Page 1

mmiiddddllee eeaasstt

MMarch a y 2 02013 13




I www.landscape-me.com I May 2013


Published by:

This Month EDITOR’S NOTE

MEMedia Publishing FZ LLC IMPZ PO Box 485005, Dubai, UAE Telephone: +971 4 4470927 Fax: +971 4 4470928 Managing Partner Ziad Maarouf Copy Editor John Hampton Sales Manager Boushra Dinnawi Art Director Ramon Andaya Administrative Assistance Sarry Gan Contributors Tania Charaf Anna Scherling Anna Klingmann Julie Taylor Jerry de Gryse Kimberly Garza Natasha Tourish Printed by Al Nisr Publishing LLC

I

n our May issue we have rounded up some of the most interesting landscaping projects across the US, Morocco and Saudi Arabia. Some have already been completed and some are still under construction but all display best practices in environmentally challenging conditions. One of the most inspiring projects is the ‘hospital healing garden’ in San Diego. The project embodies nature, privacy and eco-friendly design so that it meets the needs of its users, the patients, visitors, doctors and staff. On page 50 we review one of Washington’s most iconic projects in recent years, formerly known as Square 54, The Avenue is a dynamic mixed use development located just 6 blocks from the white House. All of our featured projects celebrate the outdoors and promote accessibility to a healthy lifestyle, which should be at the forefront of every landscape architect and planner’s designs. Enjoy the issue!

John Hampton

Webmaster www.pdinventive.com Landscape is distributed free of charge in KSA, UAE, Qatar, Kuwait, Bahrain, Oman, Jordan, Eqypt, and Lebanon by Emirates Post UAE

For free subscription and to view the magazine please visit our website:

www.landscape-me.com

The First Specialised Landscape magazine in the Middle East

I www.landscape-me.com I May 2013




Contents May 2013- Issue 71

14 14 Luxury Residential Village Quartier in Beirut 20 Al Khobar Waterfront, Saudi Arabia 28 Mission & design concept, Place Lalla Yeddouna

20

50

34 Shades of green 40 Sacramento... the city of trees 44 Landscape Architecture of Saffire 50 The Avenue 56 Interview with Nora Aridi 60 Palomar Medical Center ReConnects Nature with Healing

44

40



I www.landscape-me.com I May 2013

60


Sprinklers

Fountains

Aerators

Circulators

Moisture Sensing Central-Satellite Control Systems

Moisture Sensing Solar Controllers

Micro-Irrigation & Light Powered Control Products

VALVE & FILTER

I www.landscape-me.com I May 2013




News & Events RESYSTA wins the award for Best New Landscaping Material in Gulf Market at the first AGRAme Awards celebrated at the Dubai International Convention and Exhibition Centre on 26th of March

REYSTA wins the award for Best New Landscaping Material in Gulf Market Resysta Building Material JLT was among the winners as the AGRAme Awards celebrated outstanding contributions in the agriculture and landscaping sectors at an extravagant ceremony and gala dinner in Dubai.

C

ontested by 18 organisations across five different categories, the awards were a new addition to AGRA Middle East, which opened on 26 of March at the Dubai International Convention and Exhibition Centre and concluded on the 28 of March. As a sustainable and green product, which is perfectly designed for the challenging weather conditions in the Gulf Region, Resysta was considered the best new material for landscaping. Its special characteristics give architects and clients total new design possibilities with a long lasting, low maintenance and sustainable product.



Richard Pavitt, Exhibition Director of AGRA Middle East said: “The AGRAme Awards are an excellent reference to pay tribute to the outstanding achievements of individuals, departments, teams and organisations that have contributed to the growth and development of the agricultural, poultry and landscaping industry across the region. All the winners tonight were well deserved and we congratulate them on their achievements.” Mazdak Rafaty, the GCC Representative of Resysta received the award and commented: “We are very happy about the recognition Resysta is getting in the GCC market in such a short time. We will do our best to introduce this amazing product beyond the landscaping sector as

I www.landscape-me.com I May 2013

it has a great potential in many different fields, such as marine and furniture sector.” Held under the patronage of His Excellency Dr. Rashid Ahmad Bin Fahad, Minister of Environment & Water, AGRA Middle East is sponsored by Platinum Sponsor Al Dahra Agriculture and partnered with VET Middle East, the leading event for the burgeoning veterinary industry in the region. Resysta is a sustainable material made mainly of rice husk. After being successfully established in the European, American, African and Fareast market, it is being introduced into the Gulf Region through Resysta Building Material JLT. For further details please visit www.resysta.com/me.


Rattan House is weaving

something special for you

Our 2013/14 Collection

w w w. r a t t a n - h o u s e . c o m T +971 4 338 2977

dubai@rattan-house.com

facebook.com/rattanhousefurniture

Join us in the unveiling of our new collection Visit our stand at INDEX, Dubai World Trade Center Hall 4, Stand 4E191 20th-23rd May 2013 Visit our facebook page for more information about our new Ablaq collection

I www.landscape-me.com I May 2013




News & Events Gained emphasis in Qatar and Saudi Arabia to comply with green building norms

Regulations effecting ME landscape industry to be discussed at Smart Landscape Summit The relatively recent introduction of ESTIDAMA planning and design regulations coupled with a growing global sense of responsibility for better resource management has effected a serious change in the landscape industry”, said Geoffrey Sanderson, Principal Director at GCLA International and one of the key speakers at the Middle East Smart Landscape Summit 2013.

P

roducts and processes, landscape management and maintenance are all under challenge and rightly so. ESTIDAMA demands that almost every landscape element be sustainable but there is a great deal of confusion and inadequate data to support choices of materials, especially plants, irrigation rates, hard landscape materials and furnishing”, said Sanderson. Over 300 landscape architects, designers, government authorities, urban planners, property developers, environmental specialists are expected to gather at the Middle East Smart Landscape Summit being held on 27 & 28 May at Jumeirah at Etihad Towers to discuss opportunities and challenges for the Middle East’s landscape industry, and see what initiatives are being taken by product suppliers to encourage sustainability. JoAnn Jain, Director at event organizer Expotrade Global, believes that the timing is right. “The focus by municipalities and property developers on sustainability is greater than ever, and smart landscape planning and design play a big role in this change”. Delivered through a combination of



key note presentations, case-studies, panel discussions and roundtable sessions the Summit will look at the upcoming projects by local municipalities, sustainable landscape design and architecture, technologies for irrigation and outdoor lighting, improving soil structure and discuss ways to build awareness and engage the community. Under the patronage of Municipality of Abu Dhabi City (ADM), which is at the forefront of green space policy in the Middle East, presentations from Dr. Amar Jarar, ADM’s irrigation expert, and lighting expert Martin Valentine, will no doubt be well attended. Other speakers include Dubai Municipality’s Director of Public Parks and Horticulture Ahmed Abdul Karim, Chief Commissioner of Aqaba Special Economic Zone Authority (ASEZA) Prof. Dr. Kamel Mahadin, green roof and living wall expert Gary Grant, Geoff Turnbull of ALDAR Properties PJSC, Holley Chant of KEO International Consultants, Steven Velegrinis of Woods Bagot and Talal Al Ansari of the Abu Dhabi Urban Planning Council. More information on the event can be found at www.landscapesummit.com

I www.landscape-me.com I May 2013

M

ajor opportunities still exist in GCC construction markets despite continuing delivery issues related to current projects. In a new report of Deloitte, it said opportunities remain prevalent in Saudi Arabia, Qatar, Abu Dhabi and Iraq beyond 2012. The report also indicated that longer term infrastructure investment plans for the region are estimated to be worth in excess of $1trn. In view of the recent news, Saudi Arabia and Qatar have emphasized the need for enhancing political consultations and exchanging views in order to have a joint vision to confront the challenges facing the region. While the global economy is in transition, regions like Qatar and Saudi Arabia are ushering in a series of changes, new economic policies and innovative strategies to further boost its economy. These changes, along with fundamental economic strengths, will allow them to play a greater role in global market whilst achieving its objective of sustainable growth and development. The enormous architecture and design driven market existent in Qatar, in light of the winning bid for FIFA World Cup 2022, as well as in Saudi Arabia, has resulted in identifying these regions as primary boom markets in the real estate segment. With several ongoing projects and many more in the pipeline, it has been identified that key concerns within the Qatari and Saudi Arabian market is compliance with green building norms and a possible shortage in sourcing supplies. It is these projections and trends which cement the timeliness of a summit that will address these issues. Design Mission Middle East 2013 taking place on June 4th and 5th at the Grand Hyatt Doha, gathers up to 120 leading Architects, Interior designers, Design professionals, Hoteliers, Real estate developers, Project managing consultants, Engineers, Contractors and Sustainability experts involved in premier projects from Qatar and Saudi Arabia across different sectors. With Qatar Green Building Council as a Strategic Partner, this summit will connect senior decision makers backed by extensive hands-on experience necessary to further the region’s mission to create sustainably built environments. By recognizing the pivotal role that sustainable building and green technology plays in guiding a project in Qatar or Saudi Arabia, the underlying goal will be to highlight the due importance of a sustainably built interior environment. As part of the agenda, it will showcase prime examples of sustainable buildings. In view of the summit’s timing, Eng. Meshal Mohammed AlShamari, Director at Qatar Green Building Council explained, “The vast and fast development happening in the region needs an equivalent reaction from us and the involved parties. It is a great idea to bring together the stakeholders that are involved and participate in this summit to highlight the importance of the sustainable development along with its requirements and benefits, and its positive impact on us and our environment.” Furthermore Ganesh Babu, the Director at IDE-Global has cited the summit as crucial, noting that “Today’s business landscape needs revolutionizing services to provide even more quality options easily available under one roof. We’re excited to offer the DSI meeting model for the first time in the Middle East and work with the decision maker, the specifier, the influencer and the supplier at the same table. IDE’s expertise lies at the juncture of procurement consultancy and business facilitation, which when combined can accelerate implementation as necessary for existing projects.”


I www.landscape-me.com I May 2013




News & Events AGRA Middle East continues to draw more visitors

12% increase in visitor attendance for 2013 AGRA Middle East, the region’s largest agribusiness trade event was officially inaugurated by H.E AbdulRahman Mohammed Al Oweis, UAE Minister of Health at the Dubai International Exhibition Centre.

T

AGRAme features five closely linked exhibitions under one roof showcasing the latest advances in agriculture and irrigation; animal husbandry and poultry farming; floriculture and horticulture; fisheries and aquaculture and agricultural machinery. With more than 40% of the exhibit space for AGRAme 2014 already rebooked by 2013 exhibitors, the event next year is already assured of a sellout.



Poultry Outlook Forum - Regional poultry professionals attend in big numbers The Poultry Outlook Forum returned once again in partnership with The World’s Poultry Science Association (WPSA) in 2013. The forum, attended by 62 delegates from across the region offered valuable information on the latest advances in poultry research, science and technology and also helped advance the knowledge and understanding of this diverse industry. AGRAme Seminars – Back for 7th year Running for the 7th year, the AGRAme Seminars featured 10 FREE to attend sessions with topics ranging from changing the paradigm of poultry nutrition worldwide to let’s block salmonella and growing importance of water soluble fertilizers.

he 2013 edition of AGRAme, held from 26 – 28 March at the Dubai International Exhibition Centre has now made its mark as the largest agribusiness event in the Middle East region. With 174 exhibitors from 34 countries and 4 country pavilions, the 2013 edition of the event attracted 12% more visitors as compared to the event last year. Exhibitor feedback for the event has been excellent with many reporting onsite orders for products and services on offer. The exhibitors this year have shown great satisfaction at the quality of visitors and the enquiries gathered during the event.

the summit discussed challenges and directions for future research in horticulture with the Middle East perspective.

Agribusiness Outlook Forum The 3rd edition of the Agribusiness Outlook Forum attracted 85 delegates. The annual event once again focused on food security and water resources aspect. The forum included key regional and international speakers, discussing the various perspectives to these challenging issues. Middle East Horticultural Summit – the inaugural edition delivers beyond expectations The inaugural edition of the Middle East Horticultural Summit was very well received by the industry in the region. Attended by 52 industry professionals,

I www.landscape-me.com I May 2013


The Irrigation Innovators

TECNIDRO MESC

I www.landscape-me.com I May 2013




News & Events The event, conceived, organized, and promoted by Angelo GRASSI, provides for a fascinating, utterly modern project set within an outdoor pre-industrial 19th-century architectural scenario.

F ORTOFABBRICA MEMORY AND BEAUTY FOR THE QUALITY OF LIFE at Fuorisalone 2013

rom the central area, dominated by a swamp rich of colours, fragrances, sounds, and resources – a small-scale view of a 3.0 factory, where everything is produced and nothing is wasted – departs a philosophical and projectual reference – unprecedented in Italy – to responsible beauty and to the responsibility of beauty through the presentation of in&out environments dominated by a tamed, yet proactive nature, paced by pathways obtained through skillful recycling, enriched with lamps created with films, hand-processed felt, natural fibres encompassing premises and bodies, edible dishes, pots for vertical green, sound diffusion systems powered with solar energy, sophisticated energy-saving light that outlines shadow scenes, organic wine tastings, concrete tables and bags, sensational

natural covers and architectures, with live green climbing up to provide attractive and modern aesthetic and functional solutions. Thus, around the swamp, ORTOFABBRICA turns into a workshop powered by a consortium of creatives, designers, craftsmen, and companies, demonstrating that quality of life and future should develop hand in hand, while blending with the eco- concept: eco-design, eco-architecture, eco-sustainability, eco-nomy.

The revival of ancient jobs, the reuse of raw materials, the recycling of concrete, cast-iron, iron, wood, glass, metal, ceramics and fabrics, give life to products with regenerated materials and usage functions, enriched with rough details, adding up to functional, friendly, high-performance, technically groundbreaking serial productions that bear a strong reference to authenticity and ethics. Innovation, craft, responsibility, research, and beauty are the keys to sort out the direction towards a good and high quality of present and future life. The recovery of these values results into a driver of hope and safety for all: ORTOFABBRICA, at the heart of via Savona

10

I www.landscape-me.com I May 2013


AG Middle East A Certified Class “A “Landscape And Irrigation Contractor In Qatar – Since 1976

36 Years 36

Working Together For The Future Of Green Qatar

Tel. No. (+974) 4441 9099 Fax: (+974) 443 54571

Email: aginfo@agme.com.qa

P.O. Box 3964, Doha - Qatar

11 I www.landscape-me.com I May2013 2013 13 I www.landscape-me.com I February


HYDROTURF providing golf and lands WITH 18 years valuable experience in water management in the Middle East and having tackled all manner of water-related situations during that time, HYDROTURF International has created the ideal opportunity to explain in detail the wide variety of services it can provide by organising a seminar at the Radisson Blu in Riyadh on Wednesday May 15th. Hydroturf was created in 1995 to provide and service Flowtronex Pumps, TORO irrigation products, TORO turf machinery and Club Cars throughout the Middle East. Hydroturf now services 60 golf clubs in the Gulf States and Egypt in addition to supplying a wide variety of products for football fields, sports grounds, landscaping contractors, residential customers and municipalities. " We are pleased to be launching our water products into the Saudi Arabian market with the May 15th seminar at the Radisson Blu in Riyadh." says Hydroturf's Managing Partner Colin Baxter. Hydroturf has already supplied Flowtronex pumps and TORO irrigation systems to Saudi customers, such as the Dirab golf club near Riyadh, and Emaar’s KAEC in Jeddah. But the May15th seminar will kick start a more comprehensive Hydroturf service to Saudi customers.

Colin Baxter, MBA, FCMA Managing Partner, HYDROTURF

“As experts in the business of water efficiency and water management we are relishing the chance of being able to explain the many options available to companies and individuals in the Kingdom of Saudi Arabia,” added Colin Baxter.

" A GOLF COURSE during the summer months can consume more than two million gallons of water per day! The latest TORO products have the potential to reduce water consumption by more than 20%, which provides a huge cost saving and also helps protect the environment. Similar savings can be achieved on sports fields, parks, residences - anywhere grass is a feature. This means that water efficiency is the key. Its not only the cost of water that’s important, its how you use it. Its also vital to understand how to use clean water with high salt water and how to best combine methods of administering it by the use of sprinklers, mobile irrigation equipment and drip system. Where clean water has to be used for plants and palms salt water can be used for grass.

Come and listen to what the specialists have to say AVAILABLE at the seminar at Radisson Blu Riyadh, on May 15th from 9am to 5pm, a number of specialists in their various fields will also be joining Hydroturf’s Managing Partner Colin Baxter, including: Dr. Riaz Ahmed Sahi, from Saudi Arabia’s first private water well drilling company; Shaju Lonappan, from Hydroturf, who has installed and services 27 golf course pumping stations throughout the Gulf States; World renowned golf course architect Peter Harradine who has designed numerous golf courses in the Middle East and worldwide; Mark Chapleski of Troon Golf, the world’s largest golf course management company; Andreas Feichtinger from the TORO company.

12

I www.landscape-me.com I May 2013


scape water products in Saudi Arabia Peter Harradine,

Water Management Seminar for Golf, Landscaping & MunicipaliƟes Wed 15-May-2013 Radisson Blu Hotel, Riyadh 9am – 5pm

HARRADINE GOLF Renowned designer of golf courses throughout the World.

Mark Chapleski

TROON GOLF The Worlds largest golf course management company

Are you in the Saudi grass golf course business ? Are you in the Saudi grass sports Įeld business ?

Andreas FeichƟnger ,

Would you like to reduce your water consumpƟon whilst improving your turf quality ? AƩending our Water Management Seminar on 15th May could be your Įrst step in achieving this .

The TORO Co. Global market leading supplier of irrigaƟon products.

Dr. Riaz Ahmed Sahi, Saudi Arabia’s Įrst commercial water well drilling company Established in 1958

Shaju Lonappan

Contact us at oĸce@hydroturĮnternaƟonal.com AƩendance by invitaƟon only.

HYDROTURF Installed, commissioned and services pumping staƟons on 27 golf courses in the Gulf plus other pump staƟons in parks, football Įelds, municipaliƟes etc.

Supported by :

Saudi Arabian Golf FederaƟon

FaciliƟes Management

Pumping Systems

IrrigaƟon Systems

I www.landscape-me.com I May 2013

13


urban study

Gardens and plazas link both harmoniously public and private buildings.

14

I www.landscape-me.com I May 2013


Luxury Residential Village Quartier in Beirut

T

he program behind this intervention was the urban planning and rehabilitation of the luxury/residential Village quartier in Beirut district, for restoration following the events of the war and political uprising. A joint effort was carried out between the landscape design team and urban planners to restore and create new spaces with a traditional touch reminiscent of the cultural heritage of the city. The brief consisted of the creation of a quartier rendered alive by youth, it vibrates and inspires. A template and a model for future developed areas, this multi-usage quartier includes art galleries, boutiques, restaurants, and plazas. It is a quartier with

a “Neighborhood quality� amidst a busy city. With its large sidewalks permitting a smooth network of pedestrian tracks or trails, it is safe, familial, tranquil, and most importantly inviting, as it provokes the use of outdoor space. This urban planning study created guidelines that redefine the entire strategy of green zones in a part of Beirut that was the first to be restored after the war. The new guidelines gave priority to pedestrians, by focusing on large piazzas, pedestrian zones and landscaped squares, inserted harmoniously, to create a unified urban fabric, whose gardens and plazas link both public and private buildings.

This multi-usage quartier includes art galleries, boutiques, restaurants, and plazas surrounded with lush Robinia trees.

I www.landscape-me.com I May 2013

15


urban study

-This is a safe, familial, tranquil neighborhood and most importantly inviting, as it provokes the use of outdoor space.

Large sidewalks permitting a smooth network of pedestrian tracks or trails

Attractive Barchychiton trees add a tapestry of foliage texture to the sidewalks

16

I www.landscape-me.com I May 2013

The lushness and shaped trees ads a variety of colors creating a silhouette and works for complementing the square.


From the Largest Diversified Companies in Middle East

AL JABER GROUP Design & Estimation | Soft Landscaping | Hard Landscaping Irrigation | MEP Works | Landscape Maintenance | STP’s & RO’s

"M+BCFS-BOETDBQF--$

4VCTJEJBSZ$PNQBOZPG"M+BCFS(SPVQ

PROJECT : BAWABAT AL SHARQ MALL, Phase 1, 2 & 3 BANIYAS SPORTS CLUB DEVELOPMENT-ABU DHABI, UAE Bawabat Al Sharq Mall, Baniyas Sports Club Development, Phase 1, 2 & 3 - is one of the on going projects of Al Jaber Landscape L.L.C. complying with it’s Client, Abu Dhabi Municipality and AECOM as Consultant. After AJL’s Landscaping works at Bawabat Al Sharq Mall, AJL shall proceed the Landscaping works in Baniyas Phase 2 & 3 which includes Design & Built of Softscape, Irrigation, Hardscape (Playground equipment, tiling, benches, litter bins, gravel, etc.). Al Jaber Landscape L.L.C. is experienced in the Landscaping Works MISSION of public spaces for living: places which support a wide range of Enhance our position in the coming lifestyles in high density urban, and lower density suburban, years as the market leader in the environments. The practice has developed a good understanding of landscaping segment in the UAE, Qatar & GCC Countries. the process of physical and social regeneration in new build and existing villas. AJL is equipped with professional & experienced VISION Design Department comprised of creative professionals; aim to To provide value added landscaping create unique experience that meets our client’s full satisfaction in services to our customers by Design & Build Projects. creating a successful As Al Jaber Landscape is entering the Qatar market, under its partnership with them throughout parent company, Al Jaber & Partners W.L.L., AJL is progressing its the greenery process. operation of Al Muntazah Street Extension & South Site Wide Infrastructure Project as of the moment. As its operation are based on a unique set of capabilities, safety & quality procedures, providing new technologies, with the highest quality service that maintain its high profile and market leadership through out the Landscaping industry. UAE : P.O. Box 2175, Abu Dhabi | Tel. No. +971-25554300 | Fax No. +971-25553370 QATAR : P.O. Box 23007, Doha | Tel. No. +974-44250444 / +974-4441180 Fax No. +974-44411885 | E-mail : aljaber.landscape@aje.ae | Website: www.aljaber.com I www.landscape-me.com I May 2013

17


urban study

A template and a model for future developed areas

New guidelines gave priority to pedestrians, by focusing on large piazzas, pedestrian zones and landscaped squares.

Creating new spaces with a traditional touch reminiscent of the cultural heritage of the city

A quartier with a “Neighborhood quality� amidst a busy city embellished with greenery that provides a note of color.

Project: Urban study Place: Beirut district Lebanon Landscape Architect: Frederic Francis Size: 60.000m2 Photographer: Priscilla Elora Sharuk 18

I www.landscape-me.com I May 2013


www.jonite.com

DISTRIBUTED BY: Tanseeq LLC, P.O Box 28665, Dubai, United Arab Emirates T +971 4 3415005 F +971 4 3414909 E info@tanseeqllc.com

W www.tanseeqllc.com

I www.landscape-me.com I May 2013

19


C O RN I C H E Pa r k

Al Khobar Waterfront Saudi Arabia

A

l Khobar Waterfront is located on Amir Turki Street in the public parks of the corniche area of Al Khobar, a vibrant commercial district, surrounded by five star hotels, restaurants and shopping centers. Defining a new dimension in tourism and recreational services, it is the first mixed leisure entertainment and recreational development in the oil rich Eastern Province of the Kingdom of Saudi Arabia, providing over 1 million sq ft of mixed-use space and comprising of the following components: Traditional Souk – A mix of retail & dining spaces within a traditional Arabian setting, areas for special events, a museum and traditional courtyards.

20

I www.landscape-me.com I May 2013

Sports Complex – Designed to host the first ice hockey & skating arena in the province with a mix of other sports recreation, entertainment and eateries. Marina & Club – Set to be one of the most luxurious leisure facilities in the whole of the Kingdom, it is designed to host yachts and exclusive wellness & dinning spaces. While the project’s three components provide a unique blend of activities that appeal to a wide target audience, a one-of-a-kind destination is created that effectively draws patrons from a variety of overlapping markets during different hours of the day within a stimulating pedestrian environment.


SHADED WATERFRONT PROMENADE WITH OCEAN VIEWS

Quality Lit Flowerpots

Bloom! is simple but classy design: a flowerpot doubling as light. Use at homes, offices, hotels, beaches or large public spaces – both indoors and outdoors. Conforms to strict European specifications. Includes energy saving light bulbs, can be coloured. HeigHt Dia top 44 cm 40 cm 60 cm 66 cm 90 cm 99 cm 100 cm 110 cm

WeigHt LigHt 4 kg Yes 10 kg Yes 24 kg Yes 28 kg Yes

BuLBs Drain 2 x 10 watt no 2 x 11 watt Yes 2 x 18 watt Yes 2 x 23 watt Yes

Desert River LLC, Tel +971 4 323 3636, Fax +971 4 323 3686 More funky products and planters available on DesertRiver.com I www.landscape-me.com I May 2013

21


C O RN I C H E Pa r k LANDSCAPE INSPIRATION:

Arabic Calligraphy

The inspiration for the landscape is based on the complex organizational patterns of Islamic art, which are particularly well expressed in the art forms of calligraphy and geometry. Calligraphy and geometry are both ancient Islamic art forms that are intimately connected with the disciplines of architecture and landscape design. Both art forms have most recently inspired dynamic hyper-contemporary morphologies and innovative design. As such, these art forms are traditional and cutting-edge; sophisticated and timeless; enigmatic yet evocative; non-representational and intuitive. Both—calligraphy and geometry—are therefore conducive to a multitude of contemporary adapta¬tions and applications. These patterns inform the landscape design of the Al Khobar Waterfront on multiple scales: From the organization of the pedestrian flow on the landscape, to the detailing of the public programs, down to the pattern of the pavements. When seen from above, people will read the calligraphy as an emblem, while at ground level, the pedestrian will discover a multitude of interlinked Arabic references and meanings.

THEMATIC GARDENS WITH COMMERCIAL AMENITIES

22

I www.landscape-me.com I May 2013


Blends naturally with any environment and landscape composition simple and elegant Modern flower pots with lights

I www.landscape-me.com I November 2011 I www.landscape-me.com I May 2013

25 23


C O RN I C H E Pa r k LANDSCAPE DESIGN & PLACEMAKING:

Experiential Waterfront • The creation of a connective landscape that merges three programmatic components into one destination • Integration of indoor and outdoor programmatic elements and public attractions

• Addition of landscape features and commercial and cultural amenities situated between The Marina and Sports facility, and between the Sports facility and Old Town. • Seamless transition from parking to destination

Project: Al khobar Waterfront Location: Eastern Province, Saudi Arabia Project Area: 100,000 M2 Project Scope: Landscape Design/Concept Project Type: Souk, Sports Complex, Marina Company: Souk, Sports Complex, Marina

INTERACTIVE ENTERTAINMENT

24

I www.landscape-me.com I May 2013

• Development of wayfinding system that establishes a cohesive identity within and between Sports, Marina, Old Town, and Parking facilities • Design of unique street furniture such as benches, lighting, paving, that give the destination a unique brand identity

KLINGMANN ARCHITECTS + BRAND CONSULTANTS 401 Broadway, Suite 2102 New York, NY 10013 Rainweg 4, 12527 Berlin, Germany T: 1 212-334-1110 F: 1 212-334-7116 www.klingmann.com info@klingmann.com


Members of:

LED Lighting

www.propoolpro.com

S E RV I C E S P R O VIDED Annual maintenance p a c k a g e s Leak detection & rec t i f i c a t i o n M icrobiological analysis & chemica l r e p o r t s Old to new res t o r a t i o n s Chlorin e to Non-Chlorine con v e r s i o n s Automatic pool cleaner inst a l l a t i o n s Chemical sales & d e l i v e r y Specialized MEP con s u l t a n c y Safety covers & f e n c e s General supplies for a l l p o o l s

 www.makpools.com I www.landscape-me.com I November 2012 25 I www.landscape-me.com I May 2013


Reliance with peace of mind for Quality Landscape Solutions.. Tanseeq a leading landscaping solutions provider based in the UAE, offers a comprehensive range of landscaping products for commercial, residential & leisure applications. With our extensive knowledge, experience and resources, we provide solutions pertaining to the following broad categories in landscaping.

Soft Landscaping Hard Landscaping Irrigation Systems Swimming Pools Water Features Street Furniture

B U S I N E S S PA R T N E R S

PE landscape Edging

Planters

Decking & Railing Systems

Aluminum landscape edging

Artificial Grass

Moisture Retention Soil Additive

Stone Sealant

Reconstituted Stone Elements

Swimming Pool and Spa

Street Furniture

Garden Furniture

Pattern Imprinted Concrete

Tactile Solutions

26

Tanseeq LLC, P.O. Box: 28665, Dubai, UAE , Tel: +971 4 3415005, Fax: +971 4 3414909 I www.landscape-me.com I May 2013 E-mail: info@tanseeqllc.com, www.tanseeqllc.com


Welcome to trex transcend decking and railing. yes, it reaLLy is that Different. new Design. new CoLors. new insiDe anD out – with its high-teCh, Low-fuss surfaCe that resists faDing, staining, moLD anD time itseLf. so for DeCaDes, you’LL have a pLaCe to esCape from everything, inCLuDing maintenanCe. you Can aLso aDD Lighting anD CoorDinateD raiLing to finish the Look.

aLL this, anD transCenD is 95% reCyCLeD materiaL.

so piCk your DeCk, piCk your raiLing anD piCk your Dream at treX.Com.

oUtdoor liVing. eleVated. treX.Com | 1-800-buy-treX ©2011 Trex Company, Inc.

Illustrative Masterplan: 2 L.L.C. DistributeD by:section tanseeq

• Dubai, uae • +971 4 3415005 • info@tanseeqLLC.Com

www.tanseeqLLC.Com

I www.landscape-me.com I May 2013

27


c u lt u r a l d e s t i n at io n

Street level river 1

Bin Landoun the bridging of 2 cities

28

I www.landscape-me.com I May 2013

Birds eye view


T

he creation of a vibrant mixed-use urban center for the community of Place Lalla Yeddouna, a cultural destination for visitors and tourists, and an economic catalyst for artisan development. The key concept of the design is to bridge the two quarters of Place Lalla Yeddouna with a unifying public space that opens up the area and bridges both riverfronts. This place-based design enhances the relationships between visitors, artisans and residents by connecting Place Lalla Yeddouna on the western side of the river with two new plazas on the eastern side, providing more access points across the river that make accessibility more convenient. The design and development process will be participatory by both the local labor and artisans of the Medina, and will Imagineering ad May'13 Final.pdf

1

4/17/13

result in a solution that truly belongs to Place Lalla Yeddouna. New public spaces will be created that encourage economic vibrancy where artisans can interact with tourists for sales, that provide better accessibility for the handicapped and emergency vehicles, and which both residents and visitors can enjoy. A continuous river walk will connect the adjacent context to the site and enhance the river walk as a public space where residents and tourists alike can relax and walk along the river. To this effect, the north half of the river walks will be renovated to its original condition with a clearly defined embankment. South of the bridge, the river walk will be more naturalistic in feel and enhanced with integrated steps and rocks for seating, planters and trees. The main plaza will highlight the existing fountain

and mulberry tree by adding minimal urban elements including benches and date palm trees that do not obscure the historical facades yet provide shading. The new eastern plazas will be hardscape with sandstone pavers and will be planted with date palms and ash trees. Small fountains and street furniture will line the plazas.

HOTEL AT PLACE LALLA YEDDOUNA

The hotel will serve as a gateway building to the plaza and will help Place Lalla Yeddouna grow as a commercial center. Located at the northwest corner of the Bin Lamdoun bridge, it will provide tourists and visitors with direct access to the river walk and will open onto the plaza providing immediate access to artisan’s galleries and workshops. The hotel will consist

9:46 AM

Imagineering is a dynamic and innovative company set up to meet the challenges of the modern market by providing clients with creative design and application solutions. 10#PY "CV%IBCJ 6"&t5FM t'BY tFNBJMJOGP!JNBHJOFFSJOHBEDPN

I www.landscape-me.com I May 2013

29


c u lt u r a l d e s t i n at io n

of the lobby on the plaza level with the reception area, the dinner and breakfast area, and four handicapped accessible rooms. On the lower floor the bar and back-of-house functions will be placed. The floor above the plaza level will contain rooms for guests, and a new floor added above the existing structure will contain the rest of the guest rooms.

TRANSFORMATION OF AN EXISTING BUILDING INTO AN ICON

This design of the hotel retains and carefully restores the existing historical architecture while integrating a contemporary faรงade design that will act as a local icon to the neighborhood

30

I www.landscape-me.com I May 2013

and attract visitors. The volume of the building is designed to fit the required program while being sensitive to the local architecture and remaining below the maximum allowed building height. The construction will entail traditional masonry construction and an added exterior ornamental metal faรงade that is based on the local tradition of using ironwork grills on the outside of windows for shading and privacy. This outer ornamental faรงade will be designed to give the building an iconic yet local appearance and a distinct day/night effect. While during the day, the faรงade will provide shade and cooling, at night it will provide a focal point and exude a warm glowing effect that

Street level bridge


 V 3OD\ LWKX Z

Made in

Italy

,K&&/ &hEW>z/d>/ s/W/dZKD/͕ϳϴ ϮϬϬϮϱ>'EEK;D/Ϳ ĐŽŵŵĞƌĐŝĂůĞΛĨƵŶƉůĂLJͲŝƚĂůŝĂ͘ĐŽŵ

h /d,Z'ZKhW hŶŝƚĞĚƌĂďŵŝƌĂƚĞƐ ǁǁǁ͘ŝƚŚĂƌĂŐƌŽƵƉ͘ĐŽŵ ůĞŶĂнϵϳϭϱϬϳϮϴϱϳϳϮ

YdZ &hEW>zYdZ ĂŚŵĞĚͺĂƟĂϮϲϲΛLJĂŚŽŽ͘ĐŽŵ ŚŵĞĚнϵϳϰϲϲϴϯϬϲϵϴ

I www.landscape-me.com I May 2013

31


c u lt u r a l d e s t i n at io n Street level river 2

will attract visitors and artisans to the plaza. The faรงade will be designed in collaboration with a local artist and - made of copper - will be virtually maintenance-free and age gracefully over time. The inner faรงade will be an extension of the existing building and consist of masonry construction with double glass doors inserted at each of

32

I www.landscape-me.com I May 2013

the guest rooms that are lined with decorative wooden shutters for shade, light filtration and privacy. Between the two layers of the faรงade, each guest will have access to a private outdoor terrace. The building will be renovated and constructed by local artisans using techniques and methods familiar to the area.

Team: Anna Klingmann, Ling Zhong, Fidelma Hawney, Chelsea Zhou, Andrew Apell, Jerome Williams, Malgorzata Jasionek, Nikolaos Akarepis, Yvette Elfawal, Tom Grubbs, Matthew Tehan Project: Bin Landoun Location: Fez, Morocco Company: Klingmann Architects + Brand Consultants (KABC)

Street level plaza


I www.landscape-me.com I May 2013

33


Shades of

green

34

I www.landscape-me.com I May 2013


By André van Heerden Managing Partner, Cape Reed Group of Companies

W

ith summer just around the corner, our thoughts inevitably turn to making the most of our outdoor spaces before it’s too hot. For many that will mean the creation of a shaded area. There will be questions on shape and design, on size and colour, but there is one question that often goes overlooked, despite it being one of the most important of all: what effect will your choice have on the environment? Barely a day goes by without another story on climate change, and yet many of us believe that protecting the environment remains the responsibility of governments and big corporations.

Royal Island Beach Club

Choosing the right shading structure for your garden will benefit you and the environment

Those efforts that we do make tend to involve fairly obvious things like recycling or an attempt to use less water. Those are of course important steps, but many of us don’t realise that there are many other ways to help the environment, even down to the construction materials we use in our gardens. Using more wood in construction and landscaping can also make a significant impact if we just understand how! Trees trap carbon dioxide throughout their life but in unmanaged forests, when they die they are left to decompose, re-releasing the CO2 they contain. When forests are managed and the timber is harvested, the trees do not decompose and the carbon is trapped. When it comes to reducing the carbon footprint of a building (the total lifetime CO2 impact, including materials, construction and use), wood has unique advantages, which is why it is the only material to be featured specifically in the European Code for Sustainable Homes. Wood grows naturally and, when properly managed, is a sustainable resource.

I www.landscape-me.com I May 2013

35


Private Residential Cape Reed Thatched Gazebo in Khawaneej

Unlike other materials, its manufacture needs almost no energy. Wood is a good insulator and can increase the thermal efficiency of a building, reducing energy costs and CO2 emissions for the duration of its design life. Wood can also be recycled: at the end of a building or shaded structure’s life, its wooden elements can often be re-used, or recycled as secondary products. Managed forests and plantations also benefit the environment because the trees are replanted once they are harvested. A Cape Reed Thatched Childrens Tree House

plantation of 1,000 hectares can hold 500,000 trees, producing 6,250 tons of oxygen and removing up to 7,500 tons of CO2 from the atmosphere per year. With the average person using 278 pounds of oxygen per year, that’s enough for about 44,000 people. The environmental benefits of wood as a building material apply also to thatched roofsan increasingly common site throughout the region in beach clubs, outdoor areas and private gardens. In fact research conducted in Scotland and South Africa has proven that thatched roofs and timber pergolas are the most sensible and environmentally friendly roofing and shading structures available today. Perhaps most importantly, the thatching we use is a great insulator, reducing temperatures by as much as 10c. Thatched roofs, and more specifically roofs that are thatched with Thamnochortus Insignis (more commonly known as cape reed), are carbon negative, thus contributing a negative value to the overall footprint. Looking at roofs from a “green” point of view, the best roof or shaded structure one can construct would be a cape reed thatch roof. The structure is of timber poles storing

36

I www.landscape-me.com I May 2013

CO2 for the life of the building. The thatch does the same, with an added benefit: cape reed is not perennial, meaning that unless it is harvested and preserved, the plant dies, releasing its CO2 into the atmosphere. By using the thatch in a roof, the CO2 is locked in for years (our installations in the Middle East can last as long as 50 years). So if you want to contribute to saving the world and make the most of your garden, promote the thatching industry. Not only does it store CO2; as the demand for reed increases, a greater area of land will be put under cultivation, helping the environment and more harvesters will also get involved looking after patches of land, especially as their livelihood depends on it. Protecting the environment relies not on token gestures, but on adopting more sustainable lifestyles. A more thoughtful choice of building materials is a good first step. COMPANY BIO | The Cape Reed Group of Companies is a world leader in the construction and installation of exclusive tailor made timber and thatch structures, with offices in Dubai (UAE), Cape Town (South Africa), Marbella (Spain), and Valetta


I www.landscape-me.com I February 2013 I www.landscape-me.com I May 2013 5737


earth, making it ideal for thatching. Cape Reed thatching structures have a life expectancy of anything from 20 to 50 years. It allows trapped water and heat to escape, making it waterproof and UV-proof, and its insulating properties mean it can be as much as 10˚C cooler in summer, and warmer in winter if compared with a conventional roof, making it ideal for the local climate. Private Pool Side Cape Reed Thatched Gazebo (Malta), and new expansions into Qatar and the South of France. The company’s primary roofing material, which also gives the company its name, is cape reed (thamnochortus insignis), a unique kind of thatch that only grows on a small strip of land, approximately 78x23km, in the Southern Cape region of South Africa. Because of its scarcity very strict farming practices are adhered to in order to ensure its sustainability. The cape reed plant grows for an average of six years before it is harvested, and provides one of the most durable natural fibres on

The Cape Reed Group has also developed a unique fire retardant construction method, by weaving a fire retardant cloth into the thatch. This material is able to withstand temperatures of up to 500˚C. In the case of commercial projects, the fire rating can further be enhanced by the application of an international approved chemical (Cape Reed FireShield) that is sprayed both internally and externally. Together with beautiful timber harvested every 15-20 years from sustainable forests where 165,000 new trees are planted annually, Cape Reed creates stunning gazebos, pergolas, majlis’ and chiringuitos, as well as roofs and interiors, complemented by additional extras such as light fittings and

furniture handcrafted in South Africa. Cape Reed has introduced rustic chic to properties around the region, from villas on The Palm, Emirates Hills, Victory Heights and in Arabian Ranches, to commercial projects including Sir Bani Yas Island in Abu Dhabi, Royal Island Beach Club on Lebanon Island The World, and Sofitel Hotel and Resort on the Palm Jumeirah. The company’s work has won numerous awards including the Arch of Europe in the Gold Category for quality and technology, and the Dubai Swimming Pool and Traders Association Gold Awards. Cape Reed believes in benefitting society as well as the environment, which is why it has set up a training academy for specialised craftsmen in South Africa, and is also involved in various outreach projects. Cape Reed’s respect for nature is evident in the environmentally friendly ways in which material is sourced as well as the construction of tailor-made designs. And with today’s trend for Zen-influenced architectural design, thatch roofing adds the perfect finishing touch, creating organic flowing spaces of peace and serenity where nature becomes part of the decor. Private Pool Side Cape Reed Thatched Gazebo in Al Barari

38

I www.landscape-me.com I May 2013


MODERN AND CLASSIC LIGHTWEIGHT PLANTERS

Modern lightweight planters with the identical look and feel of original Terrazzo. The wide range consists of ageless shapes and forms and creates a unique atmosphere in your garden or living. Available in small to XX-large suitable for garden and project business. Classic lightweight planters and ornaments are indistinguishable from the original weathered concrete. The combination of a unique finish with a romantic atmosphere is a special addition to every classical garden. The collections are innovative, with an emphasis on quality and durability. Our company name has changed from Capital Ornaments to Capi Europe.

w w w. c a p i - e u ro p e . c o m

Distributed by: Tanseeq LLC, PB-28665, Dubai, UAE, Tel: +91 4 3415005, Fax: +971 4 3414909, Email: info@tanseeqllc.com, www.tanseeqllc.com I May 2013 I www.landscape-me.com

39


C a pi t o l c a n op y

T

he urban forest is an important part of every thriving city. Tree canopies provide critical services for the city, including reducing heat island effects though the provision of shade and the creation of microclimates. With a large enough canopy, a robust tree population will reduce air pollution through bioaccumulation and the production of oxygen from carbon dioxide gas. However, the urban forest should be manifested in a different manner than the wild organization of a rural forest. While establishing a productive habitat for thousands of bird and insect species, the urban forest must be integrated with the daily functions of urban life. In terms of organization, the planting strategy should conform to the urban grid, provide year-round shade to south facing facades and allow for a varied, vibrant and continuous public realm. Due to a complicated lack of investment and will, the decreased canopy has yielded an increase in urban heat islands and air pollution. Planted nearly a century ago, many of the most majestic trees in Sacramento are nearing the end of their life cycle, further reducing the amount of shade and usable public space.

40

I www.landscape-me.com I May 2013


Sacramento... the city of trees

Its existing tree canopy returns over $50 million in environmental benefits annually.

I www.landscape-me.com I May 2013

41


C a pi t o l c a n op y

A rejuvenated canopy will reduce air pollution and urban heat island levels while establishing an enhanced pedestrian realm that is a usable and productive civic core. With a healthy urban forest ecosystem, supplanted with vibrant social and civic uses, the Capitol Mall will act as a catalyst for a phased re-investment in the city’s urban canopy and public realm. Working within the existing canopy, new sites will be established within the mall to attract investment in the public realm. Early win projects might include further investment in the farmer’s market and establishment of gardens and gathering areas.

42

I www.landscape-me.com I May 2013

As the urban canopy ages, the trees will need to be replaced. These replacement plantings will be coordinated with the city-wide urban forestry plan to establish a continuous and vibrant urban ecosystem that extends to and connects with the Sacramento River. The amphitheater park will be coordinated at this phase. Regions will be targeted that coordinate with current and projected development needs. These sites should orchestrate public and private investment to plant and maintain the adjacent urban canopies. The full build-out of this plan will never be complete, but as a principle, it should further connect the rich habitats of the


In fact, the Sacramento region is uniquely positioned to capitalize on the benefits of trees. For example, scientists have shown that Sacramento’s six million trees reduce atmospheric carbon dioxide levels by storing around 238,000 tons of carbon dioxide as woody and leafy biomass each year. Another 76,000 tons of carbon emissions are avoided annually due to energy savings from trees. The result is a net removal of 334,400 tons of carbon dioxide annually by the urban forest, an amount valued at $3.3 million annually. Reduced air temperatures slow down the formation of ozone (smog) in the Sacramento region. Studies show that Sacramento’s existing canopy delivers $29 million in benefits each year through uptake of air pollutants. Planting an additional 3 to 5 million trees in the Sacramento region will lower average temperatures by 2 to 3 ºF in the summer and reduce peak ozone by 7%, providing tens of millions of dollars in benefits in improved air quality. State of the Trees Report, Sacramento Tree Foundation Sacramento River to the Northwest regions of the city that currently lacks sufficient tree canopies and public space. In the Sacramento region, where the Mediterranean climate routinely drives summer temperatures to 100 degrees and

above, studies have shown that shade trees save approximately $18.5 million annually. Sacramento alone has as many as 470,000 additional planting sites for energy-saving shade trees. If trees were planted in each of these sites, it could result in an additional energy savings of nearly $30 million annually.

Project name: Capitol Canopy Project Location: Sacramento, CA USA Project by: ATLAS Lab (Andrew tenBrink and Kimberly Garza) Project Type: Competition, 1st Place

I www.landscape-me.com I May 2013

43


n at u r a l l a n d s c a pe

Landscape Architecture of Saffire

Rehabilitated ground at the front of the suites, shows good growth. Soon you won’t be able to distinguish foreground from middleground. Photography: Peter Whyte

44

I www.landscape-me.com I May 2013


Saffire integrates visually and naturally with its surrounds. Photography: George Apostolidis

N

ature-based tourism is focused on the experience of natural systems wherein visitors seek connection and engagement with the natural landscape – quite a challenge for a landscape architect when the client decides to build on a previously disturbed site. To achieve this goal, requires: A deep appreciation of the ‘nature’ of the pre-disturbance landscape; A comprehensive approach to ‘whole of landscape’ rehabilitation as part of an over-arching sustainability agenda; A strong-handed approach to construction management to protect remnant natural systems; An artful approach to site planning and landscape design; and Detailed knowledge of ecological management to ensure the longevity of the installation. In 2004, Inspiring Place, Landscape Architects were engaged by Federal Hotels to re-imagine a degraded site and lead the process of creating an uplifting

and enriching landscape in support of a boutique, nature-based tourism experience. The brief for the project, situated on Tasmania’s East Coast with powerful views to Freycinet National Park and its dramatic pink granite landforms, was traditional in scope. At the core of the site would be an iconic reception building with restaurant and meeting room and adjacent to this would be 20 living units. The direction from the project manager – “prepare landscape designs for the areas around the building”. Inspired by the maxim that “the most important thing about the eco-lodge is that it is not the most important thing”, Inspiring Place moved beyond tradition and inspired an ecological outcome from the project. The outcome is both artful and ecological. Natural vegetation was protected where it occurred including its rare species and was restored in damaged parts of the site to its former state and ‘ornamentally’ restored in the areas immediately adjacent to the buildings.

I www.landscape-me.com I May 2013

45


n at u r a l l a n d s c a pe

Over a seven-year engagement, Inspiring Place led the tasks of site planning, environmental management and landscape design of the resort. Throughout, Inspiring Place provided a voice for the landscape and the experience of the nature of the site,

seeking sustainability by ‘keeping healthy sites healthy and healing those that had been injured’. In the pursuit of regeneration, all parties were convinced that restoration of the natural landscape was essential to the delivery of a quality nature-based tourism product.

Terraced spaces between the main building and unit have been ‘ornamentally’ rehabilitated, that is, indigenous plants have been used for artistic effect but with ecological benefits. Photography: Peter Whyte

46

I www.landscape-me.com I May 2013

The view from the spa onto an ‘ornamentally’ rehabilitated landscape. Photography: Peter Whyte


I www.landscape-me.com I May 2013

47


n at u r a l l a n d s c a pe Native vegetation in the foreground reflected by the building, building the seamless integration of Saffire and its surrounds Photography: Peter Whyte

The main entry to the building was built around important pockets of native vegetation. Photography: Peter Whyte

From the first meeting with the client, Inspiring Place promoted sustainable outcomes. 10 principles were highlighted and became criteria for questioning the work of the entire team. Thus ‘silence was defended’ where mechanical systems were used for heating and cooling and the ‘dark respected’ in the external environment through the use of low wattage fixtures with little light spill. Recycled materials were incorporated in numerous details, notably the ‘jetties’ to each of the units from the central walkway. Paved areas were minimised and permeable materials used for secondary movement systems. Importantly the ‘waters of life’ were respected through water sensitive design features promoted by the Landscape Architect during the design process. All of the roadworks and parking areas, for instance, feature day-lighting of run-off directed to controlled sediment basins, combined with infiltration during low rainfall events.

48

The source of materials was also considered in an effort to reduce the ‘carbon miles’ that landscape materials accumulated. All stone and gravel was sourced from the East Coast, much from a quarry that bounds onto Freycinet National Park. 500 advanced trees and 3000 shrubs were grown on to larger sizes to compliment over 30,000 tubestock plants and 20 kilograms of native seed used for site landscaping. All were grown on by a reputable East Coast nursery and all seed and cuttings were sourced from within 5 kilometers of the building site. Beyond restoration for ecological reasons, ‘ornamentally’ restored areas were created at the immediate front of the main building. In this area, local indigenous vegetation and stone was arranged in an artful manner based on the strandlines of detritus of the nearby beach as a metaphor for design. Adjacent to the living units a more spare planting approach was used, creating a serene, zen-like setting in the foreground to the dramatic background views.

I www.landscape-me.com I May 2013

Saffire opened in 2011 and is the State’s premier six-star accommodation. The landscape today is an artful and ecological response that accords with the iconic natural backdrop to the site and the powerful architecture of the resort. It is a study in the application of best practice techniques for landscape rehabilitation and the integration of the built environment with the natural landscape. Inspiring Place was given the first Australia Tasmania Medal for Landscape Architecture in 2011 for its efforts. At the core of the Inspiring Place contribution is a deep understanding of the landscape that inspired the client and project team and is now a catalyst for visitor’s curiosity about the landscape. Importantly, their landscape experience achieves an aspirational aim to reconnect people with the spiritual and personal benefits that are derived from contact with nature.


May 2013 I www.landscape-me.com I April

49 51


av e n u e

The Avenue

T

he Avenue, formerly referred to as Square 54, is a dynamic mixed-use development bordered by Washington Circle, 23rd Street and Pennsylvania Avenue and located just six blocks northwest of the White House. Also near George Washington University and close to a major public transportation hub, the entire-block complex includes office, residential and retail elements and abundant green public spaces, streetscapes, terraces, and courtyards with innovative storm water management strategies implemented throughout. These spaces afford visitors, office building employees, and residents a pleasurable outdoor experience in all seasons.

50

I www.landscape-me.com I May 2013


I www.landscape-me.com I May 2013

51


av e n u e

The footprints of the four buildings at Square 54 are designed to promote public use of the open space within the complex. The surrounding streetscape includes wide sidewalk promenades bordered by rows of shade trees, large planting beds filled with mixed perennials, low shrubs and flowering trees, and a series of architectural planters filled with colorful seasonal plantings. All parking is located below grade within a five-story parking garage beneath the development. The central courtyard above the parking structure is anchored by a water feature that expresses the intersection of the historic Washington city grid and the axis of Pennsylvania Avenue. This water feature functions as part of the larger storm water management system that collects all rainwater that falls within the property. The water then drains through a storm water filter to a 7,500 gallon cistern located in the five-story parking garage below the courtyard. This water is continuously re-circulated and treated by the

52

I www.landscape-me.com I May 2013


Create a greener world

AUSDRAIN drainage cell products and modular tank systems provide innovative solutions that are assisting us in creating a greener world to live in. The AUSDRAIN EnviroModule2 tank is a cost-effective and low carbon footprint underground water storage system used to harvest rainwater or store desalinated water for irrigation and non-potable purposes. EnviroModule2 tanks are also used to create infiltration systems that effectively manage stormwater run-off. AUSDRAIN 30mm & 50mm drainage cell provides an efficient drainage layer for planter boxes, green roofs and podiums and has been extensively used throughout the UAE and GCC including iconic projects such as The Dubai Mall and Burj Khalifa.

www.ausdrain.com

Distubuted by : Tanseeq LLC, P.O. Box: 28665, Dubai, UAE , Tel: +971 4 3415005, Fax: +971 4 3414909, E-mail: info@tanseeqllc.com, www.tanseeqllc.com I www.landscape-me.com I May 2013

53


av e n u e development’s dependence on the city’s inadequate combined sewer system, which periodically results in flooding of the National Mall and low-lying areas and contributes to pollution of the region’s rivers and streams. Sasaki Project Team: Alan Ward, Neil Dean, Mark Delaney, Matt Langan, Steve Engler, Dou Zhang, Steve Benz Landscape Architect: Sasaki Associates, Inc. Architects: Hickok Cole Architects with Pelli Clarke Pelli Architects Photographers: Craig Kuhner & Eric Taylor water feature that includes aquatic plantings, which offer supplemental filtration. The stored water is also used to provide all irrigation for the courtyard plantings throughout the growing seasons. The roof of the development contains 8,000 square feet of extensive green roof, which forms a microclimate that reduces the local heat island effect, provides avian habitat, insulates the building, and minimizes the roof’s runoff. Excess rainwater is filtered through the green roof layers before being collected in the water feature and cistern below. This on-site sustainable water system significantly reduces the Materials: Courtyard • Granite Pavers • Concrete Pavers • Stone dust paving • Granite walls • Stainless Steel Cable Fence • Stainless Steel bridge • Stainless steel planters • Plants • Trees • Thornless Honeylocust Trees • Downy Serviceberry • Japanese Stewartia • Grasses • Liriope • Feather Reed Grass • Fountain Grass • Black Mondo Grass • Rainwater Treatment Planters • Blue Flag Iris

54

I www.landscape-me.com I May 2013

Project name: The Avenue Project location: Washington, DC Client name: Boston Properties, Inc. Completion date: 2011 Size: 3.5 acres 153,000 square feet – full site 72,000 square feet – streetscape & courtyards (48% of site area) Services: Planning Urban Design Landscape Architecture


I www.landscape-me.com I May 2013

55


i n te r view

Interview with

Nora Aridi

of Woods Bagot

Nora Aridi Woods Bagot

56

Can you give us a brief about your educational background and your experience in the GCC area? I graduated from the American University of Beirut in 2005 where I received a BSc in Landscape Design and Eco-Management. I later went on to complete a MSc in Urban Design from Strathclyde University in Glasgow, while also studying in a joint program from the Technische Universiteit Eindhoven where I received a META U degree in Post Industrial Landscapes. After my studies I went on to work in Beirut, Ireland and Glasgow. Currently I am working in Dubai in a multi disciplinary design practice called Woods Bagot, where I have been for the last two years.

I www.landscape-me.com I May 2013

Why did you take Landscape Architect? What inspired you to become a landscape architect? At the time of choosing what to study in university I was aware of a new degree that had just been introduced to the university. I was very intrigued, although I didn’t know enough about Landscape Architecture at the time, I knew it was a degree that would match my varied interests very well. Landscape Architecture is the perfect balance between nature and design. Although I continued to study Urban Design, I found a greater interest in Landscape Architecture as it is continuously evolving and rapidly becoming a more valued profession. What inspires me most about the profession is


As a women in a male dominated profession, what has been your experience working in this field in the Middle East? Many of the projects we have worked on usually involve direct contact with professionals in the field form all over the world. So far I haven’t actually found this to be an issue as I have always been treated as a professional rather than a women. What has been your favorite project and why? I can’t say there is one single project that takes precedent over another, as each project brings new challenges and experiences. I find myself learning new things and applying different skills each time. The scale and nature of projects in the Middle East is very different to what I have worked on elsewhere and therefore keeps me constantly inspired.

What is your dream project? My main passion is for forgotten spaces in the city self defined as SPLACES; ‘A disruption in the typical urban flow or a moment of deviation, they are, an expression of the city’s natural movement when left to its own will. What may otherwise be viewed as untidy unplanned parts of the city, these spaces nurture an instant of hope, a happening[s] and a memory. If the city is a body and a being, splaces are the entrails; unappealing to some, visually out of sight to many, yet a vital functional part of the whole.’ Therefore, I would love to work on the restoration/re-development of a network of such spaces in a city such as Tokyo or the likes. I would have to say another of my dream projects would be to design a Wildlife sanctuary

that one has the ability to work on many different scales, contexts and environments, and there are always challenges that require creative solutions. When did Woods Bagot first set up the business? How has your business expanded since its inception? Woods Bagot is a global studio specialising in design and planning with a multidisciplinary team of architects, Landscape architects, interior designers, urban designers and masterplanners. In 1869 Edward Woods launched what is now Woods Bagot with the establishment of a studio in Adelaide. It currently has studios across Australia, Asia, Europe, the Middle East and North America.

I www.landscape-me.com I May 2013

57


i n ter v iew

in which part of it is open to visitors. I have always been fascinated by ethology and animals in their natural habitat and have yet to come across such a design opportunity. In your opinion, what changes need to be adopted in the GCC landscaping industry to become on a par with the rest of the world? I’m not sure how to answer this question as I think the GCC is incomparable to the rest of the world. Clients and culture are very different here and therefore have different expectations. The natural environment is also unique and requires a unique approach. However, having said that sustainable design rating systems applied globally (such as LEED or Green building) are beginning to find their way into this region through the likes of initiatives such as Estidama. If rating systems such as Estidama were compulsory for each project in the GCC, then there may likely be a more professional and better quality of work produced from an energy and environmental perspective. Do you think that the international standards for the landscaping industry are too rigid and unrealistic or can they easily be applied when executing projects? In some cases international standards

58

prove difficult for projects in the GCC, as mentioned earlier we are dealing with a different culture and quite a hostile landscape that is unlike that of other international countries. The landscaping industry needs to constantly evolve and adapt itself to new landscape cultures continuously popping up locally and globally. What would be ideal would be the establishment of a landscape institute specifically for the GCC such as LI, AILA, or ASLA. I have reason to believe that we are not far off from this reality. Where do you see GCC countries 10 years from now with respect to developments and landscaping? There is currently more awareness, then in the past, on the impact of landscape architecture in the successful development of large/small scale projects. For a long time GCC countries viewed landscape Architecture as a purely aesthetic profession that would come along to beautify an existing development. Although for some projects this may still be the case, there is, a definite improvement in this respect. I find that more frequently we are asked to join projects right from inception. If the GCC continues to follow in this direction we may find that clients will have a more thoughtful, studied and sustainable approach to development in the region.

I www.landscape-me.com I May 2013

How do you cope with having so many projects going on at once? Usually we are able to manage our projects in such a way that each one is given its own time and value and resources. However there are moments when resources are low and deadlines are tight, in such cases overtime is necessary. When you love the job hard work and long hours make it far more rewarding. Who are your major clients and what major projects have you been involved with on their behalf? Among some of our clients are developers such as; Meraas Holding, Aldar, Damac, Emaar and TATA. Abu Dhabi and Dubai municipality in the public sector, as well as


private clients such as Qatar Foundation and Masdar being among the few. Currently we are working with Meraas on ‘City Walk’; a project related to the redevelopment of Satwa Area where we are designing public courtyards and Laneways, private podiums and roof top spaces. We have also worked with Masdar on the design of the Masdar headquarters. Other projects include Oman Mall in which all outdoor spaces were designed. A long term running project with Qatar foundation includes the entire masterplan and landscape design for the Qatar Science and Technology Park. Another project of urban scale was the ENEC Operator Village in Abu Dhabi, a costal residential/multi-purpose development. Some other projects include Heydr Aliyev International Airport in Baku, Kochi Towers in India and the design of a mall to be the largest in the world located in the ME. What advise can you give to other women aspiring to become a landscape architect?

In fact I would advise anyone aspiring to be part of the profession to really want it and genuinely feel inspired by it. There is a lot of hard work and long hours involved, without truly enjoying yourself it would prove to be a very difficult journey. As for women in particularly I would say have confidence and believe in your creativity and always stay updated and knowledgeable about the profession. The most important thing is to show enthusiasm, recognize your stronger points and positively build on them. This will allow you to prove that you really belong where you are as a women and a professional. Finally, please conclude by evaluating Woods Bagot position in the market and share any relevant information about current projects? Woods Bagot ME can be considered a strong player in today’s Emirati market. The practice has established a trusted reputation since its establishment in the

UAE, with several local design awards won over the years whether in Landscape Architecture, Architecture or Interior design. Many clients find comfort in knowing that Woods Bagot is a multidisciplinary design firm. On this basis we work on several different project sizes, which naturally gives us an edge over other design firms. Woods Bagot is also unique in that it works from studios across the Globe, what this means is that the necessary expertise for any particular project in any part of the world will always be met. Currently the Dubai studio is working on projects related to the re-development of Satwa area, as well as projects running in Doha, Abu Dhabi and Baku.

I www.landscape-me.com I May 2013

59


Nat u r e w i th hea l i ng

Hospital Garden Re-Connects Nature with Healing

Nature helping to heal Frances T. Moore, AIA, LEED AP, Associate Principal, CO Architects Andrew Spurlock, FASLA, Principal, Spurlock Poirier Landscape Architects 60

I www.landscape-me.com I May 2013


F

rom the inception of Palomar Medical Center (PMC), a 736,000-squarefoot hospital in northern San Diego County, Palomar Health had a strong desire to create a green environment that promotes healing. Evidence shows that access to nature reduces stress associated with the typical clinical environment and has a positive healing effect on patients.

into consideration the visitors’ and patients needs while also restoring the site through self-sustaining features. Collaborating with Los Angeles-based CO Architects, San Diego-based Spurlock Poirier Landscape Architects included many native California plants in the sustainable landscape, which is intended to create a beautiful, restful, and restorative setting for visitors, staff, and patients.

The design and master planning of PMC’s healing gardens sought to take

The expansive 1.5-acre living “green roof” acts as a central piece of the

“The real alternative to exotic hardwoods” WPC protects primeval forests. Our first objective was to develop the technology to create a composite wood superior to natural wood in order to combat the thoughtless lumbering of forest trees.

Come and visit us at our Grand Showroom -

“WORLD Of fLOORiNG”

UAE OfficE Tel: +9714 3408626 • fax: +9714 3408636 http://www.nahar.ae • dxb@einwood.ae

I

For complete display of Natural Wood and Composite Flooring - @ The Curve Building, Showroom 12, Sheikh Zayed www.landscape-me.com I May 2013 61 Road, Al Quoz 3, Dubai.


Nat u r e w i th hea l i ng healing gardens, which are designed as a sequence of spaces, creating a journey through which healing can occur and small groups can congregate for relaxation or informal gatherings. The medical center’s green spaces act as an organizing structure, with a central spine of gardens connecting all facilities. The garden terrace at each elevator lobby in the tower, as well as the courtyard gardens in the diagnosticand-treatment wing individualize spaces, creating wayfinding elements and easing circulation. Easing the boundary between the developed medical center site and undeveloped sightlines beyond, naturalized landscape along the site edges provides trails, treatment of storm water, and a serene setting. To reinforce the healing connection to nature from the beginning, automobile driveways bring visitors and patients into pleasant courtyards that provide drop-off at the entrance and emergency care. Likewise, pedestrian circulation between (and even into) facilities is organized around gardens. By using green spaces as a directional path, the main entry, lobby, waiting areas, and roof terraces of the Nursing Tower are each related to views of the landscape from PMC’s hilltop site. Each area within these gardens addresses healing in different ways: • The Tower Gardens begin at the arrival court and extend up through the central tower by way of a series of terraces at each floor. There is also a café garden overlooking a park-like space to the north of the tower.

62

I www.landscape-me.com I May 2013


;SVPH´W&IWX

8LI

7YWXEMREFPI

0ERHWGETI)HKMRKW (YFEM7MPMGSR3EWMW

7LIMOL>E]IH&MR7YPXER&MR2EL]ER1SWUYI

%P6ELE&IEGL(IZIPSTQIRX

%091-291)(+-2+7*36 0ERHWGETI&IHˆ1EMRXIRERGI7XVMT %KKVIKEXI;EPO[E]ˆ&VMGO4EZIV %WTLEPX7YVJEGIˆ7TSVXW7YVJEGI 4IVQIEFPI4EZIQIRXˆ+VIIR6SSJ +VIIR'SQQYRMX]1SXSV'MX]

SHUPDORF

Š

8VH\RXUVPDUWSKRQHWRVFDQ WKHEDUFRGHRUFRQQHFWZLWK 3HUPDORF DW SHUPDORFFRP 7ZLWWHURU)DFHERRN

(-786-&98)(&=

6 8 6 7$ , 1 $ % / (  ( ' * , 1 *  6 2 / 8 7 , 2 1 6

8LI[SVPH´WTVIQMIVPERHWGETIWEVIJVEQIH[MXLXLI[SVPH´WTVIQMIVPERHWGETIIHKMRKW ERHVIWXVEMRXW4IVQEPSGSJJIVWETTPMGEXMSRWTIGM½GTVSHYGXPMRIWTVSZMHMRKXLILMKLIWX XERWIIUPPGGSQ UYEPMX]EPYQMRYQTVSHYGXWJSVYWIMRPERHWGETILEVHWGETIERHKVIIRFYMPH-X´W]SYVXMQI M R J S $ X E R W I I U P P G  G S Q XSI\TIVMIRGIXLIGSR½HIRGIXLEXSRP]GSQIW[MXL4IVQEPSGXLI[SVPH´WFIWXIHKMRK             63  I www.landscape-me.com I May 2013


Nat u r e w i th hea l i ng

• The approximately 1.5-acre Green Roof above the two-story diagnosticand-treatment wing offers calming views from the tower rooms above. Part flower garden and part naturalized meadow; this planted rooftop’s undulating form mimics the surrounding hills, providing a seamless visual foreground for mountain views from patient rooms and tower terraces. The six inches of soil and the planting heal the site by connecting and extending the bird habitat with the adjacent landscape, and also becomes self-sustainable with reclaimed water irrigation. The undulating topography—north and south facing slopes—creates unique microclimates and plant associations with the sage scrub. The roof pattern also creates housing space for large mechanical ductwork underneath the rolling hills. Skylights punch through in select places to bring light into floor plates, and a three-story glass atrium allow views of nature and daylight into surgery prep and recovery areas, as well as into operating rooms. The planted roof is also a critical element in the building’s sustainability program, lessening reflected heat and glare into the overlooking patient wing, thus reducing the need for mechanical cooling. An adjacent terrace contains cafeteria seating. • The Stroll Gardens are specialized healing spaces that surround the parklike area north of the tower, providing experiences from more highly developed, convenient, and social spaces near major circulation, to quieter, natural, private, and contemplative spaces farther away from activity. Each addresses different aspects of healing

64

I www.landscape-me.com I May 2013


I www.landscape-me.com I May 2013

65


Nat u r e w i th hea l i ng

Project: Palomar Medical Center Healing Garden Location: Northern San Diego County, Company: CO Architects Frances T. Moore, AIA, LEED AP, is an associate principal at CO Architects in Los Angeles, California. Andrew Spurlock, FASLA, is principal at Spurlock Poirier Landscape Architects in San Diego, California.

and provides a specialized character and experience for individual relaxation or socializing. The journey begins at a symbolic entry from the main walkway between the east parking area and the arrival lobby. Here, visitors enter through a low wall and traverse a bubbling water feature as a threshold, thereby leaving behind the stresses of the outside world. • The Mall Gardens comprise the primary pedestrian circulation through the campus and engage the arrival court for automobiles, entrance lobby, and garden beyond. Although primarily a circulation corridor, its intention is to provide an opportunity for visitors and staff—even while hurrying from one place to another—to enjoy the gardens and outdoors, and perhaps sit for a moment in a pleasant, relaxing environment.

66

Healing Effects for Hospital Users It’s not just patients that are enjoying these surroundings, staff members also benefit greatly from the gardens as places to take breaks, relieve stress, have lunch, or hold informal meetings. While doctors can use the gardens’ healing and relaxation opportunities with a certain degree of privacy, so as to not always be available in public areas for review of treatment and care. As a result, each part of the site and gardens is designed to include private spaces that allow individual space—even in the more social spaces, such as the café garden terrace. Palomar Medical Center, San Diego, design by CO Architects and Spurlock Poirier, article by Frances Moore and Andrew Spurlock.

I www.landscape-me.com I May 2013

Project Team: Architect: CO Architects Tom Chessum, FAIA, NCARB, Principal-in-Charge Steve Yundt, AIA, ACHA, Principal/Medical Planner Dennis McFadden, FAIA, Design Principal Eyal Perchik, AIA, Senior Project Manager Frances T. Moore, AIA, LEED AP, Project Architect Jenna Knudsen, AIA, LEED AP, Associate Principal Alex Korter, RIBA, LEED AP, Associate Jenna MacDonald, Project Coordinator Landscape Architect: Spurlock Poirier Andrew Poirier, FASLA, Principal Affiliates: Associate Architect for D&T Medical Planning: Stantec Construction Management: DPR Construction Interior Design: Stantec; RTKL Structural/Civil Engineer: KPFF Consulting Engineers M/E/P Engineer: M E Engineers Lighting Designer: Horton Lees Brogden Lighting Design Sustainability/Cost Estimator: Davis Langdon Wind Engineering Consultant: CPP Photographer: Tom Bonner


PICSPAVE Pattern Imprinted Concrete combines colour & texture to create an aesthetic yet highly wear resistant hard landscaping medium. PICSPAVE enables the rapid construction of all sizes of internal and external paved areas. With a wide range of designs & colours and the flexibility to accommodate different forms of trafficking. PICSPAVE is the Rolls Royce of paving.

Tanseeq LLC P.O. Box: 28665, Dubai, United Arab Emirates. Tel:+971 4 3415005 Fax:+971 4 3414909 Email: info@tanseeqllc.com Web: www.tanseeqllc.com

I www.landscape-me.com I May 2013

67


New & Ongoing Projects

middleeasttenders.com

+971 2 634 8495

Project Name

Description

Client

Country

Consultant

Contractor

Budget (USD)

Status

The Address Residency Sky View Twin Towers Project

Construction of 50-storey The Address Residence Sky View twin tower complex atop a ground podium, including a 180-room business hotel, residence and (532) serviced apartments.

Emaar Properties PJSC (Dubai)

UAE

Skidmore, Owings & Merrill LLP (USA)

N/A

N/A

New Project

3 Beirut Towers Project

Construction of 3 Beirut Towers comprising (150) apartments covering a total area of 100,000 square metres.

SV Properties & Construction (Lebanon)

Lebanon

Foster & Partners (UK)

N/A

N/A

New Project

Damac Esclusiva Tower Project

Construction of 150-metre-high Damac Esclusiva Tower comprising (100) luxury apartments.

Damac Properties (Dubai)

UAE

N/A

N/A

215000000

New Project

ABC Verdun Retail Development Project

ABC (Lebanon)

Lebanon

N/A

N/A

200000000

New Project

Club Vista Mare Residential & Recreation Project - Palm Jumeirah

Development of ABC Verdun retail scheme comprising prominent and prestigious international fashion houses, restaurants, cafes, cinemas and other recreational facilities. Construction of Club Vista Mare, a new beachfront residential and recreation project comprising (33) studio apartments, as well as eight cafes and restaurants, retail areas and gymnasium facilities.

Nakheel PJSC (Dubai)

UAE

N/A

N/A

N/A

New Project

Bluewaters Island Development Project - Jumeirah Beach Residence

Development of Bluewaters Island comprising a souq (market) with retail stores, restaurants, a hotel and a family entertainment centre.

UAE

Parsons International Ltd. (Dubai)

N/A

1600000000

New Project

Beirut Museum Project

Construction of Beirut Museum.

Lebanon

N/A

N/A

30000000

New Project

Damac Residenze Tower Project - Dubai Marina

Construction of 40-storey, 335-metre-high Damac Residenze Tower comprising luxury residential apartments.

Damac Properties (Dubai)

UAE

N/A

Arabtec Construction L.L.C (Dubai)

326000000

Current Project

Karbala Town Development Project

Development of a complete town comprising 40,000 housing units, hotels, schools, clinics and other facilities in the city of Karbala.

National Investment Commission (Iraq)

Iraq

N/A

Bloom Properties (Abu Dhabi)

3500000000

Current Project

DoubleTree by Hilton Hotel Project - Al Khobar

Construction of DoubleTree by Hilton Hotel comprising (158) rooms featuring a variety of business and leisure amenities, including extensive meeting facilities of two boardrooms, a conference hall and two meeting rooms as well as a health club and swimming pool, two appealing restaurants and a lounge.

Hamad Abdul Aziz Al Mousa Trading (Saudi Arabia)

Saudi Arabia

N/A

Hamad bin Abdulaziz Al Mousa Group (Saudi Arabia)

N/A

Current Project

Banana Island Resort Development Project

Development of Banana Island Resort comprising (11 Nos.) over-water villas, (34) chalets and a hotel block consisting of (72) guestrooms.

UrbaCon Trading & Contracting Company (Qatar)

Qatar

N/A

UrbaCon General Contracting (Qatar)

N/A

Current Project

Al Baleed Resort Project

Development of a high-end resort in Al Baleed Village comprising a total of (136) rooms and associated facilities.

Musstir (Oman)

Oman

N/A

Carillion Alawi L.L.C (Oman)

N/A

Current Project

Sheraton Doha Hotel Refurbishment Project

Carrying out refurbishment of the existing fivestar Sheraton Hotel.

Katara Hospitality (Qatar)

Qatar

N/A

N/A

192000000

New Project

Pullman Dubai Deira City Centre Residence Expansion Project

Carrying out expansion of the Pullman Deira City Centre Residence.

Majid Al-Futtaim Properties (Dubai)

UAE

N/A

N/A

40000000

New Project

Sundus Rotana Hotel Project

Construction of four-star Sundus Rotana Hotel comprising four floors of guestrooms ranging from standard to suites, a shopping avenue on the lobby level, a wide choice of fine dining options, a ballroom, one executive boardroom and seven conference rooms, including leisure facilities such as a spa, swimming pool, a full-fledged fitness centre, in addition to steam, Jacuzzi, sauna and massage rooms.

Sundus Investments Projects L.L.C (Oman)

Oman

N/A

N/A

N/A

New Project

Al Maghseel Resort Project

Development of a resort in Al Maghseel area along a scenic beachfront swath offering adventure, recreation and leisure pursuits, as well as family-oriented entertainment.

Oman Tourism Development Company S.A.O.C (Omran)

Oman

N/A

N/A

N/A

New Project

Water Discus Underwater Hotel Project

Construction of Water Discus Hotel comprising two discs - one under the water and one suspended above the water.

Dubai Drydocks World

UAE

N/A

N/A

N/A

New Project

Salalah International Medical City Project

Construction of an International Medical City in Salalah comprising facilities such as a state-ofthe-art diagnostic centre, a healthcare resort and healthcare education complex, including a luxury hotel and wellness centre.

Apex Medical Group (Saudi Arabia)

Oman

W S Atkins International (Oman)

N/A

1000000000

New Project

High Ferris Wheel Project - Dubai Eye

Construction of a large ferris wheel with a height of 210 metres known as Dubai Eye.

Meraas Development (Dubai)

UAE

N/A

Hyundai Engineering & Construction Company Limited (Dubai)

275000000

Current Project

Rapid Transport Network Construction Project

Construction of a rapid transport network with a total route distance of 184.2 kilometres, including light rail (LRT), a monorail, tram and bus rapid transport (BRT) system.

Ministry of Works (Bahrain)

Bahrain

N/A

N/A

8000000000

New Project

68

Meraas Development (Dubai) Council for Development & Reconstruction (Lebanon)

I www.landscape-me.com I May 2013


Infrastructure for sportIng excellence

• SportS Flooring • SportS EquipmEnt • CubiClES • loCkErS • Sauna & StEam • WoodEn Flooring • outdoor FurniturE • SEating

Bin Sabt Sports and Leisure LLC PO Box 109094, Abu Dhabi, United Arab Emirates Tel: +971 2 644 0303, Fax: +971 2 644 1123 Email: info@sabtmmk.ae

Sabt Industry LLC PO Box 53734, Dubai, United Arab Emirates Tel: +971 4 347 2701, Fax: +971 4 347 2453 www.sabtgroup.com I www.landscape-me.com I May 2013

69


• Landscaping development the hard and soft scape • Irrigation • Horticultural supplies, lawns and specimen plants • email: info@zaidg.com • PO Box 4756 Riyadh 11412, KSA • email: dubai@zaidg.com • PO Box 181581 Dubai, UAE • website: www.zaidg.com

RIYADH: King Khalid Airport Road: Tel. No.: 00966 (1) 4655555

70

KHOBAR: Coast Road Tel. No.: 00966 (3) 8590066

I www.landscape-me.com I May 2013

JEDDAH: Al Andalus Tel. No.: 00966 (2) 6686666

DUBAI Sheikh Zayed Road Tel. No. 00971 (4) 3296630

Landscape Magazine  

Landscape Magazine May Issue

Read more
Read more
Similar to
Popular now
Just for you