Page 1

K O R A N

KPKPOS K O R U P S I

P O L I T I K

K R I M I N A L

JAKSA TAK KAPOK TERIMA SUAP

I

HAL

EDISI 176 / THN IV 28 NOP - 4 DES 2011 (TERBIT SETIAP SENIN) Harga Eceran (Kota Medan): Rp.2.500/eksemplar

Redaksi/Usaha: Jl T.A. Hamzah Komp. Ruko Griya Riatur Blok B 181 Medan

Penerbit : PT Karya Peduli Kebangsaan www.starberita.com

3

Proyek TK Negeri Hiliserangkai Terancam Gagal

BERANTAS KORUPSI - Spanduk yang bertuliskan Rakyat = Pemerintah Berantas Korupsi. Namun tekad ini hanya slogan, karena diduga masih ada oknum pejabat yang menyalahgunakan dana APBD untuk kepentingan pribadi. (KPK POK/DOK)

NIAS - Pembangunan gedung Taman Kanak-Kanak (TK) Negeri Hiliserangkai, Kecamatan Hiliserangkai, Kabupaten Nias, terancam gagal dibangun. Pasalnya, kini ada ancaman dan larangan dari pemilik/penghibah tanah. Seperti diketahui, dana pembangunan TK tersebut bersumber dari Dana Aloksi Umum (DAU) Tahun Anggaran (TA) 2011 senilai Rp283.260.000. Saat ini, pembangunan gedung TK itu sedang dikerjakan CV Nias Indah. Namun, karena ada ancaman warga penghibah tanah yang melarang kontraktor untuk bekerja, maka pembangunan gedung TK itu terkendala.

Direktur CV Indah Nias telah menyurati Pejabat Pembuat Komitmen (PPK) Dinas Pendidikan Kabupaten Nias tertanggal 21 November 2011 Nomor : 109/ CV.NI/XI/2011, tentang adanya gangguan dan larangan tidak boleh dikerjakan proyek TK tersebut dari pemilik tanah dengan alasan karena pihak pemborong belum menemui penghibah tanah. Selain kontraktor, Kepala Dinas Pendidikan Nias Drs F Yanus Larosa, pada 22 November 2011 lalu, telah mengirim surat kepada bupati tentang adanya ancaman dan teror dari pemilik tanah. <<< selanjutnya baca Hal. 2

Usut Penyelewengan di Labura LABURA - Usut sampai tuntas penggunaan dana P.APBD Tahun 2010 dan R.APBD Tahun 2011 di Kantor Badan Pemberdayaan Masyarakat Pemerintahan Desa dan Kelurahan (PMD/K) Pemkab Labura. Penggunaan dana tersebut diduga banyak yang fiktif dan mark-up alias KKN. Desakan ini disuarakan Drs. Halder Sinurat, Ketua Dewan Pimpinan Pusat Lembaga Swadaya Masyarakat Peduli Anak Bangsa (DPP-LSM PAB) Jakarta, bidang Inventigasi dan Komu-

nikasi. Lembaga ini mendesak Kejaksaan Tinggi (Kejati) Sumut dan instansi terkait lainnya agar segera mengusut dugaan mark-up dan KKN di kabupaten itu. Bentuk dugaan penyelewengan yang dilakukan, seperti penggunaan Anggaran P.APBD Tahun 2010 dengan No. Rekening 1.22.00.15.001 Pemberdayaan Lembaga dan Organisasi Masyarakat Pedesaan dengan belanja Rp287.572.500. P.APBD Tahun 2010 No. Rekening 1.22.01.15.002 Penyelenggaraan Pendidikan dan Pelatihan Tenaga Teknis dan Masyarakat dengan belanja Rp129.507.200. P.APBD Tahun 2010 No. Rekening 1.22.15.005 Pengelolahan Pengaduan Masyarakat Desa dengan belanja Rp81.000.000. P.APBD

Tahun 2010 No. Rekening 1.22.17.001 Pembinaan Kelompok Masyarakat Pembangunan Desa dengan belanja Rp338.249.000. P.APBD Tahun 2010 No Rekening 1.22.01.17.003 Pemberian Stimulasi Pembangunan Desa dengan belanja Rp400.691.000. P.APBD Tahun 2010 No Rekening 1.22.01.18.002 Pelatihan Aparatur Pemerintahan Desa dalam Pengelolahan Keuangan Desa dengan belanja Rp115.242.400, P.APBD Tahun 2010 No Rekening 1.22.01.18.003 Pelatihan Aparatur Pemerintahan Desa Dalam Manajemen Pemerintahan Desa dengan belanja Rp119.289.500. Selanjutnya, P.APBD Tahun 2010 No Rekening 1.22.01.18.005 Peningkatan Penghasilan Aparatur Pemerintahan Desa dengan belanja

Rp2.940.806.600. P.APBD Tahun 2010 No Rekening 1.22.01.18.001 Pembinaan Peranan PKK dengan belanja Rp142.514.500. Jadi dalam penggunaan P.APBD Tahun 2010 ini diduga ada yang fiktif dan ada juga tidak terealisasi. R.APBD Tahun 2011 No Rekening 1.22. 1.22.01.15.01 Pemberdayaan Lembaga dan Organisasi Masyarakat Pedesaan dengan belanja Rp315.000.000, R.APBD Tahun 2011 dengan No Rekening 1.22. 1.22.01.15.02 Penyelenggaran Pendidikan Masyarakat dengan belanja Rp140.057.200, R.APBD Tahun 2011 No Rekening 1.22. 1.22.01.15.04 Pengelolaan Pengaduan Masyarakat dengan belanja Rp219.400.000, R.APBD Tahun <<< selanjutnya baca Hal. 2

Bantuan Untuk Lansia Sei Penuh Ditelap

kolom redaksi

TRAGEDI PENONTON BOLA BETAPA sulit kita belajar dari kesalahan mengelola penonton sepak bola. Sudah berkali-kali suporter olahraga paling populer ini membuat ulah, tapi panitia dan petugas keamanan kembali lalai mengawal perhelatan sepak bola di Senayan. Pertandingan final sepak bola SEA Games XXVI pun memakan korban: dua orang tewas dan sejumlah orang terluka. Tragedi itu berawal dari ulah penonton tanpa tiket yang memaksa masuk ke pintu Stadion Gelora Bung Karno, Senin lalu. Petugas keamanan gagal menghalau mereka. Akibatnya, sejumlah orang terdorong dan jatuh. Mereka terinjak-injak, hingga dua di antaranya tewas. Sejumlah suporter sepak bola juga dirawat di rumah sakit karena terluka. Beberapa jam sebelum insiden itu, para penonton di Senayan sempat membakar loket penjualan tiket. Mereka marah karena tak kebagian karcis. Hal serupa terjadi Sabtu sebelumnya, saat Indonesia bertanding melawan Vietnam. Untunglah, dalam dua insiden pembakaran loket tersebut tak ada korban jiwa. Orang tentu mempertanyakan kemampuan Persatuan Sepak Bola Seluruh Indonesia mengelola penonton. Sebagai penyelenggara perhelatan tersebut, kenapa PSSI tidak meminta bantuan polisi dengan jumlah yang cukup untuk menertibkan penonton? Kepolisian pun tidak bisa lepas tangan. Sebab, mereka semestinya sudah bisa mengantisipasi insiden seperti itu. Baik PSSI maupun polisi tak bisa hanya menyalahkan penonton. Penonton yang cenderung berbuat anarkistis itu ada di mana-mana, bukan cuma di Indonesia. Di negara yang industri sepak bolanya sudah maju, seperti Inggris, Italia, atau Spanyol, pun dikenal hooliganism. Selalu saja ada penonton liar. Dalam

SEI PENUH - Sungguh keterlaluan. Bantuan untuk lanjut usia (lansia) yang dikelola Dinas Sosial Kota Sei Penuh ditelap oknum yang menangani bantuan ini. Seharusnya setiap lansia menerima bantuan Rp1,8 juta. Tapi bantuan yang sangat diharapkan orang-orang sepuh itu tak pernah diterima. Karena sudah tak tahan menerima penderitaan, maka lansia di Sei Penuh melakukan aksi di kota itu. Mereka mendesak agar Walikota Sei Penuh segera mengambil tindakan tegas. "Satu rupiah uang rakyat ditilep adalah korupsi. Tindakan tegas wa-

likota Sungai Penuh dan aparat penegak hukum sangat kami dambakan," begitu harapan sang lansia sembari meminta agar aparat hukum secepatnya menindak pelaku korup terhadap hakhak rakyat. Seperti dilaporkan, bantuan sosial bagi lansia, dikelola oleh Dinas Sosial Kota Sungai Penuh. Data yang diperoleh, tercatat pada pos dan giro cabang Sungai Penuh ada 33 orang lansia. Sedang di Lawang Agung tercatat 11 penerima bantuan sosial lansia. Sementara di Desa Batu Lumut tercatat 10 orang lansia penerima bantuan .

Dan di Tanjung Mudo tercatat 12 orang penerima bantuan sosial lansia. Namun, bantuan yang diharapkan tak pernah mengalir, sehingga para lansia, Selala lalu, melakukan aksi demo di Dinas Sosial Sei Penuh. Mereka (para lansiared), meminta walikota dan aparat hukum menindak oknum yang bermain-main terhadap bantuan itu. Seorang pendemo mengatakan, mereka tidak terima atas pemotongan bantuan bagi warga lansia di Tanjung Mudo. Dikatakan, seharusnya

DILARANG - Lahan pembangunan TK Negeri Hiliserangkai yang dipancang pemiliknya. (KPK POS/YG)

Penangkapan Kapal MV Golden Falcon Saigon Dipertanyakan DUMAI - Penangkapan Kapal Cargo MV Golden Falcon Saigon berbendera Vietnam oleh Satpol Air Dumai menimbulkan pertanyaan beberapa kalangan. Pasalnya, terjadi kotroversial dalam menjatuhkan sanksi hukum terhadap Nahkoda dan Kapal MV. Golden Falcon Saigon. Dalam pemeriksaan Bea Cukai Dumai dinyatakan; 'jika benar bersalah dijerat dengan pasal 102' UndangUndang RI No.17 Tahun

2006 tentang perubahan atas Undang-Undang No.10 Tahun 1995 tentang ke Pabeanan. Sementara itu, oleh Pengadilan Negeri (PN) Dumai menerbitkan surat Penetapan Penyitaan Dokumen Kapal MV. Golden Falcon Saigon sesuai surat No.416/ Pen.Pid/PN Dumai tanggal 26 Oktober 2011, dengan tersangka Bui Cong Ting alias Bui Quasang Tung warga Vietnam dikenakan pasal <<< selanjutnya baca Hal. 2

PELABUHAN - Terlihat suasana bongkar muat di dermaga pelabuhan Dumai. (KPK POS/ <<< selanjutnya baca Hal. 2

DOK)

Sejarah Kelam Pemberantasan Korupsi

<<< selanjutnya baca Hal. 2

BACA JUGA BERITA KPKPOS DI www.starberita.com

MEDAN - Sejarah pemberantasan korupsi di Indonesia sudah cukup panjang. Ketika lembaga tersebut mulai efektif dan menyentuh elit politik pembubaran pun dilakukan. Korupsi terus ada sepanjang kehidupan manusia. Upaya untuk memberantasnya, lantas mencatatkan sejarah panjang seiring dengan sejarah kehidupan itu sendiri. Pemberantasan korupsi di Indonesia menorehkan catatan yang sedikit suram. Pada masa Orde Lama, pemberantasan korupsi ini diperkuat dengan Undang Undang Keadaan Bahaya. Lembaga tersebut kemudian dikenal dengan sebutan Panitia Retooling Aparatur Negara (Paran). Paran dibentuk pada masa Kabinet Juanda dan dipimpin Jenderal AH Nasution dibantu dua orang yang juga berintegritas tinggi, yakni Prof M Yamin dan Roeslan Abdulgani. Akibat terjadinya kekecauan politik di masa itu, Paran berakhir tragis,

deadlock, dan akhirnya pelaksanaan tugasnya diserahkan kembali kepada Kabinet Juanda. Masih pada masa Orde lama, tahun 1963, Presiden Soekarno mengeluarkan Keputusan Presiden (Keppres) No 275 tahun 1963. Namanya cukup menggugah, yakni â&#x20AC;&#x2DC;Operasi Budhiâ&#x20AC;&#x2122;. AH Nasution yang saat itu menjabat sebagai Menteri Koordinator Pertahanan dan Keamanan/Kasab diberi <<< selanjutnya baca Hal. 2

DAN DENGARKAN ULASAN BERITA, SETIAP SABTU DI RADIO STARNEWS 102.6 FM


KPK POS

2

S AMBUNGAN

E D I S I 176 28 NOPEMBER - 4 DESEMBER 2011

PROYEK TK NEGERI HILISERANGKAI ...................dari hal 1

Selain melakukan teror, pemilik tanah mengancam kepala tukang agar tidak melanjutkan pekerjaan di lokasi proyek. Bahkan papan bow plank dan benang siku yang sudah dipasang ditempat galian jalur pondasi, dirusak pemilik tanah berinisial MW, seorang oknum anggota DPRD Kabupaten Nias. Selanjutnya, pemilik tanah memasang palang kayu dan tali plastik agar tidak diteruskan pekerjaan tersebut. Kepala tukang dari CV Nias Indah, A Lina Duha kepada KPK Pos kemarin, mengatakan bahwa pada awal Oktober 2011 proyek ini telah dilakukan pematokan oleh Dinas Pendidikan Kabupaten Nias dihadiri ibu kandung penghibah tanah Fatiria Mendrofa dan Kepala UPT Dinas Pendidikan Kecamatan Hiliserangkai, E.Telaumbanua serta sejumlah warga setempat dan tidak ada masalah yang timbul. Kemudian, pada tanggal 14 November 2011 sore hari, pengawas dari Dinas Pendidikan Kabupaten Nias dan pihak kontraktor serta warga masyarakat meninjau lokasi proyek untuk memastikan bahwa kayu patok-patok proyek yang dipasang sebelumnya masih utuh. Selanjutnya pada malam harinya, A Lina Duha menemui Mareti Waruwu di rumahnya untuk memberitahukan bahwa proyek akan segera dimulai. Namun, Mareti Waruwu mengatakan kalau memang kontraktor tidak menemuinya, maka dia tidak mengizinkan proyek itu dikerjakan. “Kalau pemborong masih bersikeras, maka saya tarik kumis saya kalau proyek itu jadi dilanjutkan," katanya menirukan ucapan pemilik tanah saat itu. Kepala Bidang Sarana Prasarana Dinas Pendidikan Kabupaten Nias selaku PPK, sebelumnya telah menyurati pihak kontraktor CV Nias Indah tertanggal 3 November 2011 Nomor : 642.2/1005-DAU/2011 untuk memulai pekerjaan TK Negeri Hiliserangkai Kecamatan Hiliserangkai sesuai dengan kontrak Nomor : 642.2/796/DAU/ 2011 tanggal 12 Oktober 2011 bahwa masa pelaksanaan pekerjaan kegiatan pembangunan TK Negeri Hiliserangkai 60 hari kalender dan berakhir pada tanggal 11 Desember 2011 dan sesuai dengan Surat Perintah Mulai Kerja (SPMK) Nomor : 642.2/818/DAU/2011 tanggal 13 Oktober 2011. Salah seorang anggota DPRD Nias dari Komisi A yang dikonfirmasi KPK Pos di kantor DPRD Nias, Selasa, mengatakan informasi yang kami peroleh dari pemilik tanah bahwa lokasi pembangunan TK Negeri Hiliserangkai yang sedang dibangun saat ini bukanlah lokasi yang dihibahkan pemilik tanah. "Apalagi pihak dinas pendidikan Kabupaten Nias tidak mengakomodir pemilik tanah sebagai pelaksana untuk mengerjakan proyek tersebut, padahal dia (Mareti Waruwu-red) selaku penghibah tanah," ujarnya. (NZ/YaGi/OM)

BANTUAN LANSIA SEI PENUH DITELAP .................dari hal 1 para lansia tersebut menerima bantuan Rp1.800.000/orang. Namun kenyataannya, telah terjadi pemotongan bantuan oleh oknum Kades Tanjung Mudo dan salah satu oknum Dinas Sosial. "Kami hanya menerima Rp1.300.000. Sisanya dipotong mereka. Kami tidak terima pemotongan ini,“ ujar seorang lansia dari Tanjung Mudo. Kadis Sosial Kota Sungai Penuh, Astria Asnawi, saat dikonfirmasi di ruang kerjanya, Selasa, menyatakan tidak mengetahui jelas tentang hal tersebut. “Saya tidak mengetahui jelas tentang permasalahan tersebut. Silahkan tanya Kabid Sosial Mulyadi,” kilahnya. Namun saat wartawan koran ini menindaklanjuti arahan sang Kadis, ternyata Kabid Sosial Mulyadi telah hengkang dari ruang kerjanya. Hal ini sesuai apa yang disampaikan salah satu stafnya. "Pak Mulyadi keluar dari tadi pagi belum masuk-masuk,” terang mereka. Permasalahan pemotongan bantuan bagi masyarakat lansia jelas bermasalah. Ini terbukti adanya demo terhadap Dinas Sosial. Apa tindakan Wali Kota Sungai Penuh yang baru, masih dinanti. (DONI)

TRAGEDI PENONTON BOLA .................dari hal 1 pertandingan Piala AFF (ASEAN Football Federation) di Jakarta, tahun lalu, juga terjadi pembakaran loket dan perusakan kendaraan. Bahkan muncul insiden peledakan petasan di dalam stadion. Masalahnya, sejauh mana penyelenggara dan aparat berupaya mencegah aksi anarkistis penonton. Ini bisa dilakukan dengan berbagai cara, dari mengatur penjualan tiket jauh-jauh hari, menjual secara online, sampai memisahkan jalur keberangkatan dan kepulangan suporter tim tertentu. Jika perlu, panitia pertandingan menjual tiket dengan harga cukup mahal sehingga tidak memancing terlalu banyak penonton. Antisipasi seperti itulah yang tidak dilakukan penyelenggara pertandingan final sepak bola SEA Games kali ini. Harga tiket terlalu murah sehingga penonton amat membeludak. Semua tiket juga tidak memiliki nomor tempat duduk sehingga penonton akan cenderung berebut tempat. Kemarahan penonton sering pula dipicu oleh kurang profesionalnya panitia. Misalnya, penjualan tiket yang tak transparan. Mereka seharusnya membuat sistem penjualan yang meminimalkan antrean, misalnya penjualan lewat Internet. Panitia juga perlu membuat barikade di luar stadion agar penonton tanpa tiket tidak mendekat ke stadion. Layar-layar raksasa yang menayangkan pertandingan pun harus disiapkan sebanyak mungkin agar penonton yang tak kebagian tiket tidak terlalu kecewa. Tanpa kemampuan mengelola penonton, sulit membayangkan sepak bola kita benar-benar berkembang menjadi industri sekaligus hiburan yang aman. (***)

K PK POS KORAN KORUPSI POLITIK KRIMINAL

Selama Pelarian, Nunun Dikawal Polwan? JAKARTA - Nunun Nurbaeti diduga pernah kembali ke Tanah Air beberapa bulan lalu. Menurut sumber di satu lembaga negara, pergerakannya terdeteksi dari telepon seluler yang biasa digunakan tersangka perkara suap pemilihan Deputi Gubernur Senior Bank Indonesia itu. Tak hanya itu, sejumlah sumber di sebuah lembaga negara menyebut, Nunun selalu dikawal beberapa or-

ang, termasuk yang masih aktif menjadi polisi wanita (polwan). Beberapa foto yang diperoleh menunjukkan istri mantan Wakil Kepala Polri Adang Daradjatun itu sedang berjalan-jalan di sebuah mal di Singapura. Ihwal pergerakan Nunun ini kabarnya juga diketahui polisi. Namun, juru bicara Mabes Polri Inspektur Jenderal Saud Usman Nasution membantah tahu keberadaan buronan KPK itu, termasuk pengawalan oleh polisi wanita. “Enggak ada yang dampingi," kata Saud Usman di Mabes Polri, Kamis. "Kalau Nunun ada di depan mata, masak kami akan menutup

mata, kan enggak mungkin.” Saud juga membantah buron kasus cek pelawat itu pulang ke Indonesia saat pernikahan anaknya beberapa bulan lalu. "Tidak ada kabar dia ke Indonesia. Kalau ada, pasti sudah kami tangkap," ujar Saud lagi, seperti diberitakan Tempo. Menurut Saud, upaya penyidikan Nunun adalah domain Komisi Pemberantasan Korupsi. Posisi polisi hanya membantu mengupayakan perburuan Nunun melalui jalur Interpol. "Yang jelas kami selalu bertindak profesional dan prosedural dalam menempuh aturan internasional, yaitu melalui Interpol.

Jadi, kami masih menunggu kabar dari polisi di negara lain," katanya. Saud juga mengaku tidak mengetahui kabar yang menyatakan bahwa Nunun dilindungi jaringan bisnis keluarganya selama berada di Thailand. Polisi juga merasa tidak berkepentingan melacak keberadaan Nunun atas temuan foto yang beredar. "Karena belum tentu itu dia," ujarnya. Sebelumnya, politikus PKS di Komisi Hukum DPR yang juga suami Nunun, Adang Daradjatun, mempersilakan aparat hukum menangkap istrinya. Asalkan, kata dia, Nunun terbukti sehat dan sedang jalan-jalan

di Singapura. "Kalau tertangkap Interpol atau memang KPK bisa membawa, silakan," kata Adang, Rabu. Adang tetap berkukuh, istrinya sakit dan sedang menjalani perawatan. "Jadi, saya wajib untuk menjaga Ibu," kata dia. Ia juga berjanji akan menaati proses hukum yang menyangkut status sang istri. Dia membantah dianggap menghalangi proses hukum dengan menyembunyikan keberadaan Nunun. "Kalau toh Ibu memang tertangkap, Ibu harus dibawa ke pengadilan, seperti kemarin ribut tentang in absensia," kata dia. (TI)

USUT PENYELEWENGAN DI LABURA ........................................................................................dari hal 1 2011 No Rekening 1.22. 1.22.01.15.05 Pelatihan Kadir Pemberdayaan Masyarakat dengan belanja Rp505.619.000. R.APBD Tahun 2011 No Rekening 1.22. 1.22.01.17.05 Pelaksanaan Lomba desa dengan belanja Rp131.700.000. Kemudian, R.APBD Tahun 2011 No Rekening 1.22. 1.22.01.18.02 Pelatihan Aparatur Pemerintahan Desa Dalam Bidang Pengelolahan Keuangan Derah dengan belanja Rp114.756.400, R.APBD Tahun 2011 No Rekening 1.22. 1.22.01.18.03 Pelatihan Aparatur Pemerintahan Desa Dalam Bidang Manajemen Pemerintahan Desa dengan belanja Rp196.617.500, R.APBD Tahun 2011 No Rekening 1.22.

1.22.01.20.01 Pembinaan peran PKK dengan belanja Rp153.540.000,- R.APBD Tahun 2011 No Rekening 1.22. 1.22.01.21.01 Penyusunan Profil Desa dan Kelurahan dengan belanja Rp442.344.544, R.APBD Tahun 2011 sampai sekarang sudah bulan November 2011, diduga belum disalurkan oleh Badan PMDK. "Tujuan etos kerja kita ialah membantu kinerja Pemerintah Kabupaten Labura sesuai dengan visi dan misi Bupati Labura H. Khairuddin Syah Sitorus SE, supaya bergandengan tangan untuk membangun daerah Labura yang baru pemekaran ini," ungkap St. Saut Siburian Ketua DPP LSM PAB Labura, menambahi komentar

Halder Sinurat. "Jadi jangan ada dugaan Bupati LSM PAB tidak mendukung program pemerintah," ungkap Saut Siburian dalam penjelasan singkatnya. Di tempat terpisah, JF Dulles Saragih SPd Kepala Sekolah Mts. Alwasliyah Simpang Marbau Kec Na IXX Kabupaten Labura dan Parlaungan Sipahutar tokoh pemuda Aek Natas ketika dimintai komentarnya, Senin, di Warung Medan Kp. Pajak menjelaskan, Bupati Labura H. Kharuddin Syah Sitorus SE, tidak akan mau melindungi stafnya yang diduga melakukan KKN. "Beliau paling anti terhadap stafnya yang korupsi, sebab Bupati orangnya sa-

ngat bersih dan sudah dikenal oleh masyarakat dari tiga Kabupaten yaitu Kabupaten Labura, Labuhanbatu, dan Labusel bahkan Bupati tersebut adalah anak mantan pejuang," tegas kedua tokoh itu. Jadi jangan Kepala Kaban PMDK Pemkab Labura mengadu domba LSM PAB dengan Bupati. Biarkanlah LSM PAB bekerja sesuai dengan voksi. Karena LSM itu adalah sebagai sosial kontrol untuk mengkritisi kinerja birokrasi, eksekutif, legislatif dan judikatif. LSM ini juga adalah mitra kerja pemerintah untuk mensinerjikan keuangan Negara, yang tujuannya semua adalah untuk kepentingan masyarakat dari segala as-

pek. Halder Sinurat lebih lanjut menegaskan, Togap Siagian adalah Kepala Kaban PMDK Pemkab Labura dan sebagai Kuasa Pengguna Anggaran (KPA). Jadi seluruh dugaan KKN yang ada di Dinas tersebut adalah tanggungjawab Kepala Kaban PMDK. Dugaan KKN tersebut melanggar UU No 28 Tahun 1999 dan PP No 68 Tahun 1999 tentang penyelenggaraan bebas korupsi dan tindak pidana korupsi. Sementara itu, Togap Siagian SSos. MSi Kepala Kaban PMDK Pemkab Labura ketika dihubungi, Senin (21/11) melalui telepon selulernya sampai beberapa kali tidak ada jawaban. (JAR)

PENANGKAPAN KAPAL MV GOLDEN FALCON SAIGON .........................................dari hal 1 43 KUHAP dan UndangUndang No.8 tahun 1985. "Sanksi yang dikenakan PN Dumai terkesan adanya pelemahan pasal yang disangkakan Bea Cukai," sebut Samuel SH Aktifis LSM Bakti Nusantarta belum lama ini. Kapal MV Golden Falcon Saigon ditangkap diduga menyeludupkan beras asal Vienam sebanyak 455 karung atau 22,5 ton ke Dumai. Kapal ini ditangkap Satpol Air Dumai pada saat sandar di dermaga Pertamina Dumai ketika akan memuat “gren cook” milik Pertamina Dumai. Beras seludupan tersebut 105 karung sudah dibongkar dimuat ke Kapal Pompong. Sisanya sebanyak 355 karung ditemukan petugas Satpol pada palkah kapal MV.

Golden Falcon Saigon Penangkapan kapal dan nahkoda kapal, bukti perbuatan nahkoda kapal melanggar hukum, sehingga bisa dijerat dengan UU RI No.17 Tahun 2006 tentang kepabeanan. Sedangkan PN Dumai menjerat dengan pasal 43 KUHAP. Dalam pasal ini disebutkan; “Penyitaan surat atau tulisan lain dari mereka yang berkewajiban menurut undang-undang untuk merahasiakannya, sepanjang tidak menyangkut rahasia negara, hanya dapat dilakukan atas persetujuan mereka atau atas izin khusus ketua pengadilan negeri setempat kecuali undang-undang menentukan lain”. "Pasal ini terindikasi adanya unsur pelemahan. Bea

Cukai adalah PPNS penyidik, kenapa justru ada perbedaan pasal yang disangkakan antara Bea Cukai dengan PN Dumai, ada apa?, ujar Samuel balik bertanya. Menurut Samuel, mestinya PN Dumai mengacu pada pasal yang disangkakan Bea Cukai berdasarkan UU No.17 tahun 2006 tentang kepabeanan, karena pasal yang disangkakan Bea Cukai adalah tentang penyeludupan, “alat bukti dan tersangkanya sudah ada”. "Jika pasal 102 UU No.17 Tahun 2006 ini yang dijadikan dasar oleh PN Dumai bisa dijatuhi hukuman penjara dan denda atau kapal tersebut bisa disita untuk negara," ujarnya. Sejumlah keterangan yang dihimpun KPK Pos di

Dumai menyebutkan, Kapal MV. Golden Falkon Saigon dikontrak Pertamina untuk mengangkut “gren cook” dari dan menuju negara pengimport, yakni China dan India. Kapal MV. Golden Falkon Saigon berkapasitas 22.000 ton diinformasikan kerap menyeludupkan “sembako” seperti beras dan gula ke Dumai meski dalam skala kecil, namun sangat merugikan negara. Pemilik barang seludupan tersebut disinyalir milik oknum mantan pegawai Pertamina Dumai inisial M. Kapal MV. Golden Falcon Saigon bongkar barang seludupan pada malam hari. Hanya saja pada saat itu sekitar pukul 20.00 WIB, tanggal 23 September 2011 kapal ini lagi apes. Pada saat

SEJARAH KELAM PEMBERANTASAN KORUPSI tugas sebagai ketuanya. Lagi-lagi alasan politis menyebabkan kemandekan, seperti Direktur Utama Pertamina yang tugas ke luar negeri dan direksi lainnya menolak karena belum ada surat tugas dari atasan, menjadi penghalang efektivitas lembaga ini. Operasi ini juga berakhir, meski berhasil menyelamatkan keuangan negara kurang-lebih Rp11 miliar. Operasi Budhi ini dihentikan dengan pengumuman pembubarannya oleh Soebandrio, kemudian diganti menjadi Komando Tertinggi Retooling Aparat Revolusi (Kontrar) dengan Presiden Soekarno menjadi ketuanya serta dibantu oleh Soebandrio dan Letjen Ahmad Yani. Seiring lahirnya lembaga ini, pemberantasasn korupsi pada masa itupun seakan masuk jalur lambat, bahkan macet. Seakan menafikan kinerja Pemerintahan Orde Lama terhadap pemberantasan korupsi, munculnya Orde Baru di bawah Soeharto, pada 16 Agustus 1967, dengan terangterangan mengkritik Orde Lama. Dalam pidato kenegaraannya, Soeharto mengatakan, bahwa Orde Lama tidak mampu memberantas korupsi yang kala itu sudah cukup

menggerogoti keuangan negara. Pidato kenegaraan itu kemudian ditimpali dengan pembentukan Tim Pemberantasan Korupsi (TPK). Tim ini dibentuk tahun 1967 melalui Keppres No.228/ 1967 tanggal 2 Desember 1967 yang bertugas membantu pemerintah memberantas korupsi (pencegahan dan penindakan). Saat itu, TPK dipimpin langsung oleh Jaksa Agung. Namun, sepak terjang TPK ini banyak dipertanyakan. Soeharto pun tak kalah akal. Ia kemudian membentuk lembaga pemberantasan korupsi yang dikenal dengan ‘Komite Empat’. Komiet Empat dibentuk berdasarkan Keppres No 12/ 1970, tanggal 31 Januari 1970. Tugasnya menghubungi pejabat atau instansi, swasta sipil atau militer, memeriksa dokumen administrasi pemerintah dan swasta, serta meminta bantuan apartur pusat dan daerah dalam menjalankan tugasnya. Bahkan dengan Keppres yang sama, Soeharto juga membentuk Komite Anti Korupsi (KAK) yang masa kerjanya hanya dua bulan. Tugasnya, mengadakan kegiatan diskusi dengan pe-

mimpin partai politik dan bertemu presiden. Soeharto lengser kemudian digantikan BJ Habibie. Pada masa presiden ketiga ini, dikeluarkan UU No 28 tahun 1999 tentang Penyelenggaraan Negara yang Bersih dan Bebas dari Korupsi, Kolusi, dan Nepotisme. UU tersebut diiringi juga dengan pembentukan berbagai komisi atau badan baru. Seperti Komisi Pengawas Kekayaan Pejabat Negara (KPKPN), KPPU, atau Lembaga Ombudsman. KPKPN dibentuk melalui Keppres No 27/1999 dengan tugas melakukan pemeriksaan kekayaan pejabat negara. Lembaga ini kemudian menjadi sub bagian pencegahan dalam Komisi Pemberantasan Korupsi (KPK). KPKPN akhirnya dibubarkan dengan alasan tidak bisa bekerja karena tidak mampu menjamah koruptor kelas kakap. Periode berikutnya, seperti ditulis 'forumkeadilan', ketika Abdurrahman Wahid menjabat presiden. Ia membentuk Tim Gabungan Pemberantasan Tindak Pidana Korupsi (TGPTPK) melalui Peraturan Pemerintah Nomor 19 Tahun 2000. Namun, melalui suatu judicial review Mahkamah Agung, TGPTPK

bongkar muat beras seludupan yang bersal dari Vietnam itu ditangkap Satpol Air. Hingga saat ini MV. Golden Falkon Saigon bermuatan gren cook beserta beras seludupan dan nahkoda kapal tersebut masih ditahan Bea Cukai Dumai sebagai barang bukti. Selain itu muatan gren cook, milik pertamina yang dimuat Kapal MV Golden Falcon Saigon dikabarkan melebihi order, sesuai order dari negara pengimport 21.000 ton. Sementara gren cook yang dimuat oleh Pertamina disinyalir sebanyak 22.000 ton ada penggelembungan muatan 1.000 ton. "Harga gren cook disebut-sebut US $.100 per ton," sebut sumber. (PUR)

.............................................................dari hal 1

akhirnya dibubarkan dengan logika membenturkannya ke UU Nomor 31 Tahun 1999. Nasib serupa tapi tak sama dialami oleh KPKPN, dengan dibentuknya Komisi Pemberantasan Korupsi, tugas KPKPN melebur masuk ke dalam KPK, sehingga KPKPN sendiri hilang dan menguap. Artinya, KPK-lah lembaga pemberantasan korupsi terbaru yang masih eksis. Namun dalam perjalanan waktu, KPK pun tak urung diterpa 'badai'. Ada segelintir elemen masyarakat yang meminta agar KPK dibubarkan saja. Mencermati kondisi yang terjadi, sejumlah tokoh nasional mengeluarkan sembilan butir pernyataan sikap terkait dukungan terhadap upaya pemberantasan korupsi. Berikut delapan dari sembilan pernyataan sikap sejumlah tokoh nasional, setelah melalui diskusi sekitar dua jam: Pertama, menolak pengerdilan KPK yang dilakukan dengan berbagai cara, antara lain melalui pembahasan Rancangan UndangUndang Pengadilan Tindak Pidana Korupsi (Tipikor), karena menyalahi amanat reformasi. Kedua, menolak RUU Tipikor yang melemahkan upa-

ya pemberantasan korupsi. Ketiga, mendukung pembahasan ulang UU Pengadilan Tipikor, pencantuman tiga hakim ad hoc dan dua hakim karier. Keempat, mendukung dimilikinya kewenangan penuntutan dan penyadapan oleh KPK tanpa meminta izin Pengadilan Negeri. Selain itu, mendukung peraturan pemerintah pengganti undang-undang (perppu) tentang UU Pengadilan Tipikor sesuai amanat reformasi. Kelima, mengajak masyarakat untuk berpartisipasi dalam pemberantasan korupsi dan mempertahankan eksistensi KPK. Keenam, mendesak Presiden untuk membersihkan kepolisian dan kejaksaan dari oknum antipemberantasan korupsi. Ketujuh, membentuk komi_te etik kajian ulang atas tuduhan dan penetapan dua pimpinan KPK sebagai tersangka oleh tim independen karena terdapat dugaan konflik kepentingan. Kedelapan, menolak segala upaya kriminalisasi kebijakan pimpinan yang telah sesuai prosedur operasional baku dan undang-undang, sehingga mengakibatkan ketidakefektifan dan kevakuman pimpinan. (FR/BBS)

Penerbit : PT Karya Peduli Kebangsaan; Pembina : Iskandar, ST, Eggy Sudjana SH, MSi, Jansen Leo Siagian; Pimpinan Umum : H Baharuddin; Wakil Pimpinan Umum: Drs MA Siddik Surbakti; Pemimpin Perusahaan: Amiruddin; Pemimpin Redaksi: Syafaruddin Lubis; Redaktur Eksekutif : Ir H Benny Yuswar; Sekretaris Redaksi : Lindawati; Redaktur: Mursal Harahap, Mei Leandha; Koordinator Daerah: Manaon Lubis; Wartawan : Khairuddin Tanjung, Zulpiana, S. Edhie, Vera Sinaga; Penasehat Hukum : Syahril SH SpN, Nuralamsyah SH MH, Affan Ramadeni SH, Abu Bokar Tambak SH MHum, H Darma Bakti SH SE MH, Afrizon Alwi SH MH, Edi Suparno SH, Mazwindra SH, Ahmad Herman Bispo SH, Azwir Agus SH MHum, H Ayub SH, Ikhwaluddin Simatupang SH MHum, H.Syafrizal,SH.MH ; Alamat Redaksi/ Tata Usaha : Jl T.A. Hamzah Komp. Ruko Griya Riatur Blok B 181 Medan , Telepon: (061) 8449800 ; Fax: (061) 8462800, E-mail: kpkpos@yahoo.com; Bank: BNI ’46 Cabang Jl Sutomo a.n. Baharuddin; No. Rekening: 0148120706; Tarif Iklan: Umum Hitam Putih: Rp7.500/mm kolom, warna: Rp15.000/mm kolom, Keluarga: Rp5.000/mm kolom; ISI DI LUAR TANGGUNGJAWAB PERCETAKAN


KPK POS

3

KORUPSI

E D I S I 176 28 NOVEMBER – 4 DESEMBER 2011

NASIONAL

Eks Penari Istana Negara Gugat Pemerintah JAKARTA–Merasa diperlakukan diskriminatif dan sewenangwenang oleh Pemerintah, Nona Nani Nurani (70), mantan penari di Istana Negara pada Orde Lama, menggugat perdata ke pemerintah cq. Presiden RI ke Pengadilan Negeri Jakarta Pusat. Presiden digugat Rp 7,46 miliar untuk kerugian materil dan kerugian imateril sebesar Rp 30 juta. Selain meminta uang ganti rugi, Nani juga meminta kepada pihak tergugat, untuk menyatakan permohonan ma-

af melalui 10 media cetak nasional selama tujuh hari berturut-turut. "Maestro penari terpaksa

menggugat karena mengalami diskriminasi dan sewenang-wenang oleh Pemerintah, karena distigmakan negatif sebagai pengikut Partai Komunis Indonesia (PKI), kendati Nani hanyalah seorang penari Istana Negara di era Bung Karno," ungkap Andi Muttaqien, kuasa hukum Nani pada sidang perdana di PN Jakarta Pusat, Senin pe-

kan lalu. Atas stigma itu, lanjut Andi, pemerintah sempat menahannya selama tujuh tahun tanpa (Masuk 23 Desember 1968, keluar 19 November 1975), karena diketahui menari dalam acara ulang tahun PKI pada 1965. Penahanan itu tanpa melalui proses peradilan, lalu tanpa batas waktu kepada orangorang yang dituduh terlibat

Gerakan 30 September 1965. Padahal, keikutsertaan Nani bukan karena dia kader PKI. Namun karena dia merupakan penari di istana Cipanas. Pada Order Baru, penari senior ini kembali mengalami diskriminasi, yakni merasa kesulitan mendapatkan status kependudukan berupa Kartu Tanda Penduduk (KTP). Pada 2003, Nani Nurani

akhirnya menggugat Kepala Pemerintahan Kecamatan Koja, Jakarta Utara di PTUN DKI Jakarta karena tidak menerbitkan KTP atas nama dirinya. Pengadilan pun akhirnya mengabulkan Gugatan Nani Nurani. Atas dasar perjuangan puluhan tahun tersebut dinilai merugikan dan mencederai harkat dan martabat Nani,

Jaksa Tak Kapok Terima Suap JAKARTA - Kejaksaan Agung (Kejagung) jengkel dengan ulah para Jaksa yang tidak pernah kapok, tidak pernah jera menerima suap terhadap kasus yang ditanganinya. Sudah tiga KPK Jaksa yang ketangkap basah menerima suap. Mereka Urip Tri Gunawan (Kejaksaan Agung), Jaksa Dwi Seno Widjanarko (Kejari Tangerang) dan Jaksa Sistoyo (Kejari Cibinong). "Ini kasus sudah berkalikali terjadi, saya sebagai Jamwas heran mereka (Jaksa nakal) sudah diberi renumerasi nggak kapokkapok, nggak sadar-sadar, apa nggak malu," tegas Jaksa Agung Muda Pengawasan Kejagung, Marwan Effendy, di Jakarta, Selasa pekan lalu. Marwan melanjutkan sistem pengawasan di Kejaksaan, sebetulnya sudah cukup memadai, dan sangat ketat aturannya. Namun aksi jaksa mbalelo yang menerima suap lebih menyangkut watak. "Kalau watak sudah rusak, mau diapain juga susah," tegas mantan Jampidsus Kejagung serius. Memang, sambung Marwan, ada ribuan pengaduan dan laporan dari masyarakat soal kinerja dan perilaku jaksa. Namun sulit dibuktikan karena minimnya alat bukti. Terkait penangkapan Jaksa Sistoyo, Marwan mengaku Jaksa Agung memerintahkan agar membuat surat pemberhentian sementara. Jaksa Agung juga melakukan teleconference dengan seluruh Kepala Kejaksaan Tinggi seIndonesia. Ada perintah Jaksa Agung menyikapi penangkan Jaksa oleh KPK. Jaksa Agung mengaku sangat prihatin dengan penangkapan Jaksa Sistoyo, karena kejadian ini sangat mencoreng institusi korps Adhyaksa, di saat sedang maksimalkan membangun kepercayaan publik. Kejagung juga memerintahkan Asisten Pengawas di Kejaksaan Tinggi Jawa Barat telah melakukan pemeriksaan terhadap Kajari Cibinong Soeripto Widodo. "Pemeriksaan Kajari Cibinong ini penting untuk menentukan kadar kesalahan Kajari-nya," ujar Marwan. Jika terbukti lalai, Kajari Cibinong akan dicopot

sesuai ketetapan Jaksa Agung. Selain Kajari, juga diperiksa sembilan jaksa dari kejaksaan Cibinong bersama enam pegawai, terutama pegawai yang saat itu melaksanakan piket di Kejari Cibinong. Kejagung juga memeriksa Jaksa Sistoyo untuk mengetahui adanya kemungkinan keterlibatan di kalangan internal Kejari Cibinong, yang menikmati aliran uang tersebut. Sistoyo adalah JPU dalam kasus dugaan Pasal 378 tentang penipuan dan Pasal 263 KUHP tentang pemalsuan surat yang melibatkan pengusaha EMB dalam proyek pembangunan hanggar dan kios pasar festival Cisarua, Kabupaten Bogor. Namun pembacaan tuntutan terhadap kasus pemalsuan tersebut, beberapa kali ditunda. Marwan menduga kuat adanya keterlibatan pihak lain selain Jaksa Sistoyo dalam kasus suap tersebut mengingat perkara tersebut sudah masuk ke pengadilan. "Kalau tuntutan pidana meringankan Edward (terdakwa) bukan Jaksa Sistoyo saja yang menikmatinya. Apalagi ini sudah di pengadilan, tentunya ada pihak lain," katanya Berdasarkan catatan, Kepala Subbagian Pembinaan Kejaksaan Negeri Cibinong Sistoyo yang ditangkap KPK, baru 10 hari pulang mengikuti pendidikan dalam rangka promosi jabatan. Eselon empat yang akan naik menjadi eselon tiga, dianggap jaksa berprestasi. Sistoyo baru 10-11 bulan bertugas di Kejari Cibinong, sebelumnya menjabat ebagai Kepala Seksi Intelijen Kejari Pemekasan, Madura. Kehidupan Jaksa Sistoyo biasa-biasa saja dan keluarganya tinggal di Bandung. Pakar hukum pidana dari Universitas Trisakti, Abdul Fickar Hadjar menilai penangkapan Jaksa Sistoyo merupakan bukti korupsi di kalangan penegak hukum sudah menjadi-jadi. Korupsi oleh aparat penegak hukum sudah sistemik dan masif "Kekuasaan menyidik oleh polisi, menuntut oleh jaksa, dan memutus oleh hakim, menjadi alat ekonomi banyak penegak hukum. Ini bukti nyata kekuasaan pada akhirnya mendorong perilaku koruptif," ungkapnya. (ENDY)

maka, Nani menilai sangatlah pantas ia mengajukan tuntutan terhadap negara, melalui Presiden RI Susilo Bambang Yudhohyono. "Perbuatan-perbuatan pemerintah di masa lalu berupa tuduhan Komunis tanpa dasar, dan bahkan menahan Nani Nurani tanpa proses persidangan," ujar Nani dalam gugatannya. (ENDY)

Bekas Kepala BPPN Diperiksa KPK

KESAKSIAN BACHTIAR–Mantan Menteri Sosial Bachtiar Chamsyah (kiri) saat menjadi saksi dalam sidang lanjutan di pengadilan Tipikor, Jakarta, Senin (22/11). Sidang terdakwa Kasubdit Kemitraan Usaha Bantuan Sosial Fakir Miskin Kementrian Sosial (Kemensos) Yusrizal dalam dugaan kasus korupsi pengadaan mesin jahit dan sapi impor di Kementrian Sosial.

KPK Tangkap Tangan Jaksa dan Pengusaha JAKARTA - Daftar jaksa nakal yang ketangkap tangan Komisi Pemberantasan Korupsi (KPK), kian panjang. Sebelumnya, KPK pernah menangkap tangan Jaksa Urip Tri Gunawan yang bertugas di Kejaksaan Agung dan Jaksa Dwi Seno Widjanarko yang bertugas di Kejaksaan Negeri Tangerang. Kini, Senin pekan lalu sekitar pukul 18.15 WIB di halaman parkir Kejari Cibinong, Bogor Jawa Barat, KPK kembali menangkap tangan jaksa Sistoyo dan dua pengusaha, Anton Bambang Hadyono dan Edward M. Bunjamin karena melakukan transaksi suap terkait penanganan perkara yang dialami sang pengusaha. Selain menangkap tiga orang tersebut, KPK juga menangkap sopir Edward serta menemukan barang bukti berupa uang sejumlah Rp 100 juta kurang Rp100 ribu, yang dimasukkan dalam sebuah amplop coklat di dalam mobil Jaksa Sistoyo, yang menjabat Kasubag Pembinaan di

Kejaksaan Negeri (Kejari) Cibinong. KPK juga menyita tiga buah mobil, Toyota Innova, Toyota Avanza dan Nissan Trail. "Setelah menjalani pemeriksaan selama 28 jam, mereka ditetapkan sebagai tersangka dan ditahan. Jaksa Sistoyo ditahan di Rutan Polda Metro Jaya. Dua pengusaha Anton dan Edward ditahan di Rutan Cipinang," terang Juru bicara KPK, Johan Budi SP di kantor KPK, Jakarta, Selasa pekan lalu. Dijelaskan, peristiwa penangkapan berawal sekitar pukul 18.00 WIB, pengusaha Anton datang dengan membawa uang dalam amplop cokelat mendatangi mobil Jaksa Sistoyo. Amplop tersebut diletakkan di dalam mobil terlebih dahulu dan dibukakan pintu oleh sang Jaksa. Saat itulah penangkapan dilakukan. Hasil pemeriksaan, pengusaha, Anton Bambang Hadyono dan Edward M. Bunjamin adalah pihak yang memberikan uang sejumlah Rp

99.900.000 kepada Jaksa Sutiyoso selaku penegak hukum. Pemberian suap terhadap Jaksa Sistoyo, lantaran pengusaha Edward tengah menjalani proses persidangan di Pengadilan Cibinong atas kasus penipuan. "Kami menduga uang ini berkaitan dengan tuntutan yang akan dijatuhkan kepada Edward. Tetapi, ini masih dugaan yang akan terus kami kembangkan. Mungkin, pemberian kepada pihak-pihak lain." ungkap Johan. Selain itu, KPK masih menelusuri apakah uang Rp 99.900.000 tersebut hanyalah uang muka saja. Tetapi, memang dari awal informasi yang disampaikan adalah akan ada penyerahan uang sebesar Rp 100 juta. Jaksa Sistoyo dijerat dengan Pasal 5 ayat 2 dan atau Pasal 12 a dan b dan atau Pasal 11 UU Tipikor. Sedangkan, tersangka Anton Bambang Hadyono dan Edward M. Bunjamin dijerat dengan Pasal 5 ayat 1 dan atau Pasal 13 UU Tipikor. Usai menjalani pemeriksan marathon, ketiga tersangka keluar dari kantor KPK. Namun ketika dikonfirmasi, ketiganya kompak tutup mulut dan wajahnya ditutupi tangannya.(ENDY)

Seminar Dikorupsi, Sekjen Kemenlu Jadi Tersangka JAKARTA - Korupsi memang terjadi di semua sektor aktivitas. Buktinya, acara seminar yang bertujuan menambah informasi ternyata dikorupsi. Karenanya, Komisi Pemberantasan Korupsi (KPK) menetapkan eks Sekjen Kementerian Luar Negeri (Kemenlu), Sudjanan Parnohadiningrat ditetapkan sebagai tersangka dugaan korupsi anggaran kegiatan seminar tahun 2004-2005. "Penetapan tersangka, setelah penyidik meningkatkan proses penyelidikan ke penyidikan," jelas Juru Bicara KPK, Johan Budi SP di gedung KPK, Jakarta, Senin pekan lalu. Dikatakan, ada penyalagunaan

kewenangan yang dilakukan Sudjanan dalam menggunakan anggaran yang diposkan untuk pelaksanaan seminar di lingkungan Kemenlu. Saat itu Sekjen bertindak sebagai Pejabat Pembuat Komitmen (PPK). Kerugian negara yang diakibatkan diduga sebesar Rp 18 miliar. Ada selisih penggunaan anggaran. Penyelidikan ini sudah agak lama, bukan kasus baru, sambungnya. Terhadap Sudjanan yang juga mantan Dubes Indonesia untuk Amerika Serikat itu, KPK mengenakan pasal 2 ayat 1 dan atau pasal 3 UU Pemberantasan Korupsi nomer 31 tahun 1999 sebagaimana diubah

dengan UU nomer 20 tahun 2001. Sudjanan sebelumnya dijatuhi hukuman oleh Pengadilan Tipikor dalam kasus yang juga ditangani KPK yaitu korupsi anggaran renovasi gedung dan rumah dinas di lingkungan kedutaan besar RI untuk Singapura. Sudjanan dijatuhi hukuman satu tahun dan delapan bulan penjara. Hukuman itu, karena terbukti terlibat dalam pencairan duit negara secara ilegal. Sudjadnan menyetujui pengeluaran anggaran untuk renovasi gedung dan rumah dinas di lingkungan Kedutaan Besar RI di Singapura sebelum ada persetujuan dari Menteri Keuangan.(ENDY)

JAKARTA - Syafruddin Temenggung, bekas Kepala Badan Penyehatan Perbankan Nasional (BPPN), diperiksa Komisi Pemberantasan Korupsi (KPK), terkait kasus dugaan korupsi penjualan aset tanah perusahaan BUMN, PT Barata Indonesia di Surabaya. "Pemeriksaan Syarifuddin sebagai saksi untuk tersangka Mahyuddin Harahap," ungkap Juru bicara (Jubir) KPK, Johan Budi SP di Jakarta, Kamis pekan lalu. Usai menjalani pemeriksaan, Syafruddin Temenggung membantah terlibat dalam kasus dugaan korupsi penjualan aset tanah milik BUMN yang bergerak di bidang pengecoran dan manufaktur. "Saya tidak terkait dengan penjualan aset tanah milik BUMN yang dijual di bawah Nilai Jual Objek Pajak (NJOP). Memang, saat itu saya menjabat sebagai kepala BPPN, namun tidak memiliki kaitan dengan penjualan aset tanahnya," tegas bangkir senior. Syafruddin mengaku ditanya penyidik hanya seputar aset kredit PT Barata di sebuah bank. Syafruddin sempat tersandung dalam kasus penjualan BUMN berupa pabrik gula PT Rajawali Tiga. Akibatnya dia harus mendekam di balik jeruji besi pada Februari 2006. Jubir KPK, Johan Budi menjelaskan KPK menetapkan Direktur Pemberdayaan Keuangan dan Sumber Daya PT Barata Indonesia, Mahyuddin Harahap sebagai tersangka. Mahyuddin dijerat karena menjual tanah milik PT Barata dengan harga jual di bawah standar NJOP. Mahyudin diketahui menjual tanah aset tersebut melalui penawaran dan penunjukkan terbuka hanya senilai Rp 83 miliar. Padahal NJOP yang berlaku untuk tanah tersebut tahun 2004 senilai Rp 132 miliar. Sehingga, merugikan negara Rp 40 miliar. Atas perbuatannya tersebut, KPK menjerat Mahyuddin melanggar Pasal 2 Ayat (1) UU No.20/2001 tentang Pemberantasan Tindak Pidana Korupsi (Tipikor) dan atau Pasal 3 UU Tipikor. Dengan ancaman pidana penjara maksimal 20 tahun dan denda maksimal Rp 1 miliar. Sebab, Mahyudin diduga memperkaya diri sendiri atau orang lain serta melakukan penyalahgunaan wewenang dalam penjualan tanah PT Barata Indonesia, tambahnya. Dalam kasus dugaan korupsi ini, KPK sempat melakukan pemeriksaan terhadap Wakil Menteri BUMN Mahmuddin Yassin pada Senin minggu lalu. Mahmuddin mengatakan soal penjualan itu domainnya tim penjualan dan direksi. Kalau anggaran penjualannya itu masuk dalam Rencana Kerja dan Anggaran Perusahaan (RKAP). “Nanti direksi yang melaporkan soal penjualannya ke kementerian,” ucapnya.(ENDY)

Dituntut Enam Tahun Sesmenpora Tertawa JAKARTA - Sea Games 26 telah berlalu, namun kasus dugaan suap pembangunan wisma atlet di Jakabaring Palembang kian berkembang. Perkembangan terbaru, Sekretaris Menteri Pemuda dan Olah Raga (Sesmenpora), Wafid Muharram, sang penerima suap dituntut 6 tahun penjara dan denda Rp 200 juta subsider enam bulan kurungan. Tuntutan itu disampaikan Agus Salim, Jaksa Penuntut Komisi Pemberantasan Korupsi (KPK) dalam persidangan lanjutan dengan majelis hakim yang diketuai Marsuddin Nainggolan, di Pengadilan Negeri Tipikor Jakarta, Rabu pekan lalu. "Terdakwa Wafid terbukti menerima suap berupa cek senilai Rp 3,2 miliar dari Mindo Rosalina

Manulang dan Muhammad El Idris." ungkap Jaksa dalam surat nota tuntutannya. Pertimbangannya, lanjut Jaksa Agus, uang yang ikut disita penyidik KPK saat menangkap Wafid, Rosalina dan Idris, termasuk cek senilai Rp 3,2 miliar tidak pernah dibukukan dalam buku bendahara. Apalagi, cek tersebut telah diketahui terdakwa Wafid karena sehari sebelumnya berkomunikasi dengan Rosalina berdasarkan print out pesan singkat. Sehingga terlihat penerimaan cek tersebut telah dikehendaki sebelumnya oleh terdakwa, kata Jaksa Agus. Bahkan, mata uang asing yang ikut ditemukan penyidik KPK saat menggeledah ruang kerja Wafid di Kementerian Pemuda dan Olah Raga, sebagai hasil

korupsi. "Uang-uang itu, bukan dari sumber yang sah dan patut diduga dari hasil tindak pidana korupsi," sambungnya, Dalam persidangan terungkap, saat peristiwa penangkapan Wafid di kantornya di lantai 3 Kantor Kemenpora, Penyidik KPK menemukan sekaligus menyita uang sebesar Rp 99 juta, Rp 128 ribu, 170 ribu dolar Australia, dan 3.765 euro. Sedangkan dari tas milik Wafid, disita uang senilai 5.000 dolar AS. Uang yang disita penyidik KPK dari Poniran, salah seorang staf Wafid, disebut sebagai uang pinjaman. Salah seorang pengusaha yang meminjamkan uangnya bernama Sunarto. "Terdakwa Wafid dan Poniran mengatakan uang pinjam-

meminjam. Anehnya, uang itu nggak pernah dibukukan dalam buku bendahara, tidak dalam catatan pemerintah. Ini jelas tidak benar," tegas Jaksa. Juga, uang 5.000 dolar AS yang disebut Wafid sebagai uang saku perjalanan dinas ke luar negeri, menurut Jaksa penjelasan itu tidak bisa diterima akal sehat. "Jika disimpan dalam tas untuk jangka waktu yang lama, padahal gaji terdakwa hanya Rp 9,2 juta," tambah Jaksa. Karena itu, asal muasal uang asing itu tidak rasional berdasarkan penjelasan Wafid maupun Poniran. "Jadi uang itu nggak sah," ucapnya. Selain itu, Jaksa mengatakan bahwa Wafid telah mempunyai niat atau mengatur PT Duta Graha Indah (DGI)

memenangkan proyek pembangunan Wisma Atlet SEA Games dan gedung Serbaguna Provinsi Sumatera Selatan. Niat itu terlihat saat Wafid menyanggupi keinginan Nazaruddin dan Rosalina yang ditindaklanjuti dengan pertemuanpertemuan dengan pihak PT DGI. Bahkan, terdakwa Wafid menyampaikan kepada Ketua Komite Pembangunan, Rizal Abdullah supaya PT DGI dibantu. Setelah DGI dinyatakan sebagai pemenang lelang terdakwa menghubungi Direktur Umum (Dirut) PT DGI, Dudung Purwadi melalui Paulus Iwo. "Sehingga, terdakwa memiliki keadaan batin membuat PT DGI sebagai pemenang dan menginginkan adanya sukses fee," ungkap Jaksa Karena itu dapat disimpulkan

perbuatan Wafid selaku Sesmenpora dan juga Kuasa Pengguna Anggaran (KPA) terlihat telah memfasilitasi PT DGI untuk memenangkan proyek. Dari fakta persidangan terungkap bahwa tim verifikasi tidak pernah bekerja. Sehingga, penentuan nilai proyek sebesar Rp 191 miliar adalah atas arahan terdakwa Wafid kepada tim verifikasi. Dikatakan perbuatan terdakwa Wafid dinilai Jaksa melanggar pasal tentang penyuapan yaitu Pasal 12 huruf b UU Nomor 31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi. Usai pembacaan tuntutan, terdakwa Wafid hanya tertawa dengan tuntutan itu, dan enggan menangapinya. (ENDY)


KPK POS

4

KORUPSI

E D I S I 176 28 NOVEMBER – 4 DESEMBER 2011

Barang Bukti Tipikor Alkes RSUD Tamiang Diamankan ACEH TAMIANG - Kejaksaan Tinggi Aceh mengamankan barang bukti kasus dugaan Tindak Pidana Korupsi (TipiKor) senilai Rp 8,8 miliar, proyek pengadaan alat-alat kesehatan Rumah Sakit Umum Daerah (RSUD) Bumi Muda Setia, Kabupaten Aceh Tamiang, yang sumber dananya dari dana perubahan Anggaran Pendapatan dan Belanja Negara (APBN-P) Tahun Anggaran 2010.

Kajati Muhammad Yusni melalui Kasi PengKum/humas Amir Hamzah, dan Kejari Kuala Simpang Muhammad Basyar Rifai, Kamis pekan lalu, membenarkan pihaknya sudah mengamankan barang bukti kasus dugaan pengadaan AlKes RSUD Aceh Tamiang pada Rabu pekan lalu. Basyar mengatakan, jaksa penyidik yang ditugasi untuk mengamankan barang bukti

tersebut yaitu Choirun Parapat melakukan penyitaan berdasarkan surat perintah penyidikan Kejati Aceh No. Print-389/IV.I/09?2011 tanggal 28 September 2011 dan surat perintah penyitaan Kejati Aceh No.Print 405/IV.I/ Fd.I/10/2011 tanggal 7 Oktober 2011 dalam perkara dugaan Tipikor penyimpangan/ penyelewengan dana dalam pengadaan 26 item alat kesehatan di Dinas Kesehatan Aceh Tamiang. Di hadiri dua saksi yaitu Prawira Negara Putra (PNS Kejari Kuala Simpang), dan Jabal (PNS KTU RSUD Aceh Tamiang), telah melakukan penyitaan terhadap 7 barang bukti dari

Direktur RSUD Tamiang, Zuhaini. Menurut Kejari Kuala Simpang, barang bukti yang diamankan yakni meja operasi elektrik tanpa accessories merk Takeuchi model: TS-101 Serial Number.01675 dalam kondisi tidak digunakan, satu unit UV room sterilizer merk Kariya kode KA 36-00BSS S/ N 10292 15020 2002, satu unit UV room sterilizer merk Kariya kode KA 36-00BSS S/N 10292 15020 2004, instrumen troylley merk Kariya kode KA 36-00BSS S/n 10298 13020 2001, instrumen troylley merk Kariya kode KA 360BSS S/n 10298 13020 2006, satu unit mayo table merk

SUMUT

Kariya kode KA 36-00BSS S/ N 1029 2171 02 4001, dan satu mayo table merk Kariya kode KA 36-00BSS S/N 1029 2171 02 4002. Basyar juga menyebutkan dari 7 barang bukti yang disita, hanya meja operasi elektrik tanpa accessories yang kondisi tidak dapat di gunakan dan akan di simpan di ruang penyimpanan barang bukti Kejari Kuala Simpang. “Sedangkan barang bukti lain di titipkan di ruang penyimpanan alat RSUD Aceh Tamiang,” katanya. Kejati Aceh juga memanggil saksi untuk dimintai keterangan yaitu KadisKes Aceh Tamiang Dr Catur dan KTU RSUD, Tamiang Jabal. (BSO)

Pengaspalan Jalan Lahemo Amburadul NIAS – Proyek pengaspalan jalan ruas Hiliweto-Lasara Siwalubanua Kecamatan Gido, Kabupaten Nias, yang dikerjakan PT Sifra Kasih, Direktur Andreas Phoa, yang bersumber dari dana APBD Nias Tahun Anggaran (TA) 2011 berbiaya Rp 2.896.200, dikerjakan amburadul. Gulo, salah seorang tokoh masyarakat setempat yang dikonfirmasi dilokasi proyek mengatakan kontraktor yang mengerjakan proyek ini tidak mempunyai rasa memiliki. "Bayangkan, hampir seluruh badan jalan yang baru di aspal sudah mulai rusak dan terlihat berlubang, termasuk parit yang dibangun retak-retak. Proyek ini merugikan masyarakat dan menghambur-hamburkan uang negara," kata Gayo. Menurutnya, dapat dipastikan umur proyek tidak bakal panjang, di tambah bahan material dilapangan kurang bagus. Apalagi proyek ini masih dalam pengerjaan tetapi sudah merenggut nyawa manusia, diduga karena pelaksanaannya yang asalasalan. Penimbunan sayap duiker plat terjadi kecurangan yakni pemborong menaruh batang kelapa sehingga apabila batang kelapa tersebut membusuk di dalam tanah maka tidak tertutup kemungkinan badan jalannya akan amblas. "Kita minta kontraktor jangan mengelabui masyarakat hanya untuk mencari keuntungan yang lebih besar. Pemasangan bronjong ada yang tidak memakai kawat bronjong hanya menyusun batu-batu besar saja. Apabila di biarkan maka ketahanan bronjong akan pendek karena batu-

Usut Dugaan Mark Up Lahan Politeknik Aceh Tamiang - Kapolres Bumi Muda Sedia Kabupaten Aceh Tamiang AKBP Amia Fahmi menegaskan, pihaknya akan mengusut dan memproses dengan tuntas kasus dugaan mark up pengadaan lahan untuk pembangunan kampus di Desa Sapta Marga dan Desa Tualang Baru, Kecamatan Manyak Payed, Kabupaten Aceh Tamiang, seluas 22,2 hektar seharga Rp 31,5 miliar.

batu tersebut bisa jatuh berham-

Kepala Dinas Pekerjaan Umum (PU) Kabupaten Nias, Bazatulo Zebua BE yang di hubungi via ponselnya mengakui bahwa proyek pengaspalan jalan di Lahemo lagi bermasalah. Katanya, pihak kontraktor sudah dipanggil untuk memperbaiki pekerjaannya. "Namun di sisi lain rekanan pernah berkeluh kepada saya bahwa masyarakat kurang mendukung pelaksanaan proyek, bahkan seringkali membuat masalah dengan pemborong," ujar Kadis. Direktur PT Sifra Kasih, Andreas Phoa yang dihubungi melalui ponselnya, Kamis pekan lalu, mengatakan proyek masih belum selesai dikerjakan dan akan menyisip kembali jalan tersebut.(YAGI/NZ)

buran."

“Kita tidak tinggal diam terhadap kasus ini, akan kita usut hingga tuntas dan langsung diproses. Kita tidak pilih-pilih kasus dalam pengusutan dugaan Tipikor. Siapa saja yang terlibat akan kita proses sesuai hukum yang berlaku,” ujar Armia, Rabu pekan lalu. Untuk tahap awal, kata-

nya lagi, pihaknya telah memanggil dua pejabat teras di Pemkab Aceh Tamiang. Diantaranya Asisten Pemerintah Setda Drs Rianto Waris, dan Kabag tata Pemerintah Drs Sepriyanto. menurut Fahmi, dipanggilnya kedua pejabat yang masing-masing menjabat sebagai Wakil Ketua dan Wakil Sekretaris Panitia Pengadaan Lahan Politeknik tersebut untuk dimintai keterangan dan dokumen terkait. Dalam waktu dekat pihaknya akan memanggil sejumlah pejabat lain yang terkait dalam pengadaan lahan Politeknik tesebut. Seperti di beritakan sebelumnya, di duga telah terjadi praktek KKN dalam pengadaan lahan tersebut. Terlihat jelas sejak pengalihan status lahan dari eks HGU menjadi milik pribadi hingga penetapan harga oleh panitia pengadaan tanah yang diduga telah terjadi mark up harga. (BSO)

Korupsi BRI, Tuntutan JPU Tak Berdasar MEDAN - Fandris, Kepala Cabang (Kacab) BRI Tanjung Leidong, terdakwa tindak pidana korupsi (tipikor) kredit fiktif dan topengan, membantah semua dakwan dan tuntutan Jaksa Penuntut Umum Boy Panali dan rekan, yang mengatakan mengenai kredit topengan tidak berdasar dan tidak terbukti hukum. Nada tersebut diutarakan Fandris di depan majelis hakim, dalam agenda sidang pembelaan (pledoi) atas

tuntutan JPU, pada persidangan diruang Cakra I Pengadilan Tipikor Medan, Jumat pekan lalu. Menurut Fandris yang langsung membacakan pembelaan tersebut mengatakan, ia membantah memberikan kredit topengan pada 66 orang debitur kupedes dan 5 debitur fikit yang anggunannya direkayasa, sesuai yang didakwakan dan tuntutan JPU padanya. Menjawab kredit topengan seperti dakwaan dan tuntutan JPU, Fandris

menjawab bahwa kredit topengan adalah bukan yang diberikan pada yang sesuai berkas pinjaman. Menurut Fandris, ia sebagai Kacab BRI Cab Tanjung Laidong telah memberikan pada nasabah sesuai masing-masing pinjamannya. Hal itu lanjut Fandris, dibuktikan dengan adanya bukti kwitansi pinjamannya serta berkas pinjaman lengkap yang ditandatangani nasabah saat menerima uang di depan teller. Namun beber Fandris JPU tidak

mengahdirkan bukti tersebut di persidangan, padahal telah berulang kali, penasehat hukumnya meminta JPU untuk menghadirkan bukti tersebut. Ucapannya ini diperkuat dengan keterangan saksi Ahmad Faisal yang bertugas sebagai Teller yang melakukan transaksi pinjaman, bahwa saksi mengatakan tidak pernah membayarkan uang pada nasabah kalau tidak ada bukti kwitansi yang ditanda tangani nasabah tersebut.(SBC)

Program Pemeliharaan Dinas PU Terindikasi Korupsi SIBUHUAN - Program pemeliharaan Dinas Pekerjaan Umum dan Energi Kabupaten Padang Lawas (Palas) terindikasi korupsi di berbagai kegiatannya yang diduga telah merugikan negara miliaran rupiah karena tidak satupun kegiatan yang terlaksana maksimal sesuai dengan Juklak dan Juknis. Program rehabilitasi/pemeliharaan yang seharusnya dilaksanakan dan diawasi dengan baik agar aset yang dipelihara tetap awet dan dapat digunakan setiap saat. Sayangnya, program tersebut disalahgunakan dan di jadikan ajang korupsi seperti diduga terjadi di Dinas PU Pertambangan dan Energi APBD tahun anggaran 2010. Berdasarkan informasi dan dokumen yang di dapat, ada-

K PK PO S

KORAN KORUPSI POLITIK KRIMINAL

Salah satu alat berat wheel loader yang parkir disamping kantor Dinas PU dan energi Kabupaten Palas. Sudah setahun lebih dan tidak pernah dipakai namun sudah menelan biaya pemeliharaan puluhan juta rupiah. pun bagian program yang diduga sarat korupsi sebagai berikut: Rehabilitasi/pemeliharaan alat-alat berat dengan belanja pegawai Rp 54

juta melalui kode rekening 1.03.1.03.01.01.23.10.5.2.1, rehabilitasi/pemeliharaan jalan (belanja modal) Rp 1,375,495,500, kode rekening

1.03.1.03.01.01.18.03.5.2.3. Rehabilitasi/pemeliharaan jembatan (belanja modal) sebesar Rp 1,016,971,000, kode rekening 1.03.1.03.01.

01.18.04.5.2.3, pemeliharaan rutin Jalan (belanja modal) Rp 12,433,628,775,00, kode rekening 1.03.1.03.01.01.18.06.5. 2.3. Dana-dana program APBD TA 2010 tersebut terindikasi 'dibisniskan' dengan modus dibagi-bagi oleh oknumoknum pejabat nakal yang seharusnya bertanggungjawab terhadap program tersebut. Contohnya, dua alat berat yang ada di Dinas PU Palas yang dibeli melalui CV Asri di 2010 lalu dengan nomor paket 75 dan 76 adalah alat berat jenis wheel excavator dan wheel loader. Dua alat berat seharga Rp 54 juta tersebut belum pernah beroperasi sementara banyak j yang rusak parah, begitu juga dengan jembatan. Masyarakat meminta KPK atau lembaga penegak hukum untuk mengusut dugaan ini.(GARI)

Kabid Perkebunan Dishutbun Palas Hafijah

Kabid Perkebunan Terindikasi KKN SIBUHUAN – Kepala Bidang Perkebunan Dinas Kehutanan dan Perkebunan (Dishutbun) Kabupaten Padang Lawas berinisial Haf, terindikasi lakukan Korupsi, Kolusi, dan Nepotisme (KKN). Indikasi ini terkait menghilangnya data terkait anggaran pembibitan perkebunan induk Sipagabu yang bersumber dari APBD 2010. Menurut keterangan yang dihimpun dan setelah melakukan konfirmasi langsung dikantornya pada minggu lalu, Haf mengakui banyak hal yang tidak beres dalam pelaksanaan proyek tersebut dan segala data yang terkait dengan pelaksanaannya telah raib dari arsip yang ada di kantornya. “Data saya telah hilang dari kantor dan tidak tahu siapa yang mengambil, kalau saya tidak silap anggaran terkait dengan pembibitan tahun 2010 bersumber dari APBD sebesar Rp 700 juta dan terelisasi kurang dari jumlah itu karena pelaksanaan kegiatannya melalui proses tender,” katanya.

Saat ditanya tanggungjawabnya selaku Kabid tentang amburadulnya pelaksanaan kegiatan tersebut, ia hanya tersenyum. "Saya sudah maksimal dan bekerja sesuai dengan prosedur yang berlaku. Saya tidak bisa langsung melakukan pemantauan ke lapangan, saya kirim tenaga kerja sukarela yang ada di sini. Setelah saya tau pelaksanaannya tidak beres. TKS-nya saya pecat," jawabnya enteng. Disinggung tentang anggaran pelaksanaan kegiatan tersebut, Haf berupaya menyalahkan pegawai yang ada di ruang kerjanya yang tidak menyimpan data tersebut. “Sudah saya suruh di simpan anggota tapi tidak di kerjakan dengan baik.” Berdasarkan dokumen yang diperoleh terkait pelaksanaan kegiatan tersebut, yang masuk dalam katagori Program Peningkatan Produksi Pertanian/ Perkebunan jumlah pagu sebesar Rp 1.215.572.100, dan dana realisasinya sebesar Rp 1.151.973.000.(GARI)

BIRO MALAYSIA : Zulkifli Harun; BIRO JAKARTA : Endy Poerwanto; BIRO JABAR : M Yahya Arwiyah SH MHum; BIRO BINJAI: Sabarudin Simanjuntak; BIRO LANGKAT: Juliadi (Kabiro), Baharuddin Lubis, M Irham Arifin; BIRO PALUTA: Panggana Siregar (Kabiro) Datuk Satia ; BIRO NIAS: Yamobaso Giawa (Kabiro), Ingati Zega, Ogamota Mendrofa, Ediwan Zega, Noveli Zebua; BIRO DUMAI-BENGKALIS: Salamuddin Purba; BIRO ROKAN HILIR: Susanto; WARTAWAN DAERAH: Abdul Rahman Manik, Mulia Sinaga, Serah Purba (Sergai); Panusunan P Silitonga(Deliserdang); Ruben Sembiring, Elison Sipahutar (T Tinggi); Jhon Edy Saragih (Simalungun); Hendrik Nadeak (Dairi); Perasan Tumangger (Pakpak Bharat); Hasanuddin Hasibuan, Syawaluddin Tanjung, Mhd Dani Siahaan, Ali Tua Rambe (Labuhanbatu); Nurdinsyah Sima, Sofyan Edi Tan, Timbul Sinaga (Labuhanbatu Utara); H Zam Zam, Suraji, Armadasayuti, M Nurdin Pohan (Labuhanbatu Selatan); Imran Nasution, Buyung AL (Kisaran/Asahan); Sahril (Batubara); Taufik Hidayat (Panyabungan); Ahmad Gozali (Palas); Juliber Silitonga (Tobasa), Frans Rumahorbo (Samosir); Sahat Lumbantoruan, Parlindungan Rajagukguk (Taput); Bachruni Sitompul (Aceh Tamiang); M Marwansjah SE (Takengon/Bener Meriah/Langsa); Azwar Tanjung (Aceh Singkil); Aguswandha Manik SH, Kartolin Tumangger, Alamuddin Banchin (Subulussalam); Sofian (Lhokseumawe); Jamudin Selian, Sahidin (Kutacane); Inro Kisinger Tua, Doni Efendi, Sarman Naimbaton (Jambi); Arman Maduwu, Tomas Yeferson Lature (Nias Selatan).


KPK POS

5

KORUPSI

E D I S I 176 28 NOVEMBER â&#x20AC;&#x201C; 4 DESEMBER 2011

LIPSUS

BPK Akui Indikasi Fiktif KABAG Humas BPK Medan Mikael Togatorop SH MH mengaku telah terjadi indikasi fiktif di Dinas PU Pemko Binjai. Dan pihaknya sudah menyerahkan hasil audit tersebut ke BPK Pusat untuk segera dilimpahkan ke penegak hukum. Mikael menambahkan pihaknya hanya bertugas mengaudit laporan keuangan Pemko Binjai, ternyata ditemukan penyimpangan dan indikasi fiktif. Sementara untuk melanjuti proses hukum hanya BPK Pusat yang berwenang melimpahkanya ke penegak hukum. "Indikasi fiktif memang terdapt di Dinas PU Pemko Binjai. Dan temuan tersebut sudah kita limpahkan ke BPK pusat. jadi BPK pusat yang menyerahkan temuan tersebut ke penengak hukum untuk dilakukan proses hukum," jelasnya.(VIN)

HASIL PEMERIKSAAN LAPORAN KEUANGAN PEMKO BINJAI

BPK Temukan Penyimpangan dan Indikasi Fiktif Badan Pemeriksa Keuangan (BPK) melakukan pemeriksaan pada Pemko Binjai per tanggal 31 Desember 2009 dan 2010 berupa laporan realisasi anggaran, arus kas, dan catatan atas laporan keuangan yang berakhir pada tanggal tersebut.

Tak Sanggup, Serahkan ke KPK PRAKTISI hukum Sofyan Taufik SH mengatakan seharusnya dengan adanya temuan itu tentunya di tangani oleh pihak yang terkait seperti kejaksaan dan kepolisian. Mestinya pihak kejaksaan dan kepolisian sudah wajib menindaklanjuti temuan BPK untuk membuktikan benar atau tidak temuan itu terjadi. Jika Kejaksaan tidak sanggup menindaklanjuti temuan itu maka serahkan saja temuan itu ke KPK. Menurut Sofyan, untuk proses awal Kejatisu harus serius dalam menanganinya. Apalagi ini menyangkut tentang kerugian negara. Karena masih banyak kasus korupsi yang mengambang. Dengan adanya temuan BPK itu, Kejatisu segera menindaklanjuti. Dengan adanya tindak lanjut itu maka dapat terungkap siapa yang bertanggungjawab atas adanya temuan tersebut. Dalam perangkatnya, peran Kejatisu untuk mengungkap temuan itu sangatlah penting. Karena penyidikan dan penyelidikan dapat dilakukan oleh pihak Kejatisu. "Jika kejatisu tidak punya keberanian dalam mengungkap temuan itu, maka hapuskan lembaga itu," tegasnya. Sofyan pun berharap positif dalam temuan itu. Dimana harapan itu harus juga sesuai dengan yang melaksanakan yaitu pejabat publik untuk tidak melakukan korupsi. Sehingga pemberantasan korupsi dapat berjalan dengan baik. Dan agar kedepannya bisa lebih baik, dan dapat mempersempit kesepatan para koruptor atau bahkan korupsi bisa dihapuskan. Jika kita mengaku negara hukum, maka para penegak hukum janganlah bermain mata dalam menyelesaikan temuan itu. Mental aparaturnya harus diperbaiki karena jika mental aparaturnya buruk walaupun aturan diperketan tetap saja masih bisa kecolongan. Karena saat ini posisi hukum itu selalu tertinggal. "Peristiwa itu terjadi baru hukum itu ada. Kondisi itu tidak seiring dengan perkembangan zaman," ujarnya.(VIN)

Pemprovsu Belum Terima Laporan DITEMUKANNYA penyimpangan anggaran di Pemko Binjai, Kahumas Pemprovsu Jakaria mengatakan, sampai saat ini pihak Pemprovsu belum menerima laporan apapun terkait adanya penyimpangan di Pemko Binjai. "Sampai saat ini, kami belum mengetahui permasalahannya dan belum bisa memberikan komentar apapun tentang pengembalian anggaran tersebut," tukasnya. Kepala Biro Keuangan Pemprovsu Mahmud Sagala, tidak menjawab saat di hubungi via telepon. Begitu juga via sms, Mahmud tetap tidak membalas saat ditanya tentang pengembalian anggaran oleh SKPD Pemko Binjai. (FER)

DALAM catatan pada laporan keuangan butir 5.a.1.2, saldo kas di Kas Bendahara Pengeluaran pada 31 Desember 2010 sebesar Rp 4.085.448.063, terdiri dari sisa uang persediaan Tahun Anggaran (TA). 2010 sebesar Rp 3.534.679. 856, sisa uang persediaan TA 2009 Rp 393.550.875, dan penerimaan pajak yang belum di setorkan ke kas negara sampai 31 Desember 2010 sebesar Rp 157.217.332. Menurut BPK, kas di bendahara pengeluaran tersebut nilainya tidak wajar karena terdapat penyimpangan atas penggunaan sisa kas yang tidak dapat di pertanggungjawabkan sebesar Rp 3.379.928.107. Nilai ini terdapat pada Dinas Pekerjaan Umum sebesar Rp 2.666.362.570, Dinas Koperasi dan UKM sebesar Rp 307.083.500, Dinas Pemuda dan Olahraga sebesar Rp 400.072.500, serta di Badan Pendidikan dan Latihan sebesar Rp 6.699.537. Selain itu, terdapat sisa UP TA 2009 per 31 Desember 2010 sebe-

sar Rp 393.550.875, di empat Satuan Kerja Perangkat Daerah (SKPD). Sisa UP yang belum di setorkan sampai tanggal 16 Mei 2010 sebesar Rp 378.550.875, yang di gunakan secara pribadi. Penerimaan pungutan pajak bendahara pengeluaran yang di gunakan untuk kepentingan pribadi pada Badan Diklat sebesar Rp 43.295. 533, kemudian pada Dinas Pemuda dan Olahraga sebesar Rp 33.108. 149. Catatan atas laporan keuangan juga mengungkapkan saldo investasi permanen per 31 Desember 2010 sebesar Rp 28.892.561. 170. Investasi permanen tersebut berupa penyertaan modal Pemko Binjai pada lima badan usaha, di antaranya pada dua BUMD yang kepemilikannya 100% Pemda. Penyertaan modal di sajikan sesuai besar nilai perolehan sesuai standar akuntansi pemerintahan dan metode ekuitas. Jika Pemko Binjai melakukan ini maka nilai investasi untuk kedua BUMD tersebut sebesar Rp 21.476.891.

170, akan menjadi sebesar Rp 23.697.355.708 sampai 31 Desember 2010. Penurunan ekuitas terjadi karena kedua BUMD terus mengalami kerugian sesuai hasil audit. Selain itu terdapat perbedaan pengakuan nilai penyertaan modal antara Pemda dan BUMD yang signifikan pada PD Pembangunan, perusahaan ini menyajikan nilai penyertaan modal sebesar Rp 219.754.276, dari penyertaan modal yang telah disetorkan Pemko Binjai sebesar Rp 19. 249.998.425. Juga terungkap, saldo aset tetap sebesar Rp 1.406.966.179.107, namun pencatatan dan pengelolaan aset belum tertib. Seperti penyusunan Kartu Inventaris Barang (KIB) belum seluruhnya menyajikan nilai aset SKPD. Aset belum sepenuhnya dilengkapi Kartu Inventaris Ruangan, Nomor Inventaris Barang, serta belum ada ketetapan kebijakan akuntansi mengenai konsep nilai perolehan dan batas kapitalisasi aset. Dan

DPRD SU Belum Terima Audit ANGGOTA Komisi A dapil 11 DPRD Sumut Raudin Purba mengatakan saat ini pihaknya belum mendapat rincian sesunguhnya dari hasil pemeriksaan laporan keuangan Pemko Binjai. Namun kalau penyimpangan tersebut fakta. Maka temuan tersebut harus diselesaikan. Raudin menjelaskan, korupsi ada tiga macam. Dimana yang pertama adalah memperkaya diri sendiri. Dan memperkaya suatu kelompok, serta korupsi yang disebabkan karena kesalahan administrasi. Jadi jika penyimpangan tersebut disebabkan karena kesalahan administrasi maka harus segera diperbaiki dan ditinjau kembali. Karena tidak sepatutnya penyimpangan itu merugikan Negara.Dan sebaliknya, jika korupsi tersebut terjadi karena memperkaya diri sendiri atau kelompok maka temuan itu harus dituntaskan sampai keakar-akarnya. "Jika temuan itu disebabkan karena memperkaya diri sendiri maka pelaku korupsi itu harus dituntut sampai tuntas keakar-akarnya," tegasnya. Menurut Raudin, yang bertanggungjawab dalam temuan itu adalah Walikota Binjai dan SKPD (satuan Kerja Perangkat Daerah) Binjai. Raudin pun menyarankan untuk temuan tersebut dilimpahkan ke Kejatisu agar disidangkan di Pengadilan Tipikor. "Jangan ditunda-tunda lagi dan Walikota Binjai jangan mencari-cari alasan untuk tidak memproses temuan tersebut," katanya lagi. Raudin mengharapkan, jika temuan tersebut terbukti maka untuk berikutnya pejabat yang lainnya tidak mengulangi kesalah yang sama. Karena sebagai pejabat publik harus mempunyai moral, harga diri dan kewibawaan. Dan kepercayaan yang diberikan masyarakat kepadanya haruslah dijaga dan

jangan dinodai. Karena masyarakat kita masih lapar dan visi misi Gubsu (Gubernur Sumatera Utara) bahwa masyarakt tidak lapar, tidak sakit dan tidak bodoh belum terjamah di masyarakat. Ditambahkan Raudin, jika temuan tersebut sudah sampai kke DPRD SU maka pihaknya akan menyikapi temua tersebut. Khususnya komisi yang terkait dalam hal ini adalah Komisi A dan Komisi C. "Kalau temuan itu sudah sampai ke DPRDSU maka kita akan menyikapi temuan itu." (VIN)

terdapat belanja modal yang dperuntukkan bagi instansi vertikal/lainnya yang masih disajikan sebagai aset Pemko sebesar Rp 1.229. 846.000. Dalam laporan realisasi anggaran, saldo realisasi belanja barang jasa sebesar Rp 59.350. 971.899, di antaranya belanja barang jasa untuk pekerjaan swakelola jalan jembatan TA 2010 di Dinas Pekerjaan Umum sebesar Rp 1.322.297.440. Pekerjaan ini setelah di uji fisik berindikasi fiktif. Ketidakpatuhan terhadap peraturan tersebut berpengaruh secara signifikan terhadap saldo nilai kas bendahara pengeluaran, nilai realisasi belanja barang jasa, dan Sisa Lebih Penggunaan Anggaran (SILPA). Begitu pula pada pendapatan retribusi pelayanan kesehatan pada rumah sakit umum daerah, saldo penerimaan hingga 31 Desember 2010 sebesar Rp 893. 480.135. Saldo ini belum termasuk penerimaan Jamkesmas selama tahun 2009 - 2010 sebesar Rp

10.047.168.207, dan penggunaan langsung dari dana Jamkesmas sebesar Rp 9.619.499.081. Tapi dalam pengelolaan dana Jamkesmas, tim pengelola telah menarik uang lebih besar dari klaim yang telah selesai di verifikasi oleh tim verifikator independen. Terdapat sisa kas atas klaim yang telah di verifikasi sebesar Rp 427.669.126, yang belum termasuk pendapatan daerah dan belum di tetapkan dalam kebijakan kepala daerah. Menanggapi dugaan penyimpangan dan indikasi fiktif ini, anggota DPRD Binjai Komisi B Maruly Malau meminta BPK supaya tegas dan cepat melaporkan hal ini ke Kejari. Jika para SKPD tidak berupaya mengembalikan anggaran tersebut dan inspektorat harus lebis serius bekerja. "Jangan ada dusta dan jangan ada main dengan BPK sehingga kasus korupsi di Kota Binjai bisa terungkap," kata politisi dari Partai PPP ini.(MEI)

Mengembalikan Anggaran Bukan Bebas Hukum PRAKTISI Hukum Surya Herdiansyah SH menegaskan, jika sudah ada temuan yang mengarah pada bentuk penyimpangan, lembaga yang berkompeten harus sesegera mungkin mengusutnya. "KPK dan Kajari harus proaktif dan jangan mendiamkan kasus tersebut apalagi kasusnya sudah mencuat kepermukaan. Dan tentu saja masyarakat sudah mengetahuinya. Mengembalikan anggaran bukan berarti luput dari hukum. Penyimpangan yang telah dilakukan tanpa adanya pertanggungjawaban harus diusut tuntas. Dalam hal ini walikota Binjai jangan mencari alasan untuk melindungi para koruptor. Seharusnya, sambungnya lagi, walikota harus berkordinasi dengan aparat penegak hukum jika sudah menerima laporan dari BPK tentang penyimpangan tersebut. "Jangan justru melindungi anggotanya," sebutnya. Dalam rangka pembenahan hukum di Indonesia bentuk tindak pidana korupsi harus di usut tuntas. "Dikembalikan atau tidaknya anggaran tersebut, pelaku penyimpangan anggaran negara tetap harus dihukum. Tapi harus sesuai dengan bukti-bukti yang akurat," paparnya. Kajari Harus Proaktif Badan Pemeriksa Keuangan (BPK) Perwakilan Sumut menemukan adanya anggaran fiktif di Pemko Binjai Tahun 2009-2010. Hasil audit BPK dinyatakan

kas pengeluaran bendahara Pemko Binjai bukan merupakan nilai yang wajar. Penyimpangan yang tidak bisa dipertanggungjawabkan tersebut sebesar Rp.3.379.928.107. Menyikapi permasalahan tersebut, praktisi hukum M Santri Azhar Sinaga SH menyebutkan, seharusnya Kajari Binjai lebih pro aktif untuk melakukan penyidikan. "Sudah ada temuan, Kajari harus menindaklanjutinya tanpa memandang instansi yang terlibat," ucap Wakil Direktur LPH KADIN Sumut ini. Demikian juga halnya dengan walikota Binjai, sambungnya lagi, untuk tidak menghalangi pihak aparat hukum untuk melakukan penyidikan sehingga proses penyidikan bisa berjalan dengan lancar, sebutnya. Menurut Direktur LBH Bimantara ini, adanya temuan dari BPK membuktikan bahwa setiap bentuk penyimpangan haruslah ditindaklanjuti dan jangan di diamkan. Dengan demikian akan menimbulkan efek jera bagi yang lainnya. Kendati demikian, jika masih ada niat baik dari masing-masing SKPD dan rekanan untuk mengembalikan anggaran tersebut, bukan berarti bebas dari hukum. Penyimpangan yang dilakukan disengaja ataupun tidak disengaja haruslah tetap menjalani proses hukum. "Dalam hal ini Walikota tidak perlu melindungi orang-orangnya yang telah melakukan penyimpangan karena hal tersebut melanggar hukum," tegasnya.(FER)


KPK POS

6 N A D

POLITIK

E D I S I 176 28 NOVEMBER – 4 DESEMBER 2011

Temuan DPRK Perlu Ditangani Serius

Warga Mendesak Pemekaran Desa SUBULUSSALAM - Mengingat penduduk Kota Subulussalam meningkat drastis, seiring laju pembangunan disegala sektor, Pemko dipandang perlu mengakomodir aspirasi-aspirasi masyarakat untuk melakukan percepatan pembangunan. Pemekaran desa sudah menjadi sebuah kebutuhan publik. Sebagai contoh di Kecamatan Simpang Kiri dan Penanggalan, ada beberapa desa yang telah memiliki penduduk 3000 jiwa perdesa. Untuk menyikapinya, Walikota Subulussalam M. SAkti, SH telah mengelaurkan Peraturan Walikota (Perwal) No. 18 tahun 2011 tentang pemerintahan Desa/Kampong. Penetapan Perwal tersebut merupakan wujud keseriusan Pemko dalam penguatan penyelenggaraan pemerintahan desa agar lebih meningkatkan pelayanan dan pemberdayaan kepada masyarakat. Menurut Kabag Tata praja Setdako Subulussalam Saman Sinaga, SH didampingi Kabid Pemdes M.Ali Tumangger menyebutkan persoalan pemekaran desa telah lama muncul. Sebelum Subulussalam lahir ini telah dimohon ke Kabupaten Aceh Singkil, akan tetapi belum membuahkan hasil. Diakuinya saat ini pemekaran desa di Kota Subulussalam telah menjadi kebutuhan, melihat kepadatan penduduk. Mempermudah pelayanan masyarakat, pemekaran sebuah solusi tepat. Dalam hal ini Walikota Subulussalam serius melihat situasi ini dengan menerbitkan Perwal. Disisi lain menurut Kabag, semua pihak harus memahami pemekaran desa harus memenuhi beberapa syarat. Pertama, paling sedikit memiliki 1000 jiwa atau 200 KK, kampong induk telah berusia lima tahun. ”Ini persyaratan mutlak dan bila tidak dipunuhi usulan pemekaran akan ditolak,”kata Saman Sinaga. Pemekaran kampong murni berlandaskan kebutuhan masyarakat demi peningkatan pelayanan. Bila hal ini tersahuti dengan baik, maka kami dari Bagian Tata Praja siap mengimplementasikan seluruh kebijakan Walikota, dan dalam hal ini mohon dukungan dari DPRK Subulussalam.(KAR)

Warga Sultan Daulat Harapkan Sumur Bor SUBULUSSALAM - Reses anggota DPRK Subulussalam di Kec. Sultan Daulat daerah pemilihan (Dapil) III, di Aula Sekcam setempat, Rabu(23/11) membawa rahmat bagi masyarakat. Pasalnya Netap Ginting memberi peluang program ketersediaan air bersih di kecamatan itu dengan anggaran mencapai Rp2,5 milyar. Sarbaini sebagai tokoh masyarakat berharap program air bersih diplotkan ke kecamatan tersebut. Karena warga membutuhkan tiga unit sumur bor dari Dinas Pertambangan Energi dan Sumber Daya Mineral dinilai gagal. Salah seorang kepala sekolah menegaskan air bersih di daerah ini menjadi kendala karena sejak 2010 SD Negeri Bangunan UNICEF dan beroperasi, tidak pernah ada air bersih. ”Kedatangan anggota DPRK ini membawa berkah agar ari bersih bisa terwujud di daerah ini,” terangnya. Warga lain mengharap kedatangan wakil rakyat dapat mencari solusi penyelesaian masalah antara pihak perusahaan pemegang HGU dengan warga soal CSR. Anggota DPRK diminta dapat menjadi mediator terhadap perusahaan. Sebelumnya Plt Camat Sultan Daulat Baginda Nasution memaparkan dan 17 desa di kecamatan Sultan Daulat. Salah seorang warga mengatakan, apabila kedatangan wakil rakyat tidak membawa berkah dalam meningkatkan kesejahteraan masyarakat, priode mendatang jangan salah pilih lagi.(KAR)

SUBULUSSALAM–Permasalahan program pembangunan Kota Subulussalam ditemukan Pansus DPRK Subulussalam. Ada beberapa SKPK yang menjadi sorotan dan satu demi satu terkuak.

Gubernur Lantik Direksi Bank Jambi JAMBI - Gubernur Jambi Drs. H. Hasan Basri Agus (HBA) melantik Direksi Bank Jambi, Rabu (22/11) di Ruang Pola Kantor Gubernur Jambi. Pelantikan itu mempunyai makna sangat strategis untuk memajukan perekonomian daerah. Seperti diketahui Direksi sangat berperan mengangkat dan memberhentikan serta menetapkan susunan organisasi dan tata kerja Bank Jambi. “Pelantikan memiliki makna penting bagi kemajuan Bank Jambi,” ujar Gubernur. Sangat logis Gubernur berharap Direksi yang baru mampu menghadapi tantangan yang semakin berat. “Bank Jambi harus meningkatkan pelayanan dan IT-nya,” tegas HBA.

Gubernur juga menyampaikan beberapa pilar tata kelola perusahaan yang baik, ketahanan kelembagaan yang kuat dengan terpenuhi rasio kecukupan modal sesuai ketentuan Bank BI. Mengutamakan pertumbuhan kredit produktif, mendukung pertumbuan UMKM dan penggerak tabungan masyarakat, kemampuan melayani kebutuhan dengan mempermudah dan memperluas jaringan pelayanan. Gubernur berharap BPD Jambi dapat mewujudkan BPD Regional Champion atau bank terkemuka di daerah yang mampu menghasilkan produk dan layanan kompetitif, inovatif dengan jaringan luas serta dikelola profesional guna mendorong pertumbuhan ekonomi daerah.

BPD regional Champion yaitu komitmen BPD yang ditandatangani Gubernur se-Indonesia pada 21 Desember 2010, ditindaklanjuti pemegang saham BPD seProvinsi Jambi pada 6 Januari 2011. Besarnya tantangan dan tanggungjawab direksi yang baru merupakan hal lumrah bagi pemangku jabatan penting. “Saya berharap dapat melaksanakan amanah yang telah diberikan dengan baik sesuai sumpah jabatan.” Yang dilantik, Direktur Utama Drs. Subekti Heriyanto, MM, Direktur Umum, H. Zulyani M. Jazid, SE., Direktur Pemasaran Drs. H. M. Rivai., Direktur Kepatuhan Drs. H. Achmad Thamrin. Hadir Ketua TP PKK Provinsi Jambi Hj. Yusniana Hasan Basri, Ketua DPRD Jambi Effendi Hatta, Walikota Jambi dr. Raden Bambang Priyanto, Bupati Sarolangun Drs. H. Cek Endra, Pejabat di Lingkup Pemerintah Provinsi Jambi.(INRO)

Silaturahmi Danrem 011 Lilawangsa ACEH TAMIANG - Dalam Rangka kunjungan kerja (kunker) dan silaturahmi perdananya, di wilayah KODIM 0104 yang menekeli 3 daerah Kabupaten/Kota, kabupaten Aceh Tamiang, Pemko Langsa dan Kabupaten Aceh Timur, kunjungan dan silaturahmi perdananya tiba di Bumi Muda Sedia Kabupaten Aceh Tamiang. Komandan Korem (Danrem) 011 Lilawangsa Kol, inf. A. Rachim Siregar secara tidak langsung telah melakukan NOSTALGIA bersama istrinya dan rombongannya dan mengingat semasa kecilnya berada di dua kota yaitu Kabupaten Aceh Tamiang dan Kota Langsa, Senin (14/11) dan pada (15/11) dilanjutkan kunjungannya ke Pemko Langsa pekan lalu. Saat kunker dan silaturahmi DANREM 011 LILAWANGSA dan di dampingi istrinya serta rombongan, di sambut sejumlah muspda plus dan muspika di jajaran Pemkab Aceh Tamiang di Pendopo Bupati Kabupaten Aceh Tamiang, dan di sambut dengan berpantun secar adat istiadat di Bumi Muda Sedia Kabupaten Aceh Tamiang. Pertemuan dan kunjungan DANREM 011 LILAWANGSA ke Aceh

Tamiang pada saat acara pertemuan tersebut Bupati Kabupaten Aceh Tamiang, Drs. H. Abdul Latief dalam sambutannya melaporkan luas wilayah Kabupaten Aceh Tamiang terbagi dalam dua belas (12) kecamatan dan sejumlah penduduknya, serta bermohon atau berharap kepada Danrem 011 Lilawangsa agar kiranya segera terbentuknya Kodim di Bumi Muda Sedia Kabupaten Aceh Tamiang. Danrem 011 Lilawangsa, me-

ngatakan dalam sambutannya “ saya datang kedua kota ini (Aceh Tamiang dan Kota Langsa), saya bukan orang baru, karena saya lahir dan dibesarkan di dua kota ini hingga sampai tamat SMA baru selanjutnya melanjutkan pendidikan ke akademi militer, orang tua saya dulu tinggal di langsa, bahkan sampai sekarang masih banyak keluarga saya dan keluarga orang tua saya di Aceh Tamiang, Kota Langsa, dan Aceh Timur”, ujar Danrem.(BSO)

Ekspose Jelang Akhir Jabatan ACEH TIMUR - Memasuki masamasa akhir jabatan Bupati Aceh Timur, tim inspektorat Provinsi Aceh melaksanakan kegiatan ekspose bupati dalam rangka pemeriksaan berakhirnya masa jabatan pelaksanaan tugas Bupati yang dijadwalkan berlangsung mulai 16 s/d 30 Nop 2011 mendatang. Pemeriksaan bagi kepala daerah sesuai Permendagri No.24 Tahun 2007 tentang pemeriksaan masa jabatan. Dinyatakan sebelum atau sesudah berakhirnya masa jabatan Bupati/Walikota harus dilakukan pemeriksaan terhadap pelaksanaan tugas dan tanggung jawab sebagai kepala daerah yang berhenti dari masa jabatannya. Adapun maksud dan tujuan sasaran pemeriksaan memperjelas batas tugas dan tanggung jawab kepala daerah, mengoreksi dan atau mem-

perbaiki pelaksanaan kebijakan daerah yang tidak sesuai peraturan perundang-undangan dan mengidentifikasi indikasi yang mengarah pada KKN. Ruang lingkup pemeriksaan meliputi pengelolaan SDM, barang daerah dan keuangan daerah. Hal tersebut dikatakan Kepala Inspektorat Provinsi Aceh, Syarifuddin. Z, SH.MH ketika membuka acara ekspose Bupati Aceh Timur jelang masa akhir jabatan di Aula Pendopo Bupati Aceh Timur, Langsa Kamis lalu. Lebih lanjut dijelaskan salah satu tolak ukur pemerintah yang berhasil adalah meningkatnya ekonomi masyarakat, kesamaan pandangan dengan semua lapisan penyelenggara negara, meningkatnya kemampuan menyekolahkan anak-anak serta meningkatnya kepuasan masyarakat terhadap penyelenggaraan pemerintahan.

Bila kita perhatikan selama ini, masih banyak kelemahan-kelemahan seperti bidang birokrasi pejabat tidak sesuai keahlian dan terlalu sering terjadi penggantian sehingga tidak mungkin berkarya. Bupati Aceh Timur, Muslim Hasballah menjelaskan, Aceh Timur terletak di pesisir timur Provinsi Aceh memiliki 24 Kecamatan dengan berbagai macam budaya dan kultur dari masyarakatnya. Oleh sebab itu membangun suatu daerah dalam waktu 5 tahun belumlah terlihat nyata, sebab masih banyak kekurangan serta keterbatasan dana yang dimiliki daerah. Sementara Sekdab Aceh Timur sangat mengharapkan seluruh Kepala SKPD, para Camat sementara waktu tidak meninggalkan tempat tugas. Itu untuk kelancaran pemeriksaan tim Inspektorat.(BSO)

Hal itu dipaparkan pada sidang paripurna laporan Pansus beberapa hari yang lalu. Saat ini tak ketinggalan Dinas Perindagkop dan UKM Kota Subulusaslam. Yang paling fatal tentang pengembalian Dana kredit UKM sebesar Rp2.500.000.000 kepada masyarakat, sejak 2009 hingga 2010, belum tertangani dinas terkait. Pansus DPRK mendesak agar pengembalian dana kredit UKM ini perlu perhatian serius dinas terkait agar dana ini dapat digilir bagi masyarakat membutuhkan. ”Program bantuan dana kredit UKM ini memang sangat bagus untuk membantu usaha kecil menengah (UKM) di Kota Subulussalam, akan tetapi pengembaliannya harus tepat waktu, karena ini bukan “dana hibah,” ungkap seorang pengamat. Disisi lain penyaluran dana kredit UKM ini dalam veri-

fikasi data penerima, kurang tepat. Sehingga ada dalam satu keluarga di tahun 2009 juga dapat di 2010. Sepertinya petugas verifikasi kurang jeli, padahal hal seperti ini tak boleh terjadi. Selain dana UKM, temuan lain di Dinas Perindagkop dan UKM adalah Projek mingguan di setiap Kecamatan dan status tanah yang belum jelas. Pembangunan pabrik sagu di lima Kecamatan perlu ditindak lanjuti, terlebih pemasangan mesin. Seterusnya pengoperasian pabrik tapioka yang menghabiskan dana miliaran rupiah sampai saat ini belum jelas penanganannya. DPRK menyayangkan dinas ini yang terkesan tak mampu melaksanakan program pembangunan, padahal bila semua program walikota berjalan sesuai rencana, pasti masyarakat terbantu, dan PAD Kota Subulussalam akan bertambah.(KAR)

Lift Kantor Gubernur Kembali Rusak JAMBI - Dua staf pegawai Bagian Kesramas Kantor Gubernur Provinsi Jambi terjebak dalam lift. Nana dan Yeni yang turun dari lantai III bermaksud kembali bekerja pada ruangan dan memasuki lift yang sering rusak. Namun oleh teknisi telah diperbaiki serta tidak ada gangguan. Saat salah satu orang staf pegawai Kesramas menekan ke lantai pertama tiba-tiba lift rusak. Dalam keadaan panik, kedua staf tersebut menekan tanda darurat untuk meminta pertolongan. Bagian administrasi yang berada tepat di depan lift saat

mendengar tanda darurat langsung meminta bantuan untuk membuka pintu, serta memanggil Bagian Biro Umum khususnya Bagian Perlengkapan untuk melihat kerusakan yang sering terjadi. Menurut Yani, lift di Kantor Gubernur Jambi ada dua, tetapi salah satunya sering macet serta beberapa pegawai maupun masyarakat umum serta wartawan sering terjebak dalam lift. Gimana jika yang terjebak itu Gubernur, Wakil Gubernur, Sekda serta tamu khusus yang menaiki lift yang rusak, tentu akan menjadi persoalan besar.(INRO)

Partai Golkar Haram Mengemis SUBULUSSALAM - Mengharapkan bantuan dengan cara mengemis bagi Partai Golkar haram. Demikian disampaikan Merah Sakti SH sebagai ketua DPD II Partai Golkar Subulussalam dan orang nomor 1 di Pemko Subulussalam. Sambutan itu disampaikan pada pembukaan pelaksanaan Pendidikan dan Pelatihan Karaterdes, Subulussalam Minggu (20/11) di Grand Mitra Hotel Subulussalam Penanggalan. Sakti mengharapkan kader Partai Golkar yang duduk di lembaga legeslatif harus lebih aspiratif dan mampu mendengar, melihat dan memperjuangkan keinginan masyarakat. ”Jangan hanya sekedar duduk di kursi goyang karena tanpa masyarakat tidak dapat tercapai,” terang Sakti. Saya selaku ketua DPD II sekaligus Walikota Subulussalam sedang mengejarkan sejumlah infrastruktur jalan, lalu program 2012 dilanjutkan sejumlah insfra-

struktur perkantoran karena kita tidak bisa mengerjakan sekaligus terpaksa bertahap. Acara itu dibuka ketua DPD I Partai Golkar Sulaiman Abda ditandai penyematan tanda peserta secara simbolis oleh unsur pimpinan Partai Golkar. Hadir dalam acara itu ketua DPD I H.Sulaiman Abda dan sejumlah pengurus dan anggota Said Fuad Zakaria anggota komisi VIII DPRRI, Wakil Walikota H.Affan Alfian Bintang SE mewakili Muspida Plus dan sejumlah pimpinan Parnas/Parlok, kader kader partai Golkar seluruh dari setiap kecamatan.(KAR)

Disinyalir Ada Jual Beli Jabatan, Walikota Sungai Penuh Membantah SUNGAI PENUH - AJB selaku Walikota Sungai Penuh terhitung 2011 ini, telah melakukan programprogramnya. Program 100 hari menitik beratkan pada kebersihan dan Kartu Tanda Penduduk. Termasuk pelantikan kabinet eselon II, III dan IV. Pelantikan kabinet ABJ

dan Ardinal selaku Walikota dan Wakil Walikota terkesan lamban dan ada maunya. Desas desus terdengar ’jual beli kursi jabatan’ telah jadi momok dikalangan pejabat Kota Sungai Penuh. Menurut rumor dari kalangan Pemkot Sungai Penuh, kursi Kadis Kebersihan Pertamanan

Pemakaman dan Pemadam Kebakaran (DKP3K) saat ini masih kosong menimbulkan tanda tanya besar. Dari beberapa sumber berkembang, AJB sedang menunggu siapa yang mampu mengeluarkan dana sejumlah Rp750.000.000 untuk mendapatkan jabatan tersebut.

Kondisi belum diisinya kursi Kadis DKP3K memperkuat dugaan bahwa AJB tidak memilki komitmen dalam bertindak. Desas desus AJB Walikota Sungai Penuh memperjualbelikan jabatan Kadis DKP3K menjadi perhatian dan perlu pengawasan. AJB dan Ardinal Salim

selaku saat dikonpirmasi melalui telepon seluler di nomor 085215533xxx dan Ardinal Salim di nomor 085266608xxx, kedua membantah terjadi jual beli kursi SKPD. Katanya Kadis KP3K dalam proses seleksi, orangnya sudah ada, tinggal pelantikan, insyaallah tidak ada yang pakai uang.

”Tolong tunjukan pada kami, kalau ada yang menjadi Kadis, Kakan serta Kabag diminta uang, tulis nama jelas yang bersangkutan, nama anda yang mengadu,” jawabnya keduanya membantah. Setelah dikonfirmasi, Senin (21/11) dilaksanakan pelantikan Kadis KP3K,

Yuskal yang semula Plt Kadis KP3K dilantik menjadi sebagai kadis KP3K defenitif. Selain itu 9 Dinas, Kantor dan Badan belum diproses. Di antaranya Dinas DPPKA, Dinas Bencal, Peternakan, Pertanian, Penyuluhan, Lingkungan Hidup, Dikjar, PU, Bappeda.(DONI)


KPK POS

7

POLITIK

E D I S I 176 28 NOVEMBER – 4 DESEMBER 2011

HUT Ke-66 PGRI Di Madina PANYABUNGAN - Pengikatan HUT PGRI ke – 66 di kabupaten mandailing Natal di laksakan di lapangan kantor Bupati lama Aek godang Panyabungan,bertindak selaku Pembina Upacara Ketua Pengadilan Negeri panyabungan, jum’at ( 25/11 ).yang di hadiri Para Guru dan para Pelajar serta Para SKPD Pemkab madina. Dalam sambutan Pengurus Besar PGRI Dr.H. Sulistiyo, M,Pd yang di bacakan oleh Ketua Pengadilan Negeri panyabungan,setelah seratus hari proklamasi kemerdekaan RI, lahirlah PGRI dalam kongres Indonesia di Surakarta, PGRI lahir dari kesadaran kebangsaan dan semangat perjuangan para guru, para pengsiunan guru dan para pengawai Kementrian pendidikan. Kita patut Bersyukur bahwa keputusan Presiden nomor 78 tahun 1994 menetapklan hari guru nasional dan hari lahirnya PGRI pada 25 Nopember sebagai hari Guru nasional, PGRI lahir dengan nafas Perjuangan kebangsaan untuk mempertahankan dan menyempurnakan Republik Indonesia dan lahir untuk mencerdaskan bangsa. Dengan HUT PGRI ke-66

bilan sumpah/janji PNS tahun 2011 ini untuk membina PNS yang bersih, jujur dan sadar akan tanggung jawabnya sebagai unsur aparatur Negara, abdi Negara, dan abdi masyarakat sesuai dengan PP Nomor 21 tahun 1975 tentang sumpah/janji PNS. Sementara itu Bupati Pakpak Bharat Remigo Yolando Berutu dalam arahannya yang dibacakan Sekda Drs. Holler Sinamo, MM mengharapkan agar PNS yang telah mengambil sumpah bekerja dengan sungguh-sungguh dan professional serta proporsional sesuai dengan tugas pokok dan fungsi yang diembankan kepada masing-masing PNS. “ Kepada Para PNS Pakpak Bharat bekerjalah dengan baik sesuai tufoksi masing-masing, jangan mengecewakan pemerintah dan masyarakat” harap sekda membacakan aarahan Bupati Pakpak Bharat. Acara tersebut dihadiri, Sekda, Kepala KKD,Para Asisten, sejumlah Kadis, Rohaniawan Islam, Protestan, Katolik, para PNS Pemkab Pakpak Bharat yang akan diambil sumpah janjinya, serta undangan lainnya. (WT)

Peringatan Hari Pahlawan Hikmad KISARAN - Peringatan Hari Pahlawan di Kabupaten Asahan berjalan hikmad, peringatan dipusatkan di Lapangan Parasamya Kisaran, Kamis 10 November2011.HariPahlawanyang dikuti oleh pemuda serta peserta Napak Tilas dipimpin langsung oleh Bupati Asahan, Drs H Taufan Gama Simatupang MAP dan sebagai komanda upacara Kapten Inf Efendi Munthe. Usai melakukan peringatan Hari Pahlawan, acaradiwarnaidenganfragemenyangdilakukanoleh seluruhparaanggotaLVRIAsahan,aksiyangdilakukan veterantersebutdilakukandihadapanBupatiAsahan, besertaunsurmuspidaplussertaparaundanganyang hadir mengikuti acara peringatan hari Pahlawan 10 November tersebut. Selain itu, acara juga dirangkai dengan kehadiran para peserta napak tilas pemuda ke 25 yang digelar oleh Komite Nasional Pemuda Indonesia (KNPI) Asahan dan pemberian bingkisan secara simbolis kepada anggota LVRI dan DHC Pejuang 45 Kabupaten Asahan. Usai menyaksikan fragmen LVRI tersebut Bupati Asahan beserta muspida melakukan ziarah kemakam pahlawan Asahan dengan menabur bunga di pusara para makam pahlawan.Sebagai pemimpin upacara di makam pahlawan, Kapolres Asahan, AKBP Marzuki MM.(IN)

Sosialisasi Tugas dan Fungsi Kepling BINJAI - Wakil Walikota Binjai Timbas Tarigan

Napak Tilas KNPI Dilepas Wabup Asahan

Bupati Nias Buka Musrenbang RPJMD

ini, kita kembangkan Peran strategis Guru untuk membangun Karakter bangas, dengan ini di harapkan kita mampu memberikan insperasi kepada berbagai pihak tentang pentingnya peran strategis dalam pembangunan bangsa, dan kita yakin untuk kemajuan bangsa di perlukan pendidikan yang bermutu. Lanjut” ketika kondisi guru pada titik nadir sebagaimana kita rasakan pada awal repormasi maka PGRI memperjuangkan lahirnya undang-undang guru untuk mengangkan harkat martabat dan citra guru dan harus di akui bahwa martabat guru oleh status sosial ekonomi. Dann uapay meningkatkan kompetensi dan profesionalisme guru,PGRI akan tetap mendorong pemerintah untuk meningkatkan kesejahteraan guru. Sesuai dengan Undangundang nomor:14 tahun 2005 tentang guru dan Dosen PGRI juga mendorong pemerintah untuk menetapkan uapah minimum bagi guru Non PNS. dan masih banyak agenda guru untuk meningkatkan pendidikan di Indonesia ini. Dan saya mengajak kepada seluruh guru Dosen,dan tenaga Kependidikan untuk mengamalkan jati diri PFRI, katanya. (TH)

NIAS- Bupati Nias Drs Sokhiatulo Laoli,MM membuka Musyawarah Perencanaan Pembangunan (Musrenbang) Rencana Pembangunan Jangka Menengah Daerah (RPJMD) Kabupaten Nias Tahun 20112016 yang dilaksanakan di lantai 3 kantor Bupati Nias,kemarin. Bupati Nias dalam bimbingan dan arahannya mengatakan mekanisme sistem perencanaan pembangunan nasional mengamanatkan adanya kewajiban bagi setiap penyelenggara pemerintahan baik di pusat maupun di daerah untuk menyususn rencana pembangunan dalam jangka panjang,menengah,dan tahunan yang berfungsi sebagai kerangka acuan implementasi kebijakan

pembangunan dalam berbagai aspek dan dimensi pembangunan. Mekanisme penyususnan dokumen perencanaan pembangunan mewajibkan adanya tahapan yang harus dilalui setiap daerah sebelum menetapkan dokumen RPJMD. Salah satu tahapan dimaksud kata bupati yakni melaksankan musrenbsng sebagai upaya lebih lanjut dalam memboboti dan mempertajam rancangan RPJMD Kabupaten Nias Tahun 2011-2016 setelah melalui tahapan konsultasi publik dan kesepakatan kebijakan umum dengan lembaga legislatif sebelum dibahas dan disepakati bersama untuk menjadi Peraturan Daerah (Perda). Dikatakan,Kabupaten Nias yang kini sedang dan akan terus melakukan berbagai upaya pembenahan dalam berbagai aspek dan dimensi kehidupan masyarakat sangat membutuhkan dokumen perencanaan pembangunan yang visioner,yang

Minyak Tanah Ratusan PNS Pakpak Langka di Bharat Disumpah Madina

PAKPAK BHARAT - Sebanyak 328 orang Pegawai Negeri Sipil (PNS) formasi tahun 2008 dan 2009 di lingkungan Pemkab Pakpak Bharat disumpah. Pengambilan sumpah para PNS tersebut bertempat diaula Dinas wakil Bupati Pakpak Bharat komplek Panorama indah sindeka Salak oleh Sekda mewakili Bupati Pakpak Bharat. Selasa (15/11). Kepala Kantor Kepegawaian Jalil Angkat SH dalam laporan panitianya mengatakan, Pengambilan Sumpah /Janji PNS di lingkungan pemkab Pakpak Bharat dilaksanakan berdasrkan, Undang-undang No. 8 Tahun 1974 tentang pokok-pokok kepgawaian sebagaimana telah diubah dengan undang-undang no. 43 tahun 1999 pasal 26 ayat 1.Peraturan Pemerintah No. 53 Tahun 2011 tentang Disiplin pegawai negeri Sipil pasal 3 ayat 1. Dan surat keputusan Bupati Pakpak Bharat nomor 1093 tahun 2011 tentang panitia penyelenggara sumpah/janji PNS dilingkungan Pemkab Pakpak Bharat tahun 2011. Ditambahkan, pengam-

NASIONAL SUMUT

PANYABUNGAN–Masyarakat Mandailing Natal (Madina) resah akibat naiknya harga minyak tanah dan sulit diperoleh, sehingga masyarakat kewalahan. Walapun beberapa pengecer minyak tanah telah didatangi. Keluhan naiknya harga minyak tanah di Madina saat ini belum diketahui penyebabnya, karena selama ini harga minyak tanah Rp4000/liter. Kini sudah naik menjadi Rp6500/liter Demikian di sampaikan salah seorang ibu rumah tangga Masdani Lubis kepada KPK Pos di Panyabungan, Jum’at (25/11). Dikatakanya untuk mendapatkan minyak tanah saat ini sulit, pengecer memberikan alasan minyak tanah tidak datang mingggu ini. Sementara si pengecer masih menjual minyak tanah kepada yang lain dengan harga tinggi. Diminta pada Pemkab Madina melalui Bagian Perekonomian agar menindak pangkalan minyak tanah dan pengecer yang seenaknya menaikan harga minyak tanah tanpa ada kebijakan dari pemerintah. Bila Pemkab tidak mengambil tindakan, masyarakat semakin kesulitan dan terbebani. Seharusnya Pemkab melakukan investigasi terhadap pengecer dan pangkalan minyak tanah dan menindak pengecer Liar yang tidak memiliki izin, karena tugas pemerintah menstabilkan harga minyak tana. ”Saya berharap persoalan kenaikan harga dan langkanya minyak ini dapat ditindak lanjuti Pemkab agar masyarakat tidak kesulitan.(TH)

mengatakan peran kepala lingkungan (Kepling) sangat penting menjembatani kepentingan masyarakat di lingkungannya, sekaligus mitra lurah memberikan pelayanan umum. Terlebih makin kompleksnya tuntutan dan kebutuhan masyarakat, Kepling dihadapkan pada beberapa kendala yang mengakibatkan pelayanan tidak maksimal. Guna mengatur tugas dan fungsi Kepling, Pemko Binjai telah menerbitkan Peraturan Walikota Binjai No.26 tahun 2011 tentang Lembaga Kemasyarakatan di Kelurahan se - Kota Binjai. “Saya berharap Kepling betul-betul memahami dan mempedomani peraturan sehingga tugas pelayanan dan pemberdayaan masyarakat terlaksana dengan baik,” kata Wakil Walikota. Acara sosialisasi diikuti 282 Kepling se-Kota Binjai,Wakil Walikota meminta kepada camat dan lurah meningkatkan peran Kepling untuk menjaga dan meningkatkan kebersihan lingkungan masing-masing, antara lain jalan, berem jalan maupun drainase. Juga agar cepat tanggap terhadap setiap masalah yang ada di tengah - tengah masyarakat dan harus ditangani sedini mungkin . Kepala Bagian Pemerintahan Khairul Azhar mengatakan tujuan sosialisasi untuk meningkatkan pengetahuan dan wawasan akan tugas – tugas Kepala Lingkungan di Kelurahan seKota Binjai. (SBR)

Warga Arapayung

Mengeluh PANTAI CERMIN - Memalukan dan mengherankan melihat kinerja oknum aparatur Pemkab Serdang Bedagai (Sergai) di lingkungan Dinas Kependudukan dan Catatan Sipil saat ini. Dimana pengurusan KTP elektronik (e-KTP) dianggap pilih-pilih. Jika kondisi sepetri ini, lebih baik pengurusan e-KTP dibubarkan saja. Hal itu diucapkan Syahlan (38) warga Desa Arapayung Kecamatan Pantai Cermin yang juga adik ipar Kepala Desa Arapayung didampinggi Icah (32) Istrinya kepada sejumlah wartawan belum lama ini, di Pantai Cermin. Lebih lanjut Syahlan mengatakan lebih baik memegang KTP biasa saja.Tak repot dan cukup bayar Rp 20.000 di setiap kantor camat. Syahlan curiga atas kinerja oknum aparatur pemerintah yang menanggani urusan e-KTP ini.“Saya jelasjelas terdaftar sebagai warga Sergai, jika tidak mungkin saya memiliki Kartu Keluarga dan KTP dari Dinas Dukcapil Sergai, ditanda tangani Ibu Erni Toreh,”keluhnya. Ketika wartawan mengonfirmasi kepada Kadis Dukcapil Sergai Hj. Erni Toreh Selasa (22/ 11), namun tak berhasil ditemui di kantornya. Sementara Sekretarisnya Hj. K.Bariah ketika di Konfirmasi hanya bisa mengatakan “Saya tak berani komentar sebab belum mengerti akan tugas yang ada di Dukcapil Sergai, sebab baru bertugas 2 Minggu di Dinas ini,” ucap Bariah. (ARM)

Samin Damanik Lepas PPLT Unimed 2011 KOTARIH - Guna mencapai cita–cita, kita harus bergiat bekerja demi masa depan. Serdang

dapat menjadi patron terhadap berbagai kebijakan pembangunan di Kabupaten Nias. Kepala Bappeda Kabupaten Nias Ir Agustinus Zega dalam laporannya mengatakan RPJMD pada hakekatnya merupakan penjabaran daripada visi dan misi kepala daerah/wakil kepala daerah yang berfungsi sebagai kerangka acuan pelaksanaan program pembangunan daerah kurun waktu lima tahun kedepan. Dikatakan, salah satu tujuan penyelenggaraan musrenbang RPJMD Kabupaten Nias 2011-2016 yakni untuk penajaman, penyelarasan, klarifikasi dan kesepakatan terhadap rancangan RPJMD mencakup sasaran sasaran pemvbangunan jangka menengah daerah, strategi dan arah kebijakan umum dan program pembangunan daerah,indikasi rencana program prioritas pembangunan yang disertai dengan kebutuhan pendanaan,dan capaian indikator kinerja daerah.(YAGI)

Pemerintah Bertanggungjawab Tegakkan HAM RANTAUPRAPAT - Pembukaan penyelenggaraan bimbingan teknis (Bimtek) bidang Hak Azasi Manusia (HAM) di ruang data dan karya kantor bupati secara resmi dibuka Wakil Bupati Labuhanbatu Suhari Pane SIP, Selasa (22/11). Acara yang diikuti seluruh SKPD, OKP, KNPI dan para pengacara serta ormas, juga dihadiri ketua DPRD Hj Ellya Rossa Siregar, Wakalpolres Kompol Tetra Darmariawan SIK, Wakil Ketua Pengadilan Negeri, para kepala SKPD, Kabag Pemerintahan H Sarbaini dan Kabag Humas Abdurrahman. Bupati Labuhanbatu dalam sambutannya dibacakan Wakil Bupati Suhari Pane mengatakan, pemerintah negara memiliki tanggung jawab utama menegakkan HAM. Hal itu didasarkan karena pemerintah merupakan pelaksana pemberi pelayanan kepada warga masyarakat baik pelayanan pembangunan maupun pelayanan pemberdayaan masyarakat sebagai wujud pelaksanaan otonomi daerah. Ditambahkan bupati, rencana aksi nasional hak azasi manusia (RANHAM) Indonesia tahun 2011-2014 dibentuk berdasarkan Peraturan Presiden Republik Indonesia No.23 tahun 2011 yang di dalamnya memberikan tugas kepada kepala daerah tingkat provinsi, kabupaten dan kota melaksanakan program RANHAM sesuai dengan tugas dan fungsi masing-masing serta memperhatikan kondisi dan permasalahan daerah. Sebagai wujud ketaatan Pemkab Labuhanbatu atas amanat yang diberikan oleh Perpres nomor 23 tahun 2011 diimplementasikan melalui per-

Bedagai merupakan kabupaten baru berkembang, salah satu pembangunan dalam bidang pendidikan mulai dikembangkan. Dari 17 Kecamatan terdapat sekolah berpotensi, seperti di Kec. Kotarih SMP Negeri 1. dipimpin Samin Damanik S.Pd dan Camatnya Fitriadi S.SOS, M.Si. Samin Damanik S.Pd beserta dewan guru melepas PPLT UNIMED 2011 berjumlah 18 orang. PPLT telah mendapat bekal dari SMPN 1, sebab selama 3 bulan mereka menuntut ilmu dari SMPN 1. Samin Damanik memberikan arahan sebelum dilepaskan. Disebutkan selama berada di SMPN 1 Kotarih, ilmu diperoleh dapat dipergunakan pada hal yang positif,terutama berhubungan dengan guru – guru. Di sela-sela acara, para PPLT mengadakan perpisahan dengan dewan guru dari para murid-murid. Sewaktu KPK POS mengonfirmasi salah satu peserta PPLT Christian Manik, mengatakan selama di SMPN 1 Kotarih banyak mendapat ilmu dan mawas diri dalam persoalan. Manfaatnya ke depan menjadi guru tidak kesulitan karena sudah ada bekal. (SP).

Rapat Perdana Tim Pemelihara dengan PNPM-MP SERBA JADI - Ketua pemelihara perkerasan jalan pernasian Desa Kuala Bali pengerjaan tahun 2010 dana dari PNPM-MP sepanjang 1300 M Abdul Hamid mengadakan rapat kerja perdana bertempat di Kantor Desa Kuala Bali, Rabu (16/11). Hadir Kepala Desa Kuala Bali Khairul Anwar Nasution, Kaur Pemdes Zuraidah Hanum

aturan bupati Labuhanbatu nomor 50 tahun 2011 tentang Rencana Aksi Nasional Hak Azasi Manusia (RANHAM) Indonesia tahun 2011-2014 di kabupaten Labuhanbatu. RANHAM kabupaten Labuhanbatu merupakan komitmen Pemkab Labuhanbatu terhadap penghormatan, perlindungan, pemajuan, penegakan dan pemenuhan HAM dengan memberhatikan aspek plurarisme dan multi kulturalisme dank arena itu harus dipahami, dijadikan acyan dan dilaksanakan oleh semua penyelenggaraan kekuasaan Negara secara akuntabel. Sekretaris panitia penyelenggara yang juga Kabag hukum Setdakab Labuhanbatu H Burhanuddin Rambe SH menyampaikan maksud dan tujuan diselenggarakannya Bimtek untuk memperkenalkan Hak Azasi Manusia (HAM) secara universal kepada anggota panitia RANHAM Indonesia tahun 2011-2014 di Labuhanbatu. Selain itu, tambahnya, untuk menambah pengetahuan dan pemahaman tentang sejarah dan perkembangan hak azasi manusia kepada anggota panitia RANHAM Indonesia tahun 2011-2014 di kabupaten Labuhanbatu. Disamping itu, kata Burhanuddin, agar setiap panitia RANHAM dalam memberikan pelayanan kepada masyarakat dapat menghormati, memajukan, memenuhi, melindungi dan menegakkan hak azasi manusia masyakat kabupaten labuhanbatu dengan tetap saling memberikan partisipasi nyata dan solusi atas permasalahan yang dihadapi sebagai ekses pemberian pelayanan kepada masyarakat yang tidak dapat kita hindarkan bahkan tidak kita inginkan.(HAH)

Nasution, Ketua BPD Aran Nur Nasution, Ketua LKMD Ibrahim, Ketua KPMD Khairul Saleh dan Pasti Ulina Purba, ketua TPK Ediriswan dan Sekjen Salimah Sitompul, Sekjen Pemelihara Berlin Sembiring dan Bendahara Bangun Purba, tokoh agama Gajali Hasan S.Pd.I. Khairul Anwar berterima kasih kepada tim pemelihara yang telah bekerja memperbaiki jalan Pernasian sebagai jalan utama bagi masyarakat Desa Kuala bali yang bertani. Sehingga untuk mengeluarkan hasil pertanian lancar begitu juga dengan TPK, KPMD dan BPD, LKMD yang begitu peduli. Rapat perdana itu menghasilkan agenda kerja segera memasang plank pengumuman perdes dan palang di titik nol awal masuk kenderaan. Dana yang diperoleh untuk pemeliharaan badan jalan tersebut. ( SP ).

Mhd. Akhyar Lantik Pengurus DPK-MDP RANTAUPRAPAT - Ketua umum DPP Masyarakat Demokrasi Pembangunan (MDP) Medan Sumatera Utara Mhd. Akhyar melantik pengurus DPK-MDP Rantauprapat, (21/11). Turut mendampingi Akhyar Ketua Harian pengurus DPP Irwan Nasution, Ketua Pengkaderan Suprapto, Bagian Humas Drs M. Eeng Subrata. Setelah tiba rombongan langsung diarak ratusan becak dan puluhan sepeda motor menempuh rute Gapura Selamat Datang/depan Gedung Olahraga (GOR)-Simp. Enam-Jl. Imam Bonjol-Jl. Gajah Mada dan langsung ke kantor MDP Jl. Kejaksaan No. 4 Rantauprapat. Acara pelantikan diawali shalat magrib berjama’ah. Akhyar dalam sambutannya meminta seluruh pengurus dapat menunjukkan jati

KISARAN - Wakil Bupati Asahan, H Surya BSc melepas peserta Napak Tilas Komite Nasional Pemuda Indonesia (KNPI) Kabupaten Asahan ke 25 dalam rangka memperingati hari pahlawan tahun 2011 dihalaman kantor Bupati Asahan, Rabu, 9 November 2011. Dalam sambutan Bupati Asahan yang dibacakan Wakil Bupati Asahan menjelaskan bahwa Pemkab Asahan merasa bangga kepada para pemuda peserta napak tilas yang telah bersedia mengerahkan segenap tenaga dan mengorbankan waktu untuk menapak tilas jejak jejak para pahlawan di Asahan. Napak tilas ini juga memiliki makna yang tinggi dalam meningkatkan kesadaran para pemuda untuk saling bahu membahu memberikan sumbangan tenaga dan pemikiran demi tetap tegaknya negara kesatuan republik Indonesia. “Saya berharap kegiatan ini benar-benar dapat membangkitkan semangat kita untuk bersatu padu mengisi kemerdekaan, berupaya sekuat tenaga berpartisipasi menyumbangkan segala pemikiran, tenaga maupun harta atas segala permasalahan yang menimpah bagsa, demi memperkokoh negara kesatuan republik Indonesia yang kita cintai, “ kata Wakil Bupati. Wakil Bupati Asahan mengajak masyarakat mulai detik ini niatkan dalam hati membagun negeri dan daerah ini dengan dilandasi semangat dan nilai kepahlawanan. Apabila semangat dan nilai kepahlawanan dapat kita terapkan dalam kehidupan sehari-hari, mulai dari diri sendiri dan lingkungan yang terkecil. “ Saya yakin kita akan dapat mengatasi berbagai permasalahan dan kita akan dapat mewujudkan Asahan yang religius, sehat, cerdas dan mandiri, “ kata Wakil Bupati Asahan. Ketua DPD KNPI Kabupaten Asahan, Rahmat Hidayat Siregar Msi menjelasakan bahwa kegiatan napak tilas KNPI ke 25 ini diikuti oleh 49 peserta, berasal dari OKP, mahasiswa, pelajar dan pasukan penghormatan. Rute yang ditempuh mulai dari kantor bupati menuju Sidumulyo, Suka Damai, Lolotan, Pulau Bandring, dan istrihat di Kampung Bunga setelah menuju lapangan Parasamaya.(IN)

dirinya. Menjadi contoh di tengah-tengah masyarakat, demi kemajuan MDP. Jiwa wirausaha harus ditumbuhkembangkan hari dan mampu membaca peluang. Pada akhirnya dapat meningkatkan kesejahteraan dan kesuksesan. Akhyar selanjutnya menyerahkan bendera petaka kepada ketua dan pengurus yang baru dilantik, agar dapat dikibarkan di seluruh pelosok Labuhanbatu. Sementara ketua DPK-MDP Rantauprapat Dahlan Rambe, dalam sambutannya mengucapkan selamat datang dan terima kasih kepada DPP yang berkenan dan melantik pengurus MDP Rantauprapat. Ia juga meminta semua pengurus menyingsing lengan baju, bahu membahu memperjuangkan MDP di Labuhanbatu. Kemudian HP. Daulay SP M.Si sebagai pembina MDP Labuhanbatu memberikan motivasi kepada pengurus yang baru. “Motivation is the heart activity. Artinya motivasi adalah inti dari setiap kegiatan,” kata Daulay. Daulay yang juga Dekan Fakultas Pertanian ULB (Stiper) itu, meminta seluruh pengurus merangkul semua pihak guna memajukan organisasi. Menurutnya ada 5 pilar kekuatan organisasi yaitu harus ada orang kuat, intelektual, alim ulama, orang kaya, dan wanita. Kalau kelima pilar ini bisa kita rangkul, organisasi ini akan besar dan diperhitungkan di Labuhanbatu. Pengurus DPK MDP yang dilantik, Ketua Dahlan Rambe, Wakil Ketua Mustafrin Sebayang, Sekretaris Irwansyah Renz, Wakil Sekretaris Firmansyah Ginting, Bendahara Ade Hidayahtullah, Wakil Bendahara M. Jafar Rambe serta dilengkapi dengan seksi-seksi lainnya. (HAH)


KPK POS

8

POLITIK

E D I S I 176 28 NOVEMBER – 4 DESEMBER 2011

SUMUT

Burhan Sinulingga Pimpin PWI Binjai

TGC-Dinkes Harus Mampu Maknai Tugas STABAT - Dalam mendukung pelayanan bidang kesehatan, Bupati Langkat Ngogesa Sitepu mengukuhkan keberadaan Tim Gerak Cepat Dinas Kesehatan (TGC-Dinkes) dalam rangkaian peringatan Hari Kesehatan Nasional ke -47 di ruang Pola Kantor Bupati Senin (21/11). “Saya berharap keberadaan Saudara-saudara lebih memberi makna dan arti positif dalam ketanggapan Pemerintah terhadap penanganan sesuatu permasalahan bidang kesehatan di masyarakat,” sebut Bupati yang didampingi Sekda Surya Djahisa serta para asisten dan Staf Ahli Bupati, dihadapan 60 personil TGCDinkes yang keanggotaannya berasal dari setiap puskesmas di Kabupaten Langkat. Kegiatan yang seyogyanya dilakukan dalam apel di halaman kantor, namun karena kondisi cuaca saat itu hujan, sehingga dialihkan ke ruangan. Pada arahannya, kembali Bupati mengingatkan agar jajaran Dinas Kesehatan khususnya para pejabat di Puskesmas benar-benar memaknai program Layanan Puskesmas 24 jam, sebagai wujud abdi negara dan abdi masyarakat. Saat membacakan amanat tertulis Menteri Kesehatan, Bupati Ngogesa menyatakan, bahwa Indonesia Cinta Sehat adalah cerminan pelaksanaan amanat UUD 1945, yang menyatakan setiap orang berhak hidup sejahtera lahir dan batin, bertempat tinggal dan mendapatkan lingkungan hidup yang baik dan sehat serta berhak memperoleh layanan kesehatan. Amanat ini dijabarkan dalam UU Nomor 36 Tahun 2009 Tentang Kesehatan. Tahun 2011 Pemerintah memberikan imunisasi tambahan campak pada lebih dari 14,1 juta anak di berbagai Propinsi, selain itu berbagai program terobosan untuk meningkatkan akses masyarakat pada pelayanan kesehatan yang bermutu juga telah dilancarkan dengan peningkatan Jaminan Kesehatan Masyarakat (JAMKESMAS). Melalui Rangkaian kegiatan HKN ke-47 ini, Pemerintah lebih banyak memfokuskan kegiatan dukungan dan peranserta seluruh lapisan masyarakat, termasuk Organisasi Kemasyarakatan dan dunia usaha dalam pembangunan kesehatan dalam rangka mewujudkan Visi Masyarakat Sehat yang Mandiri dan Berkeadilan. Kegiatan pengarahan diakhiri dengan pembacaa do’a dan ucapan selamat kepada TGC Dinkes dari Bupati, Asisten, Staf Ahli dan seluruh Kepala SKPD yang hadir.(JUL)

BINJAI - Burhan Sinulingga SH terpilih menjadi ketua PWI Perwakilan Kota Binjai periode 2011-2014, setelah mengalahkan Irfan Purba diputaran kedua Konprensi PWI yang digelar di gedung Ovani Water Park Jalan T.Amir Hamzah Kota Binjai, belum lama ini. HGN & HUT PGRI–Bupati Langkat H. Ngogesa Sitepu, SH terlihat sedang berbincang dengan salah satu anggota PGRI pada peringatan Hari Guru Nasional ke-17 dan HUT PGRI ke-66 di Jentera Malay Rumah Dinas Bupati Selasa, (22/11).

Ciptakan Proses Belajar Menyenangkan STABAT - Guru merupakan pilar utama keberhasilan pendidikan, dan merupakan tulang punggung pembangunan pendidikan bangsa dan Negara. Selain itu, juga sebagai ujung tombak ruhnya pendidikan yang secara langsung mempengaruhi, membina dan mengembangkan kemampuan siswa agar manjadi manusia yang cerdas, terampil dan bermoral. Pernyataan tersebut disampaikan Bupati Langkat H. Ngogesa Sitepu,SH ketika membuka pelaksanaan seminar sehari dalam rangkaian peringatan Hari Guru Nasional ke-17 dan HUT PGRI ke-66 di Jentera Malay Rumah Dinas Bupati Selasa, (22/11). “Guru harus memiliki peran yang strategis dalam memberhasilkan proses

pendidikan membentuk karakter Bangsa,” sebut Bupati. Dikatakannya, Guru merupakan jabatan profesi yang memerlukan ketrampilan, mampu menggunakan strategi, metode atau teknik mengajar secara bervariasi untuk menciptakan suasana pembelajaran yang menyenangkan, menciptakan interaksi sosial dalam pembelajaran, dan siswa mampu memberikan perhatian yang utuh terhadap materi pembelajaran yang disampaikan. Ketua PGRI Sumut yang diwakili Drs. M. Nurdin mengatakan bahwa guru yang bersertifikasi sangat dituntut untuk lebih meningkatkan belajar dan mengajar di kelas karena pemerintah telah memberikan tunjangan

dan untuk meningkatkan wawasan guru dalam proses mendidik siswanya agar menghasilkan siswa yang berkualitas demi kemajuan bangsa. Sebelumnya Kadis Dikjar Syam Sumarno menyampaikan bahwa anggota PGRI dan guru diharapkan saling rukun bekerjasama baik di kedinasan maupun keluarga. “Mari kita jalin persatuan dan kesatuan, untuk menjalin kebersamaan dengan musyawarah mufakat dalam penyelesaian suatu masalah yang ada,” kata Syam yang pernah menjabat sebagai Kabag Humas itu. Peserta terdiri dari anggota PGRI se-Kabupaten Langkat dengan narasumber dari Kadisdik Sumut Drs. Syaiful Syafri, MM. Hadir pada kesempatan tersebut jajaran SKPD Kabupaten Langkat, pengurus TP-PKK dan Ketua DWP Langkat Ny. Hj. Khairul Bariah Surya serta undangan lainnya.(JUL)

Pemko Buka Pelatihan Bimtek PU TEBING TINGGI - Guna meningkatkan pengawasan proyek pembangunan bagi pengawas Pekerjaan Umum (PU). Pemerintah kota (Pemko) Tebingtinggi melalui Walikota Ir.H. Umar Zunaidi Hasibuan MM, Selasa (22/11) secara resmi membuka pelatihan Bimbingan Teknis (Bimtek) pengawas pekerjaan umum di Aula Dinas Kesehatan komplek perkantoran jalan Gunung Leuser kota Tebingtinggi. Pelatihan Bimtek di lingkungan Pemko tersebut diikuti 30 peserta dari Dinas Pekerjaan Umum, diselenggarakan mulai 22 -24 November 2011. Bertindak sebagai nara sumber Ir fiktor Gangga dari Himpunan Pengembang Jalan Indonesia (HPJI) Provinsi Sumatera Utara. Kepala Badan Kepegawaian Pendidikan Pelatihan Tebingtinggi Erwin Damanik SE mengatakan pelaksanaan Bimtek guna meningkatkan kualitas kerja pengawas lapangan PU. Terutama dalam melaksanakan proses pembangunan di lingkungan Pemko Tebingtinggi. Adapaun yang dilakukan dalam Bimtek, meliputi manajemen proyek,

mutu dan waktu proyek, kuantitas dan kwalitas proyek serta kode etik dan profesi para pelaksana. Walikota mengharapkan, manfaatkanlah waktu pelatihan Bimtek dengan sebaik-baiknya agar peserta dapat mengembangkan ilmu pengetahuan. Terutama dalam melaksanakan tugas tanggungjawab pengawasan pekerjaan. “Tidak ada hak untuk memilih dimana bekerja, namun jabatan adalah merupakan sesuatu kepercayaan yang diberikan atasan agar dapat dijalankan sesuai tupoksi,”ujar Walikota. Kemudian dalam melaksanakan fupoksi kerja, tidak berdasarkan perasaan atau dengan menggunakan ilmu kebatinan terhadap apa yangg kita kerjakan. Terutama dalam melakukan pemeriksaan suatu pekerjaan. Dalam bekerja, para pengawas harus berbicara sesuai bukti dan fakta, uji lapangan dan laboratorium tentang baik buruknya suatu pekerjaan. Selaku pengawas Walikota mengingatkan, harus berhati-hati dan mengerti mutu bahan atau barang dan

jenisnya. Serta paham bagaimana campuran semen dan pasir serta kualitas bangunan berdasarkan kontrak/perjanjian kerja. “Tidak perduli siapapun kontraktornya, kita akan proses sesuai aturan yang berlaku. Jangan coba coba main api,” tegas Walikota dihadapan peserta Bimtek. Sedangkan dalam standar penggilasan pengaspalan harus di lakukan 12 x gilas sesuai uji rumus laboratorium. Apabila semua prosedur pengawasan di lapangan sesuai dikerjakan maka pengawasan pekerjaan tidak dipermasalahkan. Makanya semua harus tahu dan belajar sesuai kemajuan dan perkembangan ilmu tehnik. Demikian pula apabila pekerjaan belum selesai sesuai tanggal kontrak, secepatnya diadakan adendum (perpanjangan kontrak). Semua pekerjaan harus dikuasai dan lengkapi dengan bukti poto, hasil uji lapangan, dan hasil uji laboratorium dan jangan terima sebelum ada kelengkapan, simpanlah data atau arsip di tempat yang aman, arsip berlaku sampai 20 Tahun.(RS)

41 Lansia Terima Tali Kasih SELESAI - Pemerintah Kabupaten Langkat dalam masa kepemimpinan H. Ngogesa Sitepu, SH telah banyak melakukan gebrakan yang cukup menjadi perhatian utamanya yang bersentuhan langsung dengan masyarakat. Kegemarannya dalam memberi untuk kesekian kalinya diwujudkan dalam program bantuan tali kasih kepada para orang tua yang sudah Lanjut Usia (Lansia). “Jangan dilihat dari nilai dan jumlahnya, tetapi ini adalah bentuk kepedulian Bupati Langkat” kata ketua TP. PKK Kab. Langkat Ny. Hj. Nuraida Ngogesa saat memberikan bantuan tali kasih secara langsung kepada para Lansia di aula kantor Camat Selesai (21/11). Nuraida berharap bantuan ini dapat menjadi penyemangat kepada para Lansia untuk terus berkarya di usia senja lewat berbagai aktivitas yang ada. Dirinya meyakini para lansia dapat menjadi penyemangat para generasi muda sebab para lansia merupakan

BANTUAN–Ketua TP. PKK Kab. Langkat Ny. Hj. Nuraida Ngogesa diabadikan bersama para Lansia dan Camat Selesai Ikhsan Aprija, Kakan Sosial Budi Aspriyanto serta unsur Muspika pada saat memberikan bantuan tali kasih kepada para Lansia di aula kantor Camat. barometer sosial kepada para generasi muda bahwa suatu saat nanti akan mengalami masa lansia. Pada kesempatan tersebut Kakan Sosial BudiAspriyanto, S.Sos, M.Si

melaporkan bahwa kegiatan ini merupakan rangkaian kegiatan dari Bulan Bhakti Karang Taruna Kabupaten Langkat yang sebelumnya telah dicanangkan oleh Bupati Langkat H. Ngogesa

Sitepu, SH di Kecamatan Padang Tualang (15/11) dengan salah satu agenda kegiatannya pemberian santunan kepada para lansia, untuk Kecamatan Selesai berupa beras 410 kg,

minyak goreng 205 kg, gula 205 kg, telur 41 papan dan kain sarung 41 potong. Sebelumnya Camat Selesai Ikhsan Aprija, SSTP, M.Si mengucapkan selamat datang dan terima kasih kepada TP. PKK dan rombongan yang sudi kiranya menyempatkan diri di tengah kesibukan untuk menyerahkan langsung bantuan tali kasih kepada para lansia di Kecamatan Selesai. “Syukur alhamdulilah, kami yang tua ini masih diingat sama Pak Bupati, semoga Pak Bupati beserta keluarga sehat selalu dan diberi rezeki yang melimpah” ujar nek Jumik (84) sambil terisak haru ketika disapa langsung oleh ketua TP. PKK Langkat Ny. Hj. Nuraida Ngogesa. Acara yang dihadiri unsur Muspika, Karang Taruna, TKSK, Tagana, ketua Pekerja Sosial Masyarakat (PSM) Natta Syahputra, Para Kades dan Lurah se- Kecamatan Selesai beserta ketua TP. PKK dimeriahkan dengan penampilan senam lansia oleh kelompok Lansia Sejahtera dari Desa Sei Limbat.(JUL)

Perolehan suara Burhan diputaran pertama hanya 8 suara, menjadi 11 suara di putaran kedua. Sedangkan Irfan Purba hanya tetap mengantongi 5 suara, di putaran pertama dan kedua. Pada putaran pertama, Johannes Surbakti, STh tiba-tiba muncul sebagai calon ketua, namun hanya memperoleh satu suara. Pemilihan ketua PWI Binjai ini dibuka Walikota Binjai HM Idaham SH,M.SI, ketua DPRD Binjai Ir. H. Haris Harto MSP, Kapolres Binjai, Ketua PWI Cabang Sumut Drs H. Syahril, Sekjen Edward Thahir, Wakil ketua Bidang Organisasi Drs Chairul Muslim dan pengurus PWI Sumut lainnya. Sidang dipimpin Chairul Muslim berlangsung alot, tapi peserta tetap sportif, sehingga pemilihan ketua berjalan lancar. Meskipun seusai putaran pertama salah satu calon ketua memprotes dan mempertanyakan status Burhan

Sinulingga masih sebagai pengurus parpol. Namun protes itu, teratasi ketika Burhan memperlihatkan surat pengunduran dirinya dari parpol yang pernah digunakan menjadi calon legislatif itu. Burhan menegaskan akan bekerja semaksimal mungkin membesarkan PWI Binjai dengan program kerja yang bersinergi dengan Pemko Binjai. “PWI Binjai bisa solid, jika semua pengurus dan anggota bahu membahu, menyatukan persepsi dengan kebersamaan menuju terciptanya PWI Binjai yang profesional dan bermartabat. Ini harapan saya ke depannya”, ujar Burhan. Ketua PWI Cabang Sumut Drs H. Syahril dalam sambutannya mengharapkan seluruh anggota PWI Binjai agar kembali merapatkan barisan untuk membuat program kerja bermanfaat. "Jangan ada timbul perpecahan sesama anggota PWI,” ujar Syahril singkat.(SBR)

Sosialisasi Kebijakan UMK TEBING TINGGI - Guna meningkatkan kualitas SDM pelaku dunia usaha ekonomi kerakyatan. Walikota Ir. H. Umar Zunaidi Hasibuan, MM membuka kegiatan sosialisasi kebijakkan UMK dipandu nara sumber Dr. Polin Naipospos, Dr. Jhon Tafbu Ritonga, MEc dan Prof. Dr. Bahtiar Hasan Miraza dari Provsu di Gedung Balai Kartini (22/11). Walikota Tebingtinggi mengatakan, sesuai janji politik visi dan misi di waktu pencalonan di Pemilukada lalu, H. Irham Taufik,SH,MAP berjanji akan memajukan UMK di Tebingtinggi. Namun yang menjadi permasalahan dan kendala terkiat permodalan. Sebelumnya Pemko telah menyalurkan pinjaman tanpa bunga kepada UMK. Program ini kini tidak lagi dilaksanakan karena menjadi temuan Badan Pengawas Keuangan Provinsi (BPKP). Sebab yang boleh menyalurkan pinjaman adalah pihak BUMN. Untuk itulah Pemko Tebingtinggi merangkul BUMN

dan perusahan besar untuk dapat memajukan UMK melalui bantuan modal. Sedangkan dari sisi kesehatan serta izin dari hasil produksi UMK, juga masih menimbulkan masalah. Ke depan Pemko mengharapkan kreatifitas dan kualitas menciptakan suatu produk dapat ditingkatkan. ”Pemko juga berharap agar Tebingtinggi dapat menciptakan satu produk unggulan (One Village one produc). Para nara sumber menyebutkan, kemajuan suatu bangsa atau daerah tergantung jumlah usahawannya, minimal 2 % dari jumlah penduduknya. Indonesia hanya mempunyai 0,.. % saja. Masalah kelompok usaha menengah atas biarlah urusan pusat untuk membantunya. Untuk itu jumlah pelaku UMK harus dapat didata dengan nyata, kebutuhan dan kelemahan agar pemerintah daerah dapat melakukan program pengajunan penambahan anggaran APBD. (RS)

Dishutamling ’Gandeng’ Kelompok Tani PAKPAK BHARAT - Bertujuan menggalakkan penghijauan di sejumlah kawasan di Kabupaten Pakpak Bharat, Dinas Kehutanan, Pertambangan dan Lingkungan Hidup (Dishutamling) berupaya menggandeng beberapa kelompok tani (poktan). Mereka difasilitasi berbagai jenis bibit tanaman, kemudian dikelola secara berkelompok. Demikian dikatakan Kasi Pengamanan Hutan Hendrik Tumangger Shut kepada wartawan, Rabu (16/11) di lokasi Poktan Juma Kepar Lae, di Kecamatan Siempat Rube. Didampingi staf Juragan Solin, yang juga pengawas pekerjaan dimaksud, Hendrik menjelaskan, kegiatan itu merupakan pekerjaan langkah pembuatan tanaman hutan rakyat. Beberapa poktan dan terletak di sejumlah wilayah kecamatan juga diajak bekerja sama mengadakan kegiatan sejenis. Diuraikannya, poktan yang

terdiri dari 27 anggota itu dibantu dengan 21.400 batang bibit tanaman yang terdiri dari sengon 8000 batang, aren (5000), jengkol (2000) dan durian sebanyak 64000 batang. Anggaran diplot dari Dana Bagi Hasil (DBH). Masyarakat menyediakan lahan sesuai kebutuhan. Selain biaya penanaman, mereka juga disediakan sarana produksi berupa pupuk kompos. “Kegiatan pengkayaan tegakan vegetasi pepohonan di hulu Daerah Aliran Sungai (DAS) Singkil ini, nantinya sangat bermanfaat bagi anggota kelompok petani itu sendiri,” jelasnya. Saat meninjau lokasi kegiatan Rabu itu, tim pendampingan yang dipercayakan kepada LSM Peduli Lingkungan Hidup (PILIHI) pimpinan Hasoloan Manik tersebut, terjun ke lapangan guna melihat langsung prsentase kemajuan pekerjaan yang dilaksanakan anggota poktan.(PT)


KPK POS

9

POLITIK

E D I S I 176 28 NOPEMBER - 4 DESEMBER 2011

Berbagai Kegiatan Sambut HKN di Asahan KISARAN - Menyambut pelaksanaan Hari Kesehatan Nasional (HKN) ke XLVII, Pemkab Asahan menggelar berbagai kegiatan, mulai dari lomba Bulan Balita, bina generasi muda, pencanangan kegiatan kesatuan gerak PKK, Keluarga Berencana (KB), pemberian serifikat ISO kepada Puskesmas Sidodadi, pemberian penghargaan peduli kesehatan serta pengukuhan Komisi Penanggulangan AIDS (KPA), Senin, 14 November 2011. Kegiatan yang dipusatkan di Sei Kepayang Barat tersebut langsung dibukan oleh Bupati Asahan, Drs H Taufan Gama Simatupang MAP dihadiri oleh Ketua Tim Pengerak PKK Asahan, Hj Ny Winda Fitrika Taufan Gama Simatupang, seluruh muspida plus, seluruh Camat, sluruh kepala Puskesmas dan undangan lainya. Dalam sambutan Bupati Asahan mengatakan kegiatan HKN tersebut merupakan kegiatan yang sangat baik, karena pelaksanaan kegiatan adalah merupakan bentuk kepedulian dalam bidang kesehatan. Kesehatan salah satu pilar pembagunan sumber daya manusia untuk mewujudkan manusia Indonesia yang tangguh, kuat, pandai, mampu bersaing dan kegiatan ini juga mendukung visi dan misi Pemkab Asahan. Bupati Asahan meminta secara tegas kepada seluruh PNS yang bekerja di bidang kesehatan pada tahun 2012 kedepan, pencapaian sasaran atau target program kesehatan dapat ditingkatkan dengan membangun sinergitas program serta mengembangkan jaringan kemitraan dengan berbagai pihak. “ Saya berharap kita

semua lebih serius menjalankan visi dan misi Pemkab Asahan yang mewujudkan Asahan yang sehat, “ kata Bupati Asahan. Dalam acara tersebut, Taufan juga menyampaikan keluhan masyarakat terhadap pelayanan kesehatan di kecamatan (Puskesmas), diantaranya Puskesmas Tinggi Raja, Puskesmas Bandar Pasir Mandoge dan beberapa persoalan lainya yang masih seputar kesehatan. “Jangan coba tidak melayanani masyarakat dalam hal kesehatan, karena masyarakat akan melaporkan secara langsung dengan saya melalui acara coffee moring, “ kata Bupati Asahan, seraya mengajak semua lapisan untuk terus membangun Kabupaten Asahan tercinta dengan mencintai kesehatan sebagai bagian dari kehidupan yang perlu diperlihara, dijaga dan ditingkatkan dan mengucapakan terimakasih kepada tim pengerak PKK dan pihak lainya yang telah membantu dan mendukung sehingga kegiatan tersebut dapat terselenggara dengan baik. Ketua Tim pengerak PKK Kabupaten Asahan, Hj NyWinda Fitrika Taufan Gama Simatupang sangat mengharapkan kepada semua pihak, terutama kepada pihak SKPD, Camat, Kepala Desa/Lurah dapat membantu tim pengerak PKK. “ Kami bekerja untuk membantu tugas-tugas Pemkab yang sesuai dengan 10 program pokok PKK dan semoga melalui kegiatan ini lebih mendorong dan memotifasi partisipasi masyarakat dalam mensukseskan visi dan misi Pemkab, “ kata Ketua PKK Asahan. (IN)

DAERAH

Majukan Mutu Pendidikan Perlu Kebersamaan LABURA – Dalam rangka memajukan mutu pendidikan di Kabupaten Labuhanbatu Utara (Labura) ada beberapa konsep. Antara lain perlu kerjasama yang baik antara Dinas P dan K dengan elemen masyarakat dan insan pres. Hal ini sangat penting dilakukan, karena insan pres dan LSM adalah sebagai nara sumber dunia pendidikan. Mereka sangat mengetahui di lapangan bagaimana terjadinya proses belajar mengajar di sekolah termasuk keluhan-keluhan orang tua murid atau masyarakat. Untuk percepatan peningkatan mutu pendidikan pe-

merintah harusnya mengundang instruktur dari luar daerah untuk mendirikan bimbingan test bagi para anak yang ingin melanjutkan pendidikan ke perguruan tinggi. Kemudian memberikan penataran bagi guruguru untuk menambah perbendaharaan ilmu pengetahuannya. Bagi para siswasiswi dibuat kegiatan eks-

trakurikuler atau les terbuka. Penyediaan buku-buku bacaan dari tingkat Desa, Kecamatan, sampai Kabupaten. Memfasilitasi alatalat tulis dan komputer mulai dari tingkat SD, SLTP, dan SLTA, memberikan bea siswa kepada anak berprestasi dan kurang mampu. Dinas P dan K mengangkat guru ’Honda’ benar-benar orangnya berkualitas. Selanjutnya pengangkatan Kepala Sekolah harus benar-benar yang mempunyai visi misi dan program kerja untuk memajukan mutu pendidikan. Jabatan Kepsek harus di atas 4 tahun. Disis Dinas P dan K harus

sering monitoring ke setip sekolah-sekolah untuk mengecek guru dan kepala sekolah yang jarang masuk kantor. Memperhatikan sekolahsekolah rusak serta mobiler yang tak layak pakai, mensosialisasikan penggunaan dana BOS dan BOM serta dana-dana lainnya yang diberikan pemerintah. Jika ini semua ditata dengan baik, mutu pendidikan di Labura akan cepat meningkat. Pada 2009 dan 2010, alumni dari Labura yang masuk perguruan tinggi negeri hanya 0,8 persen. Padahal kalau kita lihat alumni Yayasan Perguruan Budi

Utomo Medan, Yayasan Methodist Medan, Yayasan Santo Thomas Medan, SMA Negeri Sidikalang, Yayasan Budi Murni Pematang Siantar Simalungun dan Yayasan SMA Plus TB. Silalahi Taput, mencapai 70 – 75 % masuk perguruan tinggi negeri. Kita mengajak eksekutif dan legislatif serta dewan pendidikan lebih memperhatikan kemajuan pendidikan di Labura. Orang tua murid harus bersinerji dengan pemerintah agar mutu pendidikan bisa berkembang cepat. Juga pengusaha harus ikut memperhatikan pendidikan di Labura. (JAR)

Cetak Sawah Tak Ada Masalah PANYABUNGAN - Adanya Cetak sawah di Kabupaten Madina berada di dua titik, yakni di Desa Banjar Aur Kec. Sinunukan dan Desa Tunas Karya di kec. Natal. Saat ini di Kec. Sinunukan hampir selesai, tinggal bercocok tanam dan Kec. Natal sudah mencapai 90 persen pelaksanaanya. Program cetak sawah dananya bersumber dari tugas pembantuan APBN tahun anggaran 2011. Program ini sangat membantu masyarakat. Program cetak sawah ini sangat membantu kami kelompok tani. Kalau adanya yang mengatakan, cetak sawah bermasalah, itu tidak benar. Sampai saat ini pelaksanaanya mulai rampung, tinggal dalam waktu dekat ini akan bercocok tanam. Yang menjadi persoalan adanya warga yang meminta bagian lahan dari cetak sawah tersebut, sementara lahannya tidak ada. cuma itu kendala dan sudah dapat di atasi. ”Alat berat yang dipergunakan kwalitas bagus. Jika ada mengatakan alat inventaris kelompok cetak sawah rendah, silahkan pantau ke lapangan. Kami yang mempergunakan alat tersebut, saat ini kondisnya bagus dan tidak mengalami kerusakan,” kata Ketua Kelompok Tani Cetak sawah Salamuddin kepada wartawan.

Lebih lanjut ia mengatakan, memang ada kabar bahwa lahan cetak sawah tumpang tindih, itu juga tidak benar. Lahan cetak sawah yang dikelola kelompok tani merupakan lahan masyarakat tergabung dalam kelompok tani. ”Kami sangat berterima kasih atas adanya cetak sawah nantinya dapat meningkatkan perekonomian,” kata salamuddin. Kami juga sangat mengharapkan Bupati Madina M.Hidayat Batubara SE datang ke lokasi cetak sawah melakukan tanam perdana. Dengan adanya cetak sawah, semoga penghasilan pertanian semakin membaik. Kadis Pertanian dan Peternakan Taufik Zulhendra Ritonga, SP.MM yang dimintai keterangan mengatakan hingga saat ini pelaksanaan cetak sawah di pantai barat mencapai 90%. Untuk kec. Sinunukan di Desa Banjar Aur terdapat 300 Hektare terdiri dari 12 Kelompok dan di Desa Tunas karya kec. Natal juga 300 Hektar terdiri dari 12 kelompok. ”Saat ini penyuluh Pertanian masih berada di lapangan untuk meliputi beberapa desa untuk memberi penyuluhan pada masyarakat yang sedang melaksanakan cetak sawah,” kata Kadis Pertanian. ( TH )

Audensi Apindo Provsu TEBING TINGGI – Apindo (Assosiasi Pengusaha Indonesia) Provsu beserta rombongan diterima langsung Walikota Tebing Tinggi Ir H Umar Zunaidi Hasibuan MM Saat Beraudiensi, Senin lalu di ruang utama Walikota. Walikota didampingi Asisten II, Kadis Perindakop, Kabag Humas, mewakili Kabag Perekonomian, Ketua Apindo Provsu. Saat ini Parlindungan Purba diwakili Wakil Ketua Bidang Organisasi Johan Brien SE SH MM MBA mengatakan Apindo Provsu berkeinginan membentuk

Apindo Tebing Tinggi yang terdiri dari kumpulan pengusaha dan kami berharap nantinya pengusaha UKM dapat dilibatkan juga sebagai pengurus atau anggota, untuk memudahkan mereka mendapat channel dalam memasarkan hasil produksinya.ujarnya Walikota mengatakan sangat senang dan welcome untuk Apindo dibentuk di Kota Tebing Tinggi, di kota tebing tinggi pengusaha karet yang besar dan kita akan libatkan pelaku atau pengusaha kecil menengah (UKM) menjadi anggota atau pengurus,” ujarnya. (RS)

GERAK JALAN - Bupati Sergai diwakili Sekdakab didampingi Ketua DPC GOPTKI Sergai dan Ketua DWP secara resmi melepas peserta gerak jalan beregu dan gerak jalan santai di lapangan Desa Firdaus Kecamatan Sei Rampah. (KPK POS/ARM)

Peringatan HUT KORPRI dan HKN SEI RAMPAH - Menyambut dan memeriahkan Hari Ulang Tahun (HUT) ke-40 KORPRI dirangkaikan peringatan Hari Kesehatan Nasional (HKN) ke-47 pada 12 November lalu, Pemkab Serdang Bedagai (Sergai) menggelar lomba gerak jalan beregu, gerak jalan santai dan senam sehat serta diakhiri dengan penarikan lucky draw. Ribuan peserta lomba dilepas Bupati Sergai Ir. HT. Erry Nuradi M.Si diwakili Sekdakab yang juga Ketua KORPRI Drs. H. Haris Fadillah, M.Si di lapangan Desa Firdaus Kec. Sei Rampah, Jumat pagi (18/ 11). Acara dihadiri Ketua GOPTKI Sergai Ny. Hj. Marliah Soekirman, Ketua

DWP Sergai Ny. Hj. Imas Haris Fadillah, para Asisten, Staf Ahli Bupati, Kepala SKPD, para Camat seKabupaten Sergai serta peserta gerak jalan beregu, gerak jalan santai dan senam sehat. Bupati Sergai dalam sambutannya dibacakan Sekdakab mengatakan pelaksanaan acara ini dapat meningkatkan kebugaran dan kesehatan. Di dalam tubuh yang sehat terdapat jiwa dan pikiran yang sehat. Sekda meminta agar terus menggelorakan kegiatan-kegiatan berhubungan dengan kesehatan, sebagai upaya menciptakan perilaku hidup sehat. Ini dapat dijadikan momentum meningkatkan

rasa kebersamaan mewujudkan persatuan dan kesatuan. Ir. H. Safaruddin selaku ketua penyelenggara melaporkan kegiatan tersebut diikuti 54 regu putra dan putri melibatkan jajaran PNS dan pejabat di lingkungan Pemkab Sergai. Juga dilakukan kegiatan gotong royong, penilaian puskesmas, puskesmas pembantu, puskesdes, posyandu dan penyuluh terbaik, pertandingan tenis meja putra putri, pertandingan catur, perlombaan paduan suara, seminar ilmiah serta sosialisasi jamkesmas, jamkesda dan jampersal dan pelayanan pengobatan gratis, ujar Safaruddin. (ARM)

KADISHUB: Rehab Lalu Lintas Terlambat PANYABUNGAN - Kegiatan rehab rambu-rambu lalu lintas yang diposkan di Dinas Perhubungan dan Informatika Kabupaten Mandailing Natal (Madina) mengalami keterlambatan. Pasalnya ada perubahan nama kegiatan pada P-APBD 2011 dan harus sesuai dengan petunjuk teknis dari Dirjend Perhubungan Darat. Demikian disampaikan Kadis Perhubungan dan Informatika Kab. Madina Harlan Batubara SH, dalam jawaban tertulisnya. Kegiatan yang dilaksanakan CV. Sukma Jaya direkomendasi perusahaan yang diakui Dirjend Perhubungan Darat Jakarta. Sementara kegiatan rehab warning light dan trafik light tidak dapat dilaksanakan meskipun dananya telah alokasikan. Kegiatan rehab ramburambu lalu lintas dan petunjuk arah digabungkan menjadi satu. Ini juga atas petunjuk Dirjend Perhubungan Darat, meskipun anggaran dari APBD

Madina. Untuk kegiatan ini dilaksanakan ditiga tempat yakni, jalan masuk Kota Panyabungan dari utara di Gunung Tua, jalan masuk Kota Panyabungan dari selatan di Depan CPM, serta jalan keluar Kota Panyabungan arah selatan di Dalan Lidang depan kantor HMI. Sedangkan rehab marka jalan dan zebra cross, kegiatan ini sedang dalam pemberkasan dan menunggu peralatan datang. Dari investigasi KPK Pos di lapangan, Dinas Perhubungan melaksanakan kegiatan tersebut setelah dipertanyakan. Hingga saat ini masih melakukan pengecatan zebra cros dan marka jalan, sehingga diduga Dinas Perhubungan sengaja memperlambat pelaksanaan kegiatan tersebut. Untuk rehab warning light dan trafing light, tidak dilaksnakan meskipun masyarakat pengguna jalan selalu melanggar lalu lintas dan sering terjadi kecelakaan.(TH)

Bendahara Gaji Dispen “Tahan” Gaji Oknum PNS PAKPAK BHARAT - Berdalih tidak ada nomor rekening (Norek), oknum Pegawai SMP N 1 Salak berinisal MN yang mangkir kerja lebih 1 tahun, gajinya ’ditahan’ oknum Bendahara Gaji Dinas Pendidikan Pakpak Bharat TH. Ketika dikonfirmasi sejumlah wartawan, Bendahara Gaji Dinas Pendidikan Pakpak Bharat Tumpal Hutapea (TH), belum lama ini di ruang kerjanya mengakui-

nya. Ia mengatakan sejak menjabat bendahara gaji pada Februari 2011 lalu gaji MN yang lebih kurang Rp1,6 juta /bulan itu tidak pernah diberikannya alias ’ditahan’. Anehnya, si oknum bendahara mengakui uang itu ada ditangannya, kalau tidak diambil akan dipulangkan ke kas daerah sebagai PAD. “Kalau tidak diambilnya akan saya kembalikan ke kas daerah,” terangnya sembari mengatakan ia tidak tau

mau kemana gaji MN dikirimkan. “Saya tidak tau, mau kemana diberikan gaji MN, dia tidak punya nomor rekening di bank, sementara setiap gaji pegawai yang dibayarkan melalui Dinas sudah harus mempunyai rekening bank. ”Kita hanya mengamprah gaji pegawai dan bank yang memindahbukukan ke rekening masing-masing pegawai, ” jelasnya. Yang menjadi pertanyaan,

kenapa sampai saat ini gajinya tetap diamprah, padahl oknum PNS itu sudah lama tidak melaksanakan tugasnya? Untuk itu pihak terkait termasuk polisi diharapkan mengusut kasus ini sampai tuntas. Berita sebelumnya, pengakuan Suriani Padang Kepala sekolah SMP membenarkan kebolosan oknum pegawainya. “Sejak 2009 dia (MN-red) sudah malas menjalankan tugasnya. Padahal

kami sudah berulang kali menyuratinya, namun hingga kini tidak pernah lagi muncul” katanya. Dikatakannya, “kami sudah melaporkan hal ini kepada pihak-pihak terkait baik itu Bupati Melalui Dinas Pendidikan, maupun Kantor Kepegawaian Daerah, dan Inspektorat Kabupaten, bahkan gajinyapun sudah kami stop dari sini dan kami kembalikan ke dinas” sebutnya. (PT)


KPK POS

10

KRIMINAL

E D I S I 176 28 NOVEMBER – 4 DESEMBER 2011

NAD SUMUT JAMBI

Operasi Pemberantasan CPO Polda Sumut, Gagal LABUSEL–Operasi pemberantasan lokasi penampungan crude palm oil (CPO) ilegal yang sempat digencarkan Kepolisian Daerah Sumatera Utara, dinilai gagal. Pasalnya, praktik kejahatan industri perkebunan itu, hingga kini masih berlangsung, khususnya di kawasan Kabupaten Labuhan Batu Selatan. Di seputaran kabupaten ini, masih berdiri lokasi penampungan CPO yang dengan leluasa memaksa kendaraan tangki bermuatan CPO untuk mencurahkan ke dalam wadah penampung yang disedikan sindikat CPO. Maraknya lokasi CPO ilegal ini, seperti gudang penampungan CPO yang dikawal pria-pria berambut cepak. Diantaranya gudang penampungan CPO di Jalan Lintas Sumatera, Kecamatan

Langga Payung-Gunung Tua, persisnya Desa Simpang Ranto Jior. Selain itu lokasi juga terdapat di Jalinsum Torgamba –Bagan Batu, di kabupaten Labuhan Batu Selatan. Praktik penampungan CPO ilegal

didalangi pengusaha tionghoa asal Kota Medan. Praktik yang dilakukan, para pria berambut cepak yang menjaga gudang, memaksa para sopir tangki agar membelokkan kendaraan ke dalam gudang. Selanjutnya mencuri CPO yang dibawa kendaraan perusahaan perkebunan. Kapolsek Langga payung AKP Marahusin Siregar, Sabtu pekan lalu, mengakui masih adanya praktik gudang CPO ilegal. “Saya tidak ada izinkan itu dan sudah pernah saya perintahkan agar anggota saya turun ke lakosi menutup kegiatan ilegal itu. Namun mereka tetap membandel , ya kita takut aja terjadi yang tak

diingini, soalnya personel kita sedikit dan itu sudah saya laporkan ke Kasat Reskrim Polres Labuhan Batu,” kata Marahusin. Sedangkan di Cikampak selain gudang CPO ilegal yang bermain dengan modus layar tancap alias berpindah-pindah tempat dengan mobil tangki sebagai penampungan CPO iIegal. Diantara lokasi ilegal itu, dimiliki oleh seorang oknum, Sai. Keberadaan lokasi penampungan CPO ilegal ini, diakui para sopir meresahkan. Para sopir kerap mendapatkan tindakan arogan dari para penjaga gudang penampungan, bahkan bentuk ancaman kerap diterima para sopir. Masih seperti biasanya, para

pria berambut cepak tersebut melakukan aksinya dengan cara mencegat para supir yang mengendarai tangki bermuatan CPO dari perusahaan perkebunan kelapa sawit dan dipaksa “kencing”. Tak hanya CPO, para pelaku juga merampok inti sawit, karnel. Truk yang mengangkut karnel kerap dihentikan para pelaku. Masih maraknya aksi praktik itu, disikapi Kepolisian Resor Labuhan Batu. Kapolres Labuhan Batu, AKBP Hirbak Wahyu mengundang para pengusaha perkebunan dan ekpedisi juga pengusaha SPBU se Labuhan Batu. Dalam pertemuan itu, Hirbak menegaskan menindak para

pelaku. Dan, menjamin memberikan pengawalan gratis kepada kendaraan pengangkut CPO dan karnel. Hanya saja, hingga kini tindakan nyata di lapangan belum menunjukkan hasil yang maksimal. Sumber mengungkapkan, penampungan inti sawit semakin hari makin merajalela, dan jumlah penampungan itu kian bertambah. Disebutkannya, lokasi penampungan diantaranya, di rumah makan Pinem Desa Asam Jawa Kecamatan Torgamba, dan Desa Pinang Awan. Kedua lokasi itu, diyakini milik seorang pengusaha turunan asal Medan, KC. “KC ini tinggal di Medan, rumornya bahwa KC ini pemilik

Pejudi di Mengkudu Digulung

SIDANG PENIPUAN CPNS

Jaksa Harus Hadirkan Adik Ali Umri BINJAI – Terdakwa penipuan calon Pegawai Negeri Sipil di Dinas Perhubungan, meminta dibebaskan. Irianto melalui kuasa hukumnya, menegaskan, perintah pengutipan sejumlah uang dari tenaga honorer Dinas Perhubungan Kota Binjai dari atasan terdakwa, Kepala Dinas Perhubungan H Fadlan. Sementara itu, jaksa penuntut umum Rismiadi mengungkapkan, adik kandung bekas Wali Kota Binjai, Saifuddin alias Boy Umri telah melarikan diri. Hingga kini, Boy Umri yang namanya disebut dalam sidang kasus penipuan CPNS, ditengarai memiliki andil. Dari tindakan iming-iming akan menjadikan para korban sebagai PNS, para sindikat ini mengumpulkan ratusan juta rupiah. Dalam persidangan, Senin pekan lalu, kuasa hukum Irianto, membacakan pembelaan (pledoi) kliennya. Dalam nota pembelaan itu, majelis hakim yang dipimpin Saut M Pasaribu diminta untuk membebaskan Harianto. Alasannya, kata kuasa hukum, Irianto hanya menjalankan instruksi dari Fadlan. Peranan Fadlan dalam kasus ini, sebut kuasa hukum, sangat jelas. Indikasi itu, disebutkan antara lain, adanya perintah Fadlan kepada terdakwa Irianto untuk mengumpulkan sejumlah tenaga honorer di

Aula Dishub Binjai, menyampaikan agar tenaga honorer menyetorkan Rp 30 juta, agar diangkat menjadi PNS. “Penjelasan saksi yang menyatakan Saifuddin dan H Fadlan menyetorkan uang ke rumah ruko Ali Umri mantan Walikota Binjai, serta kuitansi bon Rp 20 juta untuk keperluan bayar pajak yang meminjam H Fadlan di tandangani oleh Kertasari selaku Bendahara Dishub Binjai. Di mana Rp20 juta merupakan uang dari tenaga honorer,” kata kuasa hukum terdakwa. Dalam kasus itu, Irianto dituntut 18 bulan penjara, sementara itu terdakwa Nelli hanya dituntut, 5 bulan penjara. Semntara itu kuasa hukum terdakwa Nelli, dalam pembelaannya di persidangan, mengatakan, bahwa JPU Rismaidi tidak cermat dan teliti dalam hal melihat faktafakta dalam persidangan. “Seharusnnya, bisa membebaskan terdakwa Nelli sesuai ketarangan saksi saksi,” kata kuasa hukum Nelli. Usai mendengarkan nota pembelaan dari kuasa hukum kedua terdakwa, cketua majelis hakim Saut M Pasaribu SH mempertanyakan kepada jaksa Rismaidi, apakah tetap dengan tuntutannya. Rismaidi menegaskan tetap pada ajuan tuntutan yang telah disampaikan. (SBR)

Bandar Narkoba Diringkus TANJUNGBERINGIN - Fuji Akbar Hutabarat yang disebut-sebut sebagai bandar narkoba, Senin pekan lalu, diringkus personel dari Satuan Narkoba Polres Sergai. Tim yang dipimpin Kasat Narkoba AKP Novie Ardhie, menangkap tersangka di Desa Kramat Asam, Kecamatan Tanjung Beringin, Kabupaten Serdang Bedagai. Tersangka sudah lama menjadi target kepolisian. Selama ini tersangka telah diintai petugas dalam peredaran narkoba yang dilaku-

kannya. Penangkapan terhadap Fuji hasil under cover buy, atau petugas menyaru sebagai pembeli. Dari tersangka disita beberapa barang bukti seperti 2 kemasan plastik berisi sabu-sabu dengan berat 0,30 gram, ganja 1 gram,1 buah jarum, 6 buah pipet gunting, dan tiga unit handphone, dan uang tunai Rp 120 Ribu. Sebelumnya, Sat Narkoba Polres Sergai bekerja sama dengan Polairud Teluk Mengkudu, manangkap Bayu alias Bonan, 16 tahun, memiliki 3,2 gram ganja.(ARM)

Kapolda Aceh Janji Tuntaskan Kasus Gula Ilegal LANGSA – Kepala Kepolisian Daerah Aceh, Irjen Iskandar Hasan berjanji akan menuntaskan kasus penyeludupan gula. Dalam pertemuan Saweu Keudee Kupi yang diselenggarakan di Kafe Ule Balang, Sabtu malam pekan lalu, Iskandar menginstruksikan Polres Aceh Tamiang dan Polres Langsa menuntaskan kasus tersebut. Instruksi tersebut disampaikan Iskandar usai mendapatkan mendengarkan aspirasi dari Ketua KNPI Langsa, Muhammad Nasir. Dalam pertemuan yang dihadiri Walikota Langsa Zulkifli Zainun, Bupati Aceh Tamiang Drs. H. Abdul Latief, Wakil Bupati Aceh Timur Nasruddin Abubakar, Kapolres Kota Langsa AKBP Yosi Muhammartha, Kapol-

res Aceh Tamiang AKBP Drs. Armia Fahmi, Kapolres Aceh Timur AKBP Ridwan Usman serta tokoh masyarakat dari tiga Kabupaten. Nasir mempertanyakan hasil kinerja kepolisian dalam kasu penyeludupan gula impor. Tak tuntasnya kasus itu, menurut Nasir, akan berdampak negatif kepada kepolisian. Sebab, katanya, kasus yang telah berjalan empat bulan itu pengusaha pemasok gula impor tak kunjung ditangkap. Mendapat ungkapan itu, Kapolda Aceh Irjen Iskandar Hasan langsung meresponnya. Iskandar memerintahkan kepala Polres Aceh Tamiang dan Langsa segera menuntaskan kasus itu. Penangkapan gula impor ilegal, berlangsung Agustus lalu. (BSO)

usaha ilegal itu, serta ada juga suruhannya oknum petugas berinisial FS yang tugas di Medan juga, ya jelas- jelas usaha ilegal itu ada, tapi hingga kini belum di tindak. ,”terang sumber . Salah seorang warga berinisial mengatakan kalau oknumoknum pengusaha CPO ilegal yang ada di Kabupaten Labusel masih beroperasi. Sekretaris DPD KNPI Labuhanbatu M.Risfan mengakui bahwa pernah menyaksikan langsung usaha ilegal itu. Ia mendesak kepolisian bertindak tegas. Sementara AKBP Hirbak Wahyu Setiawan yang dikonfirmasi akan mengecek keberadaan lokasi penampungan itu.(HAH)

Artis kibot, Niko Pranando sedang menjalani pemeriksaan di Mapolres Tebing Tinggi.

Konsumsi Sabu, Artis Kibot Dibekuk TEBINGTINGGI–Bermaksud pakai sabu-sabu untuk ketahanan tubuh agar sanggup bernyanyi, Niko Pranando, 20 tahun, warga Jalan Darat, Lingkungan I, Kelurahan Tebing Tinggi, Kota Tebing Tinggi, dikenal sebagai artis keyboard diringkus polisi. Tersangka dibekuk dari rumahnya, bersama Budi Piliang, 35 tahun, rekan dalam grup Niko, pada Minggu pekan lalu.

Polresta Binjai Sita Truk Bermuatan Kayu BINJAI - Satuan Reskrim Polresta Binjai amankan truk tronton bermuatan kayu olahan dari kawasan Kelurahan Payaroba, Kecamatan Binjai Barat, Selasa Pekan lalu. Kayu 20 ton itu diduga berasal dari hutan lindung, diamankan saat bongkar muat di salah satu gudang. Guna penyidikan, polisi mengamankan sopir truk dan kayu. Kanit Vice Control Polresta Binjai, Iptu H Tobing yang memimpin penangkapan, enggan memberikan keterangan soal penangkapan itu. Dia beralasan, belum dapat memberikan keterangan karena Kapolresta Binjai masih mengikuti rapat. “ Tunggu aja nanti,” katanya. (SBR)

Polisi menyita satu paket sabusabu dalam kemasan plastic dan dua buah telepon seluler. Kemudian, kedua tersangka langsung digelandang petugas ke Mapolres Tebing Tinggi untuk mempertanggungjawabkan perbuatannya. Niko Pranando ketika di periksa di Mapolres Tebing Tinggi, mengaku membeli sabu-sabu bersama Budi Piliang secara patungan seharga Rp100.000. “Saya baru pakai sabu

selama empat bulan ini, sebelumnya sabu ini akan kami pakai bersama-sama, tetapi ke buru polisi menangkap kami berdua, sedangkan teman saya, Jek (DPO) berhasil melarikan diri,” ujar Niko kepada Wartawan. Kebiasaan memakai sabu-sabu, diakui Niko untuk menambah stamina. “Kami penyanyi keyboard banyak job manggung, jadi untuk mengatasi kelelahan, kami pakai sabu-sabu,” jelasnya.(RS)

Kebijakan Kepala RSUD Tive Bernuansa Kolusi LABURA–Keputusan Kepala RSUD Tive, Harianto diduga sarat dengan kolusi. Penunjukkan calon pegawai negeri sipil di lingkungan RSUD Kabupaten Labuhan Batu Utara, sebagai Komite Medis Perawatan, bertentangan dengan PP 16 Tahun 1994 dan PP perubahan, Nomor 40 Tahun 2010. Penunjukkan calon PNS di lingkungan rumah sakit berplat merah itu, menimbulkan reaksi di kalangan PNS. Sebab, faktor pengalaman dan status menjadi hal yang mencolok atas kebijakan kepala RSUD Tive. Dijelaskan, pengangkatan dalam jabatan fungsional setidaknya PNS memiliki DP3. St. Saut Siburian Ketua Dewan Pimpinan Daerah Lembaga Swadaya Masyarakat Peduli Anak Bangsa (DPD. LSM. PAB) Kabupaten Labuhan Batu Utara, menegaskan penunjukkan itu tidak layak. “Kalau sudah begitu masalahnya, dalam waktu dekat ini kita akan menyurati kepala RSUD Tive. D Aek Kanopan Pemkab Labura, dan Kepala BKD Pemkab Labura,” tegasnya.

Kepala RSUD Tive, enggan berkomentar. Dengan alasan sedang melayat, Harianto memutus sambungan telepon seluler. Sementara, Kadis Kesehatan Pemkab Labura, Roilan Siregar tak mau mencampuri persoalan itu. “Kami dari Dinkes Pemkab Labura tidak lagi menaungi rumah sakit, mereka sudah berdiri sendiri menjalankan programnya,” jelas dia. (JAR)

SERGAI – Tim Polsek Teluk Mengkudu yang dipimpin AKP Maimun dan Kanit Reskrim Ipda H Syahnan sepertinya tidak main-main dengan tindak kejahatan perjudian. Hal ini terlihat dari banyaknya pelaku judi yang ditangkap dalam sepekan lalu. Para pelaku diciduk dipastikan segera dilimpahkan ke kejaksaan. Mereka yang ditangkap, Agus , 46 tahun, warga Dusun Dua, Pematang Guntung, Kecamatan Teluk Mengkudu, Ramli, 40 tahun. Penangkapan Agus hasil dari target operasi polisi. Dari tersangka, polisi menyita uang tunai Rp 44 ribu, beberapa lembar kertas kupon nomor tebakan. Barang bukti serupa juga disita polisi dari tersangka Ramli, yakni Rp 52 ribu. Jajaran Polsek Perbaungan juga melancarkan operasi penangkapan terhadap bandar togel yang telah masuk dalam daftar buronan, Ramli Nasution alias Ramona, 45 tahun. Buronan dalam kasus 303 itu ditangkap, hampir bersamaan dengan anak kandungnya, M.Irfan Nasution. Irfan digelandang petugas seperti ayahnya dalam kasus serupa. Operasi penangkapan juga sukses dilakukan polisi terhadap Khairul Jambak, 37 tahun, warga Jalan Deli No.102 C, Kecamatan Perbaungan.(ARM)

BAP Penganiayaan Jurnalis Lengkap PAKPAKBHARAT – Berita Acara Pemeriksaan (BAP) satu dari tiga tersangka penganiaya jurnalis, Edward Cibro, awak media Harian Bersama, dinyatakan lengkap. Ketiga tersangka, diantaranya seorang oknum Polres Pakpak Bharat. Penganiayaan dialami korban, Juli 2011, di lokasi kafe Desa Tanjung Mulia Kecamatan STTU Jehe, Kabupaten Pakpak Bharat. Meski proses hukum berjalan, korban merasa kecewa dengan penanganan kepolisian. Pasalnya, dari tiga tersangka penganiayaan hanya satu tersangka yang ditahan. “Saya harapkan kepada Kapolres Pakpak Bharat lebih serius menindak lanjuti kasus ini,” kata Edward. Kasat Reskrim Polres Pakpak Bharat, AKP B Silalahi menegaskan kasus tersebut akan ditindak lanjuti. “Kami Polres Pakpak Bharat akan serius dan komit menindak lanjuti masalah ini,” kata Silalahi. Diungkapkannya, dari tiga tersangka yang diberkas terpisah, satu berkas telah P-21 (lengkap) segera dilimpahkan ke kejaksaan. Sementara berkas lainnya masih berstatus P-19, akan dilengkapi oleh penyidik kepolisian.(PT)

Gaji Guru SMP Negeri 1 Ditahan PAKPAKBHARAT – Bendahara Dinas Pendidikan Pakpak Bharat menahan gaji guru SMP Negeri 1 Salak. Penahanan gaji dilakukan bersebab oknum guru, MN dalam waktu satu tahun mangkir dari tugasnya, mengajar. Selain bersebab alasan itu, penahanan juga dilakukan karena pihak Dinas Pendidikan Pakpak Bharat tidak memiliki nomor rekening sang

guru. Bendahara Dinas Pendidikan Pakpak Bharat, Tumpal Hutapea mengatakan, sejak menjabat sebagai bendahara per Februari 2011, gaji MN senilai Rp 1,6 juta tidak diberikan. Gaji MN, aku Tumpal masih berada di kas Bendahara Dinas Pendidikan Pakpak Bharat. “Gaji MN saya tahan, kalau tidak diambilnya

akan saya kembalikan ke kas daerah sebagai PAD,” tegasnya. Sementara Kepala Sekolah SMP Negeri 1 Salak, Suriani Padang mengakui MN telah mangkir dari tugas, sudah terjadi sejak 2009. “Dia (MN-red) sudah malas menjalankan tugasnya sebagai abdi negara, padahal kami sudah berulang kali menyuratinya,

namun hingga kini tidak pernah lagi muncul,” ujar Suriani, di ruang kerjanya, Kamis pekan lalu. Atas kemangkiran itu, Suriani menambahkan, dirinya selaku pimpinan telah menyurati Dinas Pendidikan Pakpak Bharat dan Bupati Pakpak Bharat. “Kami sudah melaporkan hal ini, termasuk ke Badan Kepegawaian Daerah,” tegasnya. (PT)


11

KPK POS E D I S I 176 28 NOPEMBER - 4 DESEMBER 2011

KRIMINAL

Dalam Sehari, Polresta Medan Bekuk 28 Tersangka Perjudian Togel MEDAN - Hanya dalam sehari sebanyak 28 tersangka perjudian berhasil digulung petugas Unit Judi/Susila Polresta Medan dari berbagai tempat di Medan. Penangkapan ini merupakan hasil pengembangan petugas terhadap aktivitas perjudian yang masih marak di wilayah hukum Polresta Medan. Seluruh tersangka yang diamankan petugas dari berbagai tempat ini adalah buah dari operasi rutin yang digelar petugas dalam sehari, pada Rabu pekan lalu. Bersama barang buktinya, seluruh tersangka kini mendekam di tahanan Polresta Medan untuk menjalani pemeriksaan. Ke 28 tersangka Perjudian masing-masing, Sabar B Barimbing (47), Marahasian Simbolon (50), Suwarli (42), dan Agustina (38) yang ditangkap di Jalan Negara Kecamatan Medan Denai. Ganesa (41) yang ditangkap di Jalan Lapangan Merdeka, serta Ida (29) yang diamankan dari Jalan Sei Kera, dan Indra Permana (34) yang diamankan dari Jalan Tangguk Bongkar sebagai tersangka judi togel. Bersama ketujuhnya, turut diamankan puluhan lembar kertas togel, dan 5 unit Handphone sebagai barang bukti. Kemudian Rahmad Purba (43), Syamsul Nasution (52), Efendi Harahap (31), dan Abdul Hakim (25), Hamda Nur Manik (39), Baktiar Nasution (48), Saharuddin Siregar (43), dan Junaidi (45) ke delapan tersangka diamankan pada

hari Rabu (23/11) dari Jalan Pukat I dengan barang bukti 4 set kartu joker dan uang tunai ratusan ribu rupiah. Juga Chairil Anwar (47) Syamsudin Rambe (40) Suber Lubis (50), Aulan R Marbun (46), M Saleh Pulungan (35), kelimanya diamankan bersama barang buktinya saat sedang asyik bermain judi leng di Jalan kawasan Letda Sujono. Selanjutnya, Leo Dumongi (46), Luhut Simbolon (57) yang ditangkap di kawasan kampus Unimed. Bersama keduanya petugas mendapati empat lembar kertas togel, 2 unit handphone, juga satu paket shabu-shabu dan 1 unit mobil avanza sebagai barang bukti. Lalu Tjong Tek (47), Sodi (43), Parli Simanjuntak (45), yang diamankan bersama barang bukti lima lembar kertas togel dan uang tunai ratusan ribu rupiah. dan terakhir yang diamankan, Syaifuddin Karo (49) Rudi Efni (52) dan Ismed Ginting (45), bersama barang bukti 3 set kartu, tersangka kemudian diboyong ke komando. Kasat Reskrim Polresta Medan melalui Kanit Judi/ Susila AKP Hartono ketika dikonfirmasi diruang kerjanya Kamis (24/11) membenarkan penangkapan ini. "Saat ini kita sedang melakukan pemeriksaan guna pengembangan kasus ini," kata Hartono sembari menambahkan bahwa keseluruh tersangka judi terancam kurungan pidana 5 tahun penjara karena melanggar pasal 303 KUH Pidana.(S.EDHI)

Bupati Lepas Kampanye Gaklalin STABAT - Bupati Langkat H. Ngogesa Sitepu, SH melepas secara resmi kampanye berkendaraan aman, nyaman dan tertib dalam rangkaian Giat Aksi Keselamatan Lalu Lintas (GAKLALIN) di halaman Jananuraga Mapolres Langkat, Minggu pekan lalu. Dalam kegiatan itu, Ngogesa didampingi Kapolres AKBP. H. Mardiyono, SIK, MSi, Kajari Stabat H. Faturrahman, SH, dan perwakilan FKPD serta para pejabat di jajaran Polres Langkat. “Kegiatan ini tentu merupakan upaya yang baik dari kepolisian guna mengajak masyarakat untuk senantiasa memperhatikan keselamatan berkendaraan terutama roda dua,” kata Bupati kepada pers usai melepas peserta yang mengikuti kampanye GAKLALIN. Upaya Polres Langkat khususnya melalui Satlantas dalam mendukung menurunnya angka kecelakaan tentu tidak akan berarti banyak jika kesadaran masyarakat pengendara belum sepenuhnya memahami arti penting keselamatan dengan memperhatikan aturan dan ketentuan berkendaraan secara benar. Sebelumnya Kapolres Langkat AKBP. H. Mardiyono,

SIK, MSi dalam sambutannya menyatakan kegiatan GAKLALIN dilaksanakan secara serentak di seluruh Indonesia termasuk jajaran Poldasu. Khusus wilayah hukum Polres Langkat sendiri termasuk yang tingkat kecelakaan kendaraan bermotor cukup tinggi, dimana berdasarkan data Januari s/d Oktober 2011 sebanyak 287 kecelakaan dimana 119 orang diantaranya meninggal dunia. Banyaknya kecelakaan yang terjadi salah satu penyebabnya adalah ketidaksiapan pengendara dalam memahami rambu lalu lintas dan mengikuti aturan keselamatan diantaranya menggunakan helm berstandar nasional, menyalakan lampu utama di siang hari, menggunakan lajur kiri serta tidak melakukan kebut-kebutan di jalan raya atau mendekati persimpangan. Untuk itu kampanye GAKLALIN bertujuan memberikan kesadaran akan arti penting berkendaraan secara benar dan diharapkan Langkat yang telah meraih Piala Wahana Tata Nugraha dapat terus menumbuhkan kesadaran di masyarakat untuk taat dan mematuhi aturan berlalu lintas. (JUL)

Walikota Minta Pengendara Patuhi Peraturan Lalin TEBINGTINGGI - Polresta Tebingtinggi menggelar ‘Action for Road Safety’ atau apel besar tertib lalulintas (Lalin) dan aksi peduli kampanye keselamatan di Lapangan Merdeka Sri Mersing Jalan Sutomo Kota Tebingtinggi, Minggu lalu. Pantauan wartawan, terlihat ribuan peserta kampanye keselamatan ikut meramaikan turun ke jalan raya. Walikota Tebingtinggi Ir H Umar Zunaidi Hasibuan, Kapolres AKBP Andi Rian Djajadi Sik, Dan Sub Denpom Kaften Abdul Karim, Dan Brimob Detasmen B Kota Tebingtinggi, Ormas dan OKP serta clubclub motor yang ada juga ikut turun ke jalan. Walikota dan Kapolres

Tebingtinggi ikut berkeliling mengendarai sepeda motor dilengkapi safety reding seperti penggunaan helm SNI dan menyalakan lampu utama siang hari (lihgt on). Kapolres Tebingtinggi, AKBP Andi Rian Djajadi Sik mengatakan, Polri sebagai pengayom, pelindung dan pelayan masyarakat mewujudkan keamanan, keselamatan, ketertiban dan kelancaran dalam berlalulintas. ”Program pemerintah ini adalah tentang Rencana Umum Nasional Keselamatan (RUNK) atau juga disebut decade of action for road safety 20112025,” terangnya. Dikatakan, kegiatan ini bertujuan menurunkan angka kecelakaan lalin 50 persen. (RS)

SUMUT

LP Tak Digubris, Bekas Wakapolda Metro Jaya Datangi Polresta Medan MEDAN - Mantan Wakapoltabes Medan, Brigjend (Purn) Rajiman Tarigan mendatangi Mapolresta Medan, Kamis pekan lalu. Dengan menggunakan seragam Polri lengkap, mantan Wakapolda Metro Jaya ini mempertanyakan kasus tanah yang mengendap selama 7 bulan. Kedatangan Rajiman disambut Wakapolresta Medan, AKBP Pranyoto di ruangannya. "Saya datang ke sini untuk mempertanyakan perkembangan kasus rumah saya yang digadaikan menantu saya kepada salah satu BPR di kawasan Patumbak. Saya keberatan, kenapa BPR tersebut tidak melakukan survei terlebih dahulu. Itu kan rumah saya, kok bisa diterima begitu saja. Makanya, hingga 7 bulan ini belum ada perkembangannya," ungkap Rajiman kepada wartawan usai bertemu Wakapolresta Medan. Menurut Rajiman, rumah miliknya itu diperkirakan bernilai Rp 700 juta. Beberapa bulan yang lalu,

rumah tersebut digadaikan oleh menantunya dengan harga Rp. 170 juta tanpa sepengetahuannya. Rajiman mengaku sangat kecewa dengan kinerja BPR yang tidak melakukan survei. Meskipun begitu, Rajiman mengaku telah menebus rumah tersebut. "Saya telah mengadukan BPR tersebut, tapi sampai sekarang ini tidak ada perkembangannya, makanya saya datang ke sini untuk menjumpai Kapolresta yang dulu adalah mantan anak buah saya. Saya datang dengan seragam lengkap ini supaya Tagam Sinaga bisa

menanggapi laporan saya, tapi dia (Tagam-red) beralasan sakit,” katanya. Seharusnya, kata Ranjiman, Tagam lebih memprioritaskan anggota Polri, baik yang masih aktif maupun sudah purnawirawan. “Seperti saya. Saya juga sudah berkoordinasi dengan Kapolda dan Wakapolda, mereka responnya sangat baik, tapi Kapolresta kurang menanggapi," kata Rajiman. Tak lama kemudian, Kapolresta Kombes Tagam Sinaga datang ke Gedung Utama Polresta Medan dan langsung dikonfirmasi mengenai kedatangan Rajiman. Namun orang nomor satu di jajaran Polresta Medan ini menanggapi komentar Rajiman dengan datar. Menurut Tagam, mobil dinasnya, sempat berpapasan dengan mobil Toyota Camry, B 1 SIS milik Rajiman saat keluar dari Polresta Medan. "Saya tadi lihat ada mobil itu. Tapi saya tidak tahu kalau itu mobilnya Pak Rajiman. Saya belum pernah kete-

mu sama orangnya. Kalau beliau menganggap saya menghindar, tentu itu tidak benar. Saya tidak menghindari siapa-siapa. Kalau mau bertemu, silahkan saja," ungkap Tagam. Menurut Tagam, beberapa waktu lalu dirinya memang diminta untuk bertemu dengan orang yang bernama Rajiman Tarigan, melalui Wakapolda. Namun di saat itu, dirinya sedang ikut mengamankan aksi unjuk rasa. "Waktu itu saya sedang mengawasi aksi unjuk rasa. Ya tidak jadi ketemu. Menurut saya, pendangan beliau terhadap saya sangat keliru," ujar Tagam.Secara tegas Tagam Sinaga mengatakan, dalam penanganan kasus, Polri harus tetap profesional, tidak pandang bulu antara keluarga Polri dengan masyarakat umum.’Secara tegas saya nyatakan, dalam penanganan kasus harus sama-sama memberikan pelayanan terbaik terhadap masyarakat,” tandas Tagam. (S.EDHI)

Narkoba Senilai Rp 700 Juta Disita dari 53 Tersangka MEDAN - Satuan Reserse Narkoba Polresta Medan, beserta Polsek Jajarannya, dalam kurun waktu 23 hari sejak 1 September hingga Rabu pekan lalu, telah berhasil meringkus sebanyak 53 tersangka yang terlibat dalam kasus narkoba. Dari para tersangka diamankan barang bukti berbagai jenis narkoba seperti 106,4 Kg ganja, 554,94 Gram Sabu, 3 butir pil ekstasi, dengan total senilai Rp 700 Juta. Hal itu dikatakan Kapolresta Medan Kombes Tagam Sinaga SH didampingi Kasat Res Narkoba Kompol Juli Agung Pramono, SH,SIK,M.Hum kepada sejumlah wartawan. Dijelaskannya, penangkapan ini berkaitan dengan instruksi Kapolda Sumut dalam rangka pemberantasan peredaran narkoba yang sudah sangat meresahkan dan mengkuatirkan di tengah-tengah masyarakat. "Peredaran Narkoba sudah lampu merah dan sangat sudah meresahkan dan mengkuatirkan

di kota Medan, narkoba di buang ke sini (Medan) dari Malaysia, untuk itu agar segera disikapi mulai dari lingkungan pergaulan, masyarakat" ujar Tagam. Untuk itu, Tagam menerangkan pihaknya akan terus berupaya untuk menekan peredaran narkoba dengan memerintahkan seluruh jajaran Kanit Reskrim di Polsek-polsekta Polresta Medan, wajib menangkap pelaku narkoba, dan pihaknya yang akan dilakukan Analisa dan Evaluasi (Anev) setiap satu minggu, lalu setiap satu bulan akan diberikan awardness (penghargaan) dan punishment (Sanksi). "Jadi semua Kanit menangkap narkoba dan judi togel, akan kita Anev setiap minggu, dan apabila Polsek/Polsekta tidak mampu menangkap, kita akan evaluasi kinerjanya, jadi Kanit yang tidak bisa menangkap narkoba akan dicopot" tegas Tagam. Sementara itu, terkait instruksi Kapolresta Medan untuk memberikan sanksi pencopotan terhadap Kanit Res

Polsek yang tidak mampu mengungkap kasus narkoba. Dalam paparan Narkoba yang digelar di halaman Polresta Medan, Kamis (24/11) siang, ada beberapa Polsek yang belum melakukan penangkapan kasus narkoba dan akan dievaluasi. Antara lain, Polsekta Deli Tua, Polsekta Pancur Batu, dan Polsek Kutalimbaru. Sedangkan Polsek lain yang menangkap kasus Narkoba yakni Polsekta Medan Kota dengan mengamankan dua orang tersangka dengan barang bukti 117.7 Gram Ganja, dan 0,3 Gram Sabu. Polsek Medan Barat mengamankan dua tersangka dengan barang bukti 0,71 Gram Sabu, Polsek Medan Timur mengamankan dua tersangka dengan barang bukti 24 amplop ganja. Polsekta Medan baru mengamankan 10 tersangka dengan barang bukti sabu seberat 6,1 gram. Polsekta Patumbak mengamankan 5 tersangka dengan barang bukti 0,4 gram

sabu. Polsekta Sunggal mengamankan 4 tersangka dengan barang bukti ganja 4.1 gram, dan sabu 2.1 gram. Polsek Helvetia 1 tersangka dengan barang bukti 1,2 gram ganja. Polsekta Medan Area 1 tersangka dengan barang bukti 1 ons ganja. Selain itu Sat Res Narkoba Polresta Medan juga meringkus pengedar dan pemakai narkoba sebanyak 29 tersangka, dengan barang bukti 106.3 Kg ganja, 545,33 sabu, dan 3 butir ekstasi.Dijelaskan Kasat Res Narkoba Polresta Medan Kompol July Agung Pramono SH,SIK,M.Hum mengatakan penangkapan ini berdasarkan informasi dari masyarakat melalui SMS Centre Polresta Medan dan hasil penyelidikan personel Sat Res Narkoba. Akibat perbuatannya tersangka dijerat pasal 114,111, 112, 132, 127 UU RI No 35 Tahun 2009 dengan ancaman hukuman maksimal 20 tahun penjara. (S.EDHI)

Privatisasi BUMN Hendaknya Mengutamakan Pekerja MEDAN – Privatisasi perusahaanperusahaan milik pemerintah, hendaknya diutamakan agar memberi manfaat kepada para pekerja perusahaan yang bersangkutan. Jika pekerja menjadi pemilik saham perusahaan, maka perusahaan itu tetap menjadi bagian dari Indonesia, tidak justru pindah ke koorporasi asing. Pengamat politik dari Universitas Gajah Mada (UGM) Revrisond Baswir menyatakan kasuskasus privatisasi perusahaan semacam Indosat yang kemudian dibeli Singtel, yakni bagian Temasek Singapura merupakan kasus yang seharusnya menjadi pelajaran berharga. “Tidak sulit sebenarnya, kalau memang keinginan itu ada. Jika memang akan diprivatisasi, dan pekerja menjadi prioritas, tinggal dipotong gaji. Potongan itu berubah menjadi saham,” kata Revrisond Baswir dalam Seminar Nasional Menuju Ekonomi Konstitusi sekaligus Deklarasi Asosiasi Ekonomi Politik Indonesia (AEPI) yang berlangsung di aula Fakultas Farmasi Universitas Sumatera Utara (USU), Medan, Kamis pekan lalu. Disebutkan Revrisond, privatisasi merupakan upaya perluasan kepemilikan perusahaan. Jika hal ini yang diinginkan, maka tidak selalu harus dijual kepada koorporasi asing. Rakyat Indonesia bisa menjadi pemilik perusahaan itu, melalui sistem kepemilikan saham yang dapat diperoleh melalui berbagai cara. “Jika Garuda Indonesia misalnya, bisa melalui pembelian tiket, reward dari setiap pembelian tiket diubah menjadi saham, kemudian untuk Indosat, perolehan sahamnya bisa melalui reward pembelian pulsa dan sebagainya,” kata Revrisond

dalam seminar yang turut menghadirkan sejumlah pembicara lain seperti aktivis Henry Saragih, pengamat politik Ahmad Taudfan Damanik, serta Ridwan Rangkuti dan Budi Agustono. Disebutkan Revrisond, caracara sederhana itu merupakan solusi untuk mengikutsertakan rakyat secara langsung, termasuk untuk kepemilikan Freeport maupun Inalum. Hal ini juga dapat menjadi cara untuk menghentikan langkah koorporasi asing yang terus berupaya menguasai perekonomian Indonesia. Kapitalisme hanya beroentasi untuk menggandakan keuntungan, tidak peduli dengan apapun dan tidak peduli negara manapun. Kapitalis, di mana dia bisa menggandakan keuntungan, ke sana akan pergi, tak penting negara. Lagi pula, demokrasi kooporasi tak bisa terbukti tak diteruskan. Terbukti di Amerika Serikat dan Eropa ekonominya mulai kolaps. Deklarasi AEPI Sumut Seminar nasional yang dilaksanakan AEPI ini sebelumnya didahului dengan deklarasi AEPI Sumut. Deklarasi itu dilakukan dengan membacakan ikrar yang dipimpin Muhammad Jailani. Para deklarator tingkat provinsi yang berjumlah 15 orang tersebut, terdiri dari Dadang Darmawan, Nelly Armyanti, Budi Agustono, Muhammad Jailani, Roland Muhary, Mario Firmansyah, Husnul I. Harahap, Yunus Nasution, Ramadhan Sakti Siregar, Fernanda Putra Adela, Abi Rekso, Aidil Arifin, dan Fernando Sihotang. Dalam keterangannya Muhammad Jailani menjelaskan, secara nasional AEPI sudah dideklarasikan di Jakarta pada 9 Februari lalu. Pemrakarsanya merupakan

tokoh-tokoh yang secara aktif memberikan kontribusi pemikiran dalam upaya membangun perekonomian sesuai dengan cita-cita pendiri bangsa. Sementara Ahmad Taufan Damanik yang juga Deklarator Nasional AEPI menyatakan kehadiran AEPI merupakan bagian dari upaya melakukan koreksi terhadap kebijakan yang berkaitan ekonomi politik. AEPI diupayakan menjadi wadah untuk berperan serta dalam kemajuan bangsa Indonesia yang dilandasi dengan terciptanya demokrasi ekonomi yang bermoral serta bermartabat. AEPI, menjadi salah satu jalan untuk mencapai tujuan cita-cita untuk mandiri di bidang ekonomi. “Cita-cita mewujudkan perekonomian bangsa yang mandiri, demokratis, dan berkeadilan adalah bagian yang sah dari cita-cita perjuangan kemerdekaan Indonesia. Namun sejak hari pertama setelah proklamasi, jaringan neokolonialisme dan para agennya tidak pernah berhenti berusaha merongrong pengamalan cita-cita tersebut,” katanya. Pemerintah, kata Taufan, dinilai perlu melakukan koreksi secara menyeluruh terhadap struktur ekonomi politik. Pasalnya, demokrasi politik saja tidak mencukupi bagi rakyat banyak untuk dapat mengendalikan jalannya roda perekonomian. Disebutkan Taufan, sebagaimana dalam berbagai bidang kehidupan lainnya, persaingan politik tidak mungkin dapat dipisahkan dari keperkasaan kapital. Dengan demikian, walaupun suatu masyarakat berusaha mengembangkan sistem politik yang secara prosedural tergolong demokratis, tetapi

jaringan kekuatan kapital akan tetap berusaha untuk melakukan segala upaya untuk mempengaruhi pilihan-pilihan politik masyarakat. “Model pembangunan ekonomi politik neoliberal yang tengah dijalankan sekarang, tidak dimaksudkan untuk mengkoreksi struktur ekonomi warisan kolonial tetapi justru mempertahankannya. Sistem ini telah berkontribusi besar dalam menciptakan berbagai krisis yang dialami bangsa ini,” tukas Taufan Damanik. Selama 65 tahun pasca proklamasi, kata taufan, struktur perekonomian Indonesia yang bercorak kolonial masih terus bertahan. Bahkan, dalam satu dekade terakhir, kecenderungan untuk mensubordinasikan perekonomian Indonesia di bawah struktur kapitalisme internasional itu diperparah oleh perlaksanaan agenda-agenda ekonomi neoliberal secara masif yang didukung kemajuan teknologi informasi. “Seharusnya, yang perlu dilakukan adalah melanjutkan perjuangan para pendiri bangsa dalam mewujudkan perekonomian yang mandiri, demokratis, dan berkeadilan sebagaimana digariskan dalam Pasal 33 UUD 1945 beserta penjelasannya,” katanya. Kesenjangan dan ketidakadilan sosial, yang ditutupi dengan pemaparan indikator-indikator yang mengagumkan di atas kertas, kini menjadi kenyataan sehari-hari. Muaranya, sebagian rakyat Indonesia, sebagai pemilik sah negeri ini, yang seharusnya meningkat derajat dan martabatnya sebagai tuan di negeri sendiri, terpaksa bertahan hidup dengan menjadi kuli kelas dunia. (REL)


12

KPK POS

Kriminal

E D I S I 176 28 NOPEMBER - 4 DESEMBER 2011

LIPSUS

KAPOLRESTA MEDAN KOMBES TAGAM SINAGA SH :

Yang Kena Tilang Dikirim Ke Kayu Putih

MEDAN GELAR TERTIB LALIN DAN BERSIH-BERSIH REGULASI DUA pekan lalu, sejumlah personel Kepolisian Resor Kota Medan meringsek ke beberapa terminal “mini” jasa angkutan antarkota dalam provinsi, menebar di beberapa ruas jalan diantaranya Jalan Sisingamangaraja, Kota Medan. Memang sejak, pekan itu, Kepolisian menggiatkan tertib berlalulintas. Pengendara roda dua dan roda tiga (jenis beca bermotor) diwajibkan menyalakan lampu di siang hari. Kegiatan itu dilakukan sebagai implementasi dari UndangUndang Nomor 22 Tahun 2009 tentang Lalulintas dan Angkutan Jalan. Tak sedikit pengendara yang terjaring dalam operasi giat tertib lalin itu. Banyak pula terminal mini jasa angkutan yang mengoperasikan jenis kendaraan berplat hitam ditegur. Tentu kegiatan penertiban terminal mini, tertib berlalulintas, adalah kegiatan yang

tentu didukung. Tetapi, terhadap angkutan kota dalam provinsi, ini tak sekadar hal biasa. Sebab, kita ketahui moda transportasi massal selain kereta api, pesawat dan kapal. Moda transportasi massal darat, masih kurang memadai, dan jauh dari kenyamanan. Selain itu, belum semua wilayah dicakup oleh moda transportasi massal ini. Kedatangan tim gabungan penertiban terminal liar ke perusahaan Paredep Taxi yang berada di Jalan SM Raja Medan, ternyata membuat pemilik angkutan ini tidak bisa berkutik termasuk ketika petugas menurunkan plang nama perusahaan miliknya tersebut. “Memang saat ini kami belum memiliki izin, izin kami yang lama telah mati pada 2010.Dan saat ini sedang dalam proses pengurusan, terakhir kali kami mengurus izin tahun 2005 lalu dan izin kami yang

kemarin di terbitkan Dishub Sumut,” terang pemilik Paradep Taxi, Meredep ketika ditanya ketika perusahaannya ditertibkan oleh petugas Senin pekan lalu. Dikatakannya, atas razia yang dilakukan oleh pihak Dishub ini, beberapa waktu kedepan pihaknya tidak lagi beroprasi. “Saat ini mungkin kami tidak beroperasi lagi, tapi kami juga tidak tinggal diam dan akan mengurus izin kembali karena tidak mungkin kami tidak beroperasi lagi ada sekitar 50 karyawan yang menggantungkan nasibnya,” terang Maredep. Namun demikian masih dikatakan Maredep, dalam penertiban terminal liar ini hendaknya janganlah pilih kasih. Artinya kalau memanng ada angkutan yang melanggar peraturan juga harus ditindak seperti yang telah dialaminya tersebut. "Kalau semua ditertibkan

Razia Terminal Dianggap DISKRIMINATIF RAZIA yang dilakukan tim gabungan terdidri dari petugas kepolisian dan petugas Dishub Medan di Medan dibeberapa lokasi terminal diluar terminal Amplas dna terminal Pinang Baris Medan yang dianggap mereka mencari sewa di terminal liar, Kesper Sumut (Keluarga Besar Sopir dan Pengemudi Sumatera Utara) menilai razia kali ini terhadap loket loket (penjualan tiket) di terminal bus liar di Medan dianggap Pengurus Kesper Sumut terkesan diskriminatif. Penertiban yang dilakukan petugas gabungan dilakukan terhadap beberapa loket penjualan tiket bus yang memiliki izin. Demikian dikatakan Israel Situmeang Sekretaris Kesper Sumut kepada KPK Pos kemarin. Israel menambahkan, Razia petugas gabungan ke terminal yang dianggap mereka liar hanya dilakukan terhadap loket penjualan yang ada izinn ya sementara loket penjualan tiket diduga tidak memiliki izin yang armada mobilnya berplat hitam tidak terjamah petugas gabungan ini dimana mereka hingga kini masih leluasa menjalankan penjualan tiketnya kepada penum-

pang apalagi mereka berani menaikkan maupun menurunkan penumpangnya dipinggir jalan di Medan. Loket penjualan tiket liar ini umumnya mereka tempati kios maupun ruko di pinggir Jalan Raya salah satunya di Jalan Sisingamangaraja, Jalan Laksana, Jalan Letjen Jamin Ginting,Jalan Prof. H.M Yamin Medan. “Dimana keberadaan loket penjualan tiket penumpang tersebut sering menimbulkan kemacetan lalu lintas dikawasan tersebut apalagi mobilnya diparkirkan dipinggir badan jalan sehingga menimbulkan kemacetan lalulintas umumnya disekitar penjulan loket tersebut, dimana penjualan tiket penumpang mobil plat hitam ini diduga tidak memiliki izin,” ujarnya. Menurut Israel seharusnya Badan Koordinasi Penertiban (Bakortib) terminal liar konsisten melakukan penertibkan loket penjualan tiket berikut mobil plat hitam yang sudah sangat merugikan pemilik armada yang resmi (Palat kuning) dimana mereka membayar pajak kenderana etrsebut dengan jumlah yang cukup besar.

kami tak akan protes ini,” harapnya. Selain merazia perusahaan milik Maredep, petugas gabungan inipun langsung menuju ke Perusahaan angkutan CV Sartika Group yang berada di Jalan SM Raja Simpang Limun Medan. Namun Disini petugas hanya melakukan peneguran saja. Pasalnya perusahan angkutan umum tersebut memiliki izin. Sementara itu M Saragih pengelola CV Sartika mengatakan, bukanny mereka tidak mau mengangkut penumpang di Terminal Amplas. Hanya saja, Terminal Amplas harus terlebih dahulu direnovasi lalu baru mereka akan kembali ke terminal mengangkut penumpang.“Perbaiki terlebih dahulu terminalnya baru kami mau mengangkut penumpang ke Terminal Amplas,” terangnya. (S.EDHI)

Kapolresta Medan Kombes Pol Tagam Sinaga mengatakan dalam menertibkan terminal liar dan loket liar. Polresta Medan telah berkoordinasi dengan Pemko Medan yang selanjutnya membackup penertiban terminal liar tersebut. Menurutnya yang akan ditertibkan dalam operasi ini adalah masalah terminal liar, loket liar, menaikkan dan menurunkan penumpang, betor yang tidak punya izin dan kegiatan ini dilaksanakan selama 20 hari sampai mendekati tahun baru yakni Operasi Lilin Toba untuk pengamanan tahun baru. “Dalam operasi ini yang melanggar akan diberi sanksi, bertingkat mulai dari tilang, kemudian sampai penarikan kenderaan yang akan dikirim ke Kayu Putih, “ ujar Tagam Sinaga ketika ditanya wartawan di Mapolsekta Medan Kota usai memimpin langsung razia penertiban terminal liar dikawasan Jalan SM Raja Medan, Senin pekan lalu. Lebih lanjut dirinya mengatakan, untuk tim pertama akan dipimpin oleh Kasatlantas Kompol I Made Ari Pradana, tim ke II dipimpin Kasat Sabahara Kompol Beny M Saragih, Kasad Binmas Kompol Armen Hutahuruk. “Kalau kita bilang dimana –mana saja tim itu bergerak bisa bocorlah nanti razianya. Soalnya kita sudah cukup melakukan sosialisasi dan pengumuman dan akan kita lakukan penindakkan,” terangnya. Ia mengimbau kepada masyarakat pengendara sepeda motor, angkutan kota (angkot) dan angkutan lainnya untuk segera melengkapi administrasi kenderaanya seperti SIM, STNK dan kelengkapan lainnya. “Penertiban gabungan melibatkan Sat Lantas Polresta Medan, Provost, Sat Sabhara, Dishub, Satpol PP, Organda Medan, Polisi Militer. Yang terkena razia akan disita kendaraannya dan diwajibkan mengikuti sidang di PN,” terangnya. Penertiban dilakukan 3 tim. Tim 1, terdiri dari Satlantas, Sabhara, Provost, PM dengan sasarannya roda dua dan roda tiga yang tidak menggunakan helm dan tidak menyalakan lampu utama di siang hari. Tim 2, Sat Lantas, Sabhara, PM, Dishub Medan, Pol PP, Organda Medan dengan sasaran terminal liar dan agen serta pool angkutan umum yang melanggar SK Walikota.Tim 3, terdiri dari Sat Lantas, Sabhara, Provost, PM, Dishub, Pol PP, Organda dengan sasaran angkot yang ngetem sembarangan dan melanggar rambu-rambu larangan berhenti atau larangan parkir dan bettor yang melanggar larangan area bebas bettor seperti di Jalan Sudirman dan Diponegero. Untuk masyarakat yang terkena tilang tidak diperbolehkan menitip tilang kepada polisi. kepada pengguna nantinya yang terkena tilang harus mengikuti sidang di PN Medan.“Bagi yang terkena tilang tidak diperbolehkan menitip ke petugas, dan harus mengikuti sidang, hal ini dilakukan untuk membuat efek jera,” terangnya. (S.EDHI)

Cara Akhir Tertibkan Lalulintas

Lokasi loket bus yang memiliki izin resmi dari Dinas Perhubungan (Dishub) Kota Medan kecil kemungkinan membuat kemacetan lalu lintas di sekitarnya, karena mereka dilengkapi area parkir khusus. Untuk itu Israel meminta kepada Bakortib dari Dinas Perhubungan Kota Medan dan kepolisian tidak diskriminatif saat menertibkan loket dan armada mobil plat hitam yang beroperasi menjadi angkutan tanpa izin trayek. Kesper Sumut mendukung kebijakan Pemerintah Kota Medan dan kepolisian untuk menertibkan loket serta terminal liar,upaya itu hendaknya tidak terkesan diskriminatif (pilih kasih). Selain menghindarkan diri dari kesan diskriminatif, petugas Bakortib dalam melaksanakan tugasnya melakukan razia dan penertiban loket liar hendaknya tidak arogan dalam menindak. Untuk mengurangi kemacetan lalu lintas di Medan, Kesper Sumut mendukung upaya Pemerintah Kota Medan dan aparat kepolisian menertibkan loket dan terminal liar,ujar Sekretaris Kesper Sumut tersebut. (KHAIR)

UPAYA aparat kepolisian dalam menertibkan kondisi lalulintas didaerah ini terus dilaksanakan secara berkesinabungan. Pasalnya, tingginya angka kecelakaan dijalan raya telah membuat pihak terkait membuat suatu tindakan/langkah penyelamatan nyawa masyarakat akibat kecelakaan disamping juga untuk menertibkan kondisi lalulintas. Bahkan sebelum melakukan penindakan langsung (Tilang), aparat kepolisian khususnya Satlantas Polresta Medan telah melakukan berbagai sosialisasi termasuk kepada para pemilik/pengusaha mobil angkutan tentang rencana penertiban terminal liar, termasuk melakukan kegiatan sosialisasi kesekolah-sekolah tentang penggunaan helm dan lampu. Dan sedikitnya ada 21 sekolah dengan jumlah siswa sebanyak 2085 orang. Kegiatan sosialisasi ini tidak lain hanyalah untuk mensosialisasikan UU No 22 Tahun 2009, penggunaan helm untuk roda dua dan tiga,penyalaan lampu siang hari, prosedur SIM. Selain membenahi soal pengendara roda dua dan tiga, polisi juga melakukan penertiban terhadap terminal liar yang dinilai sebagai

salahsatu faktor pemicu kemacatan dan kesemrawutan lalulintas dikota Medan. Bahkan Senin (21/1) pekan lalu yang merupakan hari pertama penindakan langsung (Tilang) terminal liar dilakukan ke kawasan Jalan SM Raja Medan yang langsung dipimpin Kapolresta Medan Kombes Tagam Sinaga SH. Dalam penindakan penertiban terminal liar berdasarkan pantauan dilokasi,suasana razia dan penertiban terminal bayangan di kawasan Jalan SM Raja Medan, nyaris berujung bentrok antara petugas tim gabungan dengan karyawan KUPJ Tours. Suasana panas tersebut terjadi, karena pihak KUPJ Tours merasa razia yang di lakukan Pemko dan Polresta Medan pilih kasih. Namun untungnya suasasana yang memanas tersebut tidak berlangsung lama, setelah pihak Polresta Medan mencoba memberikan pengertian kepada pihak KUPJ tersebut. Usai merazia KUPJ Tours rombongan petugas inipun kemudian bergerak menuju ke Perusahan Paredep Taxi milik Meredep yang berada tidak jauh dari KUPJ Tours yakni di Jalan SM Raja Medan samping Yuki Simpang

Raya.Disini tindakan penertiban petugas tidak ada mendapatkan perlawanan dari pihak perusahaan pengangkutan tersebut. Bahkan pihak perusahaan itu sendiri mengakui kesalahannya dengan alasan tidak mengantongi izin.Kemudian petugas inipun dengan leluasa menertibkan perusahaan angkutan itu yang salahsatunya merobohkan/menurunkan plang nama perusahaan tersebut dan membawanya kedalam mobil patroli. Sementara itu, akibat razia penertiban terminal liar di kawasan Jalan Sisingamangaraja simpang limun tersebut, beberapa penumpang yang ingin berangkat mengalami keterlambatan hingga dua jam. Seperti yang dialami Doni seorang penumpang yang ingin berangkat menuju Batubara meresa mengalami keterlambatan untuk berangkat. "Saya terpaksa terlambat berangkat akibat adanya penertiban terminal hari ini," terangnya. Menurut dia, untuk terminal yang lengkap dengan surat-surat izin tidak perlu lama-lama untuk melakukan pemeriksaan dan penertiban karena hal tersebut merugikan bagi para penumpang. (S.EDHI)


KPK POS

13

SUARA KPK

E D I S I 176 28 NOVEMBER – 4 DESEMBER 2011

Berharap pada OJK Oleh Marah Sutan Nasution SH

UU OJK memberi keleluasaan bagi lembaga OJK untuk bertindak, termasuk dalam hal penegakan hukum. Setelah lebih dari 12 tahun dibahas, akhirnya DPR mengesahkan UndangUndang tentang Otoritas Jasa Keuangan (OJK). Pembentukan OJK merupakan amanat Pasal 34 UU No 23 Tahun 1999 tentang Bank Indonesia. Pasal itu berintikan tugas mengawasi bank akan dilakukan oleh lembaga pengawasan sektor jasa keuangan yang independen paling lambat 31 Desember 2002. Namun, dalam perjalanannya, pembahasan OJK cukup alot, sehingga isi Pasal 34 harus direvisi melalui UU No 3 Tahun 2004 tentang Perubahan atas UU No 23 Tahun 1999. Revisi itu memuat ketentuan bahwa pembentukan OJK paling lambat 31 Desember 2010. Lagi-lagi, pemerintah dan DPR “ingkar” terhadap ketentuan Pasal 34 ayat (2) tersebut, sebab target pembentukan OJK yang ditentukan oleh undangundang tidak tercapai tepat pada waktunya. Pengesahan UU OJK tentu membawa nuansa baru dalam pengaturan dan pengawasan sektor jasa keuangan termasuk perbankan nasional. Sebab, UU OJK memangkas kewenangan pengawasan bank yang selama ini dijalankan oleh Bank Indonesia. Tugas pengaturan dan pengawasan bank akan beralih dari Bank Indonesia kepada OJK mulai 31 Desember 2013. Begitu juga dengan lembaga jasa keuangan lainnya yang selama ini di bawah pengaturan dan pengawasan Kementerian Keuangan dan Badan Pengawas Pasar Modal dan Lembaga Keuangan (Bapepam-LK) yang akan beralih ke OJK pada tanggal yang sama. Ketentuan inilah yang membuat alot pembahasan Rancangan Undang-Undang (RUU) OJK antara pemerintah dan DPR, disamping ketentuan mengenai susunan Dewan Komisioner OJK. Nampaknya, ada ketidaksetujuan dari internal BI apabila tugas pengawasan perbankan dialihkan kepada OJK. Masih lekat di ingatan, pada Desember 2010 tahun lalu, Ikatan Pegawai Bank Indonesia (IPEBI) secara tegas menolak RUU OJK. IPEBI menyatakan mayoritas pegawai BI menyatakan penolakannya untuk bergabung dengan OJK. IPEBI mengungkapkan dari 473 responden pegawai BI, 76,98 persen menyatakan menolak bergabung dengan OJK dan 14,54 persen bersedia bertugas di lembaga pengawasan sektor jasa keuangan. Sisanya, 9,88 persen memilih untuk pensiun dini (“Tolak OJK, ratusan pegawai BI kenakan pita hitam”, Kontan, Senin 06/ 12/2010). Kemudian, pada saat rapat kerja Panitia Khusus (Pansus) OJK DPR dengan Menteri Keuangan dan Menteri Hukum dan HAM tentang pandangan mini fraksi dan pengesahan draf akhir RUU OJK, Selasa malam (25/10/ 2011) di ruang rapat Komisi IX DPR, tidak ada satupun pejabat BI yang hadir. Memang, tidak ada keharusan bagi pihak BI untuk datang, namun sebagai lembaga yang memiliki kepentingan di dalam UU OJK, selayaknya BI ikut serta dalam forum tersebut. Seharusnya BI berkaca diri sebelum melakukan “protes”. Kinerja BI khususnya dalam pengawasan perbankan selama ini tidak menunjukkan hasil yang memuaskan. Hal ini tercermin dari maraknya kasus-kasus perbankan yang menyita perhatian publik. Sebut saja mega skandal kasus Bank Century (sekarang Bank Mutiara). Jika saja BI

melakukan pengawasan ketat sejak bank hasil merger tersebut lahir, tidak akan terjadi penggelontoran dana besar-besaran kepada Bank Century. Contoh lainnya kasus pembobolan dana nasabah oleh pegawai Citibank sebesar Rp17 miliar. Seharusnya bukan hanya Citibank yang disalahkan, tetapi juga BI karena bertindak sebagai pengawas bank. Seharusnya BI bekerja aktif, bukannya pasif (menunggu) dan baru bertindak setelah ada laporan dari masyarakat. Dan masih banyak persoalan-persoalan lainnya. Penyidikan Kini, harapan publik tertumpu pada OJK. Publik di sini bisa masyarakat umum, pihak perbankan, masyarakat pasar modal, perasuransian, lembaga pembiayaan, dan sektor jasa keuangan lainnya. Apalagi UU OJK ini, memberi keleluasaan bagi OJK untuk bertindak, termasuk dalam hal penegakan hukum. Ya, pemerintah dan sejumlah fraksi di DPR sedianya menginginkan agar OJK memiliki kewenangan pro justisia layaknya Komisi Pemberantasan Korupsi (KPK) yang menempatkan penyelidikan, penyidikan dan penuntutan dalam satu atap. Sebab tak dapat dipungkiri, melalui sistem penegakan hukum satu atap, mayoritas perkara di pengadilan tindak pidana korupsi dimenangkan oleh KPK. Kewenangan lebih KPK ini dikarenakan pada awal reformasi, kejahatan korupsi dianggap sebagai kejahatan luar biasa (extra ordinary crime)— lihat Ketetapan Majelis Permusyawaratan Rakyat RI No. XI/MPR/1998 tentang Penyelenggara Negara yang Bersih dan Bebas Korupsi, Kolusi dan Nepotisme—sehingga penanganannya juga dilakukan dengan cara-cara yang extra. Tetapi OJK berbeda. Tidak ada penegasan baik di dalam TAP MPR maupun peraturan perundang-undangan yang menyatakan kejahatan di sektor jasa keuangan sebagai extra ordinary crime. Oleh sebab itu, sangat beralasan jika kemudian kewenangan penuntutan pada akhirnya dihapuskan. Tetapi kewenangan penyelidikan dan penyidikan tetap melekat pada institusi OJK. Apabila melihat bentuk OJK yang sifatnya independen maka sangat dimungkinkan dibentuk lembaga penyidik OJK. Hanya, apakah pembentukan penyidik independen OJK ataupun pejabat Penyidik Pegawai Negeri Sipil (PPNS) OJK, nantinya dapat memenuhi ekspektasi terhadap tiga tujuan dasar pembentukan OJK, yakni agar keseluruhan kegiatan di dalam sektor jasa keuangan: a. Terselenggara secara teratur, adil, transparan dan akuntabel; b. Mampu mewujudkan sistem keuangan yang tumbuh secara berkelanjutan dan stabil; dan c. Mampu melindungi kepentingan konsumen dan masyarakat. Apalagi pada kenyataannya selama ini PPNS di sejumlah kementerian dan lembaga negara tidak dapat menjalankan kewenangan penyidikan dengan baik. Perkara-perkara yang diajukan PPNS kepada penuntut umum jarang mencapai P-21 (penyidikan lengkap). Bahkan tak jarang kasusnya di SP-3 karena tidak memiliki kelengkapan alat bukti. Lagi pula, sangat sulit membentuk penyidik independen yang benar-benar independen dan bekerja secara profesional tanpa bantuan dari penyidik Polri ataupun penyidik Kejaksaan. Pengalaman membuktikan, lembaga penegak hukum independen sekelas KPK, yang sudah tujuh tahun berdiri, sampai sekarang belum memiliki penyidik independen. KPK nampaknya

tidak bisa dilepaskan dari personil-personil Kepolisian dan Kejaksaan. Sampai sekarang penyidik di KPK sebagian besar adalah penyidik dari Kepolisian. Sementara penuntut umum semuanya berasal dari Kejaksaan. Lantas bagaimana OJK yang baru akan dibentuk ini memposisikan diri untuk memiliki penyidik independen yang kewenangan pro justisiannya mirip dengan kewenangan KPK (kecuali kewenangan penyadapan yang tidak dimiliki penyidik OJK)? Tentu bukan persoalan yang mudah untuk diimplementasikan. Persoalan lainnya berkaitan dengan pos anggaran. Apakah pembuat UndangUndang sudah memikirkan dampak dari besarnya anggaran per kasus yang akan dikeluarkan dari budget OJK yang bersumber dari APBN nantinya? Contoh konkret di KPK. Dalam rapat kerja Komisi III DPR dengan pimpinan KPK, Rabu (26/10/ 2011), pimpinan KPK mengungkapkan bahwa anggaran penanganan satu perkara mulai dari penyelidikan hingga penuntutan ratarata menghabiskan biaya sebesar Rp56 juta. Lantas bagaimana dengan OJK yang akan menangani perkara-perkara di sektor jasa keuangan, dimana beban pembuktiannya jauh lebih kompleks ketimbang pemeriksaan perkara tindak pidana korupsi? Pasti butuh anggaran yang juga cukup besar. Persoalan berikutnya adalah perkara dan laporan seperti apa yang dapat ditindaklanjuti oleh penyidik OJK untuk diproses (dalam hal kompetensi penyidikan suatu kasus). Sebab, pasti tidak semua laporan atau aduan bisa ditindaklanjuti oleh penyidik OJK. Oleh karena itu perlu kriteriakriteria khusus perkaraperkara yang bisa ditangani oleh OJK. Sebagai contoh, apakah penyidik OJK dapat menindaklanjuti temuan atau laporan dan/atau aduan mengenai tindak pidana penipuan dalam kontrak berjangka yang masuk ke meja pengaduan OJK? Dalam hal ini saja, sudah ada dua lembaga penyidik yang berkepentingan di dalam kasus tersebut, yakni pertama, Kepolisian Negara Republik Indonesia; kedua, pejabat PPNS Bappebti yang berada di bawah kekuasaan Kementerian Perdagangan RI. Lantas, kalau ada posisi seperti ini, OJK akan berada di posisi yang mana, apakah akan melakukan supervisi atau hanya sekedar koordinasi? Untuk itulah perlu adanya sinkronisasi antar lembaga penegak hukum apabila memang dibentuk lembaga penyidik OJK. Yang juga perlu diperhatikan adalah kewenangan penyidikan oleh OJK tidak menjadi boomerang bagi sektor jasa keuangan di Indonesia yang mulai bangkit. Sebab, kewenangan penyidik OJK -seperti: meminta data, dokumen, atau alat bukti lain baik cetak maupun elektronik kepada penyelenggara jasa telekomunikasi, kemudian memblokir rekening pada bank atau lembaga keuangan lain dari pihak yang diduga melakukan atau terlibat dalam tindak pidana di bidang industri jasa keuangan- jangan sampai membuat investor dalam negeri maupun asing, menjadi phobia untuk menanamkan modalnya di Indonesia. Dan yang terakhir, keberadaan OJK diharapkan dapat membawa angin segar bagi konsumen pengguna jasa keuangan yang kerap dizholimi oleh tindakan korporasi yang tidak bertanggung jawab. Semoga. Penulis adalah Staf Ahli DPR/Konsumen Pengguna Jasa Perbankan/HO21111

Bukan Centeng Freeport Oleh Febri Diansyah

KEMELUT masih terjadi di Papua. Sebuah afiliasi dari perusahaan tambang internasional yang berkantor pusat di Phoenix, Arizona, Amerika Serikat sedang menuai masalah yang tidak kecil. Salah satunya, tentang dana keamanan Freeport yang diberikan untuk aparat Indonesia. Setelah di tahun 2005, Global Witness dan (Alm) Munir dari Kontras pernah mempersoalkan dana untuk “tentara Freeport” tersebut, sekarang persoalan tersebut muncul kembali. Polri mengakui adanya dana keamanan dari Freeport, dan pihak perusahaan tidak membantah. Bahkan Mabes Polri mengatakan dana tersebut sah secara hukum, tidak akan berhenti menerima meskipun banyak pihak mengkritik keras. Di sisi lain, Komnas HAM tegas mengatakan, dana itu illegal. Di Amerika, United Steelworkers (USW) mengirimkan surat ke Fraud Section di Departemen Kehakiman AS (1/11) agar memeriksa apakah dana ini merupakan korupsi seperti diatur di US Foreign Corrupt Practices Act. Bagaimana kita membaca fakta-fakta ini? Objek Vital Jika dicermati, kita bisa menemukan sejumlah kejanggalan. Dalam jawaban resmi Polda Papua pada Kontras, dikatakan bahwa ada 635 personil keamanan ditugaskan untuk pengamanan objek vital (Freeport). Untuk pengamanan tersebut ada kontribusi perusahaan Rp. 1.250.000/orang/bulan. Jika dihitung, maka selama satu tahun Satgas Pengamanan tersebut menerima Rp. 9,525 Miliar. Bandingkan dengan catatan Laporan Keuangan Freeport yang tidak dibantah oleh Polri, bahwa ada alokasi dana keamanan USD 14 juta atau senilai Rp. 126 Miliar di tahun 2010. Dikatakan bahwa Polri siap diaudit dan terbuka untuk penggunaan dana tersebut, dan dana itu secara riil langsung diberikan pada anggota di lapangan. Benarkah? Jika dicermati, ternyata dana yang diterima secara langsung oleh anggota Polri dan TNI di lapangan hanya 7, 56% dan masih ada selisih lebih dari Rp. 116 Miliar. Dari sini, wajar kita bertanya, kemana dan siapa penikmat dana 92,44% lainnya? Polri bisa saja menjawab, bahwa dana tersebut juga digunakan untuk kepentingan lain, tapi sistem keuangan kita menghendaki sebuah mekanisme penerimaan dan pertanggungjawaban yang lebih rinci dan terbuka. Di titik inilah, penggunaan dana tersebut harus diperiksa oleh instansi yang berwenang, seperti BPK atau BPKP.

Setelah mengurai kejanggalan dari aspek aliran dana, pertanyaan paling serius sebenarnya adalah: apakah dana keamanan tersebut sah? Polri mengatakan sah, dan menggunakan Keputusan Presiden No. 63 tahun 2004 tentang Pengamanan Objek Vital Nasional. Dan akan terus menerima dana dari Freeport selama belum ada Kepres yang baru. Logika yang menurut saya harus dikoreksi. Kenapa? Benar, bahwa Kepres yang diturunkan pada Keputusan Menteri ESDM Nomor 1762K Tahun 2007 menyebutkan ada 126 objek vital nasional di Kementrian ESDM. Akan tetapi, aturan ini tidak bisa menjadi dasar bagi institusi manapun melakukan pungutan uang atau menerima dana diluar ketentuan keuangan Negara yang ada. Bayangkan jika setiap departemen atau lembaga Negara bisa memungut uang di semua objek vital pada semua departemen, dan kemudian dana tersebut tidak dipertanggungjawabkan dengan mekanisme audit atau mekanisme keuangan Negara yang ada. Jika itu terjadi, ini adalah lobang besar yang potensial korup. Ingat, sejumlah kasus korupsi sudah diproses secara hukum terkait dengan dana-dana non-budgeter yang dikelola oleh lembaga Negara. Pasal 4 ayat (2) Kepres 63/2004 justru memberi kewajiban bagi Polri untuk memberikan bantuan keamanan. Kenapa diberikan pada objek vital? Pasal 2 Kepres ini menyebut karena objek vital tersebut punya arti penting bagi kebutuhan masyarakat, pemerintahan dan bahkan kemanusian atau kepentingan umum. Untuk itulah Polri diberikan tugas melakukan pengamanan. Hal ini pun sesuai dengan UU Nomor 2 tahun 2002 tentang Kepolisian Negara Republik Indonesia. Dana Centeng? Banyak pihak menyoroti aspek independensi Polri jika menerima dana dari perusahaan. Itu benar, akan tetapi ada persoalan yang lebih mendasar, apakah boleh institusi Negara menerima dan memungut uang dari perorangan masyarakat atau swasta diluar mekanisme keuangan negara? Tidak. Pasal 23A UUD 1945 melarang adanya pajak atau pungutan kecuali diatur dengan Undang-undang. Kenapa Undangundang? Karena disana ada keterlibatan rakyat melalui DPR untuk menentukan pungutan yang akan membebani mereka. Tapi, argumen ini akan dibantah: bukankah dana dari Freeport itu sumbangan sukarela? Mari bertanya, jika Freeport tidak berikan dana USD 14 juta, apakah akan diturunkan 635 aparat untuk amankan Freeport?

Aturan tentang penerimaan dana diluar pajak tersebut bisa kita lihat di UU No. 20 tahun 1997 tentang Penerimaan Negara Bukan Pajak. Di kepolisian sendiri, tariff dan jenis PNBP ini diatur secara rinci dan terbatas di PP No. 31 tahun 2004. Polri hanya bisa menerima PNBP dari 7 sumber, seperti SIM, STNK, Tes klinik mengemudi, BPKB, STCK, TNKB, dan izin senjata api. Tidak ada aturan bahwa Polri bisa menerima dana dari jasa pengamanan objek vital, apalagi masyarakat tidak pernah tahu penggunaan dana tersebut secara rinci, dan apakah dana itu disetor ke kas Negara? Hal-hal seperti ini sangat sensitif dan rawan korupsi. Tidak bisa dibayangkan jika institusi Negara tanpa dasar hukum yang kuat memungut atau menerima dana. Dari aspek PNBP sebernanya juga dimungkinkan adanya penerimaan dalam bentuk hibah dari pemerintah dan swasta dalam atau luar negeri. Hal ini diatur di Pasal 2 huruf (f) UU PNBP. Akan tetapi, dana-dana tersebut wajib disetor ke Kas Negara, dan seluruhnya dikelola dengan sistem APBN (Pasal 3 dan 4 UU PNBP). Apakah mekanisme pemberian dana kemanan Freeport sudah memenuhi aturan tersebut? Tidak. Selain dari aspek PNBP tersebut, kita perlu menganalisis dari aspek gratifikasi yang diatur di UU No. 31 tahun 1999 jo UU 20 tahun 2001 tentang Pemberantasan Korupsi. Menarik ketika dalam buku saku KPK memahami Gratifikasi disebutkan : bahwa gratifikasi adalah pemberian dalam arti luas. Tidak semua gratifikasi bisa dipidana memang, akan tetapi pada contoh ke-6, KPK menegaskan jika ada pemberian hibah dari BUMN atau swasta terhadap Polri, Kejaksaan atau instansi pemerintah lainnya, maka dana tersebut tidak bisa langsung diterima, tetapi harus dilaporkan ke KPK agar ditetapkan sebagai milik Negara, dan kemudian disalurkan dan digunakan melalui persetujuan Menteri Keuangan. Persoalan ini tidak boleh mengambang karena potensi korupsinya sangat tinggi. Presiden sebagai pimpinan di eksekutif tidak bisa lepas tanggungjawab terhadap fenomena ini. Pertanggungjawaban secara administrasi keuangan dan hukum juga harus dilakukan. Selain itu, jika memang ada persoalan kekurangan anggaran, hal ini pun harus diselesaikan. Karena, aparat keamanan kita jelas bukan “centeng Freeport” atau perusahaan manapun. Penulis adalah Peneliti ICW, Koordinator Divisi Hukum dan Monitoring Peradilan/Kmps 21111


KPK POS

14

ANEKA

E D I S I 176 28 NOPEMBER - 4 DESEMBER 2011

SUMUT

Bhayangkari Polres Langkat Kembangkan Apotik Hidup STABAT - Bhayangkari Polisi Resort Kabupaten Langkat, kembangkan apotik hidup di halaman warga Bhayangkari, serta di lahan kosong yang ada di sekitar Polsek di jajaran Polres. “Kita kembangkan tanaman apotik hidup di lahan anggota, pekarangan yang ada di sekitar polsek,” kata Ketua Bhayangkari Polres Langkat, Ny Yanti Mardiyono, di Stabat, Rabu. Dijelaskannya, tanaman apotik hidup tersebut, sebelumnya disemai ke dalam polibek, lalu setelah tumbuh akan ditanam di lahan yang sudah tersedia. Adapun tanaman yang ditanam berupa jenis sayursayuran seperti sawi, kangkung, tomat, cabai, maupun juga beberapa jenis tanaman lainnya seperti papaya, sirsak, jambu biji. Diharapkan nantinya, ka-

ta Ny. Yanti Mardiyono, apa yang dilaksanakan ini akan meningkatkan keterampilan keluarga Bhayangkari, dalam pemanfaatan lahan pekarangan untuk budidaya tanaman pangan, katanya. Selain itu dapat memenuhi kebutuhan pangan dan gizi keluarga secara lestari dalam suatu kawasan. Secara terpisah Kapolres Langkat AKBP H. Mardiyono SIK MSi, menjelaskan dukungan pihaknya terhadap pengembangan apotik hidup ini, juga mendukung pemberdayaan ekonomi anggota Polres Langkat. Selain itu sebagai wujud keikutsertaan jajaran Polres Langkat menyahuti visi misi Bupati Ngo_gesa Sitepu yang mewujudkan Bumi Langkat sebagai bumi religius yang nyaman, aman sebagai wujud kota Adipura. (JUL)

TABUR BIBIT - Ketua Bhayangkari Polres Langkat Ny. Yanti Mardiyono, didampingi Kapolres AKBP H Mardiyono SIK MSi, sedang menaburkan bibit kangkung, sawi, cabai, di polibek, untuk pengembangan apotik hidup. (KPK POS/JUL)

Peringatan Hari Kesehatan di Sawit Sebrang STABAT - Peringatan Hari Kesehatan Nasional ke 47 yang dilaksanakan di perumahan PTPN 2 Sawit Sebrang, Kabupaten Langkat, berlangsung sukses dan meriah. Dalam acara yang diselenggarakan dokter-dokter Puskesmas dan elemen masyarakat Sawit Sebrang itu, 1.500 orang warga lingkungan perkebunan memperoleh pengobatan gratis. Selain memberikan pengobatan graris, pihak penyelenggara juga mengadakan lomba bagi balita. Dalam acara ini, setidaknya 30 anak juga memperoleh khitanan gratis dan 40 ibu rumah tangga mendapat pelayanan Keluarga Berencana (KB) gratis.

Tentunya, pengobatan dan pelayanan KB gratis itu diberikan kepada masyarakat yang tidak mampu. Semua dana yang digunakan dalam acara ini ditanggung oleh dokter-dokter dan seluruh pegawai yang ada di Puskesmas Sawit Sebrang yang berjumlah 38 orang. Mereka dengan senang dan bangga dapat melaksanakan program Bupati Langkat Ngogesa Sitepu SH dan Gubernur Sumut agar rakyat sehat dan tidak terserang penyakit. Kegiatan ini melibatkan elemen masyarakat diantaranya LSM Topan RI, FKPM Karang Taruna tingkat kecamatan dan juga LSM LIPAT Langkat. (MIRA)

Camat Bintang Bayu Sambut Jamaah Haji SERGAI - Camat Bintang Bayu Drs.Zulkan didampingi Ketua MUI HM Shaleh, tokoh masyarakat H.Abd.Hamid dan elemen masyarakat lainnya, Kamis, di kompleks Masjid Jami' Bintang Bayu menyambut kehadiran beberapa jamaah Haji yang baru kembali dari Tanah Suci Mekkah. Tiba dikomplek masjid, para jamaah asal Bintang Bayu yang terdiri dari Kacadis H.Sunarrudin SPd, Pengawas TK/SD H.Bahtiar Ritonga SPd, Hj.Maemunah Sunaruddin, Hj Asnani Mahmud dan Hj Boniah disambut Camat penuh haru. Sesaat kemudian para jamaah melakukan sholat tahhiyatul

masjid sebagai tanda penghormatan terhadap rumah Allah. Drs Zulkan pada kesempatan tersebut mengatakan, sangat haru dan bangga, dimana dari Kecamatan yang dipimpinya yang berpredikat Haji bertambah. Artinya ini sangat berperan dalam pembinaan mental dan suasana keagamaan semakin tampak. Diharapakan predikat Haji Mabrur juga disandang dengan harapan kedepan partisipasi para Haji dan Hajjah dalam pembinaan mental di tengah-tengah masyarakat sangat diharapkan. Acara dilanjutkan dengan tepung tawar dan diakhiri dengan Doa.(ARM)

TEPUNG TAWAR - Camat Bintang Bayu didampingi tokoh Masyarakat H.Abd Hamid menepung tawari jamaah haji. (KPK POS/ARM)

Bupati Sergai Sambut Kedatangan 194 Jamaah Haji 2011 SEI RAMPAH - Bupati Serdang Bedagai (Sergai) Ir HT Erry Nuradi MSi secara langsung menyambut kedatangan 194 jamaah haji asal Kabupaten Sergai yang tergabung dalam kloter 12 Embarkasi Medan bertempat di Asrama Haji Pangkalan Masyhur, Jalan AH Nasution Medan, Kamis pagi. Penyambutan tersebut turut dihadiri Wakil Bupati Sergai Ir H Soekirman, Kakan Kemenag Wilayah Sumut Drs. H. Abdul Rahim, MHum, Asisten Ekbangsos Sergai Drs. Amirullah Damanik, Kakan Kemenag Sergai Drs HM Hasbi MA, Kabag Humas Sergai Drs. H. Mariyono SP dan Kabag Kessos Ikhsan, AP. Dalam sambutannya Bupati mengucapkan selamat atas kembalinya para jamaah haji ke tanah air dalam keadaan sehat tanpa kekurangan satu apapun sehingga dapat berkumpul kembali bersama keluarga. (ARM)

PARAH - Jalan menuju Desa Kampung Kristen yang saat ini rusak parah. ( KPK POS/ARM)

TAK PERNAH DAPAT PERHATIAN

Kondisi Jalan Kampung Kristen Rusak Berat BINTANGBAYU - Sejak puluhan tahun lalu dari masa masih tergabung dengan Pemkab Deli Serdang hingga masuk bagian dari Pemkab Serdang Bedagai, jalan Desa Kampung Kristen dari Desa Saranggiting Kahan, Kecamatan Bintang Bayu sama sekali tak pernah mendapat perhatian terlebih dari dinas PU Sergai. Akibatnya, jalan kondisinya sangat memprihatinkan dan sulit dilalui. Pantauan KPK Pos di lapangan, kondisi jalan rusak parah, penuh kubangan lumpur terlebih dimusim penghujan seperti saat ini. Praktis jalan tersebut tidak dapat dilalui kenderaan apalagi sepeda motor. Akibatnya sangat mempengaruhi harga jual hasilhasil pertanian dan perkebunan Desa Kampung Kristen. Pihak pembeli terpaksa

mengurangi harga, beralasan biaya operasional dan perawatan kendaraan akibat imbas parahnya jalan ke desa tersebut. Selain itu, para pelajar yang belajar ke SD 104285 Saranggiting Kahan dan SMA Negeri 1 Bintang Bayu serta pelajar dari Desa lain yang hendak belajar ke SMP Negeri 1 Bintang Bayu sangat terganggu dengan kondisi jalan. "Terpaksa kami menerobos jalan dari Kebun Karet milik PTPN-3 Kebun Silau Dunia," ujar siswa SD. "Tak jarang kami jatuh kelumpur karena sepeda motor kami tergelincir. Pakaian dan sepatu kami kotor pak," ujar pelajar SMA Negeri 1 Bintang Bayu. Kepala Desa Kampung Kristen, Robert Simanjuntak beberapa waktu lalu mengakui sudah lelah me-

ngusulkan perbaikan jalan baik lewat musrenbang Kecamatan maupun saat anggota DPRD melakukan reses. "Namun sepertinya tidak membuahkan hasil. Tak tahu apa penyebabnya," ujar Robert. Sementara itu, salah satu warga yang enggan dipublikasikan namanya mengatakan, ini bagian dari ketidak pedulian Pemkab Sergai terlebih Dinas PU. Selain itu ketidak pekaan dan kurangnya kegigihan dalam memperjuangkan keluhan masyarakat dari pihak terkait seperti Kepala Desa maupun Camat kami nilai sangat dominan. "Bagaimana mau peduli Muspika-nya tidak mau turun dan melihat kondisi jalan kami. Untuk itu kami meminta Bupati Sergai melihat kondisi jalan kami," ujar warga.(ARM)

Operasi Katarak Gratis di Tebingtinggi TEBINGTINGGI - Lion Clubs Medan Host bekerjasama dengan RSUD dr Kumpulan Pane Kota Tebingtinggi menggelar operasi katarak kepada 48 orang kurang mampu secara gratis di RSUD dr Kumpulan Pane Kota Tebingtinggi, Minggu. “Ini adalah kegiatan sosial yang dilakukan Lion Clubs Medan Host dalam rangka berbagi dengan warga kurang mampu yang berada di Kota Tebingtinggi. Gerakan sosial dilakukan dengan menggelar operasi katarak secara geratis bekerjasama dengan RSUD dr Kumpulan Pane Kota Tebingtinggi,” jelas Pengurus Lion Clubs Medan Host, Oemar Witarya didampingi Lakwan Engbie.

Walikota Tebingtinggi Ir H Umar Zunaidi Hasibuan yang turut menyaksikan kegiatan sosial itu mengatakan kepada sejumlah pasien agar jangan takut, sebab operasi katarak itu dilakukan oleh dokterdokter sudah berpengalaman. ”Apabila sudah dilakukan operasi nanti, hendaknya pasien kedepan diminta rajin datang mengontrolkan matanya ke RSUD dr Kumpulan Pane atau dokter yang sudah ditunjuk di Kota Tebingtinggi,” ucap Ir Umar Zunaidi Hasibuan. Walikota juga meminta kepada Kepala RSUD dr Kumpulan Pane dr H Nanang Fitra Aulia dan Kadis Kesehatan Kota Tebingtinggi Ramses Siregar un-

tuk terus memantau kegiatan tersebut. “Kepada Direktur Rumah Sakit Kumpulan Pane dan Kadis Kesehatan saya minta untuk terus memantau kegiatan ini, sebab sangat bermanfaat bagi masyarakat kita,” ujar Umar Hasibuan. Kepala RSUD dr Kumpulan Pane, dr Nanang mengatakan, dalam operasi katarak ini terdata sebanyak 48 pasien, tetapi setelah menjalani pemeriksaan pasien, hanya sebanyak 25 orang yang bisa menjalani operasi katarak. “Sebanyak 23 pasien lagi belum bisa melakukan operasi katarak, sebab hasil pemeriksaan laboratorium bahwa mereka kadar gula dan tekanan darahnya masih tinggi,” jelas dr Nanang.(RS)

SAMBUT HAJI - Bertempat di Asrama Haji Pangkalan Masyhur Medan, Kamis pagi, Bupati Sergai didampingi Wabup menyambut kedatangan rombongan 194 jamaah haji asal Kabupaten Sergai yang kembali ke tanah air. (KPK POS/ARM)

Walikota TT Jenguk Penderita SLE TEBINGTINGGI - Walikota Tebingtinggi H Ir Umar Zunaidi Hasibuan MM didampingi Kadis Kesehatan, Kepala RSUD Kumpulan Pane, Kabag Humas, Camat Padang Hulu dan Lurah, menjenguk Surianti (20) penderita Sistem Lupus Eritematosus (SLE), Senin, di Jalan Tengku Hasyim Kelurahan Bandar Sono, Kecamatan Padang Hulu. Walikota menyarankan Surianti dirawat di RSUD Kumpulan Pane dan dirujuk ke rumah sakit Adam Malik Medan. Penyakit ini bukan penyakit langka, namun itu semua tergantung kepada keluarga Surianti. "Kalo memang keluarga Surianti ingin membawanya ke luar negeri untuk berobat kami dari pemerintah kota Tebingtinggi tidak dapat banyak membantu. Namun bila keluarga mengikuti saran kami, pemerintah kota siap membantu dan dipantau langsung oleh kepala RSUD Kumpulan Pane dan Kadis Kesehatan. Keluarga hendaknya bersabar dan masalah umur urusan Tuhan, kita selaku manusia diwajibkan usaha," ujarnya.(RS)

Kontingen Pesparawi Tebingtinggi Dilepas TEBINGTINGGI - Guna mengikuti Paduan Suara Gerejawi (Pesparawi) tingkat Provinsi Sumatra Utara, Walikota Tebingtinggi Ir Umar Zunaidi Hasibuan MM didampingi Kakanmenag Drs. H. Hasbul Husaini, melepas kontingen Pesparawi kota Tebingtinggi, Selasa, di gedung Balai Kartini Jalan Imam Bonjol kota setempat. Keberangkatan kontingen Pesparawi tersebut dihadiri seluruh peserta, ketua Badan Kerja Sama Antar Gereja (BKAG) Pdt Firdaus Purba Sth, ketua Panitia Jefri Sembiring SE dan ketua kontingen Oga Mota Hulu SH. Dalam kesempatan itu, ketua Panitia Jepri Sembiring melaporkan, kontingen yang diberangkat ke kota Sibolga tersebut merupakan peserta hasil penyeleksian tingkat kota yang diadakan pada bulan Juli 2011 lalu. Sedangkan pembiayaan kegiatan ditampung APBD 2011 kota Tebingtinggi. Sementara ketua BKAG Pdt Firdaus Purba Sth dan ketua Pesparawi Ir.Antoni Lumbanraja senada menjelaskan, penyeleksian yang dilakukan pihak panitia dinilai sudah baik dan sudah mendekati powernya. Kegiatan ini bukan semata-mata mencari popularitas dan perlombaan saja, melainkan bertujuan untuk memuliakan nama Tuhan, semoga dapat meraih juara dalam berkat Tuhan. (RS)

Ustadz Maulana Pukau Masyarakat Sergai TANJUNG BERINGIN - Menyambut datangnya tahun baru Islam 1433 H, Pemerintah Kabupaten Serdang Bedagai (Sergai) kembali menghadirkan Ustadz kondang asal Jakarta HM Nur Maulana pada acara gebyar menyambut tahun baru Islam 1 Muharram 1433 H yang diselenggarakan di Stadion Mini Dusun III Desa Nagur Kecamatan Tanjung Beringin, Sabtu sore. Kehadiran Ustadz HM Nur Maulana tersebut merupakan kunjungannya yang kedua di Kabupaten Sergai dan masih tetap disambut antusias oleh warga. Tidak kurang 10.000 umat muslim terutama ibu-ibu berbondongbondong ingin menyaksikan ulama yang akrab dengan sapaan ustadz ”jamaah” tersebut dari jarak dekat. Dalam thausiyahnya Nur Maulana mengajak umat muslim untuk memaknai tahun baru Islam dengan melakukan Hijjrah yaitu berubah dari yang buruk menjadi

baik dan yang sudah baik harus dapat terus kita pertahankan serta menjadi manusia yang lebih baik lagi di masa yang akan datang. Ada tiga ciri manusia yang tidak pernah merugi, pertama orang yang beriman kepada Allah SWT karena orang yang beriman pasti memiliki kekuatan, yakni selalu memaknai bahwa segala sesuatu pasti ada hikmahnya sehingga dia tidak akan pernah mengeluh. Kedua, orang yang bersuka cita mendengarkan ceramah agama karena pahalanya sama seperti orang yang mengerjakan seribu rakaat salat sunnah dan yang ketiga adalah orang yang suka menyampaikan pesan-pesan kebaikan (syi’ar) kepada sesamanya, ungkap HM Nur Maulana Sebelumnya Bupati Sergai Ir HT Erry Nuradi MSi dalam sambutannya turut merasa kagum menyaksikan animo masyarakat yang luar biasa dalam menghadiri acara keagamaan seperti itu dan menga-

jak kita semua agar sama-sama menyimak dan dapat mengambil

hikmah dari apa yang disampaikan Ustadz H. M. Nur Maulana. (ARM)

GEBYAR MUHARRAM - Bupati Sergai Erry Nuradi didampingi Ustadz kondang HM Nur Maulana menyampaikan sambutan dihadapan ribuan umat Muslim pada acara pembukaan gebyar menyambut tahun baru Islam 1 Muharram 1433 H di Stadion Mini Desa Nagur Kecamatan Tanjung Beringin, Sabtu. (KPK POS/ARM)


15

KPK POS

ANEKA

E D I S I 176 28 NOPEMBER - 4 DESEMBER 2011

SUMUT / ACEH / JAMBI

BRI Pesat Berdayakan Pasar Tradisional Rp2,7 M Untuk Pembukaan Jalan Baru di Nias NIAS – Dinas Sosial, Tenaga Kerja, dan Transmigrasi Kabupaten Nias Tahun Anggaran (TA) 2011 mengalokasikan dana senilai Rp2,7 miliar bersumber dari Anggaran Pendapatan dan Belanja Daerah (APBD), yang sasarannya untuk 9 kecamatan, dibagi di 24 desa yang dimanfaatkan untuk pembukaan jalan baru/perkerasan dengan pemasangan batu/ telford/sirtu yang dilaksanakan bulan Oktober 2011 dan berakhir Desember 2011. Hal itu dikatakan Kepala Dinas Sosisal, Tenaga Kerja dan Transmigrasi Kabupaten Nias Drs Asyiksana Hulu melalui Koordinator Lapangan (Korlap), F.Bate’e kepada KPK Pos di ruang kerjanya, Selasa. Dikatakan, kegiatan pa-

dat karya ini dilaksanakan Dinsosnakertrans Kabupaten Nias dan Organisasi Desa (Ordes). "Program ini bertujuan selain untuk mempermudah sarana transportasi bagi warga masyarakat di pedesaan, juga untuk meningkatkan pendapatan masyarakat desa bagi yang ingin bekerja melalui uang perangsang kerja," katanya. Masyarakat sangat antusias mendukung kegiatan ini dan diharapkan ke depan agar pemerintah mencadangkan dana guna kesinambungan kegiatan ini supaya desa-desa yang terisolir dan tidak dapat dilalui kendaraan dapat teratasi. Salah satu lokasi pembangunan jalan baru yang dibangun Dinsosnakertrans Ka-

bupaten Nias melalui padat karya yakni pembukaan jalan baru/perkerasan jalan desa Lahemo Kecamatan Gido Kabupaten Nias. Dan berdasarkan pemantauan di lapangan, pekerjaan tersebut hampir rampung. Tokoh masyarakat Desa Lahemo, S.Gulo yang dikonfirmasi KPKPos di lokasi, Sabtu, mengatakan, masyarakat sangat berterimaksih kepada pemerintah Kabupaten Nias yang telah mengalokasikan pembangunan jalan di beberapa desa di Kabupaten Nias melalui program padat karya. "Diharapkan kepada pemerintah daerah agar jalan ini kedepan dapat ditingkatkan pembangunannya menjadi jalan aspal," katanya. (YaGi/NZ)

Lift Kantor Gubernur Jambi Sering Rusak JAMBI - Dua orang staf pegawai dari bagian Kesramas Kantor Gubernur Provinsi Jambi terjebak dalam lift yang kerap rusak. Berulangkali lift kantor gubernur ini rusak dan nyaris mengambil korban. Pada hari itu, dua staf bagian Kesramas Nana dan Yeni turun dari lantai tiga dan bermaksud untuk kembali bekerja. Mereka memasuki lift yang sering rusak itu. Dalam keadaan panik kedua orang staf menekan tanda darurat untuk meminta bantuan pertolongan agar mereka terbebas dari lift rusak. Menurut Yani, salah satu staf bagian administrasi, lift pada Kantor Gubernur Jambi ada dua. Namun salah satunya sering macet serta beberapa dari pegawai maupun dari kalangan umum serta wartawan yang akan ke lantai tiga sering terjebak dalam lift. "Gimana jika yang terjebak itu Gubernur, Wakil Gubernur, Sekda serta tamu khusus yang menaiki lift yang rusak. Tentu akan menjadi persoalan besar," ujar Rani yang mengharapkan agar lift yang sering rusak itu diperbaiki. (INRO)

TV LCD dan Kulkas Untuk Warga Korpri STABAT - Menyemarakkan Peringatan Hari Ulang Tahun ke-40 Korps Pegawai Republik Indonesia (KORPRI), Bupati Langkat Ngogesa Sitepu memberikan secara cuma-cuma dua unit TV LCD masing-masing 32 inch dan 24 inch serta satu unit kulkas sebagai hadiah utama kepada peserta jalan santai lucky draw di Tribun Alunalun T. Amir Hamzah Stabat, Rabu. “Kiranya sumbangan ini bermanfaat untuk terus memupuk semangat kerja dan kebersamaan jajaran KORPRI Kabupaten Langkat,” ujar Nuraida Ngogesa menyampaikan pesan Bupati Langkat sesaat pencabutan nomor keberuntungan hadiah utama TV LCD 32 inch yang diraih 0534 atas nama

Rusli Sitepu dari Kecamatan Salapian. Sementara hadiah TV LCD 24 inch diraih nomor 2105 atas nama Ramadhani Bagian Organisasi dan 1 unit kulkas merk ternama berhasil diraih nomor 0824 atas nama Raudah dari Dinas

Dikjar UPT. Salapian. Sebelumnya, berhubung hujan turun pelaksanaan jalan santai diganti dengan ramah tamah seluruh peserta yang merupakan warga KORPRI di lokasi acara sembari membagikan nomor keberuntungan. (JUL)

HADIAH - Rusli Sitepu sebagai pemenang undian utama berupa TV LCD 32 inch diabadikan bersama Ketua TP-PKK Langkat Ny. Hj. Nuraida Ngogesa didampingi Ketua KORPRI beserta isteri Ny. Hj. Khairul Bariah Surya. (KPK POS/JUL)

TEBINGTINGGI Bank Rakyat Indonesia Peduli Pasar Rakyat (BRI-PESAT) merupakan salah satu program terwujudnya kerjasama antara Bank BRI dengan Asosiasi Pengelola Pasar Indonesia (Aspindo), dengan tujuan memberdayakan usaha mikro kecil dan menengah pasar tradisional diseluruh Indonesia.

“Melalui program pemasaran yang terintegrasi dan untuk wilayah kerja BRI Cabang Tebingtinggi, Pasar Gambir dan Pasar Inpres merupakan pasar potensial di kota ini,” demikian disampaikan Walikota Tebingtinggi melalui Plt Sekdako Drs

H Hadi Winarno pada pembukaan kegiatan BRI Peduli Pasar Rakyat, Selasa, di Pasar Tradisional Gambir Tebingtinggi. Acara tersebut turut dihadiri Wakil Ketua DPRD, H Amril Harahap, Kepala Cabang BRI Tebingtinggi, Suyanto, Wakapolres Tebingtinggi Kompol Syafwan Khayat SH MHum, unsur muspida dan para pedagang di Pasar Gambir Jalan Iskandar Muda Kota Tebingtinggi. Menurut Walikota, kegiatan tersebut sangat relevan dengan rencana program pembangunan Kota Tebingtinggi dibidang perekonomian yang bertumpu pada perekonomian rakyat khususnya para pedagang kecil dan menengah. “Kita bersyukur dengan adanya kegiatan BRI Pesat ini sebab relevan dengan visi dan misi pemerintah kota khususnya dibidang peningkatan sektor perekonomian rakyat,” sebut walikota. Hal senada disampaikan

Wakil Ketua DPRD H Amril Harahap. Menurutnya, program BRI Pesat memang sengaja diluncurkan pada komunitas pedagang pasar tradisional dengan tujuan untuk mengembangkan potensi pedagang pasar tradisional yang selama ini belum tersentuh oleh perbankan. “Kita semua telah mengakui bahwa keberadaan pasar tradisional pada saat ini telah tergusur dengan keberadaan pasar modern/swalayan. Pasar tradisional yang memiliki image kumuh dan becek merupakan salah satu alasan banyaknya konsumen yang beralih ke supermarket/swalayan, padahal dari segi harga, pasar tradisional lebih murah dari supermarket/swalayan,” katanya. Sementara itu, Kepala Cabang BRI Tebingtinggi, Suyanto menjelaskan, kegiatan BRI PESAT ini dilaksanakan bersamaan dengan kegiatan Corporate Social Responsibility (CSR) sebagai Bank yang peduli pada rak-

yat kecil atau pengusaha dilingkungan pasar maupun sebagai tanggungjawab sosial. “Sasaran akhir dari BRI PESAT adalah kepedulian pengurus (pengelola) pasar dan pedagang terhadap lingkungan pasar yang nyaman, meningkatkan kesejahteraan komunitas pedagang dan mengoptimalkan fungsi dan peran BRI sebagai lembaga keuangan dilingkungan pasar,” katanya. Berdasarkan potensi bisnis di Pasar Gambir dan Pasar Inpres kota itu, terlihat masih besar peluang meningkatkan pelayanan dan akses calon debitur untuk BRI yakni, dari 1.150 jumlah pedagang Pasar Gambir terdata sekitar 913 pedagang yang telah menjadi nasabah pinjaman dan simpanan (79 %), sedangkan dari 394 jumlah pedagang Pasar Inpres terdata sekitar 124 pedagang yang telah menjadi nasabah pinjaman dan simpanan (31%). (RS)

Warga Sei Kepayang Minta Jalan Diperbaiki KISARAN - Masyarakat Kecamatan Sei Kepayang Barat meminta kepada Pemkab Asahan untuk memperbaiki kerusakan jalan. Permintaan tersebut diajukan dalam acara coffee morning Bupati Asahan yang dilakukan di Kecamatan setiap hari Kamis. Selain mengajukan permintaan, masyarakat Kecamatan Sei Kepayang juga memberikan saran dan kritik. Diantaranya terkait pembangunan sarana infrastruktur jalan menuju Kecamatan Sei Kepayang yang mengalami kerusakan cukup parah,

sehingga hasil pertanian dari daerah tersebut mengalami kost yang besar untuk diproduksi. Kabag Humas Setdakab Asahan, Rahman Halim AP mengatakan, bahwa dari Kecamatan setempat, masyarakatnya banyak mengeluhkan persoalan jalan. Selain persoalan jalan, kata Halim, persoalan perkebunan kelapa juga mendominasi di daerah penghasil kelapa ini. Masyarakat mengeluh hama yang menyerang pohon kelapa yakni binatang kera (monyet). Kemudian masyarakat

juga meminta bantuan berupa bibit kelapa, sekaligus pemasaran kelapa dalam. Pasalnya pemasaran kelapa jadi terhambat disebabkan harga produksi yang cukup tinggi. Menanggapi persoalan tersebut, Kabag Humas menjelaskan, ditahun 2011 pembangunan jalan di Kecamatan Sei Kepayang telah dilakukan dibeberapa titik yang dikerjakan melalui TMMD. Untuk tahun 2012 Pemkab Asahan akan melanjutkan pembangunan infrstruktur jalan sesuai dengan kemampuaan anggran Pemkab Asa-

han.“Pemkab tetap memperbaiki sarana jalan, namun dilakukan secara bertahap, tentunya tergantung anggaran,“ kata Kabag Humas, Kamis. Acara coffee morning yang langsung dihadiri Bupati Asahan, Drs H Taufan Gama Simatupang MAP tersebut mendapat saran dan kritikan sebanyak 50 lembar. Selain persoalan perkebunan dan jalan, masyarakat setempat juga mempertanyakan tentang UKM, Posyandu dan lainnya.(IN)

Pemkab Asahan Gelar Sosialisasi Pembentukan BUMDes

Gapura Tiga Warna Ciri Khas Kabupaten Asahan

KISARAN - Pemerintah Kabupaten (Pemkab ) Asahan menggelar sosialisasi pembentukan Badan Usaha Milik Desa (BUMDes). Pembentukan BUMDes tersebut bertujuan untuk mengembangkan potensi perekonomian wilayah guna meningkatkan ekonomi masyarakat desa secara keseluruhan dan mampu membuka lapangan kerja dalam rangka mengatasi pengangguran. Wakil Bupati Asahan, H Surya BSc menjelaskan, Pemkab Asahan telah membuat beberapa terobosan dalam rangka percepatan pembangunan pedesaan. Diantaranya program bantuan keuangan bagi Desa dan Kelurahan sebesar Rp100 juta hingga Rp300 juta untuk setiap Desa dan Kelurahan, PNPM mandiri pedesaan, bantuan modal bagi UKM, alokasi dana desa (ADD) dan lain-lain. “Program itu semuanya adalah wujud kepedulian Pemkab kepada Desa dan Kelurahan, dan ditambah lagi dengan program baru BUMDes,“ kata Wakil Bupati Asahan, Rabu, di ruang Melati Pemkab Asahan. Mengenai BUMDes, Wakil

KISARAN - Seluruh Desa dan Kelurahan di wilayah Kabupaten Asahan kini sedang giat-giatnya melakukan pembangunan gapura tiga warna yang merupakan ciri khas daerah Kabupaten Asahan. Kepala Bagian Humas Setdakab Asahan, Rahman Halim AP mengatakan, setiap Desa dan Kelurahan harus membangun gapura selamat datang dengan dihiasai warna yang telah ditentukan. Yakni Merah, Kuning dan Hijau dan pembangunan gapura tiga warna tersebut harus tuntas pada tahun 2011 ini. Kabag Humas menjelaskan, tujuan pembagunan gapura tersebut adalah untuk menunjukan informasi daerah dan ciri khas Kabupaten Asahan. Pembangunan gapura

Bupati menjelaskan, BUMDEs merupakan wadah pengembangan jiwa kewirausahaan sekaligus menciptakan kesempatan kerja di Desa sesuai dengan amanat Permendagri nomor 39 tahun 2010 tentang BUMDEs. Diharapkan nantinya dalam menerima sosialisasi tersebut peserta diminta untuk memahami bekal dasar yang akan diterima selama berjalannya sosialisasi, karena hal ini akan terwujud secara nyata apabila peserta dapat memahami dan menerapkan secara baik dan benar dengan tetap menjaga memelihara dan meningkatkan mamajemen pemerintahan Desa. Sementara itu, Kepala Bapemmas dan Pemdes Asahan, Taufik ZA mengatakan, sosialisasi BUMDEs tersebut diikuti seluruh Kepala Desa, Camat se kabupaten Asahan, SKPD terkait. Dalam sosialisasi tersebut diisi oleh nara sumber yakni, Kepala Bapemmas da Pemdes Propinsi Sumatera Utara, Rusli Abdulah, Regional management consultant Medan dan Pinbuk Kabupaten Asahan. (IN)

diposisikan disamping badan jalan menuju daerah masingmasing. Mengenai anggaran, Kabag Humas menjelaskan bahwa sumber anggaran berasal dari anggaran bantuan keuangan desa dan kelurahan. Setiap Desa dan Kelurahan biaya untuk pembangunan harus disesuaikan dengan kondisi daerah masing-masing. “Biaya setiap gapura pasti berbeda, karena harus disesuaikan dengan kondisi lokasi daerahnya,“ kata Kabag Humas seraya mengatakan, Gapura yang akan terbangun pada tahun ini sesuai dengan jumlah Desa dan kelurahan Kabupaten Asahan yakni sebanyak 27 Kelurahan dan 177 Desa. (IN)

Pencanangan CTPS di RA Al –Hidayah SERBA JADI - Program Cuci Tangan Pakai Sabun (CTPS) selama 21 hari dilaksanakan di PAUD (Pendidikan Anak Usia Dini) yang ada di Kecamatan Serba Jadi, Sergai, khususnya di RA Al-Hidayah dan RA Nurul Ain. "Kebersihan itu perlu untuk menjaga kesehatan, apalagi anak-anak sebagai cikal bakal generasi muda bangsa dibutuhkan mempunyai pisik yang sehat dan kuat serta cerdas baik itu jasmani maupun rohani," demikian Camat serba Jadi Sariful Azhar SH , saat memberikan pengarahan dan bimbingan, pada acara CTPS tersebut. Hadir dalam acara tersebut Sekcam Sri Hernawati

SSos, staf Kantor Camat, Ketua TP PKK Kecamatan Serba Jadi Ny.Novrida Sariful Azhar SH, KUPT KB Supiani D, Ketua TP PKK Desa Karang Tengah Ny.Srinovita SPd. Darius Tarigan, Kepala RA Al-Hidayah Desa Karang Tengah Sahana, dan tokoh masyarakat serta undangan. Kepala Ra Al-hidayah Desa Karang Tengah, Suhana menyambut baik acara pencanangan cuci tangan pakai sabun selama 21 hari kepada santrinya. Dia juga menyampaikan terima kasih kepada rombongan dari Camat Serba Jadi dan pemerintahan Desa Karang Tengah yang hadir pada acara itu.(SP)

CUCI TANGAN - Camat serba Jadi Sariful Azhar SH, didampingi Ketua TP PKK Ny.Novrida Sariful, Kepala RA Al-Hidayah Suhana, Sekcam Sri hernawati SSos, TP PKK Desa karang Tengah NY.Sri Novita SPd, Darius Tarigan Kepala RA Nurul ‘Ain Fitri dalam acara cuci tangan pakai sabun 21 hari. (KPK POS/SP)


E D I S I 176 28 NOPEMBER - 4 DESEMBER 2011

KPKPOS

HALAMAN 16

DIHADANG KARYAWAN PT NAFASINDO

Tim Provinsi Gagal Pasang Patok Permanen Konsekuensi Jika Pimpinan KPK Dipilih DPR JAKARTA - Anggota Komisi III dari Fraksi Partai Hanura Martin Hutabarat menilai pemilihan Calon Pimpinan (Capim) KPK yang dilakukan oleh DPR rawan kepentingan politik. Sehingga sebaliknya pemilihan itu diserahkan kepada pihak independen yang berada di luar DPR. "KPK dipilih oleh fraksi-fraksi yang ada di DPR. Kalau fraksi kepentingannya politik. Terutama di 2014. Maka tidak bisa dipungkiri warna politik dalam seleksi capim sangat kuat," ujar Martin di Gedung DPR, Senayan, Kamis. Martin mengatakan, nuansa kepentingan politik ini terlihat karena saat ini menjelang Pemilu, sehingga dikhawatirkan pada pemilu nanti banyak kader partai politik yang terjerat kasus hukum di KPK. "Jadi Jangan lagi DPR yang memilih KPK," imbuhnya. Jika pemilihan Capim KPK tidak diserahkan kepada Komisi III, maka DPR memiliki dua pilihan untuk diikutsertakan dalam pemilihan Capim KPK. "Pertama lembaga independen kredibel dipilih oleh DPR, nanti lembaga ini yang memilih pimpinan KPK. Kedua, lembaga kredibel ditunjuk presiden memilih KPK, DPR hanya sifatnya hanya menyetujui," jelasnya. Dikatakannya, mekanisme seperti itu diharapkan akan mengurangi adanya transaksi politik dalam pemilihan Capim KPK di Komisi III nanti. "Harus ada perubahan. Ada niat kita agar DPR jangan sampai ada muatan transaksi politik. Saya lihat seleksi Capim KPK yang Antasari ada transaksi politik yang kuat," paparnya. Meski begitu, Martin mengakui usulan tersebut belum dibicarakan kepada seluruh anggota Komisi III, sehingga ini masih menjadi usulan dari Partai Hanura. "Nanti soal perubahan mekanisme pemilihan Capim KPK itu akan kita minta diakomodasi di perubahan UU KPK. Kondisinya untuk merubah itu di DPR memang saat ini cukup sulit. Oleh karena itu kita harapkan ada suara dari publik. Harus ada penggalangan civil society oleh fraksi-fraksi yang menyetujui hal ini, untuk merubah mekanisme politik di DPR ini. Itu usul Gerindra." (IC)

SINGKIL - Upaya tim fasilitasi penyelesaian sengketa lahan dari Pemerintah Aceh dan Muspida Aceh Singkil untuk melakukan patok permanen di lahan sengketa antara masyarakat 22 desa dengan PT.Nafasindo, Rabu pekan lalu, gagal dilaksanakan. Gagalnya upaya melakukan patok permanen ini, disebabkan adanya surat dari BPN-RI yang menyatakan bahwa PT.Nafasindo memiliki izin penguasaan lahan seluas 13.924 hektar. Selain adanya surat pernyataan dari BPN tersebut, pembatalan untuk melakukan patok permanen juga diakibatkan tidak kondusifnya situasi keamanan akibat adanya penghadangan yang dilakukan ribuan karyawan perusahaan. Sebelumnya, dalam rapat di ruang of room Setdakab Aceh Singkil tim fasilitasi penyelesaian sengketa lahan dari Pemerintahan Aceh, perwakilan DPRA, Muspida Aceh Singkil serta LSM Gempa sebagai perwakilan warga 22 desa, sempat terjadi perdebatan mengenai kewenangan BPN untuk melakukan patok permanen. Bahkan perdebatan dalam rapat tersebut sempat menjadi sengit akibat adanya salah seorang peserta rapat yang mengeluarkan pernyataan berbau SARA. Perdebatan baru reda

setelah Wakil Bupati Drs.H.Khazali sebagai pemimpin rapat, membuat keputusan bahwa patok permanen yang dilakukan oleh tim adalah kewenangan BPN. Dalam putusan lainnya dari hasil rapat tersebut, hasil patok permanen akan dibuatkan peta dan dikukuhkan atau diperkuat dengan sebuah berita acara dan ditandatangani oleh semua unsur tim yang telibat. Usai melakukan rapat yang dimulai sejak pukul 10.00 WIB, tepat pukul 14.00 rombongan tim bergerak menuju ke kantor perusahaan perkebunan PT.Nafasindo yang terletak di Lae Gombar, Kecamatan Kuta Baharu. Pantauan wartawan, situasi diseputar perkebunan terlihat mencekam akibat penghadangan dan juga sweeping yang dilakukan ribuan karyawan yang dulunya bernama Uber Traco tersebut. Sehari sebelumnya (Selasa), upaya penolakan terhadap patok permanen ini juga sempat diperlihatkan oleh perusahaan dengan cara mengerahkan ri-

TUNTUTAN WARGA - Perwakilan masyarakat dari 22 desa di Kabupaten Aceh Singkil yang didampingi LSM Gempa, saat mengadiri Konferensi Pers di Kantor LBH Banda Aceh. Mereka menuntut agar Pemerintah Aceh segera mengambil alih penyelesaian konflik tapal batas antara masyarakat Aceh Singkil dengan PT.Ubertraco/Nafasindo. (KPK POS/DOK)

buan karyawan berunjuk rasa ke Mapolres Aceh Singkil, kantor DPRK dan Kantor Bupati setempat. Tindakan karyawan perusahaan tidak hanya dengan cara melakukan 'sweeping', salah seorang anggota tim dari BPN bahkan nyaris diramairamaikan oleh ratusan karyawan lainnya yang berjaga-jaga di depan pintu kantor perusahaan. Nasib baik Kapolres Aceh Singkil AKBP Helmi Kwarta SIK yang ikut mendampingi tim fasilitasi tersebut berhasil menenangkan massa yang sudah emosi. Dari hasil pertemuan antara tim fasilitasi sengketa lahan dengan sejumlah staf perusahaan PT.Nafasindo terungkap adanya surat BPN-RI

KPK LAPOR KE KPK Anda mengetahui tindakan korupsi yang telah atau akan dilakukan seseorang yang anda kenal?

Jika pengaduan anda memenuhi syarat/kriteria yang dapat ditangani KPK, maka akan diproses lebih lanjut oleh petugas KPK.

Kriteria Pengaduan 1. Memenuhi ketentuan Pasal 11 UU RI No. 30 Tahun 2002. a. Melibatkan aparat penegak hukum, penyelenggara negara, dan orang lain yang ada kaitannya dengan tindak pidana korupsi yang dilakukan oleh aparat penegak hukum atau penyelenggara negara; b. Mendapat perhatian yang meresahkan masyarakat; dan/atau c. Menyangkut kerugian negara paling sedikit Rp1.000.000.000 (satu miliar rupiah). 2. Menjelaskan siapa, melakukan apa, kapan, di mana, mengapa dan bagaimana. 3. Dilengkapi dengan bukti permulaan (data, dokumen, gambardan rekaman) yang mendukung/ menjelaskan adanya TPK. 4. Diharapkan dilengkapi dengan data sumber informasi untuk pendalaman.

Pengaduan Dugaan Tindak Pidana Korupsi: Direktorat Pengaduan Masyarakat PO BOX 575 Jakarta 10120 Telp: (021) 2557 8389 Faks: (021) 5289 2454 SMS: 08558 575 575, 0811 959 575

RI di Jakarta, Gubernur Pemerintahan Aceh, Bupati Aceh Singkil, BPN Aceh Singkil, PT.Nafasindo dan LSM Gempa sebagai perwakilan dari masyarakat 22 desa yang bersengketa lahan dengan perusahaan. Ironisnya, ketika surat BPN tersebut diungkapkan oleh pengacara perusahaan Amir Husin, baik Muspida Aceh Singkil, maupun tim dari Pemerintahan Aceh mengaku tidak mengetahui adanya surat dari BPN pusat tersebut, kecuali perwakilan dari BPN Aceh yang ikut dalam tim, mengakui adanya surat dimaksud. Artinya, ketika tim berangkat dari Banda Aceh menuju Aceh Singkil, pihak BPN Aceh telah mengetahui ada-

TOKOH KELUARGA SAKINAH - Ketua TPPKK Langkat Hj. Nuraida Ngogesa saat menerima plakat saat dianugerahi sebagai Tokoh Perempuan Peduli Pembinaan Keluarga Sakinah yang diserahkan Ketua DPD. BKPRMI Langkat M. Kurnia Amir, Selasa.

Komisi Pemberantasan Korupsi

SILAHKAN MELAPOR KE KPK

menyangkut sengketa lahan yang selama ini tidak pernah diketahui oleh tim Pemerintahan Aceh. Dalam surat BPN-RI bernomor:3493/25.1600/IX/2011 tertanggal 22 September 2011 menyangkut tentang penyelesaian sengketa lahan/bidang tanah HGU No.1 dan HGU No.2 atas nama perusahaan PT.Nafasindo sebelumnya bernama Uber Traco dan ini diperlihatkan oleh pengacara perusahaan, Amir Husin kehadapan sejumlah anggota tim yang hadir dalam pertemuan tersebut. Surat yang ditujukan ke BPN Provinsi Aceh tersebut juga ditembuskan antara lain, Deputi Bidang Hak Tanah dan Pendaftaran BPN-

(KPK POS/JUL)

BKPRMI Langkat Adakan Seminar Keluarga Sakinah STABAT - Keluarga sakinah memegang peran penting bagi keberhasilan suatu daerah atau yang lebih besar lagi yaitu bangsa. Keluarga sakinah/harmonis hanya mungkin tercipta bila masing-masing anggota keluarga, suami, isteri dan anak-anak melaksanakan segala kewajiban yang harus ditunaikan, tanpa mendahulukan hak. Demikian sambutan Ketua TP-PKK Kabupaten Langkat Ny. Hj. Nuraida Ngogesa saat membuka Seminar Sehari Keluarga Sakinah BKPRMI Kab. Langkat di Gedung PKK Stabat, Selasa.

Nuraida mengutip hadist ‘Baiti Jannati” yang diungkapkan Rasulullah Muhammad SAW, bahwa rumah harus menjadi surga bagi seluruh penghuninya. Untuk mencapai hal tersebut, kita harus mempunyai niat disertai kiat, juga ilmu dan wawasan. Oleh karenanya seminar ini merupakan salah satu upaya mempersiapkan generasi muda yang siap dalam melanjutkan tahapan kehidupannya bila waktu berumah tangga telah tiba. Acara pembukaan seminar dirangkaikan dengan pemberian anugerah kepada Ny. Hj. Nuraida Ngogesa sebagai Tokoh Pe-

rempuan Peduli Pembinaan Keluarga Sakinah oleh Lembaga Pembinaaan dan Pengembangan Keluarga Sakinah DPD BKPRMI Langkat yang ditandai dengan penyematan Pin dan penyerahan plakat. Juga pelepasan Brigade BKPRMI Langkat untuk mengikuti Jambore Nasional di Cibubur Jawa Barat. Ketua BKPRMI Langkat Kurnia Amir SPdi mengatakan, salut kepada Bupati Langkat H. Ngogesa Sitepu yang berhasil memimpin Langkat yang ditandai perolehan 8 Penghargaan Nasional, juga tidak terlepas dari dukungan isteri. (JUL)

nya surat keterangan BPN pusat tersebut. Kenyataan ini sempat membuat anggota tim lainnya menjadi kesal. Pasalnya, selain upaya untuk menyelesaikan sengketa lahan tersebut menjadi berlarut-larut akibat adanya surat dari BPN pusat tersebut, juga pihak BPN terkesan menutup-nutupi dan tidak transparan. "Sebagai anggota tim kita tidak pernah diberitahu adanya surat dari BPN pusat tersebut. Parahnya lagi surat tersebut baru kita ketahui dari orang lain ada apa ini ?" protes Muslim Ayub anggota DPRA yang ikut dalam tim tersebut. Ketua Tim Fasilitasi Penyelesaian Sengketa Lahan Pemerintah Aceh M.Jakfar yang dikonfirmasi terkait adanya surat BPN pusat tersebut, menolak memberi komentar. Dengan alasan untuk keseragaman informasi, Jakfar mengarahkan agar KPKPos menghubungi Wakil Bupati Drs.H.Khazali yang juga sebagai pemimpin rapat tersebut. "Hubungi saja wakil bupati biar informasinya sama dan seragam," jawabnya. Informasi terakhir, tim fasilitasi Pemerintah Aceh ini meninggalkan Singkil Rabu malam itu juga. Rencananya, sampai di Banda Aceh tim akan membuat SK baru dalam rangka penyelesaian sengketa lahan tersebut sesuai dengan isi surat BPN-RI. (AZT)

Klinik Umum Al-Daffa Dibuka MEDAN - Klinik umum kesehatan yang dapat memberikan pelayanan terbaik bagi pasien, merupakan tekad bagi keluarga dr Hj Mazdalifah Wahab mendirikan Klinik Umum di Kota Medan. Dengan tekad 'membawa berkah dan kesehatan' bagi semua pihak, terutama bagi mereka yang sedang sakit, dokter muda ini mendirikan klinik umum yang diberi nama Al-Daffa. Klinik umum Al-Daffa ini berada di Jalan Gagak Hitam No.35 Ringroad Medan, yang diresmikan penggunaannya, Jumat (25/11). Peresmian beroperasinya klinik umum ini diawali dengan jamuan makan siang bersama dengan anak yatim piatu. "Acara peresmian ini dikemas sesederhana mungkin. Tak ada pengguntingan pita maupun kata-kata sambutan dari pejabat terkait. Hanya doa anak yatim piatu yang mengiringi acara pembukaan," ucap dr Mazdalifah. Menurut dokter muda jebolan Universitas Sumatera Utara (USU) ini, pelayanan kesehatan semakin dibutuhkan masyarakat. Karena itu, klinik umum yang dipimpinnya membuka praktek umum, Selasa - Jumat mulai pukul 09.00 WIB - 20.00 WIB. Hari Sabtu dari pukul 09.00 WIB - 15.00 WIB. Sedang hari Minggu dan hari Besar tutup. Fasilitas di klinik ini untuk sementara pemeriksaan kesehatan, tes gula darah, kolesterol, asam urat dan tes kehamilan. "Kita harapkan klinik ini membawa berkah bagi masyarakat," ucap Yusnar Lubis, atas nama pihak keluarga. (FR)

Wakil Bupati Tinjau Pelaksanaan Pelayanan KB MOW RANTAUPRAPAT - Wakil bupati Labuhanbatu Suhari Pane SIP meninjau secara langsung pelaksanaan pelayanan keluarga berencana Metode Operasi Wanita (MOW) yang dilaksanakan di Rumah Sakit PTPN III Aek Nabara, Kecamatan Bilah Hulu, Sabtu. Suhari mengatakan, pelaksanaan pelayanan KB MOW bertujuan untuk meringankan beban para calon akseptor dengan mendekatkan pelayanan kontap yang berkualitas. Dijelaskannya, segala biaya pelaksanaan KB MOW ini ditanggung sepenuhnya oleh pemerintah melalui dana APBN yang ditampung DIPA Perwakilan Badan Keluarga Berencana Nasional

Provinsi Sumatera Utara tahun anggaran 2011. Pemkab Labuhanbatu, kata Suhari, menyambut baik kegiatan seperti ini dan hendaknya dapat terus ditingkatkan agar pelayanan KB di tengah-tengah masyarakat dapat kembali berjaya seperti masa-masa lalu. “Dengan demikian pertumbuhan penduduk dapat terus ditekan di daerah ini, ” harap Suhari. Hal senada juga disampaikan Kepala Perwakilan BKKBN Provinsi Sumatera Utara yang diwakili Kabid Advokasi, Penggerakan dan Informasi Drs Dalang Sembiring MPHR. Program ini merupakan salah satu bentuk kepe- PESERTA MOW - Wakil Bupati Suhari Pane SIP didampingi Kaban Pemberdayaan Perempuan dan Keluarga Berencana Heli dulian BKKBN Sumut terhadap Fenida SKM Mkes, Kabid Advokasi, Penggerakan dan Informasi Drs Dalang Sembiring MPHR ketika mendatangi para keluarga yang ingin ber KB. (HAH) peserta MOW di ruang istirahat usai dioperasi. (KPK POS/HAH)

KPK POS Edisi 176  

KPK POS Edisi 176

Read more
Read more
Similar to
Popular now
Just for you