH and placed well in HalfArabian Hunter Pleasure and Side Saddle. Magnums Three Hearts (x Mystic Moment) was reserve in the SSS Hunter Pleasure Maturity ATR (5-Year-Olds), while in halter, Miss Mini Mag (x Attaches Miss Kitty) was second in the Half-Arabian Filly 3 & Under JTH, the Half-Arabian Saddle/Pleasure Yearling to Two-Year-Old Filly AAOTH and the Half-Arabian Saddle/Pleasure Two-Year-Old Filly. She then took Reserve Champion honors in

92 | AR ABIAN HORSE TIMES


2010

LEADING SIRES

Half-Arabian Saddle/Pleasure Mare AAOTH. Finally, Rohara Hermes (x Flameworthy) won the Half-Arabian Stock/Hunter Two-Year-Old Filly class and was Reserve Junior Champion in that division.

Marwan Al Shaqab Arabian Horse Times’ Leading Purebred Halter Sire at the 2010 Scottsdale show was Marwan Al Shaqab (Gazal Al Shaqab x Little Liza Fame). Since the fall of 2008, “Marwan” has been the leading national halter sire in the United States and is also an international show ring sensation as a sire. Of the four most prominent breeding stallions at the 2010 Scottsdale show, Marwan Al Shaqab had the fewest number of offspring competing (24), was listed on the fewest charts (6), and was the only one of the four with no HalfArabian offspring in the ring. Even with these seeming limitations, his get fairly dominated the open purebred halter competition at Scottsdale. They won just three championships and two reserves … but oh my, what sweet smelling roses! The Marwan Al Shaqab daughter, 2008 World Champion Filly Abha Palma (x Abha Ghazali) was Senior Champion Mare and Scottsdale Arabian Supreme Champion. 2008 U.S. Reserve National Champion Junior Stallion and 2006 National Champion Colt of South Africa, EKS Bey Al Gazal (x Starbright Bey) was Senior Champion Stallion. OFW Magic Wan (x Magna Prelude) was Reserve Champion Senior Stallion and Madeira El Marwan (x Maria El Besson) was SSS Reserve Champion Two-Year-Old Filly ATH. In competition that fairly sizzled with national and international winners, Marwan Al Shaqab get were first and third in the Three-Year-Old Colts; first, second and third in the Three-Year-Old Fillies; first, third and fourth in the Five-Year-Old Stallions, and second, third and sixth in the Four-Year-Old Stallions. They also won the Four-Year-Old Mares (Abha Palma) and the 6 & 7 Year-Old Stallions (EKS Bey Al Gazal). 2008 Canadian National Champion Futurity Colt RHR Marcedes (x Ellegant Dream) won the Five-Year-Old Stallions, Forever Fleurtatious (x Crysstal Echo) won the Three-Year-Old Filly class, and her seven-eighths sister, Marlayne HC (x HC Echos Splendor) was second in the Yearling Halter Fillies, January 1- April 15.

MAGNUM PSYCHE

MARWAN AL SHAQAB

APR IL 2010 | 93


2010

SCOTTSDALE

Cytosk An older stallion still impressive in the Leading Sire listings, Cytosk (Mi Tosk x Cystyr) is 27 this year. His 15 successful Scottsdale competitors won four championships and a reserve. ROL Code Red (x Ebonee) was Champion Country English Pleasure JTR 14-17 and won the SSS English Pleasure Maturity ATR, while his full brother, ROL Excyptional, was Champion Country English Pleasure AAOTR 55 & Over. ROL Trade Cycret (x Holli Berry) won the English Show Hack Championship and ROL Woopcy Daicy (x Callaway’s Blue Sky) was Half-Arabian Country English Pleasure JTR 13 & Under Champion. The other major Half-Arabian Cytosk winner, Moonlightt Cyzzle (x Moonlightting), was Reserve Champion in the Half-Arabian Hunter Pleasure JOTR 13 & Under.

Khadraj NA Khadraj NA—champion stallion and champion western pleasure horse—has produced get noted for their national wins in halter and performance, with an emphasis on hunter and western pleasure competition. His son Khardinal Sin (x Sumis Violet) followed up his 2009 U.S. National Championship roses by again winning the Scottsdale championship in Half-Arabian Hunter Pleasure open, as well as AAOTR 36-54 and AATR 40 & Over. From the same foal crop, the gelding Khiro (x LM Cerra Rose) was a Scottsdale champion and earned two top ten’s in hunter pleasure. A total of fifteen Khadraj NA offspring competed successfully at Scottsdale this year in halter, western pleasure, hunter pleasure, ladies side saddle and reining.

Magnum Chall HVP A son of major Leading Sire Magnum Psyche, multi-national champion Magnum Chall HVP (x Taamara HVP) is that stallion’s best siring son to date. Magnum Chall HVP is the sire of 17 successful competitors at this year’s Scottsdale show, all but one in halter. Most impressive were Mister Magnum (x Pretty Tricky), Champion Stallion AAOTH and second in the Arabian Six & Seven-Year-Old Stallions; Troubadour PA (x Psyches Secret), Reserve Junior Champion Colt AAOTH and RD Challs Angel (x Bey Angel TGS), second in the Two-Year-Old Fillies and winner of the SSS Champion Two-Year-Old Fillies ATH.

DA Valentino Six-time National Champion DA Valentino (Versace x DA Love) could not have gotten off to a more auspicious beginning as a sire. Last year at Scottsdale his offspring brought home three halter championships, including the Arabian Junior Champion Filly roses. In comparison, this year there were twice as many DA Valentino offspring and they won three championships, four reserves, 18 top tens, seven first place and two second place awards. Superstars included Onitnelav (x Royal Ghazallah), Reserve Champion SSS Two-Year-Old Colt ATH and winner of the 2010 Scottsdale Junior Champion Colt title. Onitnelav’s dam is a Marwan Al Shaqab daughter. An even greater coup is that the Reserve Junior Champion Colt, Cavalli (x Aspyn), was also a DA Valentino son.

Versace Two years after his death, Versace (Fame VF x Precious As Gold) is still a prominent Leading Sire. He was one of only four stallions listed on 10 or more of the 2010 Scottsdale charts and is the sire of DA Valentino, also listed here. Nineteen of Versace’s offspring competed, winning a championship and five reserves. Standouts among them were Verucci (x JA Firtatious), who took the roses in the Hunter Pleasure AATR 40 & Over; American Idol (x Bey Fireeshah), the Hunter Pleasure Reserve Champion; Just Joe (x BEA Society Belle), the Western Pleasure Reserve Champion, and Arose Is Arose (x Too Many Roses), Reserve Senior Champion Half-Arabian Stock/ Hunter Type Mare.

94 | AR ABIAN HORSE TIMES


2010

LEADING SIRES

IXL Noble Express Another stallion with the ability to combine halter and performance talents as a show horse and a sire is IXL Noble Express (MHR Nobility x RY Fire Ghazi), though his innate ability to produce English type could overshadow everything else in his breeding career. There were superstars among his youngsters at Scottsdale and they took six championships and five reserves, all in performance. To begin, his get stood first, fourth and fifth in the English Pleasure Junior Horse Championship, with Black Daniels (x Victoria Bay) winning the rose garland. Two-time national champion Expressamo (x Mystic Bey V) was champion and reserve in the AEPA Saddle Seat Pleasure Maturity, ATR and the English Pleasure Championship, respectively. A Noble Pass (x SA Passing Fancy) did the same thing in the English Show Hack, AAOTR and the English Show Hack Open, and FS Thatsa Cold Shot (x Highpoint’s Dirty Dancer) won the Half-Arabian English Show Hack Open, took reserve in the AAOTR and was also reserve in the Half-Arabian Country English Pleasure Championship, AAOTR 36-54. There were other stars, but the big money horse was KD Expression Heir (x Eliza LA), who won the coveted roses and the prize money in the SSS English Pleasure Futurity Championship.

IXL NOBLE EXPRESS

Justafire DGL Famed as a sire of horses that readily cross the border between national winning halter and national winning performance, Justafire DGL (Afire Bey V x MC Justa Kate) is included on seven of the 14 Scottsdale Leading Sire charts. His most successful offspring was Rohara Americanlegend (x Miz American Pie) who won the winning roses in the Half-Arabian Saddle/Pleasure Type Senior Gelding Championship and took top ten awards in the Half-Arabian Country English Pleasure AATR 40 & Over and the Half-Arabian Country Pleasure Driving Championships. VJ Justaflame (x Blush Berri V) also crossed a border by winning the Park Horse Championship and then toning it down a step to take third in the English Pleasure Championship. JUSTAFIRE DGL

APR IL 2010 | 95


2010

SCOTTSDALE

KHADRAJ NA

CYTOSK

Noteworthy It would be a shame to exclude three stallions that stood prominently on several Leading Sire charts beginning with Sir Fames HBV (Ffamess x Cajun Lady HCF), who had get that won three Scottsdale championships and three reserves, all in halter. His top Scottsdale winner was Rohara Mademoiselle (x Fames Fantasy Of Love) Champion Half-Arabian Mare JTH and Champion Half-Arabian Stock/Hunter Senior Mare. Sundance Kid V (Desperado V x Sweet Shalimar V) also sired offspring that won three Scottsdale championships and three reserves, all in performance. His big winner was SRWDoalittledance (x Doskatanya V) Hunter Pleasure Champion in the AATR 18-39 and reserve in the AAOTR 36-54. Finally, a “hats off ” to NDL Flashdance (Barbary x Forty Carets) sire of offspring that won three championships and two reserves at Scottsdale, including the amazing Shutup And Dance (x Callaway’s Lyric), quite possibly the most winning halter horse of all time and the 2010 Scottsdale Champion Half-Arabian Gelding JTH, Champion Half-Arabian Saddle/ Pleasure Gelding AAOTH and Reserve Champion HalfArabian Saddle/Pleasure Senior Gelding.

The following charts are ranked both on number

*MAGNUM CHALL HVP

of winners and on a point system that gives added emphasis to the sires’ progeny that place high in their classes and/or win championships. The halter sires are assigned points as follows: Top Ten – 4 pts.; 2nd place in Class – 6 pts.; 1st in Class – 7 pts.; Reserve Champion – 8 pts.; and Champion – 10 pts. With the exception of Sport Horse and Equitation, all halter classes were considered.

96 | AR ABIAN HORSE TIMES

In the performance charts, points are derived only from the championship classes and are as follows: Top Ten – 4 pts.; Reserve Champion – 8 pts.; and Champion – 10 pts. No Sport Horse or Equitation classes counted. In the Half-Arabian charts, a purebred sire only having HalfArabian winners makes the list. To make the overall charts, the sire needed to have points in both halter and performance. To make the Half-Arabian and purebred overall sire charts, each sire needed winners in both halter and performance with purebred and/or Half-Arabian winners.


2010

LEADING SIRES

Purebred Halter Points 1. Marwan Al Shaqab (Gazal Al Shaqab x Little Liza Fame) 2. DA Valentino (Versace x DA Love) 3. Sir Fames HBV (Ffamess x Cajun Lady HCF) 4. Magnum Chall HVP (Magnum Psyche x Taamara HVP) 5. Magnum Psyche (Padrons Psyche x A Fancy Miracle) 6. Justify (Magnum Psyche x S Justadream) 7. Eden C (Enzo x Silken Sable) 8. Enzo (Padrons Psyche x RD Bey Shahmpane) 9. Padrons Psyche (Padron x Kilika) 10. Always A Jullyen V ( Jullyen El Jamaal x Amazing Grace V) Falcon BHF (Bey Shah x Bey Serenade SF)

165 138 130 128 108 87 62 53 49 45 45

Winners 1. Marwan Al Shaqab (Gazal Al Shaqab x Little Liza Fame) 2. DA Valentino (Versace x DA Love) 3. Magnum Chall HVP (Magnum Psyche x Taamara HVP) 4. Magnum Psyche (Padrons Psyche x A Fancy Miracle) 5. Justify (Magnum Psyche x S Justadream) Sir Fames HBV (Ffamess x Cajun Lady HCF) 6. Enzo (Padrons Psyche x RD Bey Shahmpane) Padrons Psyche (Padron x Kilika) 7. Eden C (Enzo x Silken Sable) 8. Falcon BHF (Bey Shah x Bey Serenade SF) Pyro Thyme SA (Pryme Thyme x Holly Onfire JW)

23 18 16 13 12 12 11 11 9 8 8

Purebred Performance Points 1. Afire Bey V (Huckleberry Bey x Autumn Fire) 2. Baske Afire (Afire Bey V x Mac Baske) 3. Sundance Kid V (Desperado V x Sweet Shalimar V) 4. Cytosk (Mi Tosk x Cystyr) IXL Noble Express (MHR Nobility x RY Fire Ghazi) 5. Hucklebey Berry (Huckleberry Bey x Miz Bask) Versace (Fame VF x Precious As Gold), deceased 6. Magnum Psyche (Padrons Psyche x A Fancy Miracle) 7. Padrons Psyche (Padron x Kilika) 8. Jullyen El Jamaal (Ali Jamaal x Jullye El Ludjin)

236 90 84 76 76 74 74 70 64 60

Winners 1. Afire Bey V (Huckleberry Bey x Autumn Fire) 2. Baske Afire (Afire Bey V x Mac Baske) Magnum Psyche (Padrons Psyche x A Fancy Miracle) 3. Versace (Fame VF x Precious As Gold), deceased 4. Hucklebey Berry (Huckleberry Bey x Miz Bask) 5. IXL Noble Express (MHR Nobility x RY Fire Ghazi) Padrons Psyche (Padron x Kilika) 6. Cytosk (Mi Tosk x Cystyr) Sundance Kid V (Desperado V x Sweet Shalimar V) 7. Alada Baskin (Aladdinn x Launa Basketu) Jullyen El Jamaal (Ali Jamaal x Jullye El Ludjin) Justafire DGL (Afire Bey V x MC Justa Kate) Khadraj NA (Ponomarev x Khatreena NA)

25 11 11 10 9 8 8 7 7 6 6 6 6

Purebred Halter & Performance Points 1. Magnum Psyche (Padrons Psyche x A Fancy Miracle) 2. Marwan Al Shaqab (Gazal Al Shaqab x Little Liza Fame) 3. Magnum Chall HVP (Magnum Psyche x Taamara HVP) 4. Padrons Psyche (Padron x Kilika) 5. Versace (Fame VF x Precious As Gold), deceased 6. Baske Afire (Afire Bey V x Mac Baske) 7. Enzo (Padrons Psyche x RD Bey Shahmpane) 8. Khadraj NA (Ponomarev x Khatreena NA) 9. Jullyen El Jamaal (Ali Jamaal x Jullye El Ludjin) 10. Odyssey SC (Versace x Latoura Echo)

178 169 132 113 100 98 87 80 79 52

Winners 1. Magnum Psyche (Padrons Psyche x A Fancy Miracle) Marwan Al Shaqab (Gazal Al Shaqab x Little Liza Fame) 2. Padrons Psyche (Padron x Kilika) 3. Magnum Chall HVP (Magnum Psyche x Taamara HVP) 4. Enzo (Padrons Psyche x RD Bey Shahmpane) Versace (Fame VF x Precious As Gold), deceased 5. Baske Afire (Afire Bey V x Mac Baske) 6. Khadraj NA (Ponomarev x Khatreena NA) 7. Jullyen El Jamaal (Ali Jamaal x Jullye El Ludjin) 8. DS Major Afire (Afire Bey V x S S Magnolia) Gazal Al Shaqab (Anaza El Farid x Kajora)

24 24 19 17 14 14 12 11 9 6 6

APR IL 2010 | 97


2010

SCOTTSDALE

Half-Arabian Halter Points 1. Baske Afire (Afire Bey V x Mac Baske) 2. Magnum Psyche (Padrons Psyche x A Fancy Miracle) 3. NDL Flashdance (Barbary x Forty Carats) 4. Versace (Fame VF x Precious As Gold), deceased 5. DA Valentino (Versace x DA Love) 6. Sir Fames HBV (Ffamess x Cajun Lady HCF) 7. Justafire DGL (Afire Bey V x MC Justa Kate) 8. Afire Bey V (Huckleberry Bey x Autumn Fire) 9. Renaissanse (Ali Jamaal x Carismor) 10. Enzo (Padrons Psyche x RD Bey Shahmpane)

111 66 48 46 45 44 39 35 29 27

Winners 1. Baske Afire (Afire Bey V x Mac Baske) 2. Magnum Psyche (Padrons Psyche x A Fancy Miracle) 3. Afire Bey V (Huckleberry Bey x Autumn Fire) 4. DA Valentino (Versace x DA Love) Justafire DGL (Afire Bey V x MC Justa Kate) QR Marc (Marwan Al Shaqab x Swete Dreams) Versace (Fame VF x Precious As Gold), deceased 5. Da Vinci FM (Versace x Full Moon Astar) Hukam Maj (Marwan Al Shaqab x Dinamaj) IXL Noble Express (MHR Nobility x RY Fire Ghazi) Mamage (Zodiac Matador x CF Fire Magic) Odyssey SC (Versace x Latoura Echo) Renaissanse (Ali Jamaal x Carismor) Sir Fames HBV (Ffamess x Cajun Lady HCF)

6 5 4 3 3 3 3 2 2 2 2 2 2 2

Half-Arabian Performance Points 1. Afire Bey V (Huckleberry Bey x Autumn Fire) 2. Baske Afire (Afire Bey V x Mac Baske) 3. Cytosk (Mi Tosk x Cystyr) 4. Khadraj NA (Ponomarev x Khatreena NA) Zee Mega Bucks (Xenophonn x Somthing Special) 5. Allionce (Alada Baskin x Equitie) 6. Allionces Knight (Allionce x Kaitlin Bey) IXL Noble Express (MHR Nobility x RY Fire Ghazi) 7. Mamage (Zodiac Matador x CF Fire Magic) 8. Rohara Moon Storm (Moonstone Bey V x Rohara Tsultress)

106 98 58 50 50 48 44 44 42 40

Winners 1. Baske Afire (Afire Bey V x Mac Baske) 2. Afire Bey V (Huckleberry Bey x Autumn Fire) 3. Cytosk (Mi Tosk x Cystyr) 4. Mamage (Zodiac Matador x CF Fire Magic) 5. Justafire DGL (Afire Bey V x MC Justa Kate) Zee Mega Bucks (Xenophonn x Somthing Special) 6. Allionces Knight (Allionce x Kaitlin Bey) Apollopalooza (AA Apollo Bey x TF Magical Witch), deceased IXL Noble Express (MHR Nobility x RY Fire Ghazi) Khadraj NA (Ponomarev x Khatreena NA) Pension (Matrifik x Aristo Amy) Rohara Moon Storm (Moonstone Bey V x Rohara Tsultress) Saladins Allon (Safire x Khala Crescent) SV Basksko (Bask x Skovette)

13 12 8 6 5 5 4 4 4 4 4 4 4 4

Half-Arabian Halter & Performance Points 1. Baske Afire (Afire Bey V x Mac Baske) 2. Afire Bey V (Huckleberry Bey x Autumn Fire) 3. Justafire DGL (Afire Bey V x MC Justa Kate) 4. Magnum Psyche (Padrons Psyche x A Fancy Miracle) NDL Flashdance (Barbary x Forty Carats) 5. Cytosk (Mi Tosk x Cystyr) 6. IXL Noble Express (MHR Nobility x RY Fire Ghazi) 7. Mamage (Zodiac Matador x CF Fire Magic) 8. Versace (Fame VF x Precious As Gold), deceased 9. Apaladin (AA Apollo Bey x Amanda Of Aerie)

98 | AR ABIAN HORSE TIMES

209 141 75 74 74 62 59 58 54 32

Winners 1. Baske Afire (Afire Bey V x Mac Baske) 2. Afire Bey V (Huckleberry Bey x Autumn Fire) 3. Cytosk (Mi Tosk x Cystyr) 4. Mamage (Zodiac Matador x CF Fire Magic) 5. IXL Noble Express (MHR Nobility x RY Fire Ghazi) Justafire DGL (Afire Bey V x MC Justa Kate) 6. Magnum Psyche (Padrons Psyche x A Fancy Miracle) Versace (Fame VF x Precious As Gold), deceased 7. Krewe (Huckleberry Bey x Masquerade) 8. NDL Flashdance (Barbary x Forty Carats)

18 16 8 7 6 6 5 5 4 3


2010

LEADING SIRES

Purebred & Half-Arabian Halter & Performance Points 1. Afire Bey V (Huckleberry Bey x Autumn Fire) 2. Baske Afire (Afire Bey V x Mac Baske) 3. Magnum Psyche (Padrons Psyche x A Fancy Miracle) 4. Marwan Al Shaqab (Gazal Al Shaqab x Little Liza Fame) 5. Versace (Fame VF x Precious As Gold), deceased 6. Cytosk (Mi Tosk x Cystyr) 7. IXL Noble Express (MHR Nobility x RY Fire Ghazi) 8. Magnum Chall HVP (Magnum Psyche x Taamara HVP) 9. Khadraj NA (Ponomarev x Khatreena NA) 10. Justafire DGL (Afire Bey V x MC Justa Kate)

377 307 252 169 154 138 135 132 130 125

Winners 1. Afire Bey V (Huckleberry Bey x Autumn Fire) 2. Baske Afire (Afire Bey V x Mac Baske) 3. Magnum Psyche (Padrons Psyche x A Fancy Miracle) 4. Marwan Al Shaqab (Gazal Al Shaqab x Little Liza Fame) 5. Padrons Psyche (Padron x Kilika) Versace (Fame VF x Precious As Gold), deceased 6. Magnum Chall HVP (Magnum Psyche x Taamara HVP) 7. Cytosk (Mi Tosk x Cystyr) Enzo (Padrons Psyche x RD Bey Shahmpane) Khadraj NA (Ponomarev x Khatreena NA)

DA VALENTINO

SIR FAMES HBV

SUNDANCE KID V

41 30 29 24 19 19 17 15 15 15

VERSACE

NDL FLASHDANCE â–

APR IL 2010 | 99


AUCTIONS

t n e m e t i Ex c

FIVE YEARS OF

100 | AR ABIAN HORSE TIMES


! s s e c Suc

FIVE YEARS OF MARKETING

$7

MILLION IN SALES

136 lots sold - over $51,000.00 average

WATCH FOR SCOTTSDALE SELECT 2011 ...

The Ames Family ~ Jordan, MN

www.Cedar-Ridge.com APR IL 2010 | 101


2010

SCOTTSDALE

Scottsdale — A Perfect Venue For Marketing Horses by Colleen Scott

The Scottsdale Arabian Horse Show’s formula for success is multi-faceted: tradition, weather, national-caliber competition, shopping, a city filled with fine restaurants, galleries and museums all combine to make it a unique experience. Add to that equation that Scottsdale is also a natural venue for the marketing and sales of Arabian horses, and this year was no exception to that golden rule.

APR IL 2010 | 103


2010

SCOTTSDALE

T

“First, there’s a lot of history in Scottsdale,” David Boggs says. “There were a lot of big farms and well-known breeders who all gathered together in the Scottsdale area—Lasma,

here were dozens of open barn parties and stallion presentations throughout the week. In fact, if one wanted to, one could spend the entire week socializing, eating and drinking while traveling from one party to another. Some hosted events on a daily basis, like David Boggs and Midwest Training Centre, who elected to replace their traditional Thursday night party with more intimate daily functions. “We’ve been doing the Thursday night party for 20-odd years,” he says. “Last year I think we had almost 2,000 for dinner and the showing. Unfortunately, when there are wall-to-wall people like that, it is difficult for me to have one-on-one time with people and it is hard for them to actually get up close to the horses. We decided to try something different this year by hosting smaller gatherings on a daily basis throughout the show. We had about the same number of people; it was just a little more spread out.” Open barns on-site and off-site, stallion presentations, and dinner events combined with wine tastings, fund-raisers and sale horse presentations—there were any number and variety of events for the Arabian horse shopper to enjoy. But why so many gatherings and so many horses to choose from?

Chauncey, Gainey, Brusally. That kind of created a mega force as far as breeding

Boggs, an Arabian horse marketing force with sales in the millions each year, explains why Scottsdale is a natural site for industry sales.

programs in the early days.”

JEFFREY CARTER MASON PHOTO

104 | AR ABIAN HORSE TIMES


2010

SCOTTSDALE

“First, there’s a lot of history in Scottsdale,” he says. “There were a lot of big farms and wellknown breeders who all gathered together in the Scottsdale area—Lasma, Chauncey, Gainey, Brusally. That kind of created a mega force as far as breeding programs in the early days. “The second thing about Scottsdale that makes it a great place for selling horses is the weather. It truly is the Valley of the Sun, especially during the winter when it is a perfect time to get away from places like Minnesota, Missouri and Canada. I think that has a lot to do with the

JEFFREY CARTER MASON PHOTO

magic and mystique of Scottsdale—seeing a lot of beautiful Arabian horses and enjoying all the outside activities.” His brother, Bob Boggs, concurs. “Scottsdale is an awesome place to come in the middle of the winter. It has also become the mecca for Arabian horses. You can get the most exposure for your horses, whether you are showing or not, in Scottsdale.” Rory O’Neill, O’Neill Arabians, says people don’t necessarily even start out with shopping

JEFFREY CARTER MASON PHOTO

APR IL 2010 | 105


2010

SCOTTSDALE

for a horse in mind. “That time of year, people will find an excuse to hop on a plane and go to Scottsdale,” he says. “Once there, the environment—the weather, the horses—inspires them to buy or make breeding decisions.”

Sheer Numbers

“Scottsdale is an awesome place to come in the middle of the winter,” says Bob Boggs. “It has also become the mecca

What the big-name breeders of decades ago did when they began gathering in the Scottsdale area was create a large number of Arabian horses gathered in one place. That tradition continues today, with numerous breeders and trainers having facilities in the area and many, such as Midwest Training Centre, Rae-Dawn Arabians and North Arabians, having second facilities in and around Scottsdale. Still others lease barns for at least two, and sometimes several, months during the Arizona show season. That so many world-class breeders and trainers have chosen the area for business speaks to its historic significance to the Arabian horse.

for Arabian horses. You can get the most exposure for your horses, whether you are showing or not, in Scottsdale.”

As the show has grown exponentially since its inception 55 years ago (there were more than 2,000 horses entered in this year’s show), the number of horses a potential buyer can view has grown as well. Combine the number of barns and farms in the area with the number of horses on the show grounds, and an Arabian horse enthusiast can literally see thousands of

JEFFREY CARTER MASON PHOTO

106 | AR ABIAN HORSE TIMES


2010

SCOTTSDALE

JEFFREY CARTER MASON PHOTO

horses within days. There simply isn’t any other geographic location or show that offers that kind of opportunity. Says Jeff Schall, Shada Inc., “You would literally have to travel around the world, spending a lot of money and a lot of time, to see the number of horses that can be seen at the Scottsdale Show and the barns around the area.” David Boggs also sees the number of horses, especially the young ones, available for shoppers to view as being a huge boost to attendance before and during show time. “People dream of owning a horse that is being presented at

Scottsdale,” he says. “There is a great market here even prior to the show starting for young horses. The yearling classes at the show have been huge, not just the Scottsdale Signature Stallion classes, but the other yearling breeding classes as well.” Not only are people coming to see the young stock available, but they are also coming to see the proven show stock. Laurie Long, Laurie Long Performance Horses, had a trainer who wasn’t showing at Scottsdale fly in specifically to watch a horse in its class and test ride him for a client. “You have so many people from all over, there’s just a built-in audience to sell to and a great number of horses available there,” she says.

JEFFREY CARTER MASON PHOTO

APR IL 2010 | 107


2010

SCOTTSDALE

The Great Outdoors

“That time of year, people will find an excuse to

Whether it is the show itself, sales presentations, open barn parties or just visiting with other Arabian horse enthusiasts, there’s nothing like Scottsdale in February. The average high is 70 degrees, with the average low a bearable 41 degrees (actually quite pleasant, given what the temperatures are in more winter-like climates). The WestWorld show facility, whose 387 acres sit at the base of the McDowell Mountains, is conducive to soaking in the sun from every angle. Many of the arenas are completely outdoors, with the exception of the Equidome, which is covered but allows for glimpses of blue sky and the desert from the seats. The stalls are outdoors, spread across the vast property in a street-like fashion, providing visitors with the opportunity to amble up and down the alleyways and landscaped “avenues.”

hop on a plane and go to Scottsdale,” Rory O’Neill says. “Once there, the environment—the weather, the horses— inspires them to buy or make breeding decisions.”

108 | AR ABIAN HORSE TIMES

That town-like, window-shopping feel makes the showgrounds a great place not only to exhibit horses, but also to market them from everyone’s home away from home—the stall fronts. Presentations are held there, beautiful movie-size posters and photographs highlight champions and stallions, videos are played, and stallion cards and sales material are there for the taking. Shada, whose stalls have long been located at the east end of Wendell, introduced their new theme of


2010

SCOTTSDALE

the “Shada Red Zone” this year, complete with a large-screen television mounted at the top of their stall fronts so any passerby could watch and learn about the Shada stallions and their sales line-up. The Shada Red Zone also included a Wall of Fame, where large photographs promoted their stallions. Besides the displays at their stalls, Shada also hosted two presentations introducing sale horses and stallions, one with a finale featuring Art Dekko TT (Audacious PS x HC Amareea) and the other concluding with Marwan Al Magnifficoo (Marwan Al Shaqab x Pacific Echo). In addition to the entire show and the stables all being outdoors, so too are most of the presentations and parties. David Boggs, who attended his first Scottsdale Show in 1975, says all the Midwest-sponsored events have traditionally been held outdoors, taking advantage of the clear skies, soft breezes and warm sun. “We’ve had as many as 2,000 to 3,000 people at our traditional Thursday evening parties, soaking up the warm evening weather, and at presentations during the day, just enjoying the sunshine. It is a great combination— atmosphere and beautiful Arabian horses.” Tom Moore, who helped manage the Cedar Ridge Select Sale, concurs with Boggs about the uniqueness of Scottsdale as a sales venue. “Scottsdale is a great market for several reasons,”

“You would literally have to travel around the world, spending a lot of money and a lot of time, to see the number of horses that can be seen at the Scottsdale Show and the barns around the area,” states Jeff Schall.

APR IL 2010 | 109


2010

SCOTTSDALE

he says. “The weather is great, it makes for a great environment to present your horses, and everyone is in a great mood. There is a collection of people from all over the world, and the Scottsdale Arabian Show does a great job of promoting the Arabian breed in a very positive light to everyone. It is the time of year when everyone is looking forward to the future and thinking about their upcoming show season and breeding goals.” In its fifth year, the Select Sale was again held at Cedar Ridge’s Scottsdale location. “The weather was beautiful and it worked out very nicely outside,” says Moore. The sale’s new format this year was for all bidding to take place over the Internet, but more on that in the “What’s New?” section.

Gathering Momentum “You have so many people from all over, there’s just a built-in audience to sell to and a great number of horses available there,” says Laurie Long.

110 | AR ABIAN HORSE TIMES

Of course, the marketing of Arabian horses takes place year-round. It just so happens the Scottsdale show season is arguably the single-best impetus for sales there is throughout the calendar year. Physically, many of the breeders, owners and trainers begin their annual pilgrimage to Scottsdale far earlier than the actual show dates. The months and weeks preceding the Scottsdale Show are every bit as important to sales as the show and corresponding parties themselves. “The activity surrounding the show, prior to, during and


2010

SCOTTSDALE

for a small window after, makes it the number one time in which to market a horse,” says Schall, who hosted two presentations on-site. And for some, the Scottsdale sales season continues even today, long after the ribbons have been taken down and everyone else has gone home. “Normally by March 1 we are packed up and back in Elk River,” says David Boggs. “This year, we’re still here and won’t be going home until May 1. We’ve continued to have activity, so we’ve kept the sale barn open. We are still doing presentations and have people flying in just to see the Midwest sales offerings.”

O’Neill credits the show and the activity it generates for the highest percentage of the farm’s sales. O’Neill, who hosted an open house at his Scottsdale facility featuring *Dakar El Jamaal (Ali Jamaal x Sonoma Lady) and their broodmare supreme, Amelia B (Magnum Psyche x Amety B), believes the sales season could almost be described as culminating with the Region 7 Championship Show, traditionally held in April. “The rest of the world kind of wakes up on April 1,” he says. “By then, a lot of the young talent has already been discovered and sold at the Scottsdale Show.”

APR IL 2010 | 111


2010

SCOTTSDALE

Camaraderie Plays A Role There’s no doubt the masses in Scottsdale in February are easy to get along with and have something in common: love of the Arabian horse. Trainers Michael Byatt and Andrew Sellman took a new approach with their marketing efforts this year and produced amazing results—the two sold 22 horses between them. But instead of scheduled showings every day or on set days, they simply invited people over for special private chefprepared dinners each night at their leased facility 15 minutes from the showgrounds.

“There is a collection of people from all over the world and the Scottsdale Arabian Show does a great job of promoting the Arabian breed in a very positive light to everyone,”

The two had been talking about a different approach to sales for much of last year and at the 2009 U.S. Nationals made a commitment. They would combine facilities, combine staffs and work together to produce what Byatt now calls an “idyllic two months.” He says, “We decided to go there and be conduits of good energy. We’d have great horses, but also provide opportunities for entertainment, fellowship and camaraderie. We hosted dinner parties every night, and in the end, those gatherings translated into phenomenal sales.” The parties attracted anywhere from 20 to 100 people, with some coming back several nights in a row. However, no horses were shown during their evening parties. “We let the horses sleep. We

says Tom Moore. “It is the time of year when everyone is looking forward to the future and thinking about their upcoming show season and breeding goals.” JEFFREY CARTER MASON PHOTO

112 | AR ABIAN HORSE TIMES


2010

SCOTTSDALE

decided not to use every gathering to show horses. At night we just wanted to provide people with a place to eat, drink and laugh. We saved business for during business hours.” The end result? Many people made appointments to come back on subsequent days to view horses. “Our energy and karma all translated to a great show JEFFREY CARTER MASON PHOTO and phenomenal sales,” he says. “When you ask the question ‘what drives any industry?’ the answer is that people want to be treated fairly and have fun. We provided that.”

A Barometer For The Coming Year Predicting sales for the year is certainly not an exact science, but sales activity at the Scottsdale Show can be used as a forecast for the rest of the year. Bob Battaglia, Battaglia Farms, says, “The market there sets the tone for the rest of the year.” With several horses successfully marketed at this year’s show, Battaglia is cautiously

JEFFREY CARTER MASON PHOTO

optimistic about the coming year. “The market is still strong, although a little slow and not as strong as it has been. Within the last month I’ve seen a big turnaround—more interest in buying young prospects and finished show horses. There seem to be a lot more people looking. I think we’re going to have a good year in the long run.” That being said, Battaglia does have one caveat: The horses need to be priced realistically. “People didn’t buy the horses that were overpriced; the market has adjusted itself,” he says. “People were being very careful, as they should be, and looking for value for their dollars.”

APR IL 2010 | 113


2010

SCOTTSDALE

David Boggs says the foreign market in particular was strong at this year’s show, and Midwest exported horses to many other countries. He says the tone for the coming year is that the good horses are in great demand. “The bar keeps getting set higher and higher as potential breeders and buyers become more educated,” he says. “A seller has to be careful in making breeding decisions, showing selections and marketing. If you are diligent in all three, you’ll be successful. You really have to develop a plan that starts with the selection of the mare and stallion and goes from there.”

What’s New? “Our energy and karma all translated to a great show and phenomenal sales,” Michael Byatt says. “When you ask the question ‘what drives any industry?’ the answer is that people want to be treated fairly and have fun.”

In his continuing efforts to market Arabian horses to people outside the industry, David Boggs also hosted parties for several local companies this year. “Companies like Cities West magazine and other large area businesses are always looking for a unique venue in which to host their annual party or sales meeting,” he says. “An Arabian horse farm is extremely attractive to them for such parties. We hosted a number of those types of parties with a catered dinner, presentation and barn walk-through, introducing a lot of new people to the Arabian horse.” Bob Boggs had a similar experience, hosting a joint wine-tasting and Arabian

JEFFREY CARTER MASON PHOTO

114 | AR ABIAN HORSE TIMES


2010

SCOTTSDALE

horse presentation. He says the combination was a win-win. “I got to show Arabian horses to some people who wouldn’t necessarily have a chance to see them,” he says. Tom Mensing, who helped organize the event, says pairing different flights of wine with different groups of horses made for an educational and fun evening. While the tradition of open houses, barn parties and stallion presentations will certainly continue, like every aspect of life, there are bound to be a few changes, particularly with the introduction of technology.

JEFFREY CARTER MASON PHOTO

The Cedar Ridge Select Sale took a new turn this year when the consigned horses were presented at an Open House, but bidding was conducted over an eight-day period exclusively on the Internet, allowing both those in attendance at the open house and those at home the opportunity to bid. “This gave the buyers plenty of time to investigate their potential purchases. There was a wealth of information provided to them on the Internet: pictures, pedigrees, videos and comments from the sellers and their agents,” says Moore. “As in auctions past, there were health

exam results provided for each horse. The buyers had the option to bid on their favorite horses, or they could use the ‘buy now’ feature and purchase the horse immediately. I believe the new format worked very well, and buyers and sellers alike were very happy with the experience.” Whether in large party format, as in the days of Midwest’s Thursday night parties, or presentations on the show grounds, private viewings, or over the Internet, one thing remains certain: Scottsdale is an Arabian horse shopper’s paradise. Think you might be in the market next year? Mark your calendar now for February 17-27, 2011.

JEFFREY CARTER MASON PHOTO

APR IL 2010 | 115


2010

SCOTTSDALE

116 | AR ABIAN HORSE TIMES


2010

SCOTTSDALE

AHT Helps Introduce Youngsters to Arabian Horses When Kimberly Frankel, the Pairing Animals With Students (P.A.W.S.) program leader wanted to take her group to the Scottsdale Arabian Horse Show, there was only one problem—how to get them there. Enter Arabian Horse Times, which sponsored a bus for the dozen students from Maricopa Wells Middle School to get to the showgrounds. “I started the program because I have always had a love and passion for animals, and I saw that same love for animals in many of my students,” says Frankel. “Because of this, I wanted to create a well-rounded program that would educate students on every aspect of the subject. “In the P.A.W.S. program, students learn all about animal care, including proper nutrition, grooming, basic health care, knowledge of specific breeds, training tips, future college options, career opportunities in the animal

industry, as well as several hands-on activities working with animals. I also arrange for guest speakers, and we also take field trips to add to the hands-on experience of the P.A.W.S. program.” A Language Arts teacher, Frankel also holds a degree in Equine Science, so was naturally drawn to the great opportunity the Scottsdale Arabian Horse Show presented for her students. Besides learning about all types of animals, the program offers students the opportunity to give back to their community. They have held fund-raisers to help local animal rescue organizations. “I believe it is important to teach my students about giving back to their community,” Frankel says, “and how wonderful it feels to help an animal in need.” ■

APR IL 2010 | 117


At Wolf Springs Ranch ... We Breed for Reining ...

TR SKID MARK & Tyson Randle (Zee Mega Bucks x Chics Flip)

Champion Half-Arabian Reining Futurity Classic at Scottsdale Congratulations to KGBTexas Public Relations/Advertising for their purchase of TR Skid Mark! Gordon Potts, Agent. Trainers: Trainers: Greg GregHarris, Harris, ManagingTrainer Trainer Greg@wolfsprings.com Greg@wolfsprings.com Tyson TysonRandle Randle Bob BobLocke Locke

118 | AR ABIAN HORSE TIMES

P.O. Box 103, 38198 Hwy 69, Westcliffe, CO 81252 12435 N. 93rd St., Scottsdale, AZ 85260 Tel: 719.746.2390 | Fax: 719.746.2005 www.wolfsprings.com


The TR preďŹ x is your guarantee!

TR T R COCKADOODLEDOO & Crystal McNutt-Brock (Jaborrs Impack x Roosters Julie)

Reserve Champion Half-Arabian Reining Futurity Classic at Scottsdale Owned by: Thomas Lents

P.O. Box 103, 38198 Hwy 69, Westcliffe, CO 81252 12435 N. 93rd St., Scottsdale, AZ 85260 Tel: 719.746.2390 | Fax: 719.746.2005 www.wolfsprings.com

Trainers: Greg Harris, Harris,Managing ManagingTrainer Trainer Greg@wolfsprings.com Tyson Randle Bob Locke

APR IL 2010 | 119


TR BRACE FOR IMPACK (Jaborrs Impack x Oakachic)

& Lauren Bailey

Champion ARHA Half-Arabian Non-Pro Futurity Reserve Champion Half-Arabian Reining Horse Hackamore/Snaffle Championship Owned by: Lauren Bailey

TR GONE HOLLYWOOD+ (Hollywood Dun It x Afire Of Gold)

& Jennifer Earles

Champion Half-Arabian Reining Horse AAOTR 18-44 Championship Owned by: Jennifer & Jason Earles

TR MAJOR SNO STORM (Major Sno Chex x Portena)

& Brittany Mikkel Nokleberg Reserve Champion ARHA Half-Arabian Non-Pro Futurity Owned by: Brittany Mikkel Nokleberg

Trrai Trainers: T aine iners rs:: Greg Harris, Managing Trainer Greg@wolfsprings.com Tyson Randle Bob Locke

120 | AR ABIAN HORSE TIMES

P.O. Box 103, 38198 Hwy 69, Westcliffe, CO 81252 12435 N. 93rd St., Scottsdale, AZ 85260 Tel: 719.746.2390 | Fax: 719.746.2005 www.wolfsprings.com


TR IMA ROCKIN KID (Ima Dun Kid x Portena)

& Gordon Potts

Top Ten Half-Arabian Reining Horse Hackamore/Snaffle Championship Owned by: The Brass Ring, Inc

TR REINDANCE (Jaborrs Impack x Zee Honey)

& Brian Welman

Top Ten Arabian Reining Futurity Classic At Scottsdale Owned by: Richard Ames

TR TEXAS T (Ima Dun Kid x Portena)

& Crystal McNutt-Brock Top Ten Half-Arabian Reining Horse Bitted Championship Owned by: Dennis & Linda Clark Ltd Family Partnership

P.O. Box 103, 38198 Hwy 69, Westcliffe, CO 81252 12435 N. 93rd St., Scottsdale, AZ 85260 Tel: 719.746.2390 | Fax: 719.746.2005 www.wolfsprings.com

Trainers: Trai Tr aine ai ners ne rs:: Greg Harris, Managing Trainer Greg@wolfsprings.com Tyson Randle Bob Locke

APR IL 2010 | 121


Al-Marah Arabians AM Good Oldboy+ (AM Sea Captain++ x AM Tis Beverlie) 2/29/1992

2001 & 2006 U.S. National Reserve Champion Reining Horse 2009 Sport Horse National Top Ten Green Working Hunter Stud Fee $2,500 2nd Stud Fee 50% discount Booking good for 2010 & 2011

Al Marah Feisty Star (AM Good Oldboy+ x AM Misty Dream) 3/23/2005

2007 Sport Horse National Champion 2-Year-Old Colt In-Hand Trained and shown by Crystal McNutt for 2010 National Futurity Booking now for 2011 Introductory Stud Fee of $1,000

4101 N Bear Canyon Road, Tucson, AZ 85749-8640 • Tel: 520-749-1162 • Fax: 520-749-2572 Web: www.almaraharabianhorses.com • Email: al-marah@att.net

122 | AR ABIAN HORSE TIMES


We breed prospects & sell winners!

A

Ames Reining Horses

Black N Style - National Champion Jaborrs Impack - National Champion Lady Khazraff - National Champion Minding Ps And Qs - National Champion Scottsdale Futurity Champion Spirit Seeker - National Champion Echos Promise - National Reserve Champion Khountry Boy - National Top Ten Marliera - National Top Ten Fyre In The Skye - Two-Time Scottsdale Futurity Champion TR Texas T - Scottsdale Futurity Champion Slide N Style - Scottsdale Futurity Reserve Champion TR Reindance - Scottsdale Futurity Reserve Champion ER Oakley - Scottsdale Futurity Top Ten Miss Montana - Scottsdale Futurity Top Ten

Owned by: Di Dick i kA Ames, JJordan, d M Minnesota i t APR IL 2010 | 123


Riding & Sliding Opportunities Offering an exciting group of talented winning reiners and great prospects.

MAXEROSE

HH Maxemus x Little Alice Rose

H/A mare, grullo, 2005

MISS MONTANA CRF

Mister Montana NIC x Marliera

H/A mare, bay, 2006

SLID MAXY CRF

HH Maxemus x She Dun Slid

H/A mare, bay, 2006

TM DUNIT IN GOLD

Ima Dun Kid x Faireshine Padron

H/A mare, buckskin, 2005

TR REINDANCE

Jaborrs Impack x Zee Honey

Arabian gelding, bay, 2005

CHI CHI MONTANA

Mister Montana NIC x Jaborrs Lita

H/A mare, chestnut, 2005

3-YEAR-OLD HALF-ARABIAN PROSPECTS SIRED BY HH MAXEMUS, BLACK N STYLE, COLONELS SMOKING GUN and CUSTOM CHROME

MAXEROSE

TR REINDANCE

MISS MONTANA CRF

2009 Region 10 Reserve Champion Reining Horse

2010 Scottsdale Reserve Champion Arabian Reining Futurity Classic

2010 Scottsdale Top Ten Half-Arabian Reining Futurity Classic

124 | AR ABIAN HORSE TIMES


FYRE IN THE SKY Two-Time Scottsdale Arabian Reining Futurity Classic Champion Highest money earning mare in NRHA.

A

Ames Reining Horses

HH MAXEMUS

Zee Mega Bucks x Khabreah STANDING AT STUD

Owned by: Dick Ames • 952-492-6590 • Jordan, Minnesota Brian Welman • 612-991-5881 • Hastings, Minnesota www.WelmanReining.com APR IL 2010 | 125


Representing

H O L LY W O O D D U N I T Sire of Multiple National and Scottsdale Champion Half-Arabians Looking forward to two 2010 foals by Hollywood Dun It out of Minding Ps And Qs.

Elaine photo

Hollywood Jac 86 x Blossom Berry

NRHA's Leading All-Time Sire of Reining Horses FROZEN SEMEN AVAILABLE AT CEDAR RIDGE ARABIANS CONTACT: HEATHER DUNCAN • 715-426-9886, CELL: 612-940-0966

Brian Welman Hastings, Minnesota • 651-480-2123 • brian@welmanreining.com www.WelmanReining.com 126 AR ABIAN HORSE TIMES


TR Ima Rockin Kid with Gordon Potts

Reining Horses Available l bl

Reining Bred R B dP Prospects A Available l

Tamar Vision Quest 2003 Bay Gelding (Tamar Visionary x Fatal Attractionn) National quality reining horse for open or amateur.

Hollywood Bad Boy (pending) 2008 Buckskin Gelding (Hollywood White x KRA Pandoras Box)

Pepiliero 1995 Bay Gelding (Pepi x Liera) Multi Top Ten Open and Amateur. Kharben Color 2002 Dun Gelding (Tucknicolor x PZS Kharben Kiss) U.S. Top Ten Reining Futurity and Multi Regional Champion horse. Great for any amateur to show and win.

Im Not Dun (pending) 2008 Chestnut Filly (What It Takes x Janie Mae Gossip) Out of a Hollywood Dun It mare. Good Time To Take (pending) 2008 Bay Tobiano Gelding (What It Takes x A Good Time In Texas) It Takes A Chic (pending) 2008 Bay Filly (What It Takes x Peponitas Chic, an own daughter of Smart Chic Olena)

CC Mirage 1998 Buckskin Mare (Colorado Coolaid+ x Christy) Top Ten Reiner. Would be great for AOTR or youth rider.

Big Chex To Shine AQHA 2009 Colt (Big Chex To Cash x Shiners Cinderella, an own daughter of Shining Spark)

Hollywood Jac 2004 Half-Arabian Buckskin Gelding (Hollywood White x No Mercy) National quality reining horse, great for open or amateur. 3rd in Scottsdale Reining Futurity and would excel in western pleasure.

2009 Colt (What It Takes x Do Its Chic)

TR Comeback Kid 2003 Palomino Gelding (Ima Dun Kid x Kiss of Fame) National quality reining or western pleasure, Multi Regional Champion, great for open or amateur. TR Ima Rockin Kid 2006 Black Gelding (Ima Dun Kid x Portena) Scottsdale Top Ten Half-Arabian Reining Junior Horse.

2009 Colt (What It Takes x Candys Sweet Chic, a Smart Chic Olena daughter) 2009 Filly (What It Takes x Janie Mae Gossip) Out of a Hollywood Dun It mare. 2009 Filly (What It Takes x Peponitas Chic, an own daughter of Smart Chic Olena) 2010 (Wimpys Lil Step x Do Its Chic, an own daughter of Smart Chic Olena) 2010 (What It Takes x Fancy Romance) 2010 (What It Takes x Janie Mae Gossip) 2010 (What It Takes x Peponitas Chic) 2010 AQHA (Wimpys Lil Step x Candys Sweet Chic) Gordon & Wendy Potts 10312 County Road 1020 | Burleson, Texas 76028 Tel: 817.447.0001 | Fax: 817.295.6649 E-mail: thebrassring@hughes.net | www.thebrassringinc.com APR IL 2010 | 127


The Working by Linda White and Mary Kirkman

Arabian horse people are excited. Their enthusiasm is so electrically charged, you can almost hear it crackle. Like sorcerers, the reining, cutting, reined cow and working cow horses have woven a spell, unprecedented in living memory, over the Arabian horse culture. Interest and participation numbers continue to rise, stronger and harder to resist, with every week. The more horse show audiences watch them perform, the more they want to join in the fun. As time goes on, the division continues to evolve. Big changes for Scottsdale’s Non-Pro Derby are in the offing. Over the last three years the Non-Pro Derby has grown into an exciting spectacle for audiences and competitors. It is about to become even more exciting. Reining enthusiast Tim Anderson, owner of Amani Arabians, Milbank, S.D., has volunteered to sponsor the class for the next four years. Anderson’s generous vote of confidence will add $20,000 to the popular event’s payout. Bazy Tankersley of Al-Marah Arabians, Tucson, Ariz., a long-time proponent of the working western classes.

128 | AR ABIAN HORSE TIMES


Western “Last year, when Dick Ames, Tom Redmond and Joe Betten came to the ARHA club and asked us for ideas,” he explains, “I immediately thought of the Non-Pro Derby. If I were to guarantee a $20,000 minimum purse for each one of the next four years, I thought to myself, I’ll bet that would make the Half-Arabian Non-Pro Derby a lot more interesting. Now, my hope is that the increased payout will stimulate the market for futurity-turned-amateur horses, which in turn will strengthen Futurity Classic entries. The added $20,000 should also contribute to the Half-Arabian Non-Pro Derby’s prestige and credibility.” (See www.arha.net website for details, entry forms, rules and specifications.) Reining’s popularity is well out in front at this writing, but good, honest reining, cutting and working cow horses too are flying off the shelves. The rub is that there are not enough of them to meet the current, ever-growing demand. Dick Ames of Cedar Ridge Arabians, Jordan, Minn., a huge suppporter of the Arabian Reining Horse Association.

APR IL 2010 | 129


THE WORKING WESTERN PHENOMENON

The Brass Ring Burleson, Texas Gordon and Wendy Potts

“Arabians are very athletic and strong horses,” Gordon Potts says with a certainty based on years of training experience, and as many years of enviable success. “They may not be as heavily muscled as Quarter Horses, but they are strong, and very supple: They bend in the right places. Riding these horses is difficult, both mentally and physically, but in a different way than the demands put on riders in other disciplines. The same thing is true of the Arabians that produce them. They aren’t like Quarter Horses, where certain bloodlines have been bred for generations for one specific discipline. Arabians’ pedigrees may be filled with athletes, but those horses were athletes in different ways.” “What is the big attraction? Doing the pattern correctly is a tremendous adrenaline rush. It’s difficult and challenging, but it’s also so engrossing—like golf—that once you start, you can’t get enough. It is thrilling for any rider, and it really helps them in every other form of riding. It gives them better balance and more confidence, plus a greater awareness of their own and their horse’s bodies, and a better feel for what the horse is doing and thinking. “I had been away from it for a long time,” he explains, “but I came back when somebody brought me a horse. When I first started training working western horses again, I realized how few soundness issues these horses have, and how much they love the work. They take a long time to train, and when cattle are involved, the cow is always an unknown element. You never know what the cow is going to do, but it’s exhilarating, and there is always something new. Riders at every level have opportunities to do well on their way up, at least right now. It won’t always be that way, but today’s amateurs can have a relatively low score and still place respectably. “It’s also pretty safe,” he adds. “Getting people over the hump is the hardest part, because it’s a real challenge to

130 | AR ABIAN HORSE TIMES

Gordon Potts of The Brass Ring.

learn to ride one of these. One nice thing is that riders get to spend a lot more time on their horses than they do in most other divisions. “There is no question that all the interest in these classes is a big plus,” Potts continues. “It’s so much fun, and the more people want to play in any facet of our sport, the better off we all are. More interest creates more demand for useful, athletic, reliable horses, both purebreds and Half-Arabians. We are beginning to breed for horses with a stronger loin, lower set hocks, and greater strength—but you still have to start any young horse with the basics, and let him tell you what he likes to do. That’s how you get a happy horse and a willing partner.”

“You still have to start any young horse with the basics, and let him tell you what he likes to do. That’s how you get a happy horse and willing partner.” —Gordon Potts


THE WORKING WESTERN PHENOMENON

Brian Welman Training Center Hastings, Minn. Brian Welman Brian Welman won his first NRHA world title 25 years ago. What is less well known is that among all the Quarter Horses, Paints and Appaloosas that generally fill a reining trainer’s barn, he had an Arabian in those days and he showed at the U.S. Nationals. He made a higher-profile entry into the breed when he showed at Scottsdale in 2006. Dick Ames had asked him to help with Cedar Ridge’s reining horses, and when Welman obliged, the partnership resulted in a third-place award for Minding Ps And Qs in the Reining Futurity’s purebred division. After that, it was katie-bar-the-door: In 2007 he and Minding Ps And Qs won the purebred division, and he finished third with TR Texas T in the Half-Arabian event; in 2008, he won the purebred division with Fyre In The Skye and the Half-Arabian with TR Texas T; and in 2009, he won purebreds again with Fyre In The Skye, and with TR Reindance, finished in a tie for reserve. By anyone’s reckoning, he has done very well in the Arabian industry’s premier reining competition.

discarded, and each maneuver is scored separately—all of which lends a transparency to the procedure. “It’s not perfect,” he says, “but I think it’s one of the most fairlyjudged events that there is in western.” Welman sees potential for the future of Arabian and Half-Arabian reiners particularly on two fronts: breeding and the development of competitive opportunities. “I think more people are breeding for reiners,” he says. “With Dick’s program, we’re trying to breed futurity champions to futurity champions and hoping that will produce. You don’t know unless you try it, but that’s what the reining horse industry in general has done— breed horses that are doing good to horses that have done something in the pen or are producing horses that are. That’s how you try to make your sport stronger and more effective.” The other area for development is the range of competition. Over his years of involvement in the NRHA, he has seen that organization build a

Welman, whose record includes an enviable amount of NRHA prize money, is the first to agree that not only has the funding improved in Arabians over the years, but also the standard of competition has been elevated—and continues to rise. “Maybe in the early 1980s and before, Arabian reiners were more the horses that couldn’t make it as pleasure horses,” he observes. “To me, they’ve gotten a lot stronger and have a better shape now (they used to be kind of gangly). The classes used to be more of a stopping contest, which it still is, but there is more finesse and style in it now. The circles and spins are judged a little more, and you get more credit for them if you do them well. Before, it was more about who could slide the farthest.” In his opinion, the system of judging in reiners also makes it appealing to many Arabian owners. The competition requires five judges, with high and low scores

Brian Welman of Brian Welman Training Center.

APR IL 2010 | 131


THE WORKING WESTERN PHENOMENON

framework of classes to satisfy riders with widely varied levels of skill. That, he points out, is what creates a healthy market for the horses—and at this time, the Arabian breed needs more outlets for its reining horses when they progress beyond the futurities. “I think we need amateur events, and maybe another open event so that they don’t just rely on that one event (the futurities),” he says. “It’s going to take some time to get it to huge numbers, but I think we’re heading in the right direction. “I was kind of against the amateur non-pro futurity,” he admits, “but I guess there is quite a bit of interest in it.” He is interested in seeing a well-funded competition at the Derby level, which typically draws horses in the 6 to 8-year-old range. “It’s obvious that the prize money controls the market,” he says, and comments that in the open reining world, a horse’s value drops a little after it leaves the major money events. However, there are so many horse shows in which they can participate with amateurs that their market remains relatively strong. NRHA’s youth and amateur (called non-pro) classes are diverse, ranging from “green as grass” (entry level) to “primetime.” Eleanor Hamilton of Eleanor’s Arabian Farm.

“Arabian reining isn’t big enough yet to have that many divisions,” he says, “but when you create some and give more people an opportunity to play and feel competitive, I think you make your base a lot stronger. You definitely need to make a place for people to play and be competitive and create a market for horses, because the horses aren’t all superstars. We have novice horse divisions in NRHA too. You have to create a market for the level of the horse as well as the rider.”

Eleanor’ s Arabian Farm Rogers, Minn. Eleanor Hamilton

Eleanor Hamilton has been riding and raising reining horses since 1988, when trainer Rod Matthiesen came to Eleanor’s Arabian Farm. “We were already breeding Arabians, so we continued with what we had,” she remembers. “When we got Hesa Zee in 1995, we now had something that could really improve what we were doing. We added several good, older Quarter Horse 132 | AR ABIAN HORSE TIMES

mares to our broodmare herd. They all had good dispositions, because disposition is the thing I look at first. Hesa Zee has a terrific temperament that he passes on, and I want to breed a horse I can show, and that another woman or a kid can show. I don’t want an ill-tempered, unpredictable horse in my barn. “Not long after we got him, I took Hesa Zee to an NRHA open show, and he did very well.” She laughs to herself. “The word on the grounds was, ‘Where did this bay Quarter Horse stallion come from? Who is he? Why have we never seen him before?’ We still laugh about that. “I was tired of riding around in a circle, so working western classes, especially reining, really appealed to me. It is more exciting than other classes, and you don’t have to keep buying expensive equipment and riding outfits to compete. That helps with expenses. Nobody cares or even notices your saddle or what you’re wearing. It’s your score that matters.”


THE WORKING WESTERN PHENOMENON

Hamilton still shows in western pleasure occasionally. She won the 2009 Region 10 Western Pleasure AAOTR Championship with the pure Polish stallion TAF Pennant, now 19. The elegant grey stallion, a last-minute rescue, will be Hamilton’s western side saddle mount in 2010. “The lady I got him from had learned about the situation, and gone out to where the horses were. She bought him and took him home with her, but when she went back the next day, all the other horses were gone. What if she hadn’t taken TAF Pennant with her?” Hamilton wonders aloud. “Who knows what led up to the situation, but TAF Pennant is a lovely horse, and his jog is smooth as can be. He’s perfect for side saddle. I’m really looking forward to it. We’re having a ball with it at the farm!” She speculates about why the working western classes are so mesmerizing to audiences. “First of all, the classes have so much more crowd appeal, because there is so much action! This is especially true at shows like Scottsdale, where all kinds of non-horse people are in the audience. The classes are exciting! There is so much more to see! In other classes, the non-horse people have no idea what the judges are looking for. All the horses look alike to them. “Our classes are much more audience-friendly. With one horse working at a time, they can see and understand whether somebody does a great job or if they go off pattern. They also can identify with the exhibitors. ‘Look at that old gent!’ they say. ‘He’s having fun! I could do that.’

to do it again when her children were old enough to allow her the time, and she thanks her son for putting the University of Arizona on his short list of colleges. Seven years ago, when the family flew to Tucson to check out the school, Jacobs scheduled a visit to Al-Marah Arabians too, little knowing that she was opening the door to an absorbing passion. A year later, she bought her first horse—her second Arabian, as one of her childhood mounts had been an Arabian so impressive that she had always known she would stay with the breed. “I think it had to do with their desire for social interaction,” she says. “But when I came back, I didn’t know what I wanted to do. I’d been in hunter/ jumpers before, but this time, I spent some time researching the possibilities. In the interim, my husband and I became partners in a guest ranch in Grande, Colo., so we were doing a lot of western riding and ranch work there.” That led her to the working western disciplines, particularly reining. “The maneuvers and the precision intrigued me,” she reports, and chuckles. “I never look for the easy way! But there is no opportunity for the judge to be looking the other way. They don’t miss a thing.” Originally, Jacobs was a joint owner in the stallion AM Good Oldboy with Bazy Tankersley, but her desire to show made partnership problematic. Most amateur

“I love reining because it is something I can enjoy doing myself, at my age, knowing that I’m relatively safe doing it. I also will be showing a 5-year-old Hesa Zee daughter, Sheza Velvet Rose, this year,” she adds. “She’s a snaffle bit horse, and I have never shown a snaffle bit horse before, so this will be something new. I can hardly wait!”

Linda and Bill Jacobs Hinsdale, Ill. Linda Jacobs’ involvement in Arabian reining occurred by chance. Having ridden in her youth, she was determined

Bill and Linda Jacobs.

APR IL 2010 | 133


THE WORKING WESTERN PHENOMENON

classes were for amateur owners, and as a partial owner of AM Good Oldboy—and not a member of Tankersley’s family—they were closed to her. At her first Scottsdale, she had to take AM Good Oldboy in the open division. “I was not to be deterred,” she said. “If that was the only way I could ride and show, then I didn’t care about winning or losing. I was going out there and showing my horse.” Fortunately, her co-owner not only agreed, but encouraged her. “If there is one problem in Arabian reining,” Jacobs says, “it is that there are a lot of amateur-owner classes, but not enough amateur-to-ride. (I totally support the nonpro futurity. I wasn’t ready this year, but I hope to be ready next year at Scottsdale.) How else are we going to promote our breed and our discipline?” Eventually, her enthusiasm for the show ring led her to trade her interest in AM Good Oldboy for full ownership of his son, U.S. National Reserve Champion Al-Marah Matt Dillon. “I always loved Matt; I was there just after he was born,” she says. “Matt is a person; he has given me huge confidence. He’s quiet and bold, and he’s very powerful but gentle. It sounds hokey, but he is, and I can do anything with him. His first year in the bridle was the first year I owned him, and I showed him. Gary Ferguson, his trainer, showed him as a 6-year-old at Scottsdale and I took possession of him in April. The first time I ever showed him was in May at the Buckeye.” After that, she and Ferguson shared Matt’s show career, and it is only because she plans to ride her younger horses this year that Matt likely will be solely his trainer’s partner in 2010. For an amateur as enthusiastic as Jacobs, Ferguson’s willingness to share the horses, no matter the outcome, has been especially welcome. “I’ve gone off reining pattern many times,” she says ruefully, and adds wryly, “always when it counts the most. But that’s just part of learning to show—I’d never shown a horse in my life, and this was just my third year at Scottsdale. Gary and I trade off on my futurity horses too. He helps me make it possible for me to ride and show them, and he is very supportive of my showing them.” Jacobs has not limited her participation to reining; she fields a reined cow horse (a national top ten mare), 134 | AR ABIAN HORSE TIMES

loves the cutting division, and is looking forward to showing in western pleasure. And she is committed to promoting Al-Marah Matt Dillon as a breeding stallion. “I can’t manage more than one baby a year myself,” she says, “but my goal—for myself—is to see if I can improve on him or on the mares, and to breed purebred and Half-Arabians for reining and western pleasure mostly. So we are selling breedings too.” The very qualities that drew her to Al-Marah Matt Dillon are the ones she most values. “He’s very usable,” she says. “He’s also very beautiful; actually, he’s stunning, and he has a great temperament. I called him my boyfriend—and then I realized people thought I had a boyfriend!” She stops to consider that her husband Bill is her biggest supporter. “I’d better quit that.” “You have to do it because you love it and believe in your horse,” she says. “I believe in Matt. I’d love to see how he crosses on other people’s mares, and I want to see as many of his babies in the show pen as possible.”

McNamara Performance Horses Forest Lake, Minn. Jacquelyn McNamara

Meg McNamara aboard Bullwynkle, 2010 Scottsdale Champion Half-Arabian Non-Pro Rookie and Non-Pro Limited.


THE WORKING WESTERN PHENOMENON

Ranches of Cherry Creek Wessington Springs, S.D. Steve Grove Steve Grove earned a 2009 U.S. National Top Ten Championship in Arabian Working Cow Horse, AAOTR the first time he ever competed at the national level. Grove started riding at 50, and in less than five years, he was a legitimate reining contender. Last year, he bought Traddition, a 1983 model who was the 1989 U.S. National Working Cow Horse Champion. Twenty years later, the horse was named 2009 U.S. National Reserve Champion Working Cow Horse, showing with master horseman Don Ulmer, head trainer at Grove’s South Dakota ranch. It was Traddition on whom Groves won his 2009 U.S. National Top Ten AAOTR. He and Traddition won their class at Scottsdale 2009, too, and Grove is delighted to see how the working western division continues to grow. “Five to seven years ago,” he recalls, “there would be only seven or eight in my amateur reining classes. This year at Scottsdale, there were 28 or 30! The biggest challenge I see is that there aren’t enough older, experienced horses available for amateurs. We need trainers who can start and develop honest, reliable working western horses that will match a non-pro rider’s skill level. “What’s the big attraction?” he asks rhetorically. “I’m an adrenaline junkie, and going down that rail at 30 miles an hour, putting on the brakes, sliding to a stop, spinning, doing rollbacks, while trying to keep track of your pattern, is really exciting. The camaraderie is great, too. The amateurs all cheer each other on, because we know we’re really competing against ourselves. We’re always thinking about how we can get a higher score next time. I’m just grateful to have the opportunity to do something that’s so much fun!” “I can’t imagine doing anything else,” says Elise Ulmer, now 24. She is trainer Don Ulmer and his wife Kamber’s daughter. “It’s a lifestyle that always surrounds you. I grew up with Arabians and Quarter Horses, and as I tried to decide what I wanted to do, life kept pushing me in these horses’ direction.” Ulmer concedes that, “Training working western horses can be

a difficult job, and they take a lot of time to train. You have to perfect your own skills first. You can work four western pleasure horses in the time it takes to work one reining horse.” Ulmer is putting together an ambitious incentive program for purebreds and Half-Arabians that she calls the Ultimate Futurity. The concept is based on paying back 50 percent of the entry fees, which will be put into each class’s jackpot. Class winners will also win custom belt buckles and up to $250 per class. “Scottsdale is one of the few places with added prize money,” she notes. “If you want to pull in more people, you have to give them a monetary incentive. Even if they spend more on their horse than they can ever recoup, people like to win prize money.” Ulmer hopes to offer Ultimate Futurity classes at three shows initially, with more on the horizon. “Amateurs buy horses, not trainers,” adds Don Ulmer, “and when it comes to marketing, buyers and sellers need to recognize that not every futurity winner will have the qualities that are ideal in an amateur horse. On the other hand, a 10th place futurity horse might make a great amateur horse. “And another important thing is getting show committees to include working western classes, especially cutting and working cow classes. People often have a lack of knowledge

Don Ulmer, Traddition and Steve Grove of Ranches Of Cherry Creek.

APR IL 2010 | 135


THE WORKING WESTERN PHENOMENON

about cattle, or about cattle people. Show committees don’t like the headaches and responsibilities that come with having cattle at the show. Exhibitors complain about the smell, or gripe that the cows scare their horses, so it’s up to us to relieve show committees of those problems, and any others related to cattle. We have to be willing to do that, just to be able to show our horses.”

Thiago Sobral Performance Horses Scottsdale, Ariz. A native of Brazil, Thiago Sobral came to the United States to learn western horsemanship and, he says, to improve his English. He did both, and today is one of the rising young stars in the working western world. Sobral, who rode other disciplines in Brazil, began his career in North America by apprenticing with Benny Guitron, National Reined Cowhorse Association Hall of Fame trainer. He opened his own facility in 2003, and is now based at Loma Vista Farm in Scottsdale, with a show schedule that includes NRHA, AQHA, ApHA and Arabian events.

Sobral takes a measured approach to developing working western horses. After evaluating an individual’s needs and abilities, he takes his time to bring the horse along slowly, with an emphasis on enjoying its work—a technique, he believes, that will ensure the horse’s long and pleasant life in the show ring. Similarly, when training riders, he pays special attention to each one’s confidence and skill level, again with an eye toward long-term, successful participation in the sport. For both horse and rider, setting goals and working toward them is a favored procedure. The program at Thiago Sobral Performance Horses includes futurity to derby-level competition, along with extensive youth and non-pro training and support. In addition, two stallions are at stud at the farm: the 2008 Arabian Horse Times Readers’ Choice Working Western Horse TA Khalil and the Quarter Horse Chic Tommy. In recent years, Thiago Sobral’s achievements in the show ring—and those of his riders—have propelled him into the headlines as an Arabian trainer. In 2008, he rode TA Khalil to the U.S. National Championship in the Reining Futurity, and a year later, he returned to the Nationals to nail the title again with Santanas Angelo.

Thiago Sobral of Thiago Sobral Performance Horses.

136 | AR ABIAN HORSE TIMES


THE WORKING WESTERN PHENOMENON

Wolf Springs Ranches, Inc. Westcliffe, Colo.; Scottsdale, Ariz.; and Santa Ynez, Calif. Tom Redmond “You should have seen the celebrity reining we had at Scottsdale this year!” are the first words out of Tom Redmond’s mouth when Arabian reining is mentioned. “It was tremendous!” Redmond continues to be a key reining exhibitor, promoter and supporter. He has been instrumental in helping sustain exciting incentives and payback programs in every aspect of the sport. “We now have classes for everybody,” he says, “from beginners to non-pros, and for reining horses at every level, from novice on up!

than most other divisions—but it’s also more fun! We now have five judges scoring, all NRHA licensed, and all of them ride reining horses. That’s exciting in itself, because they know what they’re looking at. (The NRHA, reining’s national governing body, was developed and is managed primarily by Quarter Horse enthusiasts, but most NRHA events are open to all breeds.)

“It’s more exciting than any other division! You’re rockin’ and rollin’ out there!” —Tom Redmond

“Twenty years ago, when I became involved with reining,” Redmond continues, “all we ever got were the cast-offs. With the right training and management, though, some of those rejects made decent horses. These days, when a young reining horse does well in a futurity, a trainer has his client look at it for an amateur horse.” Wolf Springs maintains a topnotch herd of Arabian and AQHA broodmares, and stands a select roster of Arabian and Quarter Horse stallions that reliably sire strong reining prospects.

Tom Redmond of Wolf Springs Ranches, Inc. “Riding a reining horse is not easy, but people want to do it. Why? What’s the attraction?” he muses. “It’s more exciting than any other division! You’re rockin’ and rollin’ out there! It’s just my opinion, but I believe that learning the reining discipline is much tougher

“That brings up the obstacle we face,” Redmond says. “There are not enough reining horses, and not enough people are breeding them. We need more serious breeders! Our Wolf Springs program is small: We only raise 10 or 12 foals a year, and there aren’t very many other people out there who breed for working western horses at all.” His daughter, 12, rides and competes in everything but reining, her dad explains, and he and his wife have 4-yearold triplets who are enjoying lead-line. “I spend most of my time now enjoying my girls and their horses.”

APR IL 2010 | 137


2010 Scottsdale Reining Champion offered for sale Bullwynkle (Tucknicolor, AQHA x C-L Rafika, AHR)

6-year-old gelding

His first show ever with winnings over $1,700. Champion Non-Pro Rookie Champion Non-Pro Limited 2nd Place Non-Pro Intermediate Tied for 3rd in Non-Pro Half-Arabian

Whiz Van Winkle AQHA (Topsail Whiz, AQHA x My Way Oakie, AQHA)

2008 Regional Champion Junior Reining and NAAC Champion Open. In 2010 he earned a ROM in Amateur and Open. Winnings to date are over $12,000. Will make exceptional Half-Arabian reiners. Opening breeding fee: $1,000 Shipped semen available

Trained by Brian Welman Training Center Inquiries: McNamara Performance Horses 10321 Tenth Street North • Lake Elmo, MN 55042 651-436-3766 • DoubleGoldQHs@aol.com McNamaraPerformanceHorses.com

138 | AR ABIAN HORSE TIMES


“Your Source for the Finest Working Western Horses” DAKOTA WOLF+/

JJaborr x Cry Wolf

Don Ulmer D U National Champion U.S. H Half-Arabian W Working Cow

SHORT AND SMART+/

Smart Commander x CbarM Baroness+

Don Ulmer U.S. National Champion Half-Arabian Working Cow U.S. Reserve National Champion Half-Arabian Cutting Horse

HH TUCKS H PLAYBOY

Tucknicolor x Khabreah T

Steve Grove S U.S. National Top Ten U H Half-Arabian Reining Futurity R Region 6 Champion H Half-Arabian Reining AAOTR

RANCH OF CHERRY CREEK

22746 365th Avenue, Wessington Springs, SD 57382 Steve Grove - Owner • Don Ulmer - Trainer/Manager • Elise Ulmer - Trainer www.RanchOfCC.com • 605-539-WHOA • dkulmer@venturecomm.net APR IL 2010 | 139


One Man’s Opinion Thoughts On The State Of The Arabian Horse Industry, Part I by Bob Battaglia

As I look at the state of the Arabian horse industry in this country, I can’t help but have two simultaneous thoughts. Yes, we have problems. But at the same time, I feel strongly that the horse business is alive and well. Like everything else now, it is a little depressed, but we have lived through things like this before and we will again. And there is good news. From what I can tell, we’re seeing an increase in sales and a smaller, but real, increase in breeding. I think that is due to the fact that people are adjusting to the economic situation in our country. They have decided that they do have a little extra money to spend and that horses are worth spending it on. Horses may be a luxury, but they are also a lifestyle—a family lifestyle, actually. So, while I am definitely not lost in the doom and gloom, I do think there is a lot we can do to improve the Arabian industry, and we have to address our issues if the breed is to grow. Beginning with this column, I’m going to explore problems and look for solutions, because I’m convinced that we can find the answers. I invite reader participation; everyone’s thoughts and ideas will be valuable as we consider the future of the Arabian horse in this country.

140 | AR ABIAN HORSE TIMES


ONE MAN’S OPINION

“All of this leads me to believe that at this point in time, our biggest challenge is to find a way to introduce new people to the Arabian horse. New people, and new or revitalized activities, eventually will support the breeders, owners, trainers and shows that make up the business.”

Let’s start by looking at what we’re up against. Our biggest problem—the underlying issue confronting every horse breed and discipline—is that we are faced with a different world than the one that has been known in the past, and I’m not talking about changes that came with the economic downturn. Horses are not a necessity for transportation, as they were at the turn of the 20th century, and they are no longer the heart’s desire of every child who watched “Bonanza” (or “Roy Rogers,” and all those other television shows that put horses in everyone’s living room). We don’t see horses on “CSI” and “American Idol.” In years gone by, there were horse shows everywhere, and local stables and bridle paths. Little of that exists anymore. It is not a given that the public will get much exposure to show horses as an exciting hobby or trail horses as best-friend companions. Add to all of that, young people today are attuned to electronics. Talk about a revolution! Computers, iPads, cell phones, texting, etc., have changed the way we communicate. I suspect half the kids don’t even talk to each other these days; they text. None of that is the result of the economic climate. It’s the evolution of our world, just as the automobile was a century ago when it basically took over the horse’s job in society. Horse owners and breeders dealt with it then and they did it so well that to this day we are all enjoying some of the activities they created. All of this leads me to believe that at this point in time, our biggest challenge is to find a way to introduce new people to the Arabian horse. New people, and new or revitalized activities, eventually will support the breeders, owners, trainers and shows that make up the business. Traditionally, newcomers were best reached through local Arabian organizations—shows, club functions, open houses at breeding farms (large and small), etc. The shows and activities introduced people to Arabians, while the farms supplied the horses and provided background and education. It worked well because there were places to buy horses and a range of activities to do with them. Some of those people, then, aspired to regional and national competition, supporting yet another aspect of the industry. A great tool for exposing people to Arabians at the time was the Arabian Horse Fair, which AHA and the Registry put on in the 1970s. It was a selling tool for everyone. Stallion owners exhibited their stallions to the public and promoted breeding, while others marketed show and pleasure riding horses. Educational seminars were put on, and information was presented about all the things you can do with Arabians (not just showing). That was particularly important because although we all like the fact that the top show horses are glamorous and expensive, it does not help the breed to have an image in the public as being beyond the means of “regular people.” The most expensive show horses do cost more than many people want to spend, but we need to make it clear that the average Arabian does not—and Arabians do many things very well. Going hand-in-hand with the expensive show horse image is the one of their being “flighty,” which

APR IL 2010 | 141


ONE MAN’S OPINION

indicates that Arabians are unstable to be around. So, the first job is to teach people about the advantages of being around horses, and how much Arabians can be enjoyed for relaxation, companionship and, if you want, shows for many levels of expertise. That is the groundwork. The next step is show competition. I think many people are competitive by nature, so the task we have is to offer the venue. I come from the show end of things, so that is the part I’ll address here.

“Every level of the show ring is important, and they all relate. I believe that at this point in time, we need to focus on rebuilding the foundation of our system. The exciting, expensive national shows rest on a framework of regional and local shows, and if the framework isn’t solid, the success of the national events is not assured.”

Every level of the show ring is important, and they all relate. I believe that at this point in time, we need to focus on rebuilding the foundation of our system. The exciting, expensive national shows rest on a framework of regional and local shows, and if the framework isn’t solid, the success of the national events is not assured. The fact is that everything is so expensive now that it is a lot harder for a new or small Arabian horse owner to participate—often, even, at the local level. And we can’t forget that many of our biggest and most involved owners and breeders began at the local level. If it hadn’t been there and hadn’t been viable, they would not be in the breed today. AHA is addressing this issue with its local shows, and we need people to get more behind that. It is a positive answer; the local shows are what made this breed what it is. Taking Arabians to open shows, so that people can see that the horses aren’t “flaky,” is also a good idea. Until the advent of all-Arabian shows, the open shows were where owners showed their horses, exposing the breed to thousands of new potential enthusiasts. It is not realistic, however, to suppose that any horse show will ever be “cheap” again. Very little in life today is cheap. However, local events are certainly less costly than regional or national shows, and well within the scope of many families’ leisure budget, if they offer an enjoyable experience. To further boost that segment of the industry, we need to strengthen the class A through class C level and open shows. I believe it is time for AHA to reorient the structure of the regionals and nationals in this country. We have 18 regional shows, and they are hurting our small shows. We’ve tried everything to force people to go to the small shows—rules and regulations, points, all of those things—and nothing has worked. I propose that AHA drastically reduce the number of regionals by dividing the country into just four regions. Each of those four regionals would host a championship, featuring as much prize money as possible, to qualify exhibitors for nationals. This would serve several purposes. With fewer regionals to concentrate on, owners could afford to attend more local and class A shows to qualify for regionals and nationals, and with that kind of support, local clubs could offer more shows. Also, it would enhance the importance of a regional title because there will be fewer of them. And finally, most importantly, I hope that as the local shows get more participation, the local clubs would use the money to restart or expand their Arabian promotion programs.

142 | AR ABIAN HORSE TIMES


ONE MAN’S OPINION

“I truly believe that we can meet the challenges we’re up against in today’s world. I’ve been a breeder, done public sales, had up to 150 horses on the place, stood five or six stallions at a time, and over the years, been through the highs, the lows, the highs, and now the lows again. I don’t see our situation as desolately as some people do, but I do think that improvement is in order.”

In formulating this idea, one of my concerns is that too often, the only horses who are selling well are the ones who can win at the national level. We need to create something else to do with our horses—local shows, fun shows, trail rides—and get behind it. As it is, it is hard for the small breeder to breed and sell his or her product. It is also hard for the small show to exist because so many people want to go to regionals and nationals that when an exhibitor is on a budget, small shows have gotten cut out. I believe that this would help local people sell, and when they can sell, they can breed. Not every horse that is bred is a potential winner at nationals. We used to have various levels in this industry, and that was what kept the breeders alive—there was a place in the hierarchy for the majority of the horses. Also, it pays to remember that many of our greatest national champions came from small breeders. To end on a bright note, this year in particular Scottsdale was very successful, down only about 20 horses even in today’s economy. Sales were slow, but there were sales, and what we’re seeing now, at the beginning of the year, is better than what we saw at the end of last year. Breedings, too, have picked up a little. I think we’re seeing something positive in the industry, in all breeds, not just ours. I truly believe that we can meet the challenges we’re up against in today’s world. I’ve been a breeder, done public sales, had up to 150 horses on the place, stood five or six stallions at a time, and over the years, been through the highs, the lows, the highs, and now the lows again. I don’t see our situation as desolately as some people do, but I do think that improvement is in order. I’m interested in your thoughts, and particularly, in any suggestions you have to improve the health of the Arabian horse industry. We’re all in this together. I can be reached at info@battagliafarms.com. ■ “One Man’s Opinion,” by Bob Battaglia, will appear in Arabian Horse Times on a semi-regular basis. Trainer, owner and breeder Bob Battaglia has been involved with Arabian horses for more than four decades. He has lost count of the number of championships and reserves he and his amateurs have won at the U.S., Canadian, and Youth Nationals; more than 10 years ago, it passed 450. He has been named APAHA Horseman of the Year four times, Saddle Seat Trainer of the Year three times, and English Trainer of the Year. In addition, he is known as an instructor with a unique ability to communicate with amateurs. Among other industry contributions, he has taught at AHA judging seminars, been a member of the AHA Judges’ Steering Committee, been Vice Chairman of the National and Regional Classes Committee, and served on AHA’s Whip Study and APAHA’s Hoof Study Committees. For USEF, he served as Chair of the Show Standards Committee. He is as a Large R judge, and was a founding member and past president of APAHA. As a breeder, he has contributed an impressive array of national-winning Arabians and Half-Arabians. APR IL 2010 | 143


APRIL VISEL

Arabian Horse Photographers In Focus

by Mary Kirkman

144 | AR ABIAN HORSE TIMES


APRIL VISEL

Taken in the Kelso Dunes near the California/Arizona border. APR IL 2010 | 145


APRIL VISEL

April Visel woke up one morning and realized she was a rock star photographer. Maybe “rock star” is overstating it (she doesn’t call herself that). But ask any horse owner looking for arresting, evocative images of their horses, and on a short list of artistic photographers, her name comes up with increasing regularity. About three years ago, she noticed that her customary anonymity at Scottsdale was evaporating, as she found herself recognized and stopped. Then she scored her first magazine covers, one with a classic fine art shot, and the changes were more pronounced: Her e-mail inbox filled with requests for shoots, and her telephone rang with appointment bookings. She had arrived.

with a Half-Arabian/half-Tennessee Walking Horse, who also remained with her for life. “I spent my life on the back of my horses,” she recalls. “Did my homework on their back, rode them to my babysitting jobs, took care of them. Being a hippie child, I never wore shoes and didn’t have a saddle. Had one bridle, and that was it—wind in my hair, and it was fantastic.” One thing she did not do in those days was shoot photography; film and processing were too expensive for the family’s limited budget.

For Visel, it was a welcome, if hard to process, discovery. “I was always taught to be humble, ‘don’t think too much of yourself,’” she says. “I’ve had to learn to accept the fact that if people like the photos, they mean it.” Her humility has a practical application as well. “You can’t think too much of yourself or you get lost,” she says of doing her job. “It has to be about the horses. It has to be. If it’s a wedding, it has to be about that bride and that groom. If it’s a baby, it’s about that baby, that pregnant lady and that pregnant belly. It can’t be about anything else.” What seems like a natural fit now did not happen overnight, although horses have been on the horizon for most of her life. “I knew for sure I was going to be something in horses,” she says. Now 34, she grew up in Mount Aukum, Calif., a picturesque little town in the Sierra Nevada range that had attracted her parents, selfdescribed hippies, who hitchhiked there before she was born. Halfway between Sacramento and Lake Tahoe, it offered a laid-back community and panoramic countryside that has kept the family there—in the same house—to this day. For April, two turning points occurred in rapid succession when she was 5: Her mother supplied her with two ponies, and she watched the movie The Black Stallion. “It is totally cliché,” she admits sheepishly. “Everybody says it. No matter how I toss it, it comes back to that movie, where I knew that an Arabian was what I wanted.” She loved the ponies, and they were not only in her care but also her friends until they died 10 years ago. She wanted an Arabian, though, and finally was rewarded

146 | AR ABIAN HORSE TIMES

This is me when I was 9 years old on my pony Donald in the river that ran in our backyard.

When April was 11, her mother picked up a box of Arabian horse magazines at a yard sale. April cut out the pictures—it was the time of *Aladdinn, Khemosabi, and Bey Shah, she remembers—and turned her bedroom into a collage of Arabian horse photographs. With no camera, she tried drawing the horses but couldn’t quite achieve the images she wanted, even when she froze a frame of the Black Stallion movie (the one where the horse rears up on the beach) as a model. More and more, she knew she wanted a career in horses, but identifying one with an income was a puzzle.


I still prefer bareback with no shoes, or just flip flops! This is my gelding Knight Fire (by an An Malik son out of Le Fire daughter) on Summerland Beach, Calif.

One of my favorite photos of Brandon. I snapped it before he knew I was there, while working a wedding together in California.

Calendar Girl -taken in 2005 at Varian Arabians. This was my very first, and still favorite, artistic image. Taken on “the” day I speak of so often, standing in the Varian mare pasture, realizing this would be my “job!” This image hangs in my office as a 30x40 to remind me when it really began for me personally.

APR IL 2010 | 147


APRIL VISEL

Another turning point in her life came when she married Brandon Visel in 2000 (an earlier union rates only the memory that she kept her horses throughout it). A musician, Brandon understood her passion. “He has this love affair with his piano, which completely relates to my kind of psychotic love for horses,” April notes. “So we have this really great understanding between the two of us.” With Brandon came April’s serious introduction to photography. He was educated in it, and she experimented with his film cameras, but it was the advent of digital shooting that made all the difference. “I took pictures of flowers, landscapes, all sorts of silly stuff, and loved it,” she says. “I could see what I’d shot and train myself.”

Even with her commitment, however, her entry into the highly-competitive world of Arabian horse photography did not happen overnight. At the time, she was working as a makeup artist and Brandon was moving from an office job into the profession of music composition. As April was trying to figure out how to develop her career as an equine photographer, friends asked her to shoot pictures of their wedding. Brandon agreed to work with her, and the chance opportunity launched them into a demanding but unexpected business. “It spread like wildfire,” she says. “We went from doing one wedding for a friend to doing 16, and we were traveling the world doing it.” They were a team; Brandon had what April describes as an “editorial version of things,” typically shooting the story from an expansive angle, while she pursued the tight, emotional shots. That they were successful is evident in the comments left by newlyweds on a wedding website: “They made taking pictures fun, and we are in love with the results,” wrote one bride, while another added, “They were phenomenal.”

There was plenty to photograph on the four-and-a-half acres the couple leased in Ojai, Calif. She was playing with the camera one day when her Arabians cantered by in their pasture, and without thinking, she aimed the camera. “Everything snapped together in this huge burst of light,” she now reflects. “I thought, ‘Oh my God.’ It was amazing. I realized I could take pictures of the horses. The only trouble was, both April I began having flashbacks to my and Brandon had other goals in magazines, to all the images that mind, and after a few years, the I had been staring at my entire heavy-duty stress of wedding life. It was always the artistic photography had taken its toll. It stuff—always these great images A lot of planning went into this shoot. This horse had never seen the ocean, but took to it was time for them to concentrate that turned out, now that I look in about 10 minutes! Another moment where light on their real objectives, so they cut at them, to be the Sparagowskis, and subject came together to create something I had back to only two or three weddings the Scott Trees’, the Van Lents. been dreaming of for quite a while. a year, usually for friends. And also, Robert Vavra. He is an amazing photographer—I loved Through that time—ever since she became a his fine art stuff. He had the horses in these big scenes of photographer—April had been attending workshops, flowers and running out of the ocean ...” not only to fine-tune her knowledge of the equipment she used, but also to learn the techniques she needed The awakening was more than just knowing that she had for the kind of images she envisioned. Weddings, she found her mission. “I started to realize that these horses discovered, were especially good training grounds for are emotional to me,” she says. “What I really wanted her equine work: They honed her ability to think outside was this sort of fine art vision, like when they were on the box (“the sky is the limit in weddings”), and the the beach. I set a goal for myself to be on the cover of an ethereal look often appropriate for the event applied Arabian horse magazine, and in order to be on the cover, easily to Arabian horses. I knew it had to be a fine art, evocative image.” 148 | AR ABIAN HORSE TIMES


APRIL VISEL

A favorite of ours. Sometimes the timing and light all come together, which takes a lot of planning and coaxing in the wedding business!

APR IL 2010 | 149


APRIL VISEL

*Ecaho in Santa Ynez, 2009. This is my MOST favorite photo. It will be seen in the Arabian Horse Museum in Kentucky this year.

150 | AR ABIAN HORSE TIMES


APRIL VISEL

She set out to make her name as a fine art Arabian horse photographer. Her first published fine art image came when her friend Jenn Trickey arranged a photo shoot of the stallion Enzo and his son Eden, who was a foal at the time, for Greg Gallún. Gallún warned her that there were no guarantees, as it was hard to predict how the two would act together. “I just wanted it to work so badly,” April recalls, “and those horses were like angels. They stood right next to each other and looked at each other—they gave me the most beautiful image.” Her first Arabian horse magazine cover came with a foal photograph for Bob and Dixie North; her second was a fine art image of Eden, and with that, her business took off. “Now I am always shooting for a cover,” April says. “To me, that means coffee-table quality, fine art kind of look, even if it’s just a baby or a gelding or whatever. I try really hard to get that kind of look.” She credits others as well as Jenn Trickey with being instrumental in her career. Some, she says, helped her to handle the inner reality of being a photographer, such as her initial insecurity after a photo shoot if the client didn’t call back right away. One professional in the business counseled her, “Just do the shoot, do what you want to do. If you don’t hear back, it’s not always about you. It may be something else.” And then there were the calls of praise and appreciation. “That took a while for me to accept,” she reports. “I liked my stuff, but sometimes, you know, I worried if I was delusional.” After a while, the magnitude of her success sank in, but she maintained a wariness about it. “The second you think you’re anything uber-special, it kind of goes down the drain, because the horse doesn’t think any different of you,” she says wryly. “They’re there to act like horses, and they don’t really care if you’re awesome or not, bottom line.” Her overall style on a photography shoot reflects her own approach to horses. “What I find is that you have to get into their heads, you have to maintain a purity, or they don’t do well,” she says. “That’s why on some shoots, if there is too much upset for the horse, they don’t want to give it to you. I’ve had the blessing of working with trainers whose horses are truly happy from the inside out, and they’re happy at that moment. They don’t mind the photo shoot; they like that you’re looking at them, they don’t mind that you’re jumping around and shaking bags—they love it. But sometimes yelling and trying to make things happen only upsets the horses, and they couldn’t really care less. So I tend to stay quiet and mellow. I usually stalk shots and try to be in the right place at the right time.”

APR IL 2010 | 151


APRIL VISEL

This is Nick and Relampago during the 2007 workshop. We lovingly refer to him as the “man-meat!” The women in the workshop rarely allow him to wear shirts!

An Andalusian and his trainer in their full attire. Taken in Ojai, Calif., during one of my workshops.

152 | AR ABIAN HORSE TIMES


APRIL VISEL

“Brio” photographed in Santa Ynez, Calif. He’s an Azteca, which is an Andalusian/Quarter mix. He’s trained to rear on command which is always good fun and has never missed one of my workshops.

about you and your vibe, they don’t want to look at you. “I feel super-connected to horses,” she explains. “I really understand them, and before I can photograph a horse, it is most important for me to say that I’m a good horsewoman. To me, to be a good horsewoman, you have to be focused and you have to be connected and you need to pay attention. Nothing keeps you more true to yourself than a horse.” Her vision of her equine subject, she finds, is usually through a very long lens, so the view is exclusive of everything around it; often, it is a capsule insight into how the horse is feeling, what its world is like. “It is almost like you are seeing things that other people can’t see, especially in the eyes,” she says, struggling to describe the phenomenon. She gives up. “The only way to say it is that I am so passionate about them—I really, really care about them.”

Her description of how she has captured some very distinctive looking-the-camera-in-the-eye shots is illustrative. “I put myself in their way—they have to eyeball me for a second,” she says. “But also, they don’t mind me being there. I try to stay unobtrusive and be around. Usually they catch my eye and know that I’m there, but they don’t mind. A lot of times you can get a shot by being kind of a part of the whole scene, rather than being the antagonist. Plus, you want the horse to look in your direction, and if they hate you, everything

What does she do when a shoot just isn’t working? “If you’re not having a good day, you just try to catch yourself and reorient yourself,” she says. “Sometimes it’s the poor horse not having a good day, and there are so many factors there. Could be they didn’t like their clip job that morning, or it’s too hot or too late in the day, or whatever. Then I’m just patient. For everything that the owners and trainers want—besides the obvious curves and sexiness of the horse, and I know how to amplify those—the horse has to be engaged. If they are

APR IL 2010 | 153


APRIL VISEL

not engaged, I have no problem taking time. I try to tell people what I’m doing, but I don’t yell and scream a lot, so as long as they know I’m shooting, I just wait. It never fails that when you say ‘it’s a wrap’ and everyone turns around to walk away, the horse instantly becomes engaged.” There is one overriding principle. “I try to make the whole experience positive,” she says. “My job, for my own soul, is that when I am on a photo shoot, that experience is good for that horse.” Even though Arabians now crowd her schedule, April Visel also works in other specialties. In addition to her minimal wedding work, she also shoots portraits of babies, and more widely, baroque horses. “You can’t get any more different than a baroque horse and an Arabian,” she grins. “They are two opposite curves, but they share that same kind of nobility—and hair, which I love. On the baroque horses, that compensates for the curves that are usually on Arabians.” Another pursuit is the photographic workshops she puts on with Santa Barbara photographer Sherron Shepherd, where the emphasis is on her beloved fine art photography. April arranges for the horses, models and locations (“mountains, beaches, sand dunes, you name it,” including several Arabian horse farms in the Santa Ynez Valley), while Shepherd heads up the post processing work on images. The workshops, which began three years ago and usually have a waiting list, are limited to 20 photographers who come from all over the world. They are time-consuming and demanding in their preparation, April admits, but the camaraderie of the fellow fine art photographers—and their giddiness when they realize they have recorded just the right images—is clearly like oxygen to her. She loves the other workshops she attends as well, pursuing subjects that aren’t on her regular agenda, such as horses running free in the canyons of New Mexico, or cowboys or human models in artisticallydesigned poses. For April, so attuned to horses, appreciation of the human form has come more easily in the artistic work. “I love people and hanging out with them,” April says, “but in the end, I’d rather be in the field with a bunch of horses, by myself.”

154 | AR ABIAN HORSE TIMES

At the beginning of her career, examining the practice pictures she shot at horse shows, she often found that she had cut the heads off of riders. “I realized that I just didn’t want the person in the photo—I just wanted the horse,” she recalls, and smiles. “I learned later to embrace the whole thing, all the riding disciplines and so forth.” Her history in Arabians, she is the first to admit, does not include a years-deep knowledge of pedigrees. “I see


APRIL VISEL

Some of the fabulous Hennessey mares … another one of my MOST favorite places to shoot!

the individual horse first, and I don’t really care about the pedigree—it’s the quality of the horse,” she says. “But I love learning about the old ones.” Coming into the industry “fresh,” with no prior allegiance to bloodlines, breeding programs or people, she feels has been an asset. She is building her own history in the breed, though, and continues to follow the horses who have been landmarks in her career. “There is Eden (my first cover, which I felt

like was a fine art photo) and Bey Ambition (basically, I’ve had the privilege of being part of his campaign all the way through). I got to follow them as they became champions, and you know, you get emotionally invested. People in the breed get excited about that stuff, because as horse people, we’re crazy. We live it and breathe it everyday.” These days, life has changed for both April and Brandon. They still live on the same property in Ojai, with

APR IL 2010 | 155


APRIL VISEL

This is “junk” on the beach of Koh Pi Pi Island in Thailand 2005. This exact view is where the big tsunami came through one year later and destroyed the island. I always imagine how scary that must have been, as it happened here on the same kind of calm, sunny day.

156 | AR ABIAN HORSE TIMES


APRIL VISEL

Piazza della Repubblica in Florence Italy. Probably my favorite city in the wide world … so far!

horses in the pasture and a giant grand piano in the living room. As April’s career has grown, so too has Brandon’s; among his clients are stallion owners, in search of soundtracks for their videos, and the Arabian Horse Galleries, looking for the perfect accompaniment to its presentation of the Arabian horse breed. When time allows, Brandon occasionally accompanies his wife on photo shoots, pursuing the same artistic wide shots that he contributed to their wedding photography. “I don’t usually have time to do that,” April says, “because I’m there to get the marketing images.” If there is anything lacking in the couple’s lives, it is that there has been little photography of them together, a common problem for those who typically spend their time behind the camera. “I’m having an epiphany about that,” April says. “So now I’m writing a lot and having pictures taken of us, running across fields and that kind of stuff. I’ve ‘journaled’ nearly my whole life, but photos say so much more. When you read what you’ve written, it’s great because you are inside your own head, but when you see photos, you remember a whole bunch of things about that time. As soon as I see a picture, I remember all the feelings I had then. I feel like there is a chunk of time missing in my life, because I don’t have enough photos.”

APR IL 2010 | 157


APRIL VISEL

The upward trajectory of her life over the past few years has amazed April Visel, and she has a deep appreciation for her opportunities. “The day after I took pictures of my own horses and put it together that this was what I wanted to do, I went to Sheila Varian’s place for her Spring Fling. She let me go out after the party was over

158 | AR ABIAN HORSE TIMES

and be with her big herds of mares—Arabian horses. I thought, ‘Man, I’m standing here with my camera and I’m surrounded by these beautiful horses—this is what I want to do.’” And the phrase went through her head: “You never work a day in your life if you love what you are doing.’” ■


APRIL VISEL

APR IL 2010 | 159


Safe for your horses Stronger than wood and PVC Lowest cost over time Maintenance free Safe for the environment Made in the USA 2

To discuss the benefits of WindRiver Fence for your horses, please call the fence guys, Bill or Dave McClintic

800-269-4672 160 | AR ABIAN HORSE TIMES

Sales@aeo1.com

Aeolian Enterprises, Inc


2010 Ohio Buckeye Sweepstakes May 27-30, 2010 by Linda White The Ohio Buckeye Sweepstakes has been held at the Ohio Expo Center since 1963, and Arabian people for the last 47 years have set aside their Memorial Day Weekends to attend this prestigious show. Thousands of amazing, truly excellent Arabians, Half-Arabians, and National Show Horses have gone from this show into winner’s circles at every national show. This is the horse show where national champions are made. This year, 12 new “big money” classes have brought the Buckeye’s total prize money to $130,000. One of last year’s new offerings was the Buckeye Extravaganza Program for junior horses, who could and did win more than $60,000. The Extravaganza has a unique entry system, in which “slots” are sold, allowing a finite number of junior horses to participate in the competitive “slot” classes. This will be the third year for the Amateur Owner Challenge Classes, an increasingly popular program that awards $5,000 per class for purebred Arabians and Half-Arabians.

The Ohio Buckeye also hosts the National Show Horse District 1 Championships. A total of $10,400 in prize monies will be awarded among the 13 NSH classes scheduled. Each class will pay out $800. The Arabian English Performance Association’s Buckeye In-Hand Yearling Futurity is also taking Ohio Buckeye Show Manager place at the Buckeye with Cindy Clinton winnings of up to $30,000! Last year’s champion and winner of $10,000 was Maroon Fire Arabians’ Noble Halo (IXL Noble Express x Hidee Afire) with James Shea. The 2010 Ohio Buckeye is dedicated to the late Joyce Heiman. A kind, gracious person with always a positive word for anyone or anything related to this horse show, Joyce was well known for her support of Camp Jabez. “Joyce was also her husband’s, Paul Heiman, greatest supporter,” says longtime Ohio Buckeye Show Manager Cindy Clinton. “Her death has been a tremendous loss for everyone who knew her. She touched many lives.” Reining is gaining popularity everyplace, and purebred and Half-Arabian reining classes are being held this year under the sponsorships of reiner trainers Lee Mancini and Gary Ferguson. Ohio Buckeye judges for 2010 will be Scott Brumfield, Scott Benjamin, Chris Culbreth and Bill Melendez, all of whom also will be 2010 national show judges. ■

161 | AR ABIAN HORSE TIMES


Leaders Of The Times: April Calendar Feature

Bey Ambition and Rae-Dawn Arabians by Colleen Scott

Believing in love at first sight is one thing. Acting upon it is certainly another. When Murray and Shirley Popplewell of Rae-Dawn Arabians and trainer Claudinei Machado spotted Bey Ambition (Regal Actor JP x Bey Shahs Lady) at the 2008 Arabian Breeders World Cup Show, it was a classic case of love at first sight. As Murray recalls, it took him just 10 minutes to make owner Lucy Whittier an offer on the 2-year-old colt. His intuition was on the mark as a scant few minutes later, in his very first show outing, Bey Ambition went on to win the Junior Champion Stallion Two-Year-Old class. 162 | AR ABIAN HORSE TIMES

Murray relates, “By the end of the class, there were two others standing in line to buy this colt. We were fortunate Lucy Whittier recognized we had been first and followed through on our interest in Bey Ambition.” So, were the Popplewells stallion shopping when they arrived at the 2008 Arabian Breeders World Cup? Not at all. In fact, not only were they not shopping at the show, they weren’t shopping for a stallion, period. But something about Bey Ambition changed their minds, and quickly. “When we saw him, he just had so many great things going for him,” says Murray. “His pedigree


BEY AMBITION provides a great cross to the mares we have, and he has a really nice, clean throatlatch, long neck and good length of leg.” Murray’s assessment of the young colts’ correctness was not only validated when he won the Two-Year-Old class a few minutes later, but also when he was later named to the Top Five in the Junior Champion Supreme Stallion competition. Following the show, Bey Ambition traveled to California to star in his own videotape. He then traveled to his new home in Saskatoon, Sask., Canada. In order to qualify for the 2008 Canadian Nationals, he made his first appearance in his new country at the Saskatchewan Extravaganza. He won the Region 17 Arabian Two-YearOld Colts title and the Reserve Championship title at the Canadian Nationals. In 2009, Bey Ambition continued taking the Popplewells on a new journey, claiming the Reserve Championship title again in Canada, this time for Three-Year-Olds. However, it was his appearance in Tulsa at the U.S. Nationals that was the icing on the cake. On Thursday afternoon, October 29, with the talented Claudinei Machado at the lead, Bey Ambition bested a field of 19 colts to claim the Arabian Futurity Colt Championship. While that victory is certainly one the entire Rae-Dawn team cherishes, it isn’t what drives the couple in their Arabian horse pursuit. When asked about how important it is to win at higher levels of competition, Shirley replies candidly, “When we’re foaling the mares out in the spring, whether a foal turns out to be a champion in the show ring or a champion in someone’s heart (a good companion), I’ll never be disappointed.” As breeders, the Popplewells strive to balance the concept of creating premier Arabian show contenders and making sure their foals are suited for any life they might eventually lead. Shirley personally handles the horses, instilling confidence in them and the desire to be around humans from the beginning. The result of her efforts is a group of horses standing at the fence when they see her coming. “That’s something we try to work into them,” she says, “that when they see us coming, it’s a good thing. We don’t want to be something they run from because it means restraint or something bad. We would like them to want to come to us with a feeling that they want to be near us.” Shirley’s strategy in handling the youngsters is coming into play with Bey Ambition’s first foal crop. The couple bred 12 of their own mares and three client mares to the

Bey Ambition (Regal Actor JP x Bey Shahs Lady)

stallion last year. Although just two have been born at this writing, Murray is excited about what he has seen. “We are really, really pleased with the colt and filly already on the ground, and we are anxiously awaiting the rest,” he says. With Bey Ambition as the sire matched with a group of stellar mares (some by embryo transfer such as HL Infactuation and NW Siena Psyche), the 2010 foaling season promises to be the beginning of yet another new chapter in the Rae-Dawn story. Bey Ambition’s book was limited to 20 outside breedings for 2010, and the Popplewells will again breed their own mares to him. The stallion that has become synonymous with Rae-Dawn is also part of six different futurities; so, the 2011 foal crop will number near the 40 range. As for the stallion’s return to the show ring, Murray says Bey Ambition will be taking this year off and will likely be back as a 5-year-old. In the meantime, the handsome bay stallion is busy meeting his breeding obligations and enjoying leisure time in the warm afternoon sunshine at his Canadian home. Murray says although Bey Ambition comes alive in the show ring, he is quite a gentleman and endears himself to everyone associated with Rae-Dawn. While the next chapter unfolds, the Popplewells are quietly continuing to work together—doing their homework, making breeding decisions, managing the day-to-day operations of two farms, and enjoying the new foals. The two have built their success by creating a partnership, one that now includes the incomparable Bey Ambition. ■ APR IL 2010 | 163


ARABIAN BREEDERS SWEEPSTAKES


T

H

E

ARABIAN HORSE IN HISTORY

P

A

R

T

I

I

by Andrew K. Steen

Pasha Mohammed Ali Of Cavalla Between 1808 and 1811, Mahmud II adamantly asserted that Mohammed Ali (who had been named Viceroy on May 17, 1805) should do his bidding and send Egypt’s army into the Hejaz. Little did the Sultan realize that by persuading Mohammed Ali to invade Arabia on Turkey’s behalf, that it would provide him with the wherewithal to later gain Egypt’s independence. Among the many dire repercussions of the Wahhabis’ seizure of the Hejaz and its ports was that it had

166 | AR ABIAN HORSE TIMES

stopped all naval commerce on the Red Sea. No cargo ships had arrived from Yemen to Suez with coffee, and this forced Mohammed Ali to import Egypt’s supply from America. The Pasha from Cavalla was not a man to jeopardize his reputation and hard-earned power, unless it would enhance his personal aims and ambitions. His dream and obsession was to cast off the yoke of Ottoman sovereignty and create his own dynasty. However, he knew that he could not obtain independence without a much stronger army and far richer treasury. Therefore,


THE ARABIAN HORSE

IN HISTORY before embarking on such a dangerous enterprise, the devious Pasha proceeded with caution. His first priority was to fill the nation’s coffers. To accomplish that task, he called an assembly of Cairo’s sheiks and notables and coerced them into coughing-up 24,000 purses. From his Coptic subjects he extorted a further 6,000 purses in taxes and levees. However, that was just the beginning. Once disembarked in Arabia, he bullied the traders and commercial houses of Jeddah into making forced loans for an additional 30,000 talaris. Since Egypt had no navy and no industries capable of fabricating arms, he bought 75 over-sized iron caldrons from Stamboul then established foundries at Alexandria and Cairo for the manufacture of cannons and light arms. The timber needed to build his transport ships and combat fleet came from Anatolia. Specialized ship-builders were conscripted from Alexandria and Europe to make 18 ships, each of which could transport between 100 and 150 tons. To navigate them, he recruited experienced crews from the Nile and ports on the Mediterranean. In preparation for the war, he built fortifications at Suez and stockpiled huge quantities of wheat and other provisions, including great herds of livestock. He also assembled 10,000 transport camels. Yet, one matter remained unsettled; the Mamelukes were conspiring to overthrow him at their first opportunity. Consequently, on March 1, 1811, under the pretext of a feast organized to celebrate the

commission of his favorite son Tousson as commander of the expeditionary army, Mohammed Ali invited the Mamelukes into the citadel of Cairo. As soon as the 24 Beys, 40 Kushaf (local agents) and 400 of their bodyguard passed through the portals of the Bab el Djedid and into its narrow passageway, the Viceroy’s Albanian soldiers mowed them all down, save one, Elfy Bey, who escaped by hurling his horse off the ramparts into the street some 40 feet below.

Ahmed Tousson Pasha In October, 1811, 18-year-old Ahmed Tousson Pasha led an army of 8,000 infantry (6,000 of whom were Albanian mercenaries) and 2,000 cavalry into Arabia. As a precautionary measure, Mohammed Ali also sent Ahmud and Mustafa Bey, both famous for their courage, to act as adjutant commanders. The campaign did not begin well. Having taken the port of Yembo in two days time and the city of Zuba by January of 1812, Tousson’s troops marched towards the “sacred limits” of Medina, where a bloody fiasco awaited them. The road to that city passed through six leagues of ravines known as the “Jaws of Safra” which were sometimes so narrow that only one camel at a time could traverse them. Near the village of Jedeida, the Egyptian army entered the chasm blindly and soon was ensnared in an ambush by warriors of the Harb tribe, which were led by Saoud’s sons, Abdullah and Faisal. The massacre obliged the young Pasha, who lost 3,000 of his men, to retreat to Yembo. However, the Wahhabis failed to take

APR IL 2010 | 167


advantage of the bloodbath. Instead of pursuing Tousson, they reinforced their rocky stronghold. Although shaken by his son’s thrashing, Mohammed Ali sent reinforcements. His only consolation was that the majority of the men that had been lost in the onslaught were Albanians. Inadvertently, Saoud Ibn Saoud had rid the Viceroy of the troublesome mercenaries, who much like the Mamelukes, also posed a threat to his rule.

168 | AR ABIAN HORSE TIMES

Undoubtedly disquieted, Mohammed Ali decided to go to Arabia to personally assess the situation. On August 28, 1813, he embarked with a personal bodyguard of 70 men and some 2,000 infantry, while a new force of 1,000 cavalry and a supply train of 8,000 camels marched overland through the Sinai Desert, via Aqaba, into the Hejaz. Before departing, he had turned the administration of Upper Egypt over to his son Ibrahim Pasha and Lower Egypt to his brother-in-law Hussein Bey.


THE ARABIAN HORSE

IN HISTORY The Capture Of Mecca Upon arriving by sea at Yembo, Mohammed Ali captured the port. He rode into Mecca on October 6. There he arrested the Sherif Ghalib, whom he suspected of collaborating with the Wahhabis, and sent him and his three sons to prison in Cairo. Later, Ghalib was deported to Salónica where he died. Extreme jubilation spread throughout the Moslem world with the capture of Mecca. Mohammed Ali wasted no time in sending his third son Ismail and Latif Bey to Constantinople to break the news to the Sultan. They were received with accolades and rewards worthy of the occasion. The Sultan presented them with sabers and daggers that were encrusted with diamonds, emeralds and other precious gemstones. In The Ottomans, historian Andrew Wheatcroft related: “Once again the sultan’s name was honored in the Friday prayers at the heart of Islam. There was great celebrations throughout Stamboul when the massive bronze ceremonial keys were received and

carried in procession to the Treasury, where they were placed beside the sacred symbols of the Prophet.” Mahmut II also sent congratulations and costly cashmere robes to his Egyptian Viceroy and conferred upon him the title Ghazi (The Victorious). Until that time Mohammed Ali had been considered only an upstart, a rebel who was an impediment to the Ottoman government. Although his prestige and position were greatly enhanced, Mohammed Ali’s goals did not abate; his lust and determination for total independence from Turkey only grew more intense.

Gahalye, The Woman Warrior Mohammed Ali subsequently secured Taif and established his headquarters at a ruined castle in the nearby mountains. In November, 1813, Tousson marched to take Medina for a second time. Reinforced with fresh conscripts, he circumvented the mountains only to encounter another overwhelming obstacle. The advance of the Egyptian army was detained by a Wahhabi force led by a woman named Gahalye of the Baqoum tribe.

APR IL 2010 | 169


About the singular, old Amazon warrior, it was recorded by renowned Swiss traveler Johnann Ludwig Burckhardt: “She herself possessed more wealth than any Arab family in the neighborhood. She distributed money and provisions among the poor of her tribe, who were ready to fight the Turks. Her table was open to all faithful Wahabys, whose chiefs held their councils in her house; and as the old woman was celebrated for sound judgment, and an accurate knowledge of the interests of the surrounding tribes, her voice was not only heard in council, but generally prevailed; and she actually governed the Beqoums although they had a nominal chief, or sheikh, called Ibn Khorsha. From the first defeat of Mustafa Bey, near Taraba, the name of Gahalye had spread over the whole country. The Turkish soldiers’ fears soon magnified her influence and importance: they regarded her as chief of the united Wahabys, and (…)[as] a sorcerers, bestowing her personal favors on all Wahaby leaders, who, by her means, were rendered invincible.” (…) “These reports served to discourage the Osmanlys [Turks] and inspired the Bedouins with additional confidence; thus contributing very materially to cause the failure of Tousson Pasha’s expedition.” In a series of hard-fought skirmishes, Gahalye vanquished Tousson and obliged him to fall back on Taif.

Abdullah Ibn Saoud Saoud Ibn Saoud suddenly died around that time. His first-born son, Abdullah, was recognized without opposition as the new Emir of the movement. However, he had not inherited his father’s gift for governing or his aptitude for defending the political interests of the desert tribes. In his new adversary, Mohammed Ali found an indecisive man who was too weak to carry the torch of leadership. Some of the Bedouins that had resisted Saoud Ibn Saoud throughout his tenure willingly sided with the Egyptians. Burckhardt who was in Mecca in 1814, mentioned in his Travels in Arabia that the Beni Kahtan had steadfastly rebuffed their demanding doctrine: “The Wahabys found great difficulty in subduing this tribe, which however, subsequently became attached to the

170 | AR ABIAN HORSE TIMES

[Egyptian] conquerors, and still continue so.” About their livestock he observed: “The Beni Kahtan possess excellent pasturages, and breed many fine horses: the vast numbers of their camels have become proverbial in Arabia.” Many other tribal chiefs were won over by lavished bribes of gold. In order to consolidate their allegiance, Mohammed Ali also made sure that the people in the towns were satisfied and no one went hungry. Simultaneously, he decreed a reduction of taxes and other tariffs. In November of 1814, the first great procession of the Hajj, which had been impossible under Saoud Ibn Saoud, re-commenced and pilgrims came in droves. By some accounts 80,000 arrived to fulfill their religious obligations. Among them was Amina Hanem, the wife of Mohammed Ali, whose huge entourage traveled in magnificent style. At the beginning of 1815, the thrust into the Najd was renewed, only this time Mohammed Ali led the army himself. By January 17th, it had reached Kolath and three days later arrived at Bissel, where it encountered an important concentration of enemy troops. Almost 30,000 men were firmly entrenched and dominated the surrounding hills. In theory, their numerical superiority should have guaranteed a Wahhabi victory. However, Abdullah’s men had no artillery. Moreover, they committed a fatal strategic blunder by abandoning the high ground. The Wahhabis fell into the Viceroy’s trap, which he had artfully devised. Having made a cavalry charge, they pretended to retreat. Abdullah’s men launched a counter-attack, abandoning their secure position to pursue the Egyptians. Their fate was sealed when Mohammed Ali’s cavalry stopped in its tracks, wheeled around, and charged headlong into the midst of the oncoming Wahhabis. The carnage that resulted was devastating. Fighting on their own terms, the Egyptians massacred all but a few hundred that managed to escape. Following the victory, the prestige of Mohammed Ali’s army’s soared, not only in Arabia, but also throughout the entire Mediterranean. The towns of Taraba and Bishr [Beishe], north of


THE ARABIAN HORSE

IN HISTORY the mountains of Yemen and the tribes that occupied those districts, surrendered or changed allegiance. On March 21st, the victors marched into Mecca where Abdullah was obliged to sign a treaty that prohibited any further activity in the Hejaz. The terms of his capitulation included: 1. His acknowledgement that he was subject to the will of the Sultan. 2. His agreement to supply hostages to assure his future good conduct and to personally present himself upon request before the Porte in Constantinople. 3. That he would render his capital Diriyyah over to a governor appointed by the Sultan. 4. He would restore the jewels plundered by his father from the tomb of the Prophet at Medina. Tousson then advanced into the Najd through the Kasim and captured Rus [Rass], which at the time was the district’s capital. Negotiations were begun with Abdullah, who had retreated to Aneyzeh, and to the astonishment of everyone (for he still had a powerful army) the Emir acquiesced. It is likely that he yielded because he felt that his situation was vulnerable. The Bedouins that resided there had never accepted Wahhabi rule, and many of them were openly siding with the enemy. Moreover, Abdullah’s recent defeats had seriously damaged his army’s reputation. Therefore, he agreed to the stringent terms imposed upon him at Aneyzeh. Peace was restored for a time. However, Abdullah later refused to come to Egypt in person (even though Tousson had hostages), which nullified the truce. Although Abdullah had received a crushing blow, the Wahhabi movement had not been quashed. Much like the mythical Phoenix, time after time, it rose from the ashes. Tousson’s ventures in the Hejaz had cost 8,000 men. Thousands of beasts of burden had perished, and Egypt’s coffers were depleted to the tune of 70,000 purses. To top it off, the Wahhabis still controlled

Muhammad Ali

most of the peninsula. Reluctantly aware that Tousson was not up to the task at hand, Mohammed Ali sent him home. After making a triumphal return to Cairo on November 7, 1815, Tousson rushed to his palace to embrace his son Abbas (later Abbas Pasha, the celebrated Arabian horse breeder), who had been born at Jeddah in 1813 during his absence. Unluckily, 13 months later, Tousson died at his Damanhur headquarters near Rosetta. He was 23. After terminating the first phase of the campaign, Mohammed Ali also returned in triumph to Cairo and turned the command of the Egyptian army over to his first-born son Ibrahim Pasha. ■

Don’t miss the exciting conclusion in next month’s issue!

APR IL 2010 | 171


GETTING INTO SHAPE

Getting Into Shape For Show Season by Hillary Hoffman As spring approaches, so do those dreaded annual questions: Do my chaps zip up? Does my saddle suit still button? Let’s not mention putting on my hunt breeches. While some judge their bodies by swimsuit season, equestrians have a different standard to judge by—our show clothes. Our show clothes may not fit the same as they did at the end of last year. However, along with the fit of our show clothes, our horse may not be the same fit either. Our horses often begin preparation for the first show of the year long before we do. Many amateurs spend hundreds (or thousands) of dollars each month to have a horse in training, entrusting the fitness of their prized possession to a professional. For some, because of distance, school or work schedules, this may mean that riding on a regular basis becomes more difficult to do. It is possible, however, to get into riding shape without riding, although you need to be a bit more creative to do it. While I have the benefit of keeping my horse only 40 minutes from my home, I decided to embark this year in more training outside of the arena. The difference it has

172 | AR ABIAN HORSE TIMES

made in my riding has been astonishing. This article is intended to give you a few ideas for getting into shape for show season, as well as point out how important a healthy body is to a successful rider.

Fitness Before First Place You and your horse are both athletes performing in a sport that requires strength, stability, and endurance. Think of these elements as the trinity of being a successful rider. Without one of the corners, you will be out of balance—literally. Just consider: Finessing a 1,000 pound animal through a correction without developing your muscle is rather difficult to do. Staying in a two-point position for three laps of hand-galloping around the arena requires both strength and balance. Many would say that running a marathon without cardio training is nearly impossible. How is lasting through an English pleasure class much different? Our horses are not allowed to sit around in their stalls, munching on hay, to get ready for show season, so doesn’t it make sense that we get out there and move too?


GETTING INTO SHAPE

• Triceps Extensions. Strong triceps greatly help with the arm endurance needed to ride in all equestrian divisions. This exercise is helpful for those riding in the English style (pulling back against the bridle uses your triceps) or those riding western (holding your arm up for an extended period of time). You perform a lying triceps press while lying flat on the ground. You may hold a dumbbell in each hand, or use both hands to hold one barbell of the appropriate weight. 1.

2.

Tricep Extensions

3.

Lie back on the ground and extend your arms so that the barbell is positioned over your eyes. Positioning the bar over your eyes keeps your triceps under some tension while your arms are in the extended position. Keep your upper arms fixed in the extended position while you bend your elbows and allow the weight to descend under control toward your forehead. Repeat for desired repetitions and sets.

Strength While some may feel that the only way to develop the muscles required to ride is by actually riding, this is not the case. There are easy workouts you can do at the gym, home, barn or hotel room that can help give a solid muscular foundation. Amateur rider Elizabeth Jenkner of Setting Sun Stables in Wakarusa, Ind., recently began riding western again after several years showing hunter pleasure. “The first place I could feel it was in my legs,” she says. “I thought with riding hunt, my legs would have been in better shape; however, riding western required a great deal of strength to maintain my squeeze to keep my horse going forward.” Following are several examples of exercises to help with each of the main muscular areas used to ride in various disciplines.

Arms And Hands The muscles of your arms and hands are needed for maintaining control—making corrections to a headset, slowing down, steering. The primary arm muscle used is your triceps, followed by your bicep and forearm.

Ball Squeeze

• Ball Squeeze. This exercise is good for riders in all equestrian divisions, strengthening the forearm and hand, supporting better rein grip and control. 1. 2. 3.

Hold a rubber ball, tennis ball, foam ball, etc., in the palm of your hand. Squeeze. Repeat for desired repetitions and sets.

APR IL 2010 | 173


GETTING INTO SHAPE

1. 2. 3.

4. 5.

Hold an appropriate-weight dumbbell in each hand. Bend your elbows and raise dumbbells to shoulder height. Rotate your wrist so that your palms are facing forward, and push the dumbbells over your head until your arms are fully extended. Pause and slowly lower the dumbbells back to shoulder height position. Repeat for the desired repetitions and sets.

• Superman. This exercise is especially helpful to riders who show in the English and hunter divisions and need control of their lower back muscles while moving in and out of the saddle at a posting gait or two-point seat. 1.

2.

3. 4.

Lie straight and face down on the floor or mat. Your arms should be fully extended in front of you or straight out to the side. Simultaneously raise your arms, legs, and chest off the floor and hold this contraction for two seconds. Squeeze your lower back to get the best results from this exercise, and remember to exhale during this movement. When holding the contracted position, you should look like superman when he is flying. Slowly begin to lower your arms, legs, and chest back to the floor. Repeat for the desired amount of repetitions and duration.

Shoulder Press

Shoulder And Back These muscles are used in riding primarily for balance and posture, ensuring that you are in the ideal position to deliver commands. Developing your shoulder and back muscles is important to success in any division.

• Shoulder Press. Strong shoulders give greater stamina to all riders who are required to hold their arms up in an elevated position for an extended period of time. You can perform this exercise standing or sitting; for those with lower back problems, sitting is recommended.

174 | AR ABIAN HORSE TIMES

Superman


GETTING INTO SHAPE

Calves And Thighs Your thighs and calves are used not only to deliver cues to your horse, but also to simply hang on! Ever hear your trainer tell you to “squeeze, not kick” on your western horse, or have you been told to “post from your knee, not just from your foot” on your English horse? Both require good leg strength.

• Lunges. Longing isn’t just for horses! Lunges are an easy exercise to do that requires no equipment. The motion required to do a set of lunges will strengthen your quadriceps, helping give you greater grip at your knee. This muscle is used heavily during the posting motion required by hunt and English riders. Strong thigh muscles can also give a rider in any division a more secure seat. This is a movement that requires a great deal of balance. For added difficulty, hold dumbbells in each hand. If you suffer back problems, you may want to avoid added weight. The exercise also may be combined with the Shoulder Press listed previously. 1. 2.

3. 4.

Stand with your torso upright and your hands at your side. Step forward with your right leg about two feet or so from the stationary foot, and lower your upper body while keeping your torso upright and maintaining your balance. Do not allow your knee to go forward beyond your toes as you come down, as this will put undue stress on the knee joint. Make sure that you keep your front shin perpendicular to the ground. Using mainly the heel of your foot, push up and go back to the starting position. Repeat for the desired amount of repetitions and sets.

• Ledge Heel Rises. Strong calf muscles are very

Lunges

important to all disciplines of riding. English and hunt riders need calf strength to maintain lower leg control when they post, while western riders rely primarily on their calf muscles for both steering and making corrections. 2. 1.

Stand with your torso upright, holding a dumbbell in each hand by your side. Place the ball of your foot on a ledge (or step, edge of work

3. 4.

out machine, board, etc.), so that your heel can still touch the floor. With toes pointing straight forward, raise your heels off the floor and hold your pose at the top of the rise. Slowly lower your heels back to the floor. Repeat for the desired amount of repetitions and sets.

APR IL 2010 | 175


GETTING INTO SHAPE

• Planks. 1. 2. 3. 4. 5. 6.

Lie face down on mat, resting on your forearms. Push off the floor, rising up onto your toes and resting on the elbows and forearms. Keep your back flat, in a straight line from head to heels. Tilt your pelvis and contract your abdominals to prevent your rear end from sticking up in the air. Hold for 20 to 60 seconds, and lower. Repeat for the desired amount of repetitions and sets.

• Russian Twist. For added difficulty, you can hold an object in your hands such as a weighted ball, a dumbbell or kettle ball. 1. 2.

3. Ledge Heel Rises

Abdominal Perhaps the most important of the muscle groups required for riding is your abdominals; they are your center for balance and control. These exercises should be the main focus for all riders in any division.

4. 5. 6.

Sit on the f loor with your knees bent. Lower your upper body so that you create a V-shape with your thighs. Your arms should be fully extended in front of you, perpendicular to your torso. Twist your torso to the right side so that your arms are parallel with the f loor, and hold for a second. Move back to center. Perform the same maneuver to the opposite side. Repeat for the desired amount of repetitions and sets.

• Full Sit Up with Arms Overhead. For added difficulty, you can hold an object over your head, such as a weighted ball, a dumbbell or a weighted bar. (If you have lower back problems, you might want to check with your doctor to make sure full sit ups are right for you.) 1. 2.

3. 4.

Lie straight on the ground or mat, facing up, with your arms extended over your head. With your upper body, sit fully upright, keeping your legs in constant contact with the ground and your arms extended straight over your head. Slowly lower your upper body back to the ground or mat. Repeat for the desired amount of repetitions and sets.

176 | AR ABIAN HORSE TIMES

Full Sit Up with Arms Overhead


GETTING INTO SHAPE

Balance A personal trainer I work with, Alex Hugi, Certified Strength and Conditioning Specialist ®, recommends core strength training to improve your balance. Balance is not just your equilibrium; it is also good stability of the core muscles and joints. All movements originate from the center of the body out, never from the limbs alone. Core strength gives a rider more control over every movement required with a horse at the top level. Core and abdominal conditioning have become synonymous to many people, but actually, the abdominal muscles alone are overrated when it comes to real core strength. The muscles of the core run the length of your trunk and torso. When they contract, they stabilize your spine, pelvis and shoulder girdle, and create a solid base of support, all of which are important to give you a sure seat in your saddle. Proper development of your core muscles also can help prevent dreaded back injuries. The major muscles of your core are:

Transverse Abdominis. This is the deepest of the abdominal muscles. It lies under the obliques (muscles of your waist). These are what is needed for trunk stability. A great target exercise for transverse abdominis is Planks.

External Obliques and Internal Obliques. Your external oblique muscles are on the side and front of the abdomen, around your waist. The internal obliques lie under the external obliques, running in the opposite direction. A great target exercise for these muscles is the Russian Twist, since they work the muscles on the sides and front of your abdomen.

Rectus Abdominis. The rectus abdominis is a long muscle that extends along the front of the abdomen. This is the “six-pack” part of the abs. Classic crunches are the best exercise for these muscles. For something more difficult, try the Full Sit Up. (See previous Strength section.)

Planks

Erector Spinae. The erector spinae is a collection of three muscles running from your neck to your lower back. The Superman exercise is great for strengthening your back muscles. Anatomy information found on http://www.fitstep.com. There are many activities you can participate in to strengthen your core muscles. Jeff Lovejoy, trainer and amateur instructor at Battaglia Farms, Scottsdale, Ariz., is a marathon runner and yoga fanatic and has found a great deal of benefit from both, particularly yoga. “I have always been a runner, and that alone, I know, has given me incredible endurance, riding a horse or not,” he says. “However, it was when I began practicing yoga that I found a whole new level of strength, particularly in my core. Core strength and balance are two of the most important physical parts of riding; they are how we maintain ourselves on a horse without collapsing. Additionally, f lexibility and knowledge of isolating particular body parts and functions from one another will play a vital role in good riding. It would particularly serve any equitation rider well to take up this, as it promotes self-awareness, which is of paramount importance in great equitation. Yoga sheds light and encourages focus on so many elements. It helps calm the nerves and increases the awareness of your breathing to boot, which any competitor can benefit from!” Another activity that I have found helpful for riding has been pilates. Pilates exercises can provide an overall awareness of your body and how you control it. With pilates, you learn how to move all of the parts of your body together in harmony. Every rider needs control over his or her body to be successful. They need to be aware of when they are leaning forward or arching their back. APR IL 2010 | 177


GETTING INTO SHAPE

required. With a little bit of work, you can greatly improve your balance and control, both of which are needed to be a champion rider.

Endurance When we are youth riders, this is the part that many of us take advantage of. Most youth riders are active in school activities, dance, sports, etc. As we move into the adult divisions, we spend more time sitting at a desk, in meetings, or driving a car. This was the portion of my fitness I felt was greatly lacking when my horse and I moved from showing in the western pleasure division to the hunt division. At my first regional show showing in hunter pleasure, I was amazed at how winded I was when I trotted into the line up. Your cardiovascular endurance may be the easiest piece of the triangle to maintain away from your horse; however, this tends to be the most overlooked. Have you ever thought about what the duration of your class is—how long you have to ride at the top of your game before you are called to line up? I worked with Seehorse Video to figure out how long several amateur classes lasted at the 2009 U.S. National Championships.

Russian Twist

It helps to be mindful that when you are squeezing with your legs, you aren’t also raising your hand, or when you give a bump with your right hand that your left hand doesn’t also move. How many times has your trainer told you to do something, and within one lap around the arena, you have unconsciously stopped doing it? I have found that with pilates it has become easier for me to feel the corrections that I make to my body, and I become more aware of when I make a change. If you want to learn more about yoga or pilates, many local gyms offer classes in each. One of my favorite classes is a yoga pilates fusion class. You can also pick up instructional DVDs to practice at home. Yoga and pilates are both non-weight-bearing exercises, so they are great for someone who may be recovering from an injury. One of the benefits of all the core strengthening exercises mentioned here is that no equipment is

178 | AR ABIAN HORSE TIMES

Purebred Hunter Pleasure AAOTR 18-35: 14 minutes, 46 seconds Half-Arabian Hunter Pleasure AAOTR 40 & Over: 15 minutes, 18 seconds Purebred Country English Pleasure AAOTR 55 & Over: 9 minutes, 55 seconds Half-Arabian Country English Pleasure AAOTR 36-54: 10 minutes, 15 seconds Purebred English Pleasure AAOTR 40 & Over: 8 minutes, 55 seconds Half-Arabian English Pleasure AAOTR 18-39: 10 minutes, 10 seconds Could you run on a treadmill for the duration of the class you show in? I’m sure many of you think 15 minutes’ running on the treadmill is easy, so perhaps you should try it. To better approximate the demands of riding, hold a 10-pound weight in each hand while you’re running. And let’s not forgot to factor in the loud music, screaming crowds, and all the other excitement that raises our heart rate at a horse show. It really isn’t so easy.


GETTING INTO SHAPE

Lester Martin, an amateur rider at Liberty Meadows Training Center in Raymore, Mo., who shows in the English pleasure divisions, told me, “I found in the past, trying to juggle the hectic life of both home and running a business, I have very little time to get to the barn and ride as much as I would like. I have learned if I do a good cardio workout on a regular basis, along with consistent core muscle development workouts, I am better able to help my horse to perform to her highest level.” “The problem when a rider becomes short of breath because of poor cardiovascular endurance is they begin to lose control over their muscular strength,” says Larry Hoffman, trainer and amateur instructor at Hesten Park, in Hastings, Minn. Hoffman has coached hundreds of riders to national awards. “When a rider begins to have trouble breathing, corrections may become less controlled. For example, using your leg on a western horse starts to mysteriously involve your hand, or the posting rhythm on your English horse or hunter becomes more erratic.” To increase your cardio endurance, you should exercise enough to raise your heart rate considerably, but not to its absolute maximum. Cardiovascular training can be done by running, climbing stairs, riding a bike, swimming, or any other activity that is done for an extended period of time. While your horse may be huffing and puffing by the end of the class, keeping control of your own breath will allow you to control your horse to the best of your ability.

Hillary Hoffman Hillary Hoffman is the daughter of trainers Larry and Jody Hoffman of Hesten Park in

And The Gates Are Opened ... Heading into my first horse show of the year, I am excited to see how my non-horse training will help me in the arena. I have definitely felt the difference at home. With the right combination of muscular strength, core, and cardiovascular training, a rider can easily prepare for the show ring off the back of a horse. I hope this article encourages others to think about training for the show ring outside of the barn. By preparing yourself physically for the show season off your horse’s back, you will be a more successful rider. Your horse will thank you too! ■

Hastings, Minn. She has won numerous national championships as an amateur in pleasure, working western and equitation, and in 2002, was honored as the USEF Junior Equestrian of the Year. Hoffman serves on the Board of Directors of the Minnesota Arabian Horse Association, and is an active volunteer at local horse shows and Arabian promotional events.

APR IL 2010 | 179


*

Napitok From Russia With Love by Linda White

When Howard Kale Jr. visited Russia’s Tersk Stud in the spring of 1976, he saw 3-year-old Napitok and was mightily impressed. As he watched the young Pirit son’s exuberant, athletic capers, a dream began to form in Kale’s mind. He bought the gifted colt on the spot.

Kale and other early Russian Arabian advocates foresaw the outcross excellence that the Tersk imports and their illustrious descendants would bring to the Arabian horse population worldwide. A look at many recent national champions’ extended pedigrees confirms that impact.

“He was going to be my park horse,” says Kale, a secondgeneration Arabian breeder, exhibitor and scholar. “He probably had the most terrific shoulder I ever saw on an Arabian horse. He was big enough that I could ride him, and he had such superlative structure. He was a wonderful horse!

One early Russian enthusiast was Dr. Dee Whittlesey, a Texas OB/GYN who, with her husband, Dr. Phil Whittlesey, had established Zodiac Farm in 1971. Two years later, Kale and other early Russian imports cast their powerful magic spell on Dr. Dee. Zodiac Farm was soon participating in a star-studded list of imported Russian stallion syndications, and hosting educational conferences and seminars their participants still recall as invaluable.

“Once in a great while, you see that shoulder on a Saddlebred or other high performance breed,” he explains, “but you almost never see it on an Arabian. People used to wonder how CHMy My and CHSky Watch (legendary world’s grand champion American Saddlebreds) could do what they did. Of course they could do that! They both had those exceptionally long, strong shoulders that allowed them to perform so spectacularly. *Napitok had that same shoulder. “When I bought him, I believed I was going to have the time to ride and show him. You know how that worked out: building Karho, campaigning *Muscat (1980 Scottsdale, U.S. and Canadian National Champion Stallion), and developing a Russian herd … time was the last thing I had. When Dr. Dee Whittlesey saw him, she fell in love with him and wanted him badly. The sensible side won out. Dee genuinely loved *Napitok, and she gave him the best home imaginable. “Another wonderful dream that never came to pass,” he sighs philosophically, “but I was very lucky while it all lasted. Few people ever get to chase their passions without economic restraint.” 180 | AR ABIAN HORSE TIMES

“He probably had the most terrific shoulder I ever saw on an Arabian horse. He was big enough that I could ride him, and he had such superlative structure. He was a wonderful horse!” Howard Kale Jr.

Among the Russian stallions syndicated during that era were Karho’s *Muscat and *Nariadni, *Plastun, Ptersk, *Norton, and *Namiet. *Napitok was syndicated in 1980,


*NAPITOK

*Napitok with Michael “Spike”Barter, up. APR IL 2010 | 181


*NAPITOK and from that time, he and *Namiet stood at Zodiac, where Dr. Dee managed their syndicates.

conformation, good movement, and willing dispositions. I believe that 13 *Napitok offspring won national titles.”

What so attracted her to the big-trotting chestnut colt? “I was blown away by his unique look!” she replies without hesitation. “His elegance, style, his long neck, and his wonderful athleticism: He was a beautiful animal! His syndicate included some very supportive people, and they used their multiple breedings to him on their best mares.

Those national awards included a total of eight U.S. and Canadian national championships, five U.S. and Canadian reserve national championships, and 30 U.S. and Canadian top tens in English and western pleasure, English and western ladies’ sidesaddle, informal combination, country English pleasure and country pleasure driving, hunter pleasure, halter, and show hack. The purebred Firetok had nine U.S. or Canadian national titles, and the HalfArabian Napitoks Daydream had five national awards in carriage driving at Sport Horse Nationals. These included the U.S. National Championship in carriage pleasure driving, reinsmanship.

“Michael ‘Spike’ Barter, our Zodiac Farm trainer, had the ability to bring out his talent and show horse ways, to allow the horse to realize his full potential. Spike went with us to Karho the first time we saw him. We watched him, looked at each other, and asked ourselves, ‘How in the world can we try to get him?’ Howie (Kale) syndicated him. He then allowed us to bring him to Zodiac and to manage his syndicate. The syndicate sold out very quickly because of the Zodiac team. “Carol Miskin, our breeding manager, was an A/I specialist, so we became one of the earliest Arabian farms to do artificial insemination. Carol was an absolute phenomenon! She managed to breed *Napitok to more than 100 mares a year, with a conception rate of well over 90 percent (the average conception rate for horses is around 60 percent.) We also did non-surgical embryo transfers. It was an exciting time, with new technologies and new things for us to try. “Spike loved *Napitok, and was able to harness all his energy,” she continues. “Nappy, as we called him, was very game. He had so much presence, that great shoulder, and the size—the whole package. Compared to *Napitok, the other horses seemed small.” *Napitok and his thrilling talent dwarfed many a show ring opponent too. He was named 1981 Canadian National Champion in park, and 1981 and 1982 U.S. Top Ten Park Horse, always with his trainer, the late Spike Barter, in the irons. What kind of temperament did he have? “*Napitok had a good disposition,” Whittlesey responds. “He would drink beer out of the can! He was very masculine, and like any stallion, he took careful handling, but he was also very honest and he always worked hard to please. “As a sire, he exceeded our every expectation,” she adds. “His foals all had his unique stamp: size, excellent 182 | AR ABIAN HORSE TIMES

“When *Napitok was at Zodiac Farm, that was the best time of my life,” Whittlesey offers. “I loved every day I was there, but I never took anything for granted. I treasured every foal, the trips to Russia, the precious friendships, and my young, talented team: Spike and his wife, Vicki Barter, Carol Miskin, Mollie Standish, and the other special people who came into my life because of *Napitok and the other Russian horses.” In horsemen’s parlance, *Napitok was a well-bred Russian “close up,” with a world of history further back. For example, his dam’s granddam, Mammona, actually walked the 1,000 miles from Janow Podlaski, the venerable Polish stud where she was born in 1939, to Russia’s Tersk Stud, as a suckling at her dam’s side. The Russian soldiers who had confiscated the Arabian horses at Janow Podlaski hastily spirited their priceless booty to Tersk—on foot. “Mammona’s significance in the world’s Arabian horse population could fill volumes,” says Kale. “From 1943 through 1960, she produced a foal every year, for a total of 18!” The first of those foals was Nomenklatura, who would be *Napitok’s maternal granddam. Nomenklatura’s sire was the influential Skowronek son, Naseem, born and raised at Crabbet Park Stud, in Sussex, England. Crabbet Park’s founders, Wilfrid Scawen and Lady Anne Blunt, first ventured into the Arabian desert in 1878. Wilfrid Blunt would later chronicle their many harrowing, sometimes thrilling desert adventures, as they selected the bloodstock that would launch the Arabian breeding program at their Crabbet Park estate. The Blunts’ daughter, Judith Anne Blunt-Lytton, Lady Wentworth, inherited Crabbet Park


*NAPITOK following her parents’ deaths, and continued their practice of selling horses to breeders all over the world. In 1936, she sold the Russians a group that included Naseem, a descendant of the Blunts’ original desert-breds. He was foaled in 1922.

Aswan brought wonderful Egyptian athletes to the pedigree, and Pirit added another cross to Priboj through his paternal great-granddam, the Priboj daughter Platforma. Tersk Stud used Aswan with great success, and his descendants continue to exert a powerful influence on the Arabian gene pool worldwide.

“*Napitok’s maternal granddam, Nomenklatura, had “Pirit’s was a far different story from Aswan’s,” says Kale, four full brothers by Naseem,” Kale continues. “Each one, resuming his narrative. “The sport horse world chose him in turn, was chosen to perpetuate the Naseem heritage to become their leading sire of sport horses, which are at Tersk, but none lived to fulfill that legacy. Their full essentially Arabian crossbreds. sister’s story was far different. So, Pirit left Tersk with very few Nomenklatura produced 12 “As a sire, he exceeded our purebred Arabian offspring.” foals, which included five good Pirit nonetheless contributed Priboj daughters, one of whom every expectation. His foals significantly to his son *Napitok’s was Neposeda.” A foal of 1955, all had his unique stamp: athleticism and gameness. Neposeda was bred to Priboj to size, excellent conformation, produce *Napitok in 1973. good movement, and willing That distinction alone placed the high-going chestnut stallion Through *Neposeda and dispositions. I believe that in rarefied company, but his Nomenklatura, *Napitok carried 13 *Napitok offspring won royal heritage did not stop there. the blood of the important Sahara national titles.” Like a charge from a doubledam line. (Sahara was one of the barreled shotgun, *Napitok’s three celebrated “Pearls of Great Dr. Dee Whittlesey male antecedents blasted through Price,” foundation mares brought history with explosive force. to Poland from the desert in 1845 In 1924, the Polish government imported Priboj’s greatby Count Juliusz Dzieduszycki.) grandsire, Kuhailan I, from Hungary’s legendary Bįbolna Stud. The Army horse and cattle depot was built on Count Of Priboj, Tersk Stud’s much-revered head sire from 1948 Szįpary’s Puszta Bįbolna property, a piece of real estate for through 1958, Russian Arabian authority O. Balakszyn which the Hungarian treasury paid 450,000 gulden—a wrote, “He was a brilliant track runner, winning classic fortune in 1789, and a hefty equivalent sum today. Bįbolna stakes races and setting speed records. Unchallenged now was a rough place for horses and men. In The Arab Horse for almost a century, Priboj is the single most influential in Europe, author Erika Schiele repeats a Bįbolna legend sire of racing champions in the Arabian breed. His legacy that some workers there were so proficient in the Magyar was passing on his ideal conformation, abundant substance and strength, harmoniously functional proportion, enduring language that they could curse steadily for two hours without repeating themselves! stamina and tenacity, and incredible, versatile athletic prowess to his offspring and their descendants.” *Napitok In To Breed an Arabian Horse, Dr. George Allen, Zenon inherited his maternal grandsire’s qualities in abundance. Lipowicz, Roman Pankiewicz and Walter Schimanski, agree that Poland’s 1924 Hungarian import, Kuhailan I, The other side of his pedigree—the sireline—provided a sired “big, very strong and brave horses.” The Kuhailan I son celebrated heritage as well. His sire, Pirit (Aswan x Pika, Piolun went to Tersk, where he was extremely significant. by Knippel), was a racing superstar who handily won Had he sired only Priboj, Piolun would have made the Russia’s most prestigious races, including the 7-million “influential” short list. Dr. Allen and his collaborators point ruble Elite. out “the tremendous impact the (Kuhailan Adjuze) sire line had on the Russian Arabian breeding program.” Pirit introduced another Arabian population altogether to *Napitok’s bloodlines. His sire, the straight Egyptian That impact is quite apparent in *Napitok. Those Aswan (Nazeer x Yosreia, by Sheikh El Arab), was a qualities—big, very strong and brave—describe him gift from Egypt’s EAO Arabian Stud to the U.S.S.R., perfectly. ■ celebrating the 1963 completion of the Aswan Dam. APR IL 2010 | 183


A Lifetime With Arabians Just Call Me Little Orphan Annie by Sheila Varian Like everyone, I have had my stellar moments and my disasters. Usually, at least, my disasters turn into funny stories. I go into things thinking “this can’t be that hard,” and then find out I was wrong: It was that hard. In the 1970s, the trainers—mostly guys—were stepping up to big trucks and trailers to haul more horses, and if I was going to compete, I decided that I would step up as well. The guys all had shiny new trucks and trailers. Let me tell you about mine. I knew a Peterbilt was the best truck, but I didn’t have much money to spend, so I looked for a truck that hadn’t worked too hard. I found one with 400,000 miles that had been pulling boats (so we were told). It was a “cabover,” the snub-nose model where you sit right over the engine, and since it was the least expensive truck I could find, it had no power brakes, no power steering, no

Peterbilt ad courtesy of Tim Alborn

184 | AR ABIAN HORSE TIMES

sound-proofing—actually, it had nothing but 400,000 logged miles, and it must have been 15 years old at the time. It was a huge, grey Peterbilt truck that had a great, blasting air horn and a rattling constitution. At that time, Varian Arabians had apprentices because we couldn’t afford hired help. The three of us lived on the ranch, so there was always one of us here. It was pretty much hand-to-mouth; we did our own cooking, ate threeday-old bread, made a pot roast every day, and were happy about it. Some of those apprentices stayed for years. One was a young man I will call Dan. He had driven trucks a lot before he came to the ranch, and like every other guy who has driven a truck, he loved it—his relationship with trucks was like a marriage. He became very possessive of that Peterbilt. The only trouble was, it was mine and I intended to learn to drive it.


A Lifetime With Arabians My diesel truck had 13 gears: four low (first through fourth); four high (fifth through eighth), each with a separate overdrive; and one reverse. There was none of this automatic shifting you see today. Dan was my obvious instructor. Following his instructions, going forward didn’t sound too difficult. Stopping sounded more difficult. Dan told me I had to shift down through every gear to come to a stop. On the side of the gear was a splitter that switched each of the high gears into its halfgear. So if I was in sixth-over, say, I would switch the splitter and drop into sixth-under; step on the clutch and shift into fifth; switch the splitter and drop into fifthunder; step on the clutch and shift into fourth, and from there, there was no splitter, so it was double-clutching the rest of the way through the gears. Dan said with emphasis, “You can’t go from sixth to second.” Looking back, it’s fairly clear that Dan was making it as difficult as possible for me to drive “his” truck. I finally figured out that I could go straight from sixth to third by listening to the rpms, and then double-clutching, shift down to second. As the rpms dropped off, I learned by listening when to shift from one gear to the other. But early on in my ownership of the Peterbilt, I couldn’t get down through each of the gears fast enough, and when I was driving, there was a lot of gear-screeching going on—which I’m sure was music to Dan’s ears. In the fall of 1976, as we prepared to leave for the U.S. Nationals in Louisville, I took the big rig out to practice on a country road. I was by myself, sitting way up above everyone and everything, feeling mighty proud, driving a truck that was practically as wide as the two-lane road with no shoulder. I was doing fairly well, and pulled the air horn’s leather strap a couple of times just for fun. I was chugging along in fifth when I crested a hill and saw a guy on a bicycle up ahead. He heard me coming just as I spotted him, and I started trying to gear down. Instead of shifting from fifth, listening to the rpms and going into third, I was trying to double-clutch from fifth to fourth to third, etc., and each time I made one of these changes, the gears were complaining mightily. I could see this guy wobbling down the road, pedaling nervously for his life, obviously thinking that maybe he could pedal fast enough to escape. I was just as nervous as he was. Trying to gear down through all those gears, I couldn’t slow the truck down to second fast enough. Sweat was pouring down my forehead; I was closing in on this man who, I’m sure,

had thought he would just take his bicycle on a little spin, never guessing there would be a truck the size of a house bearing down on him. Finally, he wobbled to a stop, picked up his bicycle, and ran out into the grass, as I, with much roaring, passed by. Me? I just looked straight ahead, pretended all trucks were driven like this, and went home. I never mentioned it, of course, but figured perhaps I needed a bit more practice. On the way to U.S. Nationals, I was going to stop in Salt Lake City for a horse show as a warm-up before Louisville. In those days I took my own hay with me, because the quality of what you could buy at a show was poor and unpredictable. We had a pickup truck with a trailer full of hay that was going to follow the horse trailer. Dan would drive the Peterbilt and I would ride with him, learning the ways of a diesel truck as we traveled, while a kid we called “The Bullet” would drive the hay truck. The Bullet came by his name honestly, because I’ve never known anyone who moved slower and had less to say. He wasn’t lazy. He just had troubles, which simply stopped his feet and his mouth. Nothing moved. We hadn’t gotten two hours from home before the pickup truck’s engine boiled, so Bullet switched the key off and immediately blew the engine. We had to have the truck

APR IL 2010 | 185


A Lifetime With Arabians towed into Bakersfield for repair before we could drive on with the Peterbilt and nine-horse trailer. I wasn’t waiting; I had Nationals fever. Everyone who has shown at Nationals, especially those who have hauled their own horses, will understand: Once you get on the road, you are hyperventilating the whole way. My brain was heading for Kentucky, 3,000 miles east. Dan drove to Salt Lake City without incident, I showed our horses, and we did fine. At the end of the show, our hay truck still had not been repaired, so I had Dan fly home to pick up that truck and meet us later on the road. Remember—there were no cell phones or email at that time. When you wanted to get in touch with somebody, you called home, and when they called home, home told them that you would be waiting at some gas station for them to call. This usually took a day or two, as well as caused much confusion. So Dan went home, and I, with my Nationals fever, was bound for Kentucky with the Peterbilt truck, Trailette trailer, nine horses, and The Bullet. No problem. It was only a mere 2,000 miles.

186 | AR ABIAN HORSE TIMES


A Lifetime With Arabians The Bullet and I left Salt Lake City heading east on I-80, which at the time was a two-lane road, and before we even got into Wyoming, we had to climb a long grade out of Utah. Have I mentioned that fourth gear was a killer in this truck? Well, it was. Unless I had exactly the right rpms, I couldn’t shift into fourth gear; all I did was grind the gears, hoping the rpms would be right this time. I was going up the grade in fifth and began losing power because it was getting too steep. I had to shift down, and I could not get geared into fourth. Grind … miss. Grind … miss. Grind … miss. The truck was whining and screaming as we slowly lost power. I pulled off on the side of the highway, the truck lurching to a stop and pitching the horses all over the trailer. Trailer stalls in the ’70s were much narrower and shorter than they are today, so the horses were truly stuffed in, getting thrown around into their mangers and into the back of their stall doors. In the

APR IL 2010 | 187


A Lifetime With Arabians the back of the one ahead of me and edged along. The truck ahead went onto the scale, stopped, and drove on. I pulled my truck onto the scale, paused a minute, and drove off the scale. Suddenly, all the lights in the state of Wyoming flashed red and a booming voice over a loud speaker blasted, “Stop your truck!” Oh, God. And then with only the audacity of a man, roared, “Back up your truck!” My first thought was, “I have been driving for hours. I can’t shift into fourth, and you want me to back up my truck? Are you crazy?” And the sweat started pouring down my face again. (The Bullet, meanwhile, had disappeared into some other land, and was his usual speechless self.) Very carefully coming to a stop to avoid any lurching, I stopped and sat there a moment. The weigh station officer must have been getting the drift that he might have a problem on his hands, so in a calm but firm voice, he said, “Pull around to the back.” Sheila and Bay-El-Bey.

group were horses about to become national winners: the stallions Bay-El-Bey, U.S. National Reserve Champion Stallion, and *Essaul, U.S. National Top Ten in Formal Driving; Baytar, U.S. National Champion Gelding; the mare Kaliki, U.S. National Reserve Champion Futurity Filly; and others. By the time we crawled with much lurching to the top of the grade, I was shaking and my teeth were chattering, I was rattled and exhausted—and I’d been gone only a few hours by this time. The Bullet, of course, had nothing to say through all of this. He just sat there with a typical Bullet look on his face. Finally, with the grade behind us, we cruised into Wyoming and I began to relax. My teeth were still chattering, however, because the truck rattled and bounced along, pretty much spring-less. You could hear nothing—no music, no talking of course (which didn’t matter, because The Bullet didn’t speak), no air conditioning and no heating. Things were looking up. I’d even stopped sweating. The countryside was pretty, with antelope and the occasional coyote trotting along. When I saw the “Weigh Station” sign, I began to sweat again. I had never been through a truck weigh station and was still worried about my gear-shifting. I pulled off the highway, carefully watched the other drivers, and followed their lead. With all the rigs creeping along in second gear as close together as they could get, I put the nose of my truck six inches from 188 | AR ABIAN HORSE TIMES

In those days, even with my three-horse trailer, I had to go through ports and show all my papers when I went from state to state, so I knew I had to show paperwork and maybe pay a fee. It always seemed like they charged you by whatever mood struck them. If you looked like you weren’t real smart, they might charge more than if you looked fairly savvy. By that time, I had been in the truck for seven or eight hours, and I was four hours behind schedule. Not only was I probably the only woman in the weigh station (you didn’t see many women truckers in those days), but I was tired—worn out is a better word—and I had the jitters from the rattling of the truck. I had no more sweat to sweat. I went into the office having no clue of what they were going to require, and not even sure I had the right papers for Wyoming, since Dan had handled the paperwork. The weigh station officer sat behind a counter that was on a platform, so I had to hand my papers up to him as he looked down on me. I was quite a sight, I’m sure— dirty, tired, hair tangled, full of alfalfa, and sweaty. I said hello and pulled out all my papers, handed them up to the officer, and looked at him. He looked at me, then at the papers. I looked back at him with the past eight hours of sweating, grinding gears and no food, and said defeatedly, “Sir, just do with me what you will.” If I was going to jail, this was as good a time as any, I figured. He looked at me again. I must have been a pitiful picture to see. Handing me back my papers, he said, “Okay, honey, you just go on.”


A Lifetime With Arabians I walked out to the truck. The Bullet was standing by its door, shifting from one foot to the other nervously, which was a lot of action for him. “Okay, Bullet,” I said, “get in the truck.” So he did. “All right,” I thought, “I’m back on the road, I made it through the weigh station, the horses are watered, there’s little traffic, and I only have four or five more hours before we get to our overnight destination. I’m relaxing.” And the truck engine went cough-cough-cough. With that, we slowly coasted to the side of the highway. “I have a dirty fuel filter,” I thought. I knew how to put on a new one. On a cabover truck, the whole cab lifts up pretty easily. I replaced the fuel filter, thinking, I can do this, and down the road we went again. I figured my karma was definitely coming back to get me for all the things in life I must have done that weren’t pleasing to whoever runs the Store Upstairs. As I pulled back on the highway, a trucker named Pony Boy, who had seen me parked by the side of the road, drove up behind and asked over his CB if I was okay. He said he would follow me for a bit to be sure all was well; truck drivers then were polite and always helpful, especially out in the country. All the truckers were on CBs and everyone had a handle. My handle was Little Orphan Annie, which I had thought was really funny when I picked it. However, it was becoming more appropriate by the moment.

About 10 miles down the road after I’d changed the fuel filter, the truck went into a coughing fit, losing power again. We limped over to the side of the road and Pony Boy stopped behind me to see what was going on. He had an extra fuel filter in his truck, so he decided to change mine again—maybe the one I put on was defective. Once more, down the road we went, Pony Boy coaching me on the CB radio. (“Put your rearview mirror on the center strip,” etc.) At this point, I was really tired. It was heaven having Pony Boy, who knew about coughing trucks and weigh stations, following behind. I’d have married him then and there if he’d only followed me on to Kentucky. On the nose, 10 miles down the road, the truck coughed to a stop again as if it had run out of fuel. Pony Boy climbed out of his truck with a length of baling wire, curved the end of it into a hook, and explored my fuel tank. A moment later, he fished out a big roll of paper towel that had been floating in the fuel. As the diesel was used, the paper was sucked down until it blocked the fuel intake; then, when I stopped the truck, it would float back up to the top. Once on the road again, about 10 miles of driving drew the paper back down to flatten over the intake screen. Must have been a very close friend who wanted to make sure I learned the way of truck driving, I thought, so he made sure the lesson would be memorable. And it was, to this day. A few hours later, Pony Boy came to his fork in the road, so he wished me luck and headed off his own way. I stifled a tear and reminded myself that driving the Peterbilt and nine horses to Kentucky was my idea. As we went on, bad directions made me miss a lot of turns (no GPS in those days), and I began to become very proficient at backing out of dead-end streets. With no power steering, to turn the front wheels from a standstill, I had to stand up, grab the steering wheel and fling myself down, turn a quarter of a turn; stand up, grab the steering wheel, fling myself down, turn a quarter of a turn; do it over again. Again. Again. More sweating. If you keep moving forward, you eventually arrive somewhere, and our somewhere was where we were spending the night. It was usually at cattle layovers. There, the horses could stay in pens and move around. We got them unloaded and cared for, and The Bullet and I even got a couple of hours of sleep. Then we got up and set off again. APR IL 2010 | 189


A Lifetime With Arabians By the second day, I was feeling a lot better about my driving skills. I was even shifting into fourth gear fairly well. We had passed Council Bluffs and were crossing into northern Missouri when somebody came up beside us, honking and pointing to attract our attention. What now, for heaven’s sake? One of our taillights had fallen off the back of the trailer and was bouncing along down the street, hanging by the wires, with the turn signal blinking. We were going through a little country town at the time, and I saw a repair shop with a driveway beside it I could get the truck and trailer into. I walked in to talk to an old man who was sitting behind a pedal saw. Me: “Sir? I’m wondering if you can help me. My taillight on my trailer has fallen off.”

miniscule slice of iron fell away. This could take hours, I thought. Maybe days. Push-push, zing-zing, and four hours later, we finally had a piece of metal cut and the light fastened to it. He attached that to my trailer, the light worked, and we were ready to go again. Meanwhile, the frazzled horses were getting more tired and all of us were getting cranky. They were stomping, and Kaliki was beginning to kick. They were saying they’d had it. I’m thinking, “What do you mean, you’ve had it?” The Bullet, of course, wasn’t thinking at all. I’ll say this for that little man in Missouri. That light stayed on that trailer for as long as I had it, and I’ll bet wherever it is, when it finally goes to trailer heaven, that little old man’s push-pedal artistry will be the last thing to disintegrate into rust.

Him: “H’m.” I stand there, waiting, thinking surely he’ll do something, but he doesn’t. Nothing happens.

We got back on the road. There are big interstates now in Missouri, but at the time we were on two-lane roads, particularly narrow for a big truck. People saw me coming and just automatically headed for the bushes. The Bullet

Me: “Would you like to come look at it?” Him: “Okay.” He comes out, stares at my rig, but doesn’t say a word. “Oh, brother,” I’m now thinking. “I have another Bullet on my hands.” Me: “Do you think you can repair it?” Him: “Yup.” Okay. One doesn’t have to be a good talker to be a good mechanic. I got The Bullet, we watered the horses, and while the old man took the taillight into his shop, we found crackers to eat. Once again, fatigue was setting in. We had had very little food, as finding a place to stop a 55-foot truck and trailer, except at a truck stop, was difficult to say the least. I walked back into the shop and found the old man sitting with a foot-square, half-inch-thick piece of iron he was going to use to attach the lights to the trailer. However, he had to cut the iron first. This was northern Missouri and it was 1976. Just because I’m a Californian, what did I expect? As I watched, he pumped the pedal (pushpush)—and the cutter chewed at the iron (zing-zing). A

190 | AR ABIAN HORSE TIMES

“I must say, I loved driving that truck, sitting way up there, bouncing along. Although we never made a trip without breaking down, I truly enjoyed the adventure that it created, the people I met, and all the things I learned along the way.” and I were not speaking, but he never spoke anyway, which was by this time a blessing. By the time we finally got to our next stop, Kaliki was kicking the back out of her trailer stall and *Essaul, a stallion by Comet I’d brought over from Sweden, was jumping his front feet into his manger. I whacked Kaliki on her bottom, which didn’t help, and thumped *Essaul on his nose and told him to get his feet out of his manger. How they kept their legs attached, I don’t know, but I was too weary to worry about it. And they had four of them, anyway. The third day, I was tired beyond tired, and we were about two hours out when I heard a honk-honk-honkhonk. No faulty trailer lights this time—it was Dan,


A Lifetime With Arabians who had caught up with us. The shape I was in, Dan looked closely related to Jesus Christ, I was so happy to see him. He drove us on into Kentucky and The Bullet drove the hay truck. I sat in the passenger seat of the Peterbilt, too tired to tell Dan the story, and I wasn’t about to whine anyway. It was my truck, and I had driven it almost to Kentucky. Despite the challenges of getting to Louisville, our 1976 U.S. Nationals was wonderful. With nine horses, we won seven or eight national championships. I learned to drive that Peterbilt and nine-horse trailer all over the country. I backed a quarter-mile out of a city street in Edmonton, Canada, in the rain, and drove over San Francisco’s Golden Gate Bridge, rubbing the tires

on the edge of the bridge. I even won a $100 bet with a fellow that fancied himself a truck driver and thought he could shift into fourth without grinding the gears; to my delight, he couldn’t. I must say, I loved driving that truck, sitting way up there, bouncing along. Although we never made a trip without breaking down, I truly enjoyed the adventure that it created, the people I met, and all the things I learned along the way. When I’m 100, if someone needs to replace a dirty fuel filter or is having trouble with an alternator at dusk, they can give me call. ■

Sheila Varian, of Arroyo Grande, Calif., has bred, trained and shown Arabians for more than half a century. Now in its ninth generation, the Varian Arabians program is a dynasty of her bloodlines, with national champions in nearly every division. She has been a leading breeder at Scottsdale and the U.S. Nationals many times, and in 2008 received the USEF/Performance Horse Registry Leading Breeder Award, a selection made over all breeds. Sheila’s own record includes U.S. and Canadian National Championships in halter, English, park, stock horse, and western. She is a recognized authority in the equine industry as a whole, and was inducted into the Cowgirl Hall of Fame in Fort Worth, Texas, in 2003. Her techniques for socializing and training horses are based on the “soft approach” of the legendary Tom Dorrance, with whom she was close friends from their introduction in the 1960s until his death in 2003. For more information on Varian Arabians, and its April Spring Fling and August Summer Jubilee weekends, please go to www.varianarabians.com.

APR IL 2010 | 191


In Memoriam:

Harold Orr (1923 – 2010)

Harold and Dolly Orr.

Harold L. Orr passed away peacefully at his home in Ellensburg, Wash., on March 13, 2010. He was born August 16, 1923. He was known for his brilliant mind, entrepreneurial spirit and eccentric ways. A determined individualist, he lived life the way he wanted. Harold was born in northern California, where he remained until 1962. After turning down Officer’s Candidate School, he served as a staff sergeant in the army during World War II. Early in his career, he was a newspaper typesetter until he purchased an H&R Block franchise and moved to Seattle. As the tax business grew, he ventured into other enterprises, including commercial printing, jewelry manufacturing, boat building and retailing, a Spokane radio station, a tax software 192 | AR ABIAN HORSE TIMES

company, and most recently, a company that develops software for the pharmaceutical industry. During his busy years in the Seattle area, Harold visited and fell in love with Ellensburg, where he bought property for his retirement. His dream to have cattle and Arabian horses became a reality over the past 25 years. In 1975 he married his friend of 14 years, Dolly (Kroll) Orr. They shared their passion for animals large and small. Harold is survived by his wife, Dolly; his three children by an earlier marriage, Ronald, Sandra and John; five grandchildren, four great-grandchildren, and two nephews and their families. In lieu of flowers, donations may be sent to the animal rescue of your choice. â–


2010

Regional Judges

REGION 1 Del Mar, Calif.

Deborah Johnson – All classes Brian Murch – All classes Jody Strand – All classes Mary Jane Brown – Trail, Reining and Equitation Julie Sodowsky – Dressage and Sport Horse

Bruce McCrea – All classes Michael Damianos – Working Western Richard Wilkinson – Hunter/Jumper Bill Solyntis – Dressage/Sport Horse

REGION 14 Lexington, Ky.

Mike Beethe – All classes Mary Jane Brown – All classes Deb Witty – All classes

Karen Homer Brown – All classes and Carriage Driving Myron Krause – All classes and Reining/Trail John Lambert – All classes Rick Moser – All classes Brian Ross – Dressage and Sport Horse Thom Brede – Sport Horse

Santa Barbara, Calif.

REGION 9 Ft. Worth, Texas

REGION 15

Brian Furguson – All classes Lori Conway – All classes Richard Petty – All classes Lindsay Costigan – All classes Jim Hitt – Working Western Hilda Gurney – Dressage Jacqueline Lindberg – Sport Horse REGION 3

St. Paul, Minn.

REGION 2

Reno, Nev.

Ted Carson – All classes Kathy Callahan-Smith – All classes Bill Melendez – All classes REGION 4 Nampa, Idaho

Juli Goder-Larson – All classes Ross Tarkington – All classes Chuck Mangan – All classes and Working Western REGION 5 Monroe, Wash.

Liz Bentley – All classes Lisa Jo White – All classes Robert Purtee – All classes REGION 6 Rapid City, S.D.

Pam Zimmerman – All classes Laurie Martin – All classes Myron Krause – All classes and Working Cow Todd Banner – Cutting REGION 7 Scottsdale, Ariz.

Elizabeth Bentley – All classes Steve Lieblang – All classes

REGION 8 Denver, Colo.

Rebecca Fleck – All classes David Garrett – All classes Corky Sutton – All classes Bill Melendez – Working Western Gary Ray – Cutting REGION 10 Greg Gallun – All classes Ann Judge-Wegener – All classes Steve Lieblang – All classes REGION 11 Springfield, Ill.

Chris Culbreth – All classes Michael Damianos – All classes Jim Paden – All classes Richard Petty – All classes Patty Felker-Breiner – Sport Horse and Jumper Louise Cox and Jacqueline Lindberg – Dressage Janet Curtis and Karen Wynn – Sport Horse REGION 12 Perry, Ga.

Jeff Tracy – All classes Bill Melendez – All classes Scott Brumfield – All classes Fran Dearing – Dressage Charlotte Trentelman – Sport Horse REGION 13 Indianapolis, Ind.

Corky Sutton – All classes Ed Sutton – All classes Van Jacobsen – All classes

Lexington, Va.

Jim Hitt – All classes Van Jacobsen – All classes Wendy Gruskiewicz – All classes Diana Cappallenti – Working Hunter and Sport Horse Debbie Rodriguez – Sport Horse and Dressage Dr. Paramjett Chopra – Dressage REGION 16 Syracuse, N.Y.

John Power – All classes Terry Holmes – All classes Jody Strand – All classes Susan Kantz – Hunter/Jumper Lynda Southam – Sport Horse and Dressage REGION 17 Red Deer, Alberta, Canada

Greg Knowles – All classes Corky Sutton – All classes Kelly Alcorn – All classes and Reining Ali Buchanon – Dressage Scott Benjamin – Trail Tamara Hall – Sport Horse and Working Hunter/Jumper REGION 18 London, Ontario, Canada

Donny Bullock – All classes Wendy Gruskiewicz – All classes Dana Gardner – All classes Robyn Baechler – Sport Horse Kate Farrell – Dressage ■

APR IL 2010 | 193


A Leg Up The Third Trimester by Heather Smith Thomas Each phase of gestation has its own risks. Most pregnancy loss in mares occurs during the first trimester, particularly during the first 60 days of gestation. After that, the placenta is developing (and producing progesterone to safeguard the pregnancy), and the embryo has become a fetus. Mother and foal usually enjoy relatively smooth sailing for the rest of the pregnancy, except for some additional risks that may develop during the third trimester. It is important that owners monitor the pregnant mare throughout gestation, and be observant for any changes in her attitude or demeanor, or any health problems. Some of the important things to look for—especially during the second half of the pregnancy—include weight loss or depression, sudden increase in abdominal size, vaginal discharge, periodic mild colic, and sudden udder development or premature lactation. The final trimester of gestation is when the fetus is growing fastest and the mare’s abdomen generally becomes larger. “This is when the final growth of the fetus takes place,” says Ahmed Tibary, DVM, Dip. ACT (Professor, Department of Veterinary Clinical Sciences, College of Veterinary Medicine, Washington State University). “This is also where a lot of the changes in the mare take place to prepare for a good foaling—for good survival of the foal.” Even though light to moderate exercise is beneficial in the earlier stages of pregnancy (some individuals continue athletic careers for a while in early pregnancy), the mare’s exercise during the third trimester should be more limited. Turnout at pasture or in a large lot where she can self exercise is ideal, but strenuous work should be avoided. “The two main areas of care during the final trimester are, first, to provide enough nutrients to allow for the growth of the placenta and fetus,” says Tibary, “and secondly, from a health standpoint, to start looking at

194 | AR ABIAN HORSE TIMES

some preparations for the mare to have good colostrum and be prepared for lactation.” Nutrition (adequate levels of balanced nutrients to support not only the mare’s body maintenance, but also the growth of the fetus) is important during the entire pregnancy, but energy levels of diet, along with certain nutrients needed for growth of the fetus, should be increased during the third trimester. Tibary recommends that mares should be receiving an additional 20 to 25 percent more nutrition than what they require for their own maintenance. “Nutrition in pregnant mares has been an area with very little research,” he says. “We know that excess nutrition as well as inadequate nutrition may lead to some complications. Some of the problems people worry about are not always verified. A lot of people have thought that obese mares have difficulty foaling, but this has not been demonstrated. Obesity is really not a great concern for the foaling mare, but in my opinion should be avoided, particularly in the maiden mare.” Mares should ideally be in a body score of six (on a scale of one to nine) at the time of breeding, and should not be allowed to lose weight during pregnancy. Mares in good body condition (score six to seven) will deliver stronger, healthier foals than thin mares, and will have better lactation. “Mares that are stressed nutritionally during pregnancy will have a harder time maintaining pregnancy, or they might have an abnormally long pregnancy because of fetal growth retardation,” Tibary says. “Loss of body condition in the second half of the pregnancy reduces fetal growth and will adversely affect colostrum quality and milk production after foaling. Loss of body condition will also result in delay of a mare’s return to cyclicity (foal heat).” It is usually better for a mare to be a little too fat than too thin.


A Leg Up There can be some problems, however, in mares that are obese. “If a mare is obese throughout pregnancy, there can be metabolic complications such as pregnancyinduced laminitis,” he explains. The obese mare may also program her fetus for future metabolic problems after it is born.

western encephalomyelitis can be given in the fall of the year or at least 60 days before foaling,” he says. “Rhinopneumonitis vaccine can be given several times during the pregnancy, and inf luenza and West Nile virus vaccines should be given about 30 days before foaling (four to six weeks before due date).”

“The best thing to do regarding nutrition is to have a plan and consult with a veterinarian about what the mare should receive,” he adds. The mare owner should find out the nutritional requirements for a specific mare at various stages of her gestation. The ideal program should include a plan for testing the forage and to know what nutrient levels are being supplied by the concentrate portion of the ration. The total diet should contain 12 to 14 percent crude protein, and should also be balanced for calcium and phosphorus. During the last trimester, the mare’s ration should be between 1.2 and 1.5 parts calcium to one part phosphorus, and should also include proper amounts of the necessary trace minerals.

“The two main areas of care during the final trimester are, first, to provide enough nutrients to allow for the growth of the placenta and fetus,” says Tibary, “and secondly, from a health standpoint, to start looking at some preparations for the mare to have good colostrum and be prepared for lactation.”

Preventative health measures to ensure disease protection for the foal include vaccination boosters for the mare. These are very important for the mare during pregnancy, particularly during the last four to six weeks of gestation when she needs to be producing optimum levels of antibodies for her colostrum. The objectives of vaccination are to protect the mare’s health, fetal health, and provide good quality colostrum by the time she foals—to supply the newborn foal with adequate passive transfer of immunity.

Vaccination against rhinopneumonitis (Equine Herpes Virus 1) is important for prevention of abortion due to this disease. “The traditional vaccine used for this purpose is a killed vaccine which needs to be given every two months, starting at either the third or fifth month of pregnancy,” Tibary continues. Depending on the region and the risks, some people like to start at three months of pregnancy, while others start at five months. The vaccine is usually given to the mare at the fifth, seventh and ninth month of gestation.

Vaccination programs will vary from one region to another, depending on the most common diseases the mare might encounter. Tibary says that mares can be vaccinated during pregnancy for inf luenza, rhinopneumonitis, tetanus, rabies, eastern and western encephalomyelitis, West Nile virus, botulism, and rotavirus, for instance. “In some areas where strangles is a problem, mares are also vaccinated with Streptococcus equi,” he adds. “If a new vaccination is contemplated (one that has not been previously included in the mare’s annual vaccination schedule), it should start before the third trimester of pregnancy so that enough time is provided for both the primary and booster vaccinations.”

“Some veterinarians have used the modified live vaccine for prevention of rhino abortions without any negative effects, but this vaccine is not labeled for use in pregnant mares,” he says. “The modified live vaccine seems to protect against both EHV-1 and EHV-4.” There are recommendations for broodmare vaccination set by the American Association of Equine Practitioners (AAEP), but you need to check with your own veterinarian regarding the best vaccination program for your region and for your particular mare. It is very important to keep the pregnant mare away from horses with unknown vaccination or health history.

Some veterinarians prefer to not give more than four vaccines at any one time. “Tetanus, rabies and eastern/

Keeping the pregnant mare dewormed is also important, but make sure that the deworming drugs used are not contraindicated for pregnant mares. “Ideally, you should APR IL 2010 | 195


A Leg Up do a fecal analysis on mares before deciding on treatment for parasites, and also to be able to evaluate the efficacy of treatment,” Tibary counsels. “Your mare should also be dewormed 10 days before foaling, but be aware of parasite resistance to some of the drugs.” Proper deworming will ensure that she will not pass worm eggs in her manure for the young foal to pick up when he ingests his dam’s manure, which foals typically do.

“Care during the last trimester of pregnancy also depends on the mare herself.” Care during the last trimester of pregnancy also depends on the mare herself. “There are many mares that have an easy pregnancy and don’t need as much monitoring as mares that are classified as high risk pregnancy,” he says. “Those mares require a lot more work in monitoring, particularly in that last trimester, than a normal mare who has more chance of carrying a normal pregnancy to term.” He recommends having an emergency plan, especially during the final two weeks before the calculated due date. Emergency numbers and protocol should be posted on the door of the mare’s stall. Some people neglect to prepare for what they might need to do in case of difficulty during the mare’s pregnancy. “There are some things you can do to prepare the mare for the last trimester and things you can do in preparing for foaling in general,” he offers. “For instance, you need to have a plan in case the mare does not have enough milk or colostrum.” Colostrum banking is always a good idea. “One aspect of dealing with a high risk pregnancy depends on the area where you live, and the season of year the mare is due to foal,” he says. “The mare that will foal in cold weather will obviously need more care.” 196 | AR ABIAN HORSE TIMES

Complications That May Arise During The Last Trimester There are a number of things that the mare owner should keep in mind and watch for, especially in high risk pregnancies. One of the things that may occur in late pregnancy is premature udder development and lactation. “This is most commonly due to impending abortion and may be the result of twins, placentitis or other infections,” says Tibary. “You need to watch for any hint that the mare is starting to lactate before she should. Thus you need to have an approximate due date. Once the mare is diagnosed pregnant, you want a predicted foaling date, which is based on an average length of gestation depending on her breed, the time of year, her age, and a few other variables.” If the mare is making more udder than she should—more than four to six weeks ahead of foaling—or dripping milk before two weeks ahead of her due date, you should have her checked by your veterinarian to find out why. “Udder enlargement with severe ventral edema is another complication that may occur as the mare nears the end of gestation,” he says. “It may be seen in some mares as early as three weeks before foaling, and should be watched closely. This swelling under her abdomen should not be confused with prepubic tendon rupture.” In the latter situation, the main support for the abdomen gives way and her belly drops down too far. Vaginal discharge is another clue that something may be wrong. “The discharge may be bloody due to impending abortion, but more commonly it may be due to leaking from vaginal varicose veins,” explains Tibary. The vaginal wall/muscles may have become stretched and weakened, and some of the surface veins may be hemorrhaging. “It’s not clear


A Leg Up why this happens, but there may also be an effect of the hormonal environment of the pregnancy and the dryness of the vagina, making the veins more susceptible to bleeding.” In most cases, bloody discharges are not life threatening or pregnancy-threatening, but some may be indicative of a serious and dangerous situation. Be alert to any type of discharge. A thick discharge of mucus or pus is often a sign of placentitis. The mare should be checked by your veterinarian. “Within a reasonable limit, we also don’t want to see mares all of a sudden increase in girth,” he says. A toorapid increase in abdominal girth can be a clue that the mare is suffering from hydrops (too much fluid around the fetus, making the uterus much larger than it should be at that stage of gestation). The rapid enlargement of the uterus may be accompanied by respiratory or metabolic complications. These signs may be indicative of hydrops or sometimes twins. “Twins tend to lead to a mid- to late-term abortion, which is not a good thing,” Tibary states. “Abortion in itself is usually fairly straightforward in mares because the fetus is not yet big enough to cause the mare harm, but she is not prepared to dilate properly. Therefore the abortion may cause her harm just because of this lack of preparation.” The mare may need assistance to deliver the dead foal. Other emergencies in the last trimester include colic due to uterine torsion, and on rare occasion, rupture of the uterus. “Colic toward the end of pregnancy, particularly when it’s associated with uterine torsion, is a very serious problem,” he says. The torsion must be resolved quickly or the fetus may be endangered, due to compromised blood flow because the twisted uterine tissues restrict the blood vessels that supply the fetus. Mare owners should not wait until the last trimester to start looking closely at the mare. “Any mare that has been flagged as a high risk pregnancy because she’s had complications before, or an abortion or premature placental separation in an earlier pregnancy, should be carefully monitored,” says Tibary. “That mare needs to be examined more frequently.”

If there are other broodmares on the farm, another thing to watch is how the other pregnancies and foalings are going on. “If some mares are going longer than normal before foaling, or if the first few mares have foaled and do not have enough milk for their foals, for instance, this could be a sign of fescue toxicity if the mares are on fescue hay or pastures,” he says. The remaining mares could then be removed from the feed that’s causing the problems, and the mares that are in the last trimester of pregnancy could be started on treatment to greatly improve the chances of a normal situation for their foals.

Definitions We often talk about the trimesters of pregnancy, but most people are not sure how this breaks down time-wise in a mare’s gestational phases. Humans and cattle have a nine-month gestation, which makes the trimesters simpler to talk about because the pregnancy can be divided into thirds of three months each. A mare’s gestation is roughly 11 months, however, which doesn’t fall into such neat categories. Defining the last trimester as the final third of pregnancy may be a misnomer, since it may entail 3.5 to four months in a mare. “In the French literature, a trimester is three months,” says Dr. Ahmed Tibary. “The last trimester would therefore be just the last three months of pregnancy in the mare (the ninth, 10th and 11th months), rather than the final third.” It is a matter of definition, and sometimes we need to clarify just how much time we are actually talking about.

A complete fetal and placental evaluation is indicated in any instance where the general health of the mare is in question or when any of the above signs are encountered. Tibary advises, “The standard examination for a high risk pregnancy requires transabdominal and trans-rectal ultrasonographic evaluation of the fetus and placenta, as well as monitoring of hormonal changes over several days.” ■

APR IL 2010 | 197


Times For Amateurs To Be Competitive Part I by Keri Schenter

Several months ago I wrote an article about Cindy Tobeck, who trained and rode her horse Khajun Bey to a national reserve championship at the 2008 Sport Horse Nationals in Nampa, Idaho. Cindy, who is an incredibly gifted horsewoman, applied her own talents and dedication to achieve a life-long goal, thereby proving that it is possible to succeed at the national level without keeping a horse in a full time training situation.

If I was, what had I been doing right? If I wasn’t, what was I doing wrong? It was interesting, particularly when I realized that after 10 or 12 years showing at the regional/national level, I was much more competitive in some ways, while in others I was still struggling.

Cindy Tobeck is not your typical amateur. What sets Cindy apart is her drive and determination. While all of us have some degree of each When I returned from in ourselves, some of my first horse show of us are better (luckier?) the season, I spent most at making it work for of the eight-hour drive Cindy Tobeck and Khajun Bey. us. For as long as I can pondering how to be remember, I have wanted most competitive, and to be successful in the show ring. While my ambitions coincidentally, when I got home, I found an e-mail asking have increased from wanting to win a blue ribbon in a the same question. The e-mail referenced the story about class to thinking that maybe someday I can win a national Cindy and Khajun (Arabian Horse Times March 2009) and championship, I’ve always been determined to do what I asked what, exactly, had allowed Cindy to be nationally set out to do. So what is the difference—or what makes competitive. What had she done (apparently differently) to the difference—that fosters Cindy’s success, while for so succeed in an industry that is so dominated by professionals many of us, the challenge is still open? and amateurs riding under professional tutelage? As I was thinking about what it took to be competitive, I also considered the changes that have occurred over the years as my finances have allowed me to do more with my horse and work with a trainer. I thought of the years I rode on my own, and how (or if) I was competitive then. 198 | AR ABIAN HORSE TIMES

Let’s start at the beginning, with the dream. We need to dream big, but be realistic. When I first decided to show at the “A” level, I was riding a purebred gelding who was gifted beyond my ability. At our first show we won a class of 23 horses. Having struggled to be in the


Times For Amateurs top three of any class in my 4-H years, I had won a blue ribbon occasionally enough to know the taste of victory, but I never expected it. I always felt like everyone else was better than I was, and there was nothing I could do about it. So when we won that class, I almost fell out of my saddle. Over the course of the next year, we began to get noticed at the local level, and eventually at clinics with Arabian trainers who encouraged me to show “A,” since my horse was so good.

“When I started riding with professional trainers, the routine changed a great deal, but so did my appreciation for the preparation and detail it took to set the winners apart from the rest of the field.”

Success at the “A” level is relative. I am beginning to recognize that more now that I’ve been doing this for so many years and at opposite ends of the country. My cute little gelding and I did exceptionally well at “A” shows, but could never quite find a ribbon at regionals. Oh, how badly I wanted to take him to Nationals! The blue ribbons were stacking up, and I was living in a world where packing up for a show and going into the ring was as simple as that. The friends and I who traveled together bedded and cleaned our own stalls, fed and watered the horses, bathed, clipped and groomed to perfection, and rarely thought about much other than getting on, warming up, and going in the ring. It was always fun to get a ribbon, and even more fun to get a good ribbon. When I started riding with professional trainers, the routine changed a great deal, but so did my appreciation for the preparation and detail it took to set the winners apart from the rest of the field. Only recently have I become aware that riding in the show ring isn’t that different from riding in the practice arena or even the trail. Riding is applying cues and getting correct responses from your horse. Riding is working with your horse to achieve a goal. The difference between riding a top notch show horse and one who is just starting or hasn’t had good training is like the difference between driving a sports car and a station wagon. Both vehicles offer a means of transportation, but one is jazzier.

Cindy Tobeck and Khajun Bey competing in a hunter class.

So dream big—dream of driving that Maserati. But be realistic. Before you take on a very big goal, you owe it to yourself to know what you have, where you are, and where you want to go long-term. If you’re still at the station wagon level, there is no reason you can’t succeed there and even move into the tricked-out division. You just have to know the caliber of horse you have, or can afford to buy, to play your game. Most of us start with a horse we already have. It’s critical to understand that although you adore your horse and think he’s the loveliest animal on earth, he may not be capable of performing like a Maserati. You also have to recognize your own abilities (or lack thereof). Not everyone is a gifted rider or horseman. But your devotion to your horse and your desire to succeed will take you a long way in the pursuit of success. APR IL 2010 | 199


Times For Amateurs There are many things anyone can do if he/ she wants to be better. Let’s say that you’ve been to a horse show, and while you had fun, you didn’t win much and you want to do better next time. It’s time to do some homework. Even if you’ve taken years of lessons, take more. If you know and trust someone who shows horses (the breed doesn’t matter if you’re just starting out), take lessons

“If you see something you like, don’t hesitate to ask questions, but be sure not to interrupt. Wait until there is a break in action. Most of us love to talk to other people at shows, and I promise that the majority of us also like to show off our horses.” to learn basic show ring etiquette. You’d be surprised at the difference such subtleties can make. Go to the horse shows you want to compete at eventually and watch. While it’s Cindy Tobeck and Khajun Bey participating in a trail class. important to see what is going on, be observant enough to see the difference between what to show off our horses. If you watch a class and pick the appeals to you and what doesn’t. Don’t just watch what winner, don’t hesitate to approach the rider after the class happens in the show ring. Take time to go behind the and congratulate them. If you want to know how they scenes and watch how horses are taken care of. Again, did it, you can ask who their trainer or instructor is. It’s be sure to think about the things you like and what you a great way to meet new people and perhaps get into a don’t. There is no set method; everyone has their own way lesson or training program that you enjoy. Most trainers of doing things. Watch how horses are longed. Do you will have business cards in the barn area, so collect them like how one horse goes in just a halter, or do you prefer from the people whose methods impress you. to see horses being longed in tack? Do you prefer seeing a horse longed in a surcingle and draw reins, or with his Watching and learning what you like to see is only the saddle on and his head tied between his knees? Always beginning of your pursuit of success and your first step remember that while everyone uses different methods, toward becoming a competitive showman. I hope to be every horse has different needs and demands, so you’re able to look at other areas soon and offer suggestions that going to see a huge variety of practices. will help each of us get more out of our horse showing experience. Never give up on yourself, and never lose If you see something you like, don’t hesitate to ask your drive. That and your steadfast determination are questions, but be sure not to interrupt. Wait until there is what will carry you along this challenging path. After a break in action. Most of us love to talk to other people all, if it weren’t challenging, there would be no point in at shows, and I promise that the majority of us also like doing it. Right? ■

200 | AR ABIAN HORSE TIMES


Handy Horse Tips De-Sensitizing Your Horse by Lee Bolles Over the years, I’ve heard about lots of “bomb-proof ” horses. I’ve never met one, and I’m not sure I ever will. If you were standing at the fence, quietly enjoying the evening sunset and I walked up behind you and either poked you in the ribs or dropped a metal bucket, wouldn’t you be startled and react accordingly? You probably wouldn’t immediately run away, but you’d certainly assess the situation and determine the “threat matrix.” Our equine friends have a similar response. We can do some things to help them become accustomed to certain scary things we expect to experience on the trail or in the show ring, but I don’t think we can “bomb-proof ” them, just like we can’t “bomb-proof ” ourselves. There are three things that will determine where your horse is in terms of his response to real or imagined dangers: his natural personality, experience and his exposure. Some horses are just born more bold and fearless than others, and some are afraid of their own shadows. A horse’s experience is largely determined by his age. On the other hand, you largely determine his exposure. Let’s talk fi rst about personality. Just like people, some horses are prone to be a little skittish. A horse that is naturally fearful, like his ancestors had to be to survive, may require more time in the de-sensitization process. You have to decide if the amount of time it will take matches the timeline for your goal (whether it be to have a great trail horse, show horse or a horse that is safe for the nieces and nephews). As a horse gets older, he experiences more things — a first new pasture, a different stall, crossties, a first bath, or the first visit from the farrier or vet. These are things your horse needs to accept regardless of his eventual line of work. As he ages, he’ll naturally get a dose of all those things. If your equine friend becomes a trail companion or show horse, his experience as he ages will be much broader — first clipping, first trailer ride, first show or first covey of quail rising from the brush. Can you do anything to hurry along the experience process? Sure. Start early and try often. If the farrier is coming to

work on other horses, get your youngster out of the pasture or stall to watch. If you are giving shots to another horse, let the neophyte experience veterinary care from a safe distance. There shouldn’t be any pressure here, just a subtle hint that his turn will come someday. You will need to be a little more deliberate to complete the exposure side of the equation. Try to think of as many things as possible that your horse might see, hear or experience at the show grounds or on the trail. Start to duplicate those things as closely as you can. During this process it is important to remember not to punish a horse for being fearful. Were you ever punished for being afraid of something, say thunder, fireworks or clowns? Did the adult in your life grab you by the hand and drag you outside or up to the clown and force you to accept it? I hope not. I hope they took you by the hand and explained things to you, real soft and slow and eased you into the situation when you were ready, not when it fit their agenda. The bigger deal you make of something and the more you try to force it, the more your horse is going to remember it, and not for the reasons you want him to. Instead of forcing the issue and dragging the horse up to the mock judge’s stand you’ve set up for example, try working in circles at the other end of the arena. Get his attention and focus directly on the circles, then try gradually moving him closer to the mock stand as you continue your circles. Before you know it, you’ll be circling around the object in which he was originally scared. You also must realize that your response to real or perceived threats is a determining factor in the horse’s response. Tighten up, pull back and gasp, your horse is going to pick up the cue, “She is petrified, I better get her out of here and quick.” Be calm, cool and collected, and the horse will pick that up as well. “She heard it, but it must be okay because she just went right back to work.” There is not an assembly-line training method that works to de-sensitize horses. Before you start, ask where you are in your response to the “threat matrix.” Along with your horse’s own personality, his experience and exposure, you’ll be determining his response. ■ APR IL 2010 | 201


Calendar Of Events Items for the calendar are run FREE of charge on a space-available basis. Calendar listings are subject to change; please confirm dates and locale before making your plans or reservations. MAIL or FAX notices to Arabian Horse Times, Attention: Charlene Deyle, 299 Johnson Ave. Suite 150, Waseca, MN 56093; phone 507-835-3204 or fax 507-835-5138 or e-mail: charlened@ahtimes.com. *Due to the intrinsic nature of these shows, Arabian Horse Times cannot be held accountable for their validity.

SEMINARS/CLINICS/SALES/ OPEN HOUSE/AWARDS APRIL April 24-25, 2010, Varian Arabians’ Spring Fling, Arroyo Grande, California. Contact: Varian Arabians: 805-489-5802; www.varianarabians.com

REGIONAL SHOWS & CHAMPIONSHIPS APRIL April 15, 2010, Region 15 Competitive Trail Championship, Unionville, Pennsylvania. Contact: Kim Colket, 610-933-7074. April 22-25, 2010, Region 7 Championship Show, Scottsdale, Arizona. Contact: Marion Enders, 403-227-0538 April 24, 2010, Region 9 50-Mile Endurance Championship, Decatur, Texas. Contact: Trish Dutton, 940-455-2849. April 25, 2010, Region 15 Competitive Trail Championship, Unionville, Pennsylvania. Contact: Kim Colket, 610-933-7074. MAY May 3-8, 2010, Region 12 Championship, Perry, Georgia. Contact: Marilyn Norton, 217-563-2487. May 7-8, 2010, Region 7 Competitive Trail Championship, Sonoita, Arizona. Contact: Marilou Mann, 520-762-0554. May 13-16, 2010, Pacific Slope Championship, Santa Barbara, California. Contact: Sharon Richards, 916-645-2288. May 13-16, 2010, Western Canadian Breeders Championship, Lansing, British Columbia, Canada. Contact: Geri Burnett, 604-531-8726. May 22, 2010, Region 16 Endurance Championship, Escoheag, Rhode Island. Contact: Cheryl Mastele, 860-349-1200. JUNE June 2-3, 2010, Region 1 Pre-Show, Del Mar, California. Contact: Jean Beck, 559-642-2072. June 3-6, 2010, Region 1 Championship, Del Mar, California. Contact: Jean Beck, 559-642-2072.

202 AR ABIAN HORSE TIMES

June 3-6, 2010, Region 5 Sport Horse Qualifier and Offsite Championship, Auburn, Washington. Contact: Sharon Brodie, 360-435-9227. June 3-6, 2010, Region 11 Dressage, Hunter/ Jumper, Sport Horse Offsite Championship, Springfield, Illinois. Contact: Laurie Persson, 920-568-9073. June 5, 2010, Eastern Canadian Breeders Championship, Bethany, Ontario, Canada. Contact: Cathy Webb, 705-748-2225. June 6, 2010, Region 12 Hunter/Jumper Offsite Championship, Conyers, Georgia. Contact: John Gersch, 561-602-7122. June 8-12, 2010, Region 8 Championship, Denver, Colorado. Contact: Jo Anne Read, 303-648-3261. June 8-12, 2010, Region 9 Championship, Fort Worth, Texas. Contact: Melanni Hershberger, 480-443-3372. June 9, 2010, Region 10 Pre-Show, St. Paul, Minnesota. Contact: Mary Tronson, 763-755-1698. June 10-13, 2010, Region 10 Championship, St. Paul, Minnesota. Contact: Mary Tronson, 763-755-1698. June 11-13, 2010, Region 6 Sport Horse Offsite Championship, Edmonton, Alberta, Canada. Contact: Marion Enders, 403-227-0538. June 12, 2010, Region 12 100-Mile Endurance Championship, Oneida, Tennessee. Contact: Eric Rueter, 865-986-5966. June 13, 2010, Region 12 Competitive Trail Championship, Oneida, Tennessee. Contact: Eric Rueter, 865-986-5966. June 18, 2010, Region 10 Endurance Championship, Preston, Minnesota. Contact: Dianne Schmidt, 507-545-9936. June 18-19, 2010, Region 12 Youth Jamboree, Clemson, South Carolina. Contact: John Gersch, 561-602-7122. June 19, 2010, Region 10 Competitive Trail Championship, Preston, Minnesota. Contact: Dianne Schmidt, 507-545-9936. June 19-20, 2010, Region 12 Youth Jamboree, Clemson, South Carolina. Contact: John Gersch, 561-602-7122. June 19-20, 2010, Region 13 Dressage/Sport Horse Offsite Championship, Edinburgh, Indiana. Contact: Donna Auber, 330-274-2039. June 21-22, 2010, Region 4 Pre-Show, Nampa, Idaho. Contact: Patricia Ann Hough, 253-847-8842. June 22-26, 2010, Region 4 Championship, Nampa, Idaho. Contact: Patricia Ann Hough, 253-847-8842. June 23, 2010, Region 13 Pre-Show A and B, Indianapolis, Indiana. Contact: Donna Auber, 330-274-2039.

June 24, 2010, Region 6 Pre-Show, Rapid City, South Dakota. Contact: Jean Fredrich, 701-725-4420. June 24-27, 2010, Region 13 Championship, Indianapolis, Indiana. Contact: Donna Auber, 330-274-2039. June 26, 2010, Region 3 Endurance Championship, Walnut Creek, California. Contact: Amara Morrison, 925-229-2011. June 25-27, 2010, Region 6 Championship, Rapid City, South Dakota. Contact: Jean Fredrich, 701-725-4420. June 26-27, 2010, Region 10 Sport Horse/ Dressage Offsite Championship, Waukesha, Wisconsin. Contact: Mary Tronson, 763-755-1698. June 29-30, 2010, Region 14 Silverama, Lexington, Kentucky. Contact: Jean Hedger, 937-434-6114. JULY July 1-4, 2010, Region 11 Championship, Springfield, Illinois. Contact: Laurie Persson, 920-568-9073. July 1-4, 2010, Region 14 Championship, Lexington, Kentucky. Contact: Jean Hedger, 937-434-6114. July 3-4, 2010, Region 8 Sport Horse Offsite Championship, Estes Park, Colorado. Contact: Jo Anne Read, 303-648-3261. July 6-10, 2010, Region 5 Championship, Monroe, Washington. Contact: Patricia Ann Hough, 253-847-8842. July 8-11, 2010, Region 15 Championship, Lexington, Virginia. Contact: Marilyn Norton, 217-563-2487. July 10, 2010, Region 13 50-Mile Endurance Championship, Augusta, Michigan. Contact: Shelley Dake, 269-979-9472. July 10-11, 2010, Region 13 Competitive Trail Championship, Augusta, Michigan. Contact: Shelley Dake, 269-979-9472. July 11-13, 2010, Region 3 Last Chance Show, Reno, Nevada. Contact: Sharon Richards, 916-645-2288. July 13-17, 2010, Region 3 Championship Show, Reno, Nevada. Contact: Sharon Richards, 916-645-2288. July 15-18, 2010, Region 9 Sport Horse Offsite Championship, Waco, Texas. Contact: Sherri Re, 281-513-5745. July 21, 2010, Region 16 Hunter/Jumper Qualifier, Syracuse, New York. Contact: Marlene Kriegbaum, 716-655-1536. July 21-24, 2010, Region 16 Championship, Syracuse, New York. Contact: Marlene Kriegbaum, 716-655-1536. July 28, 2010, Region 18 Last Chance Show, London, Ontario, Canada. Contact: Crystal Green, 705-440-9456.


Calendar Of Events

July 29-31, 2010, Region 18 Championship, London, Ontario, Canada. Contact: Crystal Green, 705-440-9456.

SHOWS APRIL April 15-18, 2010, AHBAO Spring Classic, Salem, Oregon. Contact: Beth Garvison, 503-655-0386. April 16-18, 2010, Heart Of Oklahoma Charity Show, Oklahoma City, Oklahoma. Contact: Kelly McFaul, 316-722-4013. April 16-18, 2010, Indiana All Arabian Horse Show, Cloverdale, Indiana. Contact: Donna Auber, 330-274-2039. April 16-18, 2010, Annual Magnolia Spring Classic A and B, Perry, Georgia. Contact: Nancy Baker, 828-817-0359. April 16-18, 2010, BC Half-Arabian Spring Show, Cloverdale, British Columbia, Canada. Contact: Cheryl Brodie, 604-940-1167. April 17-18, 2010, Iowa Spring Show A and B, Cedar Rapids, Iowa. Contact: Ruth Charpie, 816-765-5683. April 20-21, 2010, ASHO4U, Scottsdale, Arizona. Contact: Marion Enders, 403-227-0538. April 22-25, 2010, SD Spring Show I and II, Sioux Falls, South Dakota. Contact: Heather Swanson, 605-743-2745. April 23-25, 2010, Arabians In Motion At The Hood, Boring, Oregon. Contact: Kaye Phaneuf, 503-651-3037. April 23-25, 2010, Border Bonanza A and B, Kansas City, Missouri. Contact: Ruth Charpie, 816-765-5683. April 23-25, 2010, OHAHA Springtime Show, Wilmington, Ohio. Contact: Jean Hedger, 937-434-6114. April 23-25, 2010, Spring Arabian Classic, Lexington, Virginia. Contact: Sherri Re, 281-513-5745. April 23-25, 2010, Daffodil Arabian Spring Show A and B, Puyallup, Washington. Contact: Lisa Gardner, 253-843-2748. April 24, 2010, Southern Cross Ranch Cutting Show, Foster, Oklahoma. Contact: Kathy Braden, 817-297-9784. April 29-May 2, 2010, Red Bluff Arabian Horse Show, Red Bluff, California. Contact: Sharon Richards, 916-645-2288. April 30-May 2, 2010, The Mayfest Challenge, Fort Worth, Texas. Contact: Sherry McGraw, 903-872-7279. April 30-May 2, 2010, Sahara Sands Spring Classic, St. Paul, Minnesota. Contact: Mary Tronson, 763-755-1698. April 30-May 2, 2010, Mason Dixon Classic, Quentin, Pennsylvania. Contact: Marilyn Ackerman, 315-331-2034.

April 30-May 2, 2010, CRAA Spring Derby Sport Horse Show, Northampton, Massachusetts. Contact: Debbi Thomas, 860-526-9526. April 30-May 2, 2010, Colorado Classic, Denver, Colorado. Contact: Anne Burton, 303-665-3307. April 30-May 2, 2010, Michigan All Arabian, Mason, Michigan. Contact: Sally Epps, 920-992-3293. MAY May 1-2, 2010, Milestone Spring Show, Campbellville, Ontario, Canada. Contact: Cheryl Smith-Ehrlick, 905-854-0762. May 6-9, 2010, AHANC 61st Annual Arabian Horse Show A and B, Rancho Murieta, California. Contact: Sharon Richards, 916-645-2288. May 6-9, 2010, Cascade Arabian Youth Benefit, Spanaway, Washington. Contact: Deborah Snydal Hinds, 360-457-5399. May 6-9, 2010, Zia Classic A and B, Albuquerque, New Mexico. Contact: Lois Seibel, 505-345-2244. May 6-9, 2010, Green Country Arabian Classic A and B, Tulsa, Oklahoma. Contact: Velma Boodt, 918-324-5842. May 7-9, 2010, CAHC Spring Show A and B, Denver, Colorado. Contact: Jo Anne Read, 303-648-3261. May 7-9, 2010, Empire State Arab Show, Syracuse, New York. Contact: Marlene Kriegbaum, 716-655-1536. May 8-9, 2010, SW PAHA Spring All Arabian Show, Harlansburg, Pennsylvania. Contact: Lorelei Wyman, 802-244-1602. May 13-16, 2010, AHASFV 47th Annual Arabian Horse Show, Santa Barbara, California. Contact: Sharon Richards, 916-645-2288. May 13-16, 2010, Alamo Arabian Fiesta, San Antonio, Texas. Contact: Sherri Re, 281-513-5745. May 13-16, 2010, AHABC Classic, Lansing, British Columbia, Canada. Contact: Marla Patterson, 604-574-3785. May 13-16, 2010, Western Canadian Breeders Championship, Langley, British Columbia, Canada. Contact: Geri Burnett, 604-531-8726. May 14-16, 2010, Treasure Valley Classic, Nampa, Idaho. Contact: Ginny Kelsch, 208-884-3071. May 14-16, 2010, Great Plains Arabian Classic A and B, Lincoln, Nebraska. Contact: Deanne Allen, 402-464-4995. May 14-16, 2010, NIAHAC May II Show, Springfield, Illinois. Contact: Pamela Scoggins, 217-253-4937. May 14-16, 2010, SAHIBA Arab Spring Show, Versailles, Kentucky. Contact: Jean Hedger, 937-434-6114.

May 14-16, 2010, Hudson Valley Arabian Show, Springfield, Massachusetts. Contact: Marlene Kriegbaum, 716-655-1536. May 15, 2010, AHAEC Pro Am Arabian Show, Mt. Forest, Ontario, Canada. Contact: Crystal Green, 705-440-9456. May 20-23, 2010, Diablo Arab Spring Show, Elk Grove, California. Contact: Nancy Goertzen, 559-625-2631. May 20-23, 2010, NYS Horse Breeders Show, Syracuse, New York. Contact: Tari Weston, 315-695-1332. May 20-23, 2010, AHACO Arabian Horse Show, Salem, Oregon. Contact: Betty Engleman, 360-425-7798. May 21-22, 2010, Double The Fun Arabian Show, Sauk Centre, Minnesota. Contact: Debbie Raszler, 701-725-4692. May 21-23, 2010, NJHAHA All Arabian I and II, Allentown, New York. Contact: Joan Mitch, 610-914-7008. May 21-24, 2010, Westerner Spring Show I and II, Red Deer, Alberta, Canada. Contact: Marion Enders, 403-227-0538. May 22-23, 2010, Northern Minnesota Arabian Horse Show, Sauk Centre, Minnesota. Contact: Debbie Raszler, 701-725-4692. May 22-23, 2010, Old Dominion Summer Fun Show, Doswell, Virginia. Contact: Ona Maria Morgan Jenkins, 804-590-2802. May 27-30, 2010, Buckeye Sweepstakes, Columbus, Ohio. Contact: Jean Hedger, 937-434-6114. May 28-29, 2010, Wisconsin Desert Horse (Badger) Show, West Allis, WI. Contact: Sally Epps, 920-992-3293. May 28-30, 2010, IEAHC Memorial Day Classic A and B, Spokane, Washington. Contact: Susy Birch, 360-540-4425. May 28-30, 2010, Montana Arab Show A and B, Billings, Montana. Contact: Becky Mcallister, 406-861-4929. May 28-30, 2010, Spindletop Spring Arabian Show, Katy, Texas. Contact: Sherri Re, 281-513-5745. May 28-30, 2010, AHC Of CT Horse Show, West Springfield, Massachusetts. Contact: Marlene Kriegbaum, 716-655-1536. May 28-31, 2010, Larimer County Spring Charity A, Denver, Colorado. Contact: Anne Burton, 303-665-3307. May 29-31, 2010, Iowa Arabian Memorial Weekend A and B Show, Des Moines, Iowa. Contact: Gary Paine, 641-466-3320. May 29-30, 2010, Comstock AHA Desert Spring Show A and B, Carson City, Nevada. Contact: Shannon Johnson, 775-750-0237. May 30-31, 2010, WAHA Show, West Allis, WI. Contact: Sally Epps, 920-992-3293.

APR IL 2010| 203


Calendar Of Events

JUNE June 2-6, 2010, Illinois/Arab Inc. All Arabian Show, Springfield, Illinois. Contact: Laurie Persson, 920-568-9073. June 4-6, 2010, GAHA Summer Classic A and B, Conyers, Georgia. Contact: John Gersch, 561-602-7122. June 4-6, 2010, Showtime 2010, East Lansing, Michigan. Contact: Sally Epps, 920-992-3293. June 4-6, 2010, NC PAHA Show A and B, Hughesville, Pennsylvania. Contact: Patricia McQuiston, 570-924-4836. June 4-6, 2010, Virginia Arabian Horse Show, Doswell, Virginia. Contact: Sherri Re, 281-513-5745. June 4-6, 2010, Pacific Coast Arabian Sport Horse, Elk Grove. California. Contact: Kelly Denison, 530-666-1363. June 5-6, 2010, Indianhead Arabian Horse Show, Rice Lake, Wisconsin. Contact: Jan Lerud, 715-488-2834. June 5-6, 2010, GG Thunder Dressage and Sport Horse Show, Springfield, Ohio. Contact: Donna Auber, 330-274-2039. June 5-6, 2010, Zone 9 Arabian A and B, Bethany, Ontario, Canada. Contact: Cathy Webb, 705-748-2225. June 10-13, 2010, AHAEC Summer Sizzler A and B, London, Ontario, Canada. Contact: Crystal Green, 705-440-9456. June 11-13, 2010, WA Midsummer Classic A and B, Monroe, Washington. Contact: Betty Engleman, 360-425-7798. June 11-13, 2010, Aurora Summer Show, Edmonton, Alberta, Canada. Contact: Marion Enders, 403-227-0538. June 12-13, 2010, Medallion I and II All Arabian Show, Wilmington, Ohio. Contact: Jean Hedger, 937-434-6114. June 12-13, 2010, Eastern Classic, Hamburg, New York. Contact: Marlene Kriegbaum, 716-655-1536. June 15-19, 2010, Midwest Charity, Springfield, Illinois. Contact: Cheryl Rangel, 847-537-4743. June 17-18, 2010, Shenandoah Valley Classic A and B, Lexington, Virginia. Contact: Sherri Re, 281-513-5745. June 18-20, 2010, Hoosier Horse Classic, Edinburgh, Indiana. Contact: Donna Auber, 330-274-2039. June 18-20, 2010, Red Deer Classic, Red Deer, Alberta, Canada. Contact: Aldona Tracey, 780-986-6731. June 19, 2010, Golden Gate Arabian Dressage, Santa Rosa, California. Contact: Sue Plasman, 530-695-0509. June 19-20, 2010, Shenandoah Valley Championship A and B, Lexington, Virginia. Contact: Sherri Re, 281-513-5745.

204 AR ABIAN HORSE TIMES

June 19-20, 2010, Island Classics Show A, Victoria, British Columbia, Canada. Contact: Wendy Don, 250-722-0162. June 19-20, 2010, Sunrise Summer Classic Horse Show, Sussex, New Brunswick, Canada. Contact: Lesley Ahman, 506-832-7912. June 19-20, 2010, Shenandoah Valley Championship A and B, Lexington, Virginia. Contact: Sherri Re, 281-513-5745. June 24-27, 2010, Summer Spectacular I and II, Lake St. Louis, Missouri. Contact: Ruth Charpie, 816-765-5683. June 25-26, 2010, WDHA Dressage and Sport Horse Show, Waukesha, Wisconsin. Contact: Candy Ziebell, 262-363-3640. June 25-27, 2010, Finger Lakes Arabian Summer Festival, Syracuse, New York. Contact: Marlene Kriegbaum, 716-655-1536. June 25-27, 2010, Flagstaff All Arabian Show, Flagstaff, Arizona. Contact: Melanni Hershberger, 480-443-3372. JULY July 1-3, 2010, AHANE 56th Arabian Horse Show, West Springfield, Massachusetts. Contact: Lorelei Wyman, 802-244-1602. July 2-4, 2010, CAHC Estes Park Show, Estes Park, Colorado. Contact: Jo Anne Read, 303-648-3261. July 2-4, 2010, Pennsylvania Arab Games, Dillsburg, Pennsylvania. Contact: Patricia McQuiston, 570-924-4836. July 2-4, 2010, CRVAHA Prairie Pride Show I and II, Saskatoon, Saskatchewan, Canada. Contact: Cheryl Sproule, 306-752-4240. July 2-4, 2010, Wild Rose Horse Show, Edmonton, Alberta, Canada. Contact: Marion Enders, 403-227-0538. July 3-4, 2010, Milestone Summer Show, Campbellville, Ontario, Canada. Contact: Cheryl Smith-Ehrlick, 905-854-0762. July 7, 2010, Firecracker Classic, Lexington, Virginia. Contact: Marilyn Norton, 217-563-2487. July 8-11, 2010, MSU Summer Showcase, East Lansing, Michigan. Contact: Sally Epps, 920-992-3293. July 10-11, 2010, Sport Horse Summer Fun, Tucson, Arizona. Contact: Melanni Hershberger, 480-443-3372. July 9-11, 2010, Great Arabian Get Together, Sauk Centre, Minnesota. Contact: Jan Lerud, 715-488-2834. July 9-11, 2010, Tulip Arabian Horse Show A and B, Kemptville, Ontario, Canada. Contact: Deirdre Doherty, 613-744-4917. July 11, 2010, Summertime Celebration, Longmont, Colorado. Contact: Anne Burton, 303-665-3307. July 17-18, 2010, OVAHA Summer Sizzler I and II, Springfield, Ohio. Contact: Donna Auber, 330-274-2039.

DISTANCE/ COMPETITIVE TRAIL RIDE APRIL April 17, 2010, Foxcatcher 25- and 50-Mile Endurance Ride, Elkton, Maryland. Contact: Louisa Emerick, 410-398-7234. April 17, 2010, Shine & Shine Only II 50-Mile and III 50- and 75-Mile Endurance Ride, San Jose, California. Contact: Lori Olesson, 408-710-5651. April 17, 2010, Million Pines Classic 50-Mile Endurance Ride, Soperton, Georgia. Contact: Wesley Crowe, 912-529-3956. April 17-18, 2010, Antelope Island 50-Mile Endurance Ride I and II, Antelope Island, Utah. Contact: Dian Woodward, 435-719-4033. April 17-18, 2010, Chicken Chase 50-Mile Endurance Ride I and II, Henryville, Indiana. Contact: Amy Wallace-Whelan. April 24, 2010, Texas Bluebonnet Classic 25-, 50-, and 100-Mile Endurance Ride, Decatur, Texas. Contact: Trish Dutton, 940-455-2849. April 25, 2010, Cheshire 26-Mile Competitive Trail Ride, Unionville, Pennsylvania. Contact: Kim Colket, 610-933-7074. April 24-25, 2010, Ride Like A Fool 50Mile Competitive Trail Ride, Swanton, Ohio. Contact: Cathy McClure. 419-622-4041. MAY May 1, 2010, Biltmore Challenge 50-, 75- and 100-Mile Endurance Ride, Asheville, North Carolina. Contact: Cheryl Newman, 828-665-1531. May 1-2, 2010, Washoe Valley I and II 50-Mile Endurance Ride, Carson City, Nevada. Contact: Connie Creech, 775-882-6591. May 1-2, 2010, MNDRA I 50- and 25-Mile Endurance Ride, Orrock, Minnesota. Contact: Theresa Meyer, 763-753-5236. May 5-9, 2010, Mt. Carmel XP I, II, III, IV and V 50-Mile Endurance Ride, Mt. Carmel Junction, Utah. Contact: Dian Woodward, 435-719-4033. May 7-8, 2010, SAAHA Las Cienega 25- and 35-Mile Competitive Trail Championship, Sonoita, Arizona. Contact: Marilou Mann, 520-762-0554. May 15, 2010, Hells Kitchen Canyon 25- and 50-Mile Endurance Ride, Gunnison, Utah. Contact: Dian Woodward, 435-719-4033. May 22, 2010, My Back Yard 50-Mile Endurance Ride, Princeton, Illinois. Contact: Jen Allen, 815-303-1958. May 22-23, 2010, My Back Yard 25-Mile Competitive Trail Ride I and II, Princeton, Illinois. Contact: Jen Allen, 815-303-1958.


Calendar Of Events

JUNE June 5, 2010, Just Joe Crazy 50-Mile Endurance Ride, Gilroy, California. Contact: Becky Hart, 408-425-5860. June 5-6, 2010, Maplewood 50- and 25-Mile Endurance Ride, Pelican Rapids, Minnesota. Contact: Charlotte Tuhy, 701-526-3734. June 11-12, 2010, Distance Round Up 30-Mile I and II and 50-Mile Endurance Ride, Oneida, Tennessee. Contact: Eric Rueter, 865-986-5966. June 13, 2010, Distance Round Up 40-Mile Competitive Trail Ride, Oneida, Tennessee. Contact: Eric Rueter, 865-986-5966. June 12, 2010, NASTR 50- and 75-Mile Endurance Ride, Dayton, Nevada. Contact: Connie Creech, 775-882-6591. June 12, 2010, The Pyramid Challenge 50-mile Endurance Ride, Lexington, Kentucky. Contact: Trisha Blackwell, 803-459-6501. June 18, 2010, Southeast MN 30-Mile Competitive Trail Ride, Preston, Minnesota. Contact: Dianne Schmidt, 507-545-9936. June 19, 2010, Southeast MN 50-Mile Endurance Ride, Preston, Minnesota. Contact: Dianne Schmidt, 507-545-9936. June 18-20, 2010, Strawberry Fields Forever 55-, I 50- and II 50-Mile Endurance Ride, Strawberry Reservoir, Utah. Contact: Dian Woodward, 435-719-4033. June 19-20, 2010, Prairie Smoke I and II 30-, 50-, and 75-Mile Endurance Ride, Bismark, North Dakota. Contact: Debbie Kolegraf, 701-258-6347. June 26, 2010, Zumbro Bottoms Boogie 50- and 75-Mile Endurance Ride, Theilman, Minnesota. Contact: Beth Lecy, 507-584-2237.

June 27, 2010, Zumbro Bottoms Boogie 30Mile Competitive Trail Ride I and II, Theilman, Minnesota. Contact: Beth Lecy, 507-584-2237. June 26-27, 2010, Hopkins Creek 50-Mile Endurance Ride I and II, Manton, Michigan. Contact: Dennis Byard, 231-645-4642. JUNE July 2-3, 2010, Endless Valley 50-Mile I and II and 100-Mile Endurance Ride, Spring Green, Wisconsin. Contact: Jill Feller, 920-387-5732. July 2-4, 2010, Endless Valley 25-Mile Competitive Trail Ride I, II, and III, Spring Green, Wisconsin. Contact: Jill Feller, 920-387-5732. July 9-10, 2010, Endure For The Cure 50-Mile Endurance Ride I and II, Washington, Illinois. Contact: Christopher Power, 217-648-2974. July 9-11, 2010, Endure For The Cure 25Mile Competitive Trail Ride I, II, and III, Washington, Illinois. Contact: Christopher Power, 217-648-2974. July 24-15, 2010, Salamonie Sizzler 50-Mile Endurance Ride I and II, Andrews, Indiana. Contact: Bev Staats, 260-435-6222.

NATIONAL EVENTS July 24-31, 2010, Youth Nationals, Albuquerque, New Mexico. Contact: AHA, 303-696-4500. August 16-21, 2010, Canadian Nationals, Regina, Saskatchewan, Canada. Contact: AHA, 303-696-4500. September 21-25, 2010, Sport Horse Nationals, Nampa, Idaho. Contact: AHA, 303-696-4500. October 22-30, 2010, U.S. Nationals, Tulsa, Oklahoma. Contact: AHA, 303-696-4500.

NEED STALLION CARDS? Call ARABIAN HORSE TIMES for details

1-800-AHTIMES

INTERNATIONAL EVENTS June 19-20, 2010, Mediterranean Championships, Menton, France. Contact: Christianne Chazel, 33-674-513448, chazel.c@wanadoo.fr; www.mentonarabianhorseshow.com August 6-8, 2010, 32nd Polish National Championship Show, Janow Podlaski Stud. Contact: 48-22-8606539, astojanowska@anr.gov.pl September 24-26, 2010, All Nations Cup and German National Show, Aachen, Germany. Contact: VZAP, 49-5113881180, info@vzap.org; www.vzap.org October 21-24, 2010, El Zahraa National C Show and 13th International Championships, El Zahraa, Egypt. Contact: Ahmed Hamza, 202-22983733, info@elzahraa-stud.org; www.elzahraa-stud.org December 4-5, 2010, Chilean Breeders Cup. Contact: M. Trinidad Del Campo, tdelcampo@achcca.cl December 10-12, 2010, World Championships, Paris, Nord Villepinte. Contact: Alice Wermus, alice.wermus@comexposium.com December 16-18, 2010, 7th Sharjah National Arabian Horse Festival, Sharjah, UAE. Contact: 971-65311155, frsan@emirates.net.ae; www.forsanuae.org.ae *Go to www.arabianessence.com or www.ecaho.org, for additional international shows and information.

BEAUTIFUL, HIGH TROTTING ENGLISH HORSES Good Prices Due to Retirement Purebred Afires Heir 2-Year-Old Colt Purebred IXL Noble Express 6-Year-Old Gelding Half-Arabian Allience Gelding

BILL ROBINSON ARABIANS

828-665-1955 or 828-768-1053

www.ahtimes.com APR IL 2010| 205


FRIERSON’S CUSTOM RIDING APPAREL

Didn't make our Spring Fling?

Saddle Suits from $

895

Frierson Atkinson

You are always welcome to visit Varian Arabians and see why we are the #1 LEADING BREEDER of National winners.

Located in the Asheville area of Western North Carolina

1-800-225-6419 11926 W. Southern Ave. Tolleson, AZ 85353

New foals arriving daily! Don't miss the Summer Jubilee August 6,7 & 8th

"We Specialize in Your Hay Needs"

VARIAN ARABIANS

Mike Perez Jr.

805-489-5802

Vice President of Sales & Distribution

Arroyo Grande, CA

2010 ďŹ lly Jullyen El Jamaal x Sweet Silk V

P: (623) 936-4339 C: (602)-684-4451 F: (623) 936-7360 mike@wesellhay.com www.wesellhay.com

R.O. LERVICK ARABIANS NS S Home of Cytosk+++ & Out Of Cyte yte e Halter & Performance Horses For Sale e

www.VarianArabians.com

Roger & Linda Lervick Dennis Wigren - Manager/Trainer P.O. Box 699 Stanwood, Washington 98292 t E-mail: cytosk@whidbey.net Web site: www.rolervickarabians.com

P & S ENTERPRISES INC.

  "!' $ #

&%( #

%!    ) !""  ((#" )""  !" "$#" ) %& '#!"

Odds are you’re spending too much for the wrong coverage. Find out your options. Mary Blincoe Sypolt

  %!  !

SYPOLT Insurance Services, Inc. 1-800-995-4770 ext. 202 or cell: 916-952-5244 e-mail: marysypolt@sisins.com

1-800-962-5057 License OD10217

"# &&& "#  ""# "# 206 | AR ABIAN HORSE TIMES


IRISH BORN & RAISED! Purebred Arabian Horses Young stock for sale - Reasonably priced Photo: Zygmunt (*Ganges x Zuzanna)

Mrs. Mickey Hegg Bordwin, Mountrath, Co. Laois, Ireland mickeyhegg@aol.com Cell: 353-87-6937634 • Home: 353-57-87-56435

TUBOEJOH!BU!TUVE!///

!Tqfmmdbtufs

IM

Uif!Dijfg!Kvtujdf!y!O[!Tjmwfs!Bmjdjb-!cz!Obuf{ Tjsf!pg!Obujpobm!Dibnqjpot Obujpobm!Tipx!Ipstf!'!Csffefst!Txffqtublft!Opnjobufe!Tjsf

IFBSUMBOE!WFOUVSFT-!MMD Cbmujd-!TE!ÂŚ!716.654.6:11!ÂŚ!ifbsumboewfouvsftAtwuw/dpn

The Hat Lady dresses Champions The Hat Lady has the hats you need and MORE! Western Hats, Derbies, Homburgs and Snapbrims. Custom hats. Top hats, hunt caps and helmets. Hat carriers: single and multiple. Ultimate Show Apparel by Diane Olsen. Frank Principe Silver Bits. AHA OďŹƒcial Championship Jackets.

AND

BREEDINGS

AND

HORSES FOR SALE

Owned by: Maroon Fire Arabians, Inc. Standing at: Shea Stables ~ 1925 Bartlett Rd., St. Clair, MI 48079

(810) 329-6392 ~ www.AďŹ reBeyV.com

Terri Deering 27754 197 Ave. SE Kent, WA 98042 800-549-0886 Fax: 253-630-0193

Champion Show Horse For Sale. Visit me online: www.thehatlady.com E-mail: herhatness@aol.com

arabians

STONECREEK Breeders of exceptional English Pleasure horses. Multi-National winning breeder. Full siblings to National winners and young prospects available.

Call Carrie for your DVD at 248-563-4373 www.stonecreekarabians.com

0AY *AY !RABIANS

We offer: Lowest Rates Immediate Coverage

0URE0OLISH!RABIANSWITHRACINGANDSHOWBLOODLINES

"EAUTIFUL!THLETIC #LASSIC0OLISH!RABIANS !VAILABLE&OR3ALE

Loss of Use & Fertility Premium Financing

The Agency Where YOUR Needs Come FIRST! Our Business: Insurance

*OHN#HARLOTTE9ATES /WNERS   OF½CE   RANCH 0/"OX !RTESIA .-

God's Business: Assurance - I John 5:13 830 G Street, Geneva, Nebraska 68361

Call Bob Wilkins

800-826-9441 bob@wilkinslivestock.com www.livestockinsurance.biz

APR IL 2010 | 207


Enter your most classic horse ever owned, past or present, in the Arabian Horse Times’ MOST CLASSIC ARABIAN CONTEST.

Win a color, in-depth story on you and your farm. All entries will be published in the JUNE issue of Arabian Horse Times. ENTER MORE THAN ONCE; ENTER MORE THAN ONE HORSE. DEADLINE: May 8, 2010 $100 ENTRY FEE PER PHOTO

Visit ... www.ahtimes.com For accuracy, all copy must be typed or printed legibly.

Horse Name _____________________________________________________________

E PL

AD

AM

S

Sire _____________________________ Dam _________________________________ Sex _____________________________ D.O.B. ________________________________ Owner Name ____________________________________________________________ Farm Name ______________________________________________________________ Address _________________________________________________________________

HORSE’S NAME

_________________________________________________________________________

Sire x Dam D.O.B. - Sex - For Sale or at stud? Owned by:

Phone ___________________________ Fax __________________________________

Name

FARM NAME

For Sale _________________________ Standing at Stud _______________________ If mare - IFT _______________________________________________________________ (Due to space limitations, only information requested will be included.)

Address, phone Complete the contest form and send along with color photo and payment to Arabian Horse Times. ($100 entry fee per photo) Digital images accepted — supply in jpeg format (300 dpi). E-mail to: jaytee@ahtimes.com. Credit card number _______________________________________________________ Name on card ____________________________________________________________ Exp. date ________________________________________________________________

299 Johnson Ave. - Suite 150 Waseca, MN 56093 507-835-3204 • 507-835-5138 fax

www.ahtimes.com 208 | AR ABIAN HORSE TIMES

Signature ________________________________________________________________

The winner will be selected by the staff of the Arabian Horse Times.


Arabian Horse Times offers one of the most economical and effective ways of promoting your breeding stallion …

National Champion p Stallion • AHA Breeders Sweepstakes Nominated Sire Ruminaja Ali *Ali Jamaal Heritage Memory Jullyen El Jamaal Ludjin El Jamaal Jullye El Ludjin *Nv Justa Dream

*Padron Padrons Psyche Kilika NW Shantelle Bey Shah+ NV Shanteuse GA Ryna

Stallion CARDS

Trained by and Standing at: Dawson, IL 217.364.4354 info@randysullivan.com Owned by Lynn Packer, Palos Heights, IL

Scottsdale S c Champion and U.S. National Top Ten

Ruminaja Ali Anaza El Farid Bint Deenaa Gazal Al Shaqab Kaborr+++ Kajora *Edjora++ Marwan Al Shaqab Bey Shah+ Fame VF+ Raffoleta-Rose Little Liza Fame Aza Destiny Katahza Afhar Rahza Marwan Al Magnifficoo *Aladdinn Aladdinn Echo Gaamara Echo Magnifficoo AN Magno+++/ S S Magnolia SS Soufianna Pacific Echo Patron *Padron Odessa Rosebud SS LA Basque+++/ Mar La Basque+ Marhaba Safina

Owned by: David Zouch Ross Lancefield, Australia 61-35-429-1467

Multi-Program Nominated SCID Clear Stud Fee: Private Treaty

Shaikh Al Badi Bint Magidaa *Ansata Ibn Halima *Deenaa *Naborr Bint Kholameh Exelsjor Edessa Bay El Bey Star Of Ofir

Now available in quantities of

Raffon Leta Rose Azraff Bint Bass Hisan Al-Marah Radames Zakieh Nureddin Lalage Gamaar Gazonia *AN Malik CC Montessa *Soufian Annaborr Aswan Podruga Bright Wings Serinda *Bask Habina Safinat Afnas Rhoda

Standing at Shada, Inc. 22630 Sugar Bush Road Elk River, MN 55330 Phone: 763-441-5849 Fax: 763-441-3060 www.ShadaArabians.com

250 500 1,000 2,000

Call or e-mail today for pricing and turnaround time. 1-800-248-4637 Kandi Menne ~ Mike Villaseñor ~ John Diedrich kandi@ahtimes.com mikev@ahtimes.com johnd@ahtimes.com

w w w. ah tim e s.c o m APR IL 2010 | 209


High Impact Advertising

Custom

Farm

BROCHURES ~No Job Is To Big ~Award Winning Design ~The BEST Customer Service 1-800-248-4637 w w w. a h t i m e s .c o m 210 | AR ABIAN HORSE TIMES


24/7 www.ahtimes.com

APR IL 2010| 211


The Arabian and Half-Arabian Futurity Continues To Impress At The 55th Scottsdale All-Arabian Horse Show by Barbara Anderson

I

t was all about families during the Sixth Annual Arabian and Half-Arabian Futurity Classic, when both human and equine families teamed up to win bragging rights and take home the money. It took a team effort, as the competition was tougher than ever at this year’s show.

All In The Family The family connection was never more apparent than when Nathan Kent won the $50,000 Arabian Reining Futurity Classic, riding Noble Fantasy (Vaguely Noble x SH Sharloni) for family-owned Sage Hill Arabians of Malad City, Idaho. “We have been producing reiningand working cow-type horses since we started in 1984,” says proud dad, Dave Kent. “It is great we are able to do this as a family. We are having a ball and hope this is just the beginning.” The Kent family has understood the importance of breeding from the beginning. “Although we are fairly new to the show world, we have been involved with Arabian horses for some time,” continues Kent. “I have always admired those breeders who had a vision of what they wanted to produce and were not swayed by the trend of the day. I hope we can be counted in that group.” Nathan had stiff competition from his younger brother Preston, who also had a good showing at the event.

212 | AR ABIAN HORSE TIMES

Second place was awarded to Brian Welman, riding Slide N Style (Black N Style x Marliera) for Dick Ames and Cedar Ridge Arabians of Jordan, Minn. Arabian breeder and long-time supporter of the Arabian and Half-Arabian Futurity Tom Redmond, of Wolf Springs Ranch, and NRHA trainer Tyson Randle took home the “big check” in the $80,000 Half-Arabian Futurity Classic, with Randle aboard TR Skid Mark (Zee Mega Bucks x Chics Flip). When asked about this product of his farm’s well-designed breeding program, Redmond commented, “Our program has been in place for over six years with our main focus on producing competitive Half-Arabian reining horses. I have to give a lot of credit to Tyson Randle, as he was very instrumental in constructing our program. I think we have proven we can produce some good quality reining horses. Hopefully, other breeders in the Arabian industry will follow. With the success of the Futurity Reining, there is a demand for talented horses.” Wolf Springs Ranch not only bred the Half-Arabian Champion TR Skid Mark and Reserve Champion TR Cockadoodledoo (Jaborrs Impack x Roosters Julie), ridden by NRHA trainer Crystal McNutt, but also the Non-Pro Futurity Champion and Reserve Champion as well.


“The Arabian and Half-Arabian Futurity has really changed over the last six years,” said trainer Tyson Randle after his win. “The horses, trainers and riders are competing at a higher level of difficulty every year. There were some great horses in the finals, and any one of them could have won. It feels great to finally win after competing for the last six years.” In addition to the nice paychecks, both the purebred and Half-Arabian champions were awarded Dale Chavez saddles (donated by Eleanor’s Arabians, Nymeyer’s Tack, and Dale Chavez), champion buckles, and The Lawson Bronze, donated by the Arabian Reining Horse Association (ARHA). For the second year in a row, Jennifer Murrell won the Purebred Limited Open Class riding Aantonina SF (Aabsolut x EE Karmel), and NRHA trainer Abby Cosenza won the competitive Half-Arabian Limited Open Class, riding Chex My Ref lection DF (Skeeter Chex DF x LTF Ref lection).

Non-Pro Futurity Off To A Great Start Some great rides were seen during the inaugural Non-Pro Futurity. Coached by her sister Crystal, Cotton McNutt rode No Dough (Merlann x Spring Wynd) to the first place win in the purebred class. The Half-Arabian Non-Pro winner was Lauren Bailey-Pollard, riding the Wolf Springs Ranch-bred TR Brace For Impack ( Jaborrs Impack x Oakachic). Besides trophy buckles and cash, both Cotton and Lauren took home Bob’s Custom Saddles which were donated by sponsor Marshall Kyle and Kyle’s Tack.

Big Changes Underway For The Non-Pro Derby Over the last three years, the Non-Pro Derby has become a great class to compete in and to watch, and it promises to get even more so. Reining enthusiast Tim Anderson, owner of Amani Arabians, Milbank, S.Dak., has volunteered to sponsor the class for the next four years, adding $20,000 to the popular event’s payout. “Last year, when Dick Ames, Tom Redmond and Joe Betten came to the ARHA club and asked us for ideas,” he explains, “I immediately thought of the

Non-Pro Derby. If I were to guarantee a $20,000 minimum purse for the next four years, I thought to myself, I’ll bet that would make the Half-Arabian Non-Pro Derby a lot more interesting. Now, my hope is that the increased payout will stimulate the market for futurity-turned-amateur horses, which in turn will strengthen Futurity Classic entries. The added $20,000 should also contribute to the HalfArabian Non-Pro Derby’s prestige and credibility.”

Where To From Here? This year’s event included the first-ever Celebrity Slide, which paired reining trainers with trainers in other disciplines. The dynamic teams were: Eric Krichten/Brian Welman, Vicki Humphrey/ LaRae Fletcher Powell, Joel Kiesner/Tyson Randle, Carmelle Rooker/John O’Hara, Andrew Sellman/ Russ Brown, and Jim Stachowski/Crystal McNutt. Carmelle Rooker and Vicki Humphrey tied for first place, and following a run-off, Carmelle walked away with the buckle. A sold-out barbecue preceded the event and plans are underway for next year’s Celebrity Slide. After six successful years, the Arabian and HalfArabian Reining Futurity continues to do well. With the inclusion of new events such as the Celebrity Slide, corporate and patron sponsors, the generous support of Tim Anderson, successful breeding programs and a great venue, this show will continue to f lourish. The Futurity Classic is an NRHA-sanctioned event, open to 4- and 5-year-old horses. The top one-third highscoring horses from two go-rounds advance to the clean-slate final. The Futurity Classic is held during the annual Scottsdale Arabian Horse Show. ■

APR IL 2010 | 213


M INNESOTA A RABIAN

JOIN US AND HELP SHAPE THE FUTURE OF THE ARABIAN BREED.

HORSE B REEDERS , INC . 214 | AR ABIAN HORSE TIMES

• • • • •

The Original Founded On Vision & Integrity Over 28 Years Strong Financially Successful Creating Tomorrows Tradition Through Today's Innovation

WWW .M EDALLION S TALLION . COM


BREED TO ONE OF THESE MEDALLION STALLIONS AND BE ELIGIBLE TO SHOW AT THE MINNESOTA FALL FESTIVAL! KM BUGATTI (Versace x Sanegors Lady D) LEGACYS RENOIR (Legacy of Fame x SC Psavannah) LM BOARDWALK (*Padron x RK Forever Amber) MAG K NITE (Magnum Chall HVP x TF Subroukapsyche) MAGNUM CHALL HVP (Magnum Psyche x Taamara HVP) MAGNUM PSYCHE (Padrons Psyche x A Fancy Miracle) MAMAGE (Zodiac Matador x CF Fire Magic) MANCINI BEY SMF (Brandon Bey JCA x Marrissah) MARHAABAH (*Marwan Al Shaqab x Shalina El Jamaal) MARIACHI WA (Baske Afire x Brooklyn Bey) MARJESTIC WA (Marwan Al Shaqab x Miraga WA) MARWAN AL MAGNIFFICOO (Marwan al Shaqab x Pacific Echo) MASERATI WR (Marwan Al Shaqab x Aristokayte) MASQUERADE PA (Armani FC x Cazsandra) MAZKARADE (Dakar El Jamaal x Majalis) MCA PRINCE MARWAN (Marwan Al Shaqab x MCA Eternal Secret) MILANO LRA (Parys El Jamaal x TF Klassica) ML MOSTLY PADRON (Padrons Psyche x HS Mostly) MMONSIGNOR (Justify x Liza Monelli) MPA GIOVANNI (Da Vinci FM x Glitzy) MR AMES CRF (Brass x Toi Jabaska) NOBLE WAY (IXL Noble Express x Chamorrita Afire) NYN HISANI (Marwan Al Shaqab x NYN Imara Versace) ODYSSEY SC (Versace x Latoura Echo) OMEL FIRST DREAM (Dreamcatcher SMF x Om El Jimala) PA SCIMITAR (Magnum Psyche x MA Unique) PARYS EL JAMAAL (Ali Jamaal x FF Pavielle) PPROVIDENCE (Echo Magnifficoo x Bey Amore) PS ANDIAMO (Marwan Al Shaqab x Sidcerelys Echo) PYRO THYME SA (Pryme Thyme x Holly Onfire JW) RADAAR LOVE (Shahir IASB x Semply Irazistabl) RAZCAL BEY (Bravado Bey V x CA Rufflesnlace) RHR MARCEDES (Marwan Al Shaqab x Ellegant Dream) ROUGH JUSTICE (WH Justice x Nadjana Bint Nadir) RSA TROUBLESOME (Sirius Trouble x TF Psyches Angel) SELKET MARQUE (Marwan Al Shaqab x Selket Khamala) SF SPECS SHOCWAVE (Afire Bey V x Spectra PR) SF VERAZ (Gazal Al Shaqab x Veronica GA) SHADDOFAX (Justafire DGL x R-Colette) SHER KHAN AC (MCA Magnum Gold x SD Mimosaa Bey) SIR FAMES HBV (Ffamess x Cajun Lady HCF) SIRIUS TROUBLE (VA Sirius x Chaunceys Uh Huh) SOLSTICE (*Salon x *Passionate) STIVAL (Gazal Al Shaqab x Poloma De Jamaal) SUNDANCE KID V (Desperado V x Sweet Shalimar) TAF PENNANT (Piechur x Enna) THEE DESPERADO (The Minstril x AK Amiri Asmarr) TR ALADA LEGACY (Legacy of Gold x Alada Roses) UPTOWN FIRE (Le Fire x Uptown Gal) VCP MAGNIFIRE (Afire Bey V x RY Fire Ghazi) ZEFYR (Sundance Kid V x Pattrice) ZIMMERON PGN (Shah Azim x Mimis Memory) Subject to change without notice.

WWW .M EDALLION S TALLION . COM

HORSE B REEDERS , INC .

*KORDELAS (Monogramm x Kabala) A NOBLE CAUSE (IXL Noble Express x Sweet Summer Fire) A TEMPTATION (Tempter x A Love Song) ADONIIS (Baske Afire x Coladina) AFFIRMMED (Magnum Psyche x Shimmering Star B) AFIRES VISION (Afire Bey V x Matoskette) ALI EL DIN (Ruminaja Ali x Heritage Memory) AMES CHARISMA (Magnum Psyche x Ames Mirage) AMIR JAMAAL (Ali Jamaal x Luz De Fe) ARIA IMPRESARIO (*Marwan Al Shaqab x GC Echlectica) ARMANI FC (Eternety x Aires Bey) ART DEKKO TT (Audacious PS x HC Amareea) AUDACIOUS PS (Fame VF x Hal Flirtatious) BAAHIR EL MARWAN (Marwan Al Shaqab x HB Bessolea) BARRITZ SF (FS Ritz x ZBA Fire Foxx) BASKE AFIRE (Afire Bey V x Mac Baske) BESSON CAROL (Parys El Jamaal x Classic Krystall) BEY AMBITION (Regal Actor JP x Bey Shahs Lady) BH TORINO (Pimlico RCA x Galianna RCA) BRANDON BEY JCA (Versace x Hushahby Bey) BRIXX IA (Gazal Al Shaqab x Bella Versace) CAIROS (Psymadre x LB Khourojable) CARNEGIE D (Besson Carol x Calamity Fame) CL SOLMATE (Solstice x MSU Beloved) COUTURIER (Versace x Evening Intrigue) CROWN MUSC (*Muscat x Crown Juel) DAKAR EL JAMAAL (Ali Jamaal x Sonoma Lady) D’CAPRIO PA (Magnum Chall HVP x Diva Girl) DON DE BASK (Don Ibn Bask x Staley High Cheri) DS MAJOR AFIRE (Afire Bey V x S S Magnolia) EF KINGSTON (Padrons Psyche x The Dreamspinner) ENZO (Padrons Psyche x RD Bey Shahmpane) ETERNETY (Sharem El Sheikh x Tomboy) EVER AFTER NA (Sir Fames HBV x Entaicyng NA) EVG GENTRY (*Pershahn El Jamaal x Gisele) FIRST CYTE (Out of Cyte x ROL Wild Flower) FM ECHOTA (Versace x Latoura Echo) FS RITZ (Padrons Psyche x WA-Miss Shasty) GEMINI VII (Legacy Of Fame x Precious Legacy) GEORGIO AF (Versace x Fortunes Ciara) GH MARYN (NYN Hisani x Enjoue) GIACCOMO (Marwan Al Shaqab x G Shamaal) HEIR TO GLORY (Heritage Emir x NDL Esperanza) HESA ZEE (Xenophonn x Somthing Special) HEY HALLELUJAH (Huckleberry Bey x Hallelujah Bask) HJ FAMOSO (Magnum Psyche x Poetry SMF) ITS SSHOW TIME (Showkayce x Mystic Heirloom) IXL NOBLE EXPRESS (MHR Nobility x RY Fire Ghazi) JULLYEN EL JAMAAL (*Ali Jamaal x Jullye El Ludjin) JUSTIFY (Magnum Psyche x S Justadream) JUSTTICE (Justify x Afire Storrm) KARAS ALADA PRIDE (Alada Baskin x Karas Shirgay) KHADRAJ NA (*Ponomarev x Khatreena NA)

M INNESOTA A RABIAN

THE BEST OF THE BEST CALL THEMSELVES MEDALLION STALLIONS

APR IL 2010 | 215


Online Horse Auction 1

2

A SIMPLE, INEXPENSIVE

WAY TO SELL HORSES AT FAIR MARKET VALUE.

For one low price your lot will include: • Photo of your horse • Description of your horse up to 150 words • Video of your horse up to 1 minute

Lots will be limited to 25. D e a d l i n e M o n d a y, M a y 3 r d , 2 0 1 0 AHT Online Horse Auction 2 goes LIVE Monday, May 24 to Monday, May 31.

Call for details today!

1-800-248-4637 Mike Villaseñor

Kandi Menne

John Diedrich

mikev@ahtimes.com kandi@ahtimes.com johnd@ahtimes.com

216 | AR ABIAN HORSE TIMES


AHT, Inc. Online Auction 2 Registration Form (ARABIANS

AND

HALF-ARABIANS ONLY!)

BE SURE TO FILL OUT THE FOLLOWING REQUESTED INFORMATION ACCURATELY AND COMPLETELY.

Name of Horse:_________________________ Sire:__________________ Dam: ____________________ Registration #:___________ Age:____ Sex:________Color: ________ Purebred [ Reserve Price: $_______________ (All lots will start at $1,000)

] Half-Arabian [

Buy Now Price: $ _________________

Description (150 words):

C ON TAC T INFO R M ATIO N

Name:_____________________________________ Farm Name: ___________________________________ Address:________________________City:____________ State/Provence:________ Zip/Postal Code: ________ Phone:_____________________ Mobile:_____________________ E-mail: ___________________________ PAYMEN T

Credit Card Number:____________________________________ Exp. Date:_____ / _____ Security Code:________ Name on Card: ______________________________ [

] I have read and accept the AHT, INC. USER AGREEMENT

Date: ______________________

Call to request copy of user agreement.

Price per lot is $200. Purchase four lots, get a 5th lot free. Each lot can consist of 1 PHOTO, a 150-word DESCRIPTION, and a 1 minute VIDEO of the horse. Video must be supplied in web-ready format (ex: .mp4, .mov, or .avi) no larger than 100 MB. (No stallion services or embryos!) AHT, Inc.’s Online Auction 2 starts at 12:00 P.M. (CST), May 24, 2010, and ends May 31, 2010, between 12:00 P.M. and 2:00 P.M. (CST). Bidding increment is $100.

All materials need to be at Arabian Horse Times, 299 Johnson Avenue S.W., Suite 150, Waseca, MN 56093 no later than May 3, 2010. AHT, Inc. is not responsible or liable for any transactions between sellers and buyers of this auction. We are not auctioneers, but provide an auction-style venue that facilitates commerce between interested parties.

Questions? Call 800-248-4637 Fax 507-835-5138 APR IL 2010 | 217

]


“Let The Good Times Roll!” IN THE SOUVENIR HARD COVER

YOUTH YEARBOOK Contender ads, interviews, news, and youth profiles.


YOUTH NATIONALS 2010 T HE ME

Mardi Gras June Advertise your YOUTH NATIONAL CONTENDERS IN

to be part of the Youth Yearbook.

Special ad rates & editorials offered. DEADLINE FOR PAGE RESERVATION

May 15, 2010.

Call 800-248-4637 or e-mail your ad reservations attions today! today! Kandi Menne kandi@ahtimes.com

John Diedrich johnd@ahtimes.com om

M Mike ike V Villase単or illase単or mikev@ahtimes.com m ikev@ahtimes.com

APR IL 2010 | 219


LOOKING AHEAD JUNE 2010 YOUTH NATIONALS PREVIEW Advertise your Youth Nationals contenders in June and be a part of our annual collector’s edition, hardbound Youth Yearbook. All Youth National advertisers who place Top Ten or better at the Youth Nationals will be eligible for great discounts in the Youth Nationals coverage issue.

REGION 7 Full regional show coverage and directory, PLUS Ads that get seen all year!

7

REGION 12 Full regional show coverage and directory, PLUS Ads that get seen all year!

HALTER TRAINERS AND CONTENDERS FEATURE Featuring the breed’s best and brightest halter trainers and their show strings for the coming season. All full-page color advertisers will be included in our editorial feature.

w w w. a h t i m e s . c o m 220 | AR ABIAN HORSE TIMES


LOOKING AHEAD JULY 2010 WESTERN PLEASURE The art of being a cowboy.

SPORT HORSE NATIONALS PREVIEW Form to function at its finest.

IOWA GOLD STAR ARABIAN HORSE SHOW It’ll be like Lil’ Chicago in Des Moines. Featuring nominated sires, contenders and horses for sale, and gangsters of all ages. Get with the program and get your hands on some of the loot! 2010

OHIO BUCKEYE Where National Champions are made. Full show coverage.

CANADIAN NATIONALS PREVIEW Well over 80% of previous Canadian National winners advertised in the July issue.

w w w. a h t i m e s . c o m APR IL 2010 | 221


THE BEST WAY TO PREDICT THE FUTURE IS TO HELP CREATE IT

2008 Champion HA Sahara Afire

+

$20,000

2009 Champion Noble Halo

In Prize Money Awarded Each Year

THE FUTURE OF ENGLISH PERFORMANCE

Starts Here AEPA Yearling In-Hand Futurity FRIDAY NIGHT

2010 Buckeye Sweepstakes May 27-30, 2010

2010

WWW .A RABIAN E NGLISH P ERFORMANCE A SSOCIATION . COM

222 | AR ABIAN HORSE TIMES


Index Of Advertisers A Al-Marah Arabians .................................. 122 Ames Reining Horses........................123-125 Arabian English Performance Association ...222 Arabian Horse Galleries ............................... 5 Arabian Horse Times’ Farm Brochure ........ 210 Arabian Horse Times’ Most Classic Contest ...208 Arabian Horse Times’ Online Auction ... 216, 217 Arabian Horse Times’ Stallion Cards.......... 209 Arabian Horse Times’ Website ................... 211 Arabian Horse Times’ Youth Nationals ... 218-219 B Battaglia Farms......................................26, 27 Bennett Arabians ........................................ 65 Bill Robinson Arabians ............................ 205 Brian Welman Training Center .........126, 138 C Cedar Ridge Arabians, Inc.............................. ....................................24, 25, 44, 45, 100, 101 Chattooga Ridge Arabians, Inc..................... 7 Chestnuthill Arabians ...........................33-40 Crescent Creek Farms ................................ 85 E Eleanor’s Arabian Farm ................... 224, IBC Enchanted Acres ........................................ 41 F Freeland Farms ......................................22, 23 Frierson Atkinson ..................................... 206 Frizzell, Joe & Debbie ................................ 89 G Gemini Acres .................................FC, 50-57

H Haras Del Mar ......................................62-63 Haras Sahara .........................................42, 43 Heartland Ventures, LLC ......................... 207 Hegg, Mrs. Mickey ................................... 207 HorsePower Farms, LLC ........................... 64 I Iowa Gold Star ........................................... 87 J Jacobs, Linda & Bill ................................... 88 John White Stables..................................... 84 K Kiesner Training ....................................12, 13 M Maroon Fire Arabians, Inc............ IFC, 1, 207 McNamara Performance Horses .............. 138 Midwest................................ FC, 8-11, 50-57 Minnesota Arabian Horse Breeders, Inc......... ...........................................................214, 215 N North Arabians......................................... 2, 3 O Oak Haven Arabian Horse Farm ............... 86 Oak Ridge Arabians ..............................58-61 P P & S Enterprises, Inc. ............................. 206 Pay-Jay Arabians ...................................... 207 Pomeroy Arabians .....................................BC Premier Breeders Sweepstakes...........164, 165 Prestige Farms, LLC .............................30, 31

R R.O. Lervick Arabians ............................. 206 Rae-Dawn Arabians ..............................16, 17 Ranch of Cherry Creek ............................ 139 Rooker Training Stable............................... 32 S Shea Stables..........................................IFC, 1 Smoky Mountain Park Arabians ...........14, 15 Southwest Farm Services .......................... 206 Stachowski Farm, Inc................. 18-21, 46, 47 Stone Creek Arabians............................... 207 Stone Ridge Arabians ............................60-61 Stonehedge Farms, LLC .......................46, 47 Strands Arabian Stables ............................. 89 Strawberry Banks Farm .........................28, 29 Sypolt Insurance ....................................... 206 T The Brass Ring ......................................... 127 The Hat Lady ........................................... 207 The Xtreme Partnership ............................. 41 V Varian Arabians .............................66, 67, 206 W Whelihan Arabian Farms, LLC ................. 64 Wilkins Livestock Insurers, Inc. ............... 207 WindRiver Fence ..................................... 160 Wolf Springs Ranches .......................118-121 Z Zerlotti Equine......................................42, 43

www.ahtimes.com

APR IL 2010| 223


By Xenophonn out of Somthing Special, Hesa Zee+/ is a Reserve National Champion and sire of National Champions and reiners that have won over $100,000 in the ARHA Arabian and HA Scottsdale Reining Futurity Classic, as well as the Hesa Zee+/ Futurity.

Hesa Zee+/ and Eleanor Hamilton


Spring Sales Offering Leading Sire for the 12th year in a row!

Winner of the Arabian Horse Times 2009 Readers' Choice

Zee Fire Dancer CMS Brownie Hesa Zee+/ x Fire Musc by Crown Musc+ 2006 Bay Arabian Mare Her siblings have been US Reserve National Champion Reining Futurity, Scottsdale Futurity (4th), and Regional Winners. Her dam has many reining Youth and Canadian National Top Ten awards. Sweepstakes.

Crown Musc+ x Chex Ten San (AQHA) 2007 Bay Half-Arabian Gelding Well started under saddle, he lopes, circles, stops, rates well, is quiet and national quality. A Scottsdale Futurity candidate! Crown Musc+ is the sire of national reining winners. Sweepstakes.

Sire Of The Year Award.

CMS Super Chick Palomino Filly Crown Musc+ x Super Cindy Brick (AQHA) 2004 Chestnut Half-Arabian Mare Tall, very well-bodied mare. Can carry a big man and make it a pretty picture. Shown western. Will be a superb amateur horse. Sweepstakes.

CG Colonel Jac (AQHA) x Zee Precious Gem 2010 Palomino Half-Arabian Filly Gorgeous filly with partial low blaze and no other white. Bred and built to rein. A Standout. Full sister to the buckskin being shown by Gary Ferguson. Sire: NRHA $10,000 earnings. Sweepstakes

above: Zee Fire Dancer right: CMS Super Chick far right: reference sire, CG Colonel Jac

Eleanor Hamilton, Owner Rogers, Minnesota Rod Matthiesen, Trainer Mark Coombs, Breeding Manager

763.767.1381 1.800.328.9923 www.EleanorsArabianFarm.com


Add some “Hi-Lights” to your breeding program ...

Appri rill 20 2010 10 $7.5 7.500

www.ahtimes.com

STANDING AT:

ARABIANS INTERNATIONAL

Magnum Psyche x MA Unique, by Bey Shah • Multi-program Nominated • SCID clear

Proudly owned by John Nord, Bloomington, IL For breeding information contact trainer João Rodrigues 480.889.4393 • www.PomeroyArabians.com judith photo

April 2010

PA Hi-Countessa (PA Hi-Noon x La Countesa)

Arabian Horse Times April 2010  
Arabian Horse Times April 2010  

Arabian Horse Times April 2010