Page 1

CALL Toll Free 1-877-328-0048 ext 228 Canadian Publication Mail Agreement #40012905

Your Complete Farm Information Source • www.farmpressltd.com

Saskatchewan Edition

Monday, March 19, 2012 - Volume 32, No. 06

EST SALES W L L A Rosetown Your Dealer for Versatile Sprayers & Bunning Manure Spreaders

Check out our new website at: www.bourgault.com

306-882-2283

NG DELIVERY

2012 NH 70’ P2070 PRECISION AIR DRILL

2010 NH S1070

70’, 10” Spacing, All Options, Avail W/ a 430 OR 580 Bu Tow-Behind Aircart

1600 Gal, 134’ Suspended Boom, Autoboom, Accu-boom, Raven Rate Controller & Much More, Used Only One Season, Warranty Until Spring 2013

LAST ONE FOR

$64,000

SPRING DELIVERY...2012 NH T9.670

2011 NH L215 SKID-STEER

670 Hp, Absolutely Loaded w/ Every Option, Including PTO, 113 GPM Mega-Flow Hyd Pumps & Ati Tracks...

ONLY ONE AVAILABLE!!

52 Hp Dsl, 1500 Lb Lift, Mech Controls, Cab & Heater, Susp Seat, 72” Bucket, Brand New,

2012 NH TV6070 BI-DIRECTIONAL 105 PTO, Hp, Hydro, Frt & Rear, PTO, 3pt & Hyd, 84 lb FEL, 16.9x38 & Much More

GREAT PRICE!

2012 NH T7.235 235 Eng Hp, 185 PTO Hp, P.S (40 KPH), MFWD, Dlx Cab Suspension, 4 Remotes, J.S. Fenders, 540/1000, 3 pt & Much More, 5 Yr Lease

$10,540

ONLY

$31,885

S/A, ONLY $35.14/ HR OAC

Ht Drives, 275 Hp, 100’ Frt Booms, 1200 Gallon, All Options,

2012 NH SP240.F

SPRING DELIVERY ON 8 NEW NH 4WD TRACTORS

0% - 24 Mos Available OAC

T9, 2- T9.505, 2 - T9.560, T9.615 & 2 - T9.670’S

2011 NH T7.210

DEMO 2011 NH SP365.F

2008 NH T8010

375 Hp, 1600 Gal SS Tank, 120’ Booms, All Options, 800/32 Floaters, 79 Hrs, Full Warranty

175 PTO Hp, MFWD, 540/1000 PTO, Dlx Cab, 4 Remotes, Fenders, 520/42 Duals, 3 pt Ready, 19/4 Powershift (40 KPH), 2900 Hrs.

405 Peak Hp, Powershift, PTO, 710/38 Duals, WTS, Factory, AutoSteer, Dlx Cab w/ Leather, Frt & Rear Diff Locks & More, (Also 2012 V375 STD’s On Order)

$114,000

...2.99% - 3 Yr Lease Available OAC

210 Eng/165 PTO HP, 50 KPH CVT Transmission, Terra-Glide frt axle & cab suspension, DLX cab, 3PT, 540/1000, 4 Rem, auto-guidance rdy, hid lights, 855 TL FEL, 102” bkt & grpl & much more,based on 5 yr lease

$14,549

S/A ONLY $48.50/HR OAC

SAVE... OWN THE BIGGEST SP SPRAYER ON THE MARKET

2012 NH SP275.R

DEMO 2011 NH T6070 PLUS

275 Hp, Mech Drive, 1200 Gallon Tank, 120’ Booms, 520/38 Frt & 710/38 Rears, Loaded w/ All The Options,

120 PTO Hp, 16x16 Auto-Shift, Dlx Cab, 3Pt, 540/1000 PTO, NH 855TL FEL, Bkt & Grapple, 75 Hrs, New Warranty...Ask About Our

0% - 24 Mos Avail OAC

1.0%-36 Mos Lease OAC

Markusson New Holland of Regina Ltd

after hours:

26 Great Plains Road Emerald Park,SK

306-781-2828 or 1-800-819-2583 www.markusson.com

2012 GMC 1500 CREW 4WD SLE

$495 LEASE $3,500 DOWN

$28,200*

$33,500*

#T12216

$bi1we9ek2ly

2012 CRUZE LS

#C1224

CHROME DOOR HANDLES

#T1277

7 $bi-2w2 eekly

2012 EQUINOX LS FWD

$16,250*

CHROME ASSIST STEPS

2012 GMC 1500 CREW 4WD NEVADA

$372 LEASE $3,500 DOWN

$29,700*

loaded

ROSETOWN MAINLINE HWY#7 WEST ROSETOWN

CHROME MIRROR CAPS

(Derrick) 537-3848 (Cory) 539-2526

(Emerald SE) 527-5091 (Gary NE) 550-4644

2012 CHEV ½ TON EXT 1500 4WD LS

1-877-979-7999 www.rosetownmainline.net

2011 VERSATILE 375

$26,750*

$bi1we1ek4ly

$bi1we7ek6ly

#T1219

2012 GMC 2500 CREW SLT 2012 CHEV 1500 CREW 4WD 2 4WD GFX ULTIMATE LTZ GFX ULTIMATE

$68,100*

$49,100*

#T1225

2 $bi-2w0 eekly

2012 TRAVERSE FWD LS

$31,400*

#T1206

5 $bi-2w4 eekly

2012 ENCLAVE AWD CXL

$45,900*

ROSETOWN MAINLINE

#T12197

$bi5we2ek9ly

#T12209

2 $bi-3w3 eekly

*prices plus applicable taxes

#T12224

9 $bi-3w1 eekly


PAGE 2

Saskatchewan FarmLIFE, Monday, March 19, 2012

Canada

OPTIMUM USED VEHICLES

Canada

• MANUFACTURER’S WARRANTY • 30 DAYS/2500KM NO-HASSLE EXCHANGE PRIVILEGE • 150+ POINT INSPECTION • 24 - HOUR ROADSIDE ASSISTANCE BUYBACK CARS, VANS & SPORT UTILITIES * 80 IN STOCK * 2012 CHEV IMPALA LS 4DR SEDAN 3.6L V6, auto O/D, A-C-T, power w/l, keyless entry, power seat, 23,362 km, 3 to choose from . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$21,995 2012 CHEV MALIBU 4DR LS 2.4L 4-cyl, auto O/D, A-C-T, power w/l, keyless entry, 22,100 km. . . . . . . . . . . . . .$21,995 2011 CHEV IMPALA LS 4DR, 3.5L V6, fully loaded, 36-37,000 km, 2 in stock 1-Blue 1-Black . . . . . . . . . . . . . . . .$17,995 2011 CADILLAC ESCALADE AWD 6.2 V8, fully loaded, 22” wheels, DVD, NAV, sunroof, diamond white with cashmere leather, 15,687 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$66,995 2011 CADILLAC ESCALADE AWD 6.2L V8, loaded, NAV, sunroof, 22” wheels, 7 passenger, DVD, mocha, ebony leather, 23,053 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$64,995 2011 GMC YUKON SLT REG W.B. 4X4, 5.3L V8, fully loaded, sunroof, DVD, 20-24,000 km, Diamond white, 2 in stock, starting at. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$46,995 2011 GMC YUKON SLT XL 4X4, 5.3L V8, fully loaded, sunroof, DVD, diamond white, grey leather, 28,062 km . .$47,995 2011 CHEV TRAVERSE AWD 3.6L V6, auto O/D, fully loaded, CD player, power seat, DVD, sunroof, 8-passenger, aluminum wheels, grey leather, white, 22,917 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$38,995 2011 CHEV TRAVERSE AWD 2LT 3.6 V6, fully loaded, sunroof, DVD, white with grey leather, 22,919 km . . . . . . .$38,995 2011 CHEV EXPRESS 2500 CARGOVAN 4.8L V8 glass in pass, swing out doors and rear doors, A/C, white, 27,693 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$25,995 2011 BUICK ENCLAVE CXL AWD fully loaded, leather, 1-Red jewel, 1-Diamond white, 23-29,000 km . . . . . . . . . .$39,995

USED VANS 2010 DODGE GRAND CARAVAN SXT 3.3L V6, fully loaded, CD player, power seat, silver, 49,780 km . . . . . . . . . .$22,995 2010 DODGE JOURNEY RT AWD fully loaded, CD player, power seat, aluminum wheels, DVD, sunroof, leather, white, 25,170 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$26,995 2008 PONTIAC MONTAN SV6 EXT auto O/D, fully loaded, CD player, gold, 32,117 km . . . . . . . . . . . . . . . . . . . . .$15,995 2007 PONTIAC MONTANA SV6 EXT 3.9L V6, auto O/D, fully loaded, CD player, power seat, DVD, aluminum wheels, 7-passenger, white, 157,399 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$9,995 2006 PONTIAC MONTANA SV6, auto O/D, fully loaded, CD player, power seat, DVD, green, 99,610 km. . . . . . . .$12,995 2006 PONTIAC MONTANA SV6 3.5L V6, auto O/D, fully loaded, CD player, rear A/C, stealth grey, 106,089 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$10,995 2006 PONTIAC MONTANA EXT 3.5L V6, loaded, red, 157,796 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$9,995 2005 PONTIAC MONTANA 4DR, fully loaded, CD player, DVD, power seat, 7-passenger, green, 112,383 km . . . .$10,995 2005 PONTIAC MONTANA 3.3L V6, auto O/D, fully loaded, CD player, 8-passenger, white, 104,075 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$10,995 2005 CHEV UPLANDER LS, V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, silver, 139,203 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$9,995 2005 FORD FREESTAR SPORT V6, auto O/D, fully loaded, 4-bucket seats, rear A/C, 7-passenger, silver, 150,287 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$7,995 2005 CHEV VENTURE 4DR 3.4L V6, auto O/D, fully loaded, CD player, silver, 141,120 km . . . . . . . . . . . . . . . . . . .$8,995 2004 PONTIAC MONTANA EXT, 3.4L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, keyless entry, rear A/C, 8-passenger, blue, 133,380 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$9,995

USED SPORT UTILITIES & S-TRUCKS & SUBURBANS 2012 CHEV COLORADO CREW CAB 4X4 3.7L, auto, fully loaded, CD player, aluminum wheels, white, 4,641 km .$33,995 2011 GMC TERRAIN SLE AWD 2.4 4-cyl, auto O/D, fully loaded, CD player, power seat, aluminum wheels, grey, 34,366 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$29,995 2011 CHEV TRAVERSE 1LT AWD 3.6L V6, fully loaded, white with ebony cloth, 29,400 km. . . . . . . . . . . . . . . . . . .$33,995 2011 CHEV EQUINOX 2LT AWD 4-cyl, auto O/D, fully loaded, CD player, power heated seats, blue, 29,137 km. .$29,995 2010 CHEV TRAVERSE 1LT FWD 3.6L V6, auto O/D, fully loaded, CD player, 7 passenger, hitch, grey, 101,179 km . $26,995 2010 BUICK ENCLAVE CX AWD 3.6L V6, auto O/D, fully loaded, CD player, power seats, keyless entry, dual zone air, white, 68,753 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$33,995 2010 CHEV COLORADO LT EXT CAB 4X4 3.5L 5-cyl, auto O/D, fully loaded, CD player, chrome wheels, red, 26,234 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$23,995 2010 FORD EDGE LTD AWD 3.5L V6, auto O/D, fully loaded, 6 disc CD, power heated seats, aluminum wheels, 20” wheels, sunroof, ebony leather, silver, 22,164 km. . . . . . . . . . . . . .$33,995 2010 GMC TERRAIN SLE2 AWD 2.4L 4-cyl, fully loaded, power heated seats, aluminum wheels, cyber grey, 75,753 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$25,995 2009 CHEV AVALANCHE LT 4X4 auto O/D, fully loaded, CD player, power seat, aluminum wheels, sunroof, silver, 73,704 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$32,995 2009 CHEV AVALANCHE LT 4X4 5.3L V8, auto O/D, fully loaded, CD player, bucket seats, hitch, white, 76,211 km . .$29,995 2009 CHEV EQUINOX LS FWD 3.4L V6, auto O/D, fully loaded, CD player, sport red, 99,481 km . . . . . . . . . . . . .$15,995 2009 CHEV TRAVERSE LS AWD fully loaded, CD player, spoiler, 8-passenger, hitch, silver, 80,024 km. . . . . . . . . . .$22,995 2009 CHEV TRAVERSE AWD 3.6L V6, auto O/D, fully loaded, CD player, power seat, silver, 80,029 km. . . . . . . . .$24,995 2009 CHEV TRAVERSE 2LT AWD 3.6L V6, auto O/D, fully loaded, CD player, 4 bucket seats, 7 passenger, sunroof, white, 23,563 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$28,995 2009 CHEV TRAVERSE LTZ AWD auto O/D, fully loaded, CD player, power seat, navigation, DVD, red, 70,033 km. . .$32,995 2009 GMC YUKON XL SLT 4X4 fully loaded, power heated seats, sunroof, leather, ext warranty to 160,000 km, black, 141,176 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$29,995 2008 PONTIAC TORRENT AWD 3.4L V6, auto O/D, fully loaded, CD player, roof rack, dk grey, 106,782 km . . . .$16,995 2008 CHEV TRAILBLAZER LT fully loaded, 6 disc CD, aluminum wheels, sunroof, white, 145,707 km. . . . . . . . . . .$16,995 2008 GMC ACADIA SLT AWD 3.6L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, DVD, 7 passenger, dk crimson, 138,453 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$22,995 2008 GMC ACADIA SLT AWD, fully loaded, CD player, power seat, aluminum wheels, leather, white, 131,497 km. . $25,995 2008 FORD EDGE SEL AWD fully loaded, CD player, power seat, heated seats, keyless entry, grey, 154,026 km. .$18,995 2008 PONTIAC TORRENT GXP AWD V6, auto O/D, fully loaded, CD player, power heated seats, keyless entry, sunroof, silver, 83,596 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$19,995 2007 CHEV EQUINOX LT AWD 3.4L V6, auto O/D, fully loaded, 6 disc CD, power heated seats, sunroof, grey leather, ext warranty to Aug 25/12 or 160,000 km, silver, 117,673 km. . . . . . . . . . . . . . . . . . . .$14,995 2007 CHEV TRAILBLAZER LS 4X4 4.2L 6-cyl, auto O/D, fully loaded, CD player, power seat, aluminum wheels, Touch 4X4m silver, 117,727 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$14,995 2007 CHEV HHR LS 2.2L 4 cyl, A/C/T, power windtows & locks, CD, XM, ebony cloth, sport red, 76,865 km. . . .$10,995 2007 MITSUBISHI ENDEAVOR SE V6, auto O/D, fully loaded, 6 disc CD, aluminum wheels, power seat, sunroof, goldmist, 83,860 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$18,995 2007 FORD RANGER SPORT EXT CAB 4X4 auto, CD player, A/C/t, white, 69,901 km. . . . . . . . . . . . . . . . . . . . . . .$16,995 2007 PONTIAC TORRENT AWD 3.4L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, sunroof, ebony leather, grey, 119,397 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$18,995

2007 GMC YUKON SLT 4X4, fully loaded, 6 disc CD, power heated seats, DVD, black, 86,011 km. . . . . . . . . . . . .$26,995 2006 CHEV TAHOE LT 4X4 5.3L V6, auto O/D, fully loaded, 6 disc CD, power heated seats, dual zone air, aluminum wheels, hitch, sunroof, grey leather, dk. red, 136,417 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$21,995 2006 BUICK RENDEVOUS FWD, V6, fully loaded, CD player, keyless entry, maroon, 135,365 km . . . . . . . . . . . . . .$8,995 2005 DODGE DURANGO SLT 4.7L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, grey leather, silver, 118,296 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$12,995 2005 FORD RANGER XLT EXT CAB 4X4 V6, 6 disc, A/C/T, split bench seat, green, 126,182 km. . . . . . . . . . . . . . .$11,995 2005 CHEV COLORADO LS EXT CAB 3.5L 5-cyl, auto O/D, fully loaded, CD player, red, 116,264 km . . . . . . . . . .$10,995 2004 JEEP GRAND CHEROKEE LAREDO 4X4 V6, fully loaded, CD player, bucket seats, power seat, aluminum wheels, keyless entry, red, 155,973 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$12,995 2004 BUICK RENDEZVOUS AWD 3.4L V6, auto O/D, loaded, 5-passenger, silver, 117,291 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$9,995

USED EXTENDED CABS & CREW CABS * 60 IN STOCK * 2011 GMC SIERRA SLT EXT CAB 4X4 5.3L V8, auto O/D, fully loaded, step bars, tube rails, black leather, black, 41,529 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$34,995 2011 GMC SIERRA SLT ¾T EXT CAB 4X4 6.6L Duramax Diesel, auto O/D, fully loaded, CD player, power seat, aluminum wheels, step bars, leather, grey, 84,000 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$43,995 2011 GMC SIERRA SLT CREW CAB 4X4 5.3L V8, auto O/D, fully loaded, CD player, keyless entry, aluminum wheels, sunroof, chrome kit, ebony leather, white, 33,627 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$37,995 2011 GMC SIERRA SLE EXT CAB 4X4, auto O/D, fully loaded, CD player, power seat, white, 36,774 km. . . . . . . .$32,995 2011 DODGE RAM SLT QUAD CAB 4X4 5.7L Hemi, auto O/D, fully loaded, CD player, split bench seat, power seat, aluminum wheels, red, 15,713 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$29,995 2011 GMC SIERRA SLE CREW CAB 4X4 auto O/D, fully loaded, CD player, power seat, silver, 81,076 km. . . . . . .$28,995 2010 DODGE RAM LARAMIE CREW CAB 4X4 5.7L Hemi, fully loaded, CD player, split bench seat, power heated seat, 20” aluminum rims, rails, tan leather, black/silver, 65,292 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$33,995 2010 FORD F150 XLT LARIAT CREW CAB 4X4, 5.4L V8, auto O/D, fully loaded, CD player, power bucket seats, keyless entry, step bars, ebony leather, white, 62,490 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$32,995 2010 CHEV SILVERADO LTZ EXT CAB 4X4 5.3L V8, auto O/D, fully loaded, CD player, power heated seats, aluminum wheels, Touch 4x4, hitch, ebony leather, white, 58,117 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$32,995 2010 CHEV SILVERADO LTZ EXT CAB 4X4 5.3L V8, auto O/D, fully loaded, CD player, power heated seats, aluminum wheels, sunroof, ebony leather, black, 34,890 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$31,995 2010 GMC SIERRA SLE CREW CAB 4X4 5.3L V8, auto O/D, fully loaded, CD player, power bucket seats, keyless entry, step bars, chrome kit, dk blue, 68,714 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$28,995 2009 GMC SIERRA ¾ TON CREW CAB 4X4 6.6L Duramax diesel, auto O/D, fully loaded, CD player, power seat, hitch, ext warranty to 160,000 km, silver, 145,128 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$33,995 2009 GMC SIERRA SLE CREW CAB 4X4 5.3L V8, auto O/D, fully loaded, CD player, power seat, dual zone air, silver, 68,799 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$26,995 2009 CHEV SILVERADO CREW CAB 4X4 5.3L V8, auto O/D, fully loaded, CD player, split bench seat, power seat, dual zone air, aluminum wheels, touch 4X4, silver, 89,814 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$25,995 2009 CHEV SILVERADO LT CREW CAB 4X4 5.3L V8, auto O/D, fully loaded, CD player, split bench seat, power seat, leather, white, 114,005 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$24,995 2009 CHEV SILVERADO LT CREW CAB 4X4 5.3L V8, auto O/D, fully loaded, CD player, split bench seat, power seat, aluminum wheels, hitch, white, 90,869 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$25,995 2009 GMC SIERRA SLT ¾T CREW CAB 4X4 6.6L Duramax Diesel, auto O/D, fully loaded, CD player, power heated seats, rails, boards, tonneau cover, ebony leather, maroon, 119,315 km. . . . . . . . . . . . . . . . . . . .$38,995 2009 GMC SIERRA EXT CAB 2WD 4.8L V8, auto O/D, CD player, A-C-T, power locks, blue, 37,532 km . . . . . . . . .$17,995 2009 FORD F150 XLT EXT CAB 4X4 auto, fully loaded, CD player, power seat, blue, 142,815 km. . . . . . . . . . . . .$19,995 2009 CHEV SILVERADO LT EXT CAB 2WD fully loaded, CD player, split bench seat, black, 101,042 km. . . . . . . . . .$19,995 2009 GMC SIERRA EXT CAB 4X4 5.3L V8, auto O/D, fully loaded, split bench seat, silver, 73,985 km. . . . . . . . . .$25,995 2008 CHEV SILVERADO LT EXT CAB 4X4 5.3L V8, auto O/D, fully loaded, CD player, power bucket seats, sunroof, red, 103,013 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$21,995 2008 GMC SIERRA CREW CAB 4X4 4.8L V8, auto O/D, fully loaded, CD player, split bench seat, power seat, touch 4X4, hitch, dual zone air, silver, 74,413 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$23,995 2008 DODGE RAM ½ TON CREW CAB 4X4 SXT, loaded, CD, grey cloth, dk red, 75,174 km. . . . . . . . . . . . . . . . . .$20,995 2007 CHEV SILVERADO LS ¾TON CREW CAB 4X4 6.6L Duramax diesel, auto O/D, fully loaded, split bench seat, power seat, dual zone air, aluminum wheels, hitch, dk grey, 149,526km. . . . . . . . . . . . . . . . . .$31,995 2007 GMC SIERRA CREW CAB 4X4 5.3L V8, auto O/D, fully loaded, power heated seats, sunroof, leather, silver, 90,000 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$25,995 2007 GMC SIERRA DENALI CREW CAB 4X4 6.0L V8, auto O/D, fully loaded, CD player, power heated seats, 20” wheels, sunroof, Lt grey leather, white, 98,375 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$28,995 2006 FORD F350 LARIAT EXT CAB 4X4, 6.0L Diesel, auto O/D, fully loaded, CD player, bucket seats, power seat, aluminum wheels, leather, white, 105,194 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$27,995 2006 FORD F150 XLT EXT CAB 2WD 5.4L V8, auto, fully loaded, CD player, power seat, blue, 100,374 km . . . . .$15,995 2006 DODGE RAM SLT CREW CAB 4X4 4.7L V8, fully loaded, red, 151,500 km . . . . . . . . . . . . . . . . . . . . . . . . . . .$18,995 2006 DODGE RAM SLT 1 TON QUAD CAB 4X4 5.9L Cummins, auto O/D, fully loaded, CD player, power seat, gold, 127,107 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$29,995 2004 CHEV SILVERADO ¾ TON EXT CAB 4X4 6.6L Duramax Diesel, auto O/D, fully loaded, CD player, split bench seat, power seat, aluminum wheels, pewter, 152,397 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$20,995 2004 DODGE RAM CREW CAB 4X4, hemi, fully loaded, CD player, power seat, black, 135,712 km. . . . . . . . . . . .$16,995

USED 1/2 TONS 2010 CHEV SILVERADO 4.3L V6, auto O/D, CD player, A/C/T, power locks, keyless entry, nerf bars, chrome wheels, blue granite, 19,961 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$16,995 2007 CHEV SILVERADO LT REG CAB 2WD L/BOX 5.3L V8, auto O/D, fully loaded, aluminum wheels, silver, 81,146 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $18,995 2004 FORD F150 XLT STEPSIDE 5.4L V8, auto, fully loaded, step bars, screenfront, bug deflector, blue, 128,007 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $10,995

USED 3/4 TONS & 4X4’S 2011 GMC SIERRA SLE ¾T 4X4 6.0L V8, auto O/D, fully loaded, CD player, split bench seat, step bars, silver, 21,706 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$34,995 2009 CHEV SILVERADO LS 4X4 4.8L V8, A/C/T, power locks, hitch, grey, 88,593 km. . . . . . . . . . . . . . . . . . . . . . .$19,995 2009 CHEV SILVERADO 4X4, 5.3L V8, auto O/D, CD player, A-C-T, power locks, keyless entry, white, 40,830 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$23,995

USED CARS 2011 CHRYSLER 200 SERIES CONVERTABLE HARDTOP COUPE 3.6L V6, auto O/D, fully loaded, power seats, navigation, DVD, Deep Cherry, 8,581 km..................................................................... $34,995 2010 CHEV MALIBU 2LT SEDAN 2.4L 4-cyl, 6-speed, fully loaded, CD player, power seat, aluminum wheels, gold, 51,791 km ................................................................................................ $17,995 2010 CHEV MALIBU LS SEDAN 2.4L 4-cyl, auto O/D, fully loaded, CD player, bucket seats, keyless entry, white, 17,760 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$18,995 2009 PONTIAC GS SEDAN 3.6L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, sunroof, grey, 98,265 km ............................................................................................................... $18,995 2009 TOYOTA COROLLA LE FWD SEDAN, fully loaded, CD player, power seat, sunroof, tan, 45,940 km .. $15,995 2009 CHEV IMPALA LT, auto O/D, A-C-T, CD/XM, power windows, locks & mirrors, power seat, aluminum wheels, goldmist, 82,500 km ........................................................................ $13,995 2009 CHEV MALIBU LTZ SEDAN 3.6L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, sunroof, brown leather, black, 97,071 km ....................................................................................... $15,995 2009 CHEV MALIBU LS SEDAN 2.4L 4-cyl, auto O/D, fully loaded, CD player, blue, 124,419 km ......... $11,995 2009 BUICK LUCERNE CX 3.9L V6, auto O/D, fully loaded, CD player, bucket seats, power seat, keyless entry, aluminum wheels, silver, 86,316 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$16,995 2009 PONTIAC G3 WAVE 5DR 5 speed, CD player, dk red, 153,303 km ................................................ $7,995 2008 CHEV HHR LS 2.2L 4-cyl, 5 speed, fully loaded, CD player, ext warranty to May 2014, black, 61,249 km ............................................................................................................................. $9,995 2008 CHEV IMPALA LT 4DR 3.5L V6, loaded, silver, 108,686 km ........................................................ $10,995 2008 CHEV IMPALA LS SEDAN 3.5L V6, auto O/D, fully loaded, power seat, aluminum wheels, 5 passenger, beige, 99,323 km ....................................................................................................... $10,995 2008 PONTIAC G5 PURSUIT SE COUPE 5 speed, fully loaded, CD player, aluminum wheels, sunroof, yellow, 118,243 km ............................................................................................................ $9,995 2008 BUICK LUCERNE CX, 3.8L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, crimson, 135,705 km ......................................................................................... $14,995 2008 PONTIAC G6 SE SEDAN 3.5L V6, auto O/D, fully loaded, CD player, aluminum wheels, Dk blue, 112,627 km ...................................................................................................................... $9,995 2007 CHEV MALIBU LT SEDAN 6-cyl, auto O/D, fully loaded, CD player, grey, 99,821 km . . . . . . . . . . . . . . . . . . . .$8,995 2007 CHEV IMPALA LTZ SEDAN fully loaded, CD player, power heated seats, sunroof, leather, grey 100,278 km .$12,995 2007 MITSUBISHI ECLIPSE SPYDER GS CONVERTIBLE fully loaded, auto, black, 145,424 km ................ $15,995 2007 CHEV IMPALA LTZ SEDAN 3.9L V6, auto O/D, fully loaded, CD player, power heated seats, dual zone air, aluminum wheels, spoiler, leather, silver, 75,726 km ................................................. $13,995 2007 CHEV COBALT LT COUPE, 5-speed, fully loaded, CD player, silver, 75,894 km ................................ $8,995 2007 PONTIAC GRAND PRIX GT SEDAN V6, auto O/D, fully loaded, keyless entry, aluminum wheels, sunroof, leather, white, 95,727 km ................................................................................................. $14,995 2007 PONTIAC SOLSTICE CONVERTIBLE, 5 speed, fully loaded, 6 disc CD, chrome wheels, silver, 37,130 km .......................................................................................................................... $16,995 2007 PONTIAC G5 COUPE SPORT 2.2L 4-cyl, 5 speed, fully loaded, CD player, red, 90,636 km .............. $8,995 2007 CHEV COBALT SS 2.4L 4-cyl S/C, 5-spd, fully loaded, CD player, aluminum wheels, sunroof, silver, 121,125 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$10,995 2006 CHEV IMPALA LTZ 3.9L V6, auto O/D, fully loaded, CD player, power seats, aluminum, wheels, black, 95,338 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$10,995 2006 CADILLAC CTS SEDAN 3.6L V6, auto O/D, fully loaded, CD player, power seats, aluminum wheels, sunroof, brown leather, brown, 99,132 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$16,995 2006 CHEV IMPALA LS SEDAN, 3.5L V6, auto O/D, fully loaded, CD player, power seat, burgundy, 146,876 km......$7,995 2006 CHEV COBALT LS COUPE 2.2L 4-cyl, 5-spd, CD player, A/C/T, power locks, spoiler, silver, 143,895 km. . . . . .$7,995 2006 NISSAN MAXIMA SE SEDAN 3.5L V6, auto O/D, fully loaded, 6 disc CD, power heated seats, aluminum wheels, sunroof, grey leather, silver, 119, 087 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$13,995 2005 CHEV IMPALA SEDAN fully loaded, CD player, power seat, gold, 126,219 km . . . . . . . . . . . . . . . . . . . . . . . . .$7,995 2005 PONTIAC SUNFIRE SE SEDAN, 2.2L 4-cyl, 5-speed, CD player, cruise, dk red, 82,821 km . . . . . . . . . . . . . . . .$5,995 2005 MAZDA 6 I GS SEDAN 4-cyl, auto, fully loaded, CD player, power seat, aluminum wheels, red, 91,615 km . . .$10,995 2005 CHRYSLER 300 SEDAN, 3.5L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, sunroof, white, 110,457 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$11,995 2005 FORD TAURUS SE 3.0L V6, loaded, auto O/D, grey cloth, blue, 156,469 km . . . . . . . . . . . . . . . . . . . . . .$5,995 2005 DODGE VIPER SRT-10 CONVERTIBLE COUPE V10, fully loaded, 6 disc CD, ebony leather, black, 19,731 miles . . $49,995 2004 PONTIAC GRAND PRIX GT SEDAN fully loaded, bucket seats, power seat, silver, 92,848 km . . . . . . . . . . . . . .$9,995 2004 PONTIAC GRAND PRIX GTP SEDAN fully loaded, 6 disc CD, power heated seat, aluminum wheels, heads up display, spoiler, sunroof, ebony leather, white, 129,195 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$8,995

Rebates To Dealer In Lieu of Financing!


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 3 More Power. More Features. More versatility. The new Massey Ferguson® 7600 Series.

OUR MAINLINE IS -- SHORTLINES USED TRACTORS

MISCELLANEOUS

JD4600 4wd, 3pt, loader, 1630 hrs ...................$16,900 JD 3140 Dsl, CAH, 4wd, loader, grapple, 7500 hrs ..$27,900 JD 4020 Dsl, P shift, loader .................................$9,995 CASE 2294 (84), 2wd, CAH, Ldr, 7500 hrs, clean unit ........................................................$24,900 CASE 1070 Dsl, CAH, loader, P shift ..................$10,995 KUBOTA M110 (10) CAH, ldr, 4wd, 3pt, 700 hrs.... $57, 900 KUBOTA L4610HST (01) 4wd, 3pt, loader, (450 hrs) ........................................................$21,900 NEW HOLLAND TC30 compact dsl, 3pt, 4wd (1500 hrs)........................................$10,995

USED HAY TOOLS

NEW KIRSCHNER 7’ V Ditcher w/hyd cyl & hoses .......................................................$5,995

Introducing the mid-frame row crop tractors designed to provide all the performance you need – no matter what you’re farming or what the task. With four models from 170 to 225 gross engine HP and your choice of Dyna-6™ or Dyna-VT™ transmissions, the 7600 Series offers exclusive features like programmable cruise speeds, Dynamic Tractor Management and second-generation e3™ SCR clean air technology. Come see us soon or go to masseyferguson.com

NEW LANDPRIDE 10’ trail type box blades! ........$3,800 BOBCAT 753G (00) cab, heat, bucket, 3600 hrs .........................................................$16,995 BOBCAT 430 ZHS excavator, cab, heat, bucket, 600 hrs...............................................$39,995 BOBCAT 863 (01), cab, heat, bucket (2400 hrs)$20,995 BOBCAT 863G, cab, heat, bkt, Hflow, 1200 hrs .$22,995 BOBCAT S205 (05) cab, air, heat, P-btach (2400 hrs) .... $22,995

MASSEY FERGUSON

HESSTON 1200 25’ auto fold PT swather ............$3,995

VERMEER 605M (08) baler w/ net wrap (6000 bales) ...................................................$26,900 JD567 round baler, netwrap, mega pickup, 12000 bales ....................................................$19,500

is a worldwide brand of AGCO. ©2011 AGCO Corporation, 4205 River Green Parkway, Duluth, GA 30096 (877) 525-4384. MFIICO24TCG

RTV500 gas utility vehicle (94 hrs), wsheild, winch ..................................................$7,995 HIGH LINE XL78 Hi-Dump rock picker, hyd drive, good shape .....................................................$15,995

TILLAGE & SEEDING

K.M.K. Sales Ltd.

KUBOTA RTV900 Utility Vechicle (08), Wsheild,

DEGELMAN 7000 - 70’ heavy harrow, manual angle ..................................................$25,900 DEGELMAN 7000 H Harrow, 70’, man angle (very clean).....................................................$34,900 DEGELMAN 7000 Heavy Harrow, 50’, man angle .......................................................$24,900 DEGELMAN LR7645 - 45’ landroller ..................$31,995 PEACELANDER 16’ aerator ..................................$4,995

USED FEED EQUIPMENT

canopy, winch ...................................................$9,995

CAT 277B track loader (07), cab, heat, bucket, 1200 hrs .........................................................$44,900 JLG G6-42A Zoom Boom with cab, 3600 hrs ....$43,900

USED GRAIN DRYERS

USED AUGERS

w/ canola screens .............................................$7,995 GI112 (91) 230V, NG, canola screens................$34,900

FARM KING 1370TMR (03) w/mover...................$9,900 FARM KING 1385TFM w/ hyd mover ...................$9,995

email: agsales_kmk@sasktel.net

3300 hrs ...........................................................$9,995

BEHLEN 170 bu nat gas auto batch dryer

HIGHLINE 8000 bale pro (05), RH, flot tires (consigned) ......................................$12,995

Box 540 Hwy 20, Humboldt SK

(306) 682-0738 • (800) 565-0500

THOMAS 173HL skid steer, dsl, bkt, no cab,

GT580, LPG, pto drive, canola screens................$7,995 Vertec 5500 (09) LPG, 230V,w/augers. LP tank ..$23,900

HARVESTERS- COMBINES AND HEADERS 2011 MF 9895,350sep hrs,full load,mav,16’ pu ................................ $345,000 2010 MF 9895,350 sep hrs,full load,16’ pu....................................... $315,000 2010 MF 9895,demo,40hrs,full load,16’ pu ...................................... $345,000 2009 MF 5100,draper,36’,mf adtr,tran kit ............................................ $49,900 2009 MF 9695,900’,110 sep hrs,chpper,chaff ................................... $239,900 2006 MF 9690,chopper,chaff,900’s,820sp hrs .................................. $199,900 2005 MF 9690, 680sep hrs, 30.5x32, chopp, chaff spdr................... $179,000 2005 CHALLENGER 670, 1050 Hrs, new pu, chopper ...................... $169,900 2001 MF 8780XP,1750 sep hrs,super 8,chopper, spdr........................ $99,000 2000 JD 9650W,chopper,$28,000 w/o,no hdr,30.5 ............................. $89,900 1998 MF 8780,2011 sep hrs,chopper,chaff......................................... $79,900 1996 MF 8570,2300 eng hrs ,pu header,chopper................................ $44,900 1995 MF 9700-30,rigid,bat ................................................................... $9,900 1994 MF 8570, 3000hrs, chopper, pu, spreader ................................. $39,900 1986 MF 8560, pu header, chopper, 190hp ......................................... $29,900 1983 JD (X2) 8820’s,chopper,14’jd pu,30.5........................................ $11,900

HAY & FORAGE Box 1654, Prince Albert, SK S6V 5T2 email: glenmor@sasktel.net

Toll Free 1-888-708-3739 www.glenmor.cc

2011 MF 9430,36’,full load,auto steer............................................... $102,900 2009 MF 9430,30’,ull,670hrs,loaded .................................................. $89,900 2007 MF 9430,30’,800hrs,aux hyd,roto sheers .................................. $82,400 2006 MF 9420,715hrs,36’,ull reels ..................................................... $75,900 2004 Hesston 956A,full auto, nice ...................................................... $21,900 2004 MF 9420, Hrs, 36”, 5100 series header..................................... $62,900 2003 Hesston 8020,16”, sickle ,rub on stl .......................................... $18,900 2003 NH BR780,nice........................................................................... $19,900 2001 HESSTON 1275,16’110’’ rbr on stl rollers,dubl drive ................. $27,900 1994 CIH 8380,16’,rbr on stl rollers,swing ........................................... $9,900 1998 JD 2360,30’,pu reel,dsa,dsl ....................................................... $19,900 1989 NI 486, 5x6,soft core ................................................................... $3,900 1983 VERS 4400, DSL,ENG,cab,pu reels,cab ....................................... $7,900 1982 JD 1380,14’ swing,steel rollers .................................................... $8,900 1975 IH 75, 28” batt reels ..................................................................... $2,500 220 Hay Header,16” ............................................................................ $13,900 OTMA 2-Whl ft mt swath turner ............................................................... $999

TRACTORS

There’s hay. And now there’s Hesston Hay. A better brand of hay. A better way to produce it. Welcome to the new WR Series SP Windrowers from Hesston by Massey Ferguson®. More than just a new model, this is an entirely new class of windrower. The first ever to use an onboard virtual computer to maximize productivity on every acre of every field—every day. The all-new WR Series. An unparalleled achievement in SP windrowers. From the brand that invented the category. Come see us soon or visit masseyferguson.com/windrowers MASSEY FERGUSON and Hesston are registered trademarks of AGCO. ©2011 AGCO Corporation, 4205 River Green Parkway, Duluth, GA 30096 (877) 525-4384. MF11C020TCG

ROUND BALERS

2002 HS856A 5x6 Full auto . . . . . . . . . . . . . . . . . . . $16,000 2003 HS956 5x6 Full auto HM48130 . . . . . . . . . . . $16,9000 2001 HS856A 5x6 full auto HK25253 . . . . . . . . . . . $15,9000 2003 HS956A 5x6 full auto HM25360 . . . . . . . . . . $16,9000 2002 HS856A 5x6 full auto HL25372 . . . . . . . . . . . $14,0000 2004 HS956A 5x6 full auto HN25168 . . . . . . . . . . . $16,9000 2006 HS956A 5x6 full auto HR25346 . . . . . . . . . . . $17,9000 2005 HS956 5x6 Semi Auto HP48102 . . . . . . . . . . . $17,3000 2003 HS956 5x6 Semi Auto HM25540 . . . . . . . . . . $13,9000 2003 HS956A 5x6 full auto HM25376 . . . . . . . . . . . $14,900 2007 MF2656 5x6 Semi Auto HS25209 . . . . . . . . . . $18,900 2004 HS956 5x6 Semi Auto HN25416 . . . . . . . . . . . $16,500 2005 HS956A 5x6 full auto HP25161 . . . . . . . . . . . $17,000 2009 MF2756A 5x6 full auto HU25136 . . . . . . . . . . $24,500 2003 8465 5x6 HM79105 (Rebuild) . . . . . . . . . . . . $11,000 2000 8465 5x6 74685 (Rebuild) . . . . . . . . . . . . . . $10,000 2003 4855 5x5 softcore HM79105 Ex Shape . . . . . $10,500 4845 5x4 soft core Ex Shape . . . . . . . . . . . . . . . . . . $10,000 HS514 5x6 soft core (Rebuild) . . . . . . . . . . . . . . . . . $10,500 504I Vermeer 4x5 Hard core . . . . . . . . . . . . . . . . . . . $7,500 555T 4x6 hard core w/kicker. . . . . . . . . . . . . . . . . . . $7,500 BR780 New Holland big Pick up . . . . . . . . . . . . . . . . $16,500 660 John Buhler 5x6 soft core . . . . . . . . . . . . . . . . . . $8,500

All used round balers 3.9% for 60 months

SQUARE BALERS

Hesston 4755, 3x3 sq baler . . . . . . . . . . . . . . $24,500 Hesston 4590, 1/4 turn hydro tension . . . . . . $16,500

Special Financing Available

ENTER TO WIN A TRIP TO 2012 NFR IN VEGAS

9220 Massey 30’, low hours, cab, air, Diesel w/30’ header. . . . . . . . . . . . . . . . . . . . . . . . . .$79,900 2000 HS8110S w/25’ Grain and 16’ Hay Headers (1500 hrs) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$42,500 1998 NH2 450 w/18’ Auger Header . . . . . . . . . . . . . . . . . . . . . . $28,900 MacDon pull-type Swather . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$7,900

airfare, room & rodeo ticket with the purchase of used baler to win

TRACTORS

Low Rate or Interest Free

2004 MC-135/ 115 hp, Cab, air, 3pt, diesel . . . . . . $46,900 Used Finance 3.9% for 60 months JD855 3pt, FEL, FWD, Belly Mower, 20 Hp, on all used equipment Diesel. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $8,500 MF 1085 Cab, FEL, Heater, new engine . . . . . . . . . . . $8,500 MOWER CONDITIONERS TM120 Ford NH FEL, FWD, Grappell, 3pt. . . . . . . . . $49,900 9880 Ford Tractor 4WD, 400 Hp, 6 remotes Case SCX 100 16’ Case. . . . . . . . . . . . . . . . . . . . . . $16,500 NH, 5400 hr . . . . . . . . . . . . . . . . . . . . . . . . . . . $69,900 Hesston 1275. . . . . . . . . . . . . . . . . . . . . . . . . . . . . $16,900 1989 MF 3090 FWD, Cab, FEL, 95 hp . . . . . . . . . . . $21,900 MISCELLANEOUS EQUIPMENT IHC 1466 w/loader spear air, cab . . . . . . . . . . . . . . $10,900 New Holland Bale Wagon, 169 bales, COMBINES self propelled . . . . . . . . . . . . . . . . . . . . . . . . . . . $15,500 2000-8780xp w/chopper rake pick up . . . . . . . . . $85,000 Ezee-On Post Pounder w/ motor. . . . . . . . . . . . . . . . $7,600 MF 8780 Combine 2135 seperator hrs, straw chopper, pickup header, shedded, excellent shape . . . . . . . . . . . . . . . .$65,000 2012 Bale King Bale Shredder . . . . . . . . . . . . . . . . $18,800 MF 8570 w/pickup header, low hrs, ex shape . . . . . . . .$34,500 8x14 Wheat heart Auger w/ bin sweep and hydro motor . . . . .$11,500 SWATHERS New SR112 KUHN V Rake. . . . . . . . . . . . . . . . . . . . . $7,450 2011 MF 9430 Low Hours, 30’ Sch. Drive . . . . . . . . . . $Coming GA7501 KUHN Bifold rake . . . . . . . . . . . . . . . . . . . . $7,900 2004 MF9260 Cab, Air, DBB swath, Pick up Reel 0% for 36 Months on Used Haying Equipment 3 to choose from. . . . . . . . . . . . . . . . . . . . starting at $69,000 for a limited time - see dealer for details

NICK’S SERVICE LTD. LTD. NICK’S SERVICE (306)781-1077 • (306)781-1078

#2 South Plains Rd W • Emerald Park, Sask. Parts Available for All Agco Lines

2008 NH T9050,485hp,ps trans,800hrs,800x38’s............................. $249,000 2008 JD 6430 PRM,673 ldr,grpl,fwa,16sp,4200hrs,3pth .................... $69,000 2007 CHALLENGER MT965B,510hp,800’s,6hyd,5800hrs................. $179,000 2007 CHALLENGER MT865B,510hp,tracks,6 hyd,6000hrs............... $189,000 2006 CHALLENGER MT 865B,510hp,track,6hyd,6500hrs ................ $179,000 2006 MF 2300L,600hrs,ldr,turf ............................................................. $9,900 2005 FENDT 926,240hp,5775hrs,710 dls,frt susp,cvt ...................... $135,000 2004 AGCO RT120,1665hrs,new 2795ldr,cvt trans ............................. $99,900 2004 MF 431,2wd,52hp,190hrs,3pth .................................................. $17,900 2002 MF GC2300, 350 Hrs .................................................................. $9,900 2001 FENDT 714,125hp,loader,grapple,cab & axle susp.................... $59,900 1999 Agco White 8810, 3145 hrs, 3 pth, 20.8x42 ............................. $74,900, 1996 AGCO WHITE 6175,4300hrs,20.8 dls,3hyd,fwa,18sp ............... $59,900 1996 AGCO ALLIS 9670, ps trans, 175 hp,3pth, fwa ......................... $59,000 1995 CAT 70C,285hp.ps trans,4hyd,pto ............................................ $49,900 1995 CAT 75C,325hp,4hyd,3pt,pto. .................................................... $59,900 1993 AGCO ALLIS 9630, 5831 hrs......................................18spd ps. $59,900 1990 CAT 65,270 eng hp,8200hrs,4hyd.............................................. $49,900 1990 FORD 846,5100hrs,15sp tran,pto,18.4x38dls ............................ $43,900 1990 AGCO ALLIS 9170,fwa,170hp,18sp trans ................................. $33,900 1990 AGCO ALLIS 9190,fwa,dls,4751 hrs,ft wgts.............................. $43,900 1990 JD 4555, ps trans, 3pth, 4760hrs .............................................. $43,900 1988 WHITE 185, 5488 hrs, wght,1000pto......................................... $49,900 1985 DEUTZ DX6.30,110hp,2wd ........................................................ $15,900 1984 CASE 2294, duals, 8200 hrs ...................................................... $14,900 1983 MF 4840,20.8x38dls,pto,3hyd ................................................... $19,900 1981 MF 4880,20.8x38dls,8900hrs,4hyd,50% rbbr ........................... $19,900 1979 DX110,100hp,2wd,9’ leon blade,2hyd,5000hrs. ........................ $14,900 1979 JD 4840, ps trans, 7100hrs, 3pth .............................................. $19,900 1977 WHITE 4-180,23.1x34 sgls, 12sp, 1000pto, 4500hrs ................ $16,900 JD 410 Utility,loader,cab,pto,2wd.......................................................... $9,900

SPRAYERS 2010 Versatile spx275,100’,full ld,1200gl ......................................... $200,000 2006 RoGator 874, 1631 hrs, 800gl, 100’, full load, 4wd ................. $155,900 2005 Spra-coupe 7560,80’,725tnk,174hp,2000hrs .......................... $110,000 Melroe 215 coupe,52’,150 gln,4 wl ....................................................... $8,900

INDUSTRIAL LIFTS 2006 GENIE GS2668RT,scissorlift,4x4,32”lift,1250lbs........................ $15,900 2000 Lull 644 ...................................................................................... $27,900 1999 PETTIBONE B68,8000lbs lft,4x4x4............................................. $19,900 1999 TRAVERSE 6035,6000lbs,37” lift,4x4x4 .................................... $27,900 1998 SNORKEL TBA60RFO,4x4,500lbs .............................................. $19,900 1995 SELLICK 1140,8000lbs lift ......................................................... $19,900 1991 LULL MK10,10,000lift,cab ......................................................... $39,900 1990 GRADALL 534B8,4x4,8000lbs,cab,102hp.................................. $26,900 CAT VC60D,forklift,cab,in&outdoor,6000lbs ......................................... $9,900 CLARK C500Y55,forklift,cab,in&outdoor,5500lbs ............................... $11,900 Cat T50B forklift,indoor,48hp,5000lbs lift ............................................. $5,900

SKID STEERS

2008 CAT 232B,49hp,100hrs,1750lbs lift,canopy ............................... $39,900 2006 BOBCAT 463,23hp,700lbs lift ..................................................... $12,900 2005 CAT 247B,cab,air,ht,tracks74hp,1950lbs lft ............................... $33,900 2005 JD 317,61hp,1750lbs lift,cab ..................................................... $22,900 2005 THOMAS 85, 28hp ..................................................................... $13,900 2005 CAT 248B XPS,high flo,multi terrain,74hp,2000lb lft ................. $27,900 2004 Scat Trak 1700,80hp,1850lb lift ................................................. $19,900 2004 SCAT TRAK 1330C,46hp,w/bk hoe att........................................ $18,900 2004 CAT 216B,52hp,1400lbs lift ....................................................... $27,900 2003 JCB 1110 ROBOT,92 hp,2400lbs lift .......................................... $27,900 2003 MUSTANG 2095,cab,air,aux hyd,2800hrs .................................. $27,900 2003 CAT 247,tracks,canopy,1950lb lift,74hp ..................................... $24,900 2003 BOBCAT T250,3300hrs,3600lbs lift,track,81hp .......................... $23,900 2003 KOMATSU SK1020-5, 2000 lbs lft,hi flow .................................. $26,900 2003 CAT 277,1200hrs,tracks,80hp,2950lb lft.................................... $29,900 2002 CAT 252, cat dsl, 63hp, 2250lb lift ............................................. $24,900 2002 CAT 248, 80hp, 2000lbs lift........................................................ $24,900 2002 GEHL SL7800,110hp,cab,air,ht,3600lb lift ................................ $29,900 2000 BOBCAT 463,22.5hp kub dsl,700lbs lift ..................................... $13,900 1995 BOBCAT 953,canopy,74hp,2400lbs lift....................................... $17,900 1991 CASE 1840,51hp,2100hrs,1400lbs lift,canopy ........................... $17,900 YANMAR Y30W,38hp ............................................................................ $9,900

WHEEL LOADERS 2005 TEREX SKL834,60hp,6600hrs,1.2yrd cap.................................. $39,000 2003 HYUNDIA HL740-3,130hp,3yrd bkt,5.9 cummins ...................... $49,900 2001 KAWASKI 60Z lV, 105 hp,4800 hrs,2.1 yrd bkt .......................... $47,900 2001 CAT IT28,9900hr,105hp,2yd cap ................................................ $59,000 2000 NH LW190,4.5 yrd bkt,190hp,5100hrs....................................... $59,900 1999 HYUNDAI HL730-3,106hp,2.4 yrd cap ....................................... $39,900 1995 KAWASKI 95Z lV,315 hp,N14 cummins ..................................... $59,900 1998 SCATTRAK 3200, 4WD, 75 yrd bkt, JD ...................................... $19,900 1998 DAEWOO MEGA 200,136 hp ...................................................... $44,900 1997 SAMSUNG SL120-2,5.9 cummins,126hp,2.5yrd bkt ................. $39,900 1994 CASE 721B,140hp,3.25yd bkt .................................................... $49,900 1993FIATALLIS FR 180,190hp,8.3 cummins ...................................... $49,000 1991 JD 744E,230hp,5yrd .................................................................. $47,900 1987 DRESSER 510B,80hp,1.75 yrd bkt............................................. $23,900 1985 TROJAN 1500Z,93hp dzt dsl,1.75yrd cap .................................. $22,900 1985 CASE W11,69hp,.75 yrd bkt....................................................... $25,900 1974 JD 644B,145hp,3 yrd bkt, .......................................................... $27,900

DOZERS 2004 CASE 1850K LGP,3100hrs,4way,185hp 8.3 cummins ............... $89,900 1997 CAT D5M LGP,6way,cab,6900hrs,110hp, .................................. .$79,900

BACKHOES 2007 TEREX 760B,4x4,86hp,120HRS ................................................. $79,000 2007 TEREX 860B,94hp,4x4,14’8’’dd ................................................. $79,900 2004 NH LB110,4x4,exthoe,2600hrs,108hp ....................................... $49,900 2000 JCB 214 lll,4x4,120hrs,76hp ...................................................... $49,900 1998 CASE 580SL ll,4x4,90hp,14’5’’dd............................................... $39,900 1997 FORD 555e,2WD,thumb,4200hrs............................................... $27,900 1991 CASE 580Sk,78hp,14’5’’ d.d.,4x4............................................... $28,900 1990 CAT 416,4x4,exthoe,62hp,8400hrs ............................................ $29,900 1986 JD 710B,100hp,4x4,18’ dd,5200hrs .......................................... $35,900 1974 JD 310,58hp,.75 yrd bkt,14’7’’ dd .............................................. $11,900 1972 IHC I2514 ldr bkt........................................................................ $12,900

EXCAVATORS 2006 MUSTANG G50ZRD,min ex,1000hrs,cab,thumb ........................ $49,900 2002 Daewoo Solar 220LC 111,135hp,crwl tracks ............................. $55,900 1999,YANMAR YB201U,mini hoe,30hp,10’DD .................................... $15,900 1998 YANMAR YB10,mini hoe,28hp,10’DD ........................................ $15,900 1996 KOMATSU PC28UU-2,mini hoe,30hp,12’ DD ............................. $15,900 1994 KOMATSU PC28UU-2,mini excavator ........................................ $18,900 1991 HITACHI EX200LC-LC LC5,156hp,1.83yrd cap bkt .................... $34,900 1988 BADGER 444 .............................................................................. $19,900 1984 GRADALL G880C,tracks............................................................. $17,900 YANMAR YB1200SS,mini exc ............................................................. $19,900

TRUCKS 2009 DODGE 2500,4x4,gas,auto,75kms ............................................. $19,900 2007 CHEV,4x4,crew,dsl,auto,new body ............................................. $21,900 2006 DODGE 2500HD,mega,4x4,dsl ................................................... $23,900 2006 DODGE 2500HD,4x4,ext cab,dsl,6spd ....................................... $17,900 1983 KW s/a,picker truck,cummins,auto .............................................. $9,900 1982 S 10 Chevy,custom auto .............................................................. $5,900 FORD F600,roll back deck,dsl,std trans ................................................ $7,900

MISC

2008 BRENT 1080,grain cart,tarp,900’s,scale ..................................... $39,900 2008 KAW 3010 mule, 600hrs,windshield ............................................ $6,900 2005 STONE RHINO,RBD54,vib padft comp ....................................... $19,900 2002 JD 210LE skip ldr,box blade,73hp,4x4 ....................................... $19,900 2000 DITCH WITCH JT920,direc drill.................................................. $19,900 SICARD BMG4 Q/C 102’’ whl ldr snow blr,dt dsl eng ............................ $7,900 A86-4B-3.9-sp,whl ldr sno blr,cummins dsl........................................ $11,900 Ingersoll-Rand, 6KW light tower, Kubota dsl ........................................ $3,900 Ditch Witch 6510, dsl, 8 trench bar, crumb shoe .................................. $9,900 Matatdor 7900,6ft swath invertor.......................................................... $6,900 Bomag DW 172,smooth drum ............................................................ $19,900 CASE F21 disc,light duty,20’ ................................................................. $4,900

All Prices Listed As Canadian Dollars

Visit Us At: www.kmksales.com


PAGE 4

Saskatchewan FarmLIFE, Monday, March 19, 2012

SEXSMITH USED FARM PARTS LTD. YOUR ONE STOP FOR NEW, USED & REBUILT AG PARTS

www.usedfarmparts.com Email: farmpart@telusplanet.net

Phone: (780) 568-4100 Fax: (780) 568-2000 310D JD BACKHOE

NEW & USED FRONT END PARTS

G N I L T N MA DISExtend-A-Hoe • Clam Bucket • (FWA) • Turbo Diesel Engine

DISMANTLING A VARIETY OF INDUSTRIAL EQUIPMENT Loaders • Crawlers Forklifts • Graders Skidsteers • Backhoes

NEW ARRIVALS

555 Versatile 7580 Allis 8550 Allis 220 Allis

DX160 Deutz 9600 JD R60 Gleaner R70 Gleaner

WINTER HOURS: MONDAY - FRIDAY 8 A.M. - 5 P.M.; SATURDAY & SUNDAY - CLOSED

• WE BUY FARM EQUIPMENT FOR DISMANTLING • SPECIALIZING IN LATER MODEL MFWD TRACTORS • WE ALSO OFFER FREIGHT DISCOUNTS

MAPLE FARM EQUIPMENT Yorkton, SK 306.783.9459

Preeceville, SK 306.547.2007

COMBINES 3-JD 9870 STS (11) 202-209 hrs .......................... $358,000 3-JD9870 STS (10) small grain combine.........ea. $375,000 JD 9870 STS (10) 378 hrs..................................... $318,100 JD 9870 STS (10) 181 sep. hrs., 615 hdr .............. $347,100 JD 9870 STS (10) 184 hrs., 615 hdr ..................... $349,300 3-JD 9870 STS (10) 196 sep. hrs, 615 P/U ........... $329,900 JD 9870 STS (10) 304 sep. hrs., 615 hdr .............. $347,300 JD 9870 STS (10) 321 sep. hrs., 615 hdr .............. $339,700 JD 9870 STS (10) 350 hrs., 615P hdr ................... $368,800 JD 9870 STS (10) 350 hrs., 615P hdr ................... $375,100 JD 9870 STS (10) 350 hrs., 26 ft auger, 615 hdr .. $368,800 JD 9870 STS (10) 508 hrs..................................... $328,600 JD 9870 STS (09) 193 hrs., 615 hdr ..................... $305,000 JD 9870 STS (09) 358 hrs..................................... $309,900 JD 9870 STS (09) 658 sep. hrs., 615 hdr .............. $315,700 JD 9870 STS (09) 583 hrs..................................... $309,100 JD 9870 STS (08) 440 hrs., high cap fdg. pkg...... $289,800 JD 9870 STS (08) 793 hrs, 615 hdr ..................... $269,500 JD 9870 STS (08) 952 hrs.................................... $304,800 JD 9870 STS (08) 957 hrs.................................... $306,600 JD 9860 STS (06) 992 hrs, 300 bu........................ $236,600 3-JD 9770 STS (11) 615 hdr., 163-199 hrs ........... $335,200 JD 9770 STS (11) 176 hrs., duals ......................... $340,900 JD 9770 STS (11) 274 sep. hrs.,615 P/U .............. $329,500 JD 9770 STS (11) 296 sep. hrs.,615 P/U .............. $329,500 JD 9770 STS (10) 173 hrs..................................... $305,000 3-JD 9770 STS (10) 305 hrs., prem cab................ $304,000 JD 9770 STS (10) 418 hrs, 615P, pickup platform $317,200 JD 9770 STS (10) 300 sep. hrs., 615 P/U ............. $304,600 JD 9770 STS (10) 300 sep. hrs., 615 P/U ............. $297,800 JD 9770 STS (10) 400 hrs..................................... $304,700 JD 9770 STS (09) 543 sep. hrs, 615 hdr ............... $275,000 JD 9770 STS (09) 596 sep. hrs, 615 hdr ............... $279,900 JD 9770 STS (08) 454 hrs, 470 pw7 hdr .............. $264,616 JD 9770 STS (08) Premier cab, 615 hdr ............... $263,300 JD 9770 STS (08) 654 sep. hrs, Prem. cab ........... $256,600 JD 9770 STS (08) 687 hrs, 615 pickup ................. $269,000 JD 9860 STS (06) 1410 hrs................................... $236,600 JD 9760 STS (07) 1347 hrs................................... $199,800 JD 7960 STS (04) 1050 sep. hrs, 614 hdr ............. $187,600 JD 9760 STS (04) 1500 hrs................................... $181,900 JD 9760 STS (04) 1743 sep. hrs, 22.5” auger ....... $174,900

Balcarres, SK 306.334.2492

Wynyard, SK 306.554.2536

JD 9750 STS (03) hydro, dlx hdr control ............. $143,800 JD 9750 STS (03) 2099 hrs, air seat, chaff spreader$145,800 JD 9750 STS (01) 1515 hrs................................... $147,700 JD 9750 STS (01) 1611 hrs ................................... $150,000 JD 9750 STS (00) 2295 hrs................................... $124,000 2- JD 9660 STS (04) 1672 hrs, 305 Hp, 914 hdrea. $165,000 JD 9660 STS (04) 2153 hrs................................... $159,100 JD 9650 STS (03) 1516 hrs................................... $142,700 JD 9650 STS (02) 2186 hrs, 914 pickup, 20” auger$112,100 JD 9650 W (00) 2930 sep. hrs............................... $103,950 JD 9610 (99) 2880 hrs, 20” onloading auger .......... $81,900 JD 9610 (98) 2647 sep. hrs, 20” auger.................... $90,400 JD 9600 (97) 2960 hrs, 914 hdr .............................. $79,700 JD 9600 (97) 2339 sep. hrs, triple mint, dual range $79,500 JD 9600 (97) 2988 hrs, 20’ auger, 914 p.u. ..................... $75,000 JD 9600 (96) 2842 hrs, 260 hp, new rad, JD chaff spreader........ $61,500 JD 9600 (95) 2700 hrs....................................................... $73,900 JD 9600 (93) 3565 hrs, 914 hdr ....................................... $44,900 JD 9500 (92) 20’ auger, 914 p.u. ...................................... $43,400 JD 7720 (80) ...................................................................... $17,000 JD 7720 (80) 3450 hrs........................................................$11,300 NH CR9070 (08) 426 sep. hrs, 76c header, GPS......... $263,900 Case 2388 (99) 1800 sep. hrs ......................................... $101,100 Case IH 1688 (93) 3917 hrs, 210 bu, grain tank cap ...... $40,100

SWATHERS JD A400 (11) turbo diesel ..................................... $138,900 JD A400 (10) turbo diesel ..................................... $138,900 JD A400 (10) 142 hrs, 36’, HB hdr....................... $130,000 JD A400 (10) 200 hrs, WS30 hdr.......................... $130,000 JD A400 (10) 350 hrs, 36’ HD hdr ........................ $126,500 JD 4895 (09) 234 hrs, lg bar tines, draper ready ..... $95,000 JD 4895 (09) 36’, 1522 hrs ................................... $106,700 JD 4895 (09) 1288 ................................................ $102,500 JD 4895 (09) 583 hrs, hyd. drive .......................... $106,700 JD 4895 (08) 798 hrs, 36’ Hy hdr ........................... $97,500 JD 4895 (07) 36’ HB hdr, 664 sep .......................... $94,900 2- JD 4895 (07) 538 sep. hrs, 30’, HD, large rear caster ..... $94,900 Macdon 9352I (04) 1744 hrs, hyd drive ................. $79,900 Macdon 9350 (01) 1752 hrs, 30’ hdr....................... $67,100 Macdon 9350 (01) 30’, 972 drpr, 1390 sep. hrs ...... $64,800

Foam Lake, SK 306.272.3345

Moosomin, SK 306.435.3301

Macdon 2950 (00) 1690 hrs, 30’ draper hdr ........... $63,900 Macdon 9250 (02) 1460 hrs, 9.5 rear tires .............. $66,000 Macdon 9200 (99) 1519 hrs, 30’............................. $49,900 Macdon 9200 (98) 30’ draper hdr, 1636 hrs ........... $45,000 Macdon 9200 (98) 180 hrs, 30’ draper hdr ............. $46,000 Macdon 9200 (97) ................................................... $44,900 Macdon 9000 (93) 2877 hrs, 30’............................. $38,500 Macdon 7000 (92) 2282 hrs, 30’ draper hdr ........... $25,000 Macdon 4920 (99) 936 hrs ...................................... $43,000 Macdon 2952 (04) 1801 hrs .................................... $80,850 Macdon 2952 (03) 1391 hrs, 962 hdr...................... $74,900 Macdon 2940 (06) 510 hrs, 30’, 972 hdr ................ $82,200 Macdon 2940 (05) 30’............................................. $71,900 Macdon 2940 (03) 1600 hrs, empire wheels ........... $56,500 Macdon 2930 (96) 30’, 2 sp., 960 double canvas ... $47,000 Macdon 2900 (95) 30’, 1865 hrs............................. $55,900 Macdon 2900 (95) 3100 hrs, 25’ draper hdr ........... $38,500 Macdon 2900 (94) 2093 hrs, 960 hdr...................... $53,400 Macdon M150 (10) 299 hrs, 35’ draper hdr .......... $131,200 2-Macdon M150 (10) hdr, tilt, 358 hrs ................. $131,300 Macdon M150 (11) D60 hdr, swathroller ............. $149,000 NH 8040 (10) 108 hrs, turbo drive, 36’ hdr, dlx cab$128,900 NH 4920 (99) 25’ draper hdr, 2813 hrs ................... $43,900 Case 8860 (00) 1763 hrs, 30’ shift draper ............... $45,500 Case IH 8825 (97) 1735 hrs .................................... $31,000 Case 8230 (92) 30’ .................................................... $9,500 Case IH 8820 (94) 2485 hrs, 5’ shiftable draper hdr$22,700 Agco Hesston 8450 (02) 30’, drpr, hdr, 1324 hrs ... $55,500 MF 220XL (01) 1380 hrs, pickup reel, 30’ drpr hdr $48,000 Macdon Premier 9000 (94) 30’, 2776 hrs ............... $43,200 Westward 9200 (97) 1722 hrs ................................. $44,900

HEADERS JD 935D (09) Header Draper .................................. $56,800 JD 930R (01) ........................................................... $16,900 JD 930 (95) 30’, pickup reels .................................. $12,500 JD 930 (99) ............................................................. $15,200 JD 930R (01) 30’, full Ànger auger ......................... $19,300 JD 930R (97) 30’, stubble lights, skid plates ............ $9,700 JD 930R (96) pickup reel, Elmer Trailer ................ $13,700 JD 930F (96) 30’ transport ...................................... $12,500 JD 930F (96) ........................................................... $21,000 JD 914 (96) ............................................................... $8,500

VISIT WWW.MAPLEFARM.COM

Russell, MB 204.773.2149

2-JD 640D (10) w/transp. ..................................ea. $73,300 3-JD 635D (09) ..................................................ea. $62,500 JD 635D (10) 35’ Draper ........................................ $62,500 JD 635 (10) ............................................................. $66,400 JD 635 (10) ............................................................. $66,400 JD 635F (07) ........................................................... $37,500 Macdon A40 (12) 18’, skid shoes, forming sheild .. $42,550 Macdon 974 Flex (04) 30’ drpr., NH adapter.......... $49,000 Macdon 972 (03) PU reel, transport pkg. .............. $29,500 Macdon 922 (02) 16’, pickup reel, new knife ......... $21,000 Macdon D60 (08) 35’.............................................. $62,500 Macdon D50 (09) 35’, 600 acres ............................ $54,000 Macdon D50............................................................ $33,500 Honeybee SP30 (96) ............................................... $22,500 Case 2152 (09) 40’ .................................................. $55,000 Swathmaster 13 (03) ............................................... $13,885

ROUND BALERS JD 568 (10) megawide plus, pickup, high moisture $41,900 JD 568 (09) 7000 bales ........................................... $37,500 JD 568 (09) 10,772 bales ........................................ $33,700 JD 568 (08) 8197 bales, megawide plus ................. $39,700 JD 568 (07) 13,000 bales, megawide ...................... $35,200 JD 568 (07) 11,000 bales ........................................ $34,700 JD 567 (06) 14,000 bales ........................................ $24,600 JD 567 (06) Twine surface wrap, 9000 bales .......... $28,600 JD 567 (05) 12,000 bales, megawide ...................... $25,100 JD 567 (05) 9643 bales ........................................... $25,000 JD 567 (03) bale push bar, megawide, 10,500 bales$23,900 JD 567 (03) 7600 bales, 62” bales, megatooth p.u . $22,400 JD 567 (01) 24,426 bales ........................................ $18,100 JD 567 (01) 20,314 bales, 62” bale push bar .......... $16,500 JD 567 (98) 10,000 bales ........................................ $24,100 JD 557 (05) 540 PTO slip clutch, 12,511 bales ...... $16,900 NH 688 (01) ............................................................ $12,200 NH 660 (95) .............................................................. $7,500 NH BR780 (04) 7000 bales..................................... $20,400 NH BR780A (07) 5000 bales, bale counter ............ $17,000 Vermeer 605K (94) 10,000 bales, auto tie twine ...... $7,400


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 5

RED HOT EQUIPMENT DEALS COMBINES

SEEDERS

TRACTORS

2009 CIH 9120 (SA) 900 tires, lateral tilt, 2016 pu.....$329,900 2010 CIH 8120 (SA) 900 tires, lateral tilt, 2016 pu.....$319,900 2008 CIH 8010 (LL) 900 tires, lateral tilt, 2016 pu.....$299,000 2009 CIH 7120 (SC) 565Rhrs, AFX rotor, duals, lateral tilt, chop.....$279,000 2008 JD 9770 (LL) 520 Duals, Hi Unload, Y&M, Chopper, Xenon Lights............................................................$260,000 2008 JD 9870 (SA) Duals, Bullet Rotor 915 pu Header.....$260,000 2008 CIH 7010 (SC) 400Rhrs,AFX rotor, duals, chopper.....$249,000 2010 CIH 7088 (SC) ,AFX rotor, chopper,y&m, lateral tilt.....$249,000 2008 CIH 7010 (SC) 1000Rhrs, AFX rotor, duals, lateral tilt, GPS.....$244,900 2008 CIH 8010 (SC) lateral tilt, duals, std cut chop.....$239,500 2005 JD 9760STS (ES) 920Rhrs, pu header, topper, macdon 973......$235,000 2009 CIH 6088 (ES) 500Rhrs, AFX rotor, chop, 2016pu.......$229,900 2008 CIH 7010 (SC) 900 tires, lateral tilt, 1080 rotor.....$229,000 2008 CIH 2588 (LL) AFX rotor, chopper, 2015 pu header.....$219,900 2007 CIH 7010 (SC) 840hrs, AFX rotor, chop, lat. tilt, GPS...$210,000 2007 CIH 7010 (SC)1000Rhrs, AFX rotor, chop, lat tilt, duals.....$208,000 2009 CIH 7120 (SC) 900 Tires, Lateral Tilt, Ext Wear Rotor......$199,900 2005 JD 9760 (LL) 520 Duals, Long Auger, 2033 Engine, 1435 Rotor................................................................$191,000 2005 CIH 8010 (SC) Fine Chopper, Auto Header, Lateral Tilt.....$184,900 2006 CIH 2388 (SC) 1416 eng hrs, AFX rotor, 1015 pu header.....$169,000 2005 CIH 2388 (SC) 1316hrs, AFX rotor, 1015 pu header........$165,000 2004 JD 9660STS (SC) All New Sieves, Feeds Chains, Elevators, Flighting...........................................................$139,900 1999 CIH 2388 (SC) spec 1985 rotor, chop, 2530 eng, long auger...$105,000 1997 CIH 2188 (SA) Dutch Spreader, Chopper, AFS, 1015 Swathmaster..............................................................$55,000 1992 CIH 1680 (LL) std rotor, kirby spreader, chop, macdon pu reel........................................................................$49,900 1994 CIH 1688 (SC) 1015 pu Header, 3800Hrs....$39,900 1990 CIH 1680 (ES) spec rotor, kirby spreader, chop, 1015 pu header...................................................................$35,000

2009 NH Drill (LL) 60ft, 10” spacing, 3 1/2” steel packers, 430 bushel TBT cart, 550lbs trips............................$172,900 2008 CIH ATX700 (SC) 70ft, 10” spacing, 4.5” steel packers, 3430 TBT cart...................................................$135,000

2WD Tractors 2007 CIH MX245 (SA) 1250hrs, PTO, 3PT Hitch rdy, MFD Loader.....................................................................$129,900 2006 CIH MX215 (SC) 1700hrs, 3PT Hitch, 4 hyds, duals, fenders, MFD..........................................................$119,900 2007 CIH MX245 (SA) 4600hrs, PTO, duals, MFD Loader, 4 hydraulics, weights.................................................$119,000

BALERS 2007 CIH (ES) RBX563......................................$33,000 2003 CIH (ES) RBX562............................................$19,000 2003 CIH (SC) RBX562, hard core.....................$18,500

SOLD

2001 NH 688 (LL) Round baler, auto wrap.....

SWATHERS 2009 CIH WD1203 (SC) Cab Suspension, Hyd F&A, Double Knife, Gauge Wheels................................................$115,000 2008 CIH WD1203 (SA) Cab Suspension, Cleat Tread, DHX Header Ready...........................................................$105,000 1997 CIH 8825 (SA) Modified Opening, Combine Tires, 80HP Eng............................................................................$39,000

2005 Flexicoil 5000 (SA) 57ft, 4”rubber wheels, 4350 TBH ....$129,000

SOLD

2007 NH SD440 (SC) 52ft, 10” spacing, 3.5” steel packers.. 2008 CIH ATX700 (SC) 60ft, 10” spacing, 5.9” rubber packers, ADX3430 TBH tank............................................$114,900 2005 NH SD440 (SC) 57ft, 12”spacing, 4.5”steel packers, SC430 tank..............................................................$109,500 2008 CIH SDX40 (SC) 40ft, 10” spacing, 3430 cart.......$99,500 2005 Bourgault 5725 Drill (SC) 63ft, 9.8” spacing, 2 1/4” steel packers, D/S 5440 tank, 4 tank metering...................$98,900 2000 Flexicoil 5000 Air Drill (SA) 57ft, 9” spacing, double shoot liquid, 2340 tank..........................$95,900 1999 Bourgault 5710 Drill (ES) 12” spacing, D/S, MRB’s, 3 1/2” steel packers, 4350 TBH cart..................$85,000 1999 Bourgault 5710 Drill (ES) 60ft, 12” spacing, steep press, 2001 5350 tank............................ $79,900

SOLD

2003 Flexicoil 5000 (SC) 51ft, 9” spacing, 3430 tank.. 2003 Bourgault 5720 (LL) 54ft, 9.8” spacing, D/S, MRB’s...$69,900 2001 Flexicoil 5000 Drill (SA) 39ft, 12” spacing, 5.5” rubber press, VR 2340 cart............................... $69,900 1996 Bourgault 5710 Drill (SC) 54ft, 9.8” spacing, D/S, 3 1/2” steel packers, 2000 5250 TBH tank.............. $67,900 2002 Bourgault 5710 Drill (SA) 40ft, 9.8” spacing, D/S, 3 1/2” steel packers, MRB’s, blockage..................... $49, 900 1999 Flexicoil 5000 Drill (SA) 51ft, 12” spacing, 550lbs trip, 3 1/2” steel packers, 2320 tank....................... $49,900 1997 Bourgault 8810 Air Seeder (SA) 40ft, 9.8” spacing, steel packers, S/S, 3225 Tank.....................$39,900 1997 Flexicoil 5000 (SC) 45ft, 7” spacing, steel packers, TBT 2320 Tank, liquid kit............................$29,900 1997 Flexicoil 5000 (SC) 57ft, 9” spacing, 3.5” steel packers, 2320 Tank............................................$29,000 1993 Bourgault 8800 Air Seeder (LL) 40ft, 8” spacing, S/S, K-Hart packers, 3195 Tank.........................$19,900

4WD Tractors 2010 JD 9630T (SC) 265 hrs, PTO, 36” tracks, xenon

SOLD

lighting................................................................

2011 CIH STX485 (SC) deluxe cab, triples, high capacity hyd pump..............................................$259,900 2006 CIH STX480 (SC) 3400hrs, 30” tracks, hi-flow hyd, PTO, hid lights..........................................$198,900 2007 CIH STX480 (SC) 1800hrs, 520 triples, powershift, 4hyds.....................................................$189,900 2004 CIH STX500 (SA) 4000hrs, 36” tracks, 5 hyds, HID lights, diff locks...............................................$189,000 2005 CIH STX450 (ES) 5800hrs, new 710 duals, leather cab, front weights............................................$172,900 1998 NH 9882 (SA) 4500Hrs, outback autosteer, 4 hyds, 710 duals................................................................................$89,900 1994 JD 8970 (SA) triples, autosteer rdy, 12 spd synchro..$89,000 1998 CIH 9350 (SA) 5200Hrs, S3 outback, new 520 rubber.....$75,000 1998 CIH 9390 (SA) 6300Hrs, triples, std trans, hi-flow pump, 4 hyd.........................................................................................$75,000 1991 CIH 9230 (SC) powershift, PTO.................................$47,000

SPRAYERS 2008 CIH 4420 (SC) 100ft boom, aim command, ag leader monitor...... $225,500 2008 CIH 4420 (SC) 1800hrs, 120ft boom, aim command, luxury cab.......$209,900 2007 CIH 3320 (SA) 1500hrs, 100ft boom, active suspension.......$207,300 2008 CIH 3320 (SC) 1300hrs, 100ft boom, aim command......$195,000 2007 CIH 3320 (SC) 1800hrs, 100ft boom, aim command......$184,900

SOLD

HEADERS 2009 CIH 2142 (ES) 30ft, ATX Adapter, AHHC.....................$55,000 2004 CIH 2062 (SC) 30ft, Cross Auger, Slow Speed transport..$38,000 2001 CIH 1042 (SC) 30ft, pu reel, trans, F&A..........$35,000 2005 JD 635 (SA) pu Reel, Flex.................................$29,000 1997 JD 930F (SA) pu Reel, Flex, Fore-aft................$14,000 1986 CIH 1010 (SC) 30ft, Air Reel, Trailer, Extra Batt Reel..$12,500 2001 CIH 2015 (SC) Rake Up Pick Up......................$12,000 1984 CIH 1020 (SC) 30ft, pu Reel, Trailtech Transport.....$11,900 1986 CIH 1015 (SC) Melroe Pickup............................$7,500

Saskatoon

SOLD

2004 NH TG210 (LL) 3 electric remotes, 18spd power-shift.. 1998 CIH 8930 (SC) MFD, 42” Duals, deluxe cab, PTO............$69,900

2005 JD 4720 (LL) 90ft,800gal, auto trac 2600.... 2006 CIH 4410 (LL) 1813hrs, 100ft boom, raven auto steer..........$183,900

SOLD

2007 JD 4720 (SA) 90ft boom, norac, autosteer, poly tank.........

2005 JD 4720 (SC) 2600hrs, 90ft boom, 800 gallon tank, autotrac......$164,900 2001 CIH 4260 (SC) 3200hrs, 100ft boom, 1200 gallon, aim command............................................................................. $109,900 2005 Spray Air SP2010 (SC) 103ft boom, 1000gal tank, boom height control, ez steer..........................................................................................$103,900

SOLD

1998 Wilmar 7400 (SC) 90ft, 750gal, autoboom, poly tank..............

Swift Current Lloydminster

(306) 934-3555 (306) 773-2951 800-667-9761 800-219-8867

Estevan

(306) 825-3434 (306) 634-4788 800-535-0520 866-659-5866


PAGE 6

Saskatchewan FarmLIFE, Monday, March 19, 2012

We stock Michel’s Tarps, Electric or Manual, Remote Tail Gate Openers & Hoist Controls. We install 90,000 lb air pintel hitches ‘06 International 9200

19’ box, 400hp, ISX cummins, 10spd, auto shift w/clutch $

59,500

‘95 Mack

‘06 IH 9200I

‘06 International 9200

20’ box, 400hp, ISX cummins, 10spd, auto shift w/clutch $

Sold

20’ box, pop hitch, 400hp, ISX cummins, 10spd, auto shift w/clutch $

60,500

‘04 Century Freightliner

‘06 IH 9200

61,500

‘01 Freightliner 80

10spd, auto shift, elect tarp hoist & tail gate opener, pop hitch, chrome wheel, discs, new recaps, 20’ box, 400 hp cummins, new ual exhaust Reg. $71,000

65,500

$

Just Arrived!

350 Mack, 10 spd

$

515 hp, detroit, 12 spd, ultra shift

$

42,000

‘04 Freightliner Classic

59,500

‘01 Freightliner FL80

3126 Cat engine, 240-270hp, 9spd, a/c, 14000 frts c/w new 20/21’ box & hoist Only 2 Available

$

‘97 Volvo

48,000

‘01 Mack

60 series detroit 370 hp, 10 spd, new 20’ box, power hoist

$ 435 Mercedes w/10 spd, autoshift, will have 20’ box

$

55,000

300 hp, Cummins, 9 spd trans, 16,000 fronts

39,000

13 spd, CX613, 350 Mack, c/w 20’ box

For more trucks visit

49,000

$

$

52,000

www.lbgraintrucks.com

L & B Friesen RR4 Brandon, MB | Leonard Friesen (204) 824-2172 | Larry Duchek Cell (204) 720-0876


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 7

INCREDIBLE SELECTION OF 4 WHEEL DRIVE TRACTORS!!

SOLD

2010 JD 9630

SOLD

2011 JD 9430

2700 Hrs, 78 Gal Pump, Triples.

$309,000

$219,000

1997 JD 9400

6925 Hrs.

$99,000

$79,000

$289,000

$189,000

1990 JD 8760 9032 Hrs Hrs, Duals Duals.

9772 Hrs, Duals, PTO.

$49,000

D L O S

1990 CASE 9150

8000 Hrs.

7511 Hrs.

$55,000

1991 VERSATILE 976 6086 Hrs.

$65,000

D L O S

1978 JD 8430 PTO. PTO

$25,000

SPRAYERS

GREAT SELECTION OF NEW SALFORD RTS

JD 4710 (01) .................................................................................................$122,000 WILMAR 6400 (97) 3110 hrs. .........................................................................$51,000 AG CHEM 874SS (07) 1840 hrs. ..................................................................$149,000 BRANDT SB4000 90’ .....................................................................................$28,500 FLEXI-COIL S-67 XL 100’ ..............................................................................$15,000 FLEXI-COIL S-62 100’ .....................................................................................$5,900 AG SHIELD 80’ ...............................................................................................$10,000 MELROE 115 ...................................................................................................$4,500 ROGATOR 874 SS (07) 2070 hrs. ............................................................... $149,000 ROGATOR 1074 (05) 2950 hrs. ................................................................... $145,000

BEAT THE PRICE

INCREASE! Special low pricing on 30’ and 41’ models

— MFWD —

1994 JD 8570

$55,000

$59,000

JD 8300 c/w Degelman 5700 dozer ..............................................................$73,500 JD 8300 ..........................................................................................................$65,000 JD 7930 (11) IVT/746 loader ........................................................................$169,000 JD 7830 (11) IVT ...........................................................................................$155,000 JD 7320 (03) IVT 741 loader ..........................................................................$89,000 JD 7810 (00) c/w loader .................................................................................$69,500 JD 6420 (06) c/w 640 loader .............................................................. SOLD JUST IN JD 6320 (05) 1850 hrs .....................................................................................$56,500 JD 4955 ..........................................................................................................$59,000 JD 4955 c/w Leon 1020 dozer ......................................................................$67,500 BUHLER 2145 c/w loader .............................................................................$65,000 NH 8770 c/w loader .......................................................................................$65,000 NH TM 150 MFWD/loader .............................................................................$49,500 — 2WD — JD 7800 c/w 725 loader ................................................................. ARRIVING SOON JD 7600 (95) c/w 725 loader ..........................................................................$45,000 JD 4250 (84) 3 pt., loader, 8400 hrs. .............................................................$39,000 JD 4440 (79) mint condition ..........................................................................$25,000 JD 4040 3 pt. ................................................................................................. $15,000 JD 4020 c/w 158 loader. ............................................................................... JUST IN JD 2120 (70) c/w 707 Leon loader ................................................................$12,500 JD 2120 low hours ...........................................................................................$9,800

$109,000

6245 Hrs.

478 Hrs Hrs, Loaded Loaded.

MFWD & 2WD TRACTORS

4685 Hrs, Duals.

$87,500

$299,000

JD 9630 (11) Triples, 78 gpm hyd. ...............................................................$339,000 JD 9630 (10) 868 hrs., triples ............................................................SOLD $309,000 JD 9630 (09) 78 gal pump, 800/38, .............................................................$289,000 JD 9620 (06) 2403 hrs, 800/38 duals, p/s, 78 gal hyd pump.......................$229,000 JD 9620 (05) Triples, 78 gpm, 2700 hrs. ...........................................SOLD $219,000 JD 9530T (11) PTO .......................................................................................$339,000 JD 9430 (11) P/S, PTO, 800x38, 78 gpm, 683 hrs. ..........................SOLD $289,000 JD 9430 (11) Powershift. ............................................................................ $268,000 JD 9420 (06) 24 spd., 710 duals ................................................................. $189,000 JD 9420 (04) 3529 hrs, p/s, diff lock, 48 gal hyd pump, 710/42 duals ...............................................................................................$189,000 JD 9400 (97) 24 spd., 750x42 Trelbergs ..................................................... $135,000 JD 9400 (97) Duals, 4685 hrs. ......................................................... SOLD $109,000 JD 9400 (97) Triples, 6376 hrs. ..................................................................... $99,000 JD 9330 (10) Powershift, PTO .....................................................................$249,000 JD 8870 (95) 6925 hrs., duals, 24 spd. ......................................................... $79,000 JD 8770 (93) 6245 hrs ......................................................................... SOLD $87,500 JD 8760 (90) Duals. ....................................................................................... $55,000 JD 8570 (94) Duals, PTO .............................................................................. $49,000 JD 8430 (78) PTO ............................................................................... SOLD $25,000 CASE STX 535 (10) Loaded, 478 hrs. .........................................................$299,000 CASE STX 425 532 hrs. ........................................................................ CONSIGNED CASE 9280 (93) 8000 hrs. ............................................................................. $59,000 CASE 9150 (90) 7511 hrs. ............................................................................. $55,000 VERS 976 (91) 6086 hrs. .....................................................................SOLD $65,000 VERS 1150 (82) 770 hrs, 208/42 triples, atom jet pump ...............................$69,000

SOLD

1997 JD 9400

3529 Hrs, P/S, Duals.

1993 JD 8770

1993 CASE 9280

4WD TRACTORS

2004 JD 9420

PTO, 683 Hrs, 78 gpm.

D L O S

1995 JD 8870

6376 Hrs, Triples.

2010 CASE STX535

SOLD

2005 JD 9620

868 Hrs Hrs, Triples Triples.

SALFORDS

SEEDING EQUIPMENT

SALFORD RTS 50’ (Demo) ......................................................................... $112,000 SALFORD RTS (2) 50’ ................................................................................... $99,000 SALFORD RTS 41’ ......................................................................................... $79,000 SALFORD RTS 41’ (Demo) ........................................................................... $89,000

BOURGAULT 3310 (10) 75’, c/w 6700 .............................................................. SOLD BOURGAULT 3310 (11) 65’, MRB c/w 6550 ....................................SOLD $355,000 BOURGAULT 3310 (09) 75’, MRB, c/w 6550L ............................................$325,000 BOURGAULT 3310 55’, MRB’s ....................................................................$199,000 BOURGAULT 3310 (08) 55’, NH3, MRB ......................................................$178,000 BOURGAULT 5710 (10) 75’, MRB ...............................................................$189,000 BOURGAULT 5810 (10) 62’, MRB ...............................................................$189,000 BOURGAULT 5710 64’, MRB, 12”, 5-1/2 packers c/w 6550 ......................$185,000 BOURGAULT 5710 64’, MRB, c/w 5440 .....................................................$115,000 BOURGAULT 5710 54’, MRB .............................................................. From $89,000 BOURGAULT 5710 (02) 52’, 12” space, MRB, dry sets w/ packers .. JUST IN/ CALL BOURGAULT 5710 (98) 40’, MRB .................................................................$48,000 BOURGAULT 8800 40’, c/w air pkg. (less tank) ................................SOLD $19,000 JD 1820’s 80’ ....................................................................................... From $39,000 FLEXI-COIL 5000 45’, c/w/ 2320 ........................................................SOLD $59,000

JOHN DEERE COMBINES JD 9870’S (11) 615 p/u, duals. Starting from $332,500 ONLY 9 LEFT JD 9870’s (11) 190 hrs. ................................................................................. JUST IN JD 9870 (10) ................................................................................................. JUST IN JD 9870 (08) ................................................................................................. JUST IN JD 9770’S (11) 615 p/u, duals, 12 to choose from...................... Starting from $312,500 JD 9770 (09) ................................................................................................. JUST IN JD 9770 (08) ................................................................................................. JUST IN JD 9860/914P (05) 800/32’s, 1044 hrs. ...................................................... $175,000 JD 9860/1500 PRECISION (04) 800/32’s, 1803 hrs. .................................. $149,000 JD 9660 (07) 615 p/u, 800/38 .......................................................... JUST IN - CALL JD 9750/914 (03) 800/32’s, 1897 hrs. ......................................................... $149,000 JD 9750/914 (02) 18.4x42 duals, 2076 hrs. ................................................ $142,000 JD 9650 CTS 2045 hrs. ............................................................................... $147,500 JD 9650W/914 (01) 800/32’s, 3308 hrs. ....................................................... $88,000 JD 9610 (08) 3040 hrs .....................................................................................$79,000 JD 9600/914 (96) Chaff sprd., 2955 hrs. ...................................................... $62,500 JD 9600/212 (96) 3877 hrs. ........................................................................... $54,500 JD 9600 (96) 1896 hrs .................................................................................... $82,500 JD 9600 (95) 2168 hrs., duals ....................................................................... $79,000 JD 9600/914 (95) Chaff spread., F.C. Sonnybrook, 3233 hrs. ...................... $63,500 JD 9600/914 (94) Chaff spread., F.C. Sonnybrook ..........................JUST IN - CALL JD 9600/914 (93) Chaff spread., 3714 hrs. .................................................. $49,000 JD 9600/914 (91) Chaff spread., rice tires, 2916 hrs. .................................. $59,000 JD 9600/914 (90) Chaff spread.,2439 hrs. ................................................... $59,000 JD 9650 CTS 2045 hrs. ............................................................................... $147,500 JD CTS/914 (97) 2423 hrs., big top. ............................................................. $55,000 JD CTS/914 (97) 2700 hrs., new front tires .................................................. $59,000

OTHER COMBINES CASE 2188’S ............................................................................. $59,000 TO $83,500 CASE 1680 (87) 3700 hrs. ............................................................................. $25,000 CASE IH 1660 (87) 3187 eng. hrs., pu header. ............................................. $19,500 NEW HOLLAND CX8080 (10) 4WD ............................................................ $245,000 NEW HOLLAND CX880 (05) 1178 hrs. ........................................................ JUST IN NEW HOLLAND CX860 (05) 1490 hrs. ........................................................ JUST IN NEW HOLLAND TX66 (94) 971 pu, 2300 sep. hrs. ...................................... $42,500

CULTIVATORS 61’ BOURGAULT 9400 (09) ............................................................................$94,500 57’ BOURGAULT 9400 (07) ............................................................................$82,500 63’ NEW HOLLAND ST 820 (09) ....................................................................$79,500 57’ NEW HOLLAND ST 820 (09) ....................................................................$59,000 48’ BOURGAULT 9400 ...................................................................................$39,000 52’ BOURGAULT 8800 ........................................................................SOLD $27,500 57’ FLEXI-COIL 820 ............................................................................SOLD $27,500 41’ FLEXI-COIL 820 .......................................................................................$27,000 40’ JD 410 c/w yetters vertical till colters ....................................................$29,500

MISC. KELO OFFSET DISC 14’ ..................................................................................$8,500 NEW LEADER 3032 Dry box, fits JD 4930 ....................................................$45,000 BATEO 2110 CONVEYOR (07) 115’, c/w 50 HP electric engine .................. $39,000 FLEXI-COIL SXS 95 80’ harrow packer ........................................................$16,500 BRANDT 70’ heavy harrow, demo, carbide tines .........................................$45,000 BOURGAULT 6000 MID HARROWS 90’ ............................................. From $36,500 BOURGAULT 7200 HEAVY HARROW 72’ .....................................................$32,500 DEGELMAN (09) 82’ Strawmaster, carbide tips ............................................$45,000 DEGELMAN 14’ DOZER (4WD) .......................................................................$9,500 DEEGELMAN 10’ DOZER (2WD) .....................................................................$3,500 DEGELMAN 7900 DOZER 18’, demo ............................................................... CALL LEON 4000 DOZER 14’ Fits 8870 .................................................................... CALL JD 260 FRONT END LOADER ........................................................................ $7,500 JD 725 FRONT END LOADER ........................................................................ $6,500 LEON 800 FRONT END LOADER (Like new) ................................................. $6,500 LEON 707 FRONT END LOADER ................................................................... $3,500 DEGELMAN 1214 V MAX RAKE Demo .........................................................$15,900 DEGELMAN LL3050 HAND LEVELLER Demo ................................................$9,500 VALMAR 3255 (11) Fits Bourg. Hid harrow ...................................................$11,500 TWIN 1000 NH3 TANKS c/w trailer ...............................................................$13,500 12’ KELO OFFSET DISK ............................................................................... JUST IN FARM KING 16 x 104 .....................................................................................$29,500

NYKOLAISHEN FARM EQUIP. LTD. KAMSACK, SK (306) 542-2814

www.nykolaishen.com

SWAN RIVER, MB (204) 734-3466 NEW

Toll Free 1-855-542-2814


PAGE 8

Saskatchewan FarmLIFE, Monday, March 19, 2012

UNRESERVED AUCTION FOR TOM & JEAN RYALL of RIVERS, MB

WEDNESDAY APRIL 4th 12:00 noon

DIRECTIONS: FROM RIVERS, MB. Jct of hwys #25 & #250 West on hwy #250 to Jct of #259 (At old air force base) Take hwy #259 west 10kms (to St. Mathews Cemetery) Turn south 1km to sale site on east side of road. FROM KENTON, MB. Jct of hwys #21 & #259 Take hwy #259 east 14.5kms (to St. Mathews Cemetery) Turn south 1km to sale site on east side of road. ORDER OF SALE:Ê This sale has little to no small items to sell, so please don’t be late Sale starts at 12 noon sharp.

TRACTORS: UÊ£™™ÇÊ ʙÎääÊ{7 ÊÎÈ䅫ÊÌÀ>V̜ÀÊ ÜÉÓä°n,{ÓÊ Õ>Ã]ʈɜÜÊ+Õ>`Ê/À>˜Ã°]Ê{Ê ,i“œÌiÊÞ`°]Ê,iÌÕÀ˜Êˆ˜i]ÊÎxn£…ÀÃÊŜ܈˜}]Ê Ãɘää£Î™™ UÊÓäääÊÕLœÌ>ʇ£ÓäÊ7 Ê£Ó䅫ÊÌÀ>V̜ÀÊ ÜÉәÈäÊ+ՈVŽˆiÊ-Êœ>`iÀ]Ê ÕVŽiÌ]ÊÀ>««i]Ê Î«Ì]Ê Õ>Ê*/"]Ê*ˆVŽÊ1«ÊˆÌV…]ÊÓÊ,i“œÌiÊÞ`]Ê £ÈÊ-«`Ê*œÜiÀÊ-…ˆvÌÊÜÉ-…ÕÌ̏i]Ê£n°{‡ÎnÊ-ˆ˜}iÃ]Ê ÓÇää…ÀÃÊŜ܈˜}]ÊÃɘxäx™£ COMBINES: UÊÓääÈÊ ʙÇÈäÊ-/-ÊëÊVœ“Lˆ˜iÊÎ{䅫ÊÜÉ ÕiÌÊ,œÌœÀ]ÊŜ܈˜}ÊǙxÊ̅Àiň˜}ʅÀÃ]Ê£äÈxÊ i˜}ʅÀÃ]ÊÈ£x*Ê«ˆVŽ‡Õ«Ê…i>`]ÊÃÌ`ʓœ˜ˆÌœÀÊ«>VŽ‡ >}i]ÊÃɘä™ÇÈä-Ç£ÈÓx{ UÊÓä£äÊÎä½Ê ÊÈÎä ÊÞ`À>ʏœ>ÌÊÃÌÀ>ˆ}…ÌÊVÕÌÊ …i>`iÀÊÜÉ«ˆVŽ‡Õ«ÊÀii] ÊÃɘ£ääÈÎä äÇÎxÈÈx Uʏi݇vˆ˜}iÀʈvÌiÀÃÊvœÀÊÎä½Êi>`iÀ UÊ£™™ÇÊ iÜÊœ>˜`Ê/8ÈÈÊÜÉ ˜}ˆ˜iÊœÕÀÃÊ Ón™È]Ê/…À>ň˜}ÊœÕÀÃÊÓ{äÈ]Ê£{vÌÊ-Ü>Ì…Ê >ÃÌiÀÊ*ˆVŽÕ«Êi>`iÀʘiÜÊ*ˆVŽÊÕ«Ê iÌÃ]Ê …>vvÊ -«Ài>`iÀ]ʏÊÕ«`>ÌiÃ]ÊÃɘnÓÓxäÇ£ SEED & TILLAGE EQUIPMENT: UÊ{x½Ê-ii`Ê>ÃÌiÀÊ>ˆÀÊ`ÀˆÊÜÉÊ-ii`Ê>ÃÌiÀÊ ÓnäÊ ÕÃÊ}À>ˆ˜ÊÌ>˜Ž]ÊÓnäÊ ÕÃÊviÀÌÊÌ>˜Ž]Ê£ä»Ê ë>Vˆ˜}]ÊÎÊÀœÜÊÅ>˜ŽÃ]Ê`LÊŜœÌ]Ê>`ÕÃÌ>LiÊ …Þ`ÊÌÀˆ«Ã]Ê`ˆÃŽÊ“>ÀŽiÀÃ]ÊÎÊÃiÌÃʜvʓiÌiÀˆ˜}Ê ÀœÃ]ÊÃɘ-xäÇÓ UÊÇä½Ê i}i“>˜ÊÇäääÊ-ÌÀ>ÜÊ>ÃÌiÀʅi>ÛÞÊ …>ÀÀœÜÃÊÜÉxÉn»Ê̈˜iÃ]ÊÃɘ{£ÇÇ AUGERS: UÊÓää™ÊÈä½ÊÝÊ£ä»Ê À>˜`ÌÊ*/"ÊÃ܈˜}ʅœ««iÀÊ >Õ}iÀÊÜÉÀiÛiÀÃiÀ]ÊÃɘ™ääә UÊÓää£ÊÈä½ÊÝÊ£ä»Ê À>˜`ÌÊ*/"ÊÃ܈˜}ʅœ««iÀÊ >Õ}iÀÊÜÉÀiÛiÀÃiÀ]ÊÃɘȣ{ÇÇ UÊx£½Ýn»Ê7iÃÌvˆi`Ê*/"Ê>Õ}iÀ

UÊÎx½ÊÝÊn»Ê->ŽÕ˜`ˆ>ŽÊÕ}iÀÊÜÉ-ivÊ*Àœ«iÊˆÌ]Ê Óä*ʈ˜>“>ÀÊi˜}ˆ˜i UÊ ˆ˜ÊՏÊ-i˜ÃœÀÊvœÀÊÕ}iÀ

UÊ£ää}>ÊΈ`ÊÌ>˜Ž UÊӻʜ˜`>ÊÜ>ÌiÀʫՓ« UÊλÊ}>ÃÊÜ>ÌiÀʫՓ«

SPRAYER: UÊ£™™™Ê Ê{Çääʈ}…Ê i>À>˜ViÊ-«À>ÞiÀÊ £n䅫ÊÜəä½Lœœ“Ã]ÊÌÀˆ«iʘœââiʅœ`iÀÃ]Ê Ã…œÜˆ˜}Ê£™än…ÀÃ]ÊÈÓäÉÇx,ÓÈÊ̈ÀiÃÊEÊÀˆ“ÃÊ «ÕÃÊ£Ó°{‡ÎnÊ̈ÀiÃÊEÊÀˆ“Ã]Ê Ê}Ո`>˜ViÊÃÞÃÌi“]Ê œÀ>VÊLœœ“Ê…iˆ}…ÌÊVœ˜ÌÀœÃ]ÊÀˆ˜ÃiÊÌ>˜Ž]ÊV…i“ˆ‡ V>Êˆ˜`ÕV̜À]ʅ>˜`ÊÜ>ÅÊÌ>˜Ž]Ê{ÊÃiÌÃʜvʘœââi]Ê Ãɘä{ÇääÈää{äÓÓ

ATV & YARD EQUIPMENT: UÊÓää{Ê>Ü>Ã>ŽˆÊ >ޜÕÊÓxäʵÕ>` UÊ 7Ê£ÓÊ6œÌÊ iVÌÀˆVÊ7ˆ˜V…ÊvœÀÊ/6 UÊÕLœÌ>Ê/£{Èäʏ>ܘÊÌÀ>V̜À UÊ>ܘÊÃÜii«

TRUCK: UÊ£™™{Ê6œÛœÊ/ÉÊ}À>ˆ˜ÊÌÀÕVŽÊÜÉÓä½Ê ³]ÊÀœÊ Ì>À«]Ê6œÛœÊÎÇä«Êi˜}ˆ˜i]Ê£äÊë`ÊÌÀ>˜Ã]Ê Ãɘ{6£ x,,nÎäÇÓx]Ê->v̈i`]Ê iÜÊLÀ>Žià TRAILERS: UʣȽÊÝÊn½Ê`Õ>Ê܅iiÊ-ÉÊ}À>ˆ˜ÊÜ>}œ˜Ê ÜɅœˆÃÌ UÊI ÊÌÀ>ˆiÀÊ>ݏiÊÜÉ`Õ>Ê܅iiÃ UÊ{½ÊÝÊn½Ê1̈ˆÌÞÊÜ>}œ˜ 3 PT EQUIPMENT: UÊ£ää»ÊœÜ>À`Ê-£ääÊΫÌÊÀœÌœÊ̈iÀ]Ê ÃɘÇÈäΣÎ{ UÊ >ÀÊ7œvÊΫÌÊ«œÌ>̜Ê`ˆ}}iÀ UÊ£ä½ÊΫÌÊÇ̈˜iÊVՏ̰ UÊ£ä½ÊΫÌÊÞ>À`ÊÃVÀ>«iÀ UÊÓää™ÊǽÊ7œœ`ÃÊ n{ä8ÊΫÌÊÀœÌ>ÀÞʓœÜiÀ]Ê Ãɘ££ÓÈääÇ OTHER FARM EQUIPMENT: UÊ ˆiÃiÊ*ÀœÊ«œÜiÀÊV…ˆ«Ê­V>“iʜÕÌʜvÊ ʙÈxäÊ Vœ“Lˆ˜i® UÊÊ >“ÊÃÞÃÌi“ÊÜɣʓœ˜ˆÌœÀ]Ê{ÊV>“iÀ>à UÊ/Àˆ“LiÊÕ̜Ê-ÌiiÀÊ1˜ˆÌ UÊ£Ó½Ê i}i“>˜Ê£Ó ÊvÀœ˜ÌʓœÕ˜ÌÊL>`iÊ ÜɓiV…>˜ˆV>Ê>˜}i]ÊÃɘ£ÇÈÎx UÊ-iÌʜvÊVÀœ«Ê`ˆÛˆ`iÀÃÊvœÀÊëÀ>ÞiÀ UÊ >iÊvœÀŽ

SHOP EQUIPMENT: Uʘ}iÀ܏‡,>˜`Ê`ÏÊ>ˆÀÊVœ“«ÀiÃÜÀ UÊiÌÊÓäääÊ«ÀiÃÃÕÀiÊÜ>ÅiÀÊÜÉx*Êœ˜`> UÊ/>˜>Ž>Ê- ÊÓÓ£Ê}i˜iÀ>̜À MISC: UÊ1Ãi`Ê̈Àià UÊ*/"ÊÅ>vÌà UʈÀÊÃii`iÀʅœÃi UÊ-iiV̈œ˜ÊœvÊv>À“ÊV…i“ˆV>Ã UÊ*œÕÌÀÞÊÜ>ÌiÀÃÊEÊvii`iÀà UÊÓx®Êi“«ÌÞÊ«>Ã̈VÊV…i“ˆV>Ê`ÀՓà UÊ1Ãi`Ê`ˆ“i˜Ãˆœ˜>ÊÕ“LiÀ UÊ1Ãi`Ê}À>`iÀÊL>`ià UÊ-ÌiiÊVÕ̇œvvà UÊ,>ˆÊ̈ià UÊ1Ãi`ÊÌÀi>Ìi`Êvi˜ViÊ«œÃÌÃÊ>««ÀœÝÊÓää UÊ««ÀœÝÊÈääÊi˜ViÊ*œÃÌÃ]ÊL՘`iÃʜvÊxä½Ã UÊ««ÀœÝÊ{äÊ,>ˆÜ>ÞÊ/ˆià UÊÈ»ÊÝÊÓ»Ê>˜`Ên»ÊÝÊÓ»Ê,œÕ}…Ê->Ü˜Ê œ>À`à UÊ1Ãi`Ê-Ìii UÊ1Ãi`Ê,œœvÊ-…iï˜}]Ê6>ÀˆœÕÃÊi˜}̅à UÊ1Ãi`Ê i`>ÀÊ-ˆ`ˆ˜} UÊ 7Ê£ÓÊ6œÌÊÕiÊ*Փ« UÊÎääÊ>ÊÕiÊ/>˜Ž

FOR MORE INFO CONTACT OWNER

/"ʜÀÊ  Ê,9Ê Óä{‡ÎÓn‡Çx{Èʅœ“i Óä{‡ÇÓ{‡{ÈΙÊVi

AUCTIONEERS NOTES:Ê/…iÊ,Þ>½ÃÊ܈ÅÊ̜ʜvviÀÊÌiÀ“Ãʜ˜Ê̅iÊ ÊVœ“Lˆ˜iÊEʅi>`iÀ°Êʘœ˜ÊÀiv՘`>LiÊ `i«œÃˆÌʜvÊÓx¯Ê`œÜ˜ÊÃ>iÊ`>ÞÊ܈̅ÊL>>˜ViÊ`Õiʜ˜ÊœÀÊLivœÀiÊÕ}ÕÃÌÊ£]ÊÓä£Ó°Ê1˜ˆÌÃÊÃÌ>Þʈ˜Ê«œÃÃiÃȜ˜ÊœvÊ,Þ>Ê>À“Ê Ì`°Ê՘̈Ê«>ޓi˜ÌʈÃʓ>`iʈ˜ÊvՏÊۈ>ÊL>˜ŽÊ`À>vÌʜÀÊViÀ̈vˆi`ÊV…iµÕiÊ̜Ê,Þ>Ê>À“ÊÌ`°ÊvÊvՏÊ«>ޓi˜ÌʘœÌÊÀiViˆÛi`ÊLÞÊ Õ}ÕÃÌÊ£ÃÌ]ÊÓä£ÓÊLÕÞiÀÊvœÀviˆÌÃÊ`œÜ˜Ê«>ޓi˜ÌÃ]Ê>˜`Ê,Þ>Ê>À“ÊÌ`ÊÀiÌ>ˆ˜ÃʜܘiÀň«°Ê/…ˆÃʈÃÊ>ÊÛiÀÞÊ}œœ`Êi>ÀÞÊëÀˆ˜}Ê Ã>iʜvÊÜiÊŽi«Ìʏ>Ìiʓœ`iÊv>À“ÊiµÕˆ«“i˜Ì°ÊœÃÌʜvÊ̅iÊiµÕˆ«“i˜ÌʈÃÊÅi``i`Ê>˜`ʈÃÊ>Êˆ˜ÊÛiÀÞÊ}œœ`ÊVœ˜`ˆÌˆœ˜°Ê>ÀŽÊ ̅ˆÃÊ`>ÌiÊ>˜`Ê«>˜Ê̜Ê>ÌÌi˜`Ê̅ˆÃÊÃ>i° Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 9

All Used Combines/Platforms Are Interest Free For 2 Years Offer Ends March 30, 2012

2008 JD 9870sts

592 sep hrs, 20.8R42duals, High Cap feed

$275,700 (M)

2009 JD 4730 200 hrs,100’,20”,deluxe cab $244,500 (MM)

2010 JD 9670sts 294sep hrs, 520/85R42 dual, no contour

$276,800 (M)

TRACTORS

PLATFORMS

(2) 09 JD 9630,1336 hrs up,diff lock, 800/70R38 pkg . . . . . . . . . . . . . . . . . . . . $315,000 up (M,MM) (2) 09 JD 9530,1355hrs up ,diff lock,800/70R38. . . . . . . . . . . . . . . . . . . . . . . . . . . .$298,750 up (MM) (2)10 JD 9430,900hrs up,diff lock,710/70R42, . . . . . . . . . . . . . . . . . . . . . . . . . . . .$282,000 up (M,RM) 09 JD 9430, 1649hrs, diff lock, 710/70R38, del comfort . . . . . . . . . . . . . . . . . . . . . . . . $283,785 (MM) 08 JD 9530T,deluxe cab,1000pto . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $304,900 (R) 98 JD 9400,3454hrs,diff lock,5hyds . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $149,900 (MJ) 09 JD 7830,1317hrs,800/70R38,MFWD,w/746 ldr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $165,800 (RM) 03 JD 7320, 4960hrs, MFWD, w/741Ldr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$76,500 (R) 04 JD 7320,3750hrs, MFWD, w/741 LDR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$83,300 (R) 11 JD 7230P,1034hrs, MFWD,520/85R38, w/740 Ldr. . . . . . . . . . . . . . . . . . . . . . . . . . . . .$136,900 (M) 06 CIH MX275, 1670hrs, 480/90R54,deluxe cab, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $140,000 (MM) 02 JD 7610, 6178hrs,16spd PQT,18.4-38,540/1000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $51,900 (R) 06 JD 7420,4760hrs,115hp,MFWD,18.4R38 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$78,900 (R) 01 JD 7410, 8650hrs,MFWD, w/740 Ldr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$59,900 (A) 98 JD 7410,10,000hrs, MFWD, 18.4R38, w/740 Ldr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $58,500 (S) 08 JD 6430 MFWD,4500hrs, 18.4R38,w/673 Ldr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$80,500 (R) 07 JD 6430,5325hrs,MFWD, w/JD 673 Ldr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$74,900 (R) 08 JD 6230 MFWD, 990hrs, MFWD,w/673 LDR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$58,000 (R) 03 NH TM155, 5600hrs,Frt Whl Dr, w/Buhler 2895 Ldr . . . . . . . . . . . . . . . . . . . . . . . . . . . $54,000 (RM) 92 JD 4960,4457hrs, MFWD, 3rear Scv’s,520/85R42 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $47,000(A) 92 JD 4255, 6763hrs,520/85R42,MFWD, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$50,600 (A) 79 JD 4640,7858hrs, 20.8x38,16F/6R . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $23,300 (MJ) 75 JD4230, 12155hrs, 2hyds,725 Ldr, new 18.4x34 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $18,600 (M)

(10) 11 JD 635F, Auger Composite fingers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $56,900 (MJ) 09 JD 630F, 1537hrs, aug comp fingers. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $39,500 (MJ) (4) 04 JD 635F, HH sensing, stub lights. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ..$27,200 up(A,MJ,R,RM) (5) 08 JD 635F, aug composite fingers, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $37,800 up (MM,MJ,R) (9) 09 JD 635F, air reel,good knife, long guards . . . . . . . . . . . . . . . . . . . . . . . . $43,300 up (MJ,MM,R) (4) 10 JD635F, AWS air reel. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $52,800 up (A,MJ) 06 MacDon 974-30’, 5 batt plas finger pu reel, skid shoes . . . . . . . . . . . . . . . . . . . . . . . . $49,500 (R) (2) 05 HoneyBee SP30, gauge whls, Hart cart pu reel, f/a . . . . . . . . . . . . . . . . . . . . . . . . . .$42,000 (R) 07 HoneyBee Sp30, CIH Adapt, UII PU . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $41,500 (MJ) 01 HoneyBee Sp36,new knife bar,rollers,bearing, UII split reel . . . . . . . . . . . . . . . . . . . ..$38,200 (M) (2) 02 HoneyBee Sp36,one 9600 hoookup,& 9610 . . . . . . . . . . . . . . . . . . . . . . . . . . . $34,700 up (M) 03 HonyBee Sp36,fits 60 series, dble knife dr,pea auger . . . . . . . . . . . . . . . . . . . . . . . . $42,800 (MM) 05 HoneyBee SP36, dble knife,UII split reel, upper cross . . . . . . . . . . . . . . . . . . . . . . . . . $49,400 (M) 06 HoneyBee Sp36, f/a, pea auger, 50 series hookup. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$51,900 (A) 07 HoneyBee WS36,f/a,trans,gauge whls,single knife . . . . . . . . . . . . . . . . . . . . . . . . . . $37,600 (MM) (4) 07 HoneyBee Sp36,transport,f/a . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $53,500 up (MJ,RM,S,W) 08 HoneyBee Sp36, UII 6 batt plast,end strut gauge whls. . . . . . . . . . . . . . . . . . . . . . . . $51,650 (MJ) (3) 09 HoneyBee Sp36, (1w/ single knife,2 dble). . . . . . . . . . . . . . . . . . . . . . . . . . . $51,000 up (M,RM) 07 HoneyBee Sp42,cross aug, Header Height ctrl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$51,900 (W) (2) 09 JD 630D,single knife,skid shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$51,800 (RM) 07 JD 635F, Hdr height sense,stub lights,aug comp fingers. . . . . . . . . . . . . . . . . . . . . . $34,700 (MJ) (3) 09 JD 635D, poly tine pu reel, skid shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . ..$62,400 up (MJ,RM) (4) 10 JD 635D,poly tine pu ree,road trans w/lites . . . . . . . . . . . . . . . . . . . . $65,600 up (MJ,MM,W) 11 JD 640 draper,dual dr, skid shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $80,300 (M) (3) 08 JD 936D, poly tine pu reel,road trans w/lites. . . . . . . . . . . . . . . . . . . . . . $43,900 up (MM,RM) 04 MacDon 963 36’ header,gauge whls, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $40,300 (MJ) (5) 05 MacDon 963, variety of options. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $42,000 up (M,RM,S) (2) 03 MacDon 972, 60 series hookup. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $37,100 up (S,W) (3) 05 MacDon 973,36’ pu reel, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $48,500 up (M,S,W) 08 MacDon D50, 30’, Ca20 adapt, pea auger f/a. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $55,400 (RM) 06 MacDon D60, f/a, 60 series adap, trans . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $58,800 (M) (3) 08 MacDon D60,35’, single knife dr, trans pkg . . . . . . . . . . . . . . . . . . . . . . $62,900 up (MM,R,W) (12) 09 MacDon FD 70, 35’ & 40’, slow spd trans. . . . . . . . . . . . . . . . . . . . . . . . . . . . $74,200 up (A,M) (3) 10 MacDon FD70, 40’, Dble knife . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$74,200 up (M,MM,R)

COMBINES 11 JD 9870sts,123hrs,520/85R42dual,hi-cap feed . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $359,000(R) (3) 10 JD 9870,392hrs up,duals,heavy duty final dr, . . . . . . . . . . . . . . . . . . . . . . . . $331,300 up (MJ) 09 JD 9870sts, 468hrs, 520/85R42dual,premier . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $311,800 (MM) (10) 08 JD 9870sts,419 hrs up,wide sprdr,. . . . . . . . . . . . . . . . . . . . . $274,900 up (M,MM,MJ.R,S,W) 07 JD 9860sts,670hrs, 800/70R38, w/615PU . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$271,100 (M) (2) 10 JD 9770sts,335hrs up,heavy duty final dr . . . . . . . . . . . . . . . . . . . . . . . . . . .$293,900 up (MJ,S) (15) 09 JD 9770sts,253hrs up,premier cabs,. . . . . . . . . . . . . . . . . . . . . .$266,500 up (A,MM,RM,S,W) (4) 08 JD9770sts,393 hrs up , premier cab . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $243,400 up (M,MJ,S) (2) 07 JD 9760sts,1150hrs up, prem cab, 800/70R38, . . . . . . . . . . . . . . . . . . . . . . $216,800 up (MJ) 06 JD 9760sts,1561hrs, 800R38,no contour. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $186,500 (MM) (5) 05 JD 9760sts,1301hrs up,spdr, 800/65R32 . . . . . . . . . . . . . . . . . . . . . . . .$166,600up (M,MJ,MM) (6) 04 JD 9760sts,1173hrs up,sprdr,chop . . . . . . . . . . . . . . . . . . . . . . . . . . . . $147,500 up (MJ,R,S,W) 03 JD 9750sts,1933hrs,900/60x32,chop,ch/s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $144,000 (R) (2)01 JD9750sts,2754hrs up, sprdr,chop, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $111,900 up (MM,S) (4) 11 JD 9670sts,244 hrs up,480/70R30 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $304,900 up (A,M) (3) 10 JD 9670sts,230hrs up, premier cab. . . . . . . . . . . . . . . . . . . . . . . . . . . . . $275,900 up (M,MJ,W) 07 JD9660sts,755hrs,deluxe cab, 800/65R32, sprdr,chop . . . . . . . . . . . . . . . . . . . . . . . . $212,000 (R) (2) 06 JD 9660sts,969hrs up, chop,ch/s,heavy duty . . . . . . . . . . . . . . . . . . . . . . $186,900 up (R,RM) 05 JD 9660sts,1411hrs,800/65R32,topper w/roll tarp. . . . . . . . . . . . . . . . . . . . . . . . . . . . $172,000 (S) (2)05 JD 9660w, 1869hrs up, 800/65R32, deluxe hdr ctrls . . . . . . . . . . . . . . . . . . . $126,500 up (M) 02 JD 9650sts,2207hrs,30.5R32&20.8R38duals. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $118,100 (RM) 03 JD 9650sts,2122hrs, 800/65R32,Maurer Big top. . . . . . . . . . . . . . . . . . . . . . . . . . . . $137,700 (MM) 98 JD 9610,3153hrs,20’ aug,30.5x32,dual range cyl . . . . . . . . . . . . . . . . . . . . . . . . . . . . $72,600 (MM) 97 JD 9600,1855hrs, 30.5x32, dual range cyl,ch/s.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $82,700 (MM) 95 JD 9600,2530hrs, 30.5x32,dial spd,ch/s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $59,300 (S) 04 CIH 8010,1350hrs,deluxe cab, w/ 04 CIH 2016-14’pu. . . . . . . . . . . . . . . . . . . . . . . . $190,500 (W) 08 CIH 7010, 700 hrs, 28L-26, duals ,w/Swathmaster PU. . . . . . . . . . . . . . . . . . . . . . . . $245,000 (W) 05 CIH 2388, 1145 hrs, w/CIH 2015-14’pu, specialty rotor . . . . . . . . . . . . . . . . . . . . . . $163,500 (W) 05 MF 9790,899hrs,w/MF4200 PU,w/Swathmaster 14’pu. . . . . . . . . . . . . . . . . . . . . . . . $151,900 (S) 05 Cat 570R, 1080hrs,500/85R24, w/Lexion P524- 14’. . . . . . . . . . . . . . . . . . . . . . . . . . $144,000 (MM) 00 CIH 2388,2068hrs,30.5x32,w/ CIH 810 13’ pu . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$109,900 (S) 99 JD CTSII, 2619hrs,dam,30.5x32,dialspd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$67,800 (A) (3) 97 JD CTS, 1810hrs up, dial spd, chopper . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $52,300 up (A,M) 98 & 99 CIH 2388,2304hrs up, w/1015 pu. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $91,000 (R,S) 96 JD CTS,2884hrs,dam,30.5x32,dual range cyl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $56,900 (S) 94 & 95 JD CTS combines, chop,30.5x32 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $54,500 up (M,S) 97 CIH 2188,2872hrs, 30.5L32,w/1015-12’ hdr. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $66,800 (MJ) 94 JD 9500,2210hrs, 30.5X32,2-’aug,dial spd,f/a, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$53,900 (R)

SPRAYERS (2)11 JD 4830, 329hrs up , 100’, 20”nozz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$293,900 up (A) 10 JD 4830,656hrs,100’, swath pro,380/90R46. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $294,200(A) 09 JD 4730 200hrs, 100’,20”, deluxe cab. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $244,500 (MM) (2) 09 JD 4830,1122hrs up,100’’ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $245,000 up (M,R) (2)06 JD 4920,1469hrs up, 1200gal,380/105R50 . . . . . . . . . . . . . . . . . . . . . . . . . . .$221,500 up (M,R) (2) 08 JD 4930,844hrs up, 120’,20”noz space, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$275,50.0up (R,W) (05 Apache 1010,1239hrs,Raven,90’,380/80R46 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $131,800 (A) 07 NH SF216, 134’ 1600 gal tank, Raven . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $40,700 (A)

HAYING EQUIPMENT 06 & 08 NH 1475 Moco, w/2316 16’ header,. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $24,900 up (A,MM) 08 JD 568,13,500bles,megawide,pushbar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $31,100 (MJ) 97 & 98 JD 566, 31x13.5, push bar, Hyd pu lift . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $11,700 up (M) 99 JD 566, push bars, hyd pu, gauge whls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$17,500 (R) 01 JD 567, hyd pu, push bars,sur wrap . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$23,000 (A) (4) 03 JD 567, push bars, hyd pu lift . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $18,000up (M,MM,S) (4) 05 JD 567,6000bles up, push bars,hyd pu . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $17,400up (A,M) 04 NH BR780, bale comm., net wrap, 1000 pto . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$18,700 (A) 09 Vermeer 605SM,4250bales,540pto . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $29,500(A) (5) 11 JD D450, 74hrs up, w/ JD 635 draper,HID lites . . . . . . . . . . . . . . . . . . . . . $167,000 up (R,RM) 10 JD A400,315hrs,hydro,w/896 19’aug hay . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$93,500 (R) 09 NH H8060,275hrs,w/36’ HoneyBee Hdr, UII PU . . . . . . . . . . . . . . . . . . . . . . . . . . . . $138,000 (MM) 96 HoneyBee SP25 windrower,dble swath,dble knife . . . . . . . . . . . . . . . . . . . . . . . . . . . . $20,200 (M) 09 HoneyBee WS30,UII 5 batt,dble swath,single knife. . . . . . . . . . . . . . . . . . . . . . . . . . . $41,500 (W) 07 HoneyBee WS30, 5 batt UII PU, dble swath, dble knife . . . . . . . . . . . . . . . . . . . . . . . $41,000 (MJ) 07 JD 4895 Wdr, 934hrs, w/07 HB WS30 & 05 JD 896-14’hay. . . . . . . . . . . . . . . . . . . . $98,000 (MM) (3) 03 JD 895,18’ wdr, hyd var reel spd, tall crop divid. . . . . . . . . . . . . . . . . . . . . . . . $17,100up (MM) 85 MacDon 7000 Wdr, 2600 hrs, w/30’draper,w/21’Hay plat.. . . . . . . . . . . . . . . . . . . . $22,500 (RM) 88 MacDon 7000 Wdr, w/960 -30’ hdr, Cummins diesel. . . . . . . . . . . . . . . . . . . . . . . . . $34,700 (MM) 01 MacDon 9352, 3635hrs, w/36’ 972 hdr, F K swath roller . . . . . . . . . . . . . . . . . . . . . . . .$76,500 (A) 04 MacDon 2952i,1558hrs, w/973-36’ Hdr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $75,400 (MJ) 02 MacDon 2950,1390hrs, w/972, 30’ hdr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $76,100 (MM) 00 MacDon 2950 w/972 25’ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $51,900(MM) 96 & 98 MF 220 Wdr, w/ MF 230-30’ Hdr. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $45,900 up (R)

SEEDING 10 NH P2070 70’, 10” w/430bu cart . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $248,400 (R) 08 JD 1890,43.5’,10”spac,SS air pkg. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $79,500 (MM) 08 JD 1830,61’, 10” spac, dble sht, 4x22”steel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $77,800 (M) 01 JD 1820,61’10”, w.JD 1900-340bu, Single sht. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $76,800 (M) 03 JD 1820,52’10”, DS air pkg,4x22” Steel whls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$41,800 (R) 04 JD 1820, 61’, 10” spac,w/JD 1910-340bu, dble sht . . . . . . . . . . . . . . . . . . . . . . . . . . . .$104,900 (M) 06 JD 1820,53’, 10” spac, 4x22” steel press whls,all run . . . . . . . . . . . . . . . . . . . . . . . . . . . . $65,500 (S) 00 JD 1820, 53’,12” w/1900- 270bu,6 run single . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $48,100 (MJ) 99 Flex 7500 70’,10”, w/3450 TBT, 84 openers. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$56,900 (R) 04 Conservapk 5112, 56’,12” spac,550lbtrip. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$103,900 (M)

2009 JD 9770sts 376hrs, premier cab,600/65R28 $281,100 (MM)

Assiniboia, SK (A) 306-642-3366 Montmartre (MM) 306-424-2212 Moose Jaw, SK (MJ) 306-692-2371 Mossbank, SK (M) 306-354-2411 Raymore, SK (RM) 306-746-2110 Emerald Park/ Regina, SK (R) 306-721-5050 Southey, SK (S) 306-726-2155 Weyburn, SK (W) 306-842-4686

Don’t forget to visit

www.southcountry.ca


PAGE 10

Saskatchewan FarmLIFE, Monday, March 19, 2012

LIVESTOCK EQUIPMENT DISPERSAL FOR BOLDUC FARMS DELORAINE, MB.

PLUS AREA CONSIGNORS WEDNESDAY APRIL 11th 11:00AM

DIRECTIONS: DIRECTIONS: (From Deloraine, MB. Jct #3 & #21 hwys) 2 miles west on #21hwy (to Correction Line Road) #21 curves south correction line continues west Turn right on Correction Line Road continue ½ mile west to sale site south side

LIVESTOCK HANDLING EQUIPMENT: UÊ,i>½ÃÊÜi`ˆ˜}ÊVÀœÜ`ˆ˜}ÊÌÕLÊÜÉÓÊÃiV̈œ˜Ê>`ÕÃÌ>LiÊ VÕÀÛi`Ê>iÞ Uʈ}…Êœ}ʓ>ÌiÀ˜ˆÌÞÊ«i˜ UÊ*i>ÀܘÊõÕiiâiÊV…ÕÌiÊÜɅi>`Ê}>ÌiÊEÊ«>«>̈œ˜Ê}>Ìi UÊ >vÊõÕiiâiÊV…ÕÌiÊEÊ̈«ÊÌ>Li UÊ­Ó®ÊÓ{½ÊvÀiiÊÃÌ>˜`ˆ˜}Ê>iÞ½ÃÊÜÉψ`iÊ`ˆÛˆ`iÊ}>Ìià UÊ£n½Ê«>˜iÊ܈̅ÊÓʅi>ÛÞʙ½Ê}>ÌiÃÊ UÊ­Ó®ÊÎä½ÊxÊL>ÀÊ«ˆ«i]ÊvÀiiÊÃÌ>˜`ˆ˜}Ê«>˜iÃÊ­£ÊÜÉÊ£Ó½ÊqÊ ÎÈäÊÃ܈˜}Ê}>Ìi® UÊ­£x®ÊÓ{½ÊvÀiiÊÃÌ>˜`ˆ˜}Ê«>˜iÃ]ÊÓÝÓÊÌÕLˆ˜} UÊ­£ä®Ê£Ó½ÊvÀiiÊÃÌ>˜`ˆ˜}Ê«>˜iÃ]ÊÓÝÓÊÌÕLˆ˜} UÊ­{ä®Ê£ä½]Ê£»ÊVœÀÀ>Ê«>˜iÃ UÊ­£Ó®Ê£Ó½]Ê£»ÊVœÀÀ>Ê«>˜iÃ UÊ­n®ÊÓ{½Ê܈˜`ÊLÀi>ŽÊÉÈÊL>ÀÊ«>˜iÃ LIVESTOCK FEEDING EQUIPMENT: UÊ,>˜V…iÀÃÊ7i`ˆ˜}ÊÎÊL>iÊvii`iÀ UÊ­{®Ê£»ÊÌÕLˆ˜}ÊÀœÕ˜`ÊL>iÊvii`iÀà UÊ+Õ>˜ÌˆÌÞʜvÊÌÀ>V̜ÀÊ̈ÀiÊvii`ÊÌÀœÕ}…à UÊ£ÓäLÕÃÊ«œÀÌ>LiÊVÀii«Êvii`iÀÊ UÊ£ä»ÊiiVÌÀˆVÊÀœiÀʓˆÊÜÉÊx…«Ê“œÌœÀÊ­>Ü>ÞÃÊÃ̜Ài`Ê ˆ˜Ãˆ`i® UÊÓxLÕÃÊvii`ÊLœÝÊÜÉiiVÊ՘œ>`Ê>Õ}iÀ UʣȽÝ{»Ê«i˜VˆÊ>Õ}iÀÊÜÉiiVÌÀˆVʓœÌœÀ FENCING EQUIPMENT & SUPPLIES: UÊ-…>ÛiÀÊΫÌÊ«œÃ̇«œÕ˜`iÀÊÜɓ>˜Õ>Ê̈ÌÊ UÊ+Õ>˜ÌˆÌÞʜvÊÀ>ˆÜ>ÞÊ̈ià UÊ+Õ>˜ÌˆÌÞʜvÊvi˜ViÊ«œÃÌÃ

OTHER EQUIPMENT: UÊÎä½Ê ÊÎÎxÊÌ>˜`i“Ê`ˆÃVÊÜÉӜœÌ…ÊL>`ià UÊ{ä½Ê i}i“>˜ÊVՏ̈Û>̜ÀÊÜÉÎÊÀœÜʅ>ÀÀœÜÃ]ʘiÜÊλʘœVŽÊ œ˜Ê뜜˜Ã UÊŏ>˜`ÊnÊÞ`°ÊÞ`°Ê-VÀ>«iÀ UÊ ÊÈä™ÊÌÀ>ˆÊÌÞ«iÊÀœÌ>ÀÞʓœÜiÀ UÊ ÊxäÎÊΫÌÊÀœÌ>ÀÞʓœÜiÀ UʣȽÊÌÉ>ÊV>Àʅ>ՏiÀÊÜÉLi>ÛiÀÊÌ>ˆ UÊiÌ>ÊVÕÌ̈˜}ÊL>˜`ÊÃ>Ü UÊ-…œ«Ê`ÀˆÊ«ÀiÃà MORE EQUIPMENT IS BEING CONSIGNED DAILY. PLEASE CHECK WEBSITE FOR UPDATED LISTING. CALL NOW TO ADD YOUR ITEMS TO THIS SALE. CONSIGNED EQUIPMENT: UÊ£™™nÊ œÀLiÀ̽ÃÊÌÀˆ«iÊ>ÝiÊÎÓ½ÝǤ½Êx̅Ê܅iiÊˆÛiÃ̜VŽÊ ÌÀ>ˆiÀÊÜÉnäääLÃÊ>ݏiÃ]ÊÎÊ`ˆÛˆ`iÊ}>ÌiÃ]ÊiÝÌÀ>ʅˆ}…]Êψ`iÊ Ãˆ`iÊÛi˜Ìˆ˜} UÊ£™™ÇÊ œÀLiÀ̽ÃÊÌÉ>ʣȽÝǽÊx̅Ê܅iiÊˆÛiÃ̜VŽÊÌÀ>ˆiÀ]Ê Ãˆ`ˆ˜}Ê`ˆÛˆ`iÊ}>Ìi]ÊÇäääLÃÊ>ݏiÃ]ÊÀÕLLiÀʓ>Ìà UÊÓääÓÊœ>`ˆ˜iÊ-Õ«iÀÊ Ê}À>ˆ˜ÊÌÀ>ˆiÀÃÊÜÉÀiVi˜ÌÊ«ˆ˜ÃÊEÊ LÕň˜}Ã]Ê-/

UÊ >ÃiÊnnÓäÊëÊ`ÏÊÃÜ>̅iÀÊÜÉÎä½Ê…i>`iÀ]Ê«ˆVŽ‡Õ«ÊÀii UÊ£È½Ê >ÃiÊVÀˆ“«iÀʅi>`iÀÊ­œvvÊnnÓä® UÊ,i>½ÃÊ7i`ˆ˜}ÊõÕiiâiÊV…ÕÌiÊÜɅi>`Ê}>Ìi UÊÓxäÊLÕÃÊVÀii«Êvii`iÀ UÊ>ÃÜÀÌi`Ê«>˜iÃ Uʏi˜}̅ÃʜvÊ`ÀˆÊÃÌi“Ê«ˆ«i

FOR MORE INFO ON THIS SALE OR TO ADD YOUR EQUIPMENT TO THIS LISTING PLEASE CONTACT LISTING AUCTIONEERS: BRENT CROWE 204-522-6224 OR PETER DOWNEY 204-522-5883 AUCTIONEERS NOTES:Ê/…iÊ œ`ÕV½Ãʅ>ÛiÊ`ˆÃ«iÀÃi`ʜvÊ̅iˆÀÊV>Ì̏iʅiÀ`Ê>˜`Ê>ÀiʜvviÀˆ˜}Ê̅iˆÀʏˆÛiÃ̜VŽÊ iµÕˆ«“i˜ÌÊvœÀÊÃ>i°Ê/…ˆÃʈÃÊÛiÀÞÊÜiÊŽi«ÌÊiµÕˆ«“i˜Ì°Ê/…iÀiÊ܈ÊLiÊܓiÊ}œœ`ʏˆÛiÃ̜VŽÊ>˜`Êv>À“Ê“>V…ˆ˜iÀÞÊVœ˜Ãˆ}˜‡ “i˜ÌÃÊ>``i`Ê̜Ê̅ˆÃÊÃ>iÊÜʫi>ÃiÊÜ>ÌV…ÊvœÀʘiÜÊ>``ˆÌˆœ˜Ã° Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 11

hergottcaseih.com 67 Years as an Independent Dealer 2WD TRACTORS

10 CIH WD 1903 36’ . . . . $128,000

10 CIH 215 MAGNUM . . . . $132,000 10 CIH 1203 , 36’ . . . . . . $117,900 MF 3505 MFD w/ FEL . . . . . $23,900 10 1203 36’ . . . . . . . . . . $111,500 CIH 7110 MFD . . . . . . . . . . $49,900 JD 4895 30’ shears . . . . . . $89,000 IH 5288 w/ loader . . . . . . . COMING JD 25’, sp, 1200 hrs . . . . . $42,900 4WD TRACTORS 06 H. Pro (MD) 8140 30’. . $69,900 CIH STEIGER 9240, psh, pto, engine

97 MD 9200 w/04 973 30’ $47,000

OH . . . . . . . . . . . . . . . . . $59,900 WW (MD) 9200 30’ . . . . . . . $4,350 CIH 8820 30’. . . . . . . . . . . $29,900 CIH 4490, PTO 3pth . . . . . . COMING CIH 736 36’, PT batt rl . . . . . $2,500 STEIGER BEARCAT III w/ Degelman CIH 730 PT . . . . . . . . . . . . . $3,500 Dozer, needs engine work $15,900 COMBINES & ATTACH SEEDING & TILLAGE 11 CIH 9120 . . . . . . . . . . $349,000 BG 2155 Tank . . . . . . . . . . . $6,600 09 CIH 9120 . . . . . . . . . . $279,000 BG 3165 . . . . . . . . . . . . . . . . .$8,700 06 8120 . . . . . . . . . . . . . $210,000 BG 5710 59’ MRB’s (S2), NH3 $95,000 3 BG 5710 40’, MRB’s, rubber, NH , 3225 06 CIH 8010 . . . . . . . . . . $199,000 06 8010 . . . . . . . . . . . . . $207,000

$79,900 3

BG 5710 40’, MRB, NH ,

04 8120 . . . . . . . . . . . . . $183,000

BG 3225 . . . . . . . . . . . . $83,900 03 CIH 2388AFX . . . . . . . $129,000 BG 5710 47’, MRB, DS + NH3 w/

02 CIH 2388AFX . . . . . . . $110,000

5300 . . . . . . . . . . . . . . . $99,000 99 CIH2388 . . . . . . . . . . . $99,000 00 BG 8810 60’ w/ 5440. . COMING (4) CIH 2188’s . . . . 95,96 + 2-97’s 40’ Air Kit w/ hitch . . . . . . . . . . CALL CIH 1666 w/ rake-up . . . . . $33,000 BG 8800 36’, liquid, . . . . . . $3,195 CIH 1680 . . . . . . . . . . . . . $17,500 FC 5000 39’, 500 #, d.s, IH 1480,large tires, krudld chaff & straw 2320 tank . . . . . . . . . . . $45,000 Leon 2500 Air Tank, 250 bushel, unused . . . . . . . . . . . . . . $15,000

hyd reverser . . . . . . . . . . . .$11,900 JD 9870 STS . . . . . . . . . . $269,000

The 17th annual Assiniboia Spring Fever Lotto is underway!

Over 80 PRIZES worth over $250,000.00 to give away! ONLY 5,400 TICKETS WILL BE SOLD! OUR TOLL-FREE LOTTO LINE IS 1-888-BUY-FARM (1-888-289-3276) GRAND PRIZE DRAW - MAY 12, 2012 Prize Winner will have a choice of receiving: Plane Pack

OR JD Ranch Pack

2005 Maule MX-7-180C, 4 place airplane, 180 hp, Lycoming engine, GPS, autopilot.

2012 JD 7230 ComfortGard Premium Cab tractor, 2012 JD 568 round baler, 2012 JD 741 loader with grapple and bucket.

Supplied by: Maule Air of Canada, Carman, Manitoba.

Supplied by: South Country Equipment Ltd. Assiniboia, Saskatchewan

Retail Value$165,000.00

OR Case IH Farm Pack

MECHANIC SPECIAL . . . . . . . $990 Cub 2160, 46” mower w/ bagger $990 JD 400 w/60” deck & snowblower. . . . . . . . . . . . $3,300 CUB CADET AGS2160 w/ tiller, mech. special . . . . . . . . . . . . . . . $1,400 BALERS & HAYING CIH 8480 soft core . . . . . . . . $4,900 CIH RBX 562 hard core . . . . $15,500 CIH RBX 562 1000 rpm . . . . . . CALL 3PT ATTACHMENTS FARM KING, 7’ Rotary mower. $1,950

KIRBY ATTACH (2388) . . . . . $12,00 HEADERS CIH 2052 3.5’ Draper (7010-9120) . . . . . . . . . $45,500 MACDON D60 w/ JD app . . $56,600 MACDON 973 35’ (7010-9120) . . . . . . . . . $39,900 2-MD 974 36’ w/CIH 10, 20 + 30 adaptor . . . . . . . . . . . .$49,900 ea 09 JD 635 35’. . . . . . . . . . $57,000 09 JD 635 35’. . . . . . . . . . $54,500 HONEYBEE Gleaner 36’ . . . . $20,900 CIH 1020 30’ flex. . . . . . . . $13,500 CIH 1020 30’ flex. . . . . . . . $11,900 CIH 1010 30’ w/ p.u. reel, . . $7,400 CIH 1010 30’ w/ p.u. reel, transport . . . . . . . . . . . . . . $8,500

SPRAYERS 09 CIH 4420 Full Load . . . $239,000 augers, tillers, disk, landscape WILLMAR 6400 . . . . . . . . . $39,000 rakes, box scrapers . . . . . . . . CALL SPRAYAIR 3600 suspended boom, SP & PTO SWATHERS 110’ . . . . . . . . . . . . . . . . $23,900 10 CIH WD 1203 36’ . . . . $118,000 MISCELLANEOUS 09 MD M150 35’ . . . . . . . $114,000 FC 82 60’ 5B Hrw . . . . . . . $22,000 10 CIH WD 1903 36’ . . . . $128,000 Harmon 746 Picker . . . . . . . $2,900 LAND PRIDE mowers, post hole

OR NH Ranch Pack 2011 T6050 PLUS Cab tractor, and 2011 New Holland L230 Skid Steer Loader.

Supplied by: Young’s Equipment Inc. Assiniboia, Saskatchewan

Supplied by: E. Bourassa & Sons Ltd. Assiniboia, Saskatchewan

Retail Value

Retail Value

$194,893.65

$183,744.37

OR Fantasy Pack

Leon 40’ Fixed Hitch Cult 9” space, air

LAWN & GARDEN STIGA FRONT DECK 48”, 16 Twin

$206,911.08

2012 Case IH Magnum 180 CVT tractor.

JD 9760 STS Bullet Rotor . $179,000

JD 9760 STS . . . . . . . . . . $169,000 kit, no hrws or pkrs, unused . $4,900 08 NH 9070 626 hrs . . . . $217,000

Retail Value

2012 45th Anniversary Edition Chevrolet Camaro Convertible Supplied by: Nelson GM, Assiniboia, Saskatchewan

2012 Arctic Cat Wildcat 1000 ROV Supplied by: E.Bourassa & Sons, Ltd,

3 Month World Cruise for 2 with Cunard Cruise Lines Supplied by: Assiniboia Travel,

Assiniboia, Saskatchewan

Total Value

$155,411.40!!

Assiniboia, Saskatchewan

OR $150,000.00 CASH!! 2ND PRIZE $7,000.00 Cash, OR John Deere TS 2011 Gator Utility Vehicle, Supplied by South Country Equipment, Assiniboia 3RD PRIZE $4,000.00 Cash, OR New 3D Panasonic 60” TV w/ BluRay, supplied by Harvey’s Home Centre, Assiniboia 4TH PRIZE $3,000.00 Cash, OR a Swisher Zero Turn Mower, supplied by Southland Co-op, Assiniboia 5TH PRIZE $2,000.00 Cash, OR a fantasy golf vacation, worth $3,400.00, supplied by Northstar Mountain Village, Kimberley, BC 6TH PRIZE $900.00 OR a BE Electric start Generator, supplied by Southland Co-op, Assiniboia 7TH PRIZE $800.00 OR a New Bosch Dishwasher, supplied by Harvey’s Home Center, Assiniboia 8TH PRIZE $500.00 OR EdenPURE 1000 Gen3 portable Heater, supplied by Harvey’s Home Centre, Assiniboia 9TH PRIZE $500.00 OR a Chelsea Anywhere Fireplace, supplied by Classique Home Improvements, Assiniboia 10TH & 11TH PRIZE $300.00 Cash OR an iRobot Roomba 440 Vacuum, supplied by Harvey’s Home Center, Assiniboia

40 OTHER GREAT PRIZES 7 Garmin Nuvi GPS, supplied by The Source, Assiniboia; 7 sets of Bernie Brown Dinnerware, supplied by Classique Home Improvements, Assiniboia; 3 Windscribe Wind Meters, supplied by Davis Instruments Corp.; 5 Sirius Starmate 6 Satelite Radios, supplied by The Source, Assiniboia; 2 Samsung ES65 Digital Cameras, supplied by The Source, Assiniboia; 10 King Canada Cordless Drills, supplied by Southland Co-op, Assiniboia; 2 FujiFilm Finepix Z70 Digital Cameras, supplied by The Source, Assiniboia; 3 Panasonic Cordless Phone Answering Systems, supplied by The Source, Assiniboia; 1 Sony W180 Cybershot Digital Camera, supplied by The Source, Assiniboia. Intended for SK residents.

This year we have added a 50/50 Draw to the Spring Fever Lotto. Buy 1 ticket for $10.00, 3 for $25.00 or 10 for $50.00! 1/2 Proceeds go to the Winner! ONLY 56,000 TICKETS SOLD

PREVIOUS BUYERS DRAW FEBRUARY 25, 2012

Lottery Lic No. LR11-0066

& EARLY BIRD DRAW APRIL 7, 2012

Choose $5,000.00 Cash, OR a 7 day Alaskan Cruise for 2 valued at $5,600.00 and Supplied by Assiniboia Travel

Proceeds for Olympia Theatre, playgrounds and skating arena, Assiniboia, Sask. THANK YOU SO MUCH Lottery Lic No. LR11-0065 Len: Cell 231-7216 Res 682-5411

Joe: Cell 231-7507 Res 682-5378

Scott: Cell 231-7409 Res 682-4146

Paul: Cell 231-6703 Res 682-4333

Assiniboia Civic Improvement Association • email: buy@springfeverlotto.com

Visit our website for more details: www.springfeverlotto.com

or http://lotto.sasktelwebhosting.com/springfever/index.php

Farm Equipment Ltd., Humboldt, Sk. (306) 682-2592 www.hergottcaseih.com E-mail: sales@hergottcaseih.com Visit our Web Site at http://www.caseih. com for Coop Bucks CASE IH and Case Credit are registered trademark of Case Corporation

Draws Held At Mountain & Mountain Law Office

Make cheques payable to: Spring Fever Lotto, Box 1351 Assiniboia, SK, S0H 0B0 Name: __________________________________________ Phone #: ______________ Address: ________________________________________ Postal Code: ___________ Visa/MC/AM Express # _____________________________ Expiry Date: ___________ Email:_____________________________ No of tickets: 1 for $100 ___ 3 for $250 50/50 Tickets: 1 for $10.00__ 3 for $25.00__ 10 for $50.00__ Total $ =_______Send Brochure Next year YES Tickets $100ea. or 3 for $250


PAGE 12

Saskatchewan FarmLIFE, Monday, March 19, 2012

RETIREMENT FARM AUCTION FOR JACK & MERVIN STEFANISHYN RUSSELL, MB

SATURDAY, APRIL 14th 11:00 AM

DIRECTIONS: From Silverton, MB. (Silverton, MB is located 8.5kms east of Russell, MB or 9.5kms west of Angusville, MB at the jct of hwy #45 & #478) At town of Silverton, MB Jct #45 & #478 turn north on #478 and travel 4kms to Rd122W. At Rd122W turn east and travel 2.8kms to sale site on north side of road. ORDER OF SALE:Ê 11am – 1pm (shop items, misc, tanks, aeration equipment, grain bins) 1pm (major equipment will sell) TRACTORS: UÊ£™nnÊ6iÀÃ>̈iÊnÇÈÊ iÈ}˜>̈œ˜ÊÈ]Ê{ÊÜ`ÊÓn䅫ÊÜÉÊÓä°nÊ,ÎnÊ

Õ>Ã]Ê{Ê,i“œÌiÊÞ`]ÊÀiÌÕÀ˜Êˆ˜i]ÊÎ{ÓÈʅÀÃÊŜ܈˜}]Ê£ÓÊë`Ê ÌÀ>˜ÃÊ­£Ê"ܘiÀÊ1˜ˆÌ®ÊÃɘÎÎäÎÓ£ UÊ£™ÇxÊ ÊÈäÎäÊÓÊÜ`ÊÌÀ>V̜ÀÊ£Çx…«ÊÜÉ>ÕÝÊvÕiÊÌ>˜Ž]ÊÓä°n‡ ÎnÊ Õ>Ã]Ê£äääÊ*/"]Ê`Õ>Ê…Þ`°]Ê-ޘVÀœÊÌÀ>˜Ã]Ê`ˆvvʏœVŽ]ÊÈÓÈÓÊ …ÀÃ]ÊV>L]ÊÃɘäÎxnÓÓ,Ê­ i>Àˆ˜}ÊÀi`œ˜iʈ˜Ê,i>ÀÊ ˜`®Ê­/ÕÀLœÊ ,i`œ˜i® UÊ£™ÈxÊ Ê{äÓäÊ ÃÊÓÊÜ`ÊÌÀ>V̜ÀÊÇ䅫ÊÜÉÊÓÊÀi“œÌiʅÞ`]Ê`Õ>Ê */"]Ê«œÜiÀÊňvÌ]ʜ«i˜ÊÃÌ>̈œ˜]ʙ£Ç£…ÀÃÊŜ܈˜}]Ê iÜÊ£n°{‡Î{Ê ÀÕLLiÀ]ÊÃɘ/ÓÓÎ*ä™n£x™, UÊ£™Ç™Ê7…ˆÌiÊӇ£xxÊ7 ÊÜÉiœ˜Ê£äääʏœ>`iÀ]ÊLÕVŽiÌ]Ê }À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊÇäxn…ÀÃÊŜ܈˜}]Ê 7ÊÀi>ÀÊ`Õ>Ã]Ê ÃɘÓnxnә‡{Ó£ UÊiœ˜ÊÇ{ÇÊœ>`iÀÊÜÉÊ ÕVŽiÌÊEÊ >iÊœÀŽÊ­œÕ˜ÌÃÊvœÀÊ Ê ÓäÊ-iÀˆiî WHEEL LOADER: UʈV…ˆ}>˜Ê£ÇxÊ7…iiÊœ>`iÀÊÜÉÊ««ÀœÝÊxÊ9`Ê ÕVŽiÌ]Ê iÌÀœˆÌÊ Î£nÊ ˜}ˆ˜i HARVEST EQUIPMENT: UÊÓää{Ê*Ài“ˆiÀÊә{äÊëÊÃÜ>̅iÀÊÜÉÊÓääxÊÓx½Ê>V œ˜Ê™ÇÓÊ …i>`iÀ]Ê«ˆVŽÕ«ÊÀii]ÊÓȣʅi>`iÀʅÀÃ]ÊÎ{{Êi˜}ʅÀðʭ£Ê"ܘiÀÊ 1˜ˆÌ®ÊÃɘ£x™ÓÓÓ UÊ£™nÎÊÊnÈäÊëÊVœ“Lˆ˜iÊÜÉ*>ÌÌiÀܘÊ-ˆiÛi]ÊÀi‡Ì…À>ň˜}Ê >Õ}iÀ]ÊÓ£ÇxʅÀÃ]Ê7iÃÌÜ>À`ÊΙÇÊ*ˆVŽ‡Õ«]ÊÃɘ£Ç{ȇ£Ç™n{ UÊ£™nÈÊ ÊÇÇÓ£Ê/ˆÌ>˜ÊÊ«ÌÊVœ“Lˆ˜iÊÜÉÊÀiÛiÀÃiÀ]Ê>Õ̜ʅi>`iÀÊ …iˆ}…Ì]ʏœ˜}Ê>Õ}iÀ]ÊÃɘȣx{Ç{ UÊ£n½ÊʛÇxÊ«ÌÊÃÜ>̅iÀÊÜÉL>ÌÊÀii UÊ>LÌÀœ˜ˆVÃʙ£™Ê`ˆ}ˆÌ>Ê“œˆÃÌÕÀiÊÌiÃÌiÀ SEED & TILLAGE EQUIPMENT: UÊxÓ½Ê œÕÀ}>ՏÌÊÓÎäÊ-iÀˆiÃÊx{ȇxÓÊÜÉÊn»Êë>Vˆ˜}Ê­Ü>ÞÃÊ -…i``i`®Ê{ÊL>ÀÊ œÕÀ}>ՏÌʅ>ÀÀœÜÃʭӘ`ʜܘiÀÃʜvÊ̅ˆÃÊ՘ˆÌ® UÊ{Ó½Ê œÕÀ}>ՏÌÊxÎ{‡{ÓÊÜÉÊÎÊL>ÀÊ œÕÀ}>ՏÌʅ>ÀÀœÜÃ]Ê>ˆÀʎˆÌÊ >˜`Ê}À>˜Õ>ÀʎˆÌ]Ê œÕÀ}>ՏÌÊ£ÎnÊ>ˆÀÊÌ>˜ŽÊÜɅÞ`Êv>˜]ʎ˜œVŽ‡œ˜Ê ŜÛiÃ]Ê>Ü>ÞÃÊÅi``i`]ÊÃɘ£ÓÎÓÊ­£Ê"ܘiÀÊ1˜ˆÌ® UÊә½Ê-՘vœÜiÀÊÌ>˜`i“Ê`ˆÃŽÊÜÉÊӜœÌ…ÊvÀœ˜ÌÊEÊL>VŽ UÊ£ää½Ê6iÀÃ>̈iÊÎäääʈi`ÊëÀ>ÞiÀÊÜÉÊ£äääÊ>Ê*œÞÊ/>˜Ž]Ê 7ˆ˜`Ê-VÀii˜Ã]Ê …i“ʈÝÊ/>˜Ž]Êœ>“Ê>ÀŽiÀÃ]ÊÞ`Ê*Փ«Ê Ãɘ䣣xäÎ UÊxä½Êi݈‡ œˆÊ-ÞÃÌi“Ê™xÊ>ÀÀœÜ]Ê*>VŽiÀÊ >À UÊxä½Ê >“>ÀÊ>À“Ê>ÃÌiÀÊÞ`Ê>ÀÀœÜà UÊ{ǽÊÀˆ}ÃÌ>`Ê/ˆ>}iÊÜÉœÀÀˆÃÊÎÊL>ÀÊ>ÀÀœÜà UÊÈä½ÊiÀ“>˜Ê>ÀÀœÜà UʣǽÊ>Տ‡Ê-ii`ÊEÊiÀÌÊ/i˜`iÀÊÜÉÊÞ`ÊÕ}iÀà UÊ i}i“>˜Ê,œÌ>ÀÞÊ-̜˜iÊ*ˆVŽiÀÊÜÉÊÞ`Ê ÀˆÛi UÊ­È®Ê{½Ê-iV̈œ˜ÃʜvÊœÀÀˆÃʜ՘Ìi`Ê>ÀÀœÜà UÊ œÕÀ}>ՏÌʘœVŽ‡"˜Ê-«œœ˜Ã UÊ"`ÊÈʤ½Ê`ˆÃV AUGERS & GRAIN VAC: UÊ7>ˆ˜}>Êx£äÊÃÌ`ÊÀ>ˆ˜Ê6>V]Ê£äääÊ*/"]ÊÃɘ™£äÈ{Çää]ÊÕÃi`Ê ÛiÀÞʏˆÌ̏iÊ­£Ê"ܘiÀÊ1˜ˆÌ® UʣλÊÝÊÈ£½Ê7iÃÌvˆi`Ê-܈˜}Êœ««iÀÊÕ}iÀÊÜɏœÜÊ«ÀœÊ…œ««iÀ]Ê Ãɘ££È£äÇ UÊÇ»ÊÝÊÎǽÊ->ŽÕ˜`ˆ>ŽÊÕ}iÀÊÜÉ££Ê*Êœ˜`>]ÊÃɘÓÓ£™ä UÊn»ÊÝÊ{£½Ê->ŽÕ˜`ˆ>ŽÊÜÉÓÎÊ*Êœ…iÀÊ ˜}ˆ˜i UÊ7…i>̅i>ÀÌÊ£ä»ÊÞ`Ê/À>˜ÃviÀÊÕ}iÀ UÊi>ÀÊ œÝÊvœÀʣλÊ7iÃÌvˆi`ÊÕ}iÀ UÊ*œÞÊÕ}iÀÊ œœÌÃ

GRAIN BINS: UÊ­x®ÊÓäääÊ ÕÃÊ7iÃÌiiÊ>ÌÊ œÌ̜“Ê ˆ˜Ê­ i“i˜Ì® UÊ­Ó®ÊÓ£xäÊ ÕÃÊLˆ˜ÊÜÉÊLœœÌÃ]Ê>iÀ>̈œ˜ UÊ­£®Ê£ÎxäÊ ÕÃÊi«œÝÞÊVœ>Ìi`ʅœ««iÀÊLœÌ̜“ÊLˆ˜ UÊ­{®Ê£ÈxäÊ ÕÃÊ7iÃÌiiÊLˆ˜Ã UʭӮʣÈxäÊ ÕÃÊ7iÃÌiiÊ>ÌÊ œÌ̜“Ê­ i“i˜Ì® UÊ­{®ÊÓÇääÊ ÕÃÊ7iÃÌiiÊ>ÌÊ œÌ̜“Ê­ i“i˜Ì® UÊ£ÈxäÊ ÕÃÊ7iÃÌiiÊœ««iÀÊ œÌ̜“ UÊ£ÎxäÊ ÕÃÊ7iÃÌiiÊœ««iÀÊ œÌ̜“ UÊ««ÀœÝÊÎxääÊ ÕÃÊiÌ>Ê>ÌÊ œÌ̜“Ê ˆ˜Ê­ œ˜ÛiÀÌi`Ê ˆÌÀœ}i˜Ê />˜Ž® UÊ£ÎxäÊ ÕÃÊÀˆiÃi˜Ê «œÝÞÊ œ>Ìi`Êœ««iÀÊ œÌ̜“ UÊÓäääÊ ÕÃÊ7iÃÌiiÊ ˆ˜Ê*>ÀÌÃÊ­,œœv]Ê œœÀÃ]ÊiÌV® UʭȮʫ«ÀœÝÊÓä½Ê Ê ˆ˜Ê>``iÀà UʭӮʫ>ˆÃʜvÊLˆ˜ÊLœÌÃÊ­vœÀÊÓäääÊ ÕÃÊLˆ˜Ã® TRUCKS: UÊ£™™ÎÊÊ >}iʙÎääʈ}…Ü>ÞÊ/À>V̜ÀÊÜÉÊ£äÊ-«ii`Ê-«ˆViÀÊ /À>˜Ã°]ÊΣÇÈÊ >ÌÊ ˜}ˆ˜i]Ê>ŽiÊLÀ>Ži]Ê*ÀœÊi>ÌÊ7>L>ÃVœÊ ˜}ˆ˜iÊ i>ÌiÀ]Ê Õ˜Ž]ʈ}…Ê*ÀœvˆiÊx̅Ê7…iiÊ*>Ìi]Ê£]xn{]™nxŽ“ÃÊ -…œÜˆ˜}]ÊÓ{°xÊ,ÕLLiÀ]ÊÃɘÓ- È,™* äÈÇÓÎÓ]Ê->v̈i`Ê ­i˜}ˆ˜iÊÀiLՈÌÊ£Èä]ää䎓ÃÊ>}œ® UÊ£™ÇnÊÊÓxÇx]Ê/ÉÊÀ>ˆ˜Ê/ÀÕVŽÊÜÉÊ£™½Ê E]ÊÈÈ»ÊÈ`iÃ]Ê,œÊ />À«]ÊÓÓ°xÊ,ÕLLiÀ]Ê£ÎÊ-«`Ê/À>˜Ã°]ÊәäÊ Õ““ˆ˜}ÃÊ­-iiÛiÃÊ>˜`Ê *ˆÃ̜˜Ãʏˆ˜iÃÊ`œ˜iÊÎä]äääʎ“ÃÊ>}œ®]Ê>ŽiÊLÀ>Ži]ÊÎxä]xäÎÊ“ÃÊ -…œÜˆ˜}]Ê,i>ÀÊœˆÃÌÊ œ˜ÌÀœÃ]Êi˜`iÀܘÊÃÕëi˜Ãˆœ˜]Ê->vïi`]Ê Ãɘ Ó-ÇÓ{äÓ{ UÊœœ`Ê>˜`ÊV>LÊvœÀÊ>ÊÊ£™ääÊÌÀÕVŽ TRAILERS: UÊÓää£Ê{ä½Ê/ˆ“«ÌiÊ/ÉÊ LÊœ««iÀÊÀ>ˆ˜Ê/À>ˆiÀÊÜÉʈÀÊ,ˆ`i]Ê Ç{»ÊÈ`iÃ]Ê iÜÊ,œÊ/>À«]ÊÓÓ°xÊ,ÕLLiÀ]Ê -É £/ {ääÓ8 䙙ÈÓ£]Ê->vïi`Ê­>VŽÊ…>Ãʜܘi`Ê̅ˆÃÊ՘ˆÌÊ Ãˆ˜ViÊÓää{°ÊÌʅ>Ãʅ>`ÊÛiÀÞʏˆÌ̏iʓˆiÃʜ˜ÊˆÌÊȘVi°® UÊÓn½ÊÀÕi…>ÕvÊ-Éʈ}…LœÞʏ>Ì`iVŽÊ/À>ˆiÀÊÜÉi>`>V…iÊ ,>VŽ]ÊÓ{°xÊÀÕLLiÀ]Ê->vïi`]ÊÃɘ-{ääÈxÈÈÓÓ UÊ{n½ÊÀÕi…>ÕvÊ/Éʏ>ÌÊ iVŽÊ>ÞÊ/À>ˆiÀ]Ê->vïi` UÊ-ÉÊ œ˜ÛiÀÌiÀÊ œÞ UÊ-ÉÊÃÜ>̅iÀÊÌÀ>˜Ã«œÀÌ OTHER EQUIPMENT: Uʈi`“>ÃÌiÀÊÞ`Ê-VÀ>«iÀ]Ê««ÀœÝÊÎÊÞ`Ê >« UÊ Þ˜>‡>LÊ6‡ ˆÌV…iÀ]ÊÃɘxnÈ£äΣ UÊ{½Êiœ˜ÊÃ̜˜iÊ`ˆ}}iÀ UÊ{Ê܅iiÊÎÊ*/Ê>ÞÊ,>Ži UÊÓÊʛ£ÈÊÈ`iÊ`iˆÛiÀÞÊÀ>ŽiÃÊÜÉÌ>˜`i“Ê…ˆÌV… UÊ{{»Ê,>˜V…ʈ˜}Ê*ՏÊ i…ˆ˜`ʈ˜ˆÃ…ˆ˜}ÊœÜiÀÊÜÉÊ£ä°xÊ«]Ê ÊEÊ-Ê ˜}ˆ˜i UÊλÊœ˜`>Ê7>ÌiÀÊ*Փ« AERATION EQUIPMENT: UÊi…œÊ*Àœ«>˜iÊÀ>ˆ˜Ê ÀÞiÀ UÊ­Ó®Êi…œÊxÊ*ÊiÀ>̈œ˜Ê>˜Ã UʭӮʜ`i˜ÊÀ>ˆ˜ÊÓ{»ÊiÀ>̈œ˜Ê>˜Ã UÊiÀ>̈œ˜Ê/ÕLˆ˜}

UÊ­Ó®ÊxääÊ>ÊÕiÊ/>˜ŽÃÊÜÉÊ-Ì>˜`à UÊ£ääÊ}>Ê-Žˆ`Ê/>˜Ž SHOP ITEMS & TOOLS: Uʈ˜Vœ˜Ê-‡ÓääÊ>ÃÊ*œÜiÀi`Ê œ˜Ìˆ˜i˜Ì>Ê7i`iÀʜ˜ÊÓÊ7…iiÊ 7>}œ˜ UÊ Ê£xä Ê -Êi>ÌiÀÊUÊ/ Ê£ÈÊë`Ê`ÀˆÊ«ÀiÃà UÊ >`iÀÊ£ÉÓÊ*Ê i˜V…ÊÀˆ˜`iÀÊUÊÓ½ÊÝÊλÊiÌ>Ê7i`ˆ˜}Ê/>Li UʘۈÊUÊÎȻʫˆ«iÊÜÀi˜V…ÊUÊ Ê"ÛiÀÊi>`Ê ˜}ˆ˜iÊœˆÃÌ UÊ œœÃÌiÀÊ >LiÃÊUÊ,ÕLLiÀʈÀÊœÃi UÊxÊ/œ˜ÊœœÀÊ>VŽÊUÊ/ÀÕVŽÊEÊ“«i“i˜ÌÊ/ˆÀià UÊÎÉ{Ê ÀˆÛiÊ“«>VÌÊ7Ài˜V…ÊUÊ>ÎiÌÊ>ÌiÀˆ>Ê­>À}iÊ,œ® UÊ i>`Ê Ài>ŽiÀʈ}ÊUÊ/>«ÊEÊ ˆiÊ-iÌÃÊUÊ/À>ˆiÀʈ}…Ìà UÊ*ՏiÀÊ-iÌÊUÊ*ˆ«iÊ̅Ài>`iÀÊUÊ*ˆ«iʈÌ̈˜}à UÊ œÌ̏iÊ>VŽÊUÊ Ý…>ÕÃÌʘ>ÞâiÊUÊÞ`ʈÌ̈˜}à UʈÀÊ/œœÃÊ­,>ÌV…iÌ]Ê …ˆÃi]ÊiÌV°®ÊUÊ iVÌÀˆVÊ£Éӻʓ«>VÌ UÊ œŽiÊ œœiÀʓ>`iʈ˜ÌœÊ*>ÀÌÃÊ7>ÅiÀ UÊ >ÀÃ]Ê-˜ˆ«iÃ]Ê-…œÛiÃ]ÊiÌV°ÊUʣʣÉÓÊ/œ˜Ê …>ˆ˜Ê œ“i‡>œ˜} UÊ£Ê/œ˜Ê …>ˆ˜ÊœˆÃÌÊUÊœ}}ˆ˜}Ê …>ˆ˜ÃÊUÊ iۈÃià UÊ >“«Ãʜ˜Ê-ÌÀ>«Ê7ˆ˜V…iÃÊUÊ ÝÌi˜Ãˆœ˜Ê œÀ`ÃÊ UÊÃÜÀ̓i˜ÌʜvÊ ÕÌÃÊEÊ œÌÃÊUÊÓÊë`Ê Ê-…œ«Ê*ÀiÃà UÊ >ÀÀiÊ*Փ«ÃÊUÊÞ`Ê Õ“«iÀÊ>VŽ UÊ*ˆ«iÊ7Ài˜V…iÃÊUÊÀi>ÃiÊ՘à MISCELANIOUS ITEMS: UÊiiVÌÀˆV>Ê«>˜iÊLœÝÊÜÉLÀi>ŽiÀÃÊ­Ü>ÃʓœÕ˜Ìi`ÊLÞÊLˆ˜Ã® UÊ£ÓÊ6œÌÊÕiÊ*Փ«ÊUÊ ÊÊ,>`ˆœÃÊ­ ÀÞÃÌ>Ê-Ìޏi® UÊÊnÈäʓ>˜Õ>ÊUÊÎÊ7>ÞÊÞ`Ê-«œœÊ6>Ûià UÊ/À>«ÃÊUÊÃÌiiÊV>LiÊUÊÞ`ÊœÃiÃÊUÊ>ÀÀœÜÊ/ˆÀià UÊiiÀÊ-…i>ÀÊUÊλʳÊ{»Ê >iÊ-ÌÀ>«ÃÊUÊ Àœ«ÊˆvÌiÀà UÊ7iÊ*Փ«Ê>VŽÊUÊÞ`Ê-«À>ÞiÀÊ*Փ« UÊÃÜÀ̓i˜ÌʜvÊ6Ê iÌÃÊUÊ/À>V̜Àʈ}…Ìà UÊiÌ>ÊxÊ>Ê*>ˆÃÊvœÀÊii`ˆ˜} UÊÃÜÀ̓i˜ÌʜvÊ>À“Ê,i>Ìi`Ê/œœÃÊ>˜`Ê-“>Ã UÊ-ÕL“iÀÈLiÊ*Փ«Ê œ˜ÌÀœÃÊEÊ7ˆÀˆ˜} UÊ£{ʣȰ£Ê{Ê,ˆLÊ“«i“i˜ÌÊ/ˆÀiÃÊÜÉnÊ œÌÊ,ˆ“ UÊ ÝÌÊ>``iÀÊUÊ/>À«ÃÊUÊÃÜÀÌi`ÊiÌ>Ê-…iï˜} UÊÃÜÀÌi`Ê`ˆ“i˜Ãˆœ˜>ÊՓLiÀÊEÊ*Þܜœ` UÊÃÜÀÌi`Ê Ý«>˜`i`ÊiÅÊՏÊ-…iiÌÃÊ­6>ÀˆœÕÃÊ-ˆâiî UÊxäÊ>ÊiÌ>Ê ÀՓÃÊUÊ“«i“i˜ÌÊ/ˆÀiÃÊÜÉÊ,ˆ“à UÊ Ê£n»Ê³ÊÓ{»Ê/ÕÀ˜Ê ÕVŽiÃÊUÊ£n°{ʇÊÎ»Ê Õ>Ã UÊ,ˆ˜}iÀÊ7>ÅiÀÊUÊ Ài>“Ê-i«>À>̜ÀÃÊUÊ i`>ÀÊ-…ˆ˜}ià Uʈ˜ˆÊ ՏŽÊ >}ÃÊUÊœ>“Ê>ÀŽiÀʈÌÊ­ 7® UÊÞ`ÀœÊ*œiÃ]Êi˜ViÊ*œÃÌÃ]Ê,>ˆÊ/ˆiÃÊUÊiÀÀÞÊ >˜Ã UʭӮʣӻݣ{½ÊVՏÛiÀÌÃÊUÊ­£®Ê£È»Ý{½ÊVՏÛiÀÌ Uʘ̈µÕiÊÃÌiiÊ܅iiÃ UÊ"`ʓiÌ>ÊÌÀ>V̜ÀÊÃi>ÌÃÊ­£ÊˆÃÊV>ÃÌÊLÕÌʈÌʈÃÊVÀ>VŽi`® HOUSEHOLD EFFECTS: UÊiiVÌÀˆVÊÃ̜ÛiÊUÊVœÕV…ÊEÊV…>ˆÀÊUÊÃ܈ÛiÊÀœVŽiÀ UÊV>Lˆ˜iÌÊÃÌޏiÊ/6ÊUÊ7…ˆÌiÊiiVÌÀˆVÊÃi܈˜}ʓ>V…ˆ˜iÊÜɜ>ŽÊ`iÃŽÊ UÊLi`Àœœ“ÊÃՈÌiÊ­Li`ÊvÀ>“i]Ê`ÀiÃÃiÀ]ÊV…iÃÌʜvÊ`À>ÜiÀî UÊiÝÌiÀˆœÀÊ`œœÀÃÊÎÈ»ÊUÊܜœ`ÊÃ̜ÛiÊUÊVœvviiÊÌ>Li UÊ>ÃÜÀ̓i˜ÌʜvÊ`ˆÃ…iÃÊUÊLœœŽÃÊUÊÃiVÀiÌ>ÀÞÊ`iÎ

TANKS: UÊ£äääÊ}>ÊÕiÊ/>˜ŽÊÜÉ££äÊ6œÌÊ*Փ«ÊEÊiÌiÀ UÊ£äääÊ>Ê*Àœ«>˜iÊ/>˜Ž UÊ­Ó®£ÓxäÊ>Ê*œÞÊ/>˜ŽÃ UʭӮʣxäÊ>Ê*œÞÊ/>˜ŽÃ

FOR MORE INFO CONTACT OWNER

 Ê-/  -9 Ê Óä{‡ÇÇ·Îä™n

AUCTIONEERS NOTES:Ê/…ˆÃÊÛiÀÞÊÜiÊŽi«Ìʏˆ˜iʜvÊiµÕˆ«“i˜Ìʅ>ÃÊ>Ü>ÞÃÊLii˜ÊÅi``i`°Ê Ûi˜Ê̅iÊ̈>}iʈÃÊ Ži«ÌÊÅi``i`Ê܅i˜Ê˜œÌʈ˜ÊÕÃi°Ê9œÕʓÕÃÌÊÃiiÊ̅ˆÃÊÃ>iʈ˜Ê«iÀܘÊ̜Ê>««ÀiVˆ>ÌiÊ̅iÊVœ˜`ˆÌˆœ˜°Ê*>˜Ê̜Ê>ÌÌi˜`Ê̅ˆÃÊ}Ài>ÌÊ Ã>i° Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Saskatchewan FarmLIFE, Monday, March 19, 2012

OPTIMUM CARS

07 ALLURE CX LOADED WHITE 50,000KM T12181A 07 AVEO LT 5SPD ACT ORANGE 74,454KM R4740 07 LUCERNE CXL SEDAN LOADED BRONZE 94,330KM C1173A 08 COBALT LT COUPE CLOTH LOADED RED 73,168KM C1210A 08 GRAND PRIX SE SEDAN LOADED BLACK 57,058KM T12151B 09 LUCERNE CX SEDAN 3.9L ACT CD CLOTH WHITE C1183A 56,000KM 09 LUCERNE CXL 3.9L LOADED LEATHER DIAMOND WHITE 64,507KM T11464A 10 MALIBU LT 2.4L LOADED SUEDE CASHMERE SEATS DIAMOND WHITE C1104A 10 CTS-V SC LOADED LEATHER NAV MAROON 28,530KM R4733 11 IMPALA 3.5L LT LOADED CLOTH BLACK 22,032KM BB0805 11 IMPALA LT SEDAN LOADED SILVER 24,305KM BB7508 11 IMPALA LT SEDAN LOADED GOLD 39,427KM BB1952

$15,900 $7,900 $14,900 $10,900 $13,900 $17,900 $20,900 $22,900 $57,900 $18,900 $18,900 $18,900

PAGE 13

EVERY OPTIMUM VEHICLE COMES WITH OUR PROMISE OF PEACE OF MIND. MANUFACTURER’S WARRANTY 150+ POINT INSPECTIONS 24-HOUR ROADSIDE ASSISTANCE 30-DAY/ONE TIME 2,500KM EXCHANGE

OPTIMUM SUV’S AND VANS

07 TRAILBLAZER 4.2L AWD LOADED LEATHER LS SILVER 119,530KM T111103A 07 SUBURBAN LT LOADED 7PASS BLACK 122,345KM T12158A 07 AVALANCHE LTZ 5.3L LOADED LEATHER WHITE 140,000KM C1228A 07 MONTANA REG SV6 LOADED GREY 60,543KM T11897B 07 MONTANA SV6 EXT WHITE LOADED 79,847KM R4696A 07 DURANGO SLT LOADED 4WD LT WHITE 86,637KM R4738A 08 AVALANCHE LS 5.3L 4WD LOADED WHITE 104,141KM R4745A 09 ENCLAVE AWD CX LOADED LEATHER DIAMOND WHITE 63,796KM T12150A 09 ENCLAVE CXL AWD DVD LOADED ROOF 7PASS LEAHTER WHITE DIAMOND 09 YUKON SLT 4WD LOADED 2ND ROW BUCKETS GREY 50,992KM R4713A 09 YUKON XL SLT LOADED LEATHER 8PASS WHITE 90,000KM T11244A 09 AVALANCHE LT 4WD LOADED SILVER T11949A 09 EDGE 5.3L AWD SEL LOADED CLOTH BROWN 138,811KM T11861A 10 EQUINOX LT AWD LOADED CLOTH MOCHA 40,907KM T1224A 10 AVALANCHE LT 4WD LOADED LEATHER SILVER 48,994KM T11689A 10 TRAVERSE FWD 3.6L LT ACT CD 7PASS WHITE 40,000KM T11576A 11 TRAVERSE 3.6L AWD LS LOADED 8PASS SILVER 40,300KM R4735 11 TRAVERSE 3.6L AWD LT 7PASS CLOTH SILVER 39,555KM BB9447 11 SUBURBAN LT2 LOADED 8PASS LEATHER WHITE 38,534KM BB3907 11 EDGE 3.7 SPORT AWD LOADED LEATHER SILVER 29,208KM BB4627 11 EXPLORER XLT 4WD LOADED LEATHER WHITE 30,097KM BB80868

$15,900 $25,950 $24,900 $12,900 $12,900 $19,950 $24,900 $33,900 $29,900 $34,900 $35,950 $32,900 $15,900 $26,900 $39,900 $26,900 $28,900 $32,900 $39,900 $40,900 $41,900

OPTIMUM TRUCKS

06 CHEV 1/2T 5.3L LS LOADED EXT CLOTH RED 105,331KM C1208A 06 FORD 6.0L DIESEL XLT CREW LOADED LEATHER BLACK 111,368KM R4702 07 CHEV 1/2T 5.3L LS EXT 4WD CLASSIC LOADED CLOTH PEWTER 82,490KM T12283A 07 CHEV 1/2T 5.2L CLASSIC LT EXT 4WD LOADED LEATHER Z71 RED 75,620KM T11948A 07 CHEV 1/2T CLASSIC LS REG 4WD 4.8L LOADED GRAY 105,900KM R4716 08 GMC 1/2T 5.3L SLT CREW 4WD LOADED LEATHER GREY T12107A 08 CHEV 3/4T 6.6L CREW LTZ 4WD CRIMSON 79,419KM T11934A 08 CHEV 3/4T 6.6L LT EXT 4WD LOADED BLACK 50,310KM R4742 08 CHEV 3/4T 6.6L LT EXT 4WD LOADED CLOTH BLACK 50,415KM R4742 08 CHEV 3/4T 6.6L LT CREW 4WD LOADED LEATHER WHITE 122,123KM T12253A 09 GMC 1/2T CREW 4WD SLT LOADED LEATHER RED 84,512KM T11952A 09 CHEV 1/2T LT CREW 4WD LOADED LEATHER RED 44,511KM T11858A 09 CHEV 1/2T LT 4WD 5.3L CREW LOADED LEATHER GREY 53,077KM T11795A 09 CHEV 1/2T 5.3L LTZ 4WD CREW LOADED 20”WHLS SILVER 75,467KM T1290A 09 CHEV 1/2T LT CREW 4WD LOADED BUCKETS WHITE 121,877KM C11104B 09 CHEV 1/2T EXT 4WD 5.3L LOADED BLACK 72,145KM T12252A 09 GMC 1/2T 5.3L CREW SLE 4WD LOADED WHITE 51,623KM T12120A 10 CHEV 1/2T 5.3L CREW SLE LOADED WHITE 71,628KM T12122A 10 CHEV 1/2T LTZ EXT LOADED LEATHER SILVER 38,729KM T11963A 10 GMC 1/2T SLE 4.8L 4WD LOADED GREY 104,215KM T12208A 10 CANYON SLE 4WD CREW LOADED SILVER 72,000KM T11788A 11 GMC 1/2T EXT 4WD SLE BROWN 35,000KM T12190A 11 CANYON 3.7L SLT 4WD EXT LOADED GRAY GREEN 32,000KM T12137A 11 GMC 3/4T CREW 6.6L LOADED CLOTH WHITE 59,000KM T1292A 11 FORD F350 1TON 6.7T LARIET CREW 4WD LOADED LEATHER RED 47,499KM T12227A

$16,900 $25,900 $18,900 $19,900 $15,950 $26,900 $39,900 $37,900 $38,900 $35,900 $29,950 $29,900 $28,900 $29,900 $19,900 $23,900 $28,900 $28,950 $31,900 $25,900 $22,900 $32,900 $23,900 $64,900 $59,900

*ALL PRICES PLUS APPLICABLE TAXES & FEES

CALL FOR OUR HUGE SELECTION OF NEW! 2011 TRAVERSE FWD $27,400* CASH LAST ONE!

MSRP $37,365 DISCOUNT $10,095

T11593

$bi2we1ek2ly

2011 BUICK LACROSSE $23,500* CASH MSRP $33,950

$bi1we8ek7ly

DISCOUNT $9,565

2011 COLORADO EXT 4X2 $18,900* CASH

T11684

$bi1we3ek4ly

2011 CHEV MALIBU LT $20,900* CASH

$bi1we6ek5ly

DISCOUNT $7,975

2011 SILVERADO CREW 1500 4WD $26,950* CASH LOADED

MSRP $40,235 DISCOUNT $12,285

T11812

$bi1we8ek3ly


PAGE 14

Saskatchewan FarmLIFE, Monday, March 19, 2012

RETIREMENT FARM AUCTION FOR ANDY & ANN DUBOIS OF CARROLL, MB.

MONDAY APRIL 16th 10:00AM

DIRECTIONS: (Carroll, MB. Is located on #2 hwy west of #10 and east of Souris, MB.) From Carroll, MB. (Jct #2 hwy & Road 114) 6 miles south on road 114 then turn ½ mile west to sale site. Watch for signs sale day.

TRACTORS: UÊ£™™nÊ Ê/-££äÊ7 Ê£än…«ÊÌÀ>V̜ÀÊ Üɏˆi`Ê-Êx™xʏœ>`iÀ]ÊLÕVŽiÌ]Ê*iœµÕˆ˜Ê }À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊÎÓÊë`ÊÌÀ>˜Ã]Ê Ã…ÕÌ̏iÊňvÌ]Ê`ˆvvʏœVŽ]ÊΫÌ]Ê`Õ>Ê«Ìœ]Ê {ÊÀi“œÌiʅÞ`]Ê£n°{‡ÎnÊÀi>ÀÊȘ}iÃ]Ê £{°™,ÓnÊvÀœ˜Ì]ÊÇÎÇn…ÀÃÊŜ܈˜}]Ê ÃɘȣnÎÎx UÊ£™™ÎœÀ`Ê6iÀÃ>̈iʙäÎäÊ ˆ‡ ˆÀiV̈œ˜>ÊÌÀ>V̜ÀÊÜÉʏœ>`iÀ]Ê }À>««i]ÊΫÌ]ÊÌÀˆ«iʅÞ`À>ՏˆVÃ]Ê x{äÉ£äää«Ìœ]ʅˆ‡vœÜʏˆ˜iÃÊV>LÊi˜`]Ê ÀiVi˜ÌÊV>LÊi˜`Ê̈ÀiÃ]ʣȰ™ÝÓn»]ÊÇäxÓÊ …ÀÃ]ÊÃɘ ™ÎÓ{xÇ UÊ£™Ç™ÊÊÓÇäxÊÓÜ`Ê£ÓӅ«ÊÜÉV>LÊEÊ >ˆÀ]ÊnÊë`]ÊΫÌ]Ê`Õ>Ê…Þ`]Êx{äÉ£äääÊ */"]Ê£n°{ÝÎnÊ̈ÀiÃÊÜÉÊv>V̜ÀÞÊ`Õ>Ã]Ê Ãɘ™,ää{ÈÎÈ UÊ£™näÊ iÕÌâÊ£Èä]ÊÓÜ`ÊÜÉV>LÊEÊ>ˆÀ]Ê £äääÊ*/"]Ê`Õ>Ê…Þ`]ÊÃÌ>˜`>À`ÊÌÀ>˜Ã]Ê Óä°nÝÎnÊÀi>ÀÊ̈ÀiÃ]ʘiÜÊVÕÌV…]ÊÀiVi˜ÌÞÊ Ì…ÀœÕ}…Ê̅iÊŜ«]ÊǙ™ä…ÀÃÊŜ܈˜}]Ê ÃɘÇÈÓ{‡äx{Ç

HAYING & LIVESTOCK EQUIPMENT: UÊÓääxÊ Ê ,ÊÇnäÊÀœÕ˜`ÊL>iÀÊÜÉ܈`iÊ «ÉÕ]ÊÃɘÈÎ{{È UÊÓäääÊ£{½Ê Ê£{Çxʅ>ÞLˆ˜iÊÜÉÓÎääÊ ÃiÀˆiÃʅi>`iÀÊÃɘÈ{Èäxn UÊ>ÕÀˆiÀʇӣÓxÊȘ}iÊÀœÜÊL>iÊ«ˆVŽiÀ UÊ/œ˜ÕÌ̈Ê6£{ÊqÊ£{Ê܅iiÊº6»ÊÀ>Ži UÊ>}i`œÀ˜ÊÓÇxÊÌ>˜`i“Ê>ݏiʓ>˜ÕÀiÊ Ã«Ài>`iÀÊÜɅÞ`°Ê«ÕÅʜvv]ÊÌ>ˆ}>Ìi]Ê`Õ>Ê Li>ÌiÀÃ]Ê{ÓxÊÈx,ÝÓÓ°xÊ̈Àià UʈvvÞʙääÊL>iÊ«ÀœViÃÜÀÊÜÉ£äääÊ*/"]Ê ivÌʅ>˜`Ê`ˆÃV…>À}iÊÃɘ- äääÓ£È£Ó UÊ ÊÇääʓˆÝʓˆÊÜÉ«œÜiÀÊL>iÊ vii`iÀ]Ê£äääÊ*/"

OTHER LIVESTOCK RELATED EQUIPMENT: UÊ,i>Ê˜`ÕÃÌÀˆiÃÊV>Ì̏iÊõÕiiâiÊÜɅi>`Ê }>Ìi]ʘiVŽÊiÝÌi˜`iÀ]Ê«>«>̈œ˜ÊV>}iÊEÊ £näÊ`i}ÀiiÊVÀœÜ`ˆ˜}ÊÌÕL UÊ >Ì̏iÊ œÕ˜ÌÀÞÊõÕiiâiÊÜɅi>`Ê}>ÌiÊ EÊ«>«>̈œ˜ÊV>}i UʭǮʣӽʓiÌ>ÊL՘ŽÊˆ˜iÊvii`iÀà UÊ­£Ó®Ê£ä½Êˆ>“ˆÊÜi`ˆ˜}Êvii`ÊÌÀœÕ}…à SEEDING & TILLAGE: UʭӮʣ{½Ê“iÌ>Êvii`ÊÌÀœÕ}…à UÊÓ{½ÊÊÈÓääÊ`ˆÃVÊ`ÀˆÃÊÜÉÊv>V̜ÀÞÊ UÊ7œœ`i˜ÊVÀii«Êvii`iÀÊÜÉʓiÌ>Ê«>˜iÃ ÌÀ>˜Ã«œÀÌ UÊÊxxääÊ6ˆLÀ>ÊÅ>˜ŽÊVՏ̈Û>̜À]ʎ˜œVŽÊ UÊ+Õ>˜ÌˆÌÞÊÀœÕ˜`ÊL>iÊvii`iÀà œ˜ÊŜÛiÃÊÜÉÊ œÕÀ}>ՏÌÊÎÊÀœÜʓœÕ˜Ìi`Ê UÊ+Õ>˜ÌˆÌÞʜvÊ£»ÊVœÀÀ>Ê«>˜iÃÊEÊ}>Ìià UÊ,ˆÌV…ˆiÊ£ääʅi>`ÊÃ̜VŽÊÜ>ÌiÀiÀ …>ÀÀœÜà UÊ+Õ>˜ÌˆÌÞʜvÊ>>}…iÀÊvi˜ViÀÃÊEÊ UÊÓä½Ê-՘vœÜiÀʜvvÃiÌÊ`ˆÃV vi˜Vˆ˜}ÊiµÕˆ«“i˜Ì UÊ£{½ÊʛxÓÊ`ˆÃVÊÜÉʘœÌV…i`ÊvÀœ˜ÌÊ UÊÊ-̜VŽÊ œV̜À L>`ià UÊȻʫi˜VˆÊ>Õ}iÀʜ˜Ê܅iiÃÊÜÉÊ£…«Ê UÊ£{½Ê œ‡œ«Ê`ii«Ê̈iÀÊÜÉÊÓÊÀœÜÊ “œÌœÀ …>ÀÀœÜà UʭήʓiÌ>ÊLœÌ̜“]Ê«Þܜœ`Ê̜«Ê…œ}Ê UÊÈä½Ê>À“ÊŽˆ˜}ÊëÀˆ˜}ʅ>ÀÀœÜà vii`iÀÃÊ£Ó½Ýn½{» UÊ>À“ʈ˜}Ên»Ý{ȽÊ*/"Ê>Õ}iÀ

FOR MORE INFO CONTACT LISTING AUCTIONEERS

*iÌiÀÊ œÜ˜iÞÊÓä{‡xÓӇxnnÎʜÀÊ Ài˜ÌÊ ÀœÜiÊÓä{‡xÓӇÈÓÓ{

VEHICLES, TRAILERS, & BOAT: UÊÓä£äÊœ>`Ê>ÝÊÎÓ½Êx̅Ê܅iiÊ v>ÌÊ`iVŽÊÌÀ>ˆiÀÊÜÉÊÓÊqÊ£ääääLÊ `Õ>Ê܅iii`Ê>ݏiÃ]ÊiiVÌÀˆVÊLÀ>ŽiÃ]Ê ÓÎxÉnä,£ÈÊ̈ÀiÃ]ÊLi>ÛiÀÊÌ>ˆÃ]Ê̜œÊLœÝ]Ê ÃÉ˜ä£™Ç™È UÊ£™™ÇÊÓn½Ê ÕiʈÃÊÌÉ>ÊÃ̜VŽÊÌÀ>ˆiÀÊ ÜÉÓÊ«>À̈̈œ˜Ê}>ÌiÃ]Êi˜VœÃi`ʘœÃiÊÜˆÌ…Ê }>Ìi]Êܜœ`ÊvœœÀ]ÊvÀœ˜ÌÊiÃV>«iÊ`œœÀ]Ê ÃÉ˜Ó ™xÓ6ÎÓ86£äxÎ䣣 UÊ"`iÀÊ/œÞœÌ>ÊÌÀÕVŽ UÊ6ˆ˜Ì>}iÊ À>˜`œ˜Ê/À>˜ÃˆÌÊVˆÌÞÊLÕà UÊ£{½ÊÕ“ˆ˜Õ“ÊvˆÃ…ˆ˜}ÊLœ>ÌÊÜÉÊÓä…«Ê œ…˜Ãœ˜Ê“œÌœÀÊEÊÌÀ>ˆiÀ UÊ-“>ÊȘ}iÊ>ݏiÊṎˆÌÞÊÌÀ>ˆiÀ SHOP ITEMS & MISC: UÊ >“«LiÊ>ÕÃvi`Êx…«ÊÓÈÊ}>Ê>ˆÀÊ Vœ“«ÀiÃÜÀ UÊiÌ>ÊÜi`ˆ˜}ÊEÊŜ«ÊLi˜V…ià UÊi>ÌÊ}Àˆ˜`iÀÊEʓi>ÌÊL>˜`ÊÃ>Ü UÊ/>LiÊÃ>Ü UÊ-iiV̈œ˜ÊœvÊVœ““œ˜ÊŜ«Ê̜œÃÊEÊ iµÕˆ«“i˜Ì BUILDING SUPPLIES: UÊÎä½ÊÅiiÌʓiÌ>]ÊÓäÊ«ˆiViÃÊ̜Õ}…ÊÀˆL UÊ>À}iʵÕ>˜ÌˆÌÞʜvʜ̅iÀÊÅiiÌʓiÌ> UÊ+Õ>˜ÌˆÌÞʜvʘ`ÕÃÌÀˆ>ÊÅiiÌʓiÌ>Ê ­Ó»ÊÀˆL® UÊ+Õ>˜ÌˆÌÞʜvÊv}`ÊvœœÀÊÌÀÕÃÃià UʭӮʣn»ÝÓÓ»ÝÎä½Êܜœ`ÊLi>“à UÊ­£Ó®Ê{½Ý£Ó½Ê`ÀÞÜ>ÊÅiiÌà UÊ««ÀœÝ°ÊÎxÊÅiiÌÃʜvÊ i…i˜ÊVÕÀÛi`Ê “iÌ> UÊ+Õ>˜ÌˆÌÞʜvÊÃVÀ>«ÊˆÀœ˜

AUCTIONEERS NOTES:ʘ`ÞÊEʘ˜Ê…>ÛiÊ܏`Ê̅iˆÀÊv>À“Ê>˜`Ê>ÀiÊÀïÀˆ˜}ÊÌœÊ À>˜`œ˜°ÊœÌÃʜvÊÕÃivՏÊiµÕˆ«‡ “i˜ÌÊvœÀÊ̅iʏˆÛiÃ̜VŽÊ“>˜ÊEÊÓ>Êv>À“iÀtÊ՘V…Ê-iÀÛi`°ÊœÀÊiµÕˆ«“i˜Ìʈ˜vœÊ«i>ÃiÊVœ˜Ì>VÌÊ̅iʏˆÃ̈˜}Ê>ÕV̈œ˜iiÀÃÊ *iÌiÀÊ œÜ˜iÞÊÓä{‡xÓӇxnnÎʜÀÊ Ài˜ÌÊ ÀœÜiÊÓä{‡xÓӇÈÓÓ{ Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Saskatchewan FarmLIFE, Monday, March 19, 2012

KINDERSLEY MAINLINE Motor Products Ltd

Canada

1-800-661-8228

PAGE 15

Canada

or 306-463-2653

$172 bi weekly w/ $5,000 cash or trade down

2011 CHEV 1500 4WD CREW CAB 143.5” LS CHEYENNE EDITION 4.8L SFI flex fuel V8 (Vortec) engine, 4-sp automatic transmission w/OD, heavy-duty trailering equipment with hitch platform, AM/FM stereo with MP3 compatible CD player MSRP $41,625

SALE PRICE $26,395+taxes

Optimum PRE-OWNED CARS 2008 CHEV COBALT LT SEDAN .............. SALE $11,995 2.2L 4 -cyl, auto, A/C/T, CD, power w/l, front buckets, remote start, sunroof, aluminum wheels, 23,245 km, V red, grey cloth 2009 TOYOTA CAMRY SE SEDAN ......... SALE $14,995 2.5L 4-cyl, auto A/C/T, CD, power w/l, heated front buckets, aluminum wheels, sunroof, 112,525 km, silver, gray leather 2011 CHEV MALIBU LT SEDAN ..............................SALE $19,995 3.5L V6, auto, A/C/T, CD, power w/l, front buckets, power seat, remote start, 19,967 km, goldmist, ebony leather 2011 CHEV IMPALA LT .............................................SALE $18,995 3.5L V6, auto A/C/T, CD, power w/l, front buckets, power seat, remote start, aluminum wheels, 22,735 km, white, ebony cloth 2011 CHEV IMPALA LT .............................................SALE $18,995 3.5L V6, auto A/C/T, CD, power w/l, front buckets, power seat, remote start, aluminum wheels, 29,849 km, goldmist, ebony cloth 2011 CHEV IMPALA LT .............................................SALE $18,995 3.5L V6, auto A/C/T, CD, power w/l, front buckets, power seat, remote start, aluminum wheels, 21,612 km, silver, ebony cloth

Optimum PRE-OWNED TRUCKS 2005 GMC ½ TON CREW CAB 4X4 SLE .................SALE $18,995 5.3L V8, auto A/C/T, CD, power w/l, split front bench,power seat, aluminum wheels, autotrac 4X4, 99,498 km, maroon, ebony cloth 2007 GMC ½ TON CREW CAB 4X4 SLE ......SALE $18,495 5.3L V8, auto, A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, autotrac 4x4, steps, 110,758 km, white, tan cloth 2008 GMC ½ TON CREW CAB 4X4 SLE .....SALE $19,995 5.3L V8, auto, A/C/T, CD, power w/l, front buckets, power seat, sunroof, aluminum wheels, 132,540 km, red, ebony cloth 2008 GMC ½ TON EXT CAB 2WD SLE .. SALE $18,995 5.3L V8, auto A/C/T, CD, power w/l, split seat, power seat, 94,117 km, silver, ebony cloth 2008 GMC ¾ TON CREW CAB 4X4 SLE ......SALE $17,995 6.0L V8, auto A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, 143,201 km, silver, ebony cloth 2009 CHEV ¾ TON CREW CAB 4X4 LT ........SALE $37,995 Duramax, auto A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, steps, flaps, 113,482 km, black, ebony cloth 2009 CHEV ¾ TON CREW CAB 4X4 LT ........SALE $22,995 6.0L V8, auto A/C/T, CD, Power w/l, split front bench, power seat, remote start, autotrac 4X4, aluminum wheels, 110,886 km, black, ebony cloth 2009 GMC ½ TON EXT CAB 4X4 SLE .....................SALE $26,995 5.3L V8, auto A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, autotrac 4X4, 13,209 km, maroon, ebony cloth 2009 GMC ½ TON CREW CAB 4X4 SLE .................SALE $28,995 5.3L V8, auto A/C/T, CD, power w/l, front bench, power seat, aluminum wheels, autotrac 4X4, 46,123 km, dk blue, ebony cloth

2011 CHEV IMPALA 4DR SEDAN LT

2011 BUICK ICK LACROSSE 4DR SEDAN CXL A AWD

3.5L V6, 4-sp automatic transmission w/OD, AM/FM stereo, CD, MP3, XM Satellite radio, rear spoiler, summit white, ebony cloth MSRP $31,525

3.6L V6, 6-sp automatic transmission w/OD, AM/FM sterio, CD, MP3, XM Satellite radio, Quicksilver metallic, ebony leather MSRP $42,675

SALE PRICE $22,995+taxes

FINANCE PRICE $30,995+taxes

2009 GMC ½ TON EXT CAB 4X4 SLE .... SALE $21,995 4.8L V8, auto A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, 55,407 km, white, ebony cloth 2009 CHEV ½ TON CREW CAB 4X4 LT ........SALE $26,995 5.3L V8, auto, A/C/T, CD, power w/l, aluminum wheels, autotrac 4x4, 78,859 km, silver, ebony cloth 2009 CHEV ½ TON CREW CAB 4X4 LTZ SALE $32,995 6.2L V8, auto A/C/T, CD, power w/l, heated front buckets, power seats, sunroof, DVD, nav, 20” wheels, 75,404 km, black, ebony leather 2009 CHEV ½ TON CREW CAB 4X4 LTZ SALE $19,995 5.3L V8, A/C/T, CD, power heated front buckets, power seats, remote start, sunroof, DVD, 20” wheels, 195,690 km, dia white, ebony leather 2009 CHEV ½TON EXT CAB 4X4 LT ....... SALE $24,995 5.3L V8, A/C/T, CD, power w/l, split bench, aluminum wheels, autotrac 4X4, 93,100 km, v red, ebony cloth 2009 CHEV COLORADO CREW CAB 4X4 LT ... SALE $23,995 3.7L V6,A/C/T, CD, power w/l, front buckets, sluminum wheels, 53,153 km v red ebony cloth 2009 CHEV AVALANCHE 4X4 Z71 .......... SALE $32,995 5.3L V8, A/C/T, CD, power w/l, heated front buckets, power seats, remote start, steps, aluminum wheels, 62,772 km, black, ebony leather 2010 GMC ½ TON CREW CAB 4X4 SLE ......SALE $33,995 5.3L V8, auto A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, autotrac 4X4, 21,737 km, dk blue, ebony cloth 2010 GMC ½ TON CREW CAB 4X4 SLE ......SALE $24,995 3.5L V8, auto A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, autotrac, 4X4 Z-71 off rd, 60,024 km, silver, ebony cloth 2010 GMC ½ TON EXT CAB 4X4 LT .............SALE $29,900 5.3L V8, auto A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, autotrac 4X4, 49,801 km, white, ebony cloth 2010 CHEV ¾TON CREW CAB 4X4 LT .........SALE $36,995 6.0L V8, auto A/C/T, CD, power w/l, split front bench, power seat, remote start, aluminum wheels, autotrac 4X4, 18,041 km, blue granite, ebony cloth 2010 CHEV AVALANCHE 4X4 LTZ .......... SALE $39,995 5.3L V8, A/C/T, CD, power w/l, heated front buckets, power seats, remote start, 20” wheels, nav, steps, 69,525 km, diamon white, tan leather 2010 FORD F150 CREW CAB 4X4 XLT.....................SALE $32,900 5.4L V8, auto A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, 69,850 km, black, ebony cloth 2011 GMC ½ TON CREW CAB 4X4 SLE .................SALE $27,995 5.3L V8, auto A/C/T, CD, power w/l, split front bench, power seat, aluminum wheels, autotrac 4X4, 62,873 km, silver, ebony cloth 2011 GMC ½ TON EXT CAB 4X4 W/T.... SALE $23,995 4.8L V8, A/C/T, split bench, power locks, 40,023 km, white, gray cloth 2011 GMC ½ TON CREW CAB 4X4 SLT ......SALE $38,995 6.2L V8, auto A/C/T, CD, power w/l, heated front buckets, power seats, remote start, sunroof, 20” wheels, 15,123 km, red, ebony leather

Optimum PRE-OWNED VANS & SUVS 2006 FORD ESCAPE AWD XLT ............... SALE $15,995 3.0L V6, auto, A/C/T, CD, power w/l, heated front buckets, power seat, aluminum wheels, 53,015 km, maroon, grey leather 2007 PONTIAC TORRENT FWD.............. SALE $14,995 3.4L V6, auto, A/C/T, CD, power w/l, front buckets, remote start, aluminum wheels, 61,665 km, goldmist, ebony cloth 2007 GMC YUKON XL DENALI AWD .... SALE $34,995 6.2L V8, auto, A/C/T, CD, power w/l, heated front buckets, power seats, sunroof, DVD, nav, 20” wheels, 7 pass, 113,598 km, white, tan leather 2007 CHEV UPLANDER LT EX VAN ....... SALE $11,995 3.9L V6, auto A/C/T, CD, power w/l, front buckets, power seat, 7 pass, rear air & heat, 120,649 km, dk gray cloth 2008 BUICK ENCLAVE AWD CXL........... SALE $26,950 3.6L V6, auto A/C/T, CD, power w/l, heated front buckets, power seats, remote start, aluminum wheels, nav DVD, power liftgate, 62,525 km, cocoa, tan leather 2008 CADILLAC ESCALADE AWD ......... SALE $37,995 6.2L V8, A/C/T, CD, loaded w/ 20” aluminum wheels, nav DVD, sunroof, 114,099 km, diamond white, ebony leather 2008 PONTIAC TORRENT AWD ....................... SALE $19,995 3.4L V6, A/C/T, CD, power w/l, heated front buckets, power seat, remote start, sunroof, dk gray, ebony leather 2009 GMC ACADIA AWD SLE ................ SALE $23,995 3.6L V6, auto, A/C/T, CD, power w/l, front buckets, power seat, remote start, aluminum wheels, 102,964 km, dark crimson, ebony cloth 2009 BUICK ENCLAVE CXL AWD........... SALE $27,995 3.6L, V6, auto, A/C/T, CD, power w/l, heated & cooled front buckets, power seats, remote start, sunroof, DVD, 106,467 km, black granite, gray leather 2009 BUICK ENCLAVE AWD CXL........... SALE $27,995 3.6L V6, auto, A/C/T, CD, power w/l, heated & cooled seats, remote start, sunroof, chrome wheels, DVD, NAV, 93,685 km, cocoa, tan leather 2009 CHEV TRAVERSE AWD LS............. SALE $21,995 3.6L V6, auto, A/C/T, CD, power w/l, front buckets, 87,245 km, black granite, grey cloth 2009 CHEV TRAVERSE AWD .................. SALE $27,995 3.6L V6, auto A/C/T, CD, power w/l, CD, power w/l, front buckets, remote start, aluminum wheels, sunroof, DVD, 72,865 km 2011 GMC YUKON XL 4X4 SLT .............. SALE $39,995 5.3l V8, auto, A/C/T, CD, power w/l, heated front buckets, power seats, sunroof, aluminum wheels, autotrac 4x4, boards, 8 pass, 38,696 km, white, ebony leather 2011 GMC YUKON 4X4 SLT .....................................SALE $41,995 5.3L V8, auto A/C/T, CD, power w/l, heated front buckets, power seats, remote start, boards, rear air & heat, sunroof aluminum wheels, autotrac 4X4, 39,252 km, mocha steel met, ebony leather

Mon, Tues, Wed & Fri 8-6,

Thurs 8-9,

2011 CHEV TRAVERSE AWD LT ..............................SALE $29,995 3.6L V6, auto, A/C/T, CD, power w/l, front buckets, power seat, 7 pass, aluminum wheels, 40,859 km, silver, grey cloth 2011 CHEV EQUINOX 2LT AWD ............. SALE $30,995 3.0L V6, auto A/C/T, CD, power w/l, heated front buckets, power seat, remote start, power liftgate, rear view camera, sunroof, aluminum wheels, 21,002 km, mocha, ebony leather

PRE-OWNED VEHICLES IN-STOCK 1999 GMC SUBURBAN 4X4...................... SALE $6,995 6.5L turbo diesel, auto A/C/T, CD, power w/l, 259,709 km, white, blue cloth 2001 PONTIAC SUNFIRE GT COUPE....... SALE $2,995 2.4L 4-cyl, 5 Spd, A/C/T, CD, power w/l, sunroof, aluminum wheels, 205,526 km red, grey cloth 2003 PONTIAC GRAND PRIX GTP SEDAN ..SALE $6,995 3.8L V6, supercharged, A/C/T, CD, power w/l, heated front buckets, power seats, sunroof, aluminum wheels, 129,985 km, black, ebony leather 2003 CHEV MONTE CARLO COUPE LS ....................SALE $6,995 3.4L V6, auto A/C/T, Cd, power w/l, front buckets, power seat, aluminum wheels, 130,241 km, silver, gray cloth 2004 GMC ½ TON EXT CAB 2WD LS ..... SALE $8,995 4.8L V8, auto, A/C/T, CD, power w/l, front buckets, power seat, aluminum wheels, 16,2425 km, red, ebony cloth 2005 DODGE RAM 1500 CREW CAB 4X4 SALE $9,995 4.7L V8, auto A/C/T, CD, power w/l, 165,959 km, white, gray cloth 2006 DODGE DURANGO LTD.................. SALE $17,995 5.7L Hemi, A/C/T, CD, power w/l, heated front buckets, power seat, DVD, sunroof, aluminum wheels, 148,241 km, black, gray leather 2006 GMC YUKON 4X4 SLE .................... SALE $19,995 5.3L V8, auto A/C/T, CD, power w/l, heated front buckets, power seats, boards, rear air & heat, aluminum wheels, autotrac 4X4, 147,859 km, dk gray, gray leather 2006 CHEV AVAVLANCHE 4X4 ............... SALE $15.995 5.3L, V8, auto, A/C/T, CD power w/l, front buckts, power seat, boards, aluminmum wheels, autorac 4x4, Z-71, off road, 141,193 km silver, ebony cloth 2006 FORD F350 CREW CAB 4X4 LARIAT..SALE $16,995 6.0L, power stroke auto, A/C/T, CD, power w/l, heated front buckets, power seats, 20” aluminum, 177,459 km, Dk. blue, grey leather 2007 DODGE RAM 2500 CREW CAB 4X4 SLT SALE $14,995 5.7L, hemi, auto, A/C/T, CD, power w/l, split bench, aluminium wheels, 16,2425 km, blue, ebony cloth 2008 GMC ½ TON CREW CAB 4X4 SLE SALE $16,995 5.3L V8, auto A/C/T, CD, power w/l, split front bench, power seat, remote start, autotrac, 4x4, Z-71, off-road, 150,147 km, Dk grey, ebony cloth 2008 GMC ½ TON EXT CAB 4X4 W/T ... SALE $14,995 4.8L V8, auto, A/C/T, CD, 161,205 km, blue grey, ebony cloth

Sat 8-6

website: kindersleymainline.net email: info@kindersleymainline.net


PAGE 16

Saskatchewan FarmLIFE, Monday, March 19, 2012

UNRESERVED RETIREMENT FARM AUCTION

FOR BERNARD & LOUISE TRINDER of LANGENBURG, SK.

TUESDAY APRIL 17th 11:00AM (Sask Time)

DIRECTIONS: From: Binscarth, MB. (Jct of #16 & #478 hwy) Go west 15.5kms on hwy #478 to jct of #579 – Turn north 5kms on #579 to road 114N Turn west 2.5kms on road 114N - Turn south into yard (Watch for signs sale day) From: Russell, MB. (#16 Yellowhead Highway) Go west on #16 hwy to road 173W (notice road 173W is just east of the MB/SK border) Turn south 10kms on road 173W to road 114N - Turn west 2.5kms on road 114N Turn south into yard (Watch for signs sale day) From: Langenburg, SK. (#16 Yellowhead Highway) Go east on #16 hwy to road 173W (notice road 173W is just east of the MB/SK border) Turn south 10kms on road 173W to road 114N - Turn west 2.5kms on road 114N Turn south into yard (Watch for signs sale day) ORDER OF SALE:Ê11:00am – 1:00pm (misc, tools, shop equipment, livestock related items, tanks, pumps) 1:00pm (major equipment)

TRACTORS: UÊ£™™nÊ >ÃiÊ8££äÊ7 ʙx…«ÊÜÉ >ÃiÊÎääÊ -ʏœ>`iÀ]ÊLÕVŽiÌ]Ê}À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊΫÌ]ÊÎÊ Ài“œÌiʅÞ`]Ê`Õ>Ê*/"]Ê«ÜÀʵÕ>`ÊÌÀ>˜Ã]Ê£n°{,ÎnÊÀi>ÀÊ Ãˆ˜}iÃ]Ê£{°™,ÓnÊvÀœ˜Ì]ÊÇΙx…ÀÃÊŜ܈˜}]Ê ÃɘäänÎxÎn UÊ£™™ÓÊ >ÃiÊÇ£ÎäÊ7 Ê£ÇӅ«ÊÜÉ£në`Ê«ÜÀÊ Ã…ˆvÌ]ÊÎÊÀi“œÌiʅÞ`]Ê£äääÊ*/"]ÊvÀœ˜ÌÊÜiˆ}…ÌʎˆÌ]Ê Óä°n,ÎnÊ`Õ>ÃÊÀi>À]Ê£n°{,ÓnÊȘ}iÃÊvÀœ˜Ì]ÊxxÇ{…ÀÃÊ Ã…œÜˆ˜}]ÊÃɘääΙÈÈ{]Ê­fn]äää°ääÊëi˜ÌÊëÀˆ˜}ʜvÊ Óä£ä°Ê1˜ˆÌÊÜi˜ÌÊ̅ÀœÕ}…ÊÀi`ʏˆ}…ÌÊ`i>iÀʈ˜Ã«iV̈œ˜°® UÊÊÈÓ{Ê`ÏÊÜÉÓÊÀi“œÌiʅÞ`]Êx{äÊ*/"]ÊvœÀÜ>À`É ÀiÛiÀÃiÊÅÕÌ̏i]ʘiÜiÀʣȰ™‡ÎäÊÀÕLLiÀ UÊÊ{{{Ê`ÏÊÜɏœ>`iÀ]ÊΫÌ]Êx{äÊ*/"]ÊȘ}iʅÞ` HARVEST EQUIPMENT: UÊ£™nÈÊ ÊÇÇÓ£Ê/ˆÌ>˜ÊÊ«ÌÊVœ“Lˆ˜iÊÜÉȘ}iÊë`ÊVޏ]Ê ˆÀvœˆÊÈiÛi]ʘiÜiÀÊÓࣇÓÈÊÀÕLLiÀ]ÊÃɘȣx{n{ UÊ£™™™Ê >ÃiÊÓx½ÊnÓÓäÊ«ÌÊÃÜ>̅iÀÊÜÉ«ˆVŽ‡Õ«ÊÀii]Ê Ãɘ ä£ÈÈäǙ UÊÓ{½Ê6iÀÃ>̈iʛ£äÊ«ÌÊÃÜ>̅iÀ UÊǽʫœÞÊÃÜ>̅ÊÀœiÀ UÊ ˆVŽˆiÊœ…˜Êˆ˜ˆÊ  Ê}À>ˆ˜Ê“œˆÃÌÕÀiÊÌiÃÌiÀ HAYING EQUIPMENT: UÊ£™™nÊiÃÃ̜˜Êx£{ÊÀ`ÊL>iÀÊÃɘääÇÎÓ UÊ£™™£Ê >ÃiÊnÎÇäÊ£{½Ê“œÜiÀÊVœ˜`ˆÌˆœ˜iÀÊ Ãɘ ääänn™{ UÊ>ÞʓœˆÃÌÕÀiÊÌiÃÌÊ«ÀœLi FEED PROCESSING EQUIPMENT: UÊÓäääʈ}…ˆ˜iÊ >iÊ*ÀœÊÇäääÊ*ÕÃÊL>iÊ«ÀœViÃÜÀÊ ÜÉ£äääÊ*/"]ÊÃɘ *ÇäÓä{™Î£ UÊ ÊÎxnʅ>““iÀʓˆÊÜÉ«ÜÀÊL>iÊvii` TRUCKS & TRAILERS: UÊ£™nÎÊ …iÛÊ ÇäÊÃÉ>Ê}À>ˆ˜ÊÌÀÕVŽÊÜÉ£È½Ê ³]ÊÀœÊ Ì>À«]ÊÎÈÈÊ}>Ã]Êx³ÓÊÌÀ>˜Ã]Ê£ÎǙ{Ȏ“ÃÊŜ܈˜}]Ê Ãɘ£ Ç £ È 6£Óx™™™ UÊ£™ÇÎÊ …iÛÊ xäÊÃÉ>Ê}À>ˆ˜ÊÌÀÕVŽÊÜÉ£{½Ê ³]ÊәÓÊ }>Ã]Ê{Êë`ÊÌÀ>˜ÃÊ­˜œÌʏˆVi˜Ãi`ÊÞ>À`ÊÌÀÕVŽÊœ˜Þ® UÊÓääÓÊ£È½Ê Õ˜V>˜ÊÌÉ>ÊÃ̜VŽÊÌÀ>ˆiÀÊÜÉÇäääLÃÊ>ݏiÃ]Ê ÃÉ˜Ó ™{n™Ó,äÈ䙣ä UÊÓn½Ê-…œ«Ê ՈÌÊÌÀˆ«iÊ>ÝiÊÜ>}œ˜Ê­“œLˆiʅœ“iÊ >ÝiÃ® UÊ-…œ«Ê ՈÌÊÃÉ>ʓi`ˆÕ“Ê`ÕÌÞÊVœ˜ÛiÀÌiÀÊ`œÞ

3PT MOWERS & YARD SPRAYER: UÊx½ÊÊΫÌÊÀœÕ}…ÊVÕÌÊÀœÌ>ÀÞʓœÜiÀ UÊǽÊ/iV“>ÊÓÎäÊΫÌÊvˆ˜ˆÃ…ˆ˜}ʓœÜiÀÊÜÉÀi>ÀÊ `ˆÃV…>À}i Uʈ“VœÊÌÀ>ˆiÀÊÃÌޏiÊÞ>À`ÊëÀ>ÞiÀÊÜÉ£ÓۜÌʫՓ« AUGERS & AREATION FANS: UÊ£ä»8x£½Ê7iÃÌvˆi`Ê*/"ÊÃ܈˜}ʅœ««iÀÊ>Õ}iÀ UÊÇ»8Îx½Ê À>˜`ÌÊ>Õ}iÀÊÜÉ 7Ê£n…«Êœ…iÀÊiiVÌÀˆVÊ ÃÌ>ÀÌÊi˜}ˆ˜i UÊ7…i>ÌÊi>ÀÌÊLˆ˜ÊÃÜii« UÊÈ»Ê>Õ}iÀÊÜÉ΅«Ê£«…ÊiiVÌÀˆVʓœÌœÀÊ­ÕÃi`ÊvœÀÊ viÀ̈ˆâiÀ® UÊÈ»Ê>Õ}iÀÊÜɅÞ`ʓœÌœÀʜ˜ÊÀ՘˜ˆ˜}Ê}i>ÀÊ­ÕÃi`ÊÌœÊ vii`ʓˆ® UÊ«œÞÊ>Õ}iÀʅœ««iÀà UÊ­Ó®Ê>À“Ê>˜ÃÊ>iÀ>̈œ˜Êv>˜Ã Uʏi˜}̅ʜvÊÓÓäÊۜÌÊiÝÌi˜Ãˆœ˜ÊVœÀ` SEED & TILLAGE EQUIPMENT: UÊÎ{½Ê œÕÀ}>ՏÌÊ œ““>˜`iÀÊÎ{‡ÎnÊ̈>}iÊÜÉ>ˆÀÊ Ãii`iÀʎˆÌ]Ên»Êë>Vˆ˜}]ʓœÕ˜Ìi`ʅ>ÀÀœÜÃ]ÊœÀÀˆÃÊ i˜iÈÃÊÊ£ääÊ-iÀˆiÃÊ̜ÜÊLiÌÜii˜Ê>ˆÀÊÌ>˜Ž]Ê*/"Êv>˜ UÊә½ÊœÀÀˆÃÊ>}˜Õ“Ê *ÇÓxÊV…ˆÃiÊ«œÜÊÜÉ ÎʎˆÌ]Ê ÎÊL>ÀʓœÕ˜Ìi`ʅ>ÀÀœÜà UÊÈä½Êi݈‡ œˆÊ-ÞÃÌi“Ê™xʅ>ÀÀœÜÊ«>VŽiÀÊL>À UÊ ÀœÜ˜ÊÈÊÞ`ʅÞ`ÊÃVÀ>«iÀ UÊÓä½ÊiœÕ}…ÊÓ£äÊ-iÀˆiÃÊÌ>˜`i“Ê`ˆÃŽÊÜɘœÌV…i`Ê`ˆÃŽÃ UÊxä½ÊiÀ“>˜Ê…Þ`ʅ>ÀÀœÜà UÊÈn½Ê6iÀÃ>̈iÊÎäääÊ«ÌÊëÀ>ÞiÀÊÜÉnää}>Ê«œÞÊÌ>˜Ž]Ê */"ʫՓ«]ÊV…i“Ê“ˆÝÊÌ>˜Ž UÊ£{½Ê`ii«Ê̈>}i UÊ i}i“>˜ÊÀœÌ>ÀÞÊÃ̜˜iÊ«ˆVŽiÀ LIVESTOCK ITEMS: UÊ,>˜V…iÀÃÊ7i`ˆ˜}ÊÎÊL>iÊvii`iÀÊÜÉÀi“œÛ>LiÊi˜`Ê «>˜iÊœ˜ÊΈ`à UÊ-…œ«Ê ՈÌʓ>ÌiÀ˜ˆÌÞÊ«i˜ÊÜɅi>`Ê}>Ìi UÊ-iiV̈œ˜ÊœvÊ£»ÊÌÕLˆ˜}Ê«>˜iÃÊ­n»‡£ä½‡£Ó½® UÊÀœÕ˜`ÊL>iÊvii`iÀà UÊÌÀi>Ìi`Êvi˜ViÊ«œÃÌà UÊvi˜ViÊÃÌ>Þà UʭӮʫœÞʓˆ˜iÀ>Êvii`iÀÃÊÜÉÀÕLLiÀÊ̜«Ã UÊ-̜VŽÊ œV̜À UÊÃÜÀ̓i˜ÌʜvÊÛiÌÊÃÕ««ˆiÃÊ­ÃÞÀˆ˜}iÃ]ÊÌ>}}iÀÃ]Ê ÕÀ`iââœÃ]ÊiVÌ°® UÊV>vʫՏiÀ UÊ«œÞÊV>vÊÏiˆ}… UÊvi˜Vˆ˜}Ê̜œÃ

TANKS: UÊ£Óää}>Ê«œÞÊÜ>ÌiÀÊÌ>˜ŽÊ­L>VŽ® UÊxää}>ÊvÕiÊÌ>˜ŽÊÜÉÃÌ>˜` UÊxä}>ÊΈ`ÊÌ>˜ŽÊÜɅ>˜`ʫՓ« PUMPS & HOSE: UÊÓ»ÊÜ>ÌiÀʫՓ«ÊÜÉx…«Ê ³-Êi˜}ˆ˜i UÊÓ»Ê`ˆÃV…>À}iʅœÃi UÊ ÎʅœÃi UÊ>ˆÀÊÃii`iÀʅœÃi SHOP EQUIPMENT & TOOLS: UÊÕõÛ>À˜>ÊÎ{xÊV…>ˆ˜ÊÃ>Ü UÊ-Ê É

Ê>ÀVÊÜi`iÀ UʜÝÞÉ>ViÌÊ̜ÀV…ÊÜÉv>À“iÀʜܘiÀʓˆ˜ˆÊLœÌ̏ià UÊ£ÈÊë`Ê`ÀˆÊ«ÀiÃà UʓiÌ>ÊVÕÌ̈˜}ÊV…œ«ÊÃ>Ü UʭӮʫœÀÌ>LiÊ>ˆÀÊVœ“«ÀiÃÜÀà UʭӮʫœÀÌ>LiÊ>ˆÀÊÌ>˜ŽÃ UÊ­Ó®ÊL>ÌÌiÀÞÊLœœÃÌiÀÊV…>À}iÀà UÊ>˜Ûˆ UÊۈÃiʜ˜ÊÃÌ>˜` UÊ ÊÌÀÕVŽÊÀ>“«Ã UÊL>ÀÀiÊ«Õ“«Ã UÊ̜«Ê>˜`ÊLœÌ̜“Ê̜œÊV…iÃÌ UÊ>ÃÜÀÌi`ʅ>˜`Ê̜œÃʭÜVŽiÌÃ]ÊÜÀi˜V…iÃ]ÊiVÌ°® UÊÎÉ{»ÊÜVŽiÌÊÃiÌà UÊvœœÀʍ>VŽÃ UÊ}Ài>ÃiÊ}՘à UÊ-…œ«Ê6>V UÊVœ˜ÃÌÀÕV̈œ˜Ê…i>ÌiÀ UÊ>VŽ‡Ê>VŽÃ UÊÞ>À`Ê̜œÃʭŜÛiÃ]ÊvœÀŽÃ]ÊiVÌ°® MISC: UÊ£n…«Ê ³-Ê>Õ}iÀʓœÌœÀ UʅÞ`ÊVޏ UÊiiVÌÀˆVʓœÌœÀà UÊ*/"Ê>`>«ÌiÀà UÊVÀÞÃÌ>ÊÃÌޏiÊÊÀ>`ˆœÃÊ­{‡xÊ՘ˆÌî

FOR MORE INFO CONTACT OWNER

iÀ˜>À`ÊEʜՈÃiÊ/Àˆ˜`iÀ œ“iÊÎäȇÇ{·ÓnÈnÊ œÀÊ iÊÓä{‡Ç™È‡£ÓnÓ

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Saskatchewan FarmLIFE, Monday, March 19, 2012

Tractors

33’ Ezee-On 7500 Air Drill c/w 10�Spacing S Air $28,500

2003 John Deere 250 c/w cab A/C, 2400 hrs, skid steer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $24,500

50’ Flexicoil Heavy Harrow App 18� tines. . . $16,500

Âś6SUD &RXSH

35’ Flexicoil Hdy Wing Back Packer Bar . . . . . $5,000

2007 M125 Kubota FWA c/w loader & grapple, 2900 hrs . . . . . . . . . . . . $62,500 2006 Kubota M5040 c/w Loader . . . . . . . . . $29,500 10’ Leon dozer blade . . . . . . . . . . . . . . . . . . . $1,500 Deutz DX 3.70 c/w loader + 3p.h. . . . . . . . . $16,500 1975-885 David Brown c/w 3p.h.. . . . . . . . . . $4,950

Lawn & Garden 2008 Kubota T2080 c/w mower . . . . . . . . . . . $2,850

1982 John Deere 4640 JD c/w duals . . . . . . $24,500

2005 Kubota L3130 HST . . . . . . . . . . . . . . . $13,500

1975 John Deere 4430 only 7200 hrs . . . . . $16,800

2006 T1670 Kubota c/w 44� Deck . . . . . . . . . $2,800

1984 Case 2294 c/w duals . . . . . . . . . . . . . . $14,000

2-2007 Club Car Golf Carts . . . . . . . . . . $2,400 each

2005 McCormick FWA MC115, 5500 hrs, Loader . .$59,500

RTV 900 c/w Top + Windsheild . . . . . . . . . . $10,900

Combines 2- R62 Gleaner Combines . . . . . . . . . . $38,500 each



Âś-' 676 6HS+UV

2004 R-65 Gleaner c/w P/U, app. 850 hrs . . . $149,500

2006 9020 16’ Auger Header . . . . . . . . . . . . $17,500

1993 R-72 c/w P/U Gleaner . . . . . . . . . . . . . $48,500

12 x 60 Spray Air Swing Auger . . . . . . . . . . . $8,500

Seeding & Tillage

1-16’ 2-14’ Hesston Auger headers . . . $10,500 each

1982 Morris CP 731 Cult, c/w 6130 tank . . . $12,500

Highline 7000 Bale processor . . . . . . . . . . . . $9,500

33’ Flexicoil 5000 c/w, 10� . . . . . . . . . . . . . . . . . . . $29,500

+UV 'XDOV

2009 Hesston 1275 Haybine . . . . . . . . . . . . $13,900 2001 Hesston 856 Baler. . . . . . . . . . . . . . . . $12,500

2001 Hesston 856 Baler. . . . . . . . . . . . . . . . $12,500

&,+

Miscellaneous

2008 A85 Gleaner, 890 hrs. . . . . . . . . . . . . $245,000

1990 Bourgault WR1566 Packer Bar, 49’ . . . . $5,000



B 5100E Kubota c/w tiller . . . . . . . . . . . . . . . . $4,500

3130 John Deere c/w cab, 850 hrs, like new $16,500

1991 Ford 8830 c/w duals, excellent . . . . . . $29,500

¡6PDUWUD[ 36):$

B 2782 Kubota 3 P.H. snow blower . . . . . . . . $1,700

2-2005 Kubota F2560 Front cut mower . . . $12,500 ea

PAGE 17

+27 '($/6 21 86(' (48,30(17

Ezee-On 3175 Ground Drive A.T. . . . . . . . . . $12,500



&RPELQHV &,+'XDOV+UV  &,+·V )URP &,+'XDOV$XWR6WHHU &,+ 6ZDWK0DVWHU38 &,+·V )URP &,+ 'XDOV$XWRVWHHU 

6HHGLQJ &,+·)+ 7%+0HFK %285*$8/7· 7%+05%·V  0255,60$;;,,· 7%+ 

$SSOLFDWLRQ &,+'LYLGHUV9LSHU/RDGHG  635$&283(·):$*DO  &,+ ·)ORDWHUV$6WHHU  -'·'LYLGHUV$XWR6WHHU)ORDWHUV $3$&+(·(=6WHHU&DSVWDQ $,0  635$&283(·$XWR6WHHU  52*$725·

6ZDWKHUV

Âś1+ &5

5DNH8S38 5('8&('



:(67:$5'0 ·'  &,+ ·+'6ZDWK5ROOHU  :(67:$5'0 ·'  367$5L ·  367$5 ·  0)·8,, 38 5HHO 

2010 Sakundiak 10 x 66’ new cond . . . . . . . . $9,500 1993 8465 Case IH Baler, Excellent Cond. . . . $6,500

45’ Flexicoil 5000 c/w 2320 Tank, 7� Spacing . . $29,500

Agshield 300 P.T. Crimper . . . . . . . . . . . . . . $12,500

Morris 7180 Air Tank, Single Air . . . . . . . . . $16,500

2500 Rem Grain Vac . . . . . . . . . . . . . . . . . . $16,500

Prince Albert (306) 763-6454

Melfort (306) 752-2273

For pictures and more details visit www.mokerthompson.com

North Battleford, SK

Ph 306.445.2427

NOTHING RUNS, WORKS, OR OUTPERFORMS LIKE A ROGATOR. NOTHING. In some ways it’s not even fair. RoGator’s been dominating the professional-grade sprayer category for years. And then we go and build the 2012s. Just look at them. A redesigned cab for enhanced comfort, greater visibility and reduced noise levels of up to 10 decibels. And underneath that sleek exterior, our proven drive package has been joined by an AGCO Power 8.4-liter diesel engine with more horsepower than ever. Add it all up and you’ve got the best RoGator to ever roll off the line. And that’s saying something. No matter what color you’re running now, do yourself a favor and test drive a new RoGator at a dealer near you.

Used Combines

Used Combine Heads

WE NEED COMBINE TRADES!!! 2009 MF 9895

$269,000

Chopper, chaff spreader, lateral tilt, autolube, swathmaster 2008 Challenger 680B

CALL

Chopper, chaff spreader, lateral tilt, swathmaster, warranty 2006 Case IH 8010

$199,000

Duals, chopper, lateral tilt, 2014 swathmaster 2004 MF 9790

$149,000

Chopper, chaff spreader, swathmaster, 1638 hrs 2003 MF 9790

$149,000

Chopper, chaff spreader, Swathmaster, 1262 hrs 1999 Case IH 2388

$77,500

Used Tractors

WE NEED TRACTOR TRADES!!!

Chopper, spreaders, swathmaster

2006 Case IH MXM140 Pro

0% financing available

1998 MF 4255

FWA AND

2 COMING COMING 2 COMING

Used Swathers 0% for 3 years

Used Seeding & Tillage

fwa, 3495 hrs $28,000

Used Hay Tools 2 COMING

2006 Challenger SP115C $79,900 115 hp,2 speed, deluxe cab, 36’ pu reel, gauge wheels

$51,000

We hear you.

Whitewood, SK

2012 Rogator RG1300 370 hp, 1300 gal, 120’ boom, loaded 2012 Rogator RG1100 337 hp, 1100 gal, 100’ boom, loaded 2012 Rogator RG900 305 hp, 900 gal, 100’ boom 2012 Spray-Coupe 7660 90’ boom, 2wd & fwa

4WD!!!

fwa, loader/ grapple

WSW

Sprayers

2008 Challenger FHB35 Call 35’ ex header, pur, stainless feather sheets, poly, warranty 2005 MF 8000 $25,900 30’ pur, stainless feather sheets, poly 2005 MF 8000 $27,900 30’ pur, stainless feather sheets, poly, mint 1991 MacDon 960 $10,000 25’, pur 1995 Case IH 1020 $11,900 30’, ex, pur 2010 MacDon FD70 $63,900 35�, ex draper, pur, CIH adapter, loaded

2003 Morris Maxim II $69,000 55’, 10� spacing, 3 1/2� packers atom jet openers, liquid and alpine kits, 7300 TBH, loading auger nice 2012 Seed Hawk CALL Various sizes available

!

FOLLOW US

ON FACEBOOK & TWITTER! www.whitesag.com

@WHITES_AG

1999 Hesston 565A 5x6, auto tie 2006 Hesston 956A 5X6, autocycle, 9000 bales 2004 MacDon 5020 16’, s/s, 1000 rpm

$14,900 $17,900 $14,900

Used Miscellaneous 2006 Spray Air 4370 $13,500 13â€? x 70’ swing auger, winch Farm King 1050 $4,800 10â€? x 50’ swing auger 2011 Farm King 1385 Blow Out!!! 13â€?x85’ swing auger, various conďŹ g’s Degelman $8,000 12’ dozer blade, 4 way, mounts to ďŹ t JD 2011 EZ Trail 860 UNDER 30K!!! 860 BU grain cart, 14’ auger, tarp Valley Packing Systems $19,900 2700 gal, tow between liquid caddy 2003 Freightliner Columbia Class $25,000 460 Hp, full autoshift, day cab, fresh safety Fontaine $15,000 45’ step deck, fresh safety

After Hours Call

DON JOHNSON (306) 736-7295 DENNIS EDWARDS (306) 696-7773 BLAIR ADAMS (306) 735-7232 CURTIS LANGFORD (306)-735-7662

306-735-2300


PAGE 18

Saskatchewan FarmLIFE, Monday, March 19, 2012

UNRESERVED FARM DISPERSAL FOR CRAIG & CONNIE MYERS of BELMONT, MB.

THURSDAY APRIL 19th 12:00 noon

DIRECTIONS: Sale will be held along the highway on the east edge of the town of Belmont, MB. Belmont is located on #23 highway. Watch for signs sale day. ORDER OF SALE:Ê 12:00pm – 1:00pm – misc farm related smalls, farm tools, tanks 1:00pm – augers, seed & tillage, trucks, harvest equipment, tractors, guidance system

TRACTORS: UÊ£™™äÊœÀ`Ê6iÀÃ>̈iʙ{ÈÊ iÈ}˜>̈œ˜Ê ÈÊÎÓx…«ÊÜÉÓä°n,{ÓÊ`Õ>Ã]Ê{ÊÀi“œÌiÊ …Þ`]ÊÀiÌÕÀ˜Êˆ˜i]Ê£ÓÊë`ÊÃÌ`ÊÌÀ>˜Ã]Ê ÈӣDžÀÃÊŜ܈˜}]ÊÃɘ {x䣣ÈÊ­>««ÀœÝÊ Óxä…ÀÃʜ˜ÊVÕÌV…® UÊ£™nÎÊÊ{n{äÊÜÉÓä°n‡ÎnÊ`Õ>Ã]Ê{Ê Ài“œÌiʅÞ`]ÊÀiÌÕÀ˜Êˆ˜i]ÊÎÊë`Ê«ÜÀÊňvÌ]Ê

Փ“ˆ˜ÃʙäÎÊi˜}]ÊÈnxx…ÀÃÊŜ܈˜}]Ê Ãɘ™ ää{£ÓÈ UÊ£™È£Ê ÊÎä£äÊÜÉ£n°{‡ÎäÊȘ}iÃ]Ê ÓÊÀi“œÌiʅÞ`]ÊÃޘVÀœÊ/À>˜Ã]Êx{äÊ*/"]Ê ÈǙä…ÀÃÊŜ܈˜}]ÊÃɘ£Ó/Çn™Ç UʭήÊ/ÕÀLœÊÊ«Ài‡Vi>˜iÀà GUIDANCE SYSTEM: UÊ/Àˆ“LiÊÓxäÊ >ÃÞÊՈ`iʏˆ}…ÌÊL>ÀÊ ÃÞÃÌi“ÊÜÉ£xÊ>˜Ìi˜˜>

ÀœÊÌ>À«]ÊÈäÊÃiÀˆiÃÊ iÌÀœˆÌÊxä䅫Êi˜}]Ê £nÊë`ÊÌÀ>˜Ã]Êi˜}ˆ˜iÊLÀ>ŽiÃ]Ê{‡Ü>ÞÊ `ˆvvʏœVŽÊÕ«]ʅœˆÃÌÊVœ˜ÌÀœÃÊ>ÌÊÌ>ˆÊ}>Ìi]Ê ££,Ó{°xÊÀÕLLiÀ]Ê£{ÇÓx{Ύ“ÃÊŜ܈˜}]Ê Ãɘ£1* x< n9*£Èx™{Ê­ iÜÊÀ>`ˆ>‡ ̜À]ÊVÕÌV…Ê`œ˜iÊ>««ÀœÝÊ£Î]ää䎓Ã]Ê ÌÀ>˜ÃÊÀiLՈÌÊ>««ÀœÝÊ£ää]ää䎓Ã]Ê`Àœ«Ê ˆ˜Êi˜}ˆ˜iÊ{ää]ää䎓ÃÊ>}œ® UÊ£™Ç{Ê ÊÈxääÊÌ>}Ê>ݏiÊ}À>ˆ˜ÊÌÀÕVŽÊ ÜÉÓä½Ê ³]ÊÀœÊÌ>À«]ÊÎÈÈÊ}>ÃÊi˜}]Êx³ÓÊ /À>˜ÃÊ­ÓÊë`ʘœÌÊܜÀŽˆ˜}®]ÊxÎ]ΙxŽ“ÃÊ Ã…œÜˆ˜}]ÊÃɘ/ ÈÇ{6xÇÓä£Î UÊ£™È{ÊœÀ`ÊÈääÊÃÉ>Ê}À>ˆ˜ÊÌÀÕVŽÊÜÉ£{½Ê ³]ÊΙ£Êi˜}]Ê{³ÓÊ/À>˜Ã]ʙ°ää‡ÓäÊÀÕL‡ LiÀ]Ê{™ÓÓÎʓˆiÃÊŜ܈˜}] ÊÃɘ£n£ÈäÇ{‡£x{ÇäÓ

SEED & TILLAGE EQUIPMENT: UÊ£™™ÎÊ{ä½Ê œÕÀ}>ՏÌÊnnääÊ>ˆÀÊÃii`iÀÊ HARVEST ÜÉ œÕÀ}>ՏÌÊÓ£xxÊ>ˆÀÊÌ>˜Ž]ʅÞ`Êv>˜]Ê EQUIPMENT: UÊÓx½ÊÓää£Ê*Ài“ˆiÀÊәxäÊëÊÃÜ>̅iÀÊ }À>˜Õ>ÀʎˆÌ]ʵՈVŽÊ>ÌÌ>V…Ê«>VŽiÀÃÊ>˜`Ê ÜÉÓääÓÊ>V œ˜Ê™ÇÓʅi>`iÀÊ܈̅ÊV>˜œ‡ …>ÀÀœÜÃ]Ên»Êë>Vˆ˜}]ÊÎÇxLÃÊÌÀˆ«Ã]Ê iÜÊ …œÃiÃ]ÊÓääÊ>VÀiÃʜ˜Êϻʎ˜ˆÛiÃ]ÊVՏÌÊ >Ê>Õ}iÀʜ«Ìˆœ˜]Ê«ˆVŽ‡Õ«ÊÀii]Ê££ä…«Ê ÃɘnÓ£Ó{™]ÊÌ>˜ŽÊÃɘ{xäÈ i˜}]ÊÓÊë`ÊÌÀ>˜Ã]ÊÇ{ä…ÀÃÊŜ܈˜}]Ê UÊÓää£Ê{ä½Ê œÕÀ}>ՏÌʙ{ääÊ̈>}iÊ Ãɘ£{Ón{x ÜÉ ÎʎˆÌ]Ê{ÊL>Àʅ>ÀÀœÜÃ]ʏˆ}…ÌʎˆÌ]Ê£Ó»Ê UÊn½Ê«œÞÊÃÜ>̅ÊÀœiÀ ë>Vˆ˜}]ÊÈxäLÃÊÌÀˆ«Ã]ÊÃɘÎx™ÇÓ *ä™ UÊ£™nÎÊÊnÈäʅÞ`ÀœÊëÊVœ“Lˆ˜iÊ ÜÉÀi>ÀÊ܅iiÊ>ÃÈÃÌ]ʅÞ`ÊV…>vvÊëÀi>`iÀ]Ê UÊÈǽÊ>ÕÀˆiÀʅ>ÀÀœÜÊÉ«>VŽiÀÊL>À UÊnÓ½Ê œÕÀ}>ՏÌÊ i˜ÌÕÀˆœ˜ÊÊ«ÌÊvˆi`Ê ÇÊLiÌÊiÀœiÊ«ˆVŽ‡Õ«]Ê{™Çn…ÀÃÊŜ܇ ëÀ>ÞiÀÊÜÉ£äääÊ«œÞÊÌ>˜Ž]ʅÞ`ʫՓ«]Ê ˆ˜}]ÊÃɘ£Ç{ȇ£nÓ£È `ˆÃŽÊ“>ÀŽiÀÃ]Ê܈˜`ÊÃVÀii˜Ã]ÊÀˆ˜ÃiÊÜ>ÌiÀÊ UÊ£™nÎÊÊnÈäʅÞ`ÀœÊëÊVœ“Lˆ˜iÊ Ì>˜Ž]ÊÃɘ-‡£näx ÜɅÞ`ÊV…>vvÊëÀi>`iÀ]ÊÇÊLiÌÊiÀœiÊ UÊ i}i“>˜Ê,-xÇäÊ}ÀœÕ˜`Ê`ÀˆÛiÊÀœÌ>ÀÞÊ «ˆVŽ‡Õ«]ÊΙÈä…ÀÃÊŜ܈˜}] Ã̜˜iÊ«ˆVŽiÀÊÜÉÀœVŽÊ>«Àœ˜Ê­ iÜÊ«ˆ˜Ãʈ˜Ê ÊÃɘ£Ç{ȇ£ÇÈÇÈ L>ÎiÌÊ«ˆÛœÌÃ]ʘiÜÊLi>Àˆ˜}ÃÊ>˜`Ê«ˆœÜÊ UÊ>LÌÀœ˜ˆVÃʙ£™Ê“œˆÃÌÕÀiÊÌiÃÌiÀ LœVŽÃʈ˜ÊÀii]Ê iÜÊ̈ÀiÃ]Ê iÜÊ܅iiÊ Li>Àˆ˜}î TRUCKS: UÊiœ˜ÊvœÀŽÊÌÞ«iÊÃ̜˜iÊ«ˆVŽiÀ UÊÓäääÊÀiˆ}…̏ˆ˜iÀÊ >ÃÈVÊÌÉ>Ê}À>ˆ˜Ê UÊ{äÊ̜“ʍiÌÊV>ÀLˆ`iÊ̈«Ê Îʎ˜ˆÛià ÌÀÕVŽÊ-/ ÊÜÉÓä½Ê iÕÃÌ>ÀÊ ³]Ê

UÊœ`iÊ£ä£ÊVÕÌV…ÊÃ܈ÌV…ÊEʓœ˜ˆÌœÀÊvœÀÊ œÕÀ}>ՏÌÊÓ£xxÊ>ˆÀÊÌ>˜Ž UÊ­xä®Ê ʏœÜÊ`ÀˆvÌʘœââiÃÊ£ä}>ÊqÊ x“«…Ê­œ˜ÞÊÕÃi`ÊxääÊ>VÀiî UÊÞ«ÀœÊ…Þ`À>ՏˆVÊëÀ>ÞiÀʫՓ«Ê ­ÀiLՈÌ® AUGERS: UÊÎǽÝÇ»Ê->ŽÕ˜`ˆ>ŽÊ>Õ}iÀÊÜɣ΅«Ê i˜}ˆ˜i]ÊÃɘx™nÇ£ UÊx£½Ýn»Ê7iÃÌvˆi`Ê*/"Ê>Õ}iÀ UÊ{£½Ýn»Ê7iÃÌvˆi`Ê*/"Ê>Õ}iÀ UÊΣ½ÝÇ»Ê7iÃÌvˆi`Ê>Õ}iÀÊÜɣȅ«Ê ³-Ê i˜}ˆ˜i]Ê7…i>̅i>ÀÌÊLˆ˜ÊÃÜii« TANKS: UÊ£ÓääÊ}>Ê«œÞÊÜ>ÌiÀÊÌ>˜Ž UÊ££xÊ}>ÊΈ`ÊÌ>˜ŽÊÜÉ£ÓÊۜÌʫՓ« OTHER EQUIPMENT & MISC: UÊ{Ê܅iiÊv>À“ÊÀ>VŽ UÊÊnÈäÊ«>ÀÌà UÊÊ{n{äÊ«>ÀÌà UÊ>ˆÀÊÃii`iÀʅœÃi Uʅ>ÀÀœÜÊ̈˜ià UÊÕÃi`ÊVՏÌÊŜÛiÃ UÊ}À>ˆ˜ÊŜÛiÃ UÊ«œÞÊ>Õ}iÀʅœ««iÀà UʏœœÀʓœ`iÊ`ÀˆÊ«ÀiÃà UÊÀVÊÜi`iÀ UÊ >ÌÌiÀÞÊV…>À}iÀ UÊ«œÀÌ>LiÊ>ˆÀÊVœ“«ÀiÃÜÀ

FOR MORE INFO CONTACT OWNER

,Ê9 ,-Ê Óä{‡nÓLJÓ{nÓʅœ“iÊ œÀÊÓä{‡ÇÓ䇙{{ÇÊVi

AUCTIONEERS NOTES:Ê/…iÊÞiÀÃÊv>“ˆÞʅ>ÃÊLii˜Ê>ÊÛiÀÞÊÜiÊŽ˜œÜ˜Êv>À“Êv>“ˆÞʈ˜Ê̅iÊVœ““Õ˜ˆÌÞÊvœÀÊ }i˜iÀ>̈œ˜Ã°Ê/…iÊiµÕˆ«“i˜ÌʈÃÊÛiÀÞÊÜiÊ“>ˆ˜Ì>ˆ˜i`Ê>˜`Ê܈ÊLiÊvˆi`ÊÀi>`Þ°Ê"ˆÃÊ>˜`ÊvˆÌiÀÃÊ܈ÊLiÊV…>˜}i`Ê>˜`Ê À>ˆ}Ê ÜˆÊ…>ÛiÊ}œ˜iÊ̅ÀœÕ}…Ê̅iÊiµÕˆ«“i˜ÌÊ>ÃʈvʅiÊÜ>ÃÊ}œˆ˜}Ê̜Ê̅iÊvˆi`Ê̅ˆÃÊëÀˆ˜}ʅˆ“Ãiv°Ê>ÀŽÊ̅ˆÃÊÃ>iÊ`>Ìiʜ˜ÊޜÕÀÊ V>i˜`>ÀÊ>˜`Ê«i>ÃiÊ«>˜Ê̜Ê>ÌÌi˜`° Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell 2012


Saskatchewan FarmLIFE, Monday, March 19, 2012

When

PAGE 19

Hawaiian Farm Tour

Quality Counts Counts h Travel wit mers other Far in 2013!

2 Weeks - 4 Islands $2099* from

·The HEAVIEST metal · The STRONGEST posts ·SUPERIOR craftsmanship p

Choose Prairie Post Frame

Travel with other farmers on January departures in 2013 on this famous Hawaiian Farm Tour offered by YMT every year since 1974. You’ll visit all four main islands with sightseeing on every island including Honolulu & Pearl Harbor, Punchbowl Crater, The Iao Valley, Lahaina; a Maui Tropical Plantation; the Wailua Riverboat Cruise & Fern Grotto; Kauai Sheep and Cattle Ranch; Steel Grass Farm growing bamboo, vanilla and cacao; and on the “big island” a Hilo Orchid Nursery; Black Sand Beaches; a Giant Fern Tree Forest; Volcanoes National Park; a Kona Coffee Plantation; Macadamia Nut Factory tour; Aquatic Fish Farm & more! Includes a flower lei aloha greeting, 14 nights in quality hotels, baggage handling, inter-island flights & transfers, plus Polynesian tour director on every island. *Price per person, based on double occupancy. Airfare is extra.

For details and itinerary call 7 days a week:

Leading the industry in quality post frame construction

1-800-736-7300

Please contact ontact | 877·204·2378 877 204 4 2 37 8 COMBINES NH CR9070 (09) . . . . . . . . . . . . . . . . . . . . $279,900 (O) NH CR9070 (09) 669hrs . . . . . . . . . . . . . . $279,900 (T)

USD

NH TR96 (92) 2948 hrs . . . . . . . . . . . . . . ..$21,900 (O) NH TX66 (94) 2160 hrs . . . . . . . . . . . . . . .$40,900 (T)

HAYING

CASE 238 CASE 2 388 8 (0 (03) 3) 1 184 846 6h rs . . . . . . . . . . . . .$13 $133 3,90 900 0 (T) (T) 2388 1846 hrs .$133,900

TRACTORS 2WD NH TV140 (99) 4634 hrs . . . . . . . . . . . . . . . $53,900 (O) NH T8040 (10) 573 hrs . . . . . . . . . . . . . . . $189,900 (T)

NH CR9070 (08) 901hrs . . . . . . . . . . . . . . $246,900 (T)

NH BR780A (07) . . . . . . . . . . . . . . . . . . . . . $19,900 (T)

NH TV6070 (09) 1518 hrs . . . . . . . . . . . . . $114,900 (T)

NH CR9070 (07) 909hrs . . . . . . . . . . . . . . $226,900 (T)

NH BR780A (06) . . . . . . . . . . . . . . . . . . . . $21,900 (O)

JD 4555 (89) 9000 hrs . . . . . . . . . . . . . . .$33,900 (T)

NH CR9070 (07) 1003hrs . . . . . . . . . . . . .$226,900 (T)

NH BR780 (06) . . . . . . . . . . . . . . . . . . . . . . $19,900 (O)

JD 4640 (78) w/blade . . . . . . . . . . . . . . . .$28,900 (T)

NH BR780 (05) . . . . . . . . . . . . . . . . . . . . . . $19,900 (O)

MF 2705 (86) w/795 loader . . . . . . . . . . . . .JUST IN (T)

NH CR970 (05) 1204hrs . . . . . . . . . . . . . . $178,900 (T) NH CR970 (04) 1434hrs . . . . . . . . . . . . . . $169,900 (O) NH CR9060 (09) . . . . . . . . . . . . . . . . . . . .$235,900 (O) NH CR960 (06) . . . . . . . . . . . . . . . . . . . . .$168,900 (O) NH CR960 (05) . . . . . . . . . . . . . . . . . . . . .$159,900 (O)

NH BR780 (04) . . . . . . . . . . . . . . . . . . . . . . $19,900 (O) NH BR780 (03) . . . . . . . . . . . . . . . . . . . . . . $17,900 (T) NH BR780 (03) . . . . . . . . . . . . . . . . . . . . . ..$17,900 (O)

SEEDERS/TILLAGE BOURGAULT 3310 (11) 65’ No MRBs . . . . . $184,900 (T) BOURGAULT 5710 (01) 54’ MRBs . . ..SOLD JUST IN (T)

NH CR960 (05) 1112 hrs . . . . . . . . . . . . . $184,900 (T)

NH 688 Baler (02) . . . . . . . . . . . . . . . . . . . $15,900 (T)

NH CR960 (04) 1082 hrs . . . . . . . . . . . . .$149,900 (T)

NH 664 (98). . . . . . . . . . . . . . . . . . . . . . . . . .$9,900 (O)

liquid kit . . . . . . . . . . . . . . . . . . . . . . . . . . .JUST IN (T)

NH CR960 (04) 1708 hrs . . . . . . . . . . . . . .$134,900 (T)

New Idea 4664 (97) . . . . . . . . . . . . . . . . . . .$3,900 (O)

BOURGAULT 5710 (01) 59’ MRBs . . . . . . . . .JUST IN (T)

NH TR98 (97) 3717 hrs . . . . . . . . . . . . . . . .$48,900 (O)

NH 326 (86) Sq Baler . . . . . . . . . . . . . . . . . . $7,900 (O)

BOURGAULT 5710 (99) 40’, MRB/TBT,

NH TR98 (96) . . . . . . . . . . . . . . . . . . . . . . .$50,900 (O)

NH 116 Haybine. . . . . . . . . . . . . . . . . . . . . . ..$7,900 (T)

NH TR97 (95) . . . . . . . . . . . . . . . . . . . . . . .$44,900 (O) NH TR97 (95) 2368 hrs . . . . . . . . . . . . . . . .$33,900 (O)

TRACTORS 4WD

BOURGAULT 5710 (03) 54’ No MRBs

4300 tank . . . . . . . . . . . . . . . . . . . . . . . . . JUST IN (T) BOURGAULT 6000MH (08) 90’ . . . . . . . . . .$35,900 (T) BOURGAULT 8810 (98) 48’ . . . . . . . . . . . . .$40,900 (T)

NH TR97 (94) 2138 hrs . . . . . . . . . . . . . . .$25,900 (T)

NH T9060 (10) 651 hrs . . . . . . . . . . . . . . . $285,900 (T)

BOURGAULT 3165 (97) . . . . . . . . . . . . . . . ..$12,900 (T)

NH TR97 (94) 2921 hrs . . . . . . . . . . . . . . .$29,900 (T)

NH TJ530 (07) 2195 hrs . . . . . . . . . . . . . . $229,900 (T)

BOURGAULT 7200 HH (09) 72’ . . . . . . . . .$23,900 (T)

NH TR96 (93) 2981 hrs . . . . . . . . . . . . . . . .$28,900 (T)

JD 8450 (83) 10,355 hrs . . . . . . . . . . . . . . $35,900 (T)

RITEWAY JUMBO HH (97) 77’ . . . . . . . . . .$29,900 (T)

TISDALE, SK 306-873-4588 OUTLOOK, SK K 306-867-9544 306 867 95

FARM EQUIPMENT www.johnbob.ca s sales@johnbob.ca

Trades W Welcome. Finance options available on qualifying units O.A.C.


PAGE 20

Saskatchewan FarmLIFE, Monday, March 19, 2012

UP TO 12 MONTHS INTEREST FREE ON 4WD TRACTORS & COMBINES COMBINES Case IH 1666

1993 Case IH 1666 3473 hrs 1015 p/u ......................................................................................$43,000.00

Case IH 1688

1994 Case IH 1688 4288 hrs 1015 p/u ......................................................................................$42,500.00 1994 Case IH 1688 4555 hrs 1015 p/u ......................................................................................$41,500.00 1993 Case IH 1688 4500 hrs 1015 p/u ......................................................................................$45,000.00

Case IH 2388

2005 Case IH 2388 1536 hrs 1015 p/u ....................................................................................$155,000.00 2004 Case IH 2388 1841 hrs 1015 p/u ....................................................................................$145,000.00 2004 Case IH 2388 1751 hrs 2015 p/u ....................................................................................$143,500.00 2004 Case IH 2388 3157 hrs 2015 p/u ....................................................................................$118,000.00 2004 Case IH 2388 2361 hrs 2015 p/u ....................................................................................$132,000.00 2006 Case IH 2388 1173 hrs 2015 p/u ....................................................................................$170,000.00 2003 Case IH 2388 2727 hrs no p/u ........................................................................................$120,400.00 2005 Case IH 2388 1820 hrs 1015 p/u ....................................................................................$147,700.00 2005 Case IH 2388 1927 hrs 2015 p/u ....................................................................................$140,000.00 2002 Case IH 2388 2940 hrs 1015 p/u ......................................................................................$95,000.00 2004 Case IH 2388 1777 hrs 1015 p/u ....................................................................................$133,000.00 2001 Case IH 2388 3344 hrs 2015 p/u ......................................................................................$94,700.00 2004 Case IH 2388 1800 hrs 1015 p/u ....................................................................................$157,500.00 2005 Case IH 2388 1133 hrs 2015 p/u ....................................................................................$165,000.00

Case IH 2588

2007 Case IH 2588 1064 hrs 2015 p/u ....................................................................................$179,500.00 2007 Case IH 2588 1515 hrs 2015 p/u ....................................................................................$170,000.00

Case IH 6088

2009 Case IH 6088 665 hrs 2016 p/u ......................................................................................$212,000.00

Case IH 7088

2010 Case IH 7088 577 hrs 2016 p/u ......................................................................................$272,500.00 2010 Case IH 7088 559 hrs 2016 p/u ......................................................................................$275,000.00 2009 Case IH 7088 775 hrs 2016 p/u ......................................................................................$228,000.00 2009 Case IH 7088 775 hrs 2016 p/u ......................................................................................$228,000.00 2009 Case IH 7088 972 hrs 2016 p/u ......................................................................................$220,000.00 2010 Case IH 7088 772 hrs 2016 p/u ......................................................................................$245,000.00 2010 Case IH 7088 427 hrs 2016 p/u ......................................................................................$259,900.00 2010 Case IH 7088 292 hrs 2016 p/u ......................................................................................$265,000.00 2010 Case IH 7088 526 hrs 2016 p/u ......................................................................................$250,000.00 2010 Case IH 7088 481 hrs 2016 p/u ......................................................................................$255,000.00

Case IH 7120

2009 Case IH 7120 775 hrs 2016 p/u ......................................................................................$263,900.00 2010 Case IH 7120 534 hrs 2016 p/u ......................................................................................$289,500.00 2010 Case IH 7120 426 hrs 2016 p/u ......................................................................................$298,500.00 2010 Case IH 7120 420 hrs 2016 p/u ......................................................................................$298,500.00 2010 Case IH 7120 2016 p/u ......................................................................................................$285,000.00 2010 Case IH 7120 2016 p/u ......................................................................................................$285,000.00

Case IH 8010

2008 Case IH 8010 679 hrs 16’ 2016 p/u, 20.8x42 duals ....................................................$265,500.00 2006 Case IH 8010 1488 hrs 2016 p/u ....................................................................................$198,500.00 2006 Case IH 8010 1506 hrs 2016 p/u ....................................................................................$198,500.00

Case IH 8120

2011 Case IH 8120 367 hrs 3016 p/u ......................................................................................$315,000.00 2011 Case IH 8120 345 hrs 3016 p/u ......................................................................................$315,000.00 2011 Case IH 8120 414 hrs 3016 p/u ......................................................................................$305,000.00 2011 Case IH 8120 362 hrs 3016 p/u ......................................................................................$315,000.00 2011 Case IH 8120 426 hrs 3016 p/u ......................................................................................$305,000.00 2011 Case IH 8120 347 hrs 3016 p/u ......................................................................................$315,000.00 2011 Case IH 8120 358 hrs no p/u, GPS .................................................................................$300,000.00 2010 Case IH 8120 209 hrs 2016 p/u ......................................................................................$340,000.00 2011 Case IH 8120 325 hrs no p/u, GPS .................................................................................$300,000.00 2011 Case IH 8120 341 hrs no p/u, GPS .................................................................................$300,000.00 2010 Case IH 8120 332 hrs 2016 p/u ......................................................................................$290,000.00 2011 Case IH 8120 182 hrs 2016 p/u ......................................................................................$329,000.00

Regina (306)565-2405 Visit us on the Web at www.caseih.com Case IH is a registered trademark of Case, LLC.

Moose Jaw (306)694-1800

YOUNG’S EQUIPMENT INC. FOCUSED COMMITMENT

$325 000 00 2011 Case IH 8120 247 hrs 2016 p/u ......................................................................................$325,000.00 2011 Case IH 8120 338 hrs 2016 p/u ......................................................................................$309,500.00 2011 Case IH 8120 338 hrs 2016 p/u ......................................................................................$309,000.00 2011 Case IH 8120 2016 p/u ......................................................................................................$309,000.00 2009 Case IH 8120 2016 p/u ......................................................................................................$305,000.00 2010 Case IH 8120 2016 p/u ......................................................................................................$280,000.00

John Deere

2000 JD 9650STS 3796hrs, no p/u ............................................................................................... $78,900.00 2004 JD 9760STS 2144hrs, 914 p/u...........................................................................................$173,300.00 2004 JD 9760STS 1937hrs, no p/u .............................................................................................$155,200.00 2005 JD 9760STS 1514hrs, p/u ...................................................................................................$185,000.00 2005 JD 9760STS 1455hrs, p/u ...................................................................................................$193,000.00 1994 JD 9500 4600hrs 914 p/u ....................................................................................................$38,100.00 2008 JD 9870STS 1100hrs, 615 p/u header, duals ..................................................................$251,500.00

Caterpillar

2003 Caterpillar 480R 2212 hrs.................................................................................................$142,600.00

New Holland

1993 NH TR96, 3602hrs, 971 p/u Header .................................................................................$21,100.00 2006 NH CR960 1600 hrs, 76C p/u .........................................................................................$162,300.00 2008 NH CX8080 1370 hrs, 76C p/u ......................................................................................$171,200.00 2005 NH CR970 1530 hrs, no p/u ............................................................................................$156,200.00

COMBINE HEADERS Case IH 2006 Case IH 2062 Flex Draper Header, 5 Bat w/ Plastic Tines, Case IH AFX Adapter, Upper Cross Auger .............................................................................$65,000.00 2004 Case IH 2062 36’ Draper header AFX series Adapter ................................................$45,000.00 2008 Case IH 2020 35’ Flex auger header ................................................................................$35,000.00 2009 Case IH 2020 35’ Flex Auger Header ..............................................................................$42,000.00 2006 Case IH 2062 36’ Draper header 88 series Adapter....................................................$49,000.00 2002 Case IH 1042 36’ Draper header......................................................................................$28,000.00 2008 Case IH 2020 35’ Flex auger header ................................................................................$35,000.00 2008 Case IH 2020 35’ Flex auger header ................................................................................$35,000.00 2008 Case IH 2020 35’ Flex auger header ................................................................................$35,000.00 2000 Case IH 1052 36’ Flex Draper Header, Steel Teeth, Hydraulic Fore/Aft, Upper Cross Auger ...................................................................................$22,450.00 2008 Case IH 2020 35’ Flex auger header ................................................................................$35,000.00 2006 Case IH 1020 30’ Flex Auger Header, 6 Bat w/plastic tines .......................................$25,000.00 2011 Case IH 3020 35’ Flex Auger Header, Crary Air Reel, Single Knife ..........................$43,060.00 2011 Case IH 3020 35’ Flex Auger Header, Crary Air Reel, Single Knife ..........................$43,060.00 1995 Case IH 1020 30’ Flex Auger Header, Steel Tines, Hydraulic Fore/Aft ....................$12,500.00 2008 Case IH 2020 35’ Flex Auger Header, 6 Bat w/plastic tines, Case IH 10-series adapter ...........................................................................................................$27,550.00 2002 Case IH 1020 30’ Flex Auger Header, 6 Bat w/ plastic tines ......................................$18,350.00 2002 Case IH 1020 30’ Flex Auger Header, 6 Bat w/ plastic tines ......................................$18,350.00 2008 Case IH 1020 30’ Flex Auger Header, Plastic Fingers ...................................................$27,550.00 2008 Case IH 2162 40’ Flex Draper Header, double knife, Case IH 20-series adapter ...........................................................................................................$77,000.00 1995 Case IH 1020 30’ Flex Auger Header, Single Knife .......................................................$12,050.00 2008 Case IH 2020 35’ Flex auger Header ...............................................................................$35,000.00 2009 Case IH 2162 40’ Flex Draper header, double knife, Case IH 8120 Adapter .........$70,750.00 2006 Case IH 2062 36’ Draper header AFX series Adapter ................................................$65,000.00 2011 Case IH 2162 40’ Flex Draper Header, Slow Speed Transport, Upper Cross Auger, 88/10/20-Series Adapter .....................................................$88,000.00 2011 Case IH 2162 40’ Flex Draper Header, Slow Speed Transport, Upper Cross Auger, 88/10/20-Series Adapter .....................................................$94,000.00 2011 Case IH 2162 40’ Flex Draper Header, Slow Speed Transport, Upper Cross Auger, 88/10/20-Series Adapter .....................................................$94,000.00 2011 Case IH 2162 40’ Flex Draper Header, Slow Speed Transport, Upper Cross Auger, 88/10/20-Series Adapter .....................................................$94,000.00 2011 Case IH 2162 40’ Flex Draper Header, Slow Speed Transport, Upper Cross Auger, 88/10/20-Series Adapter .....................................................$94,000.00 2011 Case IH 2162 40’ Flex Draper Header, Slow Speed Transport, Upper Cross Auger, 88/10/20-Series Adapter .....................................................$94,000.00 2011 Case IH 2162 40’ Flex Draper Header, Slow Speed Transport, Upper Cross Auger, 88/10/20-Series Adapter .....................................................$94,000.00

Assiniboia (306)642-5991

Wind (306)22

www.youngseq


Saskatchewan FarmLIFE, Monday, March 19, 2012

Honey Bee

1998 HB SP30 88 series adapter, UCA, transpor ....................................................................$26,500.00 2003 HB SP36 88 series adapter, batt reel ................................................................................$23,500.00 1998 HB SP36 JD adapter, transport ..........................................................................................$23,500.00 1996 HB SP36 Gleaner adapter, transport ................................................................................$19,500.00 2006 HB SP30 JD CTS Adapter, transport, Upper Cross Auger, Fore/Aft .........................$32,500.00 2007 HB 3655 36’ JD 50-series adapter, transport, fore/aft ..................................................$42,250.00 2005 HB SP36, transport ...............................................................................................................$29,500.00 2003 HB SP36 88 series adapter, pea auger, Case IH 88-series adapter ............................$31,550.00

Flexi-Coil

2008 60’ 12” DS Flexi-Coil 5500 Air Drill, 4.5” Steel Packers, Scrapers, Blockage w/ 2004 Flexi-Coil 3850 .........................................................................$110,700.00 1993 57’ 12” Flexi-Coil 5000 Air Drill, 5” Rubber Packers w/ 1998 Flexi-Coil 3450.....$57,000.00 1996 57’ 12” DS Flexi-Coil 5000 Air Drill, 3.5” Steel Packers, Atom Jet w/ 1996 Flexi-Coil 2320.............................................................................................$48,750.00 1995 45’ 7” SS Flexi-Coil Air Drill 2.5” Steel Packers, 3/4” Carbide Knife w/ 1993 Flexi-Coil 2320 ...............................................................................................................$38,500.00 1992 39’ 9” DS Flexi-Coil 500 Air Drill w/ 1994 Flexi-Coil 2320 .......................................$47,000.00

MacDon

2002 MacDon 962 36’ ....................................................................................................................$25,000.00 2002 MacDon 972 36’ JD 60/70 series adapter .......................................................................$31,000.00 2000 MacDon 972 36’ JD 50 series adapter .............................................................................$31,000.00 1999 MacDon 972 36’ 88 series adapter ...................................................................................$31,500.00 2002 MacDon 972 30’ 88 series adapter ...................................................................................$36,000.00 2003 MacDon 972 36’ Case IH adapter, transport, hydraulic fore/aft ................................ $36,000.00 2002 MacDon 972 36’ JD 60/70 series adapter, hydraulic fore/aft ...................................... $30,000.00 1999 MacDon 962 30’ w/ transport ...........................................................................................$20,750.00 2001 MacDon 962 30’ JD 9500 adapter, pea auger .................................................................$22,950.00 2009 MacDon FD70 40’ Flex Draper, Double Knife, slow speed transport, JD 70 series adapter......................................................................................................................$85,200.00 2008 MacDon FD70 40’ Flex Draper, transport, upper cross auger, JD 60/70 series adapter ................................................................................................................$79,750.00 2010 MacDon FD70 40’ Flex Draper, double knife, upper cross auger, transport, Case IH adapter ..............................................................................................$86,900.00 2010 MacDon FD70 40’ Flex Draper, slow speed transport, upper cross auger, Case IH 20 series adapter ...........................................................................................................$85,000.00

SP SWATHERS

2007 MacDon 9352C 640hrs, 30’ 972 header..........................................................................$95,000.00 1999 MacDon 920 18’ sickle header ..........................................................................................$15,500.00

2WD TRACTORS

1991 Case IH 7120 5500hrs 20.8x38 Duals .............................................................................$37,800.00 1980 Case 2290 7100hrs, 2 remotes ..........................................................................................$13,600.00

MFD TRACTORS

2008 Case IH Puma 155 1625hrs, 3pt-Hitch, 3 remotes .....................................................$107,300.00 2009 Case IH Magnum 215, 4 remotes, High-flow hydraulics ............................................$130,000.00 2010 Case IH Magnum 215, 4 remotes, High-flow hydraulics ............................................$139,900.00

4WD TRACTORS

1986 Versatile 876 9366hrs 20.8R38 Duals ...............................................................................$32,000.00 2011 Case IH Steiger 435 441hrs, 800/70R38, High capacity pump, 4 hydraulic outlets...... $265,000.00 1996 Case IH 9370..........................................................................................................................$89,000.00 1996 Case IH 9370 5622hrs, 520/85R42 ...................................................................................$90,000.00 2011 Case IH Steiger 385 275hrs, 710/70R38, 5 hydraulic outlets ...................................$245,000.00 2011 Case IH Steiger 385, 710/70R42, high capacity pump, 4 hydraulic outlets ............$235,000.00

TILLAGE & SEEDING Bourgault

2005 59’ 9.8” SS Bourgault 5710 Air Drill, 3.5” Steel Packers w/ 2003 Bourgault 6350 ...... $133,500.00 2004 40’ 10” SS Bourgault 5710 Air Drill, MRBs, Steel Packers w/ 2004 Bourgault 5200 ......$92,300.00 1999 64’ 9.8” Bourgault 5710 Air Drill, MRBs, Anhydrous, 3.5” Steel Packers w/ 1998 Bourgault 4350...............................................................................................................$76,500.00 1999 54’ 9.8” SS Bourgault 5710 Air Drill, MRBs, Anhydrous, 3” Rubber Packers w/ 1999 Bourgault L4300 ............................................................................................................$59,000.00 2004 54’ 9.8” SS Bourgault 5710 Air Dril, MRBs, NH3, 3” Rubber Packers......................$85,000.00 2007 59’ 10” SS Bourgault 5710 Air Drill, 2.25” Steel Packers, No Openers...................$80,000.00 2002 47’ SS Bourgault 5710 Air Drill, Liquid Kit ......................................................................$59,600.00 1998 64’ 9.8” DS Bourgault 5710 Air Drill, Side Band Openers, 3.5” Steel Packers....... $42,000.00 2009 65’ 9.8” DS Bourgault 3310 Air Drill, MRBs, 3/4” Carbide Tips, 4.5” V Packers.......$198,500.00 1997 40’ 9.8” SS Bourgault 5710 Air Drill, 3.5” Steel Packers w/ 199 Bourgault 3225 ......$45,000.00 2011 75’ 9.8” DS Bourgault 3310 Air Drill, MRB II’s, 3/4” Carbide Tips, 4.5” V Packers, Walking Castors ...............................................................................................$259,900.00 2010 60’ 9.8” SS Bourgault 5710 Air Drill, MRBs w/Liquid Kit, 2.25” Packers, 3/4” Carbide Tips w/ 2010 Bourgault 6350................................................$153,500.00 2006 74’ 12.6” DS Bourgault 5710 Air Drill, MRBs, 3/4” Carbide Tips, 3.5” Steel Packers w/ 2010 Bourgault L6550ST ...................................................................$205,000.00

Case IH

60’ 10” DS Case IH Precision Hoe 800 w/ 2010 Case IH Precision Air 3430...............$211,200.00 2008 70’ 10” SS Case IH ATX700 Air Drill, 3.5” Steel Packers, Liquid Kit w/ 2008 Case IH ADX3430 ...................................................................................$143,000.00 2007 60’ 10” Case IH ATX700 Air Drill, 3” Rubber Packers w/ 2007 Case IH ADX3430 ......................................................................................................$135,800.00 2007 70’ 10” DS Case IH ATX700 Air Drill, 4.5” Steel Packers .......................................... $85,000.00 2007 70’ 12” DS Case IH ATX700 Air Drill, 3.5” Steel Packers .......................................... $75,000.00

dthorst 24-2110

Weyburn (306)842-2629

quipment.com

PAGE 21

Concord

1993 48’ 12” SS Concord 4812 Air Drill, 5 Run, Blockage w/ 1994 Concord 2300 .......$38,200.00

John Deere

2008 57’ 10” SS John Deere 1830 Air Drill, 3” Rubber Packers, 3” Spread Tips w/ 2008 John Deere 1910 ...................................................................................$117,500.00 1996 40’ 10” SS John Deere 737 Air Drill, 3.5” Steel Packers w/ 1996 John Deere 787..............................................................................................................$31,200.00

New Holland

2010 60’ 10” DS New Holland P2070 Air Drill, w/ Scrapers, Blockage w/ 2010 NH P1060 .....................................................................................................................$211,200.00

SPRAYERS

2011 100’ Apache AS1020 275hrs, 1,000 Gal. Tank, ViperPro w/ GPS, Phoenix 200, Autoboom Ultraglide, SmartTrax ....................................................................$215,000.00 2009 100’ Apache 1210 1316hrs, Ultraglide + Autoboom, Raven SmartTrax .................$160,000.00 2003 90’ Apache 859 1870hrs, Raven Autoboom ..................................................................$105,000.00 2001 Apache 790HC 1652hrs, 460 controller, 3-way nozzle, foam markers .....................$78,000.00 2010 120’ Case IH SPX4420 342hrs, ViperPro, AIM Command, Raven G2 Autoboom, HID Lighting ............................................................................................................$364,000.00 2011 120’ Case IH SPX4420 420hrs, ViperPro, AIM Command, HID Lighting, Reversable Fan ....................................................................................................$349,000.00 2011 120’ Case IH SPX4420 420hrs, AIM Command, Viper Pro, Ultraglide, Luxury Cab, HID Lighting ......................................................................................$345,000.00 2011 120’ Case IH SPX4420 428hrs, SmartTrax, ViperPro, Luxury Cab, AIM Command, AccuBoom .......................................................................................................$345,000.00 2011 120’ Case IH SPX4420 463hrs, SmartTrax, ViperPro, Luxury Cab, AIM Command, AccuBoom .......................................................................................................$335,000.00 2011 100’ Case IH SPX4420 AIM Command, Autoboom Height Control, Deluxe Surveyor Cab, HID Lighting ........................................................................................$328,000.00 2011 120’ Case IH SPX4420 679hrs, AIM Command, Deluxe Surveyor Cab, HID Lighting ........................................................................................$318,000.00 2009 120’ Case IH SPX4420 1153hrs, 1200Gal Tank, Auto Pilot, Raven G2 Autoboom, Reversable Fan, Foam Marker ..........................................................$305,000.00 2009 120’ Case IH SPX4420 515hrs, Raven G2 Autoboom, Trimble Autopilot, Luxury Cab, HID Lighting ........................................................................$295,000.00 2011 120’ Case IH SPX3330 AIM Command, Luxury Cab, fenders, HID Lighting ..................................................................................................................................$295,000.00 2010 120’ Case IH SPX4420 1210hrs, Raven G2 Autoboom, SCS5000 Controller, EZ Boom, Autopilot, HID Lighting ....................................................$285,000.00 2009 120’ Case IH SPX4420 1005hrs, AIM Command, HID Lighting, Luxury Cab, Autopilot .......................................................................................$270,000.00 2008 100’ Case IH SPX3320 1250hrs, Raven G2 Autoboom, Trimble autopilot..........................................................................................................................$255,700.00 2009 120’ Case IH SPX4420 1400hrs, Autoboom, SCS4600 Raven Rate Controller, EZ Guide 500, EZ Boom Shutoff ..................................................$255,000.00 2007 100’ Case IH SPX3320 1300hrs, ViperPro, AIM Command, EZ Boom, HID Lighting ..............................................................................................................$243,000.00 2007 100’ Case IH SPX4420 1700hrs, 1200Gal Tank, Luxury Cab, Raven G2 Autoboom, Autopilot ...............................................................................................$215,000.00 2005 100’ Case IH SPX4410 1900hrs, Outback S2 Guidance & Mapping, Raven Autoboom, AIM Command ..................................................$211,400.00 2004 Case IH SPX3200 Sprayer.................................................................................................$127,500.00 2002 90’ RoGator 1254 1560hrs, Norac Autoboom, Outback w/E Drive, 1200Gal Tank ............................................................................................................$135,000.00 2005 100’ RoGator 1074 2460hrs, Raven Smartrax, Autoboom Wheels, Ultraglide ..................................................................................................$132,000.00 2008 John Deere 4830 815hrs, 1000 Gallon Tank, Swath Pro ............................................$268,000.00 2009 John Deere 4730 520hrs, JD Auto Steer, Greenstar 2, 800 Gallon Tank................$255,000.00 2008 90’ John Deere 4730 1175hrs, Starfire II Guidance, 2600 Monitor, Boom Trac Pro Autoboom.........................................................................................................$215,700.00 1998 60’ Spra-Coupe 3640 1540hrs, 300 Gallon Tank ...........................................................$39,900.00 2002 New Holland SF115 PT Sprayer ........................................................................................$16,500.00 2005 New Holland SF115 PT Sprayer ........................................................................................$29,900.00 Brandt QF1500 PT Sprayer ............................................................................................................. $10,500.0

Davidson (306)567-3074

Raymore (306)746-2288


PAGE 22

Saskatchewan FarmLIFE, Monday, March 19, 2012

FARM EQUIPMENT DISPERSAL FOR DAVID & JUANITA McNISH of WAWANESA, MB

MONDAY APRIL 30th 10:00AM

DIRECTIONS: From #23 hwy at Dunrea, MB. ½ mile west of Dunrea turn off on #23 hwy Turn north 10kms (road jogs a couple times just stay on main road heading north) Turn east 1km into yard. (Signs will be posted sale day) From jct of #2 hwy & PR 340 at Wawanesa, MB. ¼ mile west of Wawanesa on #2 hwy to Tenterfield Road Turn south 5kms to dead end. West 6kms then south to Noble Lake Road. (Road goes ½ mile west then south) Stay on main road going south. Turn west 3kms Turn south 2.5kms Turn east 1km into yard. (Signs will be posted sale day) SIGNS WILL BE POSTED MORNING OF SALE. WATCH FOR SIGNS AND FOLLOW TO SALE! ORDER OF SALE:Ê 10:00AM – 12:00PM (tools, misc, recreation, lawn & garden, smaller livestock items) 12:00PM (riding horses, tack, major equipment) TRACTORS: UÊ£™™xÊ >ÃiÊxÓxäÊ7 Ê££Ó…«ÊÜÉ+ՈVŽiÊÈÈäʏœ>`iÀ]Ê LÕVŽiÌ]Ê}À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊΫÌ]Ê£ÈÊë`ÊÅÕÌ̏iÊňvÌÊ ÌÀ>˜Ã]Ê`Õ>Ê…Þ`]Ê`Õ>Ê«Ìœ]Ê`ˆvvʏœVŽ]ÊÇÓää…ÀÃÊŜ܈˜}] ÊÃɘ£ä{Ó£™Î UÊ£™™£Ê >ÃiÊx£ÓäÊ7 ÊÜÉ >ÃiÊx£äʏœ>`iÀ]ÊLÕVŽiÌ]Ê }À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊΫÌ]ÊÅÕÌ̏iÊňvÌ]ÊÓÊÀi“œÌiʅÞ`]Ê `Õ>Ê«Ìœ]ÊÃɘ£ä£xÈÈÈ UÊ£™näÊ Ê{{{äÊÌÀ>V̜ÀÊÜɵÕ>`ÊÀ>˜}iÊÌÀ>˜Ã]Ê`Õ>Ê«Ìœ]Ê `Õ>Ê…Þ`]ÊÓä°n‡ÎnÊ`Õ>Ã]Ê£äÎää…ÀÃÊŜ܈˜}Ê­i˜}ˆ˜iÊ ÀiLՈÌÊ>Ìʙxää…Àî]ÊÃɘäÎäÈÓä UÊ Ê{äÓäÊÌÀ>V̜ÀÊÜÉÃޘVÀœÊÌÀ>˜Ã]Ê`Õ>Ê«Ìœ]ÊÎÊÀi“œÌiÊ …Þ`]Êxx{£…ÀÃÊŜ܈˜}]ÊÃɘÓ/n™n™äÊ­˜ii`ÃÊvˆ˜}iÀÃʜ˜Ê «ÌœÊVÕÌV…® UÊ£™ÈÈÊ Ê{äÓäÊÌÀ>V̜ÀÊÜÉÃޘVÀœÊÌÀ>˜Ã]ÊȘ}iÊÀi“œÌiÊ …Þ`]Ê`Õ>Ê«Ìœ]ʙ™ÎȅÀÃÊŜ܈˜}]ÊÃɘ££™£™Ó UÊ£™È{Ê Ê{äÓäÊÌÀ>V̜ÀÊÜÉÊÃޘVÀœÊÌÀ>˜Ã]Ê`Õ>Ê…Þ`]Ê`Õ>Ê «Ìœ]ÊÓxÇDžÀÃÊŜ܈˜}]ÊÃɘÈșxx UÊiœ˜Êœ>`iÀÊÜɓœÕ˜ÌÃÊ̜Ê Ê{äÓä UÊn½Êiœ˜ÊL>`iÊ­Ü>Ãʜ˜Ê Ê{äÓä® HAYING EQUIPMENT: UÊÓää{Ê Ê ,ÊÇnäÊÀ`Ê >iÀÊÜÉ£äää«Ìœ]ÊÃɘȣ™£ä]Ê -…i``i` UÊ£™™ÓÊn{ÈxÊ >ÃiÊÊÀ`Ê >iÀÊÜɈ˜œVՏ>̜ÀÃ]ÊÃÉ ˜ääÇ{Ónn]Ê-…i``i`Ê­ˆ˜œVՏ>̜ÀÃÊÃiÃÊÃi«>À>Ìi® UÊ£™ÇnÊ6iÀ“iiÀÊÈäxÊÀ`Ê >iÀÊÜɅÞ`Ê̈i]ÊÃɘ£nÎÓ UÊÈäxÊ6iÀ“iiÀÊÀ`Ê >iÀÊÃɘ£n™È UÊÈäxÊ6iÀ“iiÀÊÀ`Ê >iÀÊÃɘÎÎn£ UʣνÊՅ˜Ê Ê{äääÊ,Ê`ˆÃVLˆ˜iÊÃɘ£änÓÇ£ä‡ ä£xÎ UÊ£Ó½ÊiÃÃ̜˜Ê££xäÊ>ÞLˆ˜i]ÊÃɘӣä™ä UÊ-œÛi“>Ê£ÓÊ7…iiÊ6‡,>ŽiÊÃɘ™xÓxÓ UÊ>ÕÀˆiÀ£Ó£xÊ`LÊ>À“Ê£ÓÊ >i]Ê >iÊ«ˆVŽiÀ]ÊÃɘ,7Ǚ™Ç LIVESTOCK RELATED EQUIPMENT: UÊ >iʈ˜}Ê6œÀÌiÝÊÓäääÊ >iÊ*ÀœViÃÜÀÊÃɘ £™x™ UÊ ÊÎxnʈÝʈÊÜÉ«ÜÀÊ >iÊii`iÀ]ʓiV…>˜ˆV>Ê`ÀˆÛi]Ê ÓÊÌÕÀ˜ÃʏivÌʜ˜Ê…>““iÀÃ]ÊÓÊÃVÀii˜Ã]ÊÃɘÇnÎÈÓÓÊ>Ü>ÞÃÊ Ã…i``i` UÊ ÊǙ£ÊÌÉ>ʓ>˜ÕÀiÊëÀi>`iÀÊÜÉÃÌiiÊvœœÀ]ÊȘ}iÊ Li>ÌiÀ]ÊȘ}iÊV…>ˆ˜ UÊ ÊǙäÊÌÉ>Ê>˜ÕÀiÊ-«Ài>`iÀÊÜÉ̜«ÊLi>ÌiÀ]Êܜœ`ÊvœœÀ]Ê Ãˆ˜}iÊV…>ˆ˜ UÊ ÊǙäÊëÀi>`iÀÊvœÀÊ«>ÀÌà UÊÊxÇäÊÌÉ>Ê>˜ÕÀiÊ-«Ài>`iÀÊÜÉȘ}iÊLi>ÌiÀ]Êܜœ`Ê vœœÀ]Ê`œÕLiÊV…>ˆ˜]ÊÃɘää£ÎΙʭ˜iÜÊV…>ˆ˜ÃÊÎÊÞi>ÀÃÊ>}œ® Uʈ˜`i˜ÊÌÀ>ˆiÀÊÌÞ«iÊ*œÃÌÊ*œÕ˜`iÀÊÃɘäÎx™ UÊÎäääLÃÊV>«Ê*œÀÌ>LiʈÛiÃ̜VŽÊ-V>iÊÜɅˆÌV…Ê>˜`Ê܅iiÃ UÊ iÜÊ“iÀˆV>˜Ê>À“>˜`Ê-µÕiiâiÊ …ÕÌiÊ­ÕÃi`ÊÛiÀÞʏˆÌ̏i® Uʈ}…Ê+Õ>Ê-µÕiiâiÊ …ÕÌiÊÜÉ«>«>̈œ˜ÊV>}iÊ­˜ii`ÃÊvœœÀ® UʭήÊÓÓ½Ýn°x½ÊL>iÊvii`iÀà UÊ­Ó®ÊÓ{½Ýn½Ê“iÌ>ÊV>vÊÅiÌiÀÃʜ˜ÊΈ`à UÊ«>˜iÊ…>Տˆ˜}ÊÜ>}œ˜ÊUÊ >vÊ/ˆÌÊ/>Li UÊΫÌÊL>iÊvœÀŽÃÊUÊ+Õ>˜ÌˆÌÞʜvÊ/܈˜i UÊ+Õ>˜ÌˆÌÞʜvÊ>ÌiÃÊEÊ«>˜iÃÊ UÊ+Õ>˜ÌˆÌÞʜvÊ >iÊii`iÀà UÊ >vÊ Àii«Êii`iÀʜ˜Ê7…iiÃ UÊ,i>Ê˜`ÊVÀii«Êvii`iÀÊUÊ >vÊ-…i`Ã

UÊ{ää}>Ê«œÞʓœ>ÃÃiÃÊÌ>˜Ž UÊi˜ViÀÃÊUÊ-̜VŽÊ*Àœ`ÃÊUÊ/Ài>Ìi`Êi˜ViÊ*œÃÌà UÊ,>ˆÀœ>`Ê/ˆiÃÊUÊ >ÀLi`Ê7ˆÀi]Ê iVÊ7ˆÀi UÊi˜Vˆ˜}Ê-Õ««ˆiÃÊUÊ"̅iÀʈÛiÃ̜VŽÊ-Õ««ˆià RIDING HORSES & TACK: UÊ/…ÀiiÊ ÀœŽiÊ,ˆ`ˆ˜}ÊœÀÃià UÊ œÕLiÊ ÀˆÛˆ˜}Ê>À˜iÃÃÊÜÉÊ œ>Àà UÊœÀÃiÊ ÀˆÛˆ˜}Ê >ÀÌÊUÊœÀÃiÊ Ài>Žˆ˜}Ê >ÀÌ Uʜ˜iʅœÀÃiÊÏiˆ}… UÊ"̅iÀʈÃVÊœÀÃiÊ/>VŽÊEÊ µÕˆ«“i˜Ì TRUCKS: UÊ£™™xÊœÀ`Ê,>˜}iÀÊ8ÊÜÉ{ÊVޏ]ÊxÊëii`]ÊÓÎÓ]xä䎓ÃÊ Ã…œÜˆ˜} UÊ£™™{Ê …iÛÊ …iÞi˜˜iÊ£xääÊ£ÉÓÊ̜˜]Ê ÝÌÊ >LÊÜÉV>««iÀÊ Ìœ«]Ê{ÓÓ]Èx䎓ÃÊŜ܈˜}]Êx°ÇʏˆÌiÀÊi˜}]Ê>Õ̜ÊÌÀ>˜Ã]Ê>ˆÀ]Ê ÌˆÌ]ÊVÀՈÃi]ÊÃɘÓ £™Ó,££ÎÓÈÈn UÊ£™nnÊ Ê- Ê-ˆiÀÀ>ÊÓxää]ÊiÝÌÊV>L]ʏœ˜}ÊLœÝÊ ÜÉΙÎäÓ䎓ÃÊŜ܈˜}]Ê6nÊ}>Ã]ÊÎÊë`ÊÌÀ>˜Ã]ÊÃɘÓ/‡ ә{£xx™£££ UÊ£™näÊœÀ`Ê£xäÊ ÕÃ̜“Ê{Ý{ÊÜÉ{ääÊ}>ÃÊi˜}]Ê>Õ̜ÊÌÀ>˜Ã]Ê Ãɘ£{  ä{£™ UÊ£™Ç™ÊœÀ`Ê£xäÊ£ÉÓÊ/œ˜ÊÜÉ6nÊ}>Ã]Ê>Õ̜ÊÌÀ>˜Ã] ÊÃɘ£ä Èxn{]Ê­ œÌÊ,՘˜ˆ˜}® UÊ£™ÇÈÊ ÊÈxääÊ >LÊ"ÛiÀÊÜɣȽÝn°x½Ê-ÌiiÊ œÝÊEÊ œˆÃÌ]ÊÎÈÈÊi˜}]ÊÕ̜“>̈VÊ/À>˜Ã]Ê£{£ÈxÎʓˆiÃÊŜ܈˜}]Ê Ãɘ// ÈÈÈ6xÇ{nÓÇ UÊ£™ÇÓÊÊœ>`ÃÌ>ÀÊÜÉ£{½Ê-ÌiiÊ œÝÊ>˜`ÊœˆÃÌ]Ê6nÊ}>Ã]Ê >Õ̜ÊÌÀ>˜Ã]Ê œÌÊ,՘˜ˆ˜}]ÊÃɘ 7‡{nÎÇȇ n UÊ£™Ç£ÊÊœ>`ÃÌ>ÀÊÌ>}Ê>ݏiÊÜÉ£n½ÊÃÌiiÊLœÝÊ>˜`ʅœˆÃÌ]Ê Îäää}>ÊÜ>ÌiÀÊÌ>˜ŽÊ>˜`ÊÌÀœÕ}…]Êx³ÓÊÌÀ>˜Ã]ÊÀœÊÌ>À«]ʘœÌÊ À՘˜ˆ˜}]ÊÃɘ{£ÈäÈä äÈ{È£È UÊ£™È£Ê £Ç{Ê ÊÎÊ̜˜ÊÜɣȽÊ-ÌiiÊ œÝÊ>˜`ÊœˆÃÌ]Ê6nÊ }>Ã]Ê{³ÓÊÌÀ>˜Ã]Ê«Õ“Li`ÊvœÀÊ`ÀˆÊvˆ]ÊÃɘ ™£äUÊÎÊ/œ˜ÊÌÀ>ˆiÀÊÜÉÃÌiiÊLœÝÊ>˜`ʅœˆÃÌ UÊ£Ê/œ˜ÊÃÌiiÊLœÝÊ>˜`ʅœˆÃÌÊÌÀ>ˆiÀ]ʘii`ÃÊܜÀŽ TRAILERS & WAGONS: UʣǽÊÌÉ>ÊŜ«ÊLՈÌÊ-̜VŽÊ/À>ˆiÀÊÜÉÊÇäääLÃÊ>ݏiÃ] Ê«>À̈̈œ˜Ê}>Ìi Uʙ½ÊÓʅœÀÃiÊÌÉ>Ê ÊÌÀ>ˆiÀÊÜÉ«>``i`ÊÈ`iÃ]ÊÌ>VŽÊVœ“«>À̇ “i˜Ì]Êvii`ÊÃÌ>̈œ˜]Ê>˜`Ê>VViÃÃÊ`œœÀÃʜ˜ÊLœÌ…ÊÈ`iÃÊ­Li˜ÌÊ >ݏi® UÊÌÀ>ˆiÀÊÜɅœˆÃÌÊ>˜`Ê£{½ÊLœÝ SEED & TILLAGE EQUIPMENT: UÊÓÓ½ÊÊV…ˆÃiÊ«œÜÊÜÉ ÎʈÌ]ÊÎÊL>Àʅ>ÀÀœÜà UÊ£x½Ê>˜`Ê,œiÀ UÊxνÊiÀ“>˜Ê>ÀÀœÜà UʣȽÊ/>ޏœÀÊ7>ÞÊ/>˜`i“Ê ˆÃVÊ Uʙ½ÊÊ ii«Ê/ˆiÀ UÊÓn½ÊÊÇÓääÊœiÊ ÀˆÃÊÜÉÃÌiiÊ«ÀiÃÃÊ܅iiÃ]Ê ii`ÃÊܜÀŽ UÊ̜“ÊiÌʜ«i˜iÀÃÊvœÀÊÊ`Àˆ UÊÎä½Ê ÀˆÊœÛiÀ UÊ,œVŽ‡œ‡>̈VÊ,iiÊ/Þ«iÊ-̜˜iÊ*ˆVŽiÀ UÊiœ˜Ê*Àœ˜}Ê/Þ«iÊ-̜˜iÊ*ˆVŽiÀ UÊ ÛiÀÓ>˜ÊÓ- Ê-VÀ>«iÀ]ÊÃɘÓÓ{Î UʣνÊÊV…ˆÃiÊ«œÜ

AUGERS & AREATION: UÊ£ä»Ýxä½Ê iÀ}i˜Ê«ÌœÊÕ}iÀ]ÊÞ`ʏˆvÌ UÊÇ»ÝÎÈ½Ê À>˜`ÌÊÕ}iÀ]Ê£ÎÊ*Êœ˜`>ÊÜÉ`À>}Ê>Õ}iÀ UÊÇ»Ý{£½Ê>À“ʈ˜}ÊÕ}iÀ]Ê£ÈÊ*Êœ…iÀ UÊ­Ó®Ê iVÌÀˆVÊÕ}iÀÃʜ˜Ê7…iiÃ UÊ-“>ÊÕ}iÀʜ˜Ê7…iiÃ UÊ­Ó®Ê`ÀˆÊvˆÊÕ}iÀÃ]ʅÞ`ʓœÌœÀÃÊÜÉ`œÜ˜ÊëœÕÌà UÊ­Ó®Ê À>}ÊÕ}iÀà UÊ*œÞÊÕ}iÀÊœ««iÀà UÊ΅«Ê-ÕŽÕ«Ê ÎÇx£Ê>iÀ>̈œ˜Êv>˜ LAWN & GAREN & RECREATION: UÊÓääÇÊœ˜`>Ê/,8Ê{ÓäÊ/ÊÓ7 Ê+Õ>`ÊÃÉ ˜£/ Î{äÇÇ{ä£{Ó{ä UÊÓääxÊœ˜`>ÊÓxäÊÓ7 Ê+Õ>`ÊÜÉiiVÊňvÌÊ Ãɘ£/ Ó£{8È{ÈäÓäÎx UÊÓää£Êœ˜`>ÊÎxäÊÓ7 Ê+Õ>`ÊÜɓ>˜Õ>ÊňvÌ]ÊvÀœ˜ÌÊ>˜`Ê L>VŽÊÀ>VŽÃ UÊœ˜`>ÊÎxäÊÓ7 Ê+Õ>`]ÊÀiLՈÌʓœÌœÀÊÓÊÞi>ÀÃÊ>}œ UÊÓäääÊœ˜`>ÊÓxäÊÓ7 Ê+Õ>`]ʘii`ÃÊܜÀŽ UÊ7œœ`i˜Ê >˜œi UÊ£™™xÊ*œ>ÀˆÃÊ{{äÊv>˜Ê-«œÀÌÊ-˜œÜ“œLˆiÊÜɘiÜÊÌÀ>VŽ]Ê x{™äʓˆiÃÊŜ܈˜}]ÊÃɘÓ8- { -x8 äÓÎ{ÇÇ UÊ£™™{Ê*œ>ÀˆÃÊ{{äÊ-Õ«iÀÊ-«œÀÌÊ-˜œÜ“œLˆi UÊ ÕLÊ >`iÌÊ£äÈʏ>ܘÊÌÀ>V̜ÀÊÜɣ䅫Êi˜}ˆ˜i]Ê{{»Ê`iVŽ UÊ ÕLÊ >`iÌÊ/£ä{xʏ>ܘÊÌÀ>V̜ÀÊÜÉÓ䅫Êœ…iÀ]Ê{È»Ê `iVŽ]ÊÃÌ`ÊÌÀ>˜Ã UÊœ}Ê-«ˆÌÌiÀà UÊ-«À>ÞiÀÊvœÀÊ+Õ>`Ê>˜`Ê œœ“à UÊ*ՏÊLi…ˆ˜`Ê>ܘÊ-Üii« UÊ­Ó®Ê>Ü˜Ê œÞʓœÜiÀà UÊÊÀœÌœÊ̈iÀÊÜÉ ³-Êi˜}ˆ˜i OTHER EQUIPMENT: UÊǽÊ>À“ʈ˜}ÊΫÌÊȘ}iÊ>Õ}iÀÊ-˜œÜÊ œÜiÀ UÊiœ˜ÊÇäÇÊœ>`iÀÊUÊÎÊ«ÌÊ >iÊœÀŽÃ UÊiÀ>̈œ˜Ê>˜ÊUÊ{ääÊ>œ˜Ê7>ÌiÀÊ/>˜Ž UÊ£ÓxäÊ>œ˜Ê7>ÌiÀÊ/>˜ŽÊœ˜Ê ÊÜ>}œ˜ TOOLS & MISC: UʈÀÊ œ“«ÀiÃÜÀÊUÊ …>ˆ˜Ê->Üà Uʈ˜Vœ˜Ê ‡ÓÓx‡-Ê7i`iÀ UÊ­Ó®Ê-ˆ«Ê/>˜ŽÊ܈̅Ê*Փ«ÊUÊ1Ãi`ÊiÌ>Ê-ˆ`ˆ˜} UÊ+Õ>˜ÌˆÌÞʜvÊŜ«ÊÃÕ««ˆiÃÊ UÊ-“>Ê“œÕ˜ÌʜvÊ/œœÃ Uʏœ>`i`ÊLœÌÊLˆ˜ÃÊ UÊ+Õ>˜ÌˆÌÞʜvÊ-VÀ>«ÊÀœ˜ UÊ1Ãi`Ê*1Ê-Ì>ÃÊUÊ1Ãi`Ê/ˆÀià UÊ­Ó®Ê-ˆ«Ê/>˜ŽÃ]Ê œÊ*Փ«Ã

FOR MORE INFO CONTACT OWNER

6 ÊV -Ê Óä{‡ÇÓ{‡{™™£

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 23

USED EQUIPMENT USED HEAVY TRUCKS '06 IH 9900, 15L Cummins, 15 spd Eaton Fuller, Alum buds, 12000 front/40000 rear, 11R24.5 tires

USED TRACTORS '07 MF 6465, FWA, c/w MF965 loader, 4 spool valves, block heater, rear wiper, R20.8 R38 tires, 16R28 tires, 762 hrs '02 Buhler 2160 FWA, 7500 hrs, 20.8x42 tires, 84" grapple, floor joystick, bucket

USED COMBINES '10 MF 9895G, c/w MF 4200 header, duals, MAV chopper, risers, auto lube, 16' p/u '09 MF 9895G duals, MAV chopper, 4200 p/u hdr, reverser, elec. sieve, beacons, 397 hrs '05 MF 9690G with 4200 hdr @15', fieldstar, chaff spreader, 800 metric tires, redekop chopper, 550 thresher hrs, 862 hrs

USED COMBINE HEADERS MF 860 Header, 21', bat reel Duetz Allis STR 30', bat reel, for Gleaner Rotary

USED AIR DRILLS '10 Bourgault 5710@ 74', 330 trip, auto clutch switch, 3" rubber pkrs, 9.8" space, scrapers '97 Morris Maxim I w/L7240 tank, 49', 7" space, 2 1/2" rubber pkrs, 350 trip, single shoot '95 Morris Maxim Air Drill, 40' Morris 7180 Air Seeder '92 Flexi-Coil 5000 air drill w/ tow behind tank, 10" space, 3" rubber press, disc markers, single shoot, 40 ft, 170 bus, 2 tanks

USED AIR SEEDERS '07 Bourgault 6350, dual shoot, CRA, aux clutch, high output fan & auger, 3rd tank metering '02 Bourgault 5440, dual shoot, new poly auger, rice tires, 3rd tank metering '97 Bourgault 4350, CTM, single shoot, rice tires '92 Bourgault 2115, hyd. drive, cab monitors, auger

USED CULTIVATORS '11 Bourgault 8910, 70' '07 Bourgault 8810, MRB, dual shoot, ind. packers, 50', 330 trip, 1 inch vertical openers '03 Bourgault 8810, 8", 330 trip, 59', MRB, ind. packers, speed lock, new 4 bar, 1 inch vertical openers Flexicoil 600 cultivator, 50', 14" tines Schulte 29 ft, NH3 kit, spoons, 3 bar harrows, 10" space

NEW HARROWS '12 Bourgault 6000 mid harrow, 70' '12 Bourgault 7200 heavy harrow, 84' '11 Bourgault 6000 mid harrow, 90' '11 Bourgault 7200 heavy harrow, 72' '11 Degelman 7000 Strawmaster, 70'

USED DISCS '11 Sunflower 1544, 45', 24" discs

USED SWATHERS '10 Macdon M-150, c/w '10 Macdon D-60 header, 40', hyd centre link,transport kit '09 Macdon M100, c/w Macdon D-60 header, 30', hyd centre link, hyd roller '05 Premier 2952i, c/w Macdon 963 header, 30', turbo, 2 speed, single knife,single reel '03 Premier 2952, c/w Macdon 972 header, 36', double knife, turbo, 2 spd,mounted swath roller '98 Hesston 8110, with 25' DSA header '86 John Deere 2360, gas, 30', p/u reel '79 IHC 4000, 24.5', UII p/u reel, manual (y)

Meeting the challenges farmers face every day takes more than innovative technology and equipment. It takes committed people. Case IH has more committed professionals in the field, helping producers solve problems and maximize production. Our commitment is to keep you going around the clock, season after season. Because we know farming is more than an occupation – we understand your critical role in the global economic and food systems. Case IH can help you be ready. To learn more, visit caseih.com/beready.

USED HAYING EQUIPMENT '02 Hesson 856 baler 5 x 6 bales, kicker '01 MacDon 5010 Mower Conditioner, 16' '00 John Deere 272 finishing mower, 72" '00 Macdon 922 mower conditioner, 16 ft '98 New Idea 4865 Baler Hesston 81AH mower conditioner, 14 ft Hesston 81AH mower conditioner, 14 ft MacDon 922 mower conditioner, 16 ft

USED SPRAYERS '07 Spra Coupe 4655, 80', foam marker, flood lights, hitch, 776 hrs '05 AGCO 7650 Spra Coupe triple nozzle body, 90' boom, fenders, flood lights, foam markers, 1265 hrs '01 Spra Coupe 4640, 72', auto, flood lights, hitch, foam marker '98 Spra Coupe 3640, 400 gal, 72' boom, foam marker, hitch, flood lights '97 Spra Coupe 3640, 60', hitch, 5 speed.

Be sure to contact our sales department today !

Stop in at your participating Case Dealer:

Mon-Fri 8am-6pm, Saturday 8am-5pm Highway #6 North-Box 430, Naicam Saskatchewan SOK 2Z0

Ph: 306.874.2011 Fax: 306.874.2227

Dealer License Number 911672

website: www.croppermotors.com • email: info@croppermotors.com

Hergott Farm Equipment Ltd. Humboldt 682-2592

Miller Farm Equipment Moosomin 435-3866

Moker & Thompson Implements Prince Albert 763-6454 Melfort 752-2273 “Thinking about a TRUE Independent Opener Drill... look no further than Morris”

DEMO UNIT Morris 61’ Contour w/ 8370 Tank

CALL AIRDRILLS - FINANCING O.A.C.

TILLAGE & SEEDING

Morris 8370 XL, 2011, tow between 443 bu, Top-Com variable rate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$CALL Morris Contour - 71’, 12” sp, dbl sht, paired row (2 seasons) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$CALL Morris Contour - 61’, 2011 w/8370 tow between, demo, 443 bu . . . . . . . . . . . . . . . . . . . . . . . . . $229,000 Morris Contour - 61’, 2009, w/8300 tow between . . . . . . . . . . . $198,000 Morris Contour - 47’, 12” spacing, double chute . . . . . . . . . . . . . . . . .$CALL Morris Maxim II - 49’, 10” sp, dbl sht w/7300 TBH . . . . . . . . . . . . . .$CALL Morris Maxim II - 60’, (2004)10” sp, dbl sht, w/7300 tank . . . . . . . . .$CALL Morris Maxim II - 49’, 10” spacing . . . . . . . . . . . . . . . . . . . . . . . . . .$CALL Morris Maxim I - 49’, 10” spacing, liquid kit w/7300 tank. . . . . . . .$63,500 Morris Maxim I - 39’, 10” spacing, single shoot w/Morris 7300 cart . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $50,000 Morris Maxim - 49’, 71/2”spacing . . . . . . . . . . . . . . . . . . . . . . . $24,900 Seedmaster TXB (2010) - 60’, 12” spacing . . . . . . . . . . . . . . . . $149,000 Seedmaster TXB (2009) - 50’, 12” spacing . . . . . . . . . . . . . . . . . . . .$CALL Bourgault 5710 - 54’, 2003, 9.8” spacing, double shoot . . . . . . . . .$55,000 Harmon 4480 - 44’ w/3100 tank . . . . . . . . . . . . . . . . . . . . . . . $36,000 Harmon 3680-36’, w/EzeeOn 3175 tank . . . . . . . . . . . . . . . . . . $26,900 Flexicoil 5000 - 39’ 2002, rubber press, liquid kit w/FC 1720 tank . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $48,000 Flexicoil 5000 - 45’, 7 ½” spacing S.S. w/Flexicoil 2320 tank, . . . $38,000 Flexicoil 7500 -60’ w/Flexicoil 3450 Air Cart . . . . . . . . . . . . . . . . $58,000 Morris 7180 Air Cart . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$CALL Morris Max II 60’ 10” spacing DS . . . . . . . . . . . . . . . . . . . . . . . . . . .$CALL Morris Max I 39’ 10” spacing w/ 7240 Tow between . . . . . . . . . . . . .$CALL

Morris 9000-35’, w/7180 tank . . . . . . . . . . . . . . . . . . . . . . . . . . . .$CALL Bourgault 8800, 36’ w/Valmar w/2155 tank . . . . . . . . . . . . . . . $26,900 Bourgault FH 40’ Harrows . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$15,000 Bourgault 36’, FH, harrows, w/2155 tank . . . . . . . . . . . . . . . . . . . $17,900 Morris 9000 - 33’ w/Flexicoil 2320 tank. . . . . . . . . . . . . . . . . . . .$26,500 Degelman 570 Stone picker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,900 Ezee-On 5500 36’ Cultivator w/ Ezee-On 4250 Tank + Liquid Cart . .$32,000

MISCELLANEOUS John Deere 4720 Sprayer (2007), 90’ boom loaded, 1100 hrs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $165,000 Salford 41’ RTS Vertical Tillage(DEMO). . . . . . . . . . . . . . . . . . . . . . . .$CALL Rite-Way 53 ’Land Roller, 900 acres. . . . . . . . . . . . . . . . . . . . . . . .$35,900 NEW 78’ Riteway Heavy harrow, 2011 . . . . . . . . . . . . . . . . . . . . . . .$CALL Morris Field Pro 50 heavy harrow. . . . . . . . . . . . . . . . . . . . . . . . . .$18,000 Salford 30’ RTS Vertical Tillage . . . . . . . . . . . . . . . . . . . . . . . . . . $58,000 EZ Trail 510 Grain Cart (NEW ) . . . . . . . . . . . . . . . . . . . . . . . . . . .$19,900 EZ Trail 860 Grain Cart (NEW) . . . . . . . . . . . . . . . . . . . . . . . . . . . $29,900 Farm King 1370 Auger w/mover(One ONLY, NEW) . . . . . . . . . . . . . $17,400

Redhead Equipment Ltd. Estevan 634-4788 Lloydminister 1-800-535-0520 Saskatoon 934-3555 Swift Current 773-2951

Miller Farm Equipment Ltd. Yorkton 783-8508 Langenburg 743-2312 Preeceville 547-3300

Young’s Equipment Inc. Regina 565-2405 Moose Jaw 694-1800 Assiniboia 642-5991 Windthorst 224-2110 Weyburn 842-2629 Davidson 567-3074 Raymore 746-2288

Norsask Farm Equipment Ltd. North Battleford 1-888-446-8128

TRACTORS John Deere 9430 PTO 300 hrs, (2010) . . . . . . . . . . . . . . . . . . . $270,000 Case IH 485 trac, 1100 hrs (LOADED) . . . . . . . . . . . . . . . . . . . . $279,000 PURCHASE OR LEASE NEW SALFORD RTS VERTICAL TILLAGE

IN STOCK • 30 FT RTS • 30 FT RTSW/VALMAR

• 41 FT RTS • 50 FT RTS

©2010 CASE CORPORATION Case IH is a registered trademark of Case, LLC.


PAGE 24

Saskatchewan FarmLIFE, Monday, March 19, 2012

UNRESERVED FARM DISPERSAL

BABCOCK FARMS LTD of BIRNIE, MB

TUESDAY MAY 1st 11:00 AM

DIRECTIONS: FROM NEEPAWA, MB. 16 miles north of Neepawa, MB on #5 hwy to jct. of #5 & #352. East 4 miles on #352 to 5 Corner jct. Sale site located on north side of road. (Watch for signs sale day.) FROM RIDING MOUNTAIN, MB. 5 miles south of riding Mountain, MB on #5 hwy to jct of # 5 & #352. East 4 Miles on #352 to 5 Corner jct. Sale site located on north side of road. (Watch for signs sale day.) ORDER OF SALE:Ê 11:00am – 1:00pm – misc, shop equip, fuel tanks, vet supplies, livestock handling equip, grain bins, fans 1:00pm – livestock equip, augers, dryers, seed & tillage, spraying, haying equip, trucks, trailers, harvest equip, tractors, GPS systems TRACTORS: UÊÓääxÊ Ê/£ÎäÊ7 Ê£Î䅫Ê/À>V̜ÀÊÜÉ+ՈVŽiÊ-ʏœ>`iÀ]Ê LÕVŽiÌÊ}À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœ]Ê*œÜiÀÊ-…ˆvÌÊ/À>˜ÃÊÜÉÊÅÕÌ̏i]Ê ÎÊ*/]ÊÎÊ,i“œÌiÊÞ`°]Ê£äääÊ*/"]ÊÓä°n,ÎnÊ,ÕLLiÀ]ÊxäääʅÀÃÊ Ã…œÜˆ˜}]Ê­ iÜÊvÀœ˜ÌÊÀÕLLiÀʣȰ™,Ón®Ê ÊÀœ˜ÌÊ ˜` UÊ£™n£Ê6iÀÃ>̈iÊxxxÊ{7 Ê£nӅ«Ê/À>V̜ÀÊÜÉ{Ê,i“œÌiÊÞ`°]Ê ÕÝÊÀiÌÕÀ˜Êˆ˜iÊ*/"Ê ÀˆÛi]Ê£äääÊ*/"]Ê£n°{‡ÎnÊ Õ>Ã]ÊÈÇääÊ …ÀÃÊÃɘ£Î££™ÇÓ]Ê­/À>˜ÃÊLi>Àˆ˜}ʅ>ÛiÊLii˜Ê`œ˜i]ÊÕ«`>Ìi`ÊÌœÊ ˜`ÕÃÌÀˆ>ÊÞ`]ÊxääʅÀÃʜ˜Ê ˜}ˆ˜iÊ i>Àˆ˜}î UÊ£™Ç™Ê6iÀÃ>̈iÊxääÊ{7 Ê£È䅫Ê/À>V̜ÀÊÜÉÊÎÊÀi“œÌiʅÞ`°]Ê£äääÊ */"]Ê£n°{‡Î{Ê Õ>Ã]Ê««ÀœÝÊ£Ó]äääʅÀÃ]Ê/À>V̜Àʅ>ÃÊLii˜ÊÕ«}À>`iÊ ÜˆÌ…ÊxxxÊi˜}ˆ˜i]Ê iÜÊ >ÌÌiÀˆiÃ]Ê ÝÌiÀ˜>Ê«>˜iÌ>ÀÞÊ`ˆvvð UÊ

Ê£Îä‡äÈÊ/À>V̜ÀÊÜÉÓÊ,i“œÌiÊÞ`°]Ê£äääÊ*/"]Ê£n°{ʇÎnÊ

Õ>Ã]Ê*œÜiÀÊ>`ÕÃÌ>LiÊÀi>ÀÊÀˆ“Ã]Ê««ÀœÝÊÈxääʅÀà UÊœÀ`ܘÊ>œÀÊ ˆiÃiÊÓÊ7 Ê/À>V̜ÀÊÜÉÊÎÊ«Ì]Ê-ˆ˜}iÊÞ`]Êx{äÊ */"]Ê*œÜiÀÊ-ÌiiÀˆ˜} UÊ­Ó®Ê >iÊœÀŽÃʓœÕ˜ÌÃÊ̜Ê+ՈVŽiÊœ>`iÀ UÊÎÊ*/Ê >iÊœÀŽ GPS SYSTEMS: UÊ"ÕÌL>VŽÊ-ÊՈ`>˜ViÊ-ÞÃÌi“ÊÜÉÊ"ÕÌL>VŽÊÎÈäÊ>««ˆ˜}Ê6iÀȜ˜ÊÓ UÊ"ÕÌL>VŽÊ-ÓÊՈ`>˜ViÊ-ÞÃÌi“ÊÜɈ}…ÌÊ >À HARVEST EQUIPMENT: UÊ£™™ÓÊ Ê/8ÎÈÊ-*Ê œ“Lˆ˜iÊÜÉÊ ʙǣÊ*ˆVŽÊիʅi>`iÀÊÜÉÊ-Ü>Ì…Ê >ÃÌiÀÊ«ˆVŽÕ«]ÊÓnÇäÊi˜}ÊÀÃ]ÊÓÓ£ÓÊ-i«ÊÀÃ]ÊÃɘnÈäÇäÇ£ÊÜÉi>`iÀÊ ,iÛiÀÃiÀ]Ê iÜiÀÊ œ˜V>ÛiÃÊEÊ,ÕLÊL>ÀÃ]Ê iÜÊ i>˜ÊÀ>ˆ˜Ê …>ˆ˜Ê}œiÃÊ ÜˆÌ…ÊˆÌ°ÊˆÀvœˆÊ-ˆiÛiʈ˜Ê՘ˆÌÊ­œÀˆ}ˆ˜>Ê-ˆiÛiÊ܈ÊLiʈ˜VÕ`i`® UÊn½ÊœÜÃiÀÊiÌ>Ê-Ü>̅Ê,œiÀ UÊ-Ü>̅iÀÊ/À>˜Ã«œÀÌ UÊ>LÌÀœ˜ˆVÃʙ£™ÊœˆÃÌÕÀiÊ/iÃÌiÀÊÜÉÊ ˆ}ˆÌ>Ê-V>i° SEED & TILLAGE EQUIPMENT: UÊÎνʏi݈‡ œˆÊxäääʈÀÊ`ÀˆÊÜÉʏi݈‡ œˆÊ£ÇÓäʈÀÊ/>˜ŽÊ ­Ü>ÞÃÊ-…i``i`®]ʙ»Ê-«>Vˆ˜}]ÊÎÎäʏLÃÊ/Àˆ«Ã]Ê-Ìi>Ì…Ê"«i˜iÀÃÊ ÜÉÊλÊ-«ˆÌÌiÀÃ]Ê{»Ê,ÕLLiÀÊ*>VŽiÀÃ]ÊÀii˜Ê Àœ«ÊˆµÕˆ`ÊiÀÌʈÌ]Ê ˆ˜iÊEÊ œÕÀÃiÊiÌiÀˆ˜}Ê,œÃ UÊÎӽʏi݈‡ œˆÊÎääʈÀÊ-ii`iÀÊÜÉʏi݈‡ œˆÊ£££äʈÀÊ/>˜Ž]Ê Þ`Ê>˜]Ê£Ó»Ê-«>Vˆ˜}]ÊxääʏLÃÊ/Àˆ«Ã]ÊÎÊ >ÀÊ>ÀÀœÜÃ]ʈ˜iÊEÊ VœÕÀÃiÊiÌiÀˆ˜}Ê,œÃÊÃɘäÎnxä™ UÊxä½Ê-Փ“iÀÃÊi>ÛÞÊ>ÀÀœÜÃÊ­ iÜʘÕVŽiÃʈ˜Êœˆ˜Ìî UÊxä½Ê >˜V…>À`ÊÞ`À>‡ˆvÌÊ>ÀÀœÜÊ*>VŽiÀÊ >ÀÊÜÉÊÓÊ£ÉÓ»Ê *>VŽiÀÃ]Ê iÜiÀÊ/ˆ˜iÃ]Ê iÜÊ/ˆÀià UÊÈä½Ê˜>˜`ÊÞ`Ê>ÀÀœÜÃ]Ê iÜÊ/ˆ˜ià UÊÎӽʏiÝˆÊ œˆÊ-ÞÃÌi“ÊÇäÊ œˆÊ*>VŽiÀà UÊ£™½ÊˆÃÊÓÈääÊ/>˜`i“Ê ˆÃŽÊÜÉ-“œœÌ…Ê >`ià UÊiÀœiʙäÎ]ÊnÊ œÌ̜“Ê*œÜÊÜÉÊ iÜʣȻÊ-…i>Àà UÊÀii˜Ê Àœ«Ê£äääʈµÕˆ`ÊiÀÌÊ >``ÞÊÜÉÊÇx½Ê œœ“Ã]Êœ…˜Ê ÕiÊ*Փ«]Ê­ œ“«iÌiÊÀiLՈÌ®]Ê iÜÊÞ`ʈÊ*Փ« UÊ,>“LœVÊœLˆˆÌÞʙääÊ*/"Ê ÀˆÛiÊiÀ̈ˆâiÀÊëÀi>`iÀÊ ­ œ“«iÌiÞÊ,iLՈÌ® UÊ7ˆ“>ÀÊnääÊ*/"ÊiÀ̈ˆâiÀÊ-«Ài>`iÀÊ­œÀÊ*>ÀÌî UÊ,œVŽ‡"‡>̈VÊ*/"Ê ÀˆÛiÊ,œÌ>ÀÞÊ-̜˜iÊ*ˆVŽiÀÊ­ÎÊ7…iiÊ-Ìޏi® UÊÊÈÊ,œÜÊ œÀ˜Ê*>˜ÌiÀÊÜÉiÀÌÊ œÝià UÊÈÊ,œÜÊÎÊ«ÌÊ œÀ˜Ê Տ̰ UÊÎä»ÊœÀiÛiÀÊÀ>ˆ˜Ê i>˜iÀ UÊ£n½Êœ>`ʈ˜}Ê-ii`ÊEÊiÀÌÊ/i˜`iÀÊÜÉʅÞ`Ê>Õ}iÀà UÊ>܎ˆ˜ÃÊ ÀˆÊ>ÀŽiÀà UÊÎä½Ê œˆÊ*>VŽiÀÃÊ­L>Ê…ˆÌV…ÊÃÌޏi®Ê­È®Ê‡Êx½Ê-iV̈œ˜Ã SPRAYING EQUIPMENT: Uʙä½Ê œÕÀ}>ՏÌÊnxäÊ i˜ÌÕÀˆœ˜Êʈi`Ê-«À>ÞiÀ]Ê£äääÊ}>Ê«œÞÊ Ì>˜Ž]ʘiÜÊ̈ÀiÃ]ʅÞ`°Ê«Õ“«]ÊV…i“Ê“ˆÝÊÌ>˜Ž]ÊiÞiÊÜ>ÅÊÌ>˜Ž UÊ-…œ«Ê ՈÌÊi˜Viʈ˜iÀÊ-«À>ÞiÀÊÜÉ*/"Ê*Փ« UÊÓ»Ê …i“Ê>˜`iÀÊÊ …i“ʈÝÊ1˜ˆÌ UÊ£ÓääÊ>Ê*œÞÊ7>ÌiÀÊ/>˜ŽÊ­ >VŽ® UÊÓ»Ê >˜œÊ*Փ«ÊÜÉÊxÊ£É{Ê*ʜ̜À HAYING EQUIPMENT:

UÊ£™™nÊ£{½Ê>V œ˜ÊxäääÊ>ÞLˆ˜iÊÜÉ£äääÊ*/"]Ê-ÌiiÊ

Àˆ“«ˆ˜}ÊÀœiÀÃ]Ê iÜʘˆvi]Ê­>Êv>V̜ÀÞÊvÀ>“iÊÕ«`>ÌiÃÊ`œ˜i® UÊÓääÇÊ Ê ,ÇnäÊ,œÕ˜`Ê >iÀÊÜÉÊ >iʈVŽiÀ]Ê£äääÊ*/"]Ê Þ`Ê*ˆVŽÕ«]ÊÕ̜Ê̈i]ÊÃɘ9È ä£ÇӣΠUÊ Ê/£x{Ê£{Ê7…iiÊ6‡,>ŽiÊÜÉÊ܈˜`Ê`iviV̜À]ÊÃɘ£ÓÎÇÓn UÊ>˜`ˆÊ >iʘœVՏ>̜Àà GRAIN BINS & AERATION FANS: UʭӮʣ™xäÊ 1-Ê7iÃÌiiÊ ˆ˜Ãʜ˜Ê >ÀŽ“>˜Êœ««iÀÊÜÉiÀ>̈œ˜]ʜ˜Ê-Žˆ` UÊÓ£ääÊ 1-Ê7iÃÌiiÊ ˆ˜Êœ˜Ê >ÀŽ“>˜Êœ««iÀÊÜÉiÀ>̈œ˜]ʜ˜Ê-Žˆ` UÊ««ÀœÝÊÓääLÕÃÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Êii`Ê ˆ˜ UÊ£n»Ê7iÃÌiiÊ£Ê£ÉÓÊ*ÊiÀ>̈œ˜Ê>˜ UÊ­{®Êˆ``iÊ-Ì>ÌiÊiÀ>̈œ˜Ê>˜ÊÎÊ* AUGERS & GRAIN DRYERS: UÊ£ä»ÊÝÊÇ£½Ê7iÃÌvˆi`Ê*/"Ê-܈˜}Êœ««iÀÊÕ}iÀÊÃɘ{xÓÓ{ UÊÇ»Ê6iÀÃ>̈iÊÕ}iÀÊÜÉ£Ó*Êœ˜`>Ê ˜}ˆ˜i UÊÈ»ÊÝÊ£x½ÊÕ}iÀÊÜÉxÊ£ÉÓʅ«Êœ˜`>Ê ˜}ˆ˜i UʭӮʈÃVÊÈ»ÊÝÊÇ»ÊÕ}iÀÃÊUÊ*i˜VˆÊÕ}iÀà UÊÞ`Ê ÀˆÊˆÊÕ}iÀà UÊ/ÊÎnäÊ*Àœ«>˜iÊÀ>ˆ˜Ê ÀÞiÀÊÜÉ*/"Ê>˜]ÊÃɘÎnäÓäx UÊœÀˆ`}iÊ*Àœ«>˜iÊ*/"ÊÀ>ˆ˜Ê ÀÞiÀ TRUCKS: UÊ£™™ÎÊ Ê/œ«ÊˆVŽÊ-ÉÊ/ÀÕVŽÊÜÉÊÎÈÈÊ*Àœ«>˜iÊ ˜}ˆ˜i]Ê xÊ-«`Ê/À>˜Ã]ÊÓÈÈ]Îxäʎ“ÃÊŜ܈˜}]Êx̅Ê܅iiÊ«>Ìi]ÊÃÉ ˜£ È£*£{™x{]Ê->v̈i`Ê­œÜ˜iÀÊ >LVœVŽÊ>À“ÃÊÌ`® UÊ£™ÇxÊœÀ`ÊÇääÊ/>}ÊݏiÊ/ÀÕVŽÊÜÉ£n½ÊiÌ>Ê˜`°Ê œÝÊEÊ œˆÃÌ]Ê,œÊ/>À«Ê­>ÃÊÀ>ˆ˜ÊEÊ-ˆ>}iÊ ˜`Ê>Ìiî]ÊÎÈ£Ê>Ã]ÊxÊ³Ê ÓÊ/>˜Ã]ÊÇ£]äÓäʈiÃÊŜ܈˜}ÊÃɘÇä 16xÓäΣ UÊ£™™™ÊœÀ`ÊÓxäÊ{ÊÝÊ{Ê Ã]Ê,i}Ê >L]Ê{Ê-«ii`]Ê" Ê/À>˜Ã]Ê -…œÜˆ˜}ÊÎÓä]™ääʎ“Ã]Ê->v̈i`Ê­"ܘiÀÊ >LVœVŽÊ>À“îÊÃÉ ˜£/ Ó£ä8 Ç{££x]Ê­ ÕÌV…Ê,iLՈÌʈ˜VÕ`ˆ˜}Ê>ÃÌiÀÊ Þ® UÊ£™™nÊ …iÛÊ£xääÊ{ÊÝÊ{Ê,i}Ê >L]ÊÎxäÊ>Ã]Ê>Õ̜Ê/À>˜Ã]Ê ÓÎä]äääÊ“Ã]Ê->vïi`Ê­"ܘiÀÊ >LVœVŽÊ>À“î TRAILERS & WAGONS: UÊ£™nnÊ£n½Ê 7-Êx̅Ê7…ii]Ê/ÉÊ-̜VŽÊ/À>ˆiÀÊÜɘiÜÊܜœ`Ê vœœÀ]ÊÛiÀÞʏˆÌ̏iÊÀÕÃÌ]ÊÃÉ˜Ó ™6£nÇäΣää{ UÊ£™nnÊÓä½Ê-…œ«Ê ՈÌÊ/ÉÊx̅Ê7…iiÊ>ÌÊ iVŽÊ/À>ˆiÀÊÜÉ

…iVŽiÀÊ*>ÌiÊ iVŽ]ÊÇäääʏLÃÊݏiÃ]Ê­˜iÜÊÅ>VŽiî UÊ£È½Ê œ˜>…ÕiÊ/ÉÊÀ>ˆ˜Ê/À>ˆiÀÊÜÉœˆÃÌ]ÊiiVÌÀˆVÊ À>ŽiÃ]Ê ,i“œÛ>LiÊ-ˆ`iÃ]ÊÃɘ-Îää£È  UÊ£{½Ê-ÉÊÀ>ˆ˜Ê œÝÊÜÉœˆÃÌ]Êȏ>}iÊi˜`Ê}>Ìi]ÊÃÌiiÊvœœÀ]Ê ÌÀ>V̜ÀʅˆÌV…ÊÃÌޏi UÊ­Ó®Ê{x½Ê/Éʅ>ÞÊÜ>}œ˜ÃÊ­ˆ}…Ê œÞÊ/À>ˆiÀÊ œ˜ÛiÀȜ˜® UÊ­Ó®Ê-ÉÊx̅Ê7…iiÊ œˆiÃÊUÊ Ê/ÉÊ/ÀÕVŽÊÀ>“i UÊ£n½Ê Ê-ÉÊ µÕˆ«“i˜Ìʏœ>ÌÊÕÃi`ÊvœÀÊ >iÊ7>}œ˜ UÊÓȽÊ Ê7œœ`i˜Ê iVŽÊ>ÞÊ,>VŽ UÊÎÓ½Ê >iÊ7>}œ˜Ê­««ÀœÝÊ£ÇÊ >iÊ >«® UÊ>À̈˜Ê>À“Ê7>}œ˜]Ê{ääÊ 1-ÊÀ>ۈÌÞÊ7>}œ˜ÊÜɏˆ}…ÌʎˆÌ]Ê …ˆ}…ÊÈ`iʎˆÌ]ÊÃɘÊää™x™ UÊ{Ê܅iiÊv>À“ÊÜ>}œ˜ÊÜÉ«>˜iÊÜi`ˆ˜}ʍˆ}ʓœÕ˜Ìi`ʜ˜ÊˆÌ LIVESTOCK EQUIPMENT: UÊ>ÞLÕÃÌiÀÊÓÈxäÊ >iÊ*ÀœViÃÜÀ]ÊÜÉÞ`Ê iviV̜À UÊ-…ՏÌâÊ Õ˜ŽÊii`iÀÊœ`iÊ£näÊ*/"Ê Õ˜ŽÊˆ˜iÀÊii`Ê7>}œ˜Ê ÜÉÀ>ˆ˜Ê/>˜Ž UÊ>À“ʈ`Ê{{äÊ-ÉʈÝiÀÊii`Ê7>}œ˜ÊÜÉÊ-Ì>ÀÊ-V>iÊi>` UÊ ÊÎxÇÊ>““iÀʈÊÜÉÊ*ÜÀÊ >iÊii`iÀ]ÊiV…>˜ˆV>Ê 1˜œ>`]ÊÓʘiÜÊÈ`iÃʜ˜Ê…>““iÀÃ]Ê>ÃÜÀÌi`ÊÃVÀii˜Ã UÊ ÊÎxÇÊÜÉ*iiÀiÃÃÊÓä»Ê,œiÀʈÊÞ`Ê1˜œ>`Ê>Õ}iÀ UÊʈÊ œ˜ÛiÀÌi`Ê̜Ê>ÊÞ`Ê*iiÌÊÀ>ˆ˜Êii`iÀ UÊ ÊÈǙÊ/ÉÊ>˜ÕÀiÊ-«Ài>`iÀÊÜÉ`LÊLi>ÌiÀÃ]Ê iÜÊ-ÌiiÊ œœÀÊx{äÊ*/" UÊ ÕVŽiÌʜ՘ÌÊÞ`Ê«œÃÌʅœiÊ>Õ}iÀÊÜÉÊÈ»ÊEÊ£Ó»ÊLˆÌà LIVESTOCK HANDLING EQUIPMENT: Uʈ‡+Õ>Ê-µÕiiâiÊ …ÕÌiÊÜÉÊ-V>i]Ê*>«>̈œ˜Ê >}i

Uʈ‡+Õ>ÊÎÊ-iV̈œ˜Ê>`ÕÃÌ>LiÊ-ʏiÞÊÜÉ >VŽÊ1«Ê-̜«ÊÀ“à Uʈ‡+Õ>ÊÎÊ-iV̈œ˜Ê ÀœÜ`ˆ˜}Ê/ÕLÊ-ÞÃÌi“ UÊ,i>Ê˜`°Ê-µÕiiâiÊ …ÕÌiÊÜÉÊ*>«>̈œ˜Ê >}i]ÊÕÌœÊ >ÌV…Êi>`Ê >ÌiÊ­ iÜʏœœÀ® UÊ ˆ>ÃÊ-ˆ˜}iʘˆ“>Ê7iˆ}…ÌÊ-V>iÊÜÉV…ÕÌiÊÎ]äääʏLÃÊ >« UÊ*œÀÌ>LiÊ >Ì̏iÊœ>`ˆ˜}Ê …ÕÌiÊ­`ÕÃÌ>LiÊiˆ}…Ì® UÊ>ÌiÀ˜ˆÌÞÊ >Ûˆ˜}Êi>`Ê>Ìi UÊÇÊ >vÊ …ÕÌiÊÜÉÊ-V>i UÊ£Ó½ÊÝÊÎä½Ê >ÌV…Ê*i˜Ê­ ÀˆÊ-Ìi“ÊEÊ-ÕVŽiÀÊ,œ`®ÊÜÉʜÛiÀ…i>`Ê LÀ>Vˆ˜}Ê­7iÊ ՈÌ® UÊ Þ«ÀiÃÃʘ`°Ê>««ÀœÝÊÓxäÊLÕÃÊ Àii«Êii`iÀʜ˜Ê7…iiÃÊÜÉ *>˜iÃ]Ê"ˆiÀÃÊEʈ˜iÀ>Ê œÝ UÊ>««ÀœÝÊ£xäÊLÕÃÊ >ÃÞÜ>ÞÊ Àii«Êii`iÀʜ˜Ê7…iiÃÊÜÉ*>˜iÃ UÊ>««ÀœÝÊ{ääÊLÕÃÊ Þ«ÀiÃÃʘ`°Ê Àii«Êii`iÀʜ˜Ê-Žˆ`à UÊ­È®ÊÎä½ÊÀiiÊ-Ì>˜`ˆ˜}Ê7ˆ˜`LÀi>ŽÊ*>˜iÃ UÊ­£Ó®ÊÎä½Ê ÀˆÊ-Ìi“Êii`Ê Õ˜ŽÊ*>˜iÃ UÊ­£Ç®Ê£Ó½Ê->˜ÌÊ >ÀÊii`Ê*>˜iÃ UÊ­£x®ÊÓx½Ê-ÕVŽiÀÊ,œ`Ê œÀ>Ê*>˜iÃ UÊ­£ää®Ê£»Ê-µÊ/ÕLiÊ*>˜iÃʇʣä½Ê‡Ê£Ó½Ê‡Ê£{½Ê‡Ê£È½ UÊ­Óx®Ê/À>V̜ÀÊ/ˆÀiÊii`iÀÃÊUʭǮʣx½ÊiÌ>Ê ՘ŽÊii`iÀà UÊ-iiV̈œ˜ÊœvÊ*>˜iÃÊ܈̅Ê7>ŽÊ̅ÀœÕ}…Ê}>Ìià UÊ­Ó®Êi܈ÃÊ >Ì̏iÊ"ˆiÀÃÊÜÉʈ˜iÀ>Ê/ÕLÃʇʣÊ-ˆ˜}iÊÀ“ÊEÊ£Ê LÊÀ“ UÊ­Ó®ÊȽÊ-…œ«Ê ՈÌÊ >Ì̏iÊ"ˆiÀÃÊ­>«Àœ˜Ê-Ìޏi® UÊ >Ì̏iÊL>VŽÊÃVÀ>ÌV…Ê"ˆiÀÊÜÉʈ˜iÀ>Ê/ÕL UÊ£xäÊ>Ê/>˜ŽÊÕÃi`ÊvœÀÊ ÕŽÊ >˜œ>Ê"ˆÊvœÀÊii`Ê«ÕÀ«œÃi UÊ­n®Ê,œÕ˜`Ê >iÊii`iÀÃÊUÊ-ÉÊ >vÊ7>}œ˜ UÊ œ“«iÌiÊÃiÌʜvÊ iVÌÀˆVÊ Õ“iÀˆVÊ À>˜`ˆ˜}ÊÀœ˜Ã SELECTION OF VET SUPPLIES: UÊ­Ó®Êi`ˆÊ >ÀÌÊ ÀœÃÃÊ œÜÃÊUÊ*ˆÃ̜ÊÀˆ«Ê-ÞÀˆ˜}ià UÊ i…œÀ˜iÀÃÊUÊ ÕÀ`iââœÃ UÊ«ÕÃÊÃiiV̈œ˜ÊœvÊÛ>ÀˆœÕÃÊÛiÌÊÃÕ««ˆià FUEL TANKS & PUMPS: UÊ£äääÊ>Ê7iÃÌiiÊÕiÊ/>˜ŽÊÜɈ‡,ˆÌiÊ££xÊ6œÌÊ*Փ«ÊEÊ iÌiÀ UÊ£äääÊ>ÊÕiÊ/>˜ŽÊœ˜Ê7œœ`i˜Ê-Ì>˜`Ê UʭήÊÎääÊ>ÊÕiÊ/>˜ŽÊUÊxäÊ>Ê-Žˆ`Ê/>˜ŽÊÜÉ£ÓÊ6œÌÊ*Փ« SHOP EQUIPMENT: UÊÈ°xÊ*Ê>ÃÊ*œÜiÀi`ʈÀÊ œ“«ÀiÃÜÀÊ­ iÜÊ ˜}ˆ˜iÊEÊ iÜÊ

œ“«ÀiÃÜÀÊi>`®Ê­ iÜÊœÀˆâœ˜Ì>Ê/>˜Ž® UÊxÊ*Êœ˜`>Ê*œÜiÀi`Ê*ÀiÃÃÕÀiÊ7>ÅiÀ UÊ£ä*Ê œi“>˜ÊxäääÊi˜iÀ>̜À MISC. ITEMS: UÊ6Ê,>`ˆœÃÊ­ ÀÞÃÌ>ÊEÊ*Àœ}À>““>Li® UÊÞ`°Ê …>vvÊ-«Ài>`iÀÊUÊ­xä®Ê,>ˆÊ/ˆià UÊÓä°n‡ÎnÊ Õ>Ãʜ˜ÊÀˆ“ÃÊvœÀÊ£ää‡äÈÊ iÕÌâÊÜÉÊ-«>ViÀà UÊ Êœ>`ˆ˜}Ê,>“«ÃÊUÊ-iiV̈œ˜ÊœvÊ>À“ÊV…i“ˆV>Ã UÊÃÜÀ̓i˜ÌʜvÊ>À“Ê,i>Ìi`Ê-“>ÃÊEʈÃV°

FOR MORE INFO CONTACT OWNER

7>ÀÀi˜Ê >LVœVŽÊ Óä{‡{ÇȇÈxÇ{ Ê ‡>ˆÊÜÀL“iJ…œÌ“>ˆ°Vœ“

œÀʏœÞ`Ê >LVœVŽÊ Óä{‡{ÇȇÈ{ÓÇÊÊ ‡>ˆÊL>LVœVŽJˆ˜i̅œ“i°V>

AUCTIONEERS NOTES:Ê\Ê/…iÊ >LVœVŽ½ÃÊ>ÀiÊÛiÀÞÊ}œœ`ÊV>ÀiÊÌ>ŽiÀÃÊ>˜`Ê̅iÞÊ>ÀiÊÛiÀÞʓiV…>˜ˆV>°ÊÊ̅iÊ iµÕˆ«“i˜ÌʈÃÊÛiÀÞÊÜiÊœœŽi`Ê>vÌiÀÊ>˜`ÊÛiÀÞÊVi>˜°ÊÊܜÀŽÊ˜ii`i`ʜ˜ÊiµÕˆ«“i˜ÌÊÜ>ÃÊ>Ü>ÞÃÊ`œ˜iÊ>˜`ÊޜÕÊ܈ÊLiÊ …>À`Ê«ÀiÃÃi`Ê̜Êvˆ˜`ÊiµÕˆ«“i˜ÌʜvÊ̅ˆÃÊÈâiÊ>˜`Ê>}iʈ˜Ê̅ˆÃʎˆ˜`ʜvÊVœ˜`ˆÌˆœ˜°Ê*i>ÃiÊ«>˜Ê̜ÊVœ“iÊ>˜`Êëi˜`Ê̅iÊ`>ÞÊ ÜˆÌ…ÊÕð Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Saskatchewan FarmLIFE, Monday, March 19, 2012

SPRING SPECIALS 2012 Sportsmen S242BH LE LIMITED AVAILABILITY!

Travel r with othe Farmers!

PAGE 25

Autumn Leaves Tour

14 Days

from

$1448*

USD

Departs September 14 & 28, 2012 A/C, FIbreglass exterior, electric awning, stabalizer jacks, gas/electric DSI hot water heater, microwave, oven, monitor panel, 6.3 cube fridge, rubber roof, 2 year warranty. ONLY 3901 lbs! 00

Spring MSRP $20,671.00 $79 Bi-weekly $0 down OAC

Special $15,900. Go to our web page for other great price units

www.successrv.ca ph. (306) 946-2499 Watrous, SK fax (306) 946-2498

Start in Philadelphia and enjoy a historic city sightseeing tour including the Liberty Bell and Independence Hall. The following day your scenic tour begins offering spectacular and colorful vistas through Amish Country to Gettysburg where you will see the most important battlefield of the Civil War. Continue traveling north with a stop at the Corning Museum of Glass into Ontario and awe-inspiring Niagara Falls for two nights. Then head back to upstate New York where you will board a cruise through the 1000 Islands, including a guided tour over historic sunken wrecks and narrative of all the highlights. Next, drive through the six-million-acre civilized wilderness of the Adirondack region, with a stop in Lake Placid. Then head into the forest area of New England: The White Mountains, including Franconia Notch State Park, New Hampshire and Flume Gorge with impressive waterfalls. Then drive along the New England coast to Boston, with a city tour of the major sites; Cape Cod for 2 nights, exploring Chatham and Provincetown with coastal scenery, village shops and art galleries; view the gorgeous Mansions of Newport, Rhode Island; drive along the Atlantic coast through Mystic Seaport and New Haven, Connecticut; and New York City sightseeing all the sights of the “Big Apple.” *Add $100 USD for September 28 departure. *Price per person, based on double occupancy. Airfare is extra. Call for details & itinerary 7 days a week:

UNRESERVED PUBLIC AUCTION

1-800-736-7300

Regina

Pre-Owned Equipment

Saskatchewan March 29, 2012

1 OF 2– 2011 SEED HAWK 8412 84 FT

CURRENT INVENTORY INCLUDES:  

4WD Tractors 2WD Tractors

   

Combines Headers Air Drills Sprayers

2010 JOHN DEERE 9630T

   

Front End Loaders Balers Mowers Grain Handling Equipment

For complete and up-to-date equipment listings visit

» rbauction.com CALL TODAY TO ADD YOUR EQUIPMENT TO THIS UPCOMING AUCTION – 306.776.2397 AUCTION SITE: From REGINA, SK, go 21 km (13 miles) South on Hwy 6, then 19.8 km (12.3 miles) West on Grid 714, then 1/4 mile West of Rouleau on Hwy 39. North side. Sale Starts 9 AM Auction Company License #309645

TRACTORS NEW 2012 Versatile 435 HHT – synchro box, 710/70R42 duals ............................................................. $CALL KIOTI Tractors – in stock, try one today!! .................. $CALL ‘97 John Deere 8100 tractor – MFD, Outback GPS, 7400 hrs, new fronts/75% rear duals, totally mint ............................$67500 LIVESTOCK & FORAGE NEW HIGHLINE CFR650 BALE PROCESSORS .......... $CALL Penta Vertical Feed Mixers,Avail in all specifications$INQUIRE NEW CLAAS JAGUAR FORAGERS ........CALL FOR PRICING NEW Bunning Spreaders – in stock .............................. $CALL USED Claas Forage Harvesters ALL Sizes/Specs Avail$CALL ’98 Claas Jaguar 880 – 4000 hrs, new engine...................$CALL New Holland Pickup Header – for FX forager ............... $CALL JF FCT1100 P/T Forage Harvester approx 1997 ........$17,500 Richardton 700 Hi-Dump Wagon, Excellent .................$8,500 ‘07 Lucknow 750 Mixer Wagon very good, flotation tires$35000 Gehl 8285 mixer wagon – 285 cu. ft., good w.o. .............$8500 ‘07 Highline 8000 bale processor – flot. tires, r/h dis. ...$9,500 ‘09 Bunning Lowlander 105 Manure Spreader – bolt on extensions, excellent, new wear parts, 930 bushels................ $38,500 ‘05 Bunning Lowlander 90 side extensions, 840 bushels$34500 ’05 Bunning Lowlander 90 – side ext., 840 bushels ..... $34500 ’08 Bunning Lowlander 75 – side ext., 680 bushel .......$30000 ‘05 Kuhn 2044 Manure Spreader – Vertical beater, upgraded tires, v. good, 600 bushels, .............................................$22,500 ’03 Leon 425 manure spreader - good ........................$13,500 ’05 Hagedorn 275 manure spreader – 2 to choose .....$17,500 IH 595 Manure Spreader – recent floor, good .................$7,500 TELEHANDLERS/FORK LIFTS NEW Manitou MLT735-120LSU – A/C, REAL AG MACH. $CALL NEW Manitou MLT/MT telehandlers – All sizes/specs.....$CALL ’05 Manitou MT1340SL Turbo 3500 hrs, 45ft, loaded ..$52,500 ’06 Manitou MT 1340SL Turbo – 1500hrs, 45ft, loaded$62,500 ’11 Manitou MLT 735-120 LSU PS – 125 hp, 150l/min hyd., Grammer air seat, Powershift, 460/70R24 Michelin, A/C, 1000 hrs, mint, local trade .........................................................$84995 ’05 Manitou MLT741-120LSU – 125hp, 150l/min hyd., Grammer air seat, hydraulic locking, new tires, A/C, Agri, 3000 hrs, mint, local trade .........................................................................$64995 TILLAGE & SEEDING SUMO subsoilers, superior build quality & field finish$INQUIRE SALFORD RTS, VERTICAL TILLAGE TOOLS .............. $CALL NEW Ezee-On Drills and Carts – REBATES! ............... $CALL NEW Eagle rotary ditchers ........................................... $CALL Summer 70ft Harrowbar................................................... $2,000 CIH 7200 hoe press drill – 7”, 28ft, transport, mint..........$6000

HAY NEW CLAAS HAY RAKES – BEST PRICING ................. $HOT Kuhn GA7000 DL Rotary twinrake – very good ............$13995 ‘97 Claas Volto 1050T – 33 ft tedder .............................$10,995 ’09 Claas Variant 380 Round Baler – roto-cut, 4000 bales.. $32,995 ’07 Claas Variant 280 Round Baler – roto-cut, 6000 bales..$27,995 ‘99 Claas Variant 180 4x6, ...........................................$15,000 New Holland 688 Round Baler – good ............................$9500 ‘05 Case IH RBX 562 .....................................................$21,500 ‘02 Case IH RBX561 round baler – good .......................$12,500 ‘96 NH 1475/2218 Mower Conditioner, 18ft, nice shape $12,500 ’02 New Holland 1475 Haybine – 16ft, Coming ............ $CALL Kirschner Hay Fluffer .....................................................$3,500 John Deere 704 V-Rake – 10 wheel, very good ...............$6995 HARVEST NEW Macdon Westward swathers and headers all styles$CALL NEW Brandt Grain Vacs – 5200/7500 in stock ............ $CALL NEW Kane Silage/Grain Halfpipe Trailers – all sizes/specs to order, Tractor pickup hitches available! ........................... $CALL NEW BRANDT AUGERS - LARGE STOCK ................... $CALL ’07 New Holland HW325 Swather 30ft, 800 hrs, ............ $72,500 ‘98 Premier 2930 – 30ft 972 – 2400 hrs, turbo/2 spd .....$42500 ’95 Prairie Star 4900 30ft 960, 2500hrs, turbo/2spd,COMING$39,500 CIH 8220 P/T Swather – 25ft, U2 P/U Reel, mint .............$7500 Honeybee SP36 – JD Adapter, good .............................$21,995 ’06 Brandt 1070XL swing auger – very little use............. $8500 ’03 Brandt 1060XL Grain Auger – very good ..................$5000 Westfield 10 x 70 Swing Auger, newer flights and tube $6,000 MISC NEW and USED Farm King/Allied Snowblowers ....... $CALL NEW Farm King Suspended Boom Sprayers IN STOCK .$CALL NEW Woods 3 point/trailed Equipment........................ $CALL EAGLE ROTARY DITCHERS 2 units to choose, mint cond., new blades ...................................................................... $CALL ‘09 Wolverine Rotary Ditcher – mint .............................$39000 Flexi-Coil System 65 Sprayer 1000 gallon, 120 ft, nice .$7,995 Inland Terminator 1 Sprayer 70’, 800 gal.......................$5,500 NEW HLA Skidsteer and Euro Pallet Forks ................. $CALL ‘06 Brandt 5000EX Grain Vac – nice shape .................. $15,995 Agromec big square bale hook grab – Manitou Q/A, as new ...... $6,995 Skidsteer/Euro/Etc. Weld on Quick Attach Plates ....... $CALL

(204) 727-1050

VERMEER BALERS: INQUIRE TODAY! hepson.ca

After Hours (204) 573-5734

“Working With You” Brandon, MB

Sid Patterson

Neal Patterson

Jim Robinson

Mobile: (204) 573-5734

Mobile: (204) 573-0819

Mobile: (204) 573-0360


PAGE 26

Saskatchewan FarmLIFE, Monday, March 19, 2012

The equipment listed is only a small portion of what Miller Equipment has to offer! Visit us online!

06 Apache AS1010 795 Hrs,90’,1000 Gal,Autoboom,Front & Rear Fenders, Hydro Trans STK# 042548......$117,500 M

04 Apache AS850 1600 Hrs,90’,850 Gal SS Tank,Rinse Tank,Foam Mrkr,Drop Boxes STK# 042842 ........ $95,000 M

10 Apache AS715 258 Hrs,90’,750 Gal,Autoboom,Foam Mrkr,3 Way Nozz, Raven Ctrlr STK# 041819 .....$134,500 B

01 Apache 890 2495 Hrs,100’ Boom, 2 Ex. 520/85R42 Tires - 60%, 4 Crop Dividers STK# 043995 ................. $81,500 M

09 Apache AS715 228 Hrs,90’ Autoboom,750 Gal Tank, No Foam Marker STK# 036534 .............................. $129,500 M

03 Apache 859 1620 Hrs, 90’ Boom, Heavy Duty Front End, 460 Raven Controller STK#048631..................... $94,500 M

SEEDING O38970 O53634 O54412 O50929 O42526 O53422 O37556 O54347 O52296 O41481 O53077 O54381 O50709 O50715 O45398 O51105 O54663 O50913 OO4374M O52293 O53439 O54322 O53720 O54973 O53803 O54753 O52291 O53148

98 Bourgault 8800 36’, 8” Spac, 230# Trip, 155 BU Tank, Sngl Sht, Float Hitch, 2 Tnk Mtr............................. $27,500 B 97 Bourgault 8800 40’, 3 Bar Harrows, BG Quick Release Sweeps, Seed Boots, 225 BU Tank, Auger ...... $30,000 BV 93 Bourgault 8800 36’ 8” Spacing, Flexicoil 1100 Tank, 230 Trips, 3/4” Openers w/Side Wedge..................... $25,500 Y 07 Bourgault 5710 64’, 9.8” Spac, MRB, 3” Openers, 6550 TBH Tank, Dlx Auger, Dual Sht ............... $207,000 Y 02 Bourgault 5710 47’, 9.8” Spacing, 3.5” Steel Packers, Dual Shoot ................................................... $57,500 M 11 Bourgault 3310 74’, 12” Spacing, Mid Row Shanks, Double Shoot, Full Dual Walking Castors ..... $335,000 M 10 Bourgault 3310 74’, 12” Spacing, 330Trip, 4.5” V-Style Packers, Mid Row Shanks ...................... $315,000 M 09 Bourgault 3310 65’, 12” Spacing, Dual Shoot, Dry to MRB’s, Dual Caster Whls Ft, No Openers .. $159,500 M 97 Bourgault 3225 225 BU Tow Behind, Single Shoot, Single Fan, Auger, Rear Hitch ..................................... $15,000 P 94 Bourgault 3225 225 BU, 2 Comp Tank, Fill Auger, Single Fan, New Hyd Fan Motor .................................. $13,500 D 95 Bourgault 3195 195 BU, Load/Unload Auger, Single Shoot, Std Monitor, Mint Condition ........................... $15,000 M 96 Bourgault 2155 155 Bushel Tank, Load/Unload Auger, Std. Monitor, Hyd Fan, Single Shoot ....................... $9,500 B 09 Seed Hawk 72-12 600 TBT Tank (2011),Rear Clevis Htch,Prim Blkg,Hyd Meter,Duals ............................. $310,000 Y 09 Seed Hawk 72-12 600 TBT Tank (2011),Rear Clevis Htch,Prim Blkg,Hyd Meter,Duals ............................. $310,000 Y 09 Seed Hawk 65-10 30.5x32 Duals Cart, Dual Fans, Dual Shoot Dry, 400 BU Tank, TBT Tank.................. $229,500 M 09 Seed Hawk 65-10 3430 Tow Between, Dbl Shoot Air Pkg, NH3 Tanks, 8 Run Dbl Shoot.......................... $228,000 P 05 Seed Hawk 60-12 60’ 12” Spacing, 4.5 Pneumatic Pack, Quick Pin Depth Set, Duall Castors ................. $115,000 B 08 Seed Hawk 400 400 BU Tow Behind, Dual Shoot, 10” Fill Auger,Dual Hyd Fan ........................................... $73,000 Y 85 John Deere 7300 8 Row Planter, 3PT,Markers, Granular Fert......................................................................... $8,950 W 97 John Deere 787 230 BU Tow Behind, 6 Run Single Shoot, Rear Hitch, Fill Auger ....................................... $13,500 P 96 John Deere 787 230 BU, Tow Between, Auger, Two Tank Metering, 23L26 AWT-60% .............................. $14,800 P 87 John Deere 737 40’ 7.5” Spacing, Rubber Packers, Single Shoot, 230 BU Tank, Fill Auger........................ $36,000 P 93 Flexi-Coil 5000 57’ Air Drill, Tow Between, 3” Steel Packers, Single Shoot, 230 BU, 2320 Air Tank.......... $27,500 D 03 Flexi-Coil 3450 51’ Air Drill, 12” Spacing, Stealth Openers, 500 Tank, Dual Shoot, Load/Unload............... $79,500 M 98 Flexi-Coil 3450 Air Tank, 350 Bushels, Tow Behind, Var. Rate Meter Drive, Dual Shoot 6 Run Config...... $29,500 Y 00 Flexi-Coil 2340 Air Tank/Cart, 230 BU, Tow Behind, Mech. Drive, 8 Run Shoot, Dual Fans........................ $23,500 P 97 Flexi-Coil 2320 Tow Behind, Three Rollers, Dual Fan, Auger, 320 Third Tank.............................................. $23,000 Y 93 Flexi-Coil 2320 230 BU, Tow Behind, Four Rollers, Auger, 4 Run Double Shoot.......................................... $12,700 Y

O48863 O48864 O43713 O47941 O47936 O43162 O49467 O49497 O52967

11 CaseIH 4420 510 Hrs, 120’ Boom, 650/65R38x4, 320/90R46x4, Aim Com, 1200 Gal ..................... $310,000 S 11 CaseIH 4420 510 Hrs, 120’ Boom, 650/65R38x4, 320/90R46x4, Aim Com, 1200 Gal ..................... $310,000 S 10 CaseIH 4420 616 Hrs, 120’ Boom, 1200 Gal Tank, Hydro Trans, Lux Cab, Auto Pilot ..................... $279,500 K 10 CaseIH 4420 1160 Hrs, 120’ Boom, Viper & Can Cont. Sys, Act. Hyd. Susp, AIM Com. ................. $279,500 Y 10 CaseIH 4420 1202 Hrs, 100’ Boom, HID Ctr Lt, Lux. Cab, 100’ Boom, Foam Marker, Viper Pro.... $259,500 Y 09 CaseIH 4420 1565 Hrs, 120’ Boom, Act Susp,HID Lt, Raven Auto Steer, Foam Mrkr,Aim .............. $245,000 P 11 CaseIH 3330 132 Hrs, 100’ Boom, Nav II 262 Receiver, Pro 600, Ex. Set Tires ............................. $269,500 M 11 CaseIH 3330 500 Hrs, 100’ Boom, Pro 600 Nav II 262 Receiver, Del. Cab ..................................... $259,500 M 11 CaseIH 3330 300 Hrs, 100’ Boom, HID Lights, Autoboom Ht/Wheels, Foam Marker ...................... $250,000 M

SPRAYERS

Brandon, MB

Dauphin, MB

Moosomin, SK

O54888 O36122 O51122 O35541 O54943 O36479 O36165 O35765 O54785 O48041 O48668 O44369 O53206 O54460 O42842 O53328 O51240 O53719 O52432 O54246 O48576 O43995 O48631 O35547 O52714 CONSIGN CONSIGN O52705 O53076 JBU01720 O48867 O52975 O53969 O31806 JBU01719 O40685 O54149 O47939 O54942

10 CaseIH 3330 454 Hrs, 120’ Boom, Aim, Deluxe Cab, Autoboom, Accuboom, Pro 600, Auto Steer $260,000 BV 10 CaseIH 3330 353 Hrs,120’ Boom,1000 Gal,600 Mon,Ctr HID,Lthr Pkg,Full Accugde, Aim Command $259,500 M 10 CaseIH 3330 575 Hrs,120’ Boom, Quick Fill, HID Lts, Addtl Boom Sensors, 2 Sets Tires, Aim Command $265,000 BV 10 CaseIH 3330 293 Hrs,120’ Boom,1000 Gal, 20” Spac,Act Susp,Fndrs,Extra Tires .......................... $256,000 D 10 CaseIH 3330 650 Hrs, 100’ Boom, 1000 Gallon Tank, Act. Susp, Lux. Cab, Auto Height ................ $232,000 K 10 CaseIH 3330 828 Hrs,100’ Boom, 1000 Gal, Pro 600, Autoboom, Foam Mrkrs, Extra Tires .......... $219,500 M 10 CaseIH 3330 421 Hrs, 100’ Boom, 1000 Gal, 320/46 Front, 650/38 Rear, Deluxe Cab ................... $249,000 K 08 CaseIH 3320 866 Hrs, 100’, Raven Smart Trax, Aim Comm, Fenders, Act. Susp. .......................... $235,000 W 08 CaseIH 3320 1067 Hrs, 100’ Boom, 1000 Gal. Tank, Act. Susp, 5 Way Nozzle, Hal. Lights......... $208,000 KD 00 CaseIH 3200B 2501 Hrs, 90’ Boom, 750 Gal Poly Tank, Foam Marker, 3 Way Noz. ......................... $99,500 D 08 CaseIH PS160 134’ Boom, E. Pro Controller, Ultraglide, Accuboom, Fenders, Ace 206 .................... $59,500 Y 05 CaseIH 4510 2200 Hrs, Floater, 70’ Boom, Single Prod. Tank, 54x31x26 Tires - 70% ................... $139,500 M 11 Apache AS1020 200 Hrs, 100’ Boom, 1000 Gallon Poly Tank, 42” Clearance, 4 Crop Dividers ..... $169,500 S 10 Apache AS1010 395 Hrs, 100’ Boom, 1000 Gal Tank, Auto Boom, Foam Marker, EZ Guide ........ $145,000 M 04 Apache AS850 1600 Hrs,90’ Boom, 850 Gal SS Tank, Rinse Tank, Foam Mrkr, Drop Boxes ......... $95,000 M 11 Apache AS720 92 Hrs, 100’ Boom, 750 Gal. Tank, Foam Marker, SCS 5000, Radar Gun, Auto Boom $140,000 M 09 Apache AS715 300 Hrs, 90’ Boom, 750 Gal Tank, Foam Mrkr, Autoboom, Ultraglide .................... $129,000 M 09 Apache AS715 758 Hrs, 90’ Boom, 750 Gal. Poly Tank, Raven SCS 5000, HD Front End, Radar Gun $115,000 BV 08 Apache AS710 177 Hrs, 380/38 Tires, 155 Engine HP, 4 Spd Auto.............................................. $112,500 BV 06 Apache AS710 841 Hrs, 90’ Booms, 750 Gal. Tank, 4 Spd PS, Foam Marker, HD Front End ....... $104,500 M 06 Apache AS710 1290 Hrs, 90’ Boom, 750 Gal Tank, Auto Boom Ht. Control. .................................. $101,500 P 01 Apache 890 2495 Hrs, 100’ Boom, 2 Ex. 520/85R42 Tires - 60%, 4 Crop Dividers ......................... $81,500.00 03 Apache 859 1620 Hrs, 90’ Boom, Heavy Duty Front End, 460 Raven Controller .............................. $94,500 M 01 Apache 790 1750 Hrs, 90’ Boom, 750 Gallon Tank, Foam Marker,As Is........................................... $69,500 M 01 Apache 560 60’ Boom, 500 Gallon Tank, High Clearance, Norac Autoboom, 4400 Raven .............. $40,000 M 03 Flexi-Coil 67XL 90’ Boom, 830 Gallon Tank, Pull Type Sprayer, Hyd Pump,2 Way Noz Bod .......... $25,000 M 02 Flexi-Coil S67 80’ Boom, 830 Gallon Tank, 1000 PTO Pump, SP655 Ctrl, Windscrns, Rinse Tank $26,500 M 02 Flexi-Coil S67 90’ Boom, Single Wheel, Mix & Fill Rinse Tank Touch Down, Wheel Marker.......... $22,000 BV 02 Flexi-Coil S67 90’ Boom, 14.9/38 Tires, Triple Nozzle Bodies, Hyd Pump, Rate Controller .............. $18,000 K 00 Flexi-Coil XLT67 2 Booms, 2 Tanks, Auto Rate............................................................................... $27,000 KD 00 Flexi-Coil XLT67 2 Tanks, Wind Screens, Auto Rate, New Tires .................................................... $18,000 KD 98 Flexi-Coil 67XL 130’ Boom, 1200 Gallon Tank, Wind Screens, Auto Rate......................................... $12,000 K 94 Flexi-Coil S65 80’ Boom, 800 Gallon Tank, Disc Marker, Hyd Drive Hypro Product Pump ................. $5,300 Y 85 Flexi-Coil S50 70’ Boom, Pull Type, Double Body Nozzles, PTO Drive, 42 Nozzles .......................... $5,450 W 97 Flexi-Coil 65 90’ Boom, 800 Gallon Tank, Auto Rate, Disc Markers, Hyd Pump............................. $15,000 KD 10 Melroe 4660 100 Hrs, 80’ Boom, 400 Gal, Auto Trans, 2 Sets Tires, Charcoal Filter, Tow Hitch.. $110,000 BV Brandt QF2000S 130’ Boom, 1500 Gallon Tank, 16.5x16.1 x 4 Tires, Walking Axles, Auto Rate ......... $13,000 K 10 John Deere 4930 720 Hrs, Boom Trac Pro-5 Level, Wheel Shields, 5 Way Nozzle......................... $289,500 Y 03 John Deere 1810 50’ Boom, 10” Spacing, 350 BU, 150/200 BU Split, Single Chute, Atom Jet Openers $38,500 S

Shoal Lake, MB

Yorkton, SK

Langenburg, SK (306) 743-2312

Kindersley, SK (306)463-4651

(204) 725-2273

(204) 638-5558

(306) 435-3866

(204) 759-2424

(306) 783-8508

Boissevain, MB

Killarney, MB

Neepawa, MB

Winkler, MB

Preeceville, SK

(204) 534-2463

(204) 523-4644

(204) 476-3344

(204) 325-4122

www.millerfarmequipment.com

(306) 547-3300


Saskatchewan FarmLIFE, Monday, March 19, 2012

10 CaseIHST435 567 Hrs, 24 Spd Trans,Diff Loks,55 Gal Hyd Pump,Perf Monitor stk# O37173 ............... $207,500 S

08 CaseIHST485Q 1920 Hrs,30” Tracks, 55 GPM High Output, Diff Locks Ft/Rear stk# O51717............ $241,000 Y

SPRAYERS CONTINUED O47143 O54979 JBU01726 O43159 O52890

05 John Deere 850 1597 Hrs, Rear Duals, 175 Eng. HP. Zynx Monitor, Sect Cont, 850 Gal ................. $87,500 B 03 Bourgault 1460 82’ Boom, 1250 Gal. Tank, Disc Markers, Wind Screens, Fresh Water Rinse Tank . $9,900 M 08 Westward Sprayer Pull Behind Estate Sprayer, Like New ................................................................ $2,750 KD 97 Patriot 150 2714 Hrs, 90’ Boom, 3Way Nozzle, Deutz Eng, 3 Set Tips, DJ Control........................... $55,000 Y 94 Ag Shield Sprayer 100’ Wheel Boom, 1000 Gal. Tank w/Mix&Fill Tank, Wind Screens, 4 Sect. Boom .. $6,800 Y

TRACTORS

CASE IH QUAD TRACTORS O52487 O48862 O51231 O49767 O49302

11 CaseIH ST600Q 170 Hrs, 36” GY Tracks, Lux. Cab, PTO, Diff Locks, 57 GPM Hyd. Pump ............ $405,000 Y 11 CaseIH ST535Q 875 Hrs, 30” GY Tracks, 16F/2R PS, Lux. Cab, 4 Remotes .................................. $326,000 S 10 CaseIH ST535Q 795 Hrs, 30” Tracks,Dlx Cab,Dlx. Cloth Htd Seat, Adj Wide Mrkr Lts ................. $310,000 BV 11 CaseIH ST485Q 650 Hrs, 30” Tacks, Lux. Cab, HID Lights, Cold Start, 55 Gal Hyd Pump ............ $310,000 M 10 CaseIH ST435Q 1100 Hrs, 30” Tracks, PS Trans, Lux. Cab, 55 GPM Pump .................................. $255,000 M

TRACTORS: CASE IH 4WD O54256 O48276 O48083 O48880 O48881 O48885 O52900 O49874 O54929 O36199 O52472 O50434 O49495 O48082 O49316 O48307 O48255 O49305 O48099 O51250 O52491 O52699

12 CaseIH ST600 No Hours, New On Lot, Lux. Cab, Rear Remotes, Hi CapBar w/Diff Lock ............... $369,500 S 11 CaseIH ST535 550 Hrs, Prs, Triples, Lux. Interior, Nav II Controller, Diff Locks ............................... $294,500 B 11 CaseIH ST535 980 Hrs, Duals, PS Trans, Lux. Cab, Hi Cap, Pump, 4 Remotes ............................. $286,500 B 11 CaseIH ST535 504 Hrs, Full PS 16F/2R, 520/85R46 Triples, Lux. Cab, Cold Start.......................... $297,000 S 11 CaseIH ST535 622 Hrs, Full PS 16F/2R, 520/85R46 Triples, Lux. Cab, Cold Start.......................... $297,000 S 11 CaseIH ST535 727 Hrs, Full PS 16F/2R, 520/85R46 Triples, Lux. Cab, Cold Start.......................... $297,000 S 11 CaseIH ST535 506 Hrs, 520/85R46 Triples, PS Trans, Lux. Cab, Diff Locks, 55 GPM Pump ......... $297,000 D 10 CaseIH ST535 1634 Hrs, PS, Lux Cab, Diff Locks, 4 Hyd Rem, Perf Mon, Triples ....................... $267,500 BV 10 CaseIH ST535 720 Hrs, HP 610 (Pro Model), Duals, Diff Locks, Ex. Hydr. Pump, 4 Remotes ........ $259,000 S 09 CaseIH ST535 1724 Hrs, PS, 520 Triples, Lux Cab, PTO, Pro 600, 58GPM Pump ..................... $244,500 BV 09 CaseIH ST535 1400 Hrs, PS Trans, Duals, 4 Hyd Remotes, Air Seeder Drain, Frt/Rear Diff Locks $240,000 B 11 CaseIH ST485 200 Hrs, Duals, 55 Hyd Pump, Lux. Cab, 4 Hyd Remotes,PS Trans ...................... $263,500 M 11 CaseIH ST485 700 Hrs, Del. Cab, Duals, 55 Gal Hyd Pump, 4 Hyd Remotes, Nav II..................... $255,000 M 11 CaseIH ST435 750 Hrs, Duals, PS Trans, Lux. Cab, Hi Cap, Pump, 4 Remotes ............................. $242,000 B 11 CaseIH ST435 275 Hrs, Duals, 24 Spd. PS. Diff Locks, 55 Gal. Pump............................................ $222,500 M 11 CaseIH ST385 286 Hrs, Duals, PS Trans, Std Cab, Diff Locks, No Nav II Cont. .............................. $216,000 B 11 CaseIH ST385 400 Hrs, Duals, PS Trans, 4 Hyd Remotes, Perf. Monitor, Radar ............................ $216,000 D 11 CaseIH ST385 200 Hrs, Duals, PS Trans, 4 Hyd Remotes, Diff Locks, 55 Gal. Hyd Pump ............ $216,000 M 11 CaseIH ST385 400 Hrs, Duals, PS Trans, Del. Cab, Hi Cap Pump, 4 Remotes............................... $216,000 B 10 CaseIH ST385 366 Hrs, PS, Hi Cap Pump, Diff Locks, Std Drawbar, No PTO, Cold St................... $204,500 S 09 CaseIH ST385 500 Hrs, Duals, 16 Spd PS, Dlxe Cab PS, Wheel Axle w/o Diff, Std Drawbar w/o 3PT $195,000 M 96 CaseIH 9370 7529 Hrs, Duals, PTO, 12 Spd PS, 4 Remotes, Air Seat, Radio ................................... $69,000 P

TRACTORS : OTHER 4WDS O51515 CONSIGN O54847 O54857 O54404 O54820 O54946

06 New Holland TJ530 2389 Hrs, 800/70R38 Duals, Mega Flow Hyds, Perf. Monitor ............................... $202,000 Y 98 New Holland TV140 10535 Hrs, 16.9X38 Tires, NH 7614 Loader/Buck, 22 Frt Weights ........................ $34,500 K 95 New Holland 9280 4907 Hrs, 18.4R38 Tires, Duals, 4 Hyd. Remotes, Low Pressure Return, 250 HP .. $45,000 P 97 John Deere 9300 5841 Hrs, 12 Spd Std Trans, 4 Hyd. Remotes, Duals, 2-680kg Rear Wheel Weights $85,000 L 96 John Deere 8570 6135 Hrs, 18.4R38 Duals, 4 Remotes, Diff Locks, 250 Engine HP, 12 Spd Trans .... $57,000 Y 02 Buhler 2180 2400 Hrs, MFD, Duals, 1000 PTO, 3 PT Hitch, 4 Remotes, PS 18/9, Trans ...................... $73,000 B 76 Versatile 800 8400 Hrs, Duals, AC/Heater, 12 Spd. Standard, 235 Engine, 4 Remotes ......................... $12,500 B

CASE IH TRACTORS : MFD / 2WD O48075 O50197 O41600 O38436 O49485 O48879 O48877 O51863 O51248 O41135 O40951 OO3979M

11 CaseIH Puma180 700 Hrs, Duals, 112” Axle, CVT Trans, 4 Remotes, Del. Cab. ............................ $121,500 B 10 CaseIH Puma140 300 Hrs, Loaded Joystick, Fenders, Bucket, 3 Pt. Hitch, 3 Hyd Remotes ......... $119,500 M 09 CaseIH Puma140 1566 Hrs, PS, 4 Hyd Rem, 3 PTH, L760,Joystick ............................................... $97,500 KD 09 CaseIH Puma140 1031 Hrs, PS, 112”Bar Axle, 3 Hyd Rem, Fndrs, LX760, Whl Wts ........................ $92,750 L 11 CaseIH Puma 125 150 Hrs, L760 Ldr, 102” Buck/Grapple, 540/1000 PTO, 98” Bar Axle ............... $104,500 M 11 CaseIH Puma125 581 Hrs, 540/1000, 3 Remotes, Cold Weather Pkg, 8 Weights ............................. $84,500 S 11 CaseIH Puma125 875 Hrs, 540/1000, 3 Remotes, Cold Weather Pkg, 8 Weights ............................. $84,500 S 10 CaseIH Puma125 480 Hrs, L760 Ldr, 95” Buck/Grapple, 19 Spd Trans, 23 degree radial............... $105,000 S 10 CaseIH Puma125 218 Hrs, PS, 3 Hyd Rem, Grid Heater, Elec Mirrors, PTO, Cold Start Pkg ........... $99,500 S 09 CaseIH Puma125 2015 Hrs, 18 Spd, L760 Loader, 3 Func Joystick, Fenders .................................. $96,500 W 09 CaseIH Puma125 2489 Hrs, PS, L760 w/Bkt/Grpl/Sil Sc, 3 Hyd Rem, 3 Func Joystk, No Duals....... $89,500 D 09 CaseIH Puma125 1069 Hr, MFD, 3Pt, Loader Rdy,18.4R42, Frt.Fndrs,16.9x28 ................................ $87,500 B

BRANDON Larry Mountain Wade Heinrichs Craig Frondall Marv Nicholls

BOISSEVAIN

DAUPHIN

KILLARNEY

Wayne Stansall George Panko Jeff Cuvelier Henry Voth Todd Nichol Kelly Johnston Ryan Heinrichs Jeff Abraham Bruce Charles Henry Voth (204) 534-7578

O48354 OO2654M O34589 O45613 O46433 O54188 O38833 O48061 O48154 O48153 O48106 O48059 O48107 O38403 O54567 O38293 O48072 O51966 O48060 O53629 O41515 O48537 O41739 O54830 O54361 JBU01825 O54819 O39949 O54261 O37844 O33136 O52535 O53235

PAGE 27

11 CaseIH ST435 591 Hrs, Duals, Dlx. Cab, Diff Locks, PS Trans, Low Pressure Return stk# O49736 ....... $242,000 M

08 CaseIH Puma125 1751 Hrs, L760 Loader, 3 Pth, Joystick, Del. Cab, Rear Wgts ........................... $91,500 BV 08 CaseIH Puma125 984 Hrs, MFD, 3Pt, 20.8x38, L760 FEL, 92” Bkt, 2 Hyds, 540/1000 .................... $85,000 M 08 CaseIH Puma125 1744 Hrs, PS, 3 Hyd Rem, 3PTH, Bar Axle, Frt Wts, Dual PTO .......................... $83,000 M 06 CaseIH MXM190 5369 Hrs, PS, 190 Engine HP, 175 PTO HP, 3 PT Hitch........................................ $71,500 S 04 CaseIH MXM175 4530 Hrs, PS, MFS, 3Pt Hitch & PTO, LX175 MSL Load w/Grap. & Joystick ........ $70,000 Y 06 CaseIH MXM120 4300 Hrs, LX162 Ldr, 4 Hyd. Remotes, 3 PT Hitch, Bucket/Grapple, 540/1000 PTO $54,500 D 03 CaseIH MXM120 4144 Hrs, LX 160 Ldr, Semi PS, No Duals, 3 PTH,4 Hyd Remotes ...................... $47,500 M 11 CaseIH MX275 700 Hrs, Duals, 19 Spd PS, Del. Cab, Sgle Beacon, Frt Fenders ........................... $159,500 B 10 CaseIH MX275 1250 Hrs, Duals, 23 Spd PS/Creeper, Del. Cab. 10 Weights................................... $149,500 B 10 CaseIH MX275 1250 Hrs, Duals, 23 Spd PS/Creeper, Del. Cab. 10 Weights................................... $149,500 B 11 CaseIH MX245 700 Hrs, Duals, 19 Spd PS, Del. Cab, Sgle Beacon, Frt Fenders ........................... $158,000 B 11 CaseIH MX245 545 Hrs, Duals, 245 Engine HP, 19 Spd PS, Del. Cab, Single Beacon, 4 Remotes $146,500 B 11 CaseIH MX245 700 Hrs, Duals, 19 Spd PS, Del. Cab, Sgle Beacon, Frt Fenders ........................... $158,000 B 09 CaseIH MX215 1160 Hrs, PS, 4 Hyd Rem, Beacon, Htd Cloth Seat, No 3PTH, PTO ................... $135,000 BV 06 CaseIH MX215 3100 Hrs, PS, 4 Rear Remotes, 3PT Hitch, Diff Locks, PTO, Heavy Duty Draw Bar $115,000 KD 99 CaseIH MX180 7757 Hrs, Duals, PS, MFD, 3 Rem, 3PTH, Beacon, Buddy Seat, PTO .................... $52,000 W 11 CaseIH MX125 600 Hrs, L750 Loader/Grapple, 98” Bar Axle, Semi PS, 3 Remotes .......................... $99,500 B 10 CaseIH Max125 291 Hrs, L750 Ldr, 95” Buck/Grapple, 16x16 Semi PS, 540/1000 PTO .................. $94,000 M 10 CaseIH Max125 377 Hrs, Max 125 Value, 3x4 Synchro, 125 Eng. HP, 3 Remotes ........................... $64,500 B 09 CaseIH Max110 300 Hrs, L740 MSL Frt Ldr, Open Station, Folable Rops, 16X16 Semi PS Trans ... $50,500 B 97 CaseIH 8920 6428 Hrs, PS, 2895 Buhler Ldr/Jystk, 3 PTH,3 Hyd Rem, Cab/Air/Heater .................... $62,500 N 99 CaseIH 7110 10259 Hrs, Std. Cab, AC/Heater, No 3 PTH, 3x Rear Hyd. Remotes ........................... $22,500 B 89 CaseIH 7110 9249 Hrs, 18 Spd PS Tr, 3 Rem, 540/1000 PTO, Duals............................................... $25,000 M 82 CaseIH 5288 Standard Transmission, 160 Engine HP, 14L-15.1 Front, 20.8/38 Rear, Duals ............ $13,500 D 84 CaseIH 3688 7200 Hrs, Duals, Std. Trans, 140 Engine HP, 3 Hyd. Remotes, A/C, Heater................ $12,500 B 83 CaseIH 2590 9092 Hrs, Case FEL .................................................................................................... $11,500 KD 82 CaseIH 2390 6126 Hrs, 12 Spd. PS, Duals, 2 Hyd. Remotes, 1000 PTO, Cab, Air, Heat. ................. $16,500 D 81 CaseIH 2390 6665 Hrs, PS, 2 Hyd Remotes, 1000 PTO, Duals ........................................................ $14,500 M 86 CaseIH 2096 9042 Hrs, PS Transmission, 11.00-16 Front, 18.4-38 Rear, L795 Ldr & Bucket ........... $17,500 N 78 CaseIH 2090 8153 Hrs, PS, Bolt on Duals, 2 Remotes, 540/1000 PTO ............................................. $12,500 N 84 CaseIH 1896 7663 Hrs, PS, 540/1000 PTO, 3 Hyd Rem, Rear Whl Wts ........................................... $15,000 M 76 CaseIH 674 2615 Hrs, 2WD, Loader, 60” Land Pride 25-60 3 PTH Mower, 540 PTO, 8x4 Transmission $7,000 B 66 CaseIH 580 Industrial Tractor, 3 PTH, Gas Eng, 2WD, Const. Front End Ldr, Road Box Scrap 84” . $9,500 Y

OTHER TRACTOR MAKES O46553 O47167 O54467 O54558 O49883 O54818 O51230 O53968

04 New Holland TM175 4628 Hrs, LB72 Loader, 95” Buck. w/Grapple, No Duals, 3 Function ............. $62,500 M` 94 New Holland 8870 9564 Hrs, MFD, Lg 1000 PTO, Duals, Shedded, PS Transmission ..................... $38,000 B 96 New Holland 8670 6090 Hrs, MFD, PS Transmission, 140 Engine HP, Allied FEL ......................... $55,000 M` 00 John Deere 7510 13058 Hrs, 740SL Fel & Grapple, 3 Remotes, Air, 3 Point, Joystick, 155 PTO HP $44,500 N 75 John Deere 4230 5848 Hrs, Quad Shift Trans, 10-16 Front Tires, 18.4x38 Rear Tires ..................... $13,500 D 84 John Deere 2950 5885 Hrs, 260 SL Loader, Bucket/Grapple, Quick Detach, Joystick, 3 PT Hitch ... $28,500 D 92 Massey Ferg 390 2020 Hrs, 12 Spd Tr, Diff Lock, #80 Ezee Loader............................................... $12,000 BV 08 Kubota M135XD 2435 Hrs, Loader/ Bucket Grapple, Fast Turn, 4 Hyd, Dual PTO, Fluid In Tires . $65,000 BV

O54344 O51251 O48326 O48282 O49493 O48090 O48891 O48892 O48894 O48895 O49713 O48287 O48281

12 CaseIH WD1203 4 Hrs, 16’ HDX 162 Hay Hdr, Dbl Knife Drive,Rubber on Rubber, PU Reel ......... $108,500 B 11 CaseIH WD1203 43 Hrs, DH362 Draper, Dbl Knife, Spit Reel, Hyd F&A, Susp Cab......................... $126,000 S 11 CaseIH WD1203 125 Hrs, DH362, UII 6 Bat 1 PC Reel, Dbl Knife Drive, Hyd F&A ......................... $126,000 B 11 CaseIH WD1203 86 Hrs, DH302, 30’ UII PU Reel, Hyd F&A, Dbl Knife Drive, Del. Cab.................. $126,000 B 11 CaseIH WD1203 100 Hrs, DH302 30’ Draper, Dbl Knife Dr, Cab Upgraded, UII PU ....................... $126,000 M 11 CaseIH WD1203 200 Hrs, DH362, 1 PCUII PU Reel, Upgraded Cab, Dbl Knife Dr. ........................ $126,000 B 11 CaseIH WD1203 205 Hrs, DH362, 21Lx28 Tires, Cab Susp. Only, Split Reel, Hyd F&A .................. $126,000 S 11 CaseIH WD1203 207 Hrs, DH362, 21Lx28 Tires. Cab Susp. Only, Split Reel, Hyd F&A .................. $126,000 S 11 CaseIH WD1203 261 Hrs, DH362, 21Lx28 Tires, Cab Susp. Only, Split Reel, Hyd F&A .................. $126,000 S 11 CaseIH WD1203 223 Hrs, DH362, 21Lx28 Tires, Cab Susp. Only, Split Reel, Hyd F&A .................. $126,000 S 11 CaseIH WD1203 191 Hrs, DH302, 30’ UII PU Reel, 21Lx28 Tires, Susp. Cab, Hyd F&A ................. $119,000 S 11 CaseIH WD1203 86 Hrs, DH302, 30’ UII PU Reel, Hyd F&A, Sgle Knife Dr. Del. Cab .................... $119,000 B 11 CaseIH WD1203 86 Hrs, DH302, 30’ UII PU Reel, Hyd F&A, Sgle Knife Dr. Del. Cab .................... $119,000 B

SWATHERS AND HEADERS

MOOSOMIN

NEEPAWA

SHOAL LAKE

WINKLER

YORKTON

PREECEVILLE

Torrie Carter Barry Doole Jason Miller

Doss Mayor Buzz Bradley Wally Van Niekerk

Mark Swereda Willie Voth Gerry McTavish

Kevin Bergen Lee Maclean Travis Thiessen

Barry Maurer Jerry Borchowitz Ken Chepil Warren Kotzer

Jason Reine Russel Larnder

www.millerfarmequipment.com

LANGENBURG Cory Andres Dave Eberts


PAGE 28

Saskatchewan FarmLIFE, Monday, March 19, 2012

The equipment listed is only a small portion of what Miller Equipment has to offer! Visit us online!

07 CaseIH 2042 36’ Draper,2388 Adptr, No Trans, Gauge Whls, Empire Whls, Stk# 033645 ........................$32,500 M

O49302 10 CaseIH ST435Q 1100 Hrs, 30” Tracks, PS Trans, Lux. Cab, 55 GPM Pump ........................................... $55,000 M

08 CaseIH ST535 1925 Hrs,PS,Lux Cab,4 Hyd Rem,Pro 600,262 Rec,Nav II,Triples stk# O38363 ........... $235,000 D

09 CaseIHWD1203 202 Hrs, DHX362 Hdr, Dbl Knife Dr, Hyd F/A, Susp Cab, Wiper, Cold Start stk# O37901 .. $114,000 L

05 CaseIH WD1202 910 Hrs,36’ PU DH362 Sngl Knife Dr,Sch. Cut Sys,Slow Spd Tr STK#033264 ......... $86,900 B

10 CaseIH WD1203 197 Hrs, 36’ DH362, PU Reel, Upgrade Cab, Cold Start, srk# O35234 .......................... $119,500 B

SWATHERS AND HEADERS CONTINUED O48223 O49325 O49303 O48098 O49745 O49204 O49207 O48415 O52460 O36307 O36309 O35817 O37726 O38164 O36215 O36216 O52972 O36093 O38295 O38908 O49732 O37849 O38163 O48416 O48413 O48157 O35018 O38360 O38361 O50062 O50061 O40566 O46162 O49783 O47165 OO3290 O46343 O31940 OO5006M

11 CaseIH WD1203 75 Hrs, DH302, 21Lx28 Tires, 30’ PU, 2 Spd Hydro,Hdr Transport ...................... $119,000 S 11 CaseIH WD1203 50 Hrs, DH302, 21Lx28 Tires, 30’ UII PU, Hydro Trans, Susp. Cab ..................... $119,000 M 11 CaseIH WD1203 2 Hrs, DH302, 21Lx28 R4 Lug, 30’ UII PU Reel, 5 Bat Plastic .............................. $122,500 M 11 CaseIH WD1203 200 Hrs, DH302, 21Lx28 Tires, Del. Cab, Cab Susp. Frt Wiper ............................ $119,000 B 11 CaseIH WD1203 155 Hrs, 36’ PU Reel, 362 Header, 21Lx28 Tires .................................................. $126,000 K 11 CaseIH WD1203 150 Hrs, DH302, 18.4R26 Tires, Dble Knife Drive, UII 5 Batt Reell ...................... $119,000 D 11 CaseIH WD1203 150 Hrs, DH302, 18.4R26 Tires, Dble Knife Drive, UII 5 Batt Reell ...................... $119,000 D 11 CaseIH WD1203 120 Hrs, 30’ DH302, UII 5 Batt PU Reel, Hyd Fore/Aft. Del. Cab.......................... $115,000 D 11 CaseIH WD1203 105 Hrs, 30’ DH302, UII PU Reel, Hyd Fore/Aft, Chaff Wiper Kit, Plastic Teeth ... $115,000 S 10 CaseIH WD1203 285 Hrs, 36’ DH362, UII Split Reel, Hyd Fore/Aft, Dual Knife Dr........................... $119,500 S 10 CaseIH WD1203 256 Hrs, 36’ DH362, UII Split Reel, Hyd Fore/Aft, Dual Knife Dr........................... $119,500 S 10 CaseIH WD1203 72 Hrs, 30’ DH302, UII 6 Batt Reel, Upgrade Cab, Aux Hyd Pump Reel Dr ......... $119,500 B 10 CaseIH WD1203 217 Hrs, 36’UII PU,Dbl Knife Dr,Hyd Fore/Aft,Front Wiper,Dlx Cab ...................... $105,000 M 10 CaseIH WD1203 209 Hrs, 36’ UII PU,Fore/Aft,Dlx Cab,Front Wiper,Cold Start Pkg,Mirrors ............ $119,500 S 10 CaseIH WD1203 209 Hrs, 36’ DH362 6 Batt UII PU, Hyd Fore/Aft, Dual Knife Dr.......................... $119,500 BV 10 CaseIH WD1203 246 Hrs, 36’ DH362 6 Batt UII PU, Hyd Fore/Aft, Dual Knife Dr............................ $119,500 B 10 CaseIH WD1203 180 Hrs, 36’ DH362, Del. Cab, Hyd Fore/Aft, Cab Suspension, Frt Wiper/Washer ... $117,500 M 10 CaseIH WD1203 80 Hrs, 30’ UII PU ,Hyd Fore/Aft, Hyd Tilt, Single Knife Dr, Dlx Cab .................... $115,500 S 10 CaseIH WD1203 167 Hrs, 30’, UII PU Reel w/Plastic Teeth, Fore/Aft,Dlx Cab................................ $115,000 W 10 CaseIH WD1203 312 Hrs, 36’ PU, Dble Knife Dr, Std Cab w/Susp, Rear Axle Susp, Cold St ....... $114,800 BV 10 CaseIH WD1203 523 Hrs, 36’ DH362 Header, UII Split Reel, F&A, Dble Knife Drive ...................... $114,500 M 10 CaseIH WD1203 247 Hrs, 36’ DH362, 6 Batt UII PU,Hyd Fore/Aft,Dual Knife Dr ........................... $114,500 BV 10 CaseIH WD1203 151 Hrs, 30’ UII w/Plastic Teeth, Fore/Aft, Dlx Cab, Front Wiper, Grid Htr ........... $112,500 S 10 CaseIH WD1203 275 Hrs, 30’ DH302 UII 5 Batt PU, Del.Cab, Cold Start, Cold Start Kit ................. $110,000 D 10 CaseIH WD1203 220 Hrs, 30’ DH302 UII 5 Batt PU, Del. Cab, Hyd Fore/Aft, Cold Start ................. $110,000 D 10 CaseIH WD1203 250 Hrs, DH302, 21Lx28 Tires, Del. Cab, Cab Susp, Frt Wiper ............................ $109,500 B 09 CaseIH WD1203 316 Hrs, 36’ UII PU Reel, Dbl Knife Dr, Hyd F/A, Sngl Span Reel ........................ $112,000 D 09 CaseIH WD1203 396 Hrs, 36’ UII PU Reel, Dbl Knife Dr, Hyd F/A, Cold Start Pkg.......................... $109,500 S 09 CaseIH WD1203 337 Hrs, 36’ UII PU Reel, Dbl Knife Dr, Hyd F/A, Cold Start Pkg.......................... $109,500 S 09 CaseIH WD1203 300 hrs, 36’ UII PU Reel, Split Reel, Double Knife Drive, Del. Cab....................... $107,500 M 09 CaseIH WD1203 300 Hrs, 36’ UII PU Reel, Split Reel, Double Knife Drive, Del. Cab ...................... $107,500 M 08 CaseIH WD1203 419 Hrs, 36’ UII 6 Batt 1 Pc Reel, Dbl Knife Dr, Trans,Dlx Cab,Wiper .................... $89,500 B 08 CaseIH WD1203 433 Hrs, 30’ DH302 Double Knife Drive, Completed Updates ................................. $88,500 K 08 CaseIH WD1203 785 Hrs, 30’ DH302 Dbl Knife Dr, UII Pickup Reel, Hyd F/A, Dlx Cab .................... $87,500 D 07 CaseIH WDX1202 831 Hrs, 36’ Header, UII Split Reel, Dbl. Knife Drive, F&A ................................... $87,500 N 07 CaseIH WDX1202 732 Hrs, 30’ PU Reel, Transport, Guage Wheels, Dlx Cab ................................... $82,500 D 06 CaseIH WDX1202 883 Hrs, Split Reel, Gauge Wheels, Endwise Transport ....................................... $83,000 Y 06 CaseIH WDX1202 395 Hrs, 25’, Hdr Tilt, Steel PU Teeth, Fore/Aft, Hi Spd Transport ...................... $79,500 W 06 CaseIH WDX1202 1586 Hrs, 36’ PU Reel, Guage Wheels, Transport,SKD .................................... $72,500 KD

Brandon, MB

Dauphin, MB

Moosomin, SK

O36732 O45578 O51273 O51276 O45786 O49704 O50063 CONSIGN O49917 O46386 O47170 O54204 O46429 O46360 O46624 O45530 O42428 O54015 O54205 O54078 O33419 OO3221M O46628 O49995 O52882 O49499 CONSIGN O53330 O52085 O48665 O47763 O48666 O45537 O54532 O46629 O54921 O54922 O46273 O46574 O52575

06 CaseIH WD1202 470 Hrs, 36’, Split Reel, Hyd Fore/Aft, Transport, Guage Whls ............................... $76,500 M 05 CaseIH WD1202 837 Hrs, 30’ Sinlge Knife Drive, UII PU Reel ........................................................... $89,000 K 05 CaseIH WD1202 813 Hrs, DH362 Hdr, Hyd Fore & Aft, Double Knife Drive, PU Reel ....................... $79,500 D 05 CaseIH WD1202 1062 Hrs, DH362, Single Knife Drive, Pickup Reel.................................................. $77,500 D 05 CaseIH WD1202 1025 Hrs, 30’ Header, 18.4x26, 14Lx16.1 Tires, UII PU Reel, Del. Cab ................. $77,500 D 05 CaseIH WD1202 870 Hrs, 30’ Draper Header, UII PU Reel, New Guards, Hydro Trans ................... $76,000 K 09 CaseIH HDX162 16’ HDX162 Hay Header .......................................................................................... $22,500 M 08 CaseIH HDX162 16’ Hay Head Fits WD1202/WD1203 ....................................................................... $21,500 M 99 CaseIH 8825 1700 Hrs, 25’ Hdr w/UII PU Reel, Diesel Engine, Shedded........................................... $28,500 N 98 CaseIH 8825 1985 Hrs, 14.9x24, 11Lx15, Hydro Trans, Dbl. Swath, Dbl. Knife Drive........................ $34,000 N 97 CaseIH 8825 1850 Hrs, 25’, UII PU Reel, DKD, DS, Hydro Trans, 98 Engine HP ............................. $32,000 K 96 CaseIH 8820 2031 Hrs, 25’ Center Delivery Header, UII PU Reel, 21.5x16.1 Front, 7.5x15 Rear ..... $22,500 B 95 CaseIH 8820 1910 Hrs, 21’ Header, UII PU Reel, 14.9-24 Tires ......................................................... $26,500 D 95 CaseIH 8820 2305 Hrs, 25’ UII PU Reel, 14.9-24 Tires, Canvas Good Condition .............................. $25,500 S 94 CaseIH 8820 2195 Hrs, 30’ UII PU Reel, 16.5x16.1, 9.5x14 Tires, Plastic Teeth ............................... $27,500 S 94 CaseIH 8820 2460 Hrs, 30’ Header, Double Knife, UII PU Reel, Plastic Teeth .................................. $23,500 D 94 CaseIH 8820 2715 Hrs, 25’ PU Reel, Dble Knife Drive, Gauge Wheels, Diesel Engine ..................... $22,900 B 94 CaseIH 8820 4732 Hrs, 25’ UII PU Reel, 14.9-24 Tires, Double Swath .............................................. $14,500 D 96 CaseIH 8820 16’ Hay Header, Steel on Steel Conditioner, Single Knife Drive...................................... $5,500 B 93 CaseIH 8820 14’ Hay Header, Double Knife Drive, Steel on Steel Rollers, PU Reel ............................ $5,500 D 85 CaseIH 6000 3800 Hrs, 30’ PU Reel, Rear Weights ............................................................................ $11,500 M CaseIH 730 30’ PT Windrower,Bat Reel,Rubber Canvass ........................................................................ $2,650 W 96 CaseIH 205 16’ Hay Header to fit Massey Windrowers 200 and 220 .................................................... $4,500 S 06 MacDon 9250 660 Hrs, 36’ 963 Draper Header, Pickup Reel, Gauge Wheels ................................... $72,000 M 00 MacDon 9250 978 Hrs, 30’ 962 Header(2001) PU Reel, Deluxe Cab, 21.5x16.1 Ft/ 14Lx16 Rear.... $59,500 M 02 MacDon 2940 1145 Hrs, 962 30’ Header w/PU Reel, 2 Spd Trans .................................................... $67,500 M 96 MacDon 960 25’, Fits Vers/NH 9030 Bi Directional, mounted swath roller, knife ................................ $11,500 N 09 MacDon M150 525 Hrs, 35’ D60 Draper Header, Mech Centre Link, Hyd F&A, Single Knife Drive . $125,000 M 09 MacDon 100 255 Hrs, 30’ D50 Hdr, 600 Dr. Tires, 16.5x16.1 Forked Rear, Hyd F&A ..................... $110,000 L 10 Massey 9435 36’, Single Swath, One Piece UII Reel, w F&A, End Guage Wheels............................ $99,500 Y 09 Massey 9430 130 Hrs, 36’ Draper Head w/PU, Sgl Knife Drive, Rear Weights ................................ $109,500 M 08 Massey 9430 36’ Single Swath, 6 Rear Weights, Accutrac Steering, Hyd Tilt, F&A ........................... $91,500 Y 06 Massey 9220 805 Hrs, 25’ 5200 Hdr Model, Formed Casters, 5 Batt Reel........................................ $61,000 W 97 Massey 220 2211 Hrs, 26’ PU Reel, Double Swath, Schumacher Knife Drive, Hydro Trans ............. $29,500 M 03 Massey 200 1420 Hrs, 26’, UII PU with Plastic, Cavasses & Knife very good cond. .......................... $29,500 S 09 John Deere 4895 283 Hrs, 36’ Honey Bee Header, PU Reel, Deluxe Cab, Gauge Wheels, Hydro Trans. $109,500 M 09 John Deere 4895 270 Hrs, 36’ Honey Bee Header, PU Reel, Deluxe Cab, Gauge Wheels, Hydro Trans.$109,500 M 99 Prairie Star 4920 1876 Hrs, 25’ 960 Hrd, PU Reel, Shedded, Field Ready....................................... $39,500 D 00 Prairie Star 4600 2000 Hrs, 30’ Pull Type Swather, Batt Reel .............................................................. $4,500 D 03 Westward 9250 920 Hrs, 30’ 972 Header, Double Knife Drive, Double Swath, Hyd F& A, Split Reel $62,000 K

Shoal Lake, MB

Yorkton, SK

Langenburg, SK (306) 743-2312

Kindersley, SK (306)463-4651

(204) 725-2273

(204) 638-5558

(306) 435-3866

(204) 759-2424

(306) 783-8508

Boissevain, MB

Killarney, MB

Neepawa, MB

Winkler, MB

Preeceville, SK

(204) 534-2463

(204) 523-4644

(204) 476-3344

(204) 325-4122

(306) 547-3300

* All prices expire 28 days after publication, subject to change without notice.

www.millerfarmequipment.com


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 29

10 CaseIH Puma140 648 Hrs, PS, 540/1000 PTO, L760 Ldr (No Grapple), 2 Func Jystk stk# O37260 .. $105,000. K

92 Flexi-Coil 5000 57’, 235 BU Tank, 350# Trip, 2” Steel Pkrs, C-Shanks, 3/4” Carbide Opnrs stk# O40780 $48,500 N

97 Bourgault 5710 2’ Air Drill, 7” Spacing, 3” Steel Packers, 330lbs Trips stl# O47678 .................................... $39,500 M

09 Bourgault 3310 65’ Width, 12” Spacing, Double Shoot, Mid Row Shanks, 4.5” Packers stk# O49979 ....$147,500 M

07 Bourgault 5710 64’,9.8” Spac,MRB,3” Openers,6550 TBH Tank,Dlx Auger,Dual Sht stk# O42197 .......$207,000 Y

10 Bourgault 8810 60’ Drill, MRB, HD Packers, Single Shoot, NH3 Kit, stk# O52915 ........................... $135,000 M

SWATHERS AND HEADERS CONTINUED O51800 O46093 O33418 O53209

04 Westward 2952 740 Hrs, 972 Hdr, 30’ Split Reel, PU Reel, Plastic Teeth, Two Spd ......................... $74,500 S 90 Hesston 8100 1647 Hrs, 25’ Header, Gas, New Whl Seal on RH Side, Field Ready ......................... $18,500 M 89 Hesston 8100 3642 Hrs, 30’ Pickup Reel ............................................................................................ $19,500 M 06 NewHolland HW325 680 Hrs, 30’ PU Reel, Double Knife Drive, Hyd F&A ........................................ $69,500 S

COMBINES

CASE IH COMBINES O48838 O48840 O48841 O48842 O48843 O48844 O48845 O49503 O48050 O49170 O49766 O37087 O40806 O53066 O52003 O52894 O52892 O36268 OO4352M O33952 O54701 O51055 O45500 O51183 O49993 O34058 O50045 O39587 O49802 O38404 O36285

11 CaseIH 9120 251 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad Lights ....................... $314,000 S 11 CaseIH 9120 256 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 S 11 CaseIH 9120 235 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 S 11 CaseIH 9120 254 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 K 11 CaseIH 9120 313 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 K 11 CaseIH 9120 247 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 S 11 CaseIH 9120 256 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 S 11 CaseIH 9120 100 Hrs, Duals, 2016 16’ PU Hdr, Lux Cab, Magna Cut Chop, Lg Auger ................... $314,000 K 11 CaseIH 9120 325 Hrs, Duals, 2016 PU Header, Y&M, Lateral Header Tilt, Pro 600 ........................ $308,000 B 11 CaseIH 9120 186 Hrs, Duals, 2016 14’ PU Hdr, Fully Hyd Steer, 24’ Auger, Lat. Tilt ...................... $308,000 D 11 CaseIH 9120 255 Hrs, 3016 PU Hdr, Fine Cut Chopper, LT Rotor, Ext Wear ................................. $304,000 W 10 CaseIH 9120 251 Hrs, 14’ 2016 PU,Sm Tube Rotor,Magnacut Chpr,HID......................................... $314,000 B 10 CaseIH 9120 387 Hrs, 14’ 2016 Hdr,Pro 600,HID Lts,Sm Tube Rotor,Diff Locks,Y&M .................... $305,000 D 10 CaseIH 9120 351 Hrs, Duals, Magna Cut Chopper, Ext. Wear Sm Tb Rotor, 600 Monitor .............. $305,000 S 10 CaseIH 9120 354 Hrs, 16’ Hdr, Duals, Magna Cut Chopper, Ext. Wear Sm Tb Rotor ...................... $305,000 S 10 CaseIH 9120 198 Hrs, 16’ 2016 PU Hdr, Duals, Fine Cut Chopper, Sm Tb Rotor, Lat. Tilt, Lux. Cab .. $299,500 D 10 CaseIH 9120 231 Hrs, 16’ 2016 PU Hdr, Duals, Magna Cut Chopper, Small Tube Rotor, Lux. Cab $299,500 D 10 CaseIH 9120 370 Hrs, 16’ 2016 PU, Sm Tube Rotor, Pro 600, HID Lts,Dlx Cab ............................ $299,500 S 09 CaseIH 9120 611 Hrs, 2016 PU,Lat Tilt,Std Rotor,Magna Cut Chpr,HID Lts,24” Auger .................. $291,000 M 09 CaseIH 9120 396 Hrs, 7.3 M Unload Auger, Cloth Seat, Sm Tube Rotor, HID Std LTs ................... $299,500 S 09 CaseIH 9120 300 Hrs, 16’ 2016 PU, Sm Tube Rotor, Fine Cut Chopper, Y&M, Pro 600 ................ $280,000 M 09 CaseIH 9120 655 Hrs, 14’ 2016 PU,Lux Cab,Magna Cut Chppr,Y&M,HID Lts,Duals ....................... $275,000 D 10 CaseIH 8120 394 Hrs, 2016 16’ PU Header, Duals, Hydro Trans, 450 Engine HP .......................... $299,000 B 10 CaseIH 8120 291 Hrs, 2016 PU Hdr,AFX Ext Wear Rotor,Magna Cut,Rock Trap ............................ $296,000 Y 10 CaseIH 8120 480 Hrs, 2016 PU Hdr, AFS Pro 600,Y&M, Fine Cut Chopper .................................... $292,500 N 10 CaseIH 8120 294 Hrs, 2016 Hdr, Magna Cut Chpr, 24’ Auger, HID Stad Lts ................................ $290,000 BV 10 CaseIH 8120 692 Hrs, 16’ 2016 PU Header, Duals, Fine Cut Chopper, Y&M ................................. $285,000 N 10 CaseIH 8120 404 Hrs, Hal Stadium Lts, Yield&Moisture Perf. Trough ............................................. $285,000 W 10 CaseIH 8120 280 Hrs, 14’ 2016 PU Hdr, AHHC, Lat. Tilt, Fine Cut Chop, Y&M.............................. $280,500 M 09 CaseIH 8120 619 Hrs, Pro 600,Magna Cut Chpr,Lateral Tilt,Elec Mirrors,Duals .............................. $279,500 S 09 CaseIH 8120 830 Hrs, 14’ 2016 PU Header, Pro 600, 24’ Unload Auger ......................................... $272,500 N

BRANDON Larry Mountain Wade Heinrichs Craig Frondall Marv Nicholls

BOISSEVAIN

DAUPHIN

KILLARNEY

Wayne Stansall George Panko Jeff Cuvelier Henry Voth Todd Nichol Kelly Johnston Ryan Heinrichs Jeff Abraham Bruce Charles Henry Voth (204) 534-7578

O53639 WA20338A WA03183A O35183 O48229 O48241 O35049 O47087 O46664 O40489 O40491 O48586 O51245 O51246 O38286 O50018 O50017 O31996 O48250 O48511 O50166 O52693 O52692 OO5570M O54056 WA105222 O34420 O35869 O36565 O49547 O49285 O49309 O49457 O49466 O49983 O49984 O48052 O48051 O36457

09 CaseIH 8120 480 Hrs, 16’ 2016 Swathmaster PU, Pro 600, 24’ Unload Auger, Rock Trap ............. $265,500 B 08 CaseIH 8010 547 Hrs, 16’ 2016 Hdr, Sml Tube Rotor, F/cut Chper, Y&M, Elec. Sieve .................... $265,000 Y 08 CaseIH 8010 572 Hrs, 14’ Hdr., Pro600, F/cut Chpr, 24’ Unload Auger, Dlx Cab............................. $260,000 Y 08 CaseIH 8010 660 Hrs, 14’ 2016 PU Hdr,Fine Cut Chpr,Y&M,Pro 600,Long Aug.............................. $244,900 D 08 CaseIH 8010 509 Hrs, 14’ 2016 PU Hdr, Duals, Del.Cab, Long Auger, Lat. Tilt ............................... $243,000 D 08 CaseIH 8010 509 Hrs, 14’ 2016 PU Hdr, Duals, Del.Cab, Long Auger, Lat. Tilt ............................... $243,000 D 08 CaseIH 8010 685 Hrs, 14’ 2016 PU Hdr, Fine Cut Chpr, Y&M, Pro 600,Long Auger ......................... $242,50 D 08 CaseIH 8010 923 Hrs, 16’ PU, Pro 600, Y&M, 10” Platform Ext, 24’ Unload Auger ......................... $242,500 N 08 CaseIH 8010 978 Hrs, 14’ PU Hdr, Sieve Elec Adj, Rock Trap, Y&M, Pro 600 ................................ $229,000 Y 08 CaseIH 8010 838 Hrs, 14’ PU Hdr, Sieve Elec Adj, Rock Trap, Y&M, Pro 600 ................................ $221,000 L 08 CaseIH 8010 833 Hrs, 14’ PU Hdr, Sieve Elec Adj, Rock Trap, Y&M, Pro 600 ................................ $221,000 L 08 CaseIH 8010 850 Hrs, 14’ 2016 PU Hdr, Pro 600 Screen, 10” Platform Ext. ................................. $219,500 BV 07 CaseIH 8010 605 Hrs, 14’ 2016 PU Hdr, Std Cut Chppr,Y&M, 24’ Auger, Pro 600 .......................... $245,000 D 07 CaseIH 8010 556 Hrs, 14’ 2016 PU Hdr, Std Cut Chppr, Y&M, 24’ Auger, Pro 600 ......................... $245,000 D 07 CaseIH 8010 1200 Hrs, HID Lights, Long Auger, Chopper, Electric Mirrors,Duals .......................... $199,500 M 07 CaseIH 8010 1188 Hrs, 14’ PU, Pro 600 Monitor, Duals, Fine cut chopper, Hop Top ...................... $198,000 S 07 CaseIH 8010 1189 Hrs, 14’ PU, Pro 600 Monitor, Duals, Fine cut chopper, Hop Top ...................... $198,000 S 06 CaseIH 8010 907 Hrs, 14’ 2016 PU Hdr, 425 HP Eng, 20.8x42 Duals, Pro 600 Mon ..................... $189,500 M 06 CaseIH 8010 1736 Hrs, 14’ 2016 PU Hdr, Duals, 6.4M Unload Auger, Del. Cab ............................ $215,000 M 06 CaseIH 8010 1131 Hrs, 14’ 2016 PU Hdr, Chopper, Y&M, Ext. Wear Rotor..................................... $200,000 K 06 CaseIH 8010 1206 Hrs, 14’ 2016 PU Hdr, HID Lights, Y&M, GPS Ready, 21’ Auger.................... $195,000 KD 06 CaseIH 8010 1283 Hrs, 14’ 2016 PU Hdr, 20.8R42 Duals, Elect Sieve Adjust, Rock Trap, Fine Cut Chop $185,000 P 06 CaseIH 8010 1242 Hrs, 14’ 2016 PU Hdr, 20.8R42 Duals, Elect Sieve Adjust, Rock Trap, Fine Cut Chop $185,000 P 05 CaseIH 8010 1529 Hrs, 2016 PU w/Hyd Windguard,Extender in Auger .......................................... $159,500 M 04 CaseIH 8010 1684 Hrs, 16’ 2016 PU Swathmaster, 21’ Unload Auger, Del. Cab, Sieve Elec. Adjust .. $198,500 Y 04 CaseIH 8010 1296 Hrs, 14’ 2016 Hdr, Rock Trap, Elec.Sieve, Chper, Revs Fan ............................. $192,000 Y 04 CaseIH 8010 1215 Hrs, 14’ 2016 PU, AFX Rotor, Dlx Cab,Std Fdr, No Diff Locks........................... $190,000 N 04 CaseIH 8010 1324 Hrs, 14’ 2016 PU, Y&M, Pro 600, Dlx Cab, 24’ Auger w/Ext .............................. $175,500 D 04 CaseIH 8010 1182 Hrs, 14’ 2016 PU Hdr, Fine Cut Chpr, Rock Trap, Beacons, Long Auger .......... $163,550 P 04 CaseIH 8010 2425 Hrs, 14’ 2016 PU, 900/60R32, 540/65R32, Black/White Mon............................. $160,000 D 11 CaseIH 7120 8 Hrs, 14’ 2016 PU Hdr, 1 1/8” Adj. Up/Sieve, Fine Cut Chopper .............................. $282,000 M 11 CaseIH 7120 25 Hrs, 2016 PU Header, Y&M, HID Lights, Car. Header Drove ................................ $282,000 M 11 CaseIH 7120 100 Hrs, 14’ 2016 PU Hdr, Y&M, Magna Fine Cut Chop, HID Lights ......................... $282,000 M 11 CaseIH 7120 <100 Hrs, 14’ 2016 PU Hdr, Y&M, Magna Fine Cut Chop, HID Lights....................... $282,000 M 11 CaseIH 7120 146 Hrs, 2016 PU Hdr, 1 1/8” Sieves, Fine Cut Chop, Std Wear Cone ...................... $282,000 S 11 CaseIH 7120 148 Hrs, 2016 PU Hdr, 1 1/8” Sieves, Fine Cut Chop, Std Wear Cone ...................... $282,000 S 11 CaseIH 7120 300 Hrs, 2016 PU Hdr, Magna Cut Chop, Y&M Monitor, Pro 600 ............................... $282,000 B 11 CaseIH 7120 152 Hrs, 2016 PU Hdr, Magna Cut Chop, Y&M Monitor, Pro 600 ............................... $282,000 B 10 CaseIH 7120 329 Hrs, 14’ 2016 Hdr w/ Swthmastr PU, Std Rotor, Pro 600, HID Lts #3 .................. $283,000 B

MOOSOMIN

NEEPAWA

SHOAL LAKE

WINKLER

YORKTON

PREECEVILLE

Torrie Carter Barry Doole Jason Miller

Doss Mayor Buzz Bradley Wally Van Niekerk

Mark Swereda Willie Voth Gerry McTavish

Kevin Bergen Lee Maclean Travis Thiessen

Barry Maurer Jerry Borchowitz Ken Chepil Warren Kotzer

Jason Reine Russel Larnder

www.millerfarmequipment.com

LANGENBURG Cory Andres Dave Eberts


PAGE 30

Saskatchewan FarmLIFE, Monday, March 19, 2012

The equipment listed is only a small portion of what Miller Equipment has to offer! Visit us online!

08 CaseIH 8010 823 Hrs,Y&M,Fine Cut Chpr, Lat. Tilt,Pro 600,Var Hdr Dr,Stone Trap STK#041054 ......... $245,000 M

09 CaseIH 2152 35’ Draper, Transport, Guage Wheels, Hyd.F/A, Skid Shoes, Stk# 002786M .................. $69,500 B

07 CaseIH 2042 36’Draper,Split PU Reel,8010 Adptr, Guage Wheels, Trans, Stk# 002954....................$49,500 M

CASE IH COMBINES CONTINUED O36092 O36471 O36882 O36478 O35024 O34998 O45307 O41166 O50182 O47023 OO2939M O53080 OO3483M O37981 O37982 OO2643M O47809 OO3222M OO3372M O49977 O45580 O50070 O38291 O41132 OO3387M JBU01849 O48449 O37426 O37428 O48149 O36175 O48151 O45579 O52881 O52880 O48477 WA04495A O54437 WA95708A O53430 O45701 O48496 O48485 O39679 WA276228 WA75250B O51317 O36523 O54016 O49539 OO1861M O32112 O41146 O45703 O49540 O47753 O40299 O48582 O39396

10 CaseIH 7120 182 Hrs, 16’ 2016 PU, AFX Rotor, Fine Cut Chpr, Pro 600,Y&M ................................ $277,500 S 10 CaseIH 7120 272 Hrs, Yield & Moisture, Pro 600 Monitor, HID Lights, Std Chopper ...................... $262,500 M 10 CaseIH 7120 255 Hrs, 14’ 2016 PU, Std Chpr, HID Lts #2 Cold Start Pkg, Y&M, Pro 600 ............. $257,500 M 10 CaseIH 7120 251 Hrs, 14’ 2016 PU, Std. Chopper, HID Lts #2, Y&M, Cold Start ............................ $269,500 S 10 CaseIH 7120 207 Hrs, 14’ 2016 PU Hdr, Y & M, Pro 600, HID Lights, Magna Cut Chpr.................. $269,500 B 10 CaseIH 7120 263 Hrs, 2016 Hdr w/ Swathmstr PU, 600 Mon, Aug & Hopp Ext, ........................... $264,500 BV 09 CaseIH 7120 537 Hrs, 14’ 2016 PU Hdr, Rock Trap, Hydro Trans, No Duals .................................. $260,000 B 09 CaseIH 7120 195 Hrs, 16’ 2016 Swthmstr, Hyd Fore/Aft, Y&M, Pro 600, Unload Auger .................. $260,000 B 09 CaseIH 7120 349 Hrs, 14’ 2016 Strawmaster, 7.3M Unload Auger, Straw Chopper ....................... $257,500 M 09 CaseIH 7120 440 Hrs, 16’ 2016 PU, Chopper, Rock Trap, Pro 600, 900x32, 600x28 ................... $250,000 BV 09 CaseIH 7120 479 Hrs, 14’ 2016 PU Hdr, Pro600, Y&M,900/60R32, HID, 24’Auger ........................ $239,500 M 10 CaseIH 7088 1050 Hrs, 24’ Unload Auger, Y&M, Ext. Wear Rotor, Grain Tank Cover, Sieve Adjust ... $197,000 Y 09 CaseIH 7088 464 Hrs, 2016 PU Hdr, Pro 600, 800/65R32, Hopper Tpr, Y&M, HID ......................... $239,500 B 09 CaseIH 7088 415 Hrs, 2016 PU Hdr, AFS,Y&M, GPS,14ft 2016, Fore/Aft, AFX Rotor, Chopper,900x32 $225,500 L 09 CaseIH 7088 586 Hrs, 2016 Swthmstr PU, Lat Tilt, AFS, AFX Rotor, HID, Y&M, Blk Htr.............. $225,500 KD 09 CaseIH 7088 226 Hrs, 14’ 2016 PU Hdr, H.D. Cone, Peterson Sieve, Y & M, HID Lights................ $209,500 N 08 CaseIH 7010 322 Hrs, 14’ PU, Duals, Del Cab, Pro 600, 24’ Auger, Fine Cut Chop ..................... $269,000 KD 08 CaseIH 7010 331 Hrs, 16’ 2016 PU Hdr,Pro 600,900/60R32Sngls,Fine Cut Chpr .......................... $259,500 W 08 CaseIH 7010 500 Hrs, 14’ 2016 PU Hdr, Pro600, 900/60R32, 28Lx16, HID Lites ........................... $225,000 M 08 CaseIH 7010 550 Hrs, 2016 PU Hdr, Duals, Pro 600, Y&M, Hal. Lights, Lg Auger ....................... $250,000 KD 08 CaseIH 7010 502 Hrs, 14’ 2016 PU Hdr, Deluxe Cab, Fine Cut Chopper, HID Lights...................... $239,500 P 08 CaseIH 7010 649 Hrs, 14’ 2015 PU Hdr, Pro 600, Duals, Y&M, Halogen Lights ........................... $235,000 KD 08 CaseIH 7010 815 Hrs, 14’ 2016 PU Hdr, AFS Y&M w/GPS, Fine Cut Chpr, Duals .......................... $228,000 Y 08 CaseIH 7010 512 Hrs, 14’ 2016 Swthmstr, Long Auger, Y&M, Dlx Cab, Pro 600 w/Card ................ $221,000 K 07 CaseIH 7010 746 Hrs, 16’ 2016 PU Hdr, 20.8R42 Duals, Y&M, Pro 600, Std.Cut Chopper............. $249,500 B 07 CaseIH 7010 1043 Hrs,14’ 2016 PU Hdr, AFS, Y&M, GPS, Fore/Aft,AFX Rotor,Chop,900x32 .... $197,500 KD 10 CaseIH 6088 144 Hrs, 14’ 2016 PU Hdr, Chopper, Chaff Spreader, Long Auger ............................ $240,000 S 10 CaseIH 6088 187 Hrs, 16’ Swthmstr PU Hdr, Std Fdr Dr, Cold Start Pkg, AHHC, Std Cab ............. $235,000 S 10 CaseIH 6088 262 Hrs, 16’ Swthmstr PU Hdr, Std Fdr Dr, Cold Start Pkg, AHHC, Std Cab .......... $235,000 KD 10 CaseIH 6088 289 Hrs, 2016 PU Hdr, Del. Cab, Y&M, Pro 600, Fine Cut Chopper........................... $234,500 B 09 CaseIH 6088 189 Hrs, 2016 PU Hdr, Chpr,Chaff Sprdr, Pro 600, Y&M, Rock Trap ......................... $229,500 S 09 CaseIH 6088 504 Hrs, 2016 PU Hdr, Del. Cab, Y&M, Pro 600, Std. Cut Chopper ........................... $212,500 B 09 CaseIH 6088 816 Hrs, 14’ PU Hdr, Pro 600 Chopper, Hid Lighting, Long Auger........................... $201,500 KD 08 CaseIH 2588 475 Hrs, 14’ 2015 Swathmaster, Y&M, 6.4M Unload Auger, Straw Chopper ............. $199,900 M 08 CaseIH 2588 475 Hrs, 14’ 2015 Swathmaster, Y&M, 6.4M Unload Auger, Straw Chopper ............. $199,900 M 08 CaseIH 2588 686 Hrs, 14’ 2015 PU Hdr, AFX Rotor, Chaff Spreader, Ext Wear Cone ................... $197,500 M 08 CaseIH 2588 1027 Hrs, 12’ 2015 PU Hdr, Y&M, Rock Trap, Hdr Float, Peterson Sieve .................. $180,000 Y 07 CaseIH 2588 1884 HRs, 2015 PU Hdr, Y&M w/600 Display, AFX Rotor, Auger Ext, Straw Chopper... $165,000 Y 06 CaseIH 2388 865 Hrs, 14’ 2015 PU Hdr, Y&M, Ext.Wear Trans Cone, Chper,Sprdr ........................ $166,500 L 06 CaseIH 2388 1169 Hrs, 16’ 2015 Swathmaster, Big Top Hopper Topper, Y&M, Fine Cut Chop ..... $145,000 W 05 CaseIH 2388 1132 Hrs, 14’ 2015 PU Hdr, 5.5M Unload Auger, Straw Chopper, Y & M.................. $159,500 M 05 CaseIH 2388 1117 Hrs, 14’ 2015 PU Hdr, AFX Rotor, Chaff Spread, Hopper Top.......................... $155,500 M 05 CaseIH 2388 1450 Hrs, 14’ 2015 PU Hdr, AFX Rotor, Chaff Spreader, Hopper Top ...................... $155,500 M 05 CaseIH 2388 1470 Hrs, Swathmaster PU, Y&M, Hopper Topper, Auger Ext ................................... $127,500 M 05 CaseIH 2388 1103 Hrs, 2015 PU Hdr, AFX Rotor, Topper,Y & M, Silencer, Auger Ext.................... $139,500 L 04 CaseIH 2388 1122 Hrs, 2015 PU Hdr, Rock Trap, Field Tracker, AFX Rotor, Sprder ...................... $160,000 Y 04 CaseIH 2388 1088 Hrs, 14’ 2015 PU Hdr, Y&M, AFX Rotor, Crary Hppr Tppr, Chppr ..................... $147,500 Y 04 CaseIH 2388 1285 Hrs, 14’ Swathmaster PU Hdr, Spec Rotor, Chpr, Hpr Tpr, Long Auger ........... $125,000 M 04 CaseIH 2388 1996 Hrs, 2015 PU Hdr, Y&M, Pro 600, Hyd. Reverser, Crary Hop. Top, Straw Chop ... $133,000 Y 03 CaseIH 2388 1590 Hrs, 2015 PU Hdr, AFX Rotor, Chopper, Long Auger, Hop Top ........................ $122,500 D 02 CaseIH 2388 1643 Hrs, 1015 PU Hdr,Spec.Rotor, Chopper, Long Auger, 30.5x32, 14.9x24.......... $107,500 M 02 CaseIH 2388 1873 Hrs, 2015 Swthmaster PU Hdr, Spec Rotor, Chpr, Chaff Spreader .................... $98,500 M 02 CaseIH 2388 2841 Hrs, 2015 Swthmstr PU Hdr, Hyd F/A, AFX Rotor, Rock Trap, Straw Chpr ......... $95,500 B 00 CaseIH 2388 2045 Hrs, 2016 Swthmstr PU, F&A,Hppr Tppr, Y&M,Rock Trap, Chpr ....................... $106,000 Y 99 CaseIH 2388 1836 Hrs, 2015 PU Hdr, Spec Rotor, Chopper, Long Auger ......................................... $99,500 D 99 CaseIH 2388 1857 Hrs, 1015 Swthmstr PU Hdr, AFX Rotor, Rock Trap, Chopper ............................ $95,500 Y 99 CaseIH 2388 2367 Hrs, Hopper Topper, IH PU Hdr, Chopper Chaff Sprdr, AHH, Fore/Aft ................ $93,500 S 99 CaseIH 2388 2555 Hrs, 1015 PU Hdr, Crary Hopper Ext, Yield & Moisture, Crary Hopper Ext. .... $79,500 BV 99 CaseIH 2388 2616 Hrs, 1015 PU Hdr, Spec Rotor, Chopper, 30.5x32 Tires ..................................... $74,500 M

O51062 O42282 O34853 O47637 O47445 O38283 O33769 O38374 O46295 O47632 O45442 O47636 O41614 O41150 O37801 O46821 O46438 O53228 O43772 O46948 O50450 O53832 O41541 O53229 O46551 O45790 O31808 O47625 O52701 O46693 O47395 O49544

99 CaseIH 2388 3053 Hrs, 1015 Hdr, New PU Belts, AFX Rotor, Y&M, New Chppr Blades................... $75,000 B 99 CaseIH 2388 3870 Hrs, 1015 PU Hdr, AFX Rotor ,Rock Trap, Long Auger, Chopper........................ $62,500 L 98 CaseIH 2388 1760 Hrs, 1015 PU Hdr, Spec Rotor, Y&M,Rock Trap,Long Auger,Hpr Tpr ................ $89,500 W 98 CaseIH 2388 2044 Hrs, 1015 PU Hdr, Spec Rotor, Long Auger, Chopper, Chaff Spread .................. $86,000 K 98 CaseIH 2388 1961 Hrs, 1015 PU Header w/Victory PU, Spec. Rotor, Straw Chop ............................ $85,000 Y 98 CaseIH 2388 2638 Hrs, Spec Rotor, Hpr Tpr, Rock Trap, Redekop Chpr .......................................... $79,500 N 98 CaseIH 2388 2388 Hrs, 2015 PU Hdr, Chaff Spreader,Chopper,Hopper Topper ............................ $77,500 BV 98 CaseIH 2388 2580 Hrs, Accelerator Kit, Hopper Topper, Krby Spreader,Shedded ............................ $75,000 K 98 CaseIH 2388 2195 Hrs, 1015 PU Hdr, Rock Trap, Specialty Rotor, Hyd Reverser............................. $71,500 P 06 CaseIH 2377 845 Hrs, 2015 PU Header, 250 Chipped Engine, Chopper SM ................................ $185,000 KD 98 CaseIH 2366 1615 Hrs, 23.5-32,14.9-24 Tires, Rock Trap, Spec. Rotor............................................. $86,500 L 97 CaseIH 2188 2841 Hrs, Yield Monitor, Chopper/Chaff Sprdr, Long Auger, Excell Rotor .................... $71,000 K 97 CaseIH 2188 3256 Hrs, 1015 PU Hdr, Spec Rotor, Chpr/Sprdr, Fore/Aft, Y&M, Long Auger............. $60,000 D 96 CaseIH 2188 2818 Hrs, 1015 PU, Std Cab, AFX Rotor, Rock Trap, Hyd F/A, Straw Chpr................. $62,500 B 95 CaseIH 2188 3177 Hrs, 1015 PU, AFX Rotor, Straw Chopper,Unload Auger .................................... $49,500 M 95 CaseIH 2188 2788 Hrs, Rock Trap, Specialty Rotor, Maurer Hopper Topper, Hyd F & A .................. $53,000 Y 95 CaseIH 2188 2974 Hrs, Hopper Topper, Specialty Rotor, Chopper .................................................... $48,500 S 94 CaseIH 1688 3100 Hrs, 1015 PU Hdr, Spec. Rotor, Chopper, Long Auger, Outside Bottom Sieve Adjust. $40,000 S 94 CaseIH 1688 4377 Hrs, 1015 PU Hdr, Rock Trap, Spec. Rotor, Reddekop Chopper ......................... $39,000 L 94 CaseIH 1688 4159 Hrs, Chopper, CIH Pick Up, Specialty Rotor ...................................................... $37,500 BV 94 CaseIH 1688 4100 Hrs, 1015 PU Hdr w/IH PU, No Chopper, Rock Trap, Long Auger....................... $32,000 L 90 CaseIH 1688 3900 Hrs, 1015 PU Hdr, Spec Rotor, Chopper, Long Auger, Rock Trap, Shedded ...... $27,500 D 92 CaseIH 1680 3718 Hrs, PU Hdr, Chpr/Sprdr, Hpr Ext, Straw Sprdr, Rock Trap .............................. $26,500 BV 92 CaseIH 1680 3575 Hrs, 12’ 1015 PU Hdr, F&A, Third Lift Cylinder, Cross Flow Fan, Auto Hdr........ $24,000 S 91 CaseIH 1680 4607 Hrs, 1015 PU Hdr, Concaves, Chopper, Air Foil Sieve......................................... $26,500 Y 89 CaseIH 1680 4199 Hrs, 7 Belt PU, Rear Wheel Dr. Hopper Topper, Header Height ......................... $26,000 W 88 CaseIH 1680 3180 Hrs, 1015 PU Hdr, Chppr, Hdr Hght Ctrl, Long Auger,Spec. Rotor ..................... $27,900 W 87 CaseIH 1680 3360 Hrs, 1015 PU Hdr, Hopper Topper, Grain Loss Monitor ...................................... $24,500 W 86 CaseIH 1680 4040 Hrs, 1015 PU Hdr, Rock Trap, Std Rotor, Chopper, 235 Engine HP, Hydro Trans $24,000 P 87 CaseIH 1660 3379 Hrs, 1015 PU Hdr, Std Rotor, No Chopper, Rock Trap, GLM .............................. $22,250 Y 86 CaseIH 1660 4705 Hrs, 1015 PU Hdr, Std. Rotor, Chopper, Kirby Chaff Spreader ............................ $17,400 P 81 CaseIH 1480 4450 Hrs, 810-13’ w/12’ Hdr, Rodono Straw Chop, Rock Trap ..................................... $12,500 N

OTHER MAKE COMBINES O51227 O48653 O48651 O50403 O54948 O44471 O46488 O49101 O49099 WA706090 OO4623M O48509 WA720401 O48529 O46345 O48143 O40328 O41036 O48265 OO5562M O47529 O52833 O51420 O37550 O35237 O46718

10 Massey Ferg 9895 499 Hrs, 4200 PU w/Swthmstr,Mav Chppr,Lthr Seat,Raven .............................. $279,000 Y 10 Massey Ferg 9895 494 Hrs, Duals, Fdr Hse Lat, Hdr Tilt Sys, Mav. Chop, Leather Seat ................ $255,000 Y 07 Massey Ferg 9895 1269 Hrs, Duals, MF 4000 Hdr, Sieve& Chaffer, Elec. Adj. Mav. Chop............... $164,50 L 09 Massey Ferg 9795 604 Hrs, Duals, 4200-14’ Hdr, Y&M, Touch Screen Monitor........................... $225,000 KD 06 Massey Ferg 9690 936 Hrs, 4200 PU Header, Fieldstar Ready, On Track GPS, Mav Chopper, 300 BU $125,000 KD 04 Massey Ferg 9690 1549 Hrs, 14’ Swathmaster PU, 480X42 Duals, 16.9X28 Rear Tires ............. $109,000 KD 94 Massey Ferg 8570 2328 Hrs, Hydro Trans, Chopper, Dual Chaff Spreaders .................................... $41,500 M 09 John Deere 9870STS 691 Hrs, Duals, 916 PU Hdr, Long Auger, AutoGuidance Ready .............. $270,000 KD 08 John Deere 9870STS 451 Hrs, Duals, 916 PU Header, AutoGuidance Ready, Yield & Moisture $281,000 KD 04 John Deere 9860STS 811 Hrs 14’ PU Hdr, F/cut Chpr, Hpr Tarp, Harvest Trac Monitor................. $178,500 Y 04 John Deere 9860 2179 Hrs, No PU Hdr,20.8x42 Dls, Mav Chpr, Long Auger, Yield & Moisture ......$144,500 B 08 John Deere 9770STS 800 Hrs, No PU, Duals, 20.8R42 .................................................................. $230,000 W 07 John Deere 9760STS 1111 Hrs, 16’ Swathmaster PU Hdr,28L-26 Rear,Greenstar Autotrac & Display, $220,000 Y 05 John Deere 9760 1054 Hrs, 914 PU Header, Yield & Moisture, Fine Cut Chopper, Shedded ........ $165,000 K 91 John Deere 9600 1843 Hrs, 30.5-32 Ft Tires, 14.9-24 Rear Tires, 914 PU Header........................... $62,500 D 08 New Holland CX8080 1059 Hrs, 14’ 76C Swathmaster PU Hdr, 900/60R32 Tires, Full Y&M Map $215,000 M 06 New Holland CR970 1297 Hrs, 16’ 76C PU Hdr, Long Unld Auger, Y&M, Fin Cut Chpr ................ $175,000 M 03 New Holland CR970 954 Hrs, 14’ Strawmaster PU Hdr, Beacon Lts, Chaff Sprdr, Chppr,Unload Auger.. $153,000 P 03 New Holland CR960 2181 Hrs, 14’ 76C PU Header, Del. Cab, Del. Straw Chopper ...................... $133,000 Y 02 New Holland CX840 3255 Hrs, Swathmaster PU Hdr, Rear Whl Assist, Chpr w/Blwr, Beacons ..... $120,000 B 02 New Holland TR-99 2141 Hrs, 14’ Swathmaster PU Hdr, Hopper Topper, Red Cop Chopper .......... $92,500 B 01 New Holland TR-99 1648 Hrs, Swathmaster PU Hdr,971 Header, Duals, Stone Trap, Chopper, Tarp Cover $85,000 P 97 New Holland TR98 3100 Hrs, 14’ Swathmaster PU Hdr, 30.5-32 Front, 14.9-24 Rear, Chaff ........... $34,000 K 93 New Holland TR96 2765 Hrs, NH 971 Hdr w/Swathmaster PU, 30.5-32 Tires, Chaff Sprdr .............. $28,000 L 90 New Holland TR96 3744 Hrs, Vict PU Hdr, Var Spd Feeder, Elec Stone Tr, Straw Chopper ............ $21,300 B 95 New Holland TX66 2513 Hrs, Chaff Spreader, Straw Chopper, Grain Loss Monitor, Rock Trap ....... $41,500 Y

Brandon, MB

Dauphin, MB

Moosomin, SK

Shoal Lake, MB

Yorkton, SK

Langenburg, SK

(204) 725-2273

(204) 638-5558

(306) 435-3866

(204) 759-2424

(306) 783-8508

(306) 743-2312

Boissevain, MB

Killarney, MB

Neepawa, MB

Winkler, MB

Preeceville, SK

(204) 534-2463

(204) 523-4644

(204) 476-3344

(204) 325-4122

Kindersley, SK (306)463-4651

www.millerfarmequipment.com

(306) 547-3300


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 31

10 CaseIH 9120 252 Hrs, 16' 2016 Hdr, Full Auto Guide, Diff Lock, Lat Tilt, STK#036450 ........................ $324,000 W

10 CaseIH 9120 527 Hrs, 16’ Swthmastr PU, Sm Tube Rotor, Pro 600, HID Lts STK#036241 .....................$299,500 Y

10 CaseIH 8120 425 Hrs,2016 PU Hdr HID, Guidance Rdy,Hpr Tpr,Fine Cut Chpr,Duals STK#038911 ................$295,500 BV

09 CaseIH 9120 396 Hrs, 7.3 M Unload Auger, Cloth Seat, Sm Tube Rotor, HID Std LTs stk# O33952 ........ $299,500 S

10 CaseIH 9120 290 Hrs, 14’ 2016 Hdr, Pro 600, HID Lts, Sm Tube Rotor stk#O36278 ............................. $315,000 N

09 CaseIH 7120 283 Hrs,14’ 2016 PU Hdr, Y&M,Rock Trap,Small Tube Rotor STK#033599 .................$286,000 Y

OTHER MAKE COMBINES CONTINUED OO3128

05 Caterpillar 580R 815 Hrs, 14’ Swathmaster PU Hdr, 900/60R32, 500/85R24, Chaff Spreader ...... $229,500 W

O54848 O54850 O54851 O44307 O48852 O48855 O48856 O48857 O48858 O48859 O48860 O39470 O39474 O50046 O48288 O39278 O52883 O33284 OO3003M O50002 O48587 O35604 O35431 O53412 OO2652M O52433 OO1657M O36171 O45090 O47591 OO4223M O41189 OO2755M O36784 O51072

11 CaseIH 3020 30’ PU Header, 6 Bat, Plastic Tines, End Dividers, Cutterbar 3”, Man. Cutterbar Susp. . $34,000 L 11 CaseIH 3020 30’ PU Header, 6 Bat, Plastic Tines, End Dividers, Cutterbar 3”, Man. Cutterbar Susp. . $34,000 L 11 CaseIH 3020 30’ PU Header, 6 Bat, Plastic Tines, End Dividers, Cutterbar 3”, Man. Cutterbar Susp. . $34,000 L 08 CaseIH 2152 40’ PU Reel, 11X15 Tires, Factory Transport, Float Sensor .......................................... $56,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 10 CaseIH 2142 35’ Draper PU Single Reel,Hyd Fore/Aft,Gauge Whls,10/20 Adpt................................. $59,500 S 10 CaseIH 2142 35’ Draper PU Single Reel,Hyd Fore/Aft,Gauge Whls,10/20 Adpt................................. $59,500 Y 10 CaseIH 2142 35’ Drpaer PU, Hyd Tilt, Slow Speed Transport, Lodged Crop Fing.............................. $59,500 N 10 CaseIH 2142 35’ Std. Cut Hdr, Single Knife Dr. PU Reel, Hyd. Fore/Aft. Transport ........................... $56,500 B 06 CaseIH 2062 36’,Cross Auger Pkg,Gauge Whl,Slow Spd Trans,Hyd F/A,Adptr ................................. $57,000 Y 06 CaseIH 2062 36’ Cross Auger Pkg, Gauge Whl, Slow Spd Trans, Hyd F/A, Shedded ....................... $54,000 Y 06 CaseIH 2052 36’ Rigid Split Reel, 4 Whl Trans, Fore/Aft, 10/20 AFX Adptr ........................................ $51,000 Y 07 CaseIH 2042 30’ Rigid, Hart Carter Reel, 2388 Adptr, Fore/Aft, No Trans.......................................... $39,500 S 10 CaseIH 2020 35’ Flex Header, Dble Knife Drive, Auto Hdr Height Control, 7088 Adapt .................. $45,000 KD 08 CaseIH 2016 14’ Pickup Header ....................................................................................................... $16,500 BV 08 CaseIH 2015 14’ Pickup Header ........................................................................................................ $16,900 M 09 CaseIH 2010 30’ Rigid,6 Batt, PU Reel, Auto Hdr Height Ctrl, Lateral Tilt .......................................... $28,000 D 07 CaseIH 2010 30’ Rigid Header, PU Reel, Plastic Fingers, Hyd F&A, Always Shedded ...................... $22,500 D 01 CaseIH 1042 36’ Draper, PU Reel, Transport, Guage Wheels ......................................................... $34,500 BV 03 CaseIH 1042 36’ Pickup Reel, Transport ............................................................................................ $32,000 M 99 CaseIH 1042 30’ Draper, PU Reel, F/A,Guage Wheels, Transport ..................................................... $29,500 S 04 CaseIH 1020 30’ Flex PU Hdr, Fore/Aft ............................................................................................... $19,000 D 96 CaseIH 1020 30’, PU, Header Transport, Hydr. Fore and Afte. ......................................................... $17,300 W 95 CaseIH 1020 25’ Flex Header, Plastic Fingers, Always Shedded....................................................... $13,000 W 94 CaseIH 1020 30’ Flex, Hart Carter PU Reel, Fore/Aft, Dble Dr, Open Wbl Box .................................. $12,500 S 96 CaseIH 1020 25’, 5 Batt. PU Reel, Plastic Fingers, Crop Dividers, Hyd. Fore & Aft. ........................... $7,650 W 93 CaseIH 1015 14’ Pickup Header,Super 8 Pickup .................................................................................. $4,750 M 87 CaseIH 1015 13’ IH Pickup Header........................................................................................................ $1,995 S 04 CaseIH 1010 30’ Rigid Header, Pickup Reel....................................................................................... $13,500 M

CASE IH HEADERS

BRANDON Larry Mountain Wade Heinrichs Craig Frondall Marv Nicholls

BOISSEVAIN

DAUPHIN

KILLARNEY

Wayne Stansall George Panko Jeff Cuvelier Henry Voth Todd Nichol Kelly Johnston Ryan Heinrichs Jeff Abraham Bruce Charles Henry Voth (204) 534-7578

O53311 O49885 O53839 O46440

99 CaseIH 1010 30’ Rigid Header, PU Reel, Near New Knife Sections/Guards, Bushings on Reel....... $12,750 M 94 CaseIH 1010 30’ Rigid Header, Fits 80/88 Series Combines ............................................................... $8,800 M 93 CaseIH 1010 30’ Rigid Header, PU Reel, Shedded ............................................................................... $9,500 D 93 CaseIH 1010 30’ Straight Cut Header .................................................................................................... $8,800 S

O35048 O54438 O37187 O49498 O35075 O42488 OO3159M

92 CaseIH 1010 25’ Rigid Header, Batt Reel,Cranks,Four Wheel Trailer.................................................. $7,500 M 92 CaseIH 1010 25’ Header, with PU Reel ................................................................................................ $7,000 M 91 CaseIH 1010 30’ Rigid Header, Pickup, 5 Batt w/Steel Fingers .......................................................... $11,500 D 90 CaseIH 1010 30’ Header, with PU Reel ................................................................................................ $9,900 M 90 CaseIH 1010 30’ Rigid Batt Reel, Summers Header Transport ............................................................. $8,900 K 87 CaseIH 1010 30’ Hyd Fore/Aft, Pickup Reel ,Slow Speed Header Trailer ........................................... $11,500 B 82 CaseIH 810 30’ Bat Reel, Large Auger .................................................................................................. $2,500 N

OTHER MAKE HEADERS O47174 O38822 OO4303M O52978 O38608 JBU01813 JBU01735 O46283 O49324 O46375 O44601 O52831 OO5066M JBU01781 O48549 O33116 O49862 O514737 JBU01797 O48309 O33277 O40114 O40115 O40116 O37859 O50043

09 Honey Bee SP42 42’, Centre Mount, Case Adapter, 5 Bat PU Reel, Hdr Height Cont .................... $65,000 BV 06 Honey Bee SP42 42’ Draper,Dual Knife Dr,Fact Trans,Cutter Bar,Hyd Ang Tilt,8010 Adpt ....................$48,000 Y 09 Honey Bee SP40 40’,Draper Hdr,UII PU Reel,Hyd.F/A,Dbl Knife Drive,........................................... $71,500 BV 10 Honey Bee SP36 36’ Header, Never Used, PU Reel, Single Knife Drive, 20 Series Adapter .....................$55,000 B 06 Honey Bee SP36 36’ Draper,PU,Cross Auger,Transport Kit,8010 Adapter ........................................ $43,500 M 00 Honey Bee SP36 36ft, PU Reel, Pea Auger, 2588 Adaptor ..............................................................$26,500 KD 98 Honey Bee SP36 36ft, PU Reel, Pea Auger, Transport, 2588 Adaptor............................................. $32,500 KD 94 Honey Bee SP36 36’ Draper Header, Split PU Reel, Cross Auger, 2388 Adapter ...........................$12,500 KD 09 Honey Bee SP30 30’ Draper Hdr, UII PU Reel, Trans. Hyd Fore/Aft, New Never Used .................... $54,500 M 04 Honey Bee SP30 30’, PU Reel, Hyd Fore/Aft, Upper Cross Auger, Transport, Adapt 2388 ...................$38,000 M 97 Honey Bee SP30 30’ Draper Header, Endwise Transport, 2388 Adapt. Castor Gauge ......................$30,000 L 00 Honey Bee SP25 25’ Header, UII Pickup Reel, Hyd Fore & Aft, Gauge Wheels ................................$19,000 P 03 Honey Bee 436 36’ Draper,PU Reel,JD Adptr,Cross Auger,Transport ............................................. $42,500 BV 09 New Holland 94C 40’ PU Reel, Pea Auger,Transport,7120 Adaptor, End Wheels........................... $69,000 KD 07 New Holland 94C 36’ Draper Header, Pick Up Reel, Cross Auger, Crop Lifters, Shedded .....................$45,500 KD 06 New Holland 994 36’ Draper,PU,Hyd Fore/Aft,Cross Auger,2388 Adapter ........................................ $47,500 M 00 New Holland 994 36’ Draper Hdr,New Canvas,New Fingers,Pea Auger, JD Adptr.......................... $30,000 KD 99 New Holland 994 30’ Draper Header, Trailer Adapt. U2 Reel, Slow Speed Trans ..............................$22,500 K 98 New Holland 971 To go on TR99, NO Pickup .....................................................................................$5,000 KD 89 New Holland 971 30’ Header, Crop Lifters, No Fore/Aft. .................................................................. $10,000 BV 89 New Holland 971 30’ Rigid, UII Pickup Reel, Std Batt Reel,2008 Hdr Trans.........................................$9,000 B 07 MacDon D60-D 40’, Fac Trans, Hyd fore/Aft, Dual Guage Whls, Sngl Knife Dr, Ux Auger ...................... $59,500 BV 07 MacDon D60-D 40’, Fac Trans, Hyd fore/Aft, Dual Guage Whls, Sngl Knife Dr, Ux Auger............................$62,500 BV 07 MacDon D60-D 40’, Fac Trans, Hyd fore/Aft, Dual Guage Whls, Sngl Knife Dr, Ux Auger ...................... $59,500 BV 04 MacDon 2052 36’ Draper,PU,Split Reel, Single Knife Dr,Fore/Aft,7120 Adptr,Transport.................... $50,000 M 08 MacDon 974 36’ Draper Hdr, Single Knife Drive, Slow Speed Transport, Split Reel ........................$40,000 KD

MOOSOMIN

NEEPAWA

SHOAL LAKE

WINKLER

YORKTON

PREECEVILLE

Torrie Carter Barry Doole Jason Miller

Doss Mayor Buzz Bradley Wally Van Niekerk

Mark Swereda Willie Voth Gerry McTavish

Kevin Bergen Lee Maclean Travis Thiessen

Barry Maurer Jerry Borchowitz Ken Chepil Warren Kotzer

Jason Reine Russel Larnder

www.millerfarmequipment.com

LANGENBURG Cory Andres Dave Eberts


PAGE 32

Saskatchewan FarmLIFE, Monday, March 19, 2012

Classified Section

Published Every Other Monday Office Hours: 7:30 a.m. to 4:00 p.m. Monday to Friday

(600) Farm Machinery

2206A Avenue ‘C’ North, Saskatoon, Saskatchewan S7L 6C3 E-Mail: adsales@farmpressltd.com Visa or Mastercard

Phone Orders Toll Free 1-877-328-0048 Ext. 228

(600) Farm Machinery

(609) Miscellaneous

(609) Miscellaneous

WANTED NEW! Wrapped & Boxed! Contact Us For Great Pricing On Grain Bags & Net Wrap Self-unloading Hay Trailers Hay Feeders, Gate & Panels Gallagher Fencing Supplies Call Today 306-227-4503 LIQUIDATION & EQUIP. INVENTORY REDUCTION. Museum Project abandoned. Many collectables/ duplicates. Dozer Blades 5'-16' wide - $375-$2,200. Wetmore hammermill w/hay mixer, on trans., very little used - $750. Small bale elevators. Extra HD 9' motor driven snow blower $7,800. 8' RT/sweeper, quick attach mount, S/S - $1,400. 1988 Dodge Ram 1500 half, 4x4, 318 engine - $1,850. 1999 Dodge 1500 4x4, good condition, 3/4" box liner since new - removable, will show original near new box interior, clean truck replaced by larger capacity is reason for sale - $3,475. Vintage combines: (2) MF Model 72’s (1 - PTO, 1 motor driven), exc. restoration project. MF 88 diesel tractor, no scrapes or dents, clean tractor $3,400. Inquiries welcome - If you need it, I might have it. Phone: 403-732-4979. (600) AG 18-19 MB 19-20 AD 11-12 SK 20-21

USED EQUIPMENT- 1995 John Deere tractor 8300 MFWD, 3PT, P/S, 5800 hours $77,500, New 2011 Parker 739 grain cart w/tarp SALE PRICE $24,900, 2004 John Deere 630F SALE PRICE $20,500, 2004 John Deere 635F SALE PRICE $23,900, Horsch Anderson Joker short disc 8RT, 5 in stock from $60,000 to $68,000 Please visit website at www.genag.com or call Shelton Kehler 701-330-7401 or Tom Wiebe 204-312-0604 (600) SK 19-20 MB 19-20

• John Deere 2520, 3020, 4020, 4620, (’69-’72), diesel powershift

UÊ …ˆÀœ«i`ˆVÊ+Õii˜Ê*ˆœÜ̜«Ê i`Ê-iÌ ........ $395 ­ œÕLiÊ-iÌÊfÎÇx®

USED GRAIN CARTS: 400-1050 bushel; large selection. Gravity wagons; used 200-750 bushel, new 400 bushel - $6,700. Richardton Hi Dump Wagons. Used fertilizer spreaders. Phone: 1-866-938-8537, www.zettlerfarmequipment.com. (600) MB 14-20 SK 15-21

(604) Seeding & Tillage VW MANUFACTURING - Carbide Drill Points. See our new products for spring 2012. Our full carbide - triple shoot - paired row openers have fertilizer between seed rows & slightly below. We also have 1/4” stainless steel liquid fertilizer lines delivering fertilizer to seed rows. Available for all Paralink, C Shank & Edge-on. Please visit our website for updates, www.vwmfg.com - thanks for visiting. VW Mfg, Dunmore, AB (Medicine Hat) 403-528-3350.

(1100) Horses & Supplies BUGGIES, DEMOCRATS, Cutters, Large Sleigh, Wagon, totally restored & upholstered. Harness, Saddles & Tack. Call: 204-8574932, Portage la Prairie, MB. (1100) MB 19 AD 11 SK 20

UÊi>̅iÀÊ-œv>]ÊœÛiÊÃi>ÌÊEÊÊ>ÌV…ˆ˜}Ê …>ˆÀÊ­ `˜Ê >`i®Ê­ ÀœÜ˜ÊœÀÊ >VŽ®........................f£]Ιx

• Steiger 470 or 525 tractor

Phone: 306-423-5983 or 306-960-3000

VISIT OUR CLASSIFIED PAGES ONLINE www.farmpressltd.com

UÊ-œˆ`Ê">ŽÊ™È»Ê/>Li]ÊÈÊ«>``i`ʅˆ}…ÊL>VŽÊ V…>ˆÀÃ]Ê œÊ6i˜iiÀÊ­ ÕvvÉÕÌV…ÊÛ>ˆ°®Ê/>LiÊ-iÌÊ ÜœÀ̅ÊfÎ]{xä ............................. - Êf£]Èxä

TRIM BOSS: Power Hoof Trimmer - take the work out of hoof trimming. Trim wall, sole & flare on Saddle Horses, Drafts & Mini’s. Phone, Rominick Livestock Services: 780-898-3752, www.rlscanada.ca. (1100) AG 17-20 MB 18-21 AD 10-13 SK 19-22

UÊÈÊ«V°Ê i`Àœœ“Ê-ՈÌiÊ­ˆ˜VÕ`ˆ˜}Ê+Õii˜Ê*É/Ê Li`ÊÃiÌ]ÊÎÊ œœÀî................................. $900 UÊ-œˆ`Ê7œœ`Ê-ˆ˜}iʜÛiÀÊ œÕLiÊ Õ˜ŽÊ-iÌÊ­-É-Ê -iÌÊfx™x®Ê-«>À>LiÊEÊ œÌi`.................... fÈxä

MUST SELL! CAN DELIVER! (204) 571-1971 BRD. (608) Tractors FORD 750 BACKHOE, good for farm, new motor & tires 800 hrs ago, will trade for cattle - $15,000. Phone: 403-938-7858 (608) AD 11 SK 20 AG 19 MB 20

WIRADA RANCH ENTERPRISES

You Deserve the Best! Why Settle for Less!

WIRELESS DRIVEWAY ALARMS LETS YOU KNOW ANYTIME SOMEONE WALKS OR DRIVES INTO YOUR PLACE!

(610) Machinery Parts

MURPHY SALVAGE: new, used, rebuilt parts, for tractors, com(604) AG 12-21 MB 13-22 AD 5-14 SK 14-23 bines, swathers, balers, tillage & miscellaneous machinery. Buying (608) Tractors used machinery. Toll Free: 1-877858-2728 or 204-858-2727, JOHN DEERE 4440, quad range, Deleau, MB. (610) MB 14 TFN SK 15 TFN 9020 hrs, 158 loader, bucket & forks, joystick, 3 SCV’s, 20.8x38 (700) Farm Buildings rear, 1100x16 front - $21,500 OBO; John Deere 3020, power shift, 3 pt, loader, 1 SCV, 9682 STEEL BUILDING SALE - Invenhrs., 18.4x30 rears, 9.5Lx15 front tory Discount Sale: 30x40, 42x80, - $12,500. Phone: 403-653-2196. 100x100. Erection Available. Must (608) AD 11-12 SK 20-21 AG 19-20 Sell, Will Deal. 40 yr paint. 1-800964-8335 Source: 1MC (700) AG 18-19 MB 19-20 AD 11-12 SK 20-21

“WE DELIVER TO

P.O. Box 882, Coalhurst, AB T0L 0V0

Ph/Fax: (403) 381-4817 Email: wirada@telusplanet.net

(800) Grain, Feed & Hay HEATED PEAS/FLAX…Buying damaged pulses & oilseeds. “On Farm Pickup” Westcan Feed & Grain: 1-877-250-5252. (800) AG 13-19 MB 14-20 AD 6-12 SK 15-21

BUYING BARLEY/OATS for feed. “On Farm Pickup” Westcan Feed & Grain: 1-877-250-5252.

(1500) Specialty Livestock FOR SALE - Morand Bison Squeeze Chute with Crash Gate. Also, Alleyway with side gates. Phone: 780-829-3603, email: malonesha@hotmail.com (1500) AD 11-12 SK 20-21 AG 19-20

(1700) Seed CERTIFIED #1 Unity/Waskada, midge tolerant VB, vigar & germination tested 97%, winter & volume pricing. Naicam, SK: 306874-7590. (1700) AG 16-21 MB 17-22 AD 9-14 SK 18-23

(1750) General Miscellaneous DISCOUNT PLYWOOD Douglas Fur 4x8, 4x9, 4x10 standard or with smooth overlay 3/8 to 1 1/2 inch thick. 1 1/2 and 1 3/4 pine plywood up to 60 ft. 306-278-3138 (1750) AD 6 TFN SK 15 TFN AG 14 TFN MB 15 TFN

Don’t break the bank.

FARMLIFE CLASSIFIEDS 1-877-328-0048

(800) AG 13-19 AD 6-12 SK 15-21

EVERY

CLASSIFIED INDEX FOR SALE Announcements ......................................90 Antiques ................................................200 Coins .....................................................201 Auctions.................................................300 Construction Equipment ........................400 Dairy & Supplies....................................500 Farm Machinery ....................................600 Haying Equipment .................................601 Combines & Headers ............................602 Fertilizer Equipment ..............................603 Seeding & Tillage ..................................604 Spraying Equipment ..............................605 Swathers & Mower/Conditioners ...........606 Tractors..................................................608 Miscellaneous .......................................609 Machinery Parts ....................................610 Farm Buildings ......................................700 Granaries & Bins ...................................701 Grain, Feed & Hay.................................800 Irrigation ................................................900 Hogs & Supplies ..................................1000 Horses & Supplies ...............................1100 Livestock & Supplies ...........................1200 Poultry & Supplies ...............................1300 Sheep & Supplies................................1400 Specialty Livestock ..............................1500 Pets & Supplies ...................................1600 Seed ....................................................1700 Specialty Seeds...................................1701 General Miscellaneous ........................1750

FOR RENT Acreages .............................................1800 Commercial Property...........................1900 Equipment ...........................................2000 Farms & Ranches................................2100 Houses ................................................2200 Land ....................................................2300 Storage................................................2400

REAL ESTATE Acreages .............................................2600 Auctions...............................................2700 Commercial Property...........................2800 Farms & Ranches................................2900 Houses ................................................3000 Industrial..............................................3100 Manufactured Homes ..........................3200 Realtor Listings....................................3300

TRANSPORTATION Automobiles.........................................3400 Automotive Parts & Service.................3500 Boats & R.V.’s ......................................3600 Heavy Trucks .......................................3700 Light Trucks .........................................3800 Motorcycles & Quads ..........................3900 Snowmobiles .......................................4000 Trailers .................................................4100 Vans ....................................................4200

SERVICES Accounting & Bookkeeping .................4300 Computers & Accessories ...................4400 Custom Work.......................................4500 Feedlot Cleaning .................................4600 Land Mapping .....................................4700 Parts & Repairs ...................................4800 Rentals ................................................4900 Travel ...................................................4950

EMPLOYMENT Employment Opportunities..................5000 Employment Wanted............................5100 Business Opportunities .......................5200 Training................................................5300

WANTED Equipment ...........................................5400 Personal ..............................................5600

FARM & RANCH!”

A Division of:

“Where Farmers and Ranchers Look First to Buy.”

NATION WIDE CLASSIFIED HOTLINE 1-877-328-0048 EXT. 228


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 33

Where Farmers and Ranchers Look First To Buy

Classified Section (800) Grain, Feed & Hay

(800) Grain, Feed & Hay

(1100) Horses & Supplies

BEST PRICES FOR HEATED OR HIGH GREEN CANOLA.

(1100) Horses & Supplies

Added Attraction 10 a.m. to 2 p.m.

Trade Show

Also buying damaged or off grade barley, wheat, etc. “30 Years!”

Silver Sage Community Corral Brooks, AB

Lacombe AB.

www.eisses.ca

1-888-882-7803

HEATED GREEN CANOLA BUYING:

CANOLA WE BUY DAMAGED GRAIN

Green &/or Heated Canola / Flax Wheat, Barley, Oats, Peas, Etc.

1-877-641-2798 Bow Valley Trading Ltd (2300) Land

• COMPETITIVE PRICES • PROMPT MOVEMENT • TOUGH • WEEDY

Select Horse Sale Saturday, March 24th, 2012

(3700) MB 14 TFN SK 15 TFN

R.M. OF GULL LAKE, SK NO.139: 6 - 1/4 sections Grassland, 4 miles west of Gull Lake bordering No.1 HWY. 5 - Deeded. 1 - Lease. Unlimited water supply, 2 spring fed dugouts. Water well supplying two big rubber water troughs. Piped underground. All fenced & cross fenced, 4 wires. Power to corral, good working corrals, good grass cover. Offers. Phone: 403-380-4748

WIRELESS DRIVEWAY ALARMS, calving/foaling barn cameras, video surveillance, rear view cameras for RV’s, trucks, combines, seeders, sprayers and augers. Mounted on magnet. Free Shipping. 403-616-6610, www.FAAsecurity.com, Calgary, AB.

(2300) AD10-11 SK 19-20

(4500) AD 6 TFN SK 15 TFN AG 14 TFN MB 15 TFN

(3300) Realtor Listings

LAKE McGREGOR AREA • 8,240 cultivated acres in one block. • 1,120 acres lease land. Call for more details and price. For viewing call Harold or Lyle Magnuson at Magnuson Realty Ltd. Harold: 403-485-0368 Lyle: 403-485-6901 (5000) Employment Opportunities

(5000) Employment Opportunities

A full time position on a mid-sized, East Central Alberta Beef and Grain Farm available April 2012.

All classes of Riding Horses: Ranch, Performance, Pleasure, Youth

Looking for a physically fit, self-motivated, & energetic individual.

Preview of Horses 10 a.m. Sale starts 1:30 p.m.

Duties will include all aspects of farm related work including: operation and maintenance of farm related machinery, feeding and handling of livestock in cow/calf production and feedlot operation.

www.badlandsspringselecthorsesale.com online catalog www.northernhorse.com

A clean driving record and police check may be required.

For further information contact Darren Hubka 403.363.2723 • Gordon Musgrove 403.363.1729 Darren Rebalkin 403.633.9997 • email: badlandshorsesale@hotmail.com

Wage range depending on experience from $16-$22/hour.

(3700) Heavy Trucks 2 - 1999 IHC 9200 day cab w/12.7L Detroit 430/470, 13 spd, 3 way lockers, 12x40 axles, aluminum buds all around, very clean, saftied - $28,000; 1998 IH 9200, 410 HP, N14, 10 spd., saftied - $12,000; 2002 IH 9100, ISX Cummins, 450 hp, 13 spd., saftied - $18,000; 2001 Western Star w/ 72” Sleeper, Cat C15 6NZ engine, 475 HP, 13 spd, 3.70RR, 24.5” rubber 90%, 1.5K km, 3-way lockers, saftied Asking $25,000.Eastern Equipment Ltd. 204-436-2317.

(3300) Realtor Listings

Sale Managed by: Sale conducted by:

gwacountry@gmail.com www.gwacountry.com

(5000) Employment Opportunities

Bonuses available upon evaluation. Please fax or email resume to Peter (with subject: Farm Labourer Resume) Email: pjs.cls@xplornet.com Fax: 403-882-2053 Home Phone Number: 403-882-2053

(5000) Employment Opportunities

Help Wanted

(4500) Custom Work

FIND WHAT YOU NEED IN THE

Operators needed for a modern custom manure applicator company. Experience with equipment and maintenance is an asset. Willing to train. Must be responsible, motivated and a team worker. Year round work available for the right candidate. Company is based in Southwest Manitoba. Please call 204-534-7382 for more information!

What is that funny looking picture?? Use the QR Code reader on your smart phone to photograph and decode this image!

Or visit us online! www.farmpressltd.com

Full issues available online! Also find issues of your favorite FarmPress Ltd. productions!

1-888-924-6397

Ad-Viser • Ag-Viser Irrigating Alberta Manitoba Farmlife


PAGE 34

Saskatchewan FarmLIFE, Monday, March 19, 2012

UNRESERVED FARM AUCTION FOR HIGHWAY 68 FEEDERS JASON & THERESA ZUK and DAVID & VALERIE ZUK of ARBORG, MB

FRIDAY MAY 25TH @ 12:00 noon DIRECTIONS: From Arborg, MB. 10 miles west of Arborg on highway 68 (through the S-curves to 1st yard on south side.)

TRACTOR: UÊÓääÈÊi˜`ÌÊn£nÊ7ÊÌÀ>V̜ÀÊ ÜÉi˜`ÌÊÇxxʏœ>`iÀÊ܈̅ÊÎÀ`Êv՘V̈œ˜]ÊÎÎʓˆiÊ«iÀʅœÕÀÊÌÀ>˜Ã]ÊvÀœ˜ÌÊ ÃÕëi˜Ãˆœ˜]Ê/-]Ê{ÊÀi“œÌiʅÞ`]Ê Î«Ì]Êx{äÉx{äÊiVœ˜Ê>˜`Ê£äääʫ̜]Ê Ón™ä…ÀÃÊŜ܈˜}]ÊÃɘǣnÉÓÓÉÇä{Î

UÊ}i>ÀLœÝÊ`ÀˆÛiÊ>˜}iÊ>`>«ÌiÀÊÌœÊ “œÕ˜ÌÊi“«iÀʅi>`ÊÌœÊ ʜÀÊ

UÊiÃÃ̜˜ÊxÊÀœÜÊVœÀ˜Ê…i>` UÊǽÊiÃÃ̜˜Ê…>Þʅi>`iÀ UÊ,ˆV…>À`ܘÊˆÊ Փ«Êȏ>}iÊÜ>}œ˜ UÊ,ˆV…>À`ܘÊˆÊ Փ«Êȏ>}iÊÜ>}œ˜

LIVESTOCK FEEDING CAT & WHEEL EQUIPMENT: LOADER: UÊ£™™™Ê >iʈ˜}Ê6œÀÌiÝÊÓäääÊL>iÊ UÊ£™nÎÊ >ÌÊ È ÊVÀ>܏iÀÊÜÉ£Î½Ê «ÀœViÃÜÀÊÃɘÓäänä “>˜Õ>Ê>˜}iÊL>`i]Ê«ÜÀÊňvÌÊÌÀ>˜Ã]Ê UÊ£™™™ÊÕVŽÊ œÜÊÎääÊȏ>}iÊÜ>}œ˜Ê Ài>ÀÊ܈˜V…]Êә»Ê«>`Ã]Ê£{ÈÓx…ÀÃÊ ÜÉ{Ê>Õ}iÀʓˆÝiÀ]ʅÞ`ÊV…ÕÌiʅiˆ}…Ì]Ê Ã…œÜˆ˜}]ÊÃɘÓä8äÎxÇnÊ­ÛiÀÞÊviÜÊ

ˆ}ˆÃÌ>ÀÊÃV>i]Ê£äää«Ìœ]ÊÃɘ™™‡Ç£Ç …œÕÀÃʜ˜Ê˜iÜÊvˆ˜>Ê`ÀˆÛiÃÊ>˜`ÊÀi>ÀÊ UÊ£™nÓÊœÀ`ÊnäääÊÌ>˜`i“ÊÌÀÕVŽÊÜÉÊ >ݏiÃ]Ê>˜`Ê̜ÀµÕiÊVœ˜ÛiÀÌiÀÊܜÀŽ® ÕVŽÊ œÜÊ{ÓxʓˆÝiÀÊvii`ÊÜ>}œ˜ UÊ£™ÇÎʏˆÃÊ …>“iÀÃÊn{äÊ܅iiÊ ]Ê{Ê>Õ}iÀʓˆÝiÀ]Ê ˆ}ˆÃÌ>ÀÊÃV>i]ʅÞ`Ê œ>`iÀÊÜÉn½ÊLÕVŽiÌ]Ên½Ê“>˜ÕÀiÊvœÀŽ]Ê V…ÕÌiʅiˆ}…Ì]ÊÎÓänÊ >ÌÊi˜}ˆ˜i]Ê>ÕÌœÊ ÃɘÎäxx ÌÀ>˜Ã]ÊvÀœ˜ÌʓœÕ˜ÌʅÞ`ʫՓ«Ê`ÀˆÛi]Ê Ãɘ£ 91nä1 6£ÈÓÈÈ FORAGE HARVESTING TRUCK & TRAILER: EQUIPMENT: UÊ£™nÎÊœÀ`ʙäääʅˆ}…Ü>ÞÊÌÀ>VUÊÓäääÊ >>ÃÊ>}Õ>ÀÊnÈäÊȏ>}iÊ ÌœÀÊ->v̈i`ÊÜÉÎxäÊ Õ““ˆ˜Ã]ʙÊë`Ê …>ÀÛiÃÌiÀÊÓÜ`]ÊÜÉ{Óää…ÀÃÊŜ܈˜}]Ê ÌÀ>˜Ã]ÊÜiÌʎˆÌ]ÊÎÇșÓӎ“ÃÊŜ܈˜}]Ê ÀœVŽÊÃ̜««iÀ]Ê>Õ̜ʎ˜ˆviÊÅ>À«i˜iÀ]Ê Ãɘ£ 91™ä7È 6{xÈÇ >Õ̜ʏÕLi]ÊÃɘ{™£äÓ{ÇÓÊ­œ˜ÞÊ UÊ£™™ÇÊqÊ{n½ÊiÀÀˆÌÌÊV>Ì̏iÊ«œÌÊ {xä…ÀÃʜ˜Ê˜iÜÊVÕÌ̈˜}ÊVޏˆ˜`iÀ]Ê ->v̈i`ÊÜÉ>ˆÀÊÀˆ`i]ʘœÃiÊ`iVŽˆ˜}]Ê Vޏˆ˜`iÀʎ˜ˆÛiÃ]ÊÅi>ÀÊL>À]ÊLœÜiÀÊ ˜iÜÊLÀ>ŽiÃ]ʘiÜÊ`ÀՓÃ]ʘiÜÊ̈ÀiÃ]Ê «>``iÃ]ʎiÀ˜iÊ«ÀœViÃÜÀÊÀœÃ]Ê>˜`Ê Ãɘ£/Ó {nә6ä£ä™Ç£ Üi>ÀÊ«>Ìiî UÊ£™™äÊiÃÃ̜˜ÊÇÇÓxÊȏ>}iʅ>ÀOTHER LIVESTOCK ÛiÃÌiÀÊÎÓx…«]ÊÃɘÓxä‡ä䙇äÎx EQUIPMENT: UÊ£Ó½Ê >>ÃÊÎnäÊ ʅ>Þʅi>`iÀÊ UÊ-…œ«Ê ՈÌʅÞ`ÊõÕiiâiÊV…ÕÌi Ãɘ{әä£nx{ UʈÊ+Õ>ÊVÀœÜ`ˆ˜}ÊÌÕL UÊi“«iÀʓœ`iÊ{xääÊÈÊÀœÜÊVœÀ˜Ê UÊ>>}…iÀÊ, ÊÌ>}Ê«>˜iÊÀi>`iÀ …i>`ÊÃɘ{{™£™

UÊ/ÀÕiÊ/iÃÌÊ8,ÊÎäääÊÃV>iʓœ˜ˆÌœÀÊ ÜÉÜ>˜`ÊÀi>`iÀ UÊÎä½ÊvÀiiÊÃÌ>˜`ˆ˜}Ê«>˜iÃʭܓiÊ ÜˆÌ…Ê܈˜`ÊLÀi>ŽÊLœ>À`î OTHER EQUIPMENT: UÊ£™™{Ê >ÃiÊÊnnÓäÊëÊÃÜ>̅iÀÊ ÜÉÓx½Ê}À>ˆ˜Ê…i>`iÀ]ÊÓÓää…ÀÃÊŜ܈˜}]ÊÃɘää{™Èx UÊ£È½Ê >ÃiÊVÀˆ“«iÀʅ>Þʅi>`iÀ UÊ,œ“iÊÌ>˜`i“Êœvv‡ÃiÌÊ`ˆÃŽÊÜÉn½Ê ܜÀŽˆ˜}Ê܈`̅]Ê>`ÕÃÌ>LiÊ>˜}i]ÊÎä»Ê ˜œÌV…i`Ê`ˆÃVà UÊ£™™ÇÊ-V…ՏÌiʈ>˜ÌÊÓxääÊÀœÌ>ÀÞÊ Ã̜˜iÊ«ˆVŽiÀÊÜɅÞ`Ê`ÀˆÛi UÊ/ÕLi‡"‡>̜ÀÊ}À>ˆ˜ÊL>}}iÀÊÜÉÎÈ»Ê ,i˜˜ÊÀœiÀʓˆÊ­V>˜ÊLiÊ돈̮ UÊ£{½Ê>˜`ÊÀœiÀ UÊ-…œ«Ê ՈÌÊÀœÌ>ÀÞÊ`ˆÌV…iÀ MISC. ITEMS & PARTS: UÊÎä½ÊÃÕVŽiÀÊÀœ`à UÊ iÜÊL>}ÃÊvœÀÊ}À>ˆ˜ÊL>}}iÀ UÊvœ>“ʏi>vÊVÕÌÌiÀÊLiiʘiÃÌà UÊ«>Ã̈VÊ`œ“iʏi>vÊVÕÌÌiÀÊLii ÊÅiÌiÀà FOR MORE INFO CONTACT OWNER

>ܘÊ<ÕŽÊ Óä{‡ÈÈ{‡x{ääÊ œÀÊ

>ۈ`Ê<ÕŽÊ Óä{‡ÈÈ{‡xÓÇ{

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell 2012


Saskatchewan FarmLIFE, Monday, March 19, 2012

Spring Equipment Specials Watch for our 30th Annual Customer Appreciation Sale April 9th to 14th 4X4 TRACTORS

LEON M1700 SCRAPER

PAGE 35

Diamond Shelters / Grain Vacs Swath Inverters / Hay Conditioners TREAGER WOOD PELLET GRILLS

Offering Over 16 Years of Experience Building Shelters

• Cook with pure, natural 100% wood pellets • Flip a switch and your grill becomes the best smoker there is • Smoke your own jerky, fish, sausage, cheese, nuts, etc. • 12 different models available as well a commercial grills

SPECIAL

1998 Case IH 9370 Quad Trac 4Rem, 5000 hrs, new hyd pump ....................................BLOWOUT $69,000 *C.N.T

$39,900 *C.N.T

SEEDING & TILLAGE

2001 Bourgault 5710/5350 40'-9.8", ROUND BALERS liquid kit, MRB ................................................. REDUCED $89,500 & Mower ConditIoners Bourgault 9200 36' Flexi 1610 Air Seeder .............................$24,900 2002 RBX561 .........................................................................$14,500 COMBINES 2005 Case IH HDX 142-14' MC ............................................$19,900 UP TO 24 MONTHS FREE FINANCE 1996 NH 664 ...........................................................................$8,900 1987 Case IH 1680 $18,000 work order, new motor..............$32,900 1995 Case IH 8480 soft core ....................................................$5900 2005 MF 9790 Redekopp, 900 hrs ......................................$155,900 1992 NH 660 .........................................................................$11,000 2004 MF 9790 w/Redekopp, 1300 hrs.................................$139,500 2003 Case IH HDX162, 16' ....................................................$19,900 2009 Case IH 9120 380 hrs .................................................$295,500 2004 Case IH 8010 1100 hours ..........................................ARRIVING 1999 Case IH RS561 ............................... BLOWOUT $8,000 *C.N.T MISCELLANEOUS 1995 NH TR97 ........................................BLOWOUT $26,000 *C.N.T 1995 NH TR97 ...........................................................$24,000 *C.N.T 2002 Highline 7000 big tires, w/grain tank..............................$9,500 1995 Case IH 2188, 2400 hrs ................................................$60,000 2003 Highline 7000 big tires ...................................................$9,500 2008 Grain Max 4371 auger ..................................................$15,500 Headers 1993 MacDon 960 with NH adaptor.......................................$16,900 Leon 12' 2530 4 way blade, like new 2011 .........................ARRIVING Case IH 810 - 20'.....................................................................$6,900 2001 Jiffy 900 Bale Pro ...........................................................$6,900 Case IH 882 16', fits Case 8820 ............................................$14,900 Maneiro 2230 Grain Bagger ....................................CALL FOR PRICE LOADER TRACTORS Akron EXG300 Extractor..........................................CALL FOR PRICE 2004 NH-TM120 ldr MFD, 4,300 hrs ....................................$55,500 Morris 881 8 Bale wagon, like new........................................$17,900 *C.N.T = Cash No Trade SWATHERS 1986 CASE IH 5000 dsl, with 14' hay header, nice shape ..ARRIVING WE HAVE GRAIN BAGS AT 1996 CASE IH 8820 25' PUR.................................................$26,900 CLEAROUT SALE PRICE WDX 1002S DHX302, 600 hrs............................................ARRIVING

MARTODAM MOTORS

GRAIN EQUIPMENT HAY STORAGE HOG

• 40 - 160 ft. wide, any length

DIAMOND SHELTERS

Free Standing or Pony Wall Style

CONVEYAIR GRAIN VACS

22-38 ft. Wide

End walls for Diamond Shelters can be wood or metal clad. Our own polyethylene covered end wall provides a durable and attractive finish to your Diamond Shelter.

DIAMOND SHELTERS

• 13’ High discharge boom for B trains • 3300 - 4000 bu./hr. • Dust separation system • 20 ft. steel hose and 14 ft. poly hose standard

CHIEF WESTLAND FARM BINS • • • •

SPIRITWOOD, SK, 306-883-2045 CHECK OUT OUR NEW WEBSITE:

MARTODAMMOTORS.COM

Corrugated steel sidewalls TITAN “W” Stiffeners Standard G115 galvanize coating Standard easy access doors

Visit us on the Web at www.caseih.com Case IH is a registered trademark of Case, LLC.

• 15 to 18 ft. wide, free standing • Various lengths

StarLine FROM

EXG 300 AKRON

THE

GREAT CAPACITY, 300 TON/HOUR 1 BUSHEL CLEAN UP AT THE END OF THE BAG. FULLY WINDS UP GRAIN BAG CHABOT IMPLEMENTS Neepawa, MB 204-476-3333 Steinbach, MB 204-326-6417 F.V. PIERLOT & SONS Nipawin, SK 306-862-4732 GREENFIELD AGRO SERVICE Rosetown, SK 306-882-2600 KROEKER MACHINERY Winkler, MB 204-325-4311 MARKUSSON NEW HOLLAND Emerald Park, SK 1-800-819-2583 MARTODAM MOTORS Spiritwood, SK 306-883-2045 MOODY’S EQUIPMENT LTD. Saskatoon, SK 306-934-4686 Perdue, SK 306-237-4272 Unity SK 306-228-2686 Lloydminster, SK 306-825-6141 Kindersley, SK 306-463-2335 Olds, AB 403-556-3939 High River, AB 403-652-1410 Balzac, AB 403-295-7824 NYKOLAISHEN FARM EQUIPMENT Kamsack, SK 306-542-2814 Swan River, MB 204-734-3466

PARKLAND FARM EQUIPMENT North Battleford, SK 306-445-2427 REDVERS AGR. & SUPPLY LTD. 306-452-3444 ROBERTSON IMPLEMENTS (1988) LTD. Shaunavon, SK, 306-297-4131 Swift Current, SK 306-773-4948 SCHROEDER BROS. Chamberlain, SK 306-638-6305 TWEED FARM EQUIPMENT Devil’s Lake, ND 701-662-7522 Medora, MB 204-665-2260 WHITE AG SALES & SERVICE Whitewood, SK 306-735-2300 AR-MAN EQUIPMENT Vulcan, AB 403-485-6968, 1-866-485-6968 BILL’S FARM SUPPLIES INC. Stettler, AB 403-742-8327 CAOUETTE & SONS IMPLEMENTS St. Paul, AB 780-645-4422 FOSTER’S AGRI-WORLD Beaverlodge, AB 780-354-3622, 1-888-354-3620

Email: craigyeager@grainbagscanada.com or aaronyeager@grainbagscanada.com

HAT AGRI-SERVICE Medicine Hat, AB 403-526-3701, 1-888-526-3702 Dunmore, AB,403-526-3701, 1-888-526-3702 HI LINE FARM EQUIPMENT LTD. Wetaskiwin, AB 780-352-9244, 1-888-644-5463 HAMMER NEW HOLLAND Westlock, AB 780-349-2588 1-877-456-3276 HOULDER AUTOMOTIVE LTD. Falher, AB, 780-837-4691, 1-866-837-4691 Grimshaw, AB 780-332-4691, 1-800-746-4691 KASH FARM SUPPLIES LTD. Eckville, AB 403-746-2211, 1-800-567-4394 TROCHU MOTORS LTD. Trochu, AB 403-442-3866, 1-888-336-3866 E. BOURASSA & SONS: Assinniboia 1-877-474-2456 Estevan 1-877-474-2495 Pangman 1-877-474-2471 Radville 1-877-474-2450 Weyburn 1-877-474-2491

LEASING AVAILABLE

SPECIAL BOOKING PRICES for complete Chief bin and extension packages.

• RV’s • Trucks • Tractors

Equipment Sales Ltd. 3906 - 84 Avenue, Leduc, AB.

(780) 986-5548 or

Toll Free 1-888-601-6611

WE SHIP ANYWHERE

UNBEATABLE POST FRAME BUILDINGS

PERMA-COLUMN concrete posts with lifetime guarantee only available from Integrity in Canada.

1-866-974-7678 • IntegrityPostStructures.com

Call Your Local Dealer

or Grain Bags Canada at 306-682-5888

www.grainbagscanada.com

Call for a FREE Quote


PAGE 36

Saskatchewan FarmLIFE, Monday, March 19, 2012

VERSATILE SX275 SP SPRAYER

VERSATILE 190

275 HP, 1200 gal tank, 100 ft. boom, boom height control, full GPS, loaded cab.

FWA, loader, grapple, loaded.

CALL FOR MORE DETAILS & PRICING

Milliken Farm

Taber, AB

403-223-4437

Toll Free 1-888-313-9988 Email us at sales@millikenfarm.com

Supplies (1977) Ltd.

HORSCH ANDERSON

Farming with passion

the JOKER Corn, wheat, bean or cover crop, the Horsch Anderson Joker is versatile enough to handle any type of crop residue in wet, dry, rocky or extremely saturated soils. No other tillage system gives you the speed, durability, moisture conservation and finishing capabilities of the Horsch Anderson Joker. With the Joker, you don’t have to sacrifice speed to finely chop and incorporate residue back into your field. It is specifically designed to perform at higher speeds in order to give you the most efficient, time-saving tillage experience. From the frame to the tires, the discs to the finishing system, the team at Horsch Anderson analyzed every aspect of the design to find ways to improve performance and increase your productivity. The result is the fastest, most efficient minimum tillage system on the market. The Joker can till fields in half the time or faster. Just a few miles per hour faster increases the productivity per acre. In our field tests, the Joker was able to perform at speeds up to 12 mph. That’s more than twice as fast as traditional tiller systems. Think about how much more you could accomplish with the fast, efficient and flexible Joker. The Joker compact disc may not look like every other tiller system, but then again, no other minimum tillage system handles quite like the Joker. Whether it’s the MT, RT or PT series, the Joker has the versatility to become an integral part or your farming operations.

Milliken Farm

Supplies (1977) Ltd.

YOUR

HORSCH ANDERSON DEALER FOR ALBERTA

Taber, AB

403-223-4437

Toll Free 1-888-313-9988 Email us at sales@millikenfarm.com


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 37

IN YARD

480 Steiger Quad 2007, Degelman Blade

$224,000

NH CR940 1500 hrs, dlx chopper, 76C pickup header.

$125,000

2 - CR9065 COMBINES Wishek 842 Disc

2010 MODELS WITH ONLY 250 HOURS

$42,000

D

L O S JD 4240

Allied Grapple, Joystick, 6,900 hrs.

$23,900

Flexi-Coil 5000

NH H8080

BLOWOUT PRICE

w/18 ft. disc header, 500 hrs.

57', 2002, 12", 4 1/2 steel, c/w 2003 3450 variable rate cart

$79,000

$92,000

Landroller 50 ft.

NH 9882 1997, 4600 hrs

$95,000

NH T8020 2010, 3 pt, 1400 hrs, 870 FEL.

$139,000

CIH 2090

$32,000

Good rubber, Weights, PS.

2011, 25 ft.

$13,500

$59,000

NH ST650

LD O S JD 2950 3000 hrs, 3 pt hitch, 260 FEL

Call For Price

5 Shank

$14,900 CIH 1680 3800 hours.

$15,000

Great Plains Turbo Till 40 ft.

$44,000

Horsch Anderson Joker

FC System 65XL 130 ft.

$7,500

CIH 8820 2500 hrs, 25 ft.

$29,000

USED EQUIPMENT

Manitou telehandler - 1400 hrs, c/w bucket, big square bale fork, pallet fork. 50â&#x20AC;&#x2122; Land Roller Due to a major increase in sales, we are looking for the following qualified personnel: 1 - SALESMAN; 1 - PARTSMAN 1 - MECHANIC Please phone for further information and to book an interview.


PAGE 38

Saskatchewan FarmLIFE, Monday, March 19, 2012

WATROUS MAINILINE MOTORS 0%

FINANCING ON MOST NEW GM CARS AND SPORT UTILITIES!

“HUGE FACTORY INCENTIVES”

GM STUDENT BONUS!

GM CARD ALLOWANC E!

FINAL 2011 MODEL BLOWOUT!

OVER 300 PRE-OWNED VEHICLES TO CHOOSE FROM!

MON-TUES-WED-SAT-8:30AM-6PM THURS-FRI-8:30AM-9PM


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 39

WATROUS MAINLINE MOTOR’S 0%

FINANCING ON MOST GM CARS & SPORT UTILITES!

SPRING MELTDOWN EVENT GM Student Bonus

USED VANS & SUBURBANS

ON NOW!!

Need help to establish credit?

e GM Card Allowanc

CALL US!

PRE OWNED VEHICLES

2007 CHEV UPLANDER LS EXT auto O/D, fully loaded, CD player, power seat, dk blue, 216,857 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,995 2006 PONTIAC MONTANA SV6, fully loaded, CD player, power seat, DVD, rear A/C, aluminum wheels, dk bronze, 161,614 km . . . . . . . . . . . . . . . $8,995 2004 PONTIAC MONTANA EXT 4DR, 3.4L V6, auto O/D, fully loaded, power seat, power door, aluminum wheels, DVD, dk. bronzemist, 180,547 km . . . . $7,995 2002 HONDA ODYSSEY LX fully loaded, CD player, 4 bucket seats, 7 passenger, gold, 218,000 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $8,995 2002 CHEV VENTURE EXT fully loaded, power seat, 7-passenger, sandstone, 195,013 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,995

2004 GMC SIERRA EXT CAB 4X4 5.3L V8, auto O/D, fully loaded, CD & Cassette, aluminum wheels, 2” lift, grey, 174,017 km. . . . . . . . . . . . . . . . $12,995 2003 CHEV SILVERAO LS ¾ TON CREW CAB 4X4 6.6L Duramax diesel, auto O/D, fully loaded, CD player, power seats, aluminum wheels, tan, 239,838 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $14,995 2003 GMC SIERRA EXT CAB 4x4, fully loaded, CD player, red, 206,018 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $11,995 2002 GMC SIERRA SLT EXT CAB 4X4 fully loaded, power heated seats, graphite leather, blue, 223,041 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $10,995 1996 CHEV SILVERADO LT EXT CAB 4X4 6.5T diesel, bucket seats, green, 368,428 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,995

USED SPORT UTILITIES & S-TRUCKS

USED CARS

2007 GMC YUKON DENALI XL AWD 6.2L V6, auto O/D, fully loaded, CD player, power heated seats, Nav DVD, sunroof, leather, black, 218,602 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$21,995 2006 GMC YUKON DENALI XL fully loaded, CD player, power heated seats, aluminum wheels, DVD, sunroof, leather, grey, 180,952 km . . . . . . . . . $17,995 2006 GMC YUKON XL SLT 4X4 5.3L V6, auto O/D, fully loaded, 6 disc CD, power heated seats, touch 4X4, aluminum wheels, hitch, grey leather, white, 195,741 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $16,995 2005 FORD ESCAPE XLT 4X4 SPORT 4DR V6, fully loaded, 6 disc CD, power seat, keyless entry, aluminum wheels, blue, 180,303 km . . . . . . . . . . . $10,995 2004 CHEV AVALANCHE 4X4 5.3L V8, auto O/D, fullly loaded, CD player, split bench seat, power seat, aluminum wheels, red, 200,878 km . . . . . $12,995 2004 GMC YUKON XL SLT 4X4 5.3L V8, auto O/D, fully loaded, power heated seats, grey leather, white, 175,015 km. . . . . . . . . . . . . . . . . . . . . . $15,995 2003 JEEP LIBERTY SPORT 3.7L V6 auto, fully loaded, CD player, silver, 100,346 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $9,995 2003 CHEV AVALANCHE 4X4 5.3L V8, auto O/D, fully loaded, CD player, split bench seat, aluminum wheels, dual zone air, keyless entry, blue, 214,507 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $11,995 2001 CHEV S-10 EXT CAB 2WD w/ 3rd DOOR CD player, A/C/T, white, 121,825 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,995 2001 FORD RANGER XLT EXT CAB 2WD w/ 3rd DOOR 3.0L V6, auto O/D, fully loaded, 6 disc CD, silver, 169,555 km . . . . . . . . . . . . . . . . . . . . . $6,995 2000 JEED GRAND CHEROKEE LIMITED AWD 4.7L V8, auto O/D, fully loaded, AM/FM cassette, power heated seats, aluminum wheels, sunroof, grey leather, grey, 315,434 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,995 1990 CHEV SUBURBAN 2WD, 7.4L V8, auto O/D, fully loaded, AM/FM cassette, bucket seats, keyless entry, aluminum wheels, 5-passenger, blue, 119,591 miles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,995

2007 CHEV IMPALA LT SEDAN auto O/D, fully loaded, CD player, power seat, aluminum wheels, white, 161,857 km . . . . . . . . . . . . . . . . . . . . . . . . $3,995

USED EXTENDED CABS & CREW CABS *** 60 IN STOCK ***

2002 PONTIAC GRAND AM SEDAN 2.2L, 4 cyl, auto O/D, CD, player, bucket seats, silver, 255,485 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $1,995

2007 FORD F150 XLT CREW CAB 4X4 5.4L V8, auto O/D, fully loaded, CD player, white, 163,108 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $15,995 2007 DODGE RAM SLT ¾ TON EXT CAB 4X4 Cummins diesel, auto O/D, fully loaded, 6 disc CD, power heated seats, aluminum wheels, grey leather, white, 146,990 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $32,995 2006 FORD F250 LARIAT SUPERCAB 4X4 6.0L Diesel, auto O/D, fully loaded, CD player, power heated seats, keyless entry, hitch, leather, white, 162,840 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $24,995 2005 GMC SIERRA SLT CREW CAB 4X4 6.0L V6, auto O/D, fully loaded, 6 Disc CD, power heated seats, keyless entry, touch 4x4, aluminum wheels, black, 213,596 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $16,995

2006 VW JETTA TDI, fully loaded, CD player, power heated seats, aluminum wheels, blue, 241,819 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $9,995 2006 PONTIAC GRAND PRIX GT 4DR 3.8L V6, loaded, stealth grey, 169,196 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,995 2006 PONTIAC VIBE AWD 4 cyl, auto O/D, fully loaded, Aluminum Wheels, Blue/Green, 170,500 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $8,995 2006 CHEV IMPALA LTZ 3.4L V6, loaded, auto O/D, heated buckets, ebony leather, bronzemist, 161,145 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $8,995 2004 CHEV MALIBU SEDAN 2.4L 4-cyl, auto O/D, fully loaded, CD player, brown, 106,011 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,995 2004 BUICK LESABRE CUSTOM 3.8L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, silver, 163,674 km . . . . . . . . . . . . . . . . . $6,995 2003 PONTIAC GRAND AM GT COUPE 3.4L V6, auto O/D, fully loaded, CD player, aluminum wheels, spoiler, red, 75,512 km . . . . . . . . . . . . . . . . $8,995 2003 PONTIAC GRAND AM GT 3.4L V6, auto O/D, fully loaded, CD player, power seat, aluminum wheels, spoiler, sunroof, white, 142,273 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,995 2003 OLDS ALERO GL COUPE 3.4L V6, auto O/D, fully loaded, CD player, power seat, keyless entry, aluminum wheels, sunroof, silver, 125,256 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,995 2002 PONTIAC GRAND PRIX GT COUPE, 3.6L V6, auto O/D, fully loaded, CD player, bucket seats, power seat, aluminum wheels, dk bronze mist, 109,997 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,995 2002 FORD MUSTANG GT COUPE 4.6L V8, 5-spd, fully loaded, 6 disc CD, power seat, aluminum wheels, ebony leather, black, 146,214 km . . . . . . $9,995 2002 PONTIAC GRAND AM SEDAN V6, auto, fully loaded, CD player, keyless entry, aluminum wheels, spoiler, silver, 244,931 km . . . . . . . . . . . . . . $2,995 2002 CHEV IMPALA LS SEDAN V6, fully loaded, CD player, bucket seats, power seat, aluminum wheels, spoiler, silver, 161,577 km. . . . . . . . . . . . . . $6,995 2001 CHEV IMPALA SEDAN 3.4L V6, auto, fully loaded, blue, 187,570 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,995 2001 CHEV CAVALIER Z24 COUPE auto, CD player, A-C-T, aluminum wheels, sunroof, silver, 160,622 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,995 2001 PONTIAC GRAND AM GT COUPE fully loaded, CD player, white, 212,367 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,995 2001 VOLVO S80 T6 V6, auto, twin turbo, loaded, sunroof, CD, ebony leather, green, 151,047 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $10,995 2000 BUICK REGAL SEDAN 3.8L V6, auto O/D, fully loaded, bucket seats, power seat, aluminum wheels, grey . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,995 1996 CHEV CAMARO COUPE 3.8L V6, auto O/D, fully loaded, CD player, keyless entry, aluminum wheels, blue, 158,663 km . . . . . . . . . . . . . . . . . $7,995

2005 FORD F250 XLT SUPERDUTY 6.0L, fully loaded, CD player, white, 390,000 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $8,995

MEDIUM DUTY

2004 FORD F250 XLT CREW CAB 4X4, 6.0L diesel, auto O/D, fully loaded, power seats, burgundy, 234,076 km . . . . . . . . . . . . . . . . . . . . . . . . . . $13,995 2004 GMC SIERRA SLE EXT/C 4X4 6.6L D/MAX, A-C-T, power windows & locks, split front bench, keyless entry, aluminum wheels, steering wheel controls, spoiler, CD, hitch, white, 300,795 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $14,995

2009 GMC C3500 REG CAB TANDEM 7.8L duramax diesel, fully loaded, 8 spd, Allison auto, CD player, 8½’ x 20’ x 60’ CIM ultra box & Horst electric roll tarp, remote endgate & hoist, hitch, victory red, 22,000 km, LIKE NEW - 2 IN STOCK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $103,995

2004 CHEV SILVERADO LT ¾T EXT CAB 4X4 6.6L Duramax diesel, auto O/D, fully loaded, touch 4X4, aluminum wheels,

TRAILERS & BUS

4” lift, nerf bars, chrome kit, pushbar, box cover, ebony leather, black, 262,469 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $15,995 2004 CHEV SILVERADO LS EXT CAB 4X4 5.3L V8, auto O/D, fully loaded, CD & cassette, power seat, aluminum wheels,

1989 FORD E350 BUS 2WD 7.3L Diesel, auto, 24 passenger, air ride, front A/C, cruise, tilt, brown, 79,432 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,995

white, 236,000 km . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $11,995

USED ½ TONS

2004 GMC SIERRA SLT ¾ TON CREW CAB 4X4 6.6L Duramax diesel, auto O/D, fully loaded, 6 disc CD, DVD, power heated seat, dual zone air, keyless entry, hitch, dk grey leather, white, 238,589 km. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $14,995

2002 CHEV SILVERADO 4.8L V8, auto O/D, fully loaded, CD pplayer, power seats, aluminum wheels, red, 204,374 km . . . . . . . . . . . . . . . . . . . . . . . $7,995

2012 3/4TON + 1 TON REG CABS + CREWCABS & EXT. CAS 2012 CHEV AVALANCHE’S

2012 ORLANDO 4DR WGN

2012 CHEV AVALANCHE LTZ 4WD 5.3 V-8, loaded, sunroof, DVD, NAV, White Diamond with DK./ LT. Cashmere Leather. MSRP 66,540 . . ..............................................Sale Price $56,995 2012 CHEV AVALANCHE LT 4WD 5.3 V-8, Loaded, Black with Ebony cloth. MSRP $51,410 ............................................... Sale Price $41,995

6-2010 CHEV ORLANDO 4DR WGS STARTING AT.....................................................$24,995

2012 SPORT UTILITIES 5- 2012 CHEV TRAVERSE’s AWD starting at stock # C1010 .................................................. $35,995 10-2012 BUICK ENCLAVE’s starting at stock # C1009 .................................................. $40,995 10-2012 GMC ACADIA’s starting at stock # C1028 .................................................. $34,995 2012 GMC YUKON SLT 4WD 5.3L V8, fully loaded, sunroof, white diamond with ebony leather MSRP $68,795 ............................................SALE PRICE $61,995

2012 COLORADO’S & CANYONS 2012 GMC CANYON SLE CREWCAB 4WD Fully loaded, Z71, fire red, MSRP $42,140 .SALE PRICE $34,995

2012 CHEV & GMC 1500 4WD CREWCAB 60 – 2012 CHEV & MC 1500 4WD CREWCAB S/BOX’s in stock starting at stock #C1141 ......................................... $29,995

MEDIUM DUTY TRUCKS 2013 KENWORTH T370 350 HP, diesel, Allison auto, fully loaded, air suspension, 8.5’x20’x65” CIM Ultracel box, hoist, electric tarp, remote controls ............................................. $139,995

2011 CHEV&GMC 2500 HD EXT CAB 4X4s 2011 CHEV & GMC 2500 H.D. 4WD EXT CAB Duramax Diesels starting at stock # B1102 .................$47,995

0% FINANCING FOR UP TO 72 MOS!

2012 CHEV EQUINOX AWD 50 IN STOCK! NEW 2012 EQUINOX’S & GMC TERRAINS! starting at ........................................ $29,995 stock #C1438

2012 CHEV 2500 HD (3/4) 4WD REG W.T. 6.0L V8, auto O/D, LS pkg, A/C/T, P.L., remote entry, white MSRP $44,260 ......................................... SALE PRICE $38,995 2012 GMC SIERRA HD 2500 (3/4) 4WD REG CAB Duramax Diesel, Allison auto, SL pkg, A/C/T, P.L., remote entry, white MSRP $56,025 ......................................... SALE PRICE $46,995 2012 GMC SIERRA SLE 2500 S/BOX 4WD CREWCAB 6.0L V8, loaded, mocha steel metallic, ebony cloth .... $45,995 25 – CHEV & GMC 2500 HM S/BOX 4WD CREWCABS with Duramax diesel, loaded, starting at stock #C1158 ............................................... $53,995 2012 GMC SIERRA “DENALI” 2500 HD 4WD S/BOX CREWCAB Duramax diesel, loaded, sunroof, NAV, stealth grey, ebony leather, 3 in stock starting stock # C1192 MSRP $77,115 ......................................... SALE PRICE $63,995 2012 GMC SLE 3500 HD 4WD CREWCAB LWB SRW Duramax diesel, loaded, white, ebony cloth................. $56,995 2012 GMC SLT 3500 HD CREWCAB 4WD LWB – SRW Duramax diesel, loaded, white, ebony leather MSRP $71,895 .........................................................SALE PRICE $60,995

MON-TUES-WED-SAT-8:30AM-6PM THURS-FRI-8:30AM-9PM


PAGE 40

Saskatchewan FarmLIFE, Monday, March 19, 2012

n o i t a v o n Re

OUT with the OLD IN with the NEW

931- 6611

e l a S

Take advatage of the great deals during our

or 1-800-298-8110

www.merlinford.com 3750 Idylwyld Dr.N.

Our sales staff is now located in trailers on the north side of the building.

Across from Costco

XC40347

ED40688

F139138

RA38518 8518

2012 EDGE SEL FWD

2012 ESCAPE XLT FWD

2011 F150 S/CREW LARIAT 4X4

2011 RANGER R/CAB 4X2

3.5L V6, 6 Spd Auto, Air, Tilt, Cruise, Power Windows, Locks & Seat, Heated Seats, Auto Climate Control, Trialer Tow, SYNC.

2.5L, 4 cyl, 6 Spd, Auto, Convenience Group, Sync, Air, Tilt, Cruise, Power Seat, Windows & Locks, Rubber Floor Mats.

2.3L, Auto O/D, w/60-40 Cloth Bench Seat.

MSRP - $35,199 Merlin Discount - $1,680

MSRP - $27,049 Merlin Discount - $1,767

6.2L V8, 6 Spd Auto, Max Trailer Tow, Chrome Pkg, Sony Audio, Rear Camera, Trailer Tow Mirrors, Tail Gate Step. MSRP - $55,759 Delivery Allowance - $7,500 Merlin Discount - $5,856 Custom Cash - $750

2012 EDGE SEL FWD YOU PAY

Delivery Allowance - $4,000 Custom Cash - $1,000

$

YOU PAY

*

28 8,519

Delivery Allowance - $5,000 Custom Cash - $500

$

YOU PAY

19 9,782*

$

MSRP - $15,058 Merlin Discount - $557 Delivery Allowance - $1,500 Custom Cash - $750

YOU PAY

*

41 1,653

$

12 2,249*

FC40120 0120 FN40993

$

$

28,519*

19,782*

2012 FORD FUSION SE 2.5L, 4 cyl, Auto, Loaded w/ SYNC and Rear Spoiler. MSRP - $25,749 Merlin Discount - $750 Delivery Allowance - $4,000 Custom Cash - $1,000

YOU PAY

2012 FORD MUSTANG GT COUPE

2.0L, 5 Spd Manual, Loaded w/ Heated Seats & Sport Package. MSRP - $21,699 Merlin Discount - $420 Extended Term Finance - $3,000 Custom Cash - $500

5.0L, V8, 6 Spd Manual, Loaded w/ Sheker 1000 Audio. MSRP - $43,349 Merlin Discount - $2,000 Delivery Allowance - $4,500 Custom Cash - $1,000

0% Interest Available

YOU PAY

17 7,779* 2012 FORD FOCUS

19 9,999*

41,653*

2012 FORD FOCUS SE HATCHBACK

YOU PAY

$

$

MU36958

$

SE HATCHBACK

$

0% APR

NOW GET THE FORD YOU WANT WITH THE OPTIONS YOU WANT.

PURCHASE FINANCING

OR

17,779*

2012 FORD FIESTA 5 DOOR HATCHBACK SE MSRP - $19,349 Merlin Discount - $439 Extended Term Finance - $2,250 Custom Cash - $500

YOU PAY

35 5,849*

$

— STARTING MARCH 12 TH —

22012 012 BRIER BRIER VVEHCILES EHCILES ON SALE

2011 F350 FX-4 SUPERCREW 4X4

2011 F150 XLT S/CREW 4X4

57,500 Km, 6.7 Diesel, SK Tax Paid.

6,251 km, Like New, Fully Equipped.

27,906 Km, XTR Pkg, Trailer Tow Pkg.

16 6,160*

5,500 + 1,000 UP TO

$

UP TO

$

TOWARDS THE OPTIONS YOU WANT

ON MOST NEW 2012 MODELS

ON MOST NEW 2012 MODELS

$

35,849*

$

*See dealer for details. Prices and p programs g are subject j to change g with notice or verification. Plus freight g and taxes, Cash back deducted. Vehicles not exactlyy as illustrated.

2011 GRAND VITARA 4X4

0% Interest Available

2012 FORD FIESTA 5 DOOR HATCHBACK SE

IN MANUFACTURER REBATES

ON MOST NEW 2012 FOCUS AND FIESTA

$

12,249*

1.6L, 4 cyl, 6 Spd, Auto, Loaded.

2012 FORD MUSTANG GT COUPE

AS LOW AS

$

FS40322

2011 TRANSIT CONNECT 9,310 km, Great Fuel Mileage, Fullyy Equipped. q pp

2011 E350 XLT 12 PASSENGER 22,450 Kms, Fully Equipped, Replacement Over $46,000.

16,160* 2011 SILVERADO LS CHEYENNE 3,700 Km, Like New, Sask. Tax Paid.

PU40838 PU40199

PU40915

F340848A

PU41017

F140082A

$20,900

$49,900

$29,900

$25,900

$30,900

$18,900

2009 RANGER REG CAB

2011 EXPLORER LIMITED

2010 RANGER FX-4 S/C 4X4

2010 EXPLORER LIMITED 4X4

2010 F150 XLT S/CREW 4X4

2009 MONTANA SV-6

2012 BRIER VEHICLES ON SALE STARTING MARCH 12 TH 43,488 Km, Low, Low Mileage, Local Trade.

15,022 km, Navigation System, Leather & Moonroof, Sask. Tax Paid.

39,522 km, All The Options, Box Cover.

PU41052

F139488A

$11,900 $35,900 $43,900 $43,900 $23,900

F140206A

$20,900 $18,900

22,534 km, All The Options, Power Boards, DVD/TV, Leather & Moonroof.

PP39712

$32,,9 900 $25,900

“Products you know - People you trust”

John Colin McKenna Anderson

John Hynd

$21,900 Frank Medve

Tom Geenen

Darryl Bretzer

Tara Collins

Shirley Schafer

Paul Lindo

Adam Guest

Steve Lieffers

Ron Adams

$13,900 Larry Nairn

Rob Wright

PU40797

$26,990 $ 26,990 $15,900

39,780 km, Low, Low Mileage, Excellent Condition. Condition ndition

XC40612B

$1 4,900 $22,900 Dealer License Number 314526

931- 6611

Larry Tim Lennox Backstrom

$11,900 Mel Bahrey

64,312 km, Sask. Tax Paid.

$19,900

or 1-800-298-8110 www.merlinford.com $7,950 $19,900 3750 Idylwyld Dr. N Across from Costco


Deines: What’s your Favourite Summer Pastime?

-UP P I L F DECK

Do you ever feel as though you have no time to enjoy your Saskatchewan summers? Those long, warm days are great for relaxing, but it always seems as though there is grass to mow and trimming to do. Don’t get bogged down with summer chores. Get on your Deines and let the six foot deck and zero degree turns mow the large areas efficiently. The precise lever steering allows you to control each wheel independently at any speed and makes trimming fast and simple. And the 11 gauge steel and heavy duty design means that you do not have to shy away from the areas behind the shed or between the bins. Whether your favourite summer pastime is golfing, going to the lake, or just sitting and basking in the beauty of your backyard, a Deines mower will help you appreciate more of it this summer and for many summers to come. Get a Deines in Laird, and get ready to enjoy your summer. Fits in your pick-up truck and we'll load it for you.

Come see us at our annual spring sale in Laird.

April 20th and 21st from 8 to 5. Save hundreds off of every new and used mower in stock.

Laird Manufacturing Corporation Laird, Saskatchewan

AGRICULTURAL EQUIPMENT TRACTORS New Versatile 485 STD Duals . . . . . . CALL FOR PRICE New Versatile 535 PS Duals . . . . . . CALL FOR PRICE

HARVEST

2010 MF 9795 mav chopper, 160 threshing hrs, shedded . . . . . . . . . . $265,000 2010 MF 9795 mav chopper, P.U. header, swathmaster, P.U., power fold, hopper ext . . . . . . . . . .$282,000 2008 MF 9690 1019 Threshing hrs, copper chaff spreader, shedded . . . . . . $170,000 2007 MF 9895 mav pu, table swathmaster, p.u. duals, shedded . . . . . $230,000 2004 MF 9790 Chopper chaff spreader, Swathmaster, P.U. 1100 threshing hrs, shedded. . . . . . . . . .$148,000 2004 Gleaner R65 Spreaders, 1300 threshing hrs, shedded . . . . . . . . . . $110,000 1996 MF 8570 Chopper Kirby Chaff Spreader swathmaster, P.U. . . . . $37,500 1986 MF 8560 Spreaders P.U.Header, Victory P.U. . . . . . . . . . . . . . . . $18,000

HEADERS 2008 HoneyBee 36’ single reel, double knife drive, transport. . . . . . . . . . . $48,000 2001 HoneyBee 36’ Double reel, transport . $25,000 1998 Massey 5000 Draper header, P.U. . . . . . . .reel transport. . . . . . . . . . . $22,000 1995 MacDon 36 ft 960, draper header, P.U reel, pea auger . . . . . . . . . . . . . $22,000 1998 Massey 4000 13’ P.U. table w/ Victory P.U. . . $9,000

SPRAYERS New Flexicoil Sprayers in stock, whl boom & suspended boom . Call For Prices 2008 Flexicoil System 68XLT 120’, whl boom, hyd pump, double combo, jet nozzles, windscreens, auto rate $30,000

2003 Flexicoil System 67XLT 120’, hyd pump & pto pump, windscreens, Flexicontrol . . . . . $13,000 1997 System 67XL 120’, windscreens, hyd pump . . . $9,900 Flexicoil System 65 150’ hyd pump. . . . . . . . . . . $4,000 Flexicoil System 65 XLT 100' Hyd. pump & PTO pump, wind screens . . . . . . . . . . . . . $8,000

AUGERS NEW Farm King Augers in stock . . . . . . . . . . . . . . . Call For Prices Used Farm King 10x60 Swing Auger . . . . . . . . . . . . . $6,500 2002 Brandt 10x70 Swing Auger . . . . . . . . . . . . . $7,000

TILLAGE New Flexi-Coil 5000 HD, 58’ Air Drill, 10” spacing, Rubber Packers, Double Shoot, Air Pkg, New Flexi-Coil 4350 Mechanical Air Cart, Duals. . . .CALL FOR PRICE New Flexi-Coil 5000 HD, 51’ Air Drill, 10” spacking, rubber packers, double shoot, air pkg, new Flexi-COil 4350, variable rate cart. . . . . . . . . . CALL FOR PRICE New Morris 8370XL Air Cart Double shoot, 3rd tank, variable rate . . . . . . . . . CALL FOR PRICE 2009 Morris MaxII 60’ Air Drill 10” spacing, 3” rubber packers, double shoot, air pkge, broadcast kit, single shoot, atom jet openers . . . . . . . . . . $65,000 2008 Morris 61’ Contour drill 10” spacing, pneumatic packers, single shoot, Morris 8370 cart . . . . . . . . . $156,000 2000 Flexicoil 2320 Air Cart, 8 run double shoot. . . $22,000 1998 Morris Concept 2000 44’, Air Seeder, 10” spacing, single shoot, Knives . . . . . . . . . $15,000 1998 Morris 7240 Air Cart, single shoot. . . . . . . . . . $18,000 Dutch 40’ land roller . . . $12,500

Owens & Sweitzer

(1972) Ltd.

1-800-205-2473

Check it out at:

www.lairdmowers.ca


PAGE 2

Saskatchewan FarmLIFE, Monday, March 19, 2012

Serving Southern Alberta & Saskatchewan since 1952

MEDICINE HAT FEEDING CO. Cattle Auction Market & Livestock Supply Store 3381 Gershaw Drive S.W., Medicine Hat, AB T1B 3N2

403-526-3129 â&#x20AC;˘ Toll Free 1-800-452-3129 CANADIAN SATELLITE LIVESTOCK AUCTION EVERY WEDNESDAY @ 11:00 AM

MHFC Livestock Supply 403-526-2707

Manager: Lyle Taylor 403-528-0797 Field Manager: Nolan Herman 403-502-6417 Office Managers: Cindy Dennis / Kristy Munsch

General Manager: Brian Palichuk 403-878-7003

Check out our website at www.mhfc.ca â&#x20AC;˘ Find us on Facebook! MHFC Livestock Supply â&#x20AC;&#x153;YOUR ONE STOP FOR CATTLE MARKETING AND LIVESTOCK SUPPLIESâ&#x20AC;?

REGULAR SALES EVERY WEDNESDAY AT 9:30 A.M. If you have cattle for sale or are in the market for grass cattle, contact the market at 403-526-3129 and one of our field men would be happy to set up a visit with you. Great time to be in the Cattle Industry and donâ&#x20AC;&#x2122;t sell your cattle short in a rising market-let the auction determine the value of your cattle and maximize your returns!!!!!!!!!! Outstanding sets of bulls on offer at each of our upcoming bull sales scheduled. Mark the dates on your calendar and plan on purchasing some top quality genetics to use in your program!!!

PRE-SORT YEARLING SALES FOR THIS SPRING: SALE TIME - 10.00 AM. Call the market to list your feeder cattle for one of our sales as demand is strong and we are seeing record highs in the feeder market!!

March 23 - Expecting 2000 head

April 4

April 13

COW CALF PAIRS - SALE TIME-1:00PM April 18

April 25

May 2

May 9

May 16

May 23

BULL SALE DATES Couple of reputation sales coming up at MHFC. Mark the dates below if youâ&#x20AC;&#x2122;re looking for quality bulls out of reputation herds that have been in the cattle business for years!!! â&#x20AC;˘ Thursday March 15, 2012 at 1:00 p.m. Border Butte Black Angus/Allencroft Black Angus â&#x20AC;˘ Monday, April 23, 2012 at 1:00 p.m. - Rancher Choice Black Angus

4th ANNUAL KILLARNEY & DISTRICT EQUIPMENT CONSIGNMENT AUCTION KILLARNEY, MB. SATURDAY APRIL 21st 9:00am

DIRECTIONS: Sale will be held at the farm of Del & Gert Smith, ½ mile west of the jct of #3 & #18 hwys. (Just off #3 hwy across from water tower) ORDER OF SALE:Ă&#x160; 10:00am â&#x20AC;&#x201C; 12:00pm (misc, tools, palleted lots) 12:00pm â&#x20AC;&#x201C; (livestock related items followed by major equipment) THIS IS AN EARLY LIST WITH MORE CONSIGNMENT BEING ADDED DAILY. CALL NOW TO HAVE YOUR ITEMS ADDED TO THIS COMMUNITY SALE.

TRACTORS: UĂ&#x160;xännĂ&#x160;Ă&#x152;Ă&#x20AC;>VĂ&#x152;Â&#x153;Ă&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;Ă&#x17D;nÂťĂ&#x160;`Ă&#x2022;>Â?Ă&#x192;]Ă&#x160;Ă&#x192;Ă&#x2030;Â&#x2DC;1ää{xĂ&#x201C;n U Ă&#x160;{äĂ&#x201C;äĂ&#x160;Ă&#x152;Ă&#x20AC;>VĂ&#x152;Â&#x153;Ă&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;`Ă&#x2022;>Â?Ă&#x160;Â&#x2026;Ă&#x17E;`]Ă&#x160;`Ă&#x2022;>Â?Ă&#x160;ÂŤĂ&#x152;Â&#x153;]Ă&#x160;Ă&#x20AC;iViÂ&#x2DC;Ă&#x152;Ă&#x160;VÂ?Ă&#x2022;Ă&#x152;VÂ&#x2026;]Ă&#x160;Â&#x2DC;iĂ&#x153;Ă&#x160;iĂ?Â&#x2026;>Ă&#x2022;Ă&#x192;Ă&#x152;]Ă&#x160;Â&#x2DC;iĂ&#x153;Ă&#x160;L>Ă&#x152;Ă&#x152;iĂ&#x20AC;Â&#x2C6;iĂ&#x192;]Ă&#x160;Â&#x2DC;iĂ&#x153;Ă&#x160; Ă&#x192;i>Ă&#x152;]Ă&#x160;Â&#x2DC;iĂ&#x153;Ă&#x160;VÂ&#x2C6;Ă&#x20AC;VĂ&#x2022;Â?>Ă&#x152;Â&#x2C6;Â&#x2DC;}Ă&#x160;Â&#x2026;i>Ă&#x152;iĂ&#x20AC;]Ă&#x160;Ă&#x2C6;xääÂ&#x2026;Ă&#x20AC;Ă&#x192;Ă&#x160;Ă&#x192;Â&#x2026;Â&#x153;Ă&#x153;Â&#x2C6;Â&#x2DC;} U Ă&#x160;{ä£äĂ&#x160;Ă&#x153;Ă&#x2030; Ă&#x160;ÂŁ{nĂ&#x160;Â?Â&#x153;>`iĂ&#x20AC;]Ă&#x160;`Ă&#x2022;>Â?Ă&#x160;Â&#x2026;Ă&#x17E;`]Ă&#x160;Ă&#x192;iÂŤ>Ă&#x20AC;>Ă&#x152;iĂ&#x160;Ă&#x203A;>Â?Ă&#x203A;iĂ&#x192;Ă&#x160;vÂ&#x153;Ă&#x20AC;Ă&#x160;Â?Â&#x153;>`iĂ&#x20AC;]Ă&#x160;ÂŁĂ&#x201C;Ă&#x160;Ă&#x203A;Â&#x153;Â?Ă&#x152;Ă&#x160;Ă&#x192;Ă&#x17E;Ă&#x192;Ă&#x152;iÂ&#x201C;]Ă&#x160; Â?Â&#x2C6;}Â&#x2026;Ă&#x152;Ă&#x192; UÂŁÂ&#x2122;Ă&#x2C6;Ă&#x201C;Ă&#x160; Ă&#x160;Ă&#x17D;ä£äĂ&#x160;Ă&#x153;Ă&#x2030; Ă&#x160;{Ă&#x2C6;Ă&#x160;Â?Â&#x153;>`iĂ&#x20AC;]Ă&#x160;ÂŁĂ&#x201C;Ă&#x160;Ă&#x203A;Â&#x153;Â?Ă&#x152;Ă&#x160;Ă&#x192;Ă&#x17E;Ă&#x192;Ă&#x152;iÂ&#x201C;]Ă&#x160;`Ă&#x2022;>Â?Ă&#x160;Â&#x2026;Ă&#x17E;`]Ă&#x160;Ă&#x192;iÂŤ>Ă&#x20AC;>Ă&#x152;iĂ&#x160;Â&#x2026;Ă&#x17E;`Ă&#x160;Ă&#x203A;>Â?Ă&#x203A;iĂ&#x160;vÂ&#x153;Ă&#x20AC;Ă&#x160; Â?Â&#x153;>`iĂ&#x20AC;]Ă&#x160;}Â&#x153;Â&#x153;`Ă&#x160;Ă&#x20AC;Ă&#x2022;LLiĂ&#x20AC; U Ă&#x160;Ă&#x160;Ă&#x20AC;Â&#x153;Ă&#x153;Ă&#x160;VĂ&#x20AC;Â&#x153;ÂŤĂ&#x160;Ă&#x152;Ă&#x20AC;>VĂ&#x152;Â&#x153;Ă&#x20AC; U-Ă&#x2022;ÂŤiĂ&#x20AC;Ă&#x160;Ă&#x160;Â&#x2026;Â&#x2C6;}Â&#x2026;Ă&#x160;Â?Â&#x2C6;vĂ&#x152;Ă&#x160;Â?Â&#x153;>`iĂ&#x20AC; U}Ă&#x20AC;>ÂŤÂŤÂ?iĂ&#x160;vÂ&#x153;Ă&#x20AC;Â&#x17D;Ă&#x160;Â&#x153;vvĂ&#x160;Ă&#x160;Â?Â&#x153;>`iĂ&#x20AC; HARVEST EQUIPMENT: U

Ă&#x160;Â&#x2122;Ă&#x2C6;ääĂ&#x160;ÂŤĂ&#x152;Ă&#x160;VÂ&#x153;Â&#x201C;LÂ&#x2C6;Â&#x2DC;i UĂ&#x201C;ä½Ă&#x160;6iĂ&#x20AC;Ă&#x192;>Ă&#x152;Â&#x2C6;Â?iĂ&#x160;{ääĂ&#x160;Ă&#x192;ÂŤĂ&#x160;Ă&#x192;Ă&#x153;>Ă&#x152;Â&#x2026;iĂ&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;L>Ă&#x152;Ă&#x160;Ă&#x20AC;iiÂ? U nÂ&#x2122;äĂ&#x160;ÂŤĂ&#x152;Ă&#x160;vÂ&#x153;Ă&#x20AC;>}iĂ&#x160;Â&#x2026;>Ă&#x20AC;Ă&#x203A;iĂ&#x192;Ă&#x152;iĂ&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030; nnä7Ă&#x160;ÂŤÂ&#x2C6;VÂ&#x17D;Â&#x2021;Ă&#x2022;ÂŤĂ&#x160;Â&#x2026;i>` UĂ&#x160; nnä7Ă&#x160;Ă&#x17D;Ă&#x2C6;ÂťĂ&#x160;Â&#x2026;>Ă&#x20AC;Ă&#x203A;iĂ&#x192;Ă&#x152;iĂ&#x20AC;Ă&#x160;Â&#x2026;i>`iĂ&#x20AC; UĂ&#x160; Ă&#x160;Ă&#x201C;Ă&#x160;Ă&#x20AC;Â&#x153;Ă&#x153;Ă&#x160;>`Â?Ă&#x2022;Ă&#x192;Ă&#x152;>LÂ?iĂ&#x160;VÂ&#x153;Ă&#x20AC;Â&#x2DC;Ă&#x160;Â&#x2026;i>`iĂ&#x20AC; HAYING EQUIPMENT: UĂ&#x160;­Ă&#x17D;ÂŽĂ&#x160; Ă&#x160; ,Ă&#x2021;näĂ&#x160;Ă&#x20AC;`Ă&#x160;L>Â?iĂ&#x20AC;Ă&#x192; UĂ&#x160;ÂŁĂ&#x201C;½Ă&#x160; Ă&#x160;{Â&#x2122;Â&#x2122;Ă&#x160;Â&#x2026;Ă&#x17E;`Ă&#x20AC;Â&#x153;Ă&#x160;Ă&#x192;Ă&#x153;Â&#x2C6;Â&#x2DC;}Ă&#x160;Â&#x201C;Â&#x153;Â&#x2021;VÂ&#x153; UĂ&#x160;ÂŁĂ&#x201C;½Ă&#x160; Ă&#x160;{Â&#x2122;xĂ&#x160;Â&#x2026;>Ă&#x17E;LÂ&#x2C6;Â&#x2DC;iĂ&#x160;Ă&#x192;Ă&#x2030;Â&#x2DC;Ă&#x2C6;äxÂŁnn UĂ&#x160;ÂŁĂ&#x2C6;½Ă&#x160; >Ă&#x192;iĂ&#x160;nĂ&#x17D;näĂ&#x160;Â&#x2026;Ă&#x17E;`Ă&#x20AC;Â&#x153;Ă&#x160;Ă&#x192;Ă&#x153;Â&#x2C6;Â&#x2DC;}Ă&#x160;Â&#x201C;Â&#x153;Â&#x2021;VÂ&#x153; UĂ&#x160;}Ă&#x160;-Â&#x2026;Â&#x2C6;iÂ?`Ă&#x160;,iVÂ&#x153;Â&#x2DC;Ă&#x160;Ă&#x160;Ă&#x20AC;iVĂ&#x20AC;Â&#x2C6;Â&#x201C;ÂŤiĂ&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;Â&#x2026;Ă&#x17E;`Ă&#x160;`ivÂ?iVĂ&#x152;Â&#x153;Ă&#x20AC;Ă&#x160;Ă&#x192;Â&#x2026;Â&#x2C6;iÂ?`Ă&#x192;]Ă&#x160;x{äĂ&#x160;ÂŤĂ&#x152;Â&#x153; UĂ&#x160;-Â&#x2C6;Ă&#x152;Ă&#x20AC;iĂ?Ă&#x160;Ă&#x2C6;Ă&#x160;Ă&#x153;Â&#x2026;iiÂ?Ă&#x160;Ă&#x20AC;>Â&#x17D;iĂ&#x160;Ă&#x192;Ă&#x2030;Â&#x2DC;nĂ&#x201C;Ă&#x17D;äĂ&#x2021; UĂ&#x160;Ă&#x201C;Ă&#x160;Ă&#x153;Â&#x2026;iiÂ?Ă&#x160;Ă&#x20AC;>Â&#x17D;iĂ&#x160;Ă&#x192;Ă&#x2030;Â&#x2DC;£äĂ&#x2021;Ă&#x2C6; UĂ&#x160;L>Â?iĂ&#x160;Ă&#x152;Ă&#x20AC;>Â&#x2C6;Â?iĂ&#x20AC;Ă&#x160;UĂ&#x160;L>Â?iĂ&#x160;iÂ?iĂ&#x203A;>Ă&#x152;Â&#x153;Ă&#x20AC; LIVESTOCK RELATED ITEMS: UĂ&#x160; Ă&#x160;Ă&#x17D;xnĂ&#x160;Â&#x2026;>Â&#x201C;Â&#x201C;iĂ&#x20AC;Ă&#x160;Â&#x201C;Â&#x2C6;Â?Â?Ă&#x160;Ă&#x153;Ă&#x2030;ÂŤĂ&#x153;Ă&#x20AC;Ă&#x160;L>Â?iĂ&#x160;vii`]Ă&#x160;£äääĂ&#x160;ÂŤĂ&#x152;Â&#x153;]Ă&#x160;Ă&#x201C;Ă&#x160;Ă&#x192;VĂ&#x20AC;iiÂ&#x2DC;Ă&#x192;]Ă&#x160;VÂ&#x153;Â&#x201C;ÂŤÂ?iĂ&#x152;iĂ&#x160;Â&#x2026;Ă&#x17E;`Ă&#x160;Â?Â&#x153;Â&#x2DC;}Ă&#x160; Ă&#x2022;Â&#x2DC;Â?Â&#x153;>`Ă&#x160;>Ă&#x2022;}iĂ&#x20AC;Ă&#x160;­Â?Â&#x2C6;vĂ&#x152;]Ă&#x160;Ă&#x192;Ă&#x153;Â&#x2C6;Â&#x2DC;}]Ă&#x160;`Ă&#x20AC;Â&#x2C6;Ă&#x203A;iÂŽ]Ă&#x160;Ă&#x192;Ă&#x2030;Â&#x2DC;nÂŁxĂ&#x2021;Ă&#x201C;ä UĂ&#x160;Ă&#x160;ÂŁĂ&#x201C;xäĂ&#x160;Â&#x201C;Â&#x2C6;Ă?Ă&#x160;Â&#x201C;Â&#x2C6;Â?Â?Ă&#x160;Ă&#x153;Ă&#x2030;Ă&#x192;Ă&#x2022;ÂŤÂŤÂ?iÂ&#x201C;iÂ&#x2DC;Ă&#x152;Ă&#x160;Â&#x2026;Â&#x153;ÂŤÂŤiĂ&#x20AC;]Ă&#x160;£äääĂ&#x160;ÂŤĂ&#x152;Â&#x153;

UĂ&#x160;>Ă&#x20AC;Â&#x201C;Ă&#x160;Â&#x2C6;Â&#x2DC;}Ă&#x160;Â&#x201C;Â&#x153;`iÂ?Ă&#x160;Ă&#x2C6;äĂ&#x160;iÂ?iVĂ&#x152;Ă&#x20AC;Â&#x2C6;VĂ&#x160;Â&#x2026;>Â&#x201C;Â&#x201C;iĂ&#x20AC;Ă&#x160;Â&#x201C;Â&#x2C6;Â?Â?Ă&#x160;Ă&#x153;Ă&#x2030;xÂ&#x2026;ÂŤĂ&#x160;ÂŁÂŤÂ&#x2026;Ă&#x160;Ă&#x201C;Ă&#x201C;äĂ&#x203A;Â&#x153;Â?Ă&#x152;Ă&#x160;Â&#x201C;Â&#x153;Ă&#x152;Â&#x153;Ă&#x20AC; UĂ&#x160;*>Ă&#x20AC;Ă&#x152;Â&#x2DC;iĂ&#x20AC;Ă&#x192;Â&#x2026;Â&#x2C6;ÂŤĂ&#x160;7iÂ?`Â&#x2C6;Â&#x2DC;}Ă&#x160;, Â&#x2021;xäĂ&#x160;L>Â?iĂ&#x160;ÂŤĂ&#x20AC;Â&#x153;ViĂ&#x192;Ă&#x192;Â&#x153;Ă&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;Ă&#x17D;Ă&#x160;Li>Ă&#x152;iĂ&#x20AC;Ă&#x192;]Ă&#x160;Ă&#x192;iÂ?vĂ&#x160;Â?Â&#x153;>`Â&#x2C6;Â&#x2DC;}]Ă&#x160;x{äĂ&#x160;ÂŤĂ&#x152;Â&#x153;]Ă&#x160; ­}Ă&#x20AC;Â&#x2C6;Â&#x2DC;`Ă&#x192;Ă&#x160;LÂ&#x153;Ă&#x152;Â&#x2026;Ă&#x160;Ă&#x20AC;Â&#x153;Ă&#x2022;Â&#x2DC;`Ă&#x160;>Â&#x2DC;`Ă&#x160;Ă&#x192;ÂľĂ&#x2022;>Ă&#x20AC;iĂ&#x160;L>Â?iĂ&#x192;ÂŽ UĂ&#x160;,i>Â?Ă&#x160;Â&#x2DC;`Ă&#x2022;Ă&#x192;Ă&#x152;Ă&#x20AC;Â&#x2C6;iĂ&#x192;Ă&#x160;ÂŤÂ&#x153;Ă&#x20AC;Ă&#x152;>LÂ?iĂ&#x160;Â&#x2026;>Â&#x2DC;`Â?Â&#x2C6;Â&#x2DC;}Ă&#x160;Ă&#x192;Ă&#x17E;Ă&#x192;Ă&#x152;iÂ&#x201C;Ă&#x160;Ă&#x153;Ă&#x2030;>Ă&#x2022;Ă&#x152;Â&#x153;Ă&#x160;V>Ă&#x152;VÂ&#x2026;Ă&#x160;Â&#x2026;i>`Ă&#x160;}>Ă&#x152;i]Ă&#x160;ÂŁĂ&#x2C6;½Ă&#x160;/Ă&#x2022;L]Ă&#x160;ÂŁĂ&#x2C6;½Ă&#x160;>`Â?Ă&#x2022;Ă&#x192;Ă&#x152;Â&#x2021; >LÂ?iĂ&#x160;>Â?Â?iĂ&#x17E;Ă&#x160;Ă&#x153;Â&#x2C6;Ă&#x152;Â&#x2026;Ă&#x160;Ă&#x152;Â&#x2026;Ă&#x20AC;iiĂ&#x160;>VViĂ&#x192;Ă&#x192;Ă&#x160;ÂŤ>Â&#x2DC;iÂ?Ă&#x192;Ă&#x160;>Ă&#x152;Ă&#x160;Â&#x2026;i>`Ă&#x160;}>Ă&#x152;i]Ă&#x160;L>VÂ&#x17D;Ă&#x160;Ă&#x2022;ÂŤĂ&#x160;Ă&#x192;Ă&#x152;Â&#x153;ÂŤÂŤiĂ&#x20AC;Ă&#x192;]Ă&#x160;ÂŤ>Â?ÂŤ>Ă&#x152;Â&#x2C6;Â&#x153;Â&#x2DC;Ă&#x160;V>}iĂ&#x160;Â&#x2C6;Â&#x2DC;Ă&#x160; >Â?Â?iĂ&#x17E;]Ă&#x160;Â&#x2026;Â&#x2C6;Ă&#x152;VÂ&#x2026;Ă&#x160;>Â&#x2DC;`Ă&#x160;Ă&#x153;Â&#x2026;iiÂ?Ă&#x160;Â&#x17D;Â&#x2C6;Ă&#x152; UĂ&#x160;£ä½Ă?n½Ă&#x160;Â?Â&#x153;>`iĂ&#x20AC;Ă&#x160;Â&#x201C;Â&#x153;Ă&#x2022;Â&#x2DC;Ă&#x152;Ă&#x160;Â&#x201C;>Ă&#x152;iĂ&#x20AC;Â&#x2DC;Â&#x2C6;Ă&#x152;Ă&#x17E;Ă&#x160;ÂŤiÂ&#x2DC;Ă&#x160;Ă&#x153;Ă&#x2030; Â&#x153;Ă&#x20AC;Ă&#x152;Â&#x2026;Ă&#x160;-Ă&#x152;>Ă&#x20AC;Ă&#x160;>Ă&#x2022;Ă&#x152;Â&#x153;Ă&#x160;V>Ă&#x152;VÂ&#x2026;Ă&#x160;Â&#x2026;i>`Ă&#x160;}>Ă&#x152;i]Ă&#x160;Â&#x201C;Â&#x153;Ă&#x2022;Â&#x2DC;Ă&#x152;Ă&#x192;Ă&#x160;Ă&#x152;Â&#x153;Ă&#x160;  Ă&#x160;ÂľĂ&#x2022;Â&#x2C6;VÂ&#x17D;Ă&#x160;>Ă&#x152;Ă&#x152;>VÂ&#x2026; UĂ&#x160;Ă&#x20AC;Ă&#x160;-ÂľĂ&#x2022;iiâiĂ&#x160;VÂ&#x2026;Ă&#x2022;Ă&#x152;iĂ&#x160;Ă&#x153;Ă&#x2030;>Ă&#x2022;Ă&#x152;Â&#x153;Ă&#x160;V>Ă&#x152;VÂ&#x2026;Ă&#x160;Â&#x2026;i>`Ă&#x160;}>Ă&#x152;iĂ&#x160;UĂ&#x160;Â&#x2026;i>`Ă&#x160;}>Ă&#x152;i UĂ&#x160;Ă&#x192;Â&#x2C6;Â&#x2DC;}Â?iĂ&#x160;>Â&#x2DC;Â&#x2C6;Â&#x201C;>Â?Ă&#x160;`Â&#x2C6;}Â&#x2C6;Ă&#x152;>Â?Ă&#x160;Ă&#x192;Ă&#x152;Â&#x153;VÂ&#x17D;Ă&#x160;Ă&#x192;V>Â?i UĂ&#x160; Ă&#x160;Ă&#x2021;Â&#x2122;äĂ&#x160;Ă&#x152;Ă&#x2030;>Ă&#x160;Â&#x201C;>Â&#x2DC;Ă&#x2022;Ă&#x20AC;iĂ&#x160;Ă&#x192;ÂŤĂ&#x20AC;i>`iĂ&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;Ă&#x192;Â&#x2C6;Â&#x2DC;}Â?iĂ&#x160;Li>Ă&#x152;iĂ&#x20AC;]Ă&#x160;£äääĂ&#x160;ÂŤĂ&#x152;Â&#x153; UĂ&#x160;Ă&#x160;Ă&#x201C;äxĂ&#x160;Ă&#x192;Ă&#x2030;>Ă&#x160;Â&#x201C;>Â&#x2DC;Ă&#x2022;Ă&#x20AC;iĂ&#x160;Ă&#x192;ÂŤĂ&#x20AC;i>`iĂ&#x20AC;]Ă&#x160;Ă&#x192;Ă&#x2030;Â&#x2DC;Ă&#x201C;äxÂŁĂ&#x2C6;ä UĂ&#x160;>ÂŤÂŤĂ&#x20AC;Â&#x153;Ă?Ă&#x160;Ă&#x201C;xäĂ&#x160;viÂ&#x2DC;ViĂ&#x160;ÂŤÂ&#x153;Ă&#x192;Ă&#x152;Ă&#x192; UĂ&#x160;­Ă&#x2021;ÂŽĂ&#x160;Â&#x2C6;>Â&#x201C;Â&#x2C6;Ă&#x160;7iÂ?`Â&#x2C6;Â&#x2DC;}Ă&#x160;LĂ&#x2022;Â&#x2DC;Â&#x17D;Ă&#x160;vii`iĂ&#x20AC;Ă&#x192; UĂ&#x160;­Ă&#x17D;ÂŽĂ&#x160;£ä½Ă&#x160;Â&#x201C;iĂ&#x152;>Â?Ă&#x160;vii`Ă&#x160;Ă&#x152;Ă&#x20AC;Â&#x153;Ă&#x2022;}Â&#x2026;Ă&#x192; UĂ&#x160;­{ÂŽĂ&#x160;Ă&#x201C;n½Ă&#x160;,>Â&#x2DC;VÂ&#x2026;iĂ&#x20AC;Ă&#x192;Ă&#x160;7iÂ?`Â&#x2C6;Â&#x2DC;}Ă&#x160;LĂ&#x2022;Â&#x2DC;Â&#x17D;Ă&#x160;Â?Â&#x2C6;Â&#x2DC;iĂ&#x160;vii`iĂ&#x20AC;Ă&#x192; UĂ&#x160;­Ă&#x201C;ÂŽĂ&#x160;,Â&#x2C6;Ă&#x152;VÂ&#x2026;Â&#x2C6;iĂ&#x160;ÂŁxäĂ&#x160;Â&#x2026;i>`Ă&#x160;Ă&#x192;Ă&#x152;Â&#x153;VÂ&#x17D;Ă&#x160;Ă&#x153;>Ă&#x152;iĂ&#x20AC;iĂ&#x20AC;Ă&#x192;

UĂ&#x160;Ă&#x201C;x½Ă&#x160;

Ă&#x160;Ă&#x201C;ÂŁxĂ&#x160;`iiÂŤĂ&#x160;Ă&#x152;Â&#x2C6;Â?Â?>}i UĂ&#x160; i}iÂ?Â&#x201C;>Â&#x2DC;Ă&#x160;Ă&#x2C6;Ă&#x160;Ă&#x17E;`Ă&#x160;Â&#x2026;Ă&#x17E;`Ă&#x160;Ă&#x192;VĂ&#x20AC;>ÂŤiĂ&#x20AC; UĂ&#x160; i}iÂ?Â&#x201C;>Â&#x2DC;Ă&#x160;vÂ&#x153;Ă&#x20AC;Â&#x17D;Ă&#x160;Ă&#x152;Ă&#x17E;ÂŤiĂ&#x160;Ă&#x192;Ă&#x152;Â&#x153;Â&#x2DC;iĂ&#x160;ÂŤÂ&#x2C6;VÂ&#x17D;iĂ&#x20AC; UĂ&#x160;­Ă&#x201C;ÂŽĂ&#x160; Ă&#x20AC;Â&#x153;Ă&#x153;Â&#x2DC;Ă&#x160;vÂ&#x153;Ă&#x20AC;Â&#x17D;Ă&#x160;Ă&#x152;Ă&#x17E;ÂŤiĂ&#x160;Ă&#x192;Ă&#x152;Â&#x153;Â&#x2DC;iĂ&#x160;ÂŤÂ&#x2C6;VÂ&#x17D;iĂ&#x20AC;Ă&#x192; UĂ&#x160;Â&#x201C;>Ă&#x20AC;Â&#x17D;iĂ&#x20AC;Ă&#x192;Ă&#x160;vÂ&#x153;Ă&#x20AC;Ă&#x160;Â?iĂ?Â&#x2C6;Â&#x2021; Â&#x153;Â&#x2C6;Â?Ă&#x160;>Â&#x2C6;Ă&#x20AC;Ă&#x192;ii`iĂ&#x20AC; UĂ&#x160;ÂŁÂ&#x2122;½Ă&#x160;iĂ?Ă&#x152;Ă&#x20AC;>Ă&#x160;Â&#x2026;Â&#x2C6;}Â&#x2026;Ă&#x160;>Ă&#x2022;Â?Ă&#x160;Â?Â?Ă&#x160;Ă&#x192;ii`Ă&#x160;EĂ&#x160;viĂ&#x20AC;Ă&#x152;Ă&#x160;Ă&#x152;iÂ&#x2DC;`iĂ&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;Ă&#x20AC;i>Ă&#x20AC;Ă&#x160;`Â&#x2C6;Ă&#x192;VÂ&#x2026;>Ă&#x20AC;}iĂ&#x160;>Ă&#x2022;}iĂ&#x20AC;Ă&#x192; UĂ&#x160;{Ă&#x160;Ă&#x20AC;Â&#x153;Ă&#x153;Ă&#x160; Ă&#x160;{Â&#x2122;{Ă&#x160;VÂ&#x153;Ă&#x20AC;Â&#x2DC;Ă&#x160;ÂŤÂ?>Â&#x2DC;Ă&#x152;iĂ&#x20AC;Ă&#x160;Â&#x153;Â&#x2DC;Ă&#x160;Ă&#x17D;Ă&#x2C6;ÂťĂ&#x160;Ă&#x20AC;Â&#x153;Ă&#x153;Ă&#x192;Ă&#x160;Ă&#x153;Ă&#x2030;viĂ&#x20AC;Ă&#x152;Â&#x2C6;Â?Â&#x2C6;âiĂ&#x20AC;Ă&#x160;>Ă&#x152;Ă&#x152;>VÂ&#x2026;Â&#x201C;iÂ&#x2DC;Ă&#x152;

SEED & TILLAGE EQUIPMENT: UĂ&#x160;ÂŁĂ&#x201C;½Ă&#x160;Ă&#x2022;Ă&#x152;VÂ&#x2026;Ă&#x160;>Ă&#x192;Ă&#x152;iĂ&#x20AC;Ă&#x160;Â&#x153;vvĂ&#x160;Ă&#x192;iĂ&#x152;Ă&#x160;`Â&#x2C6;Ă&#x192;VĂ&#x160;Ă&#x153;Ă&#x2030;Â&#x2DC;Â&#x153;Ă&#x152;VÂ&#x2026;i`Ă&#x160;vĂ&#x20AC;Â&#x153;Â&#x2DC;Ă&#x152;Ă&#x160;>Â&#x2DC;`Ă&#x160;Ă&#x192;Â&#x201C;Â&#x153;Â&#x153;Ă&#x152;Â&#x2026;Ă&#x160;Ă&#x20AC;i>Ă&#x20AC;Ă&#x160;LÂ?>`iĂ&#x192; UĂ&#x160;Ă&#x201C;n½Ă&#x160; >Ă&#x192;iĂ&#x160;Ă&#x2021;Ă&#x201C;ääĂ&#x160;Â&#x2026;Â&#x153;iĂ&#x160;ÂŤĂ&#x20AC;iĂ&#x192;Ă&#x192;Ă&#x160;`Ă&#x20AC;Â&#x2C6;Â?Â?Ă&#x160;Ă&#x153;Ă&#x2030;Ă&#x152;Â&#x153;Â&#x201C;Ă&#x160;iĂ&#x152;Ă&#x160;Â&#x153;ÂŤiÂ&#x2DC;iĂ&#x20AC;Ă&#x192;]Ă&#x160;Ă&#x20AC;Ă&#x2022;LLiĂ&#x20AC;Ă&#x160;ÂŤĂ&#x20AC;iĂ&#x192;Ă&#x192;Ă&#x160;Ă&#x153;Â&#x2026;iiÂ?Ă&#x192;]Ă&#x160;Â&#x201C;>Ă&#x20AC;Â&#x17D;Â&#x2021; iĂ&#x20AC;Ă&#x192;]Ă&#x160;v>VĂ&#x152;Â&#x153;Ă&#x20AC;Ă&#x17E;Ă&#x160;Ă&#x152;Ă&#x20AC;>Â&#x2DC;Ă&#x192;ÂŤÂ&#x153;Ă&#x20AC;Ă&#x152; UĂ&#x160;Ă&#x201C;{½Ă&#x160;

Ă&#x160;vÂ&#x2C6;iÂ?`Ă&#x160;VĂ&#x2022;Â?Ă&#x152; UĂ&#x160;Ă&#x201C;Â&#x2122;½Ă&#x160; Ă&#x2022;Ă&#x192;Â&#x2026;Ă&#x160;Â&#x153;}Ă&#x160;vÂ&#x2C6;iÂ?`Ă&#x160;VĂ&#x2022;Â?Ă&#x152;

RECREATIONAL & LAWN and GARDEN ITEMS: UĂ&#x160;nĂ?nĂ&#x160;Ă&#x20AC;}Â&#x153;Ă&#x160;>Â&#x201C;ÂŤÂ&#x2026;Â&#x2C6;LÂ&#x2C6;Â&#x153;Ă&#x2022;Ă&#x192;Ă&#x160;/6 UĂ&#x160; Ă&#x160;Ă&#x201C;ÂŁ{Ă&#x160;Â?>Ă&#x153;Â&#x2DC;Ă&#x160;Ă&#x152;Ă&#x20AC;>VĂ&#x152;Â&#x153;Ă&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;{nÂťĂ&#x160;Â&#x201C;Â&#x153;Ă&#x153;iĂ&#x20AC;Ă&#x160; `iVÂ&#x17D;]Ă&#x160;Ă&#x192;Â&#x2DC;Â&#x153;Ă&#x153;LÂ?Â&#x153;Ă&#x153;iĂ&#x20AC;

TRAILERS: UĂ&#x160;,>Â&#x2C6;Â&#x2DC;LÂ&#x153;Ă&#x153;Ă&#x160;`Â&#x153;Ă&#x2022;LÂ?iĂ&#x160;Ă&#x153;Â&#x2C6;`iĂ&#x160;Ă&#x192;Â&#x2DC;Â&#x153;Ă&#x153;Â&#x201C;Â&#x153;LÂ&#x2C6;Â?iĂ&#x160;Ă&#x152;Ă&#x20AC;>Â&#x2C6;Â?iĂ&#x20AC; INDUSTRIAL EQUIPMENT: UĂ&#x160; 7Ă&#x160;Ă&#x192;Â&#x2026;Â&#x153;ÂŤĂ&#x160;LĂ&#x2022;Â&#x2C6;Â?Ă&#x152;Ă&#x160; Ă&#x160;LÂ&#x153;Ă?Ă&#x160;LÂ?>`iĂ&#x160;Ă&#x192;VĂ&#x20AC;>ÂŤiĂ&#x20AC; SHOP EQUIPMENT & TOOLS: UĂ&#x160; >}Â?iĂ&#x160;V>Ă&#x192;Ă&#x152;Ă&#x160;Â&#x2C6;Ă&#x20AC;Â&#x153;Â&#x2DC;Ă&#x160;>Â&#x2C6;Ă&#x20AC;Ă&#x160;VÂ&#x153;Â&#x201C;ÂŤĂ&#x20AC;iĂ&#x192;Ă&#x192;Â&#x153;Ă&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;Â&#x2122;Â&#x2026;ÂŤĂ&#x160;Â&#x153;Â&#x2DC;`>Ă&#x160;iÂ&#x2DC;}Â&#x2C6;Â&#x2DC;i Â&#x153;`Â&#x2C6;>Â&#x17D;Ă&#x160;- {äää8-Ă&#x160;iÂ?iVĂ&#x152;Ă&#x20AC;Â&#x2C6;VĂ&#x160;Ă&#x192;Ă&#x152;>Ă&#x20AC;Ă&#x152;Ă&#x160;}iÂ&#x2DC;iĂ&#x20AC;>Ă&#x152;Â&#x153;Ă&#x20AC;Ă&#x160;Ă&#x153;Ă&#x2030;xÂ&#x2026;ÂŤĂ&#x160;Â&#x153;Â&#x2DC;`>Ă&#x160;iÂ&#x2DC;}Â&#x2C6;Â&#x2DC;i

FOR MORE INFO CONTACT OWNER

iÂ?Ă&#x160;-Â&#x201C;Â&#x2C6;Ă&#x152;Â&#x2026;Ă&#x160;Ă&#x201C;ä{Â&#x2021;xĂ&#x17D;{Â&#x2021;Ă&#x2021;Ă&#x2021;nĂ&#x17D; Ă&#x20AC;>Ă&#x192;iĂ&#x20AC;Ă&#x160;Ă&#x2022;VĂ&#x152;Â&#x2C6;Â&#x153;Â&#x2DC;Ă&#x160;-iĂ&#x20AC;Ă&#x203A;Â&#x2C6;ViĂ&#x160; Ă&#x201C;ä{Â&#x2021;Ă&#x2021;Ă&#x201C;Ă&#x2021;Â&#x2021;Ă&#x201C;ää£

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL:office@fraserauction.com Auctioneer: Scott Campbell


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 3

UNRESERVED RETIREMENT FARM AUCTION FOR MAMCHUK FARMS LTD. of FISHER BRANCH, MB

SATURDAY, MAY 26TH 10:00 AM

DIRECTIONS: : From Fisher Branch, MB (Jct # 17 & 233) on # 17 North 4.8 kms (Dept of Highways Yard) turn West 3.8 kms to sale site on South side of road. ORDER OF SALE:Ê10:00 – 12:00 (Tools, Shop Equipment and Misc) 12:00 – 1:00 (Tanks, Bins, Aeration Fans, Grain Dryers, Augers) 1:00 PM (Trucks & Major Equipment) TRACTORS: UÊ£™n™Ê >Ãiʙ£xäÊÊ{Ü`ÊÜÉÎÊÀi“œÌiʅÞ`]Ê£ÓÊë`Ê*ÜÀÊňvÌ]Ê UÊ£™n™Ê >Ãiʙ£xäÊÊ{Ü`ÊÜÉÎÊÀi“œÌiʅÞ`]Ê£ÓÊë`Ê*ÜÀÊňvÌ]Ê

Փ“ˆ˜ÃÊ£äÊi˜}ˆ˜iÊÓnäʅ«]ÊxÓäÉnx,ÎnÊ`Õ>Ã]ÊxÎә…ÀÃÊŜ܈˜}

Փ“ˆ˜ÃÊ£äÊi˜}ˆ˜iÊÓnäʅ«]ÊxÓäÉnx,ÎnÊ`Õ>Ã]ÊxÎә…ÀÃÊ UÊ >ÃiÊÓәäÊÓÜ`ÊÜÉ£n°{‡ÎnÊ`Õ>Ã]ÊΫÌ]ÊÓÊÀi“œÌiʅÞ`]Ê Ã…œÜˆ˜}]ÊÃɘäääÓnÇÎ ÈÓxx…ÀÃÊŜ܈˜}]ÊÃɘnn{ȣΣÊÜÉʈ`ÌiV…Ê-Ü>̅Ê8ʈ}…ÌÊ >ÀÊ UÊ >ÃiÊÓәäÊÓÜ`ÊÜÉ£n°{‡ÎnÊ`Õ>Ã]ÊΫÌ]ÊÓÊÀi“œÌiʅÞ`]Ê Ո`>˜ViÊ-ÞÃÌi“ ÈÓxx…ÀÃÊŜ܈˜}]ÊÃɘnn{ȣΣÊÜÉʈ`ÌiV…Ê-Ü>̅Ê8ʈ}…ÌÊ >ÀÊ UÊ1˜ˆÛiÀÃ>Ê1/ Ê1‡{{xÊ /Ê7 ÊÜÉΫÌ]ÊȘ}iÊÀi“œÌiʅÞ`] Ո`>˜ViÊ-ÞÃÌi“ UʏˆÃÊ …>“iÀÃÊ ÊÜÉÊ iÞʜ՘ÌÊ-ˆVŽiÊœÜiÀÊ­ œÌÊÀ՘˜ˆ˜}® UÊ1˜ˆÛiÀÃ>Ê1/ Ê1‡{{xÊ /Ê7 ÊÜÉΫÌ]ÊȘ}iÊÀi“œÌiʅÞ` UʏˆÃÊ …>“iÀÃÊ ÊÜÉÊ iÞʜ՘ÌÊ-ˆVŽiÊœÜiÀÊ­ œÌÊÀ՘˜ˆ˜}® INDUSTRIAL EQUIPMENT: UʏˆÃÊ …>“iÀÃÊ {ÊÜÉÊœ>`iÀÊ­œ˜iÊÞ`ÊLÕVŽiÌ®Ê >`iÊEÊ INDUSTRIAL EQUIPMENT: -̜˜iÊœÀŽ]Ê-…ÕÌ̏iÊ ÕÌV…]Ê-ÌÀiiÌÊ*>`à UʏˆÃÊ …>“iÀÃÊ {ÊÜÉÊœ>`iÀÊ­œ˜iÊÞ`ÊLÕVŽiÌ®Ê >`iÊEÊ UÊœ“>˜Ê -Ê£ÇxÊ ÊˆÀÊ œ“«ÀiÃÜÀʜ˜Ê-ÉÊ/À>ˆiÀÊÜÉÓÊ -̜˜iÊœÀŽ]Ê-…ÕÌ̏iÊ ÕÌV…]Ê-ÌÀiiÌÊ*>`à -ˆâiÃʜvʅœÃià UÊœ“>˜Ê -Ê£ÇxÊ ÊˆÀÊ œ“«ÀiÃÜÀʜ˜Ê-ÉÊ/À>ˆiÀÊÜÉÓÊ -ˆâiÃʜvʅœÃià COMBINES: UÊ£™™ÇÊ ʙÈääÊÃ«Ê œ“Lˆ˜iÊÜÉ ʙ£{Ê«ˆVŽÕ«]Êvˆ˜iÊVÕÌÊV…œ«‡ COMBINES: iÜÊÎä°x‡ÎÓÊÀˆViÊ̈ÀiÃ]Ê «iÀ]Ê-ÊV…>vvÊëÀi>`iÀ]ʈÀÊœˆÊÈiÛiÃ]Ê UÊ£™™ÇÊ ʙÈääÊÃ«Ê œ“Lˆ˜iÊÜÉ ʙ£{Ê«ˆVŽÕ«]Êvˆ˜iÊVÕÌÊV…œ«‡ œ˜}Ê>Õ}iÀ]ʅœ««iÀÊÌ>À«]Ê£nÇxÊi˜}ʅÀÃÊŜ܈˜}]Ê£{È£ÊÃi«Ê…ÀÃÊ «iÀ]Ê-ÊV…>vvÊëÀi>`iÀ]ʈÀÊœˆÊÈiÛiÃ]Ê iÜÊÎä°x‡ÎÓÊÀˆViÊ̈ÀiÃ]Ê Ã…œÜˆ˜}]Ê>ÀÛiÃÌÀ>VÊœ˜ˆÌœÀÃ]ÊÃɘÈÇäÈnÇ œ˜}Ê>Õ}iÀ]ʅœ««iÀÊÌ>À«]Ê£nÇxÊi˜}ʅÀÃÊŜ܈˜}]Ê£{È£ÊÃi«Ê…ÀÃÊ UÊ£™™ÇÊ ʙÈääÊÃ«Ê œ“Lˆ˜iÊÜÉ ʙ£{Ê«ˆVŽÕ«]Ê-ÊV…>vvÊ Ã…œÜˆ˜}]Ê>ÀÛiÃÌÀ>VÊœ˜ˆÌœÀÃ]ÊÃɘÈÇäÈnÇ Ã«Ài>`iÀ]Ê ÊÃiˆÛiÃ]ÊÎä°x‡ÎÓÊÀˆViÊ̈ÀiÃ]ʏœ˜}Ê>Õ}iÀ]ʅœ««iÀÊ UÊ£™™ÇÊ ʙÈääÊÃ«Ê œ“Lˆ˜iÊÜÉ ʙ£{Ê«ˆVŽÕ«]Ê-ÊV…>vvÊ Ì>À«]Ê>««ÀœÝÊ£ÇääÊi˜}ʅÀÃÊŜ܈˜}]Ê>««ÀœÝÊ£{xäÊÃi«Ê…ÀÃÊ Ã«Ài>`iÀ]Ê ÊÃiˆÛiÃ]ÊÎä°x‡ÎÓÊÀˆViÊ̈ÀiÃ]ʏœ˜}Ê>Õ}iÀ]ʅœ««iÀÊ Ã…œÜˆ˜}]Ê>ÀÛiÃÌÀ>VÊœ˜ˆÌœÀÃ]ÊÃɘÈÇäÎäx Ì>À«]Ê>««ÀœÝÊ£ÇääÊi˜}ʅÀÃÊŜ܈˜}]Ê>««ÀœÝÊ£{xäÊÃi«Ê…ÀÃÊ Ã…œÜˆ˜}]Ê>ÀÛiÃÌÀ>VÊœ˜ˆÌœÀÃ]ÊÃɘÈÇäÎäx HEADERS: UÊÓx½Ê ʙÓxʏiÝÊi>`iÀÊÜÉ«ˆVŽÕ«ÊÀii]ÊÃɘÈx£{ÎÓ HEADERS: UÊÓx½Ê ʙÓxʏiÝÊi>`iÀÊÜÉ«ˆVŽÕ«ÊÀii]ÊÃɘÈx£{ÎÓ MOISTURE TESTERS: UÊ>LÌÀœ˜ˆVÃʙ£™Ê/ÊœˆÃÌÕÀiÊ/iÃÌiÀ MOISTURE TESTERS: UÊ*œÀÌ>LiÊœˆÃÌÕÀiÊ/iÃÌiÀ UÊ>LÌÀœ˜ˆVÃʙ£™Ê/ÊœˆÃÌÕÀiÊ/iÃÌiÀ UÊ*œÀÌ>LiÊœˆÃÌÕÀiÊ/iÃÌiÀ SWATHER: UÊÓää{Ê>V œ˜Ê>ÀÛiÃÌÊ*ÀœÊn£xӈÊ`ÏÊëÊÃÜ>̅iÀÊÜÉÓx½Ê SWATHER: >V œ˜Ê™ÇÓÊi>`iÀ]Ê«ˆVŽÕ«ÊÀii]Ê`LÊÃÜ>̅]ÊȘ}iʎ˜ˆviÊ`ÀˆÛi]Ê UÊÓää{Ê>V œ˜Ê>ÀÛiÃÌÊ*ÀœÊn£xӈÊ`ÏÊëÊÃÜ>̅iÀÊÜÉÓx½Ê x£äÊVÕÌ̈˜}ʅÀÃÊŜ܈˜}]ÊÈxÈÊi˜}ʅÀÃÊŜ܈˜}]Ê­£änʅ«ÊÃÕâÕÊ >V œ˜Ê™ÇÓÊi>`iÀ]Ê«ˆVŽÕ«ÊÀii]Ê`LÊÃÜ>̅]ÊȘ}iʎ˜ˆviÊ`ÀˆÛi]Ê /ÕÀLœÊi˜}ˆ˜i®ÊÃɘ£x™ä£Î x£äÊVÕÌ̈˜}ʅÀÃÊŜ܈˜}]ÊÈxÈÊi˜}ʅÀÃÊŜ܈˜}]Ê­£änʅ«ÊÃÕâÕÊ UÊn½Ê*œÞÊ-Ü>̅Ê,œiÀ /ÕÀLœÊi˜}ˆ˜i®ÊÃɘ£x™ä£Î UÊn½Ê*œÞÊ-Ü>̅Ê,œiÀ SPRAYERS: UÊÓääxÊ >ÃiÊ- 8ÊÎΣäÊ-*Ê-«À>ÞiÀÊÜəä½Ê œœ“Ã]ÊxÊLœ`ÞÊ SPRAYERS: ˜œââiÃ]ʈÀÊ ÕLLiÊiÌʘœââiÃ]Ê£äääÊ}>Ê-É-ÊÌ>˜Ž]ÊV…i“ˆV>Ê UÊÓääxÊ >ÃiÊ- 8ÊÎΣäÊ-*Ê-«À>ÞiÀÊÜəä½Ê œœ“Ã]ÊxÊLœ`ÞÊ ˆ˜`ÕV̜À]ÊλÊvˆÊÛ>ÛiÃ]ÊÓääÊ«Êi˜}ˆ˜iÊ­ Փ“ˆ˜Ã®]Ê/Àˆ“LiÊ ˜œââiÃ]ʈÀÊ ÕLLiÊiÌʘœââiÃ]Ê£äääÊ}>Ê-É-ÊÌ>˜Ž]ÊV…i“ˆV>Ê >Õ̜ÊÃÌiiÀÊÃÞÃÌi“]Êvœ>“Ê“>ÀŽiÀÃ]ÊëÀ>ÞÊÌiÃÌÊÃÞÃÌi“]ʙ™ÈÊ ˆ˜`ÕV̜À]ÊλÊvˆÊÛ>ÛiÃ]ÊÓääÊ«Êi˜}ˆ˜iÊ­ Փ“ˆ˜Ã®]Ê/Àˆ“LiÊ …ÀÃÊŜ܈˜}]Ê- -Ê{ÈääÊœ˜ˆÌœÀÊ*Ž}]ÊÃiÃÊ܈̅ÊÓÊÃiÌÃʜvÊ̈ÀiÃÊ >Õ̜ÊÃÌiiÀÊÃÞÃÌi“]Êvœ>“Ê“>ÀŽiÀÃ]ÊëÀ>ÞÊÌiÃÌÊÃÞÃÌi“]ʙ™ÈÊ EÊÀˆ“Ã]Ê­ÈxäÉÈx,ÎnÊ̈ÀiÃÊEÊÀˆ“ÃÊ­œœ`Ê9i>ÀÊ /Ên£n®ÊEÊ …ÀÃÊŜ܈˜}]Ê- -Ê{ÈääÊœ˜ˆÌœÀÊ*Ž}]ÊÃiÃÊ܈̅ÊÓÊÃiÌÃʜvÊ̈ÀiÃÊ ­ÎÓäəä,{ÈÊ̈ÀiÃÊEÊÀˆ“ÃÊ­œœ`Ê9i>ÀÊ /nää®]ÊÃɘäääÇxÎä EÊÀˆ“Ã]Ê­ÈxäÉÈx,ÎnÊ̈ÀiÃÊEÊÀˆ“ÃÊ­œœ`Ê9i>ÀÊ /Ên£n®ÊEÊ UÊxä½ÊiÀœiÊ££xÊ-«À>ÞÊ œÕ«iÊÜÉ£xäÊ}>Ê«œÞÊÌ>˜Ž]ÊxÇäʅÀÃÊ ­ÎÓäəä,{ÈÊ̈ÀiÃÊEÊÀˆ“ÃÊ­œœ`Ê9i>ÀÊ /nää®]ÊÃɘäääÇxÎä Ŝ܈˜}]ÊÃɘ££x££nx‡Ç™ UÊxä½ÊiÀœiÊ££xÊ-«À>ÞÊ œÕ«iÊÜÉ£xäÊ}>Ê«œÞÊÌ>˜Ž]ÊxÇäʅÀÃÊ UÊÈn½Ê6iÀÃ>̈iÊ{näÊ«ÌÊ-«À>ÞiÀÊÜÉxääÊ}>Ê*œÞÊ/>˜Ž]Ê*/"Ê*Փ« Ŝ܈˜}]ÊÃɘ££x££nx‡Ç™ UÊÈn½Ê6iÀÃ>̈iÊ{näÊ«ÌÊ-«À>ÞiÀÊÜÉxääÊ}>Ê*œÞÊ/>˜Ž]Ê*/"Ê*Փ« SEED & TILLAGE EQUIPMENT: UÊ£{½Ê Ê£È{äÊ/>˜`i“Ê ˆÃŽ SEED & TILLAGE EQUIPMENT: UʣǽÊ>Տ‡Ê-ii`ÊEÊiÀÌÊ/i˜`iÀ UÊ£{½Ê Ê£È{äÊ/>˜`i“Ê ˆÃŽ UÊÓä½Ê ʙÎxäÊ É Ê*ÀiÃÃÊ ÀˆÊÜÉ,ÕLLiÀÊ*>VŽiÀÃ]Ê/>À«ÃÊ UʣǽÊ>Տ‡Ê-ii`ÊEÊiÀÌÊ/i˜`iÀ ­Ü>ÞÃÊ-…i``i`® UÊÓä½Ê ʙÎxäÊ É Ê*ÀiÃÃÊ ÀˆÊÜÉ,ÕLLiÀÊ*>VŽiÀÃ]Ê/>À«ÃÊ UÊǽÊÎÊ*/Ê ÕÌ ­Ü>ÞÃÊ-…i``i`® UÊ ÀœÜ˜Ê,œÌ>ÀÞÊ-̜˜iÊ«ˆVŽiÀÊÜÉÞ`Ê ÀˆÛi]ÊÎÊ >ÌÊ,ii UÊǽÊÎÊ*/Ê ÕÌ UÊÓä½ÊÎÊL>ÀÊ>ÀÀœÜÃÊ­7iÃÌvˆi`Ê>Àœ‡ˆ˜}® UÊ ÀœÜ˜Ê,œÌ>ÀÞÊ-̜˜iÊ«ˆVŽiÀÊÜÉÞ`Ê ÀˆÛi]ÊÎÊ >ÌÊ,ii UÊÓääxÊÇä½Ê œÕÀ}>ՏÌÊÈäääʈ`‡>ÀÀœÜÊÜÉÇɣȻÊÝÊÓä»Ê/ˆ˜ià UÊÓä½ÊÎÊL>ÀÊ>ÀÀœÜÃÊ­7iÃÌvˆi`Ê>Àœ‡ˆ˜}® UÊ{ä½Ê Ê£äääʈi`Ê ÕÌÊÜÉÎÊL>ÀÊ>ÀÀœÜÃ]ÊÃɘää{xn{ UÊÓääxÊÇä½Ê œÕÀ}>ՏÌÊÈäääʈ`‡>ÀÀœÜÊÜÉÇɣȻÊÝÊÓä»Ê/ˆ˜ià UÊ{ä½ÊÊÈ{xÊ/ˆ>}iÊÜÉÎÊL>ÀÊ>ÀÀœÜà UÊ{ä½Ê Ê£äääʈi`Ê ÕÌÊÜÉÎÊL>ÀÊ>ÀÀœÜÃ]ÊÃɘää{xn{

UÊΣ½Ê

Óä{Ê ii«Ê/ˆ>}iÊÜÉÎÊL>ÀÊ>ÀÀœÜà UÊ{ä½ÊÊÈ{xÊ/ˆ>}iÊÜÉÎÊL>ÀÊ>ÀÀœÜà UÊÈÊ œÌ̜“ÊnnäÊÎÊ«ÌÊ*œÜÊÜÉÊÞ`ÊÀiÃiÌÃ]ÊÃɘ£È™{ääÓx™{ UÊΣ½Ê

Óä{Ê ii«Ê/ˆ>}iÊÜÉÎÊL>ÀÊ>ÀÀœÜà UÊnÊ œÌ̜“ÊÊnnäÊ*œÜÊÜÉÊÞ`Ê,iÃiÌÃ]ÊÃɘ£È™{xäÎäÎ{ UÊÈÊ œÌ̜“ÊnnäÊÎÊ«ÌÊ*œÜÊÜÉÊÞ`ÊÀiÃiÌÃ]ÊÃɘ£È™{ääÓx™{ UÊnÊ œÌ̜“ÊÊnnäÊ*œÜÊÜÉÊÞ`Ê,iÃiÌÃ]ÊÃɘ£È™{xäÎäÎ{ GRAIN DRYER, AUGERS & GRAIN HANDLING EQUIP: GRAIN DRYER, AUGERS & GRAIN UÊ Ê£Ó£äÊ œ˜Ìˆ˜ÕœÕÃʏœÜÊxÊ-iV̈œ˜Ê*Àœ«>˜iʜÀÊ >ÌÕÀ>Ê HANDLING EQUIP: >ÃÊÀ>ˆ˜Ê ÀÞiÀ]Ê£Ê*]Ê{ʈˆœ˜Ê /1Ê>Ý]Êä°xʈˆœ˜Ê /1Ê UÊ Ê£Ó£äÊ œ˜Ìˆ˜ÕœÕÃʏœÜÊxÊ-iV̈œ˜Ê*Àœ«>˜iʜÀÊ >ÌÕÀ>Ê ˆ˜ˆ“Õ“]Ê-iÃÊÜÉÊ£ä½ÊÝÊ£Ó½Ê ÀÞiÀÊ-…>VŽÊ̅>ÌʅœÕÃiÃÊ>Ê >ÃÊÀ>ˆ˜Ê ÀÞiÀ]Ê£Ê*]Ê{ʈˆœ˜Ê /1Ê>Ý]Êä°xʈˆœ˜Ê /1Ê iiVÌÀˆV>ÊEÊ œ˜ÌÀœÊ«>˜iÃ ˆ˜ˆ“Õ“]Ê-iÃÊÜÉÊ£ä½ÊÝÊ£Ó½Ê ÀÞiÀÊ-…>VŽÊ̅>ÌʅœÕÃiÃÊ>Ê UÊ£ä»ÊÝÊÈä½Ê>À“ʈ˜}Ê*/"Ê-܈˜}Êœ««iÀÊÕ}iÀÊÜÉ iÜÊ}i>ÀÊ iiVÌÀˆV>ÊEÊ œ˜ÌÀœÊ«>˜iÃ LœÝiÃ]Ê iÛiÀÊ눏ÊëœÕÌÊÃɘ™£äÎÓä{ UÊ£ä»ÊÝÊÈä½Ê>À“ʈ˜}Ê*/"Ê-܈˜}Êœ««iÀÊÕ}iÀÊÜÉ iÜÊ}i>ÀÊ UÊÓääÈÊn»ÊÝÊ{È½Ê Õ…iÀÉ>À“ʈ˜}ÊÕ}iÀÊÜÉ-ivÊ*Àœ«iÊˆÌ]Ê LœÝiÃ]Ê iÛiÀÊ눏ÊëœÕÌÊÃɘ™£äÎÓä{ Ó{Ê*Êœ˜`>Ê ˜} UÊÓääÈÊn»ÊÝÊ{È½Ê Õ…iÀÉ>À“ʈ˜}ÊÕ}iÀÊÜÉ-ivÊ*Àœ«iÊˆÌ]Ê UʭήÊÈ»Ê7iÃÌvˆi`ÊÕ}iÀÃÊÜÉÊΰxÊqÊx…«Ê iVÌÀˆVʜ̜ÀÃ]Ê Ó{Ê*Êœ˜`>Ê ˜} 6>ÀˆœÕÃÊi˜}̅à UʭήÊÈ»Ê7iÃÌvˆi`ÊÕ}iÀÃÊÜÉÊΰxÊqÊx…«Ê iVÌÀˆVʜ̜ÀÃ]Ê UÊÈ»ÊÕ}iÀÊÜÉ££…«Ê E-Ê ˜}ˆ˜i 6>ÀˆœÕÃÊi˜}̅à UÊ««ÀœÝÊ£ää½Ê1‡/ÀœÕ}…ÊÀ>ˆ˜Ê>˜`ˆ˜}Ê-ÞÃÌi“ÊÜÉÊÇÊ`Àœ«ÃÊ UÊÈ»ÊÕ}iÀÊÜÉ££…«Ê E-Ê ˜}ˆ˜i ÜÉÊxÊ*]Ê£Ê«Ê iVÌÀˆVʜ̜À UÊ««ÀœÝÊ£ää½Ê1‡/ÀœÕ}…ÊÀ>ˆ˜Ê>˜`ˆ˜}Ê-ÞÃÌi“ÊÜÉÊÇÊ`Àœ«ÃÊ UʭȮʣȽÊ-iV̈œ˜ÃʜvÊ >ÌÊ7>Žˆ˜} ÜÉÊxÊ*]Ê£Ê«Ê iVÌÀˆVʜ̜À UʭȮʣȽÊ-iV̈œ˜ÃʜvÊ >ÌÊ7>Žˆ˜} TRUCKS: UÊ£™näÊœÀ`ÊnääÊ/ÉÊÀ>ˆ˜Ê/ÀÕVŽÊÜÉ£n½Ê ³]ÊÀœÊÌ>À«]ÊxÊ TRUCKS: ³Ê{Ê/À>˜ÃÊ­Ê,iLՈ`Ê-iVœ˜`>ÀÞÊ/À>˜ÃÊÓÊ9i>ÀÃÊ}œ®]Ê{әÊ>ÃÊ UÊ£™näÊœÀ`ÊnääÊ/ÉÊÀ>ˆ˜Ê/ÀÕVŽÊÜÉ£n½Ê ³]ÊÀœÊÌ>À«]ÊxÊ³Ê ˜}]ÊÎÈ]ÓÎΎ“ÃÊŜ܈˜}]Ê£ä°ää‡ÓäÊ,ÕLLiÀ]Ê- / ]ÊÃÉ {Ê/À>˜ÃÊ­Ê,iLՈ`Ê-iVœ˜`>ÀÞÊ/À>˜ÃÊÓÊ9i>ÀÃÊ}œ®]Ê{әÊ>ÃÊ ˜}]Ê ˜xn£6nää™ ÎÈ]ÓÎΎ“ÃÊŜ܈˜}]Ê£ä°ää‡ÓäÊ,ÕLLiÀ]Ê- /

UÊ£™Ç™Ê>VŽÊ,-ÇääÊ/ÉÊÀ>ˆ˜Ê/ÀÕVŽÊÜÉÓä½Ê ³]Ê,œÊ/>À«]Ê™Ê -«`ÊՏiÀÊ/À>˜Ã]ÊΣxÊ*Ê>VŽÊ ˜}]Ê£Ç{]ÇxäʈiÃÊŜ܈˜}]Ê ÓÓ°xÊ,ÕLLiÀ]ÊÃɘ,xÇ£Ó-/ÎÇ{ș]Ê-/

UÊ£™nÈÊ …iÛÊ7À>˜}iÀÊ£ÉÓÊ̜˜ÊÓÜ`ÊÜəÓ]{ÎnʜÀ}Ê“ÃÊ -…œÜˆ˜}]Ê-/ ]ÊÃɘÓ/ £{Σx䙙nÎ UÊ£™näÊ …iÛÊÇäÊ-ÉÊÜÉÓxääÊ}>Ê«œÞÊÜ>ÌiÀÊÌ>˜Ž]ʣȽʏ>ÌÊ

iVŽ]ÊÓ»Ê …i“Ê>˜`iÀÊÊV…i“ˆV>Ê“ˆÝÊÃÞÃÌi“]ÊÎÈÈÊ}>ÃÊi˜}]Ê x³ÓÊ/À>˜Ã]Ê iÜÊÓ»Ê7>ÌiÀÊ*Փ«]ÊÈ£ä{£Ž“ÃÊŜ܈˜} iÜÊÓ»Ê7>ÌiÀÊ*Փ«]ÊÈ£ä{£Ž“ÃÊŜ܈˜}]Ê UÊ£™ÈÎÊ …iÛÊÈäÊ-ÉÊÜÉ£{½Ê ³]ÊÀœÊÌ>À«]ÊәÓÊ>ÃÊ ˜}]Êx³ÓÊ /À>˜Ã]ÊÎxn£ÈʈiÃÊ-…œÜˆ˜}]ÊÃɘΠÈÎäÎÈäÇÇÇÓ UÊ£™™{Ê Ê- ÊÎÉ{Ê/œ˜Ê{ÊÝÊ{Ê ÝÌÊ >LÊÜÉÈ°xʏˆÌiÀÊ`Ï]ÊÕÌœÊ /À>˜Ã]Ê œÝÊ >«]ÊÓÓÓ]ÎÓ£Ž“ÃÊ-…œÜˆ˜}]Ê-/

UÊ£™nxÊ Ê6>˜`ÕÀ>ÊÎxääÊ6>˜ÊÜÉ1  Ê,iviÀÊ œ`Þ]Ê ÎÓn]È{Ȏ“ÃÊ-…œÜˆ˜}]Ê,iLՈÌÊÎxäÊi˜}]ÊÕ̜Ê/À>˜Ã]ÊÃɘÓ ‡ ÎÓn]È{Ȏ“ÃÊ-…œÜˆ˜}]Ê,iLՈÌÊÎxäÊi˜}]ÊÕ̜Ê/À>˜Ã Σ™{xäÈ{{™ TRAILERS: TRAILERS: UÊ£{½Ê Ê/ÉÊ*ˆ˜ÌiʈÌV…Ê/ˆÌˆ˜}Ê/À>ˆiÀÊ­>Տi`Ê {Ê À>܏iÀ® UÊ£{½Ê Ê/ÉÊ*ˆ˜ÌiʈÌV…Ê/ˆÌˆ˜}Ê/À>ˆiÀÊ­>Տi`Ê {Ê À>܏iÀ® UÊÓä½Ê/ÉÊ>âÕÀÊ7i`ˆ˜}ʏ>ÌÊ iVŽÊ/À>ˆiÀÊÜÉÎxääʏLÃÊݏià UÊÓä½Ê/ÉÊ>âÕÀÊ7i`ˆ˜}ʏ>ÌÊ iVŽÊ/À>ˆiÀÊÜÉÎxääʏLÃÊݏià UÊxνÊ/ÉÊ-̜À>}iÊ/À>ˆiÀÊ­ "Ê/" ® UÊxνÊ/ÉÊ-̜À>}iÊ/À>ˆiÀÊ­ UÊ{n½Ê/ÉÊ-̜À>}iÊ/À>ˆiÀÊ­ "Ê/" ® UÊ{n½Ê/ÉÊ-̜À>}iÊ/À>ˆiÀÊ­ "Ê/" ® 3PT EQUIPMENT: 3PT EQUIPMENT: UÊn½Êˆi`ÊΫÌÊ LÊÕ}iÀÊ-˜œÜÊ œÜiÀÊÃɘ™Èän™™Ç UÊn½Êˆi`ÊΫÌÊ LÊÕ}iÀÊ-˜œÜÊ œÜiÀÊÃɘ™Èän™™Ç UÊx½Ê ՅiÀÉ>À“ʈ˜}Êx£äÊ,œÌ>ÀÞÊœÜiÀÊÃɘÓÇ£ääx{£ UÊx½Ê ՅiÀÉ>À“ʈ˜}Êx£äÊ,œÌ>ÀÞÊœÜiÀÊÃɘÓÇ£ääx{£ UÊΫÌÊ >iÊœÀŽÊUÊΫÌÊ i“i˜ÌʈÝiÀÊUÊΫÌÊ/À>VŽÊ À>ÃiÀà UÊΫÌÊ >iÊœÀŽÊUÊΫÌÊ i“i˜ÌʈÝiÀÊUÊΫÌÊ/À>VŽÊ À>ÃiÀà GRAIN BINS:Ê­ œ˜iʜvÊ̅iÊLˆ˜Ãʅ>ÛiÊiÛiÀÊLii˜ÊÕÃi`Ê GRAIN vœÀÊviÀ̈ˆâiÀ°®BINS:Ê­ œ˜iʜvÊ̅iÊLˆ˜Ãʅ>ÛiÊiÛiÀÊLii˜ÊÕÃi`Ê vœÀÊviÀ̈ˆâiÀ°® UÊ­Ó®Ê{äääÊ 1-ÊÀ>ˆ˜Ê>ÝÊœ««iÀÊ œÌ̜“Ê ˆ˜ÃÊÜÉȽÊiÀ>̈œ˜Ê UÊ­Ó®Ê{äääÊ 1-ÊÀ>ˆ˜Ê>ÝÊœ««iÀÊ œÌ̜“Ê ˆ˜ÃÊÜÉȽÊiÀ>̈œ˜Ê ,œVŽiÌ]Ê «œÝÞÊ œ>Ìi`]Ê/i“«Ê-i˜ÃœÀÊ >Lià ,œVŽiÌ]Ê «œÝÞÊ œ>Ìi`]Ê/i“«Ê-i˜ÃœÀÊ >Lià UÊ­{®ÊÓÓnäÊ 1-ÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Ê ˆ˜ÊÜÉ{ʤ½ÊiÀ>̈œ˜Ê UÊ­{®ÊÓÓnäÊ 1-ÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Ê ˆ˜ÊÜÉ{ʤ½ÊiÀ>̈œ˜Ê ,œVŽiÌ]Ê «œÝÞÊ œ>Ìi`]Ê/i“«Ê-i˜ÃœÀÊ >Lià ,œVŽiÌ]Ê «œÝÞÊ œ>Ìi`]Ê/i“«Ê-i˜ÃœÀÊ >Lià UʭӮʣnääÊ 1-ÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Ê ˆ˜Ã]Ê «œÝÞÊ œ>Ìi` UʭӮʣnääÊ 1-ÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Ê ˆ˜Ã]Ê «œÝÞÊ œ>Ìi` UÊ­x®Ê7iÃÌiiÊ£ÈxäÊ ˆ˜Ãʜ˜Ê ,7ÊÓxäÊ ÕÃÊœ««iÀà UÊ­x®Ê7iÃÌiiÊ£ÈxäÊ ˆ˜Ãʜ˜Ê ,7ÊÓxäÊ ÕÃÊœ««iÀà UÊÎxääÊ 1-Ê6ˆ`ˆÀÊœ««iÀÊ ˆ˜Ã]Ê «œÝÞÊ œ>Ìi` UÊÎxääÊ 1-Ê6ˆ`ˆÀÊœ««iÀÊ ˆ˜Ã]Ê «œÝÞÊ œ>Ìi`

TANKS & PUMPS: UÊ£äääÊ>Ê œÀ̅iÀ˜Ê-ÌiiÊÕiÊ/>˜ŽÊÜÉÊ££äÊ6œÌÊ*Փ«ÊEÊiÌiÀ TANKS & PUMPS: UÊ£äääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜` UÊ£äääÊ>Ê œÀ̅iÀ˜Ê-ÌiiÊÕiÊ/>˜ŽÊÜÉÊ££äÊ6œÌÊ*Փ«ÊEÊiÌiÀ UÊ­Ó®ÊÎääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜`à UÊ£äääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜` UÊxääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜` UÊ­Ó®ÊÎääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜`à UÊ£ÓxäÊ>Ê*œÞÊ7>ÌiÀÊ/>˜Ž UÊxääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜` UÊ£äääÊ>ÊiÌ>Ê7>ÌiÀÊ/>˜Ž UÊ£ÓxäÊ>Ê*œÞÊ7>ÌiÀÊ/>˜Ž UÊÕÝÊvÕiÊ-Žˆ`Ê/>˜ŽÊÜÉÊ£ÓÊۜÌʫՓ«ÊEÊÃ̜À>}iÊVœ“«>À̓i˜Ìà UÊ£äääÊ>ÊiÌ>Ê7>ÌiÀÊ/>˜Ž UÊ iÜÊ££äÊۜÌÊÕiÊ*Փ«ÊUÊȻʏœ>̈˜}Ê-œÕ}…Ê*Փ« UÊÕÝÊvÕiÊ-Žˆ`Ê/>˜ŽÊÜÉÊ£ÓÊۜÌʫՓ«ÊEÊÃ̜À>}iÊVœ“«>À̓i˜Ìà UÊÓ»ÊxÊ*Êœ˜`>Ê7>ÌiÀÊ*Փ«ÊUÊ ÕV>ÀÊÓ»Ê7>ÌiÀÊ*Փ« UÊ iÜÊ££äÊۜÌÊÕiÊ*Փ«ÊUÊȻʏœ>̈˜}Ê-œÕ}…Ê*Փ« UÊ ÊEÊ-ÊÓ»Ê7>ÌiÀÊ*Փ«ÊÜÉÊx…«Êi˜} UÊÓ»ÊxÊ*Êœ˜`>Ê7>ÌiÀÊ*Փ«ÊUÊ ÕV>ÀÊÓ»Ê7>ÌiÀÊ*Փ« UÊ ÊEÊ-ÊÓ»Ê7>ÌiÀÊ*Փ«ÊÜÉÊx…«Êi˜} OTHER FARM EQUIPMENT: UÊ Ê{xÈÊǽÊ-ˆVŽiÊ >ÀÊœÜiÀ]ÊÃɘәxx™x OTHER FARM EQUIPMENT: UÊ{Ê7…iiÊ>À“Ê7>}œ˜ÊUÊ­x®Ê ˆ˜ÊiÛiÊ˜`ˆV>̜Àà UÊ Ê{xÈÊǽÊ-ˆVŽiÊ >ÀÊœÜiÀ]ÊÃɘәxx™x UÊ-Ü>̅iÀÊ >ÀÀˆiÀÊÜÉÊ7>Žˆ˜}Ê i>“Êݏià UÊ{Ê7…iiÊ>À“Ê7>}œ˜ UÊÓ{½Ê ÀˆÊ >ÀÀˆiÀÊ­ iÜiÀÊ-Ìޏi® UÊ­x®Ê ˆ˜ÊiÛiÊ˜`ˆV>̜Àà Uʘ̅iÃÊÀ>ۈÌÞÊ œÝʜ˜Ê{Ê7…iiÊ7>}œ˜ UÊ-Ü>̅iÀÊ >ÀÀˆiÀÊÜÉÊ7>Žˆ˜}Ê i>“Êݏià UÊ­n®ÊÊ,>`ˆœÃÊ­*Àœ}À>““>LiÊ-Ìޏi®Ê£Ê >ÃiÊ-Ì>̈œ˜ UÊÓ{½Ê ÀˆÊ >ÀÀˆiÀÊ­ iÜiÀÊ-Ìޏi® Uʘ̅iÃÊÀ>ۈÌÞÊ œÝʜ˜Ê{Ê7…iiÊ7>}œ˜ RECREATIONAL & YARD UÊ­n®ÊÊ,>`ˆœÃÊ­*Àœ}À>““>LiÊ-Ìޏi®Ê£Ê >ÃiÊ-Ì>̈œ˜ EQUIPMENT: UÊÃÜÀÌi`Ê9>À`Ê/œœÃÊ­-…œÛiÃ]ÊœÀŽÃ]Ê,>ŽiÃ]ÊiÌV°® RECREATIONAL & YARD UÊ+Õ>`Ê,>“«ÃÊvœÀÊ/ÀÕVŽ EQUIPMENT: UÊ7œœ`Ê-«ˆÌÌiÀʇÊ/À>ˆiÀÊ/Þ«i UÊÃÜÀÌi`Ê9>À`Ê/œœÃÊ­-…œÛiÃ]ÊœÀŽÃ]Ê,>ŽiÃ]ÊiÌV°® UÊ{n»Ê-Üii«‡Ê Ó{{nÊ*œÜiÀÊ>ܘÊ-Üii«iÀÊÜÉx°xÊ*Ê>ÃÊ UÊ+Õ>`Ê,>“«ÃÊvœÀÊ/ÀÕVŽ ˜}ˆ˜i UÊ7œœ`Ê-«ˆÌÌiÀʇÊ/À>ˆiÀÊ/Þ«i UÊ{½Ê Ê£xÊ/6Ê >ÀÌÊÜÉ>˜Õ>Ê Փ« UÊ{n»Ê-Üii«‡Ê Ó{{nÊ*œÜiÀÊ>ܘÊ-Üii«iÀÊÜÉx°xÊ*Ê>ÃÊ ˜}ˆ˜i UÊ*œ>ÀˆÃÊ/8Î{äÊ-˜œÜ“œLˆi]Ê£™Çn UÊ{½Ê Ê£xÊ/6Ê >ÀÌÊÜÉ>˜Õ>Ê Փ« UÊ œi“>˜ÊxxääÊi˜iÀ>̜À UÊ*œ>ÀˆÃÊ/8Î{äÊ-˜œÜ“œLˆi]Ê£™Çn UÊ œi“>˜ÊxxääÊi˜iÀ>̜À SHOP EQUIPMENT, TOOLS & MISC: EQUIPMENT, TOOLS & SHOP UÊx°xÊ*Êœ˜`>Ê*ÀiÃÃÕÀiÊ7>ÅiÀÊUÊÕ>À`ˆ>˜Ê£ÈÊ-«`Ê ÀˆÊ*ÀiÃà MISC: Uʈ˜Vœ˜Ê ÊÓÓxÊÀVÊ7i`iÀÊUÊÊiÌ>Ê ÕÌ̈˜}Ê >˜`ÊÃ>Ü UÊx°xÊ*Êœ˜`>Ê*ÀiÃÃÕÀiÊ7>ÅiÀÊUÊÕ>À`ˆ>˜Ê£ÈÊ-«`Ê ÀˆÊ*ÀiÃà UÊ-œ>ÀÊÈÇäÊ >ÌÌiÀÞÊ …>À}iÀÉ œœÃÌiÀ Uʈ˜Vœ˜Ê ÊÓÓxÊÀVÊ7i`iÀÊÊUÊ1Ãi`Ê/ˆÀiÃÊ­/ÀÕVŽÊEÊ“«® UÊ >ÀŽiÊ£ä£ ÊÀVÊ7i`iÀÊUʈ˜Vœ˜ÊˆÀÊÀi>ÃiÀ UÊ-œ>ÀÊÈÇäÊ >ÌÌiÀÞÊ …>À}iÀÉ œœÃÌiÀÊ UÊ œÀ`iÃÃÊ/œœÃÊUÊÓ{½Ê ÝÌi˜Ãˆœ˜Ê>``iÀ UÊÊiÌ>Ê ÕÌ̈˜}Ê >˜`ÊÃ>ÜÊUÊ >ÀŽiÊ£ä£ ÊÀVÊ7i`iÀ UÊn½Ê-Ìi«Ê>``iÀÊUÊ/œÜÊ >LiÃÊEÊ …>ˆ˜Ã Uʈ˜Vœ˜ÊˆÀÊÀi>ÃiÀÊUÊ œÀ`iÃÃÊ/œœÃ UÊ >ÀÀiÊ*Փ«ÃÊUÊ-“>Ê˜ÛˆÊUÊ1Ãi`Ê/ˆÀiÃÊ­/ÀÕVŽÊEÊ“«® UÊÓ{½Ê ÝÌi˜Ãˆœ˜Ê>``iÀÊUÊn½Ê-Ìi«Ê>``iÀ UÊ Ê7i`ˆ˜}Ê i˜V…ÊÜÉ6ˆÃiÊUʏ>ÌÊÜÀi˜V…iÃÊÕ«Ê̜ÊÓ» UÊ/œÜÊ >LiÃÊEÊ …>ˆ˜ÃÊUÊ >ÀÀiÊ*Փ«Ã UÊ>““iÀÃÊUÊ*ˆ«iÊ7Ài˜V…iÃÊ UÊ-“>Ê˜ÛˆÊUÊ Ê7i`ˆ˜}Ê i˜V…ÊÜÉ6ˆÃi UÊÃÜÀ̓i˜ÌʜvÊv>À“ÊÀi>Ìi`Ê̜œÃÊUÊ*œÀÌ>LiʈÀÊ œ“«ÀiÃÜÀ Uʏ>ÌÊÜÀi˜V…iÃÊÕ«Ê̜ÊÓ»ÊUÊ>““iÀÃÊUÊ*ˆ«iÊ7Ài˜V…ià UʈÀʅœÃiÊÀiiÊÜÉÊÀÕLLiÀʅœÃiÊUÊ"ÝÞÉVVÌÊ/œÀV…ÊˆÌ UÊÃÜÀ̓i˜ÌʜvÊv>À“ÊÀi>Ìi`Ê̜œÃÊUÊ*œÀÌ>LiʈÀÊ œ“«ÀiÃÜÀ UÊÀˆ˜`iÀÃ]Ê ÀˆÃ]Ê->ÜÃ]Ê ÌV°ÊUÊ*ՏiÀÃÊUÊi>ÃÕÀˆ˜}Ê7…iiÃ UʈÀʅœÃiÊÀiiÊÜÉÊÀÕLLiÀʅœÃiÊUÊ"ÝÞÉVVÌÊ/œÀV…ÊˆÌ UÊÓäÊ/œ˜ÊˆÀÉÞ`Ê œÌ̏iÊ>VŽÊUÊÈÉ£äÉÓäÊ/œ˜Ê œÌ̏iÊ>VŽÃ UÊÀˆ˜`iÀÃ]Ê ÀˆÃ]Ê->ÜÃ]Ê ÌV°ÊUÊ*ՏiÀÃÊUÊi>ÃÕÀˆ˜}Ê7…iiÃ UÊ Ê œ“iÌÊ i˜V…ÊÀˆ˜`iÀÊUÊ1Ãi`Ê܈˜`œÜà UÊÓäÊ/œ˜ÊˆÀÉÞ`Ê œÌ̏iÊ>VŽÊUÊÈÉ£äÉÓäÊ/œ˜Ê œÌ̏iÊ>VŽÃ UÊ Ê œ“iÌÊ i˜V…ÊÀˆ˜`iÀÊUÊ1Ãi`Ê܈˜`œÜà MISC. LEAF CUTTER BEE EQUIPMENT: MISC. LEAF CUTTER BEE UÊ*i>ÃiÊV>Ê ˆÊvœÀʈ˜vœÀ“>̈œ˜]Ê>Û>ˆ>LˆˆÌÞÊ>˜`Ê`iÌ>ˆÃÊ>LœÕÌÊ EQUIPMENT: i>vÊVÕÌÌiÀÊLiiÊiµÕˆ«“i˜Ì° UÊ*i>ÃiÊV>Ê ˆÊvœÀʈ˜vœÀ“>̈œ˜]Ê>Û>ˆ>LˆˆÌÞÊ>˜`Ê`iÌ>ˆÃÊ>LœÕÌÊ i>vÊVÕÌÌiÀÊLiiÊiµÕˆ«“i˜Ì

FOR MORE INFO CONTACT OWNER

Ê ˆÊ>“V…ÕŽÊ Óä{‡ÇΙ‡ÈΣx

CONDITIONSÊ\Ê ÕÞiÀÃʅ>Ûiʣʓœ˜Ì…Ê̜ÊÀi“œÛiÊʈÌi“ÃÊvÀœ“ÊÃ>iÊÈÌi°Ê­ ˆ˜Ãʈ˜VÕ`i`® Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed Licensed and and bonded. bonded. P.L. P.L. License License #918093. #918093. Member Member of of M.A.A., M.A.A., S.A.A., S.A.A., A.A.A., A.A.A., A.A.C. A.A.C.

PHONE: PHONE: (204) (204) 727-2001 727-2001 FAX: FAX: (204) (204) 729-9912 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com www.fraserauction.com EMAIL: fauction@mts.net Auctioneer: Scott Campbell Auctioneer: Scott Campbell - Warren Wright

2012


PAGE 4

Saskatchewan FarmLIFE, Monday, March 19, 2012

- Honey Bee 36’ w/split p/u reel, hyd fore/aft, factory transport, 20’ pea auger, IHC adapter s/n 436000611. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $24,500 - 222 JD w/PU reel, s/n 324956. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,950 - 224 JD w/batt reel, decent cond, s/n 483771 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,250 - 320 Gleaner Flex hdr w/p/u reel to fit N & R series, s/n 19350 . . . . . . . . . . . . . . . . . . . . . $4,000 - 327 Gleaner -Batt reel with hyd kit -fits N-R series combines. . . . . . . . . . . . . . . . . . . . . . $5,500 - 810 IH, 22.5’ p/u reel, skid plates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 - 1010 IH 22.5’ w/pu reel, w/hyd fore/aft, s/nJJC0076143 . . . . . . . . . . . . . . . . . . . . . . . . . . $6,950 - 1010 IH 30’ w/batt reel, very nice header, s/n JJC0078368 . . . . . . . . . . . . . . . . . . . . . . . . $7,450 - 1010 IH 30’ w/batt reel, very nice header, s/n JJC0126766 . . . . . . . . . . . . . . . . . . . . . . . . $7,950 - 1020 IH 25’ w/pu reel, s/n JJC0093747 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,950

SEVERAL MACDON HEADER ADAPTERS TO FIT MANY MAKES & MODELS - 1859 MF 20’ w/p/u reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,750 - 9024 MF 22’ w/p/u reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,950 - 9024 MF, Batt reel, Floor & Auger mint . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 - 9230 MF 30’ w/batt reel, very low acres, fits 8600-9720, 8560, 8570, 8780, 8590, s/n H000033 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $9,500 - 9230 MF, Batt reel,fits 8600-9720,8560,8570,8780,8590 . . . . . . . . . . . . . . . . . . . . . . . . . $7,500 - 9550 Claas, 20’ flex hdr w/p/u reel, crop lifters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 - 6022 Claas 22’ stripper . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 - 971 NH, 24’, batt reel, s/n 518631 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,950 - 971 NH 25’ w/pu reel, s/n 576126 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,950 - 971 NH, 30’, Rigid w/p/u reel with hyd fore/aft . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,500 - AC LM, 24’ w/batt reel, will fit L,M series combine, S/N LM2461862 . . . . . . . . . . . . . . . . . $4,000 - AC LM, 20’, w/batt reel, will fit L,M series combines. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,750 - AC LM, 18’, w/batt reel (excellent), fits M, L3SOLD Gleaner . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,500

DIESEL ENGINE OVERHAUL KITS IN STOCK!!! Most John Deere, B & C Cummins, & Perkins Ag Applications available! Visit www.gcparts.com for kit pricing and details!

Grouser 11’ industrial paralift blade, fits many steigers (off CM325) . . . . . . . . . . . $10,500 Leon 13’, 4 way, excellent condition, very little use, 39” frame mount, off PT250 . $12,500 Leon 12' 2 way, mnts to fit 700-950 Vers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Leon 11’ 2 way, has snow & ice cutting edge, mnts to fit 118-145 Vers, easily adapted to others. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$4,500 Leon 10’ 4 way, to fit 9030 Ford NH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,500 Homemade 9’ 4 way blade, very easily adaptable for most 2wd & smaller MFWD (WA11). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $1,500 Leon Rock Ripper (pins to existing frame) or we have partial frame to modify . . . . $1,250

JD 148 6’ w/o grapple, needs some repairs, call for details, mounts to fit 4010-4455 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,250 JD 148 6’ w/grapple, quite nice condition, mounts to fit 4010-4455. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,950 JD 280 loader w/grapple, some wear, decent usable mounts to fit 4430-4850. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $9,000 JD 746 8’ w/grapple, some fire, but quite nice, call for details, off 7920 FWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $8,000 JD 840 8’ w/grapple, some fire (8100-8420 mnts) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,500 K160 White 6’ bucket, decent cond., mnts to fit 700 White MFWD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,500 Boss 8’ w/grapple, very decent, to fit 2-135/2-155 White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,000 MF 1080 8’ w/ 2cyl grapple, quite nice cond., s/n 000058, mnts to fit 6280-6290 MF. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,500 Ezee-on 2100 7’ w/grapple, decent cond., mounts to fit 6170-6180 MF . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Ezee-on 115E, 7’ w/grapple, very decent cond, mnts to fit 3630, 3650 -3660 MF . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Leon 790 7' bucket w/grapple, very nice, fits 7630 Agco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Leon 747 8' bucket w/teeth, excellent shape, fits 706-1256, easily modified to fit 966-1486 . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Leon 707 w/o bucket, some fire buy very decent, mnts to fit 90-94 series Case . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,500 Leon 707 7’ bucket w/grapple, fair amount of welding, no mounts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,500 CIH L300 7’ w/grapple, very decent cond., has mnts to fit MX 110-120-135 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 CIH L510 7’ bucket/grapple, mnts to fit 5130-5250 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,950 Ezee-on 120 7’ w/grapple, needs some work, mnts to fit 90-94 series Case . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,500 Ezee-on 2105 7’ w/grapple, decent cond., mnts to fit 5130-5250 CIH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,250 Ezee-on 20805/905 6’ w/grapple, very decent cond, s/n 40563, mnts to fit C80,4210,4230 CIH. . . . . . . . . . . . . . . . . . . . . . . . $4,000 Versatile 2360 priced from $2,500 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Call For Details 7414 Ford.Vers. 8’ w/grapple to fit 256-9030 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,950

SOLD

Ezee on #4515 to fit 970-1175 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $750 Ezee on #3541 to fit 3690 MF. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $1,150 Ezee on #3501 to fit 1100-1130 MF. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $750 Ezee on #9519 to fit 8010-8070 AC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $595

SOLD

WHY BUY NEW? 12 Bolt 18.4 x 38 Vers 12 Bolt 24.5 x 32 Vers 12 Bolt 18.4SOLD x 38 Vers (4) inners 16 Bolt 20.8 x 38 Vers (yellow) 16 Bolt 20.8 x 38 Vers (white) 10 Bolt 18.4 x 38 Steiger 10 Bolt 20.8 x 38 Steiger

USED STARTERS Starting at $95.00! USED ALTERNATORS Starting at $50.00!

Bench Tested and 30 Day Replacement Warranty! SAVE YOUR MONEY!


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 5

MORRIS SALES & SERVICE LTD. Box 566, Highway #10 East, Yorkton, Sask - Phone (306) 782-2445 Check our website at: www.morris-retail.com

AIR CARTS

HAY CONDITIONERS

Bourgault 3225 Hy/auger, MacDon 5020 - 16â&#x20AC;&#x2122;, 2003............$16,900 w/3rd tank.................................$16,500 NH 116 - 16â&#x20AC;&#x2122;, 540 PTO .................$7,500 Morris 7300 Hy/auger, 1997 ............ Call MacDon Hay Header - 14â&#x20AC;&#x2122; ............$6,500

AIR DRILLS Bourgault 5710-64â&#x20AC;&#x2122;, w/5440 aircart, M.R. ser II, D.S, dry ann hy, 2006 .....$139,500 Morris Maxim II-55â&#x20AC;&#x2122;, D.S., 10â&#x20AC;?, w/7240 tow bet & 7300 tow beh..$96,500 Morris Maxim II-40â&#x20AC;&#x2122;, 10â&#x20AC;? sp dual shoot, w/7300 ...........................$85,000 Morris Maxim III-60â&#x20AC;&#x2122;, w/10â&#x20AC;? spacing, 2006 ..........................$69,500 Morris 40â&#x20AC;&#x2122; Maxim, w/7240 aircart .$65,000 Morris Maxim-50â&#x20AC;&#x2122;, w/2320 tow between, 10â&#x20AC;?, liquid side band .. $59,500 Morris Maxim II-40â&#x20AC;&#x2122;, 10â&#x20AC;? sp dual shoot ...........................................$45,000 Concord 2810-liq, w/Morris 7130 hy/auger ......................................$36,500 CAIH 7200-42â&#x20AC;&#x2122;, w/factory transport......................................$10,000

AIR SEEDERS Morris Concept 2000 - 61â&#x20AC;&#x2122;, w/6180 air cart .........................$39,500 Bourgault 8800-56â&#x20AC;&#x2122;, 8â&#x20AC;? sp, packers/harrows w/4300 Air Cart + granular ...................$47,500 Bourgault FH536-40â&#x20AC;&#x2122;, 8â&#x20AC;? spacing & harrows, w/ Bourgault 180 aircart ......................................... $17,500

AUGERS Farm King 16104 swing auger, 2008 ....................$29,500 Brandt 8x50 mover, 27 hp, 2008 ...$9,950 Wheatheart 10x41, w/30 hp & mover, clutch ..............................$9,900 Wheatheart BH8x51, w/ mover kit. $3,950 Sakundiak HD8-1400, 27 hp, mover, clutch & rev gear box.................$7,950 Sakundiak HD10-1600, w/engine ..$3,500 Farm King 8x31 .............................$2,950 Farm King 10x50 Hy Swing..........$2,950 Sakundiak 7-45, w/ 13 hp Honda ..$1,500

BALERS CAIH RBX561, round baler, 2002 ..$16,500

MISCELLANEOUS Handi-Hitch....................................$3,500 Allied 96â&#x20AC;&#x2122; Snow Blower, 2009 ......$3,500 John Deere 696 Snow Blower .......$2,950 Ag Mach 6â&#x20AC;&#x2122; flail mower, new........$2,250 Westerhaug 10 bale hay hauler......$1,950 Farm King 60â&#x20AC;? tiller ......................$1,700

PACKER HARROW BARS Morris 70â&#x20AC;&#x2122; Field Pro, new tines ...$25,000

SPRAYERS Brandt 830-86â&#x20AC;&#x2122;, PTO pump ...........$2,500

SWATHERS CAIH WD1203-30â&#x20AC;&#x2122;, w/p.u. reel, 2008 ..........................................$87,500 Cat/Challenger SP115B/36â&#x20AC;&#x2122; Honeybee, 2006........................$85,000 Westward 9352i, w/972 - 30â&#x20AC;&#x2122;, 2006 ..........................................$79,500 Westward 9000/960-30â&#x20AC;&#x2122;, w/gauge wheels ......................................$45,000 Premier 2900-94, w/972-30â&#x20AC;&#x2122;, 2002......$42,500 CAIH 8825-25â&#x20AC;&#x2122;, w/ p.u. reel & keer shear .................................................$38,500 CAIH 8820-30â&#x20AC;&#x2122;, S.P. w/ p.u. reel ........$27,500 CAIH 8820-25â&#x20AC;&#x2122;, w/ p.u. reel, 1994..........$27,500 CAIH 6500-30â&#x20AC;&#x2122; w/p.u. reel, diesel ..........$25,000 Westward 7000-25â&#x20AC;&#x2122;, diesel, p.u. reel .......$19,500 IHC 4000-24.5â&#x20AC;&#x2122;, Perkins diesel, p.u. reel $17,500 Versatile 4400-25â&#x20AC;&#x2122;, diesel ....................$15,000 Prairie Star 4600-30â&#x20AC;&#x2122;, w/p.u. reel ........$12,500 CAIH 730 - batt reel, pull type ..........$7,950 Hesston 1200- 21â&#x20AC;&#x2122;, batt reel...............$4,950 Westward 3000-30â&#x20AC;&#x2122;, w/batt ...............$7,950 John Deere 590-25â&#x20AC;&#x2122;, w/batt ...............$6,950 Westward 3000-25â&#x20AC;&#x2122;, w/p.u. reel ........ $5,500

AFTER HOURS CALL: MIKE 306-786-6709 CELL 306-621-9440

Pushing performance to the max!

Dwayne 306-783-6780 CELL: 306-641-5853

Invest in Quality! The simple hydraulic push design ÂŽ

means no apron chains and fewer moving parts for dependable service and long life. It also provides faster unloading capability WRPD[LPL]HHIÄ&#x;FLHQF\

ProPush Spreaders 12.5 & 15.3 m3 440 & 540 cu. ft. heaped capacities

7KHUXJJHGGXUDEOHSRO\ÄšRRU and polylam sides reduce friction and promote self cleaning to help prevent material buildup on the inside of the spreader.

Videos at www.KuhnNorthAmerica.com

Visit your local Kuhn Knight dealer today! E. Bourassa & Sons

Nickâ&#x20AC;&#x2122;s Service

Novlan Bros. Sales

$VVLQLERLDĹ?(VWHYDQ 3DQJPDQĹ?5DGYLOOH :H\EXUQ

(PHUDOG3DUN

/OR\GPLQVWHU 3DUDGLVH+LOO

John Bob Farm Equipment 2XWORRN 7LVGDOH

PRELIMINARY NOTICE

FARM AUCTION WAGON WHEEL SEED CORP - WARREN & CARLA KAEDING of CHURCHBRIDGE, SASKATCHEWAN

SATURDAY APRIL 7th STARTS @ 9:30 AM SHARP!!

PARTIAL LISTING OF EQUIPMENT FEATURED

1-800-667-2075 hodginsauctioneers.com

SK PL # 915407 AB PL # 180827

TRACTORS&DVH,+67;:'Â&#x2021;-RKQ'HHUH:' Â&#x2021;&DVH,+0;80):'Z)URQW(QG/RDGHU *UDSSOHÂ&#x2021;COMBINES - &DVH,+Â&#x2021;&DVH,+Â&#x2021;COMBINE HEADER & PICKUPS - &DVH,+Â&#x2021;SWATHER - &DVH,+:'; Â&#x2021;GRAIN TRUCKS - :HVWHUQ6WDUÂ&#x2021;,QWHUQDWLRQDOÂ&#x2021; TRUCKS - .HQZRUWK7Â&#x2021;LIFT TRUCKS - +\VWHU;;0Â&#x2021; GRAIN TRAILERS - &DVWOHWRQIW7UL$[OHZ$LU5LGH6XVSHQVLRQÂ&#x2021; AIR DRILL - %RXUJDXOWZ%RXUJDXOW7RZ%HKLQG$LU 7DQNÂ&#x2021;CULTIVATOR - 6DOIRUG576IW9HUWLFDO7LOODJH7RROÂ&#x2021;HIGH CLEARANCE SPRAYER - -RKQ'HHUHÂ&#x2021;GRAIN CART - 2000 8)7Â&#x2021;AUGER - )DUPNLQJÂ&#x2021;YDULRXV6DNXQGLDN$XJHUVÂ&#x2021; LAWN & GARDEN EQUIPMENT - -RKQ'HHUH==HUR7XUQ/DZQ 0RZHUÂ&#x2021;RECREATIONAL VEHICLES - -RKQ'HHUH(;:'$79Â&#x2021; ASSORTED SHOP EQUIPMENT & TOOLS

Commercial Buildings

>VÂ&#x2026;Â&#x2C6;Â&#x2DC;iĂ&#x160;-Ă&#x152;Â&#x153;Ă&#x20AC;>}iĂ&#x160;UĂ&#x160;Â&#x2DC;Ă&#x192;Ă&#x2022;Â?>Ă&#x152;i`Ă&#x160;-Â&#x2026;Â&#x153;ÂŤĂ&#x192;Ă&#x160; UĂ&#x160;"Â&#x2C6;Â?wiÂ?`Ă&#x160; Ă&#x2022;Â&#x2C6;Â?`Â&#x2C6;Â&#x2DC;}Ă&#x192;Ă&#x160;UĂ&#x160; Â&#x153;Â&#x201C;Â&#x201C;iĂ&#x20AC;VÂ&#x2C6;>Â?Ă&#x160; Ă&#x2022;Â&#x2C6;Â?`Â&#x2C6;Â&#x2DC;}Ă&#x192;Ă&#x160; UĂ&#x160;Â&#x2DC;`Ă&#x2022;Ă&#x192;Ă&#x152;Ă&#x20AC;Â&#x2C6;>Â?Ă&#x160; Ă&#x2022;Â&#x2C6;Â?`Â&#x2C6;Â&#x2DC;}Ă&#x192;Ă&#x160;UĂ&#x160;7>Ă&#x192;Â&#x2026;Ă&#x160; >Ă&#x17E;Ă&#x192;Ă&#x160; UĂ&#x160;-Ă&#x152;Â&#x153;Ă&#x20AC;>}iĂ&#x160; Ă&#x2022;Â&#x2C6;Â?`Â&#x2C6;Â&#x2DC;}Ă&#x192;Ă&#x160;UĂ&#x160;7iÂ?`Â&#x2C6;Â&#x2DC;}Ă&#x160;-Â&#x2026;Â&#x153;ÂŤĂ&#x192;Ă&#x160;UĂ&#x160;7>Ă&#x20AC;iÂ&#x2026;Â&#x153;Ă&#x2022;Ă&#x192;iĂ&#x192;Ă&#x160; UĂ&#x160;,Â&#x2C6;`Â&#x2C6;Â&#x2DC;}Ă&#x160;Ă&#x20AC;iÂ&#x2DC;>Ă&#x192;Ă&#x160;UĂ&#x160;VĂ&#x20AC;i>}iĂ&#x160; Ă&#x2022;Â&#x2C6;Â?`Â&#x2C6;Â&#x2DC;}Ă&#x192;Ă&#x160; UĂ&#x160; ÂľĂ&#x2022;Â&#x2C6;ÂŤÂ&#x201C;iÂ&#x2DC;Ă&#x152;Ă&#x160; i>Â?iĂ&#x20AC;Ă&#x192;Â&#x2026;Â&#x2C6;ÂŤĂ&#x192;Ă&#x160;UĂ&#x160;>Ă&#x17E;Ă&#x160;-Â&#x2026;iÂ?Ă&#x152;iĂ&#x20AC;Ă&#x192;Ă&#x160; UĂ&#x160; >Ă&#x152;Ă&#x152;Â?iĂ&#x160;-Â&#x2026;iÂ?Ă&#x152;iĂ&#x20AC;Ă&#x192;Ă&#x2030; >Â?Ă&#x203A;Â&#x2C6;Â&#x2DC;}Ă&#x160; >Ă&#x20AC;Â&#x2DC;Ă&#x192;Ă&#x160; UĂ&#x160;Â&#x2C6;Ă&#x20AC;ÂŤÂ?>Â&#x2DC;iĂ&#x160;>Â&#x2DC;}>Ă&#x20AC;Ă&#x192;Ă&#x160;UĂ&#x160;"vwViĂ&#x2030;,iĂ&#x152;>Â&#x2C6;Â?Ă&#x160; Ă&#x2022;Â&#x2C6;Â?`Â&#x2C6;Â&#x2DC;}Ă&#x192;

Industrial Buildings

www.goodon.com OilďŹ eld Buildings

. . . and much more

1.800.665.0470 Saskatchewan Sales: Brad Edwards | 306.737.8788


UNFOLD FOR LISTING

$

$

91,300

SHOAL LAKE

STE. ROSE

SWAN RIVER

59,900 $

47,500 $

42’, 4 Bar Harrows

108,900

’10 NH CR9080

NEEPAWA

287,900

81,900

$

5,512

738 hrs, 1250LB Capacity, Elec. Dump Kit

UNFOLD FOR LISTING

PORTAGE

$

2019E/1579S, 30.5x32, Chpr, Chaff Sprdr

’02 NH TR99

$

710E/630T hrs, Long Auger w/ext., Chaff Sprdr, Y&M

’07 Toro 2110 Workman

MOOSOMIN

$

, 4600 hrs, 20.8 Triples, Std. Transmission

’98 NH 9882

BRANDON

209,900 $

1180 hrs, 710/70R42D, PS, 4 Remotes

’09 NH T9040

’11 NH ST830

54’, MRB, 4” Rubber Pckrs, SS, Heavy Trip

29,250

22,500

$

146,900

HARTNEY

’02 BO 5710 Air Drill

’06 NH TV145

Blade w/Sileage ext., 16’, Hyd tilt & Angle

710R38-600/65x28 Front, 3 PTH, 3 Hyd, w/L780 SL Ldr

105HP, 856 hrs, 16.9x38, 2 Hyd. Remotes

’04 Degelman 7900

’11 CIH Magnum 190

1000 RPM, Gathering Wheels, LB, BC

ARBORG

ARBORG

172,900

$

70’, 10” Spac., SS, 7 Run

’10 NH P2070 Air Drill

’09 NH BR 7090

Blowout Pricing

Blowout Pricing

$

Lucknow 2290 Twin screw, Vertical Mixer, Floatation Tires, Hydraulic Chute.

Lucknow 425

4 Horizontal Augers, Flotation Tires, Hydraulic Chute.

BLOWOUT

PAGE 6 Saskatchewan FarmLIFE, Monday, March 19, 2012


Saskatchewan FarmLIFE, Monday, March 19, 2012 Lethbridge 3214 – 5th Ave. North Lethbridge, AB T1H 0P4 Ph: 403-327-5512

Taber 5802 – 56th Ave. Taber, AB T1G 1X7 Ph: 403-223-3588

Burdett Box #33 Burdett, AB T0K 0J0 Ph: 403-833-3811

PAGE 7

Medicine Hat 1549 – 30th Street SW Medicine Hat, AB T1B 3N5 Ph: 403-526-4450

www.westerntractor.ca • 1-800-334-7049

Great Selection of Premium 2010/11 9770STS Combines available. Please call dealer.

J.D. 9860STS / J.D. 615P 46283/2009 Performax, 2007 - Premier Cab, Contour Master Variable Speed Feederhouse, Deluxe Header Controls w/HHS, Harvest Monitor, 22.5 Extended Wear Folding Unloading Auger, Wide Spread Fine Cut Chopper/Chaff Spreader, 800/70R-38 Drive Tires (70%), 4WD Power Rear/2 Speed, 600/65R28 Rear Tires (70%), High Capacity Feeding, Remote Heated Mirrors, 1655 Eng / 1093 Sep Hrs.

Clearance Priced – Please Call (L) J.D. 9860STS / J.D. 615P 46314, 2007 - Performance Plus Custom, Premier Cab, Contour Master/Variable Speed Feederhouse, Deluxe Header Controls w/HHS, Harvest Monitor Less Display, Extended Wear Separator Package, 6.9M Regular Auger, Wide Spread Fine Cut Chopper/Chaff Spreader, 800/70R38 Drive Tires, 600/65R28 Rear Tires, High Capacity Feeding, Remote Heated Mirrors, 1928 Eng Hrs. / 1324 Sep Hrs.

$220,000 (L) J.D. 9650STS 46353, 2003 - Contour Master Deluxe Header Controls w/HHS, 20 Ft. Unloading Auger, 800/65R32 Drive Tires (75%), 18.4-26 Rear Tires (50%), Extra High Capacity Air Cleaner. 2850 Eng. / 1951 Sep Hrs.

$118,500 (L) J.D. 9870STS / J.D. 615 U2191, 2009 - Premier Cab, Hi-Capacity Lift Cylinders, 6.9M Unloading Auger, Wide Spread Fine Cut Chopper/Integrated Chaff Spreader, 900/65R-28 Drive Tires, Feed Accelerator Slow Speed, 615 Eng / 404 Sep Hrs.

$299,000 (T) J.D. 9760STS 46293 - 2005 - Deluxe Header Controls w/HHS, GreenStar w/Autotrac Less Display, 6.9M Unload Auger, Straw chopper/Chaff Spreader, 800/65R-32R1 Drive, 18.4R-26 Rear Tires, 1730 Eng. / 1284 Sep Hrs.

$180,500 (M)

HIGH CLEARANCE SPRAYERS

NH SF110 41250 - 2006 - 90 Ft. Suspended Boom, 800 Gallon Tank, Rinse Tank, Auto Rate Controller, No Auto Boom . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $36,000 (T) NH SF115 41284 - 2006 - 90 Ft. Suspended Boom, 1200 Gallon Tank, Rate Controller, Chem Handler, Chem Rinse Tank, Hydraulic Pump, Variable Rate, 2 Nozzle Bodies, Raven Auto Boom Leveling, Diamond Tread Tires . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $35,500 (M) NH SF115 41313 - 2004 - 90 Ft. Suspended Poly Boom, 1200 Gallon (1500US) Tank, Single Nozzle Body, Bubble Jet Nozzles, Variable Rate Flex Control Monitor, 18.4-38 Tires (80%), Rate Controller, Chem Handler, Chem Rinse Tank, Boom End Wheels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $34,500 (M) NH SF115 41283 - 2004 - 90 Ft. Suspended Boom, 1200 Gallon Tank, Rate Controller, Chem Handler, Chem Rinse Tank, Hydraulic Pump, Variable Rate, 2 Nozzle Bodies, Raven Auto Boom Leveling, 18.4-38 Tires . . $29,000 (L) JD 4930 41055 - 2009 - 120 Ft. Stainless Steel Boom, 380/105R50 Tires, High Flow Solution Pump, Less Eductor, Boomtrac Auto Level System (5 Sensor), Less Foam Marker, Wheel Slip Control, Deluxe Operator Station, Auto Air Spring Leveling System, Xenon HID Lighting, AM/FM/CD/Radio-4 Speakers, (R.H & L.H) Fence Row Nozzles, Boom Section Strainers, Chassis Radar, Fenders, Engine Block Heater, Buddy Seat, Front & Rear Window Shades, c/w JD 2600 Screen, No Activations, 1142 Hrs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $252,500 (L) JD 4930 41053 - 2008 - 120 Ft. Stainless Steel Boom, 380/105R50 Tires, High Flow Solution Pump, Less Eductor, Boomtrac Auto Level System (5 Sensor), Less Foam Marker, Wheel Slip Control, Deluxe Operator Station, Auto Air Spring Leveling System, Xenon HID Lighting, AM/FM/CD/Radio-4 Speakers, (R.H & L.H) Fence Row Nozzles, Boom Section Strainers, Chassis Radar, Fenders, Engine Block Heater, Buddy Seat, Front & Rear Window Shades, c/w JD 2600 Screen, No Activations, 1725 Hrs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $240,000 (T)

TRACTORS 4WD’S & MATERIAL HANDLING

JD 8570 51165 - 1997 - 250 HP, 12F/3R Synchro Transmission, (F&R) Diff Lock, 3 Hydraulics, 18.4R38 Duals (50% FS), Hydraulic Return Line, Roof Lights, Performance Monitor, AM/FM/Stereo. Rebuilt Engine @ 3050 Hrs. 4050 Hrs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $62,000 (L) JD 9320 51168 - 2002 - 375 Eng. HP, Deluxe Cab w/Active Seat, GreenStar Ready Harness, Comfort Package, (F&R) Diff Lock, 18F/6R Power Shift Transmission, 520/85R42 Triples (90% Michelin), 4 Hydraulics, Premier Lighting Package, AM-FM/Weatherband/CD, Instructional Seat, Weight Package. 4677 Hrs . . . . . . . . . $152,000 (L) JD 9430 51140 - 2008 - 425 HP, Deluxe Cab,w/Active Seat, Less Differential Lock, 24F/6R Manual Shift Transmission, 48 GPM Hydraulic Pump, 4 Hydraulics, 800/70R38 Duals, 2100 Hrs.. . . . . . . . . . . . . . . . . . . . . . $230,000 (B) JD 9430 51143 - 2008 - 425 HP, Deluxe Cab,w/Active Seat, Less Differential Lock, 24F/6R Manual Shift Transmission, 48 GPM Hydraulic Pump, 4 Hydraulics, 800/70R38 Duals, 2100 Hrs. . . . . . . . . . . . . . . . . . . . . . . $230,000 (B) JD 9520 51125 - 2003 - 450 Eng HP, Deluxe Cab w/Active Seat, GreenStar Ready Wiring, 18 Speed Power Shift Transmission, (F&R) Diff Lock, 710/70R42 Duals (80% Michelin), 4 Hydraulics, 1000 RPM PTO, 4150 Hrs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $175,000 (M) JD 9620 51127 - 2004 - 500 Eng HP, Deluxe Cab w/Active Seat, 18F/6R Power Shift Transmission, (F&R) Diff Lock, 48 GPM Hydraulic Pump, 4 Hydraulics, 800/70R38 Duals (Good Year 60%), 3 Point Hitch, Radar, 3800 Hrs . . . . . . . . . . $181,000 (T) JD 9620 51142 - 2004 - 500 Eng HP, Deluxe Cab w/Active Seat, 18F/6R Power Shift Transmission, (F&R) Diff Lock, 48 GPM Hydraulic Pump, 4 Hydraulics, 520/85R46 Triples (95% Michelin), Radar, 4000 Hrs.. . $185,000 (B) JD 9630T 51119 - 2011 - 530 Eng. HP, Deluxe Cab, Autotrac Ready, Deluxe Comfort Package, Cat 5 Wide Swing Drawbar, 36 In. Durabilt 5500 Tracks, 4 Hydraulics, 1000 RPM PTO, Extremity Warning Lights, Premiere Lighting Package, Tool Box, Rear Field Vision Xenon HID Lighting. 857 Hrs.. . . . . . . . . . . . . . . . . . . . . $355,500 (T) CIH 9350 51144 - 1996 - 310 HP, 24 Speed Transmission, 20.8R38 Duals (40% Firestone), 4 Hydraulics, Hydraulic Return Line, AM/FM/Radio. 3308 Hrs.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $68,000 (T)

JD 2WD’S & MFWD’S

JD 4440 51160 - 1981 - 130 PTO, 2WD, 16 Speed Quad Range Transmission, 2 Hydraulics, 540/1000 RPM PTO, 20.8-34 Rear (85% FS) Duals (40% AS), 11.00-16 Front (80% FS), No 3 Point, Radio, 3 Cast Rear Weights, c/w JD 260 Loader. 9700 Hrs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $24,750 (L) JD 6430 51117 - 2011 - 115 HP, Open Station High Platform, M.F.W.D, 16.9R38 Rear (80% Firestone, 14.9R24 Front Tires (80% Firestone), PowerQuad LHR 16F/16R (30K) Transmission, Adjustable Rear Wheel, 1+2 Deluxe SCV, Vertical Exhaust, Front Fenders, Tool Box, High Clearance Foot Steps, Cold Start Package 1, Standard Swing Drawbar w/Hammer Strap. Not Available until March 2012, 357 Hrs. . . . . . . . . . . . . . . . . . . . . . . $54,250 (T) JD 7130 51092 - 2011 - 100 PTO HP, Premium Tractor, IVT Transmission (40Km), M.F.W.D, 3 Hydraulics, 3 Point Hitch, 540/1000/540E RPM PTO, 520/85R38 Rear (90%), 480/85R28 Front Tires (90%), CD Player, c/w JD 741 Loader/Grapple, 500 Hrs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Not Available until March 2012 (L) JD 7930 / 746 51081 - 2006 - 170 PTO HP, Deluxe Cab, AutoTrak Ready, IVT Transmission w/LHR, Deluxe Comfort Package, 4 Hydraulics, 1 3/4 In. 1000, 1 3/8 In. Capable PTO, 3 Point Hitch, 63cc Hydraulic Pump, 380/90R46 Rear, 380/85R30 Front, Front & Rear HID Lighting, Clevis w/Pin, Instructional Seat, Engine Block Heater, Rear weights, Now! 4105 Hrs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $122,000 (T) JD 8245R 51020 - 2010 - 198 PTO HP, Deluxe Cab w/Active Seat, Autotrac Ready, IVT Transmission, HID Lighting, 4 Hydraulics, 540/1000 RPM PTO, 3 Point Hitch, 85CC Hydraulic Pump, 520/85R46 Duals, 480/70R34 Front Tires, Rear Weights, Quick-Tatch Weight Support w/22 Weights, Now! 1192 Hrs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Price Reduced to $180,500 From $194,000 (L)

OTHER 2WD’S & MFWD’S

CIH Puma 165 51099 - 2011 - 165 HP, 19 Speed Power Shift Transmission (50Km), 4 Hydraulics,

620/70R42 Rear, 480/70R30 Front Tires, Front Axle Suspension, GPS and Auto Steer Integrated, 310 Hrs. . . . . $113,500 (L) CIH Puma 180 / CIH L780 51130 - 2011 - 6.7L 185 HP, M.F.W.D, CVT Transmission, 4 Hydraulics, 43 GPM Hydraulic Pump, 3 Point Hitch, 620/70R42 Rear (Firestone 90%), 480/70R30 Front (Firestone 90%), 540/1000 RPM PTO, 100mm Rear Axle, Foot Throttle, AM/FM/Radio, Rear weights, c/w L780 Loader/Grapple, 673 Approximate Hrs. in spring. Not Available until June 2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $154,500 (L) CIH Puma 225 / CIH L780 51129 - 2011 - 6.7L 225 HP, M.F.W.D, CVT Transmission, 4 Hydraulics, 43 GPM Hydraulic Pump, 3 Point Hitch, 520/85R42 Rear Duals (Firestone 90%/100%), 480/70R30 Front (Firestone 90%), 540/1000 RPM PTO, 100 mm Rear Axle, Foot Throttle, AM/FM/Radio, c/w L780 Loader/Grapple, 732 Approximate Hrs. in spring. Not Available until June 2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $170,000 (L) NH TG255 51107 - 2004 - 255 Eng HP, 18F/4R Power Shift Transmission, M.F.W.D, 5 Hydraulics, 3 Point Hitch, 1000 RPM PTO, 380/90R54 (Titan 85%) Rear, 380/80R38 (Titan 75%) Front, 16 Front Weights, 2382 Hrs. (04Jan12) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $115,000 (T) White 6105 / Ezee-On 2105 51106 - 1992 - 106 PTO HP, 24F/12R Synchromesh Transmission, M.F.W.D, 3 Point Hitch, 3 Hydraulics, 540/1000 RPM PTO, 18.4R38 Rear (60%) Good Year, 14.9R30 Front Tires (60%) Good Year, Fluid in Rear Tires, c/w Ezee On 2105 Loader, Single Lever Joystick, 4363 Hrs.(6*). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $31,500 (T)

Call about our selection of Pre-owned Air Drills


PAGE 8

Saskatchewan FarmLIFE, Monday, March 19, 2012

Contact Your Nearest BRANDT Dealer TODAY! FARM & GARDEN CENTRE

KINDERSLEY, SK

MELFORT, SK

306/463-2683

PRINCE ALBERT, SK

306/375-2302

306/752-9344 306/763-6686

SASKATOON, SK 306/933-3303

ROSTHERN, SK 306/232-4852

WATROUS, SK

KYLE, SK

LEADER, SK

306/628-3889

MAPLE CREEK, SK 306/662-2233

NORTH BATTLEFORD, SK 306/445-4468

306/946-3362

SWIFT CURRENT, SK

JAYDEE AGTECH

UNITY, SK

306/773-9351

HUMBOLDT, SK

306/228-2696

KELVINGTON, SK

TISDALE, SK

306/682-2572 306/327-4355

JOHN BOB FARM EQUIPMENT 306/873-4588

MAPLE FARM EQUIPMENT BALCARRES, SK 306/334-2492

FOAM LAKE, SK 306/272-3345

MOOSOMIN, SK 306/435-3301

WYNYARD, SK 306/554-2536

MEADOW POWER & EQUIPMENT MEADOW LAKE, SK 306/236-4455

NELSON MOTORS & EQUIPMENT AVONLEA, SK 306/868-2022

ESTEVAN, SK 306/634-6422

For more information, contact your local Brandt dealer


Saskatchewan FarmLIFE, Monday, March 19, 2012

OXBOW, SK

306/483-5115

RADVILLE, SK

1-306-869-3000

REDVERS, SK 306/452-3418

MONTMARTRE, SK 306/424-2212

MOOSE JAW, SK 306/692-2371

MOSSBANK, SK

WESTERN SALES (1986) LTD. BIGGAR, SK

306/948-3909

ELROSE, SK

306/378-2575

306/354-2411

OUTLOOK, SK

KAMSACK, SK

RAYMORE, SK

ROSETOWN, SK

SHAUNAVON INDUSTRIES (1980) LTD.

REGINA, SK

NYKOLAISHEN FARM EQUIPMENT 306/542-2814

SHAUNAVON, SK 306/297-2639

SOUTH COUNTRY EQUIPMENT LTD. ASSINIBOIA, SK 306/642-3366

306/746-2110 306/721-5050

SOUTHEY, SK

PAGE 9

306/867-8601 306/882-4291

DAVIDSON, SK 306/567-2828

CENTRAL BUTTE, SK 306/796-4320

306/726-2155

WEYBURN, SK 306/842-4686

1-866-4BRANDT (1-866-427-2638), or visit us at www.brandt.ca


PAGE 10

Saskatchewan FarmLIFE, Monday, March 19, 2012

SEEDING

JH:9:FJ>EB:CI

‘08 Bourgault 5710 64ft, 9.8” spacing, 3 1.2 steel packers, atom jet openers .... $92,500 ‘99 Bourgault 5710 64ft, 9.8” spacing, 3” rubber packers, mid row banders ...... $65,000 ‘03 Bourgault 5710 54ft, 9.8” spacing, 3” rubber packers, mid row banders ...... $75,000 ‘07 Bourgault 5710 54ft, 9.8” spacing, 3 1/2 steel packers, w/Bourgault 6350 aircart ......................................................................................................... $142,500 ‘01 Bourgualt 8810 55ft, 10” spacing, double shoot air kit, mid row banders ..... $75,000 ‘01 Bourgault 8810 55ft, 10” spacing, 450 Ib trip 4 bar harrows, granular kit ..... $56,500 ‘01 Bourgault 8810 40 ft, 10” spacing, double shoot air kit, independent poly packers .................................................................................................................. $45,000 Flexi-Coil 5000 Air Drill 45ft, 9” spacing, 3” rubber packers, w/2320 air cart ..... $49,500 Bourgault FH 536-40 40ft, 8” spacing, w/2155 air cart........................................ $19,500 ‘95 Bourgault 3225 Air Cart 225 bushel .............................................................. $16,900 ‘92 Bourgault 3165 Air Cart 165 bushel ................................................................ $9,500 *Good Selection of Used Poly Packers*

TRACTORS

‘05 Kubota M125X powershift trans w/Kubota M960 front end loader, 1925 hrs $59,500 ‘07 Kubota M108 swing shift, trans, open station, w/Kubota M45 FEL, 3200 hrs $43,500

Maximize Performance when it counts - the 5710 Air Hoe Drill. It’s easy to see why the 5710 AHD is the most popular drill over the last decade. UÊ-Õ«iÀˆœÀÊ`iÈ}˜Ê>˜`ÊVœ˜ÃÌÀÕV̈œ˜Ê“i>˜ÃʏiÃÃÊLÀi>Ž`œÜ˜Ê`ÕÀˆ˜}ÊÃii`ˆ˜}] UÊ ÝVii˜ÌÊVœ˜ÌœÕÀˆ˜}ÊV…>À>VÌiÀˆÃ̈VÃÊ܈Ê«ÀœÛˆ`iÊ«ÀiVˆÃiÊÃii`Ê«>Vi“i˜Ì] UÊ-ˆ˜}i‡«œˆ˜ÌÊ`i«Ì…ÊVœ˜ÌÀœÊvœÀʵՈVŽÊ>˜`Ê>VVÕÀ>ÌiÊÃii`ˆ˜}Ê>`ÕÃ̓i˜ÌÃ] UÊÊ܈`iÊÀ>˜}iʜvʜ«i˜iÀÊ>˜`Ê«>VŽiÀʜ«Ìˆœ˜ÃÊ̜ÊÃՈÌÊiÛiÀÞÊv>À“ˆ˜}ʜ«iÀ>̈œ˜° UÊÛ>ˆ>LiÊÕ«Ê̜ÊÇx½Êœ˜Ê™°n»Ê>˜`Ê£Ó°È»Êë>Vˆ˜}°

s-AC$ONs+UBOTAs(IGHLINEs6ERMEERs+UHN+NIGHTs

MISC

‘10 Salford RTS 570 50ft.................................................................................... $104,500 ‘06 Leaon 585 Manure Spreader ........................................................................ $14,400 ‘07 Schulte XH1000 rotary cutter 10ft, w/Schulte FLX10 flex arm .................... $16,900 Riteway 1600 packer bar, 40ft, w/P30 packers..................................................... $4,500 Turbo K990 super deluxe grain vac, minty clean ................................................ $7,250

BjggVnÉh;VgbHjeea^Zh ÆEgdjYH]dgia^cZ9ZVaZg[dg',NZVghÇ

WINDROWERS

‘09 MacDon M150 320 hrs, w/D60 35ft header ................................................. $114,500 ‘09 MacDon M100 329 hrs, w/D50 30ft header ................................................. $101,000 ‘07 NH HW325 820 hrs, w/Honeybee 30ft header ............................................... $82,500 ‘02 MacDon 9352C 1708 hrs, Turbo 2 spd, w/30ft 972 header ........................... $72,900

GJHH:AA

H=D6AA6@:

(204) 773-2644

(204) 759-2626

!FTER(OURS #ORRIE+AEDING204-773-6382

!FTER(OURS $UANE+ENT   *ASON$IGBY  


Crystal City 873-2480 Hartney 858-2000

Killarney 523-4414 Neepawa 476-2364 Portage 857-8711

91 BOURGAULT 2115 TBH Bourgault 2115 Tank, 2 Compartment ...................................... $4,900 P 09 CIH 3430 430BU., 30.5-32, 8 Run, DS, Variable Rate ....................................................$64,900 R 87 EZ 2175 5 Run, 175 BU, 60/40 Split, SS.........................................................................$7,900 ST 10 NH P1060 430BU., TBH, VariRate, Dual Fan, 18.4x38R1 Duals w/Spacers, 10”Auger $82,500 K

TANKS

01 BO 7200 72’, 21.5 X 16.1, 5/8” Tine .............................................................................$33,750 SW 01 BO 7200 70’., Heavy Harrow, Hyd. Tine Adjust ...............................................................$28,900 M 02 FC S82 60’, Warning Lamps, 12 Section........................................................................... $6,750 P

HARROW

90 BO 8800 40’, 8” Spacing, w/4 Bar Harrows & Knives, w/ BO 3225 Tank, 7” Auger,...... $27,900 SL 99 BO 9400 60’, 500 Lb Trip, NH3 Kit, 4 Bar Harrows, Spd Lock Adapters .....................$59,900 SW ELMER RC20SS830 8 Row Crop Cultivator, 30” Spacing ................................................... $12,319 P MONGRAIN PAKER BAR 36’, Farm Built Packer Bar, 1.5” Coils, Wing Type.....................$3,900 ST 98 MR 9000 49’, 5 Section, Floating Hitch, 4 Bar Harrows .................................................. $24,750 P 11 NH ST830 42’, 12” Spac, 650LB Trips, Transport Lighting & Marking............................. $45,000 R

TILLAGE

96 BO 5710 40’, 12.5” Spacing, 3.5” Steel Pkrs, Atom Jet Boot, 5 Run Air Pk, Liquid Kit ... $30,900 H 98 BO 5710 50’, 12” Spacing, MRS w/NH3 Tubes, SS, Steel Packers, New Openers........$53,900 M 02 BO 5710 63’, 12” Spacing, Steel Pkrs, MRB, 18” Coulters, w/BO 5350 Tank, ............$100,900 M 00 BO 5710 40’, 450LB Trip, 9.8” Spacing, SS, 4” Rubber Packers, Harrow, Closers .....$42,188 SW 10 BO 5710 w/6550 Tank, Dual Whls, 450 lb Trip, SS.Square Seed Boots, Dbl Caster Whls$224,900 SW 02 BO 5710 54’, MRB, SS Air Kit, Dual Casters ...............................................................$59,900 SW 97 CC 4010 40’, Case 2300 Tank, 300 Bu., (4) 18.4-26 Tires On Tank, 2 Compartments ... $39,400 K 98 CC 4010-4R 40’, SS, Packer Tires, Dual Casters, w/FC TBT 2320 Tank........................ $45,900 A 95 CC 4012 40’, 3” Paired Row Dutch Openers, Pneumatic Pkrs, DS, FC Air Kit ............... $20,800 R 92 FC 5000 57’, 2320 Air Tank, Single Spike Carbides, 7.2” Spacing, 3” Steel Press ......... $43,875 K 98 FC 5000 45’, 3” Steel Packers, 550 lb. Trip, 10” Spacing, Openers In Box.................$30,900 SW 97 FC 5000 57’, w/1996 2320 Tank TBT,Steel Packers, 500 lb Trip, 7.2” Spacing, .......... $32,500 SL 99 FC 5000 45’ , SS, 550 lb. Trips, 9” Spacing, 4” Rubber Pkrs, FC 2320 TBH Cart........... $60,500 P 93 FC 5000 39’, 3” Rubber, Liquid Kit, 5 Run, SS, 450LB Trip, w/FC 2320 Tank..............$30,900 SW 94 FC 5000 39’, 3.5” Steel Packers, 7.2” Spacing, 350 Trips, 6 Manifold TBH, ................. $22,900 N 02 FC 7500 60’, 3 1/2” Split Boots, 5” Rubber Pkrs, 10” Spacing, DS, 3450 Air Cart, TBT, 350 BU $64,900 CC 97 MR MAXIM 49’, New Atom Jet Openers (1500 Acres), Rubber Packers, Dual Shoot ....$31,900 M 01 MR MAXIUM 34’, 10 In. Spac, Steel Whls, Patison Liquid Kit, w/MO 7240 TBH, ........... $44,900 H 10 NH P2070 70’, 10” Spac, SS, 7 Run, NH3 Tubes, NH Knife, ........................................ $172,900 H 08 NH SD550 70’ Hoe Drill, 430BU. TBH Tank, SS, Stealth Carbide Tips, 10” Spac, ....... $162,225 K

DRILLS

83 CA 4490 213HP, 5693 hrs, 18.4R34 Duals .....................................................................$14,900 M 99 JD 9300 360 HP, 4805 hrs, 620/70R X 42 Duals, Wts & Ballast, 12 Spd., 4 Hyd. Remotes$96,750 K 04 NH TJ325 325 HP, 2929 hrs, New 520R42R1W Michelin, Powershift .........................$137,900 B 07 NH TJ530 530HP, 1701 hrs, 800/70R38, 55 GPM, 4 Remotes, Std Weight Pkg, Dlx Cab$203,900 B 11 NH T9.450 400 HP, 300 hrs, Dlx Cab, HID Lights Front & Back, 16 Spd PS ...............$242,900 H 11 NH T9.450 400HP, 1939 hrs, 4 Remotes, Dlx Cab, Guidance Ready ...........................$219,900 B 11 NH T9.450 400HP, 1409 hrs, 55 Gal. Pump, 4 Remotes, Deluxe Cab..........................$224,900 B 10 NH T9030 385 HP, 1961 hrs, PS, HD Drawbar, 55 GPM Hyd Pump, 4 Remotes ......... $183,500 B 11 NH T9040 435HP, 420E hrs, Full Intellisteer, High Flow Hyd, 1000 RPM PTO ............. $252,000 R 09 NH T9040 435HP, 1180 hrs, 710/70R42 Duals, 4 Remotes, PS, Auto Guidance Ready$209,900 B 11 NH T9050 485HP, 400 hrs, 800 R 38 Duals, Full Intellisteer, 55 Gallon Pump, HID Lights$252,000 SW 11 NH T9060 535HP, 290E hrs, 800/70R38, Full Intellisteer Autoguidance, High Flow ..... $300,300 R 09 NH T9060 535HP, 2187 hrs, 800/70R38 Duals, High Capacity Pump, Deluxe Cab .....$229,900 B 10 NH T9060 535HP, 985E hrs, 800/70R38D, Luxury Cab, High Flow Hyd, 6 Remotes ... $266,700 R 98 NH 9882 425HP, 4600 hrs, 20.8 Triples, Standard Transmission .................................$108,900 M 97 NH 9482 310HP, 6112 hrs, 20.8 R42 Drum Duals, 4 Remotes, PS ....................................CALL P 88 NH 876 280HP, 11,226 hrs, 18.4R42 Duals,Standard Transmission............................... $28,125 R

TRACTORS 4WD

10 NH T8020 200 PTO HP, 1275 hrs, 480/80R46D, 420/90R30 Fronts, 3 PT, 540/1000 PTO $152,200 B 94 NH 8770 160HP, 9150 hrs, 20.8R42 Duals, 16.9R30 Front, FWA, 4 Hyd Remotes ...... $49,900 H 00 NH 8870 180 PTO HP, 3406 hrs, 20.8R42 Duals, 16.9R30 Front Duals, 1000 PTO, FWA $71,500 H

SWATHERS

Roblin 937-2134 Shoal Lake 759-2126 Winnipeg 253-2900

Swan River 734-9361 Ste. Rose 447-2739 Moosomin (306) 435-3610

Check out our complete inventory at mazergroup.ca

02 AGCHM 1254 110’, 620/75R 30-380/90R46, 1200 Gal Stainless Tank, ...................... $159,900 A 07 APAHE 1010 103’, Drop Boxes, 1000 Gallon Tank, 500 Ez Steer, Sharp Shooter Boom.$138,900 SW 08 APAHE 1010 103’, 380/80R38-380/90R46, 20.8X42, 1000 Gallon Plastic Tank, ......$138,900 SW 08 APAHE 1010 100’, 380 Narrow Tires, 520 Used Rear, 1000 Gal. Tank, Tripple Nozzle$155,900 B 11 NH SP.240F 100’, 275 HP, 6.7L Turbo, 320/90R50, 1000 Gal. SS Tank, 31 GPM Pump$277,900 H 90 SCOUP 230 11.4x24, Extra Tires 9.4x24, Single Nozzle Bodies, Tee Jet, Light Bar .... $12,000 SL 95 SCOUP 3430 73’, Mid Tech Controller, 5 Spd Trans, 5 Section Boom, 400 Gal. Poly Tank$35,900 A

SELP PROPELLED SPRAYERS

86 AH 6555 16’ Hay Head, 4200 hrs, Cab, Air, 21.5L x 16.1 Turf Tires............................. $13,900 ST 06 CIH WDX1202 30’, 286E hrs, 18.4 x 26, DHX 302 Hdr, Dbl Knife, UII PU Reel ............. $81,900 P 06 S WDX1202 934E hrs, PU Reel, 2 Roto Shears, New Canvases in 2011, .................$82,900 SW 06 CIH WDX1202 18.4 x 26, New Canvas in 2011, Trnspt & Gauge Whls, Roto Shears .$83,050 SW 08 CIH WD1203 30’, 777 hrs, 126 HP, 18.4x26 tires, UII PU, Dbl Knife Hdr, 6’ Hay Hdr ... $119,900 H 10 CIH WD1203 120 HP, 400 Hrs, 18.4R26 Drive & 14L-16.1 Rear, Double Knife, ....... $109,600 CC 86 CIH 4000 UII PU Reel, Gauge Whls Rear Axle Ext. 2’ Rear Wts, End Hitch..................... $8,500 A 96 CIH 8820 30’, 1563 Hrs, 21.5x16 Drive, 7.60x15 Rear, Hdr, U2 Reel Single Span ....... $30,375 K 98 CIH 8825 21’, 2000 hrs, 21.5Lx16.1, Table, DKD, UII PU Reel, Shiftable Draper......... $27,900 ST 98 CIH 8825 2185 hrs, 21.5 x 16.1-9.5 x 16 Rear, 30’ Hdr, Gauge Whls, U2 PU Reel .....$16,875 SW 90 JD 2360 75’, 4563 hrs, 21.5 x 16 Front & 8.5 x 14 Forked Rear, 21’ Draper Hdr.........$14,900 SW 81 JD 2420 25’, PU Reels, Diesel, Air, Underneath Swather Roller, Gauge Wheels. ......$10,688 SW 04 JD 4895 30’, 967 hrs, 6 Batt PU Reel, Gauge Wheels, Transport, 2 Roto Shears. .....$73,900 SW 01 MB 2940 25’, 2105 hrs, 21.5 x 16.1, 9.5L Single Fork, MD 972 Hdr, 6’ Bat PU, Dbl Swather .$54,900 N 01 MB 9250 1532E hrs, 2003 Macdon 922 18’ Auger Hdr ................................................... $48,900 P 00 MF 220 II 1131 E hrs, 25’, 21.5Lx16.5 Drive & 9.5L Forked Caster Tires, PU Reel ..... $43,875 CC 99 MF 220 II 25’ PU Reel, Honey bee Cutting System 21.5L-16.1SL Cleat Tread Drive Wheels$37,900 A 03 NH HW300 1820 hrs, Pwr Reverser Kit, Rotary Screen Cleaner, 16.9 x 24 Cleat Tires .$45,900 N 07 NH HW305 720 hrs, 18.4 x 26, Bought New in 2009, NH HS16 Head ........................... $78,900 A 20 NH HW305 5 hrs, 98HP ..................................................................................................$61,900 M 01 NH HW320 2328E hrs, 16.9 x 24, 994 25’ Head , UII PU Reel, DKD, Trnsprt Kit .......... $56,900 N 03 NH HW320 2276 hrs, UII 5 Bat PU Reel, Plastic Teeth, 2 Spd, 25’ 94C ......................... $55,900 N 07 NH HW325 1474 hrs, Cab & Rear Axle Susp, HCC PU Reel, Cross Auger Kit, HB30 Hdr$77,900 ST 07 NH HW325 30’, 535 hrs, HB30, 5 Bat PU Reel, SKD, Std. Dyck 18.4x26 Cleat Tires . $88,000 CC 07 NH HW325 25’, 780 hrs, Cab Susp, 21Lx238, UII PU, 5 Bat, Plastic Teeth.................$81,900. ST 06 NH HW325 30’, 1129 hrs, 18.4R26 R1, w/NH HB30, UII Steel Fingers, Poly Skid ......... $82,900 B 07 NH HW325 30’, 740 hrs, SKD, HCC PU Reel, 2 Roto Shears, Dlx Cab, Cab Susp ....$88,000 SW 05 NH HW325 30’, 1300 hrs, w/NH 994, SKD, UII Plastic 5 Batt Reel, Gauge Wheels....... $70,900 B 07 NH HW325 HB30 Header................................................................................................ CALL SW 03 NH HW340 1037E hrs, 18.4x26 10 ply, 25’ Hdr, UII PU Reel, Gauge Whls, 15’ Discbine$85,250 SL 08 NH H8040 30’ HB30 Head, 650 hrs, Cab Susp, PU Reel w/Plastic Fingers ................. $107,900 B 08 NH H8040 25’, 825 hrs, 18.4 x 26-14L x 16.1 Rear, Manual For/Aft, UII Pick Up Reel $92,900 ST 08 NH H8040 438E hrs, 18.4-26, Cab & Axle Susp., Dlx Cab, HB30 Header...................... $98,900 R 08 NH H8040 30’, 422 hrs, Dlx Cab, w/NH HB30 Head, Hyd Fore Aft, SKD, Center Delivery $106,900 B 08 NH H8040 16’, 1665 hrs, w/NH HS16 Head, Rubber Conditioning Rolls. .......................$82,900 M 09 NH H8040 30’, 222 hrs, 18.4R26 R1, w/NH HB30 Head, SKD, UII PU Reel, Plastic Fingers$110,900 B 08 NH H8040 36’ Hdr, 605 hrs, 18.4R26, DKD, UII Reel, Gauge Wheel, Transport Kit ... $102,300 SL 08 NH H8040 30’, 480 hrs, w/NH HB30 Head, DKD, Hyd Fore/Aft, Cab Suspension. .....$103,900 M 08 NH H8080 802 hrs, Cab & Axle Susp., 18.4 x R26, Dlx Cab, 18’ 770 HDN Hdr ......... $104,900 ST 99 PREMR 2920 30’, 1532 hrs, w/MB 972, Gauge Wheels, PU Reel..................................$54,900 H 96 PREMR 2920 25’. 2460 hrs, 21.5x16.1, 960 Header, UII PU Reel, 600 Hours On New Engine$43,900 N 01 PREMR 2940 80HP, 1751 Hrs, 21.5x16 & 9.5Lx14, 972 MD, 5-Batt PU Reel ............. $62,700 CC 99 PSTAR 4920 25’,1836 hrs, 21.5x15 Drive & 9.5Lx14, 972 Harvest Hdr, PU Reel ....... $56,100 CC 03 PSTAR 4940 25’, 1530E hrs, 21.5 x 16- 9.5L X 14 Caster Wheels, MD 972 Harvest Hdr$63,800 K 01 PSTAR 4950 30’, 1151 hrs, 21.5 L -16.1 Front -9.5 L -15” Rear, 972 30’ Header , SKD$70,900 SW 86 VA 4700 25’, 2485 hrs, PU Reel ...................................................................................$10,200 SW 90 VA 4750 22’., 2800 hrs, UII PU Reel ...............................................................................$13,900 B 09 WS M150 30’, 299E hrs, 900 Front-16.1 X 16.5 Rear, D60 Hdr, SKD, PU Reel ....... $114,900 SW 09 WS M150 900 Front and 16.1 X 16.5 Rear, 5256 Total Acres Swathed, PU Reel, D60 Hdr $114,900 SW 97 WS 9200 25’, 1602 hrs, MacDon 960 Harvest Hdr, Hyd Deck Shift, PU Reel ............. $50,050 CC 01 WS 9250 25’, 1631 hrs, w/972 Head, Double Swath, SKD, PU Reel..............................$57,900 M 08 WS 9250 25’, 528 hrs, Rear Wgt Pkg, 21.5L-16 Drive & 9.5L-14, 972 MD Harvest Hdr$80,300 CC

w w w. m a z e r g r o u p . c a

Brandon 728-2244 Arborg 376-5600

79 CA 2390 160HP, 11,000 hrs, 20.8R38D, 1000 PTO, Dual Hyd ....................................... $11,900 N 11 CIH MAGNUM190 165HP, 768 hrs, 3 PTH, 3 Hyd, L780SL Ldr, 8’ Bucket ............... $146,900 ST 06 CIH MX255 255HP, 2200 hrs, 4 Hyd, 540-1000 PTO, Ezee Steer .............................. $116,900 ST 87 FIAT 180-90 180HP, 7050 hrs, MFWD, 3 PTH, Front Weights, Triple Hyd ................... $26,900 ST 86 JD 4650 165HP, 9013 hrs, FWA, 16.9X28 Front, 20.8X38 Rear, 15 Spd PS, 3 Remotes. $30,900 M 07 NH TG215 215HP, 2605 hrs, 710/70R38, 600/65R28, 3 PT, w/NH 870TL Ldr, 540/1000 PTO$128,900 B 04 NH TG285 285HP, 3414 hrs, 420/80R46D, 380/85R30, SS, 540/1000 PTO, 3 PT, 1000 PTO$108,900 B 11 NH T8.275 235HP, 1165 hrs, 480/80R50D, New 380/80R38, Triple PTO, 3 PTH ....... $160,900 B 11 NH T8.275 235HP, 650 hrs, PS, FWA, 480/80R50D, 380/80R38, Triple PTO, 3PTH ... $162,900 B 11 NH T8.275 195 PTO HP, 1140 hrs, NEW 480/80R50D, New 380/80R38 Front, 6 Remotes$160,900 H 09 NH T8010 175 PTO HP, 1755 hrs, 520/85R42 Duals, 16.9R30 GY, 540/1000 PTO, 3 PTH$134,900 H 10 NH T8010 175HP, 1816 hrs, 520/85R42D,16.9R30 Front,3 PT, 540/1000 PTO, 1000 PTO $137,900 B 10 NH T8020 200HP, 1440 hrs, 380/80R38 Frt, 480/80R50 Rear Duals, 4 Remotes, 3 PTH $148,900 P

TRACTOR 140+ HP

03 NH TV140 105HP, 4824 hrs, 420/85/r28, Rear Wts, 3 Spd, 7614 Ldr, Bucket & Grapple$51,700 P 06 NH TV145 105HP, 856 hrs, 16.9 x 38 GY, Mega-Flow Ready, EE Wts, 2 Hyd. Remotes$91,300 K 06 NH TV145 105HP, 8500 hrs, 480/85R34, Grapple, 3 PTH, 2 Remotes EE .................... $57,900 A 06 NH TV145 105HP, 3545E hrs, Cab End 3 PTH, 3rd Pedal, 540/1000 PTO, Long Loader$75,900 A 04 NH TV145 105HP, 2346 hrs, 16.9R38, Aux. Hyds, Bucket, Grapple, Manure Tines .......$74,900 M 08 NH TV145 145HP, 1350E hrs, 84LB Ldr w/Grapple, Cab End 3PH, Cab End PTO........$89,650 R 09 NH TV6070 145HP, 1661 hrs, 16.9R38, PTO EE, Remotes EE, 540/1000 PTO .......... $111,900 B 09 NH TV6070 145HP, 2824 hrs, 18.4 Non Directional, New Long Loader and Grapple. .$104,900 M 09 NH TV6070 145HP, 1242 hrs, 16.9R38, 3rd Pedal, Grapple, 540/1000 PTO ...............$108,900 B 09 NH TV6070 145HP, 980E hrs, 480/85R34 Non-Directional, 82LB loader .....................$107,500 R 09 NH TV6070 145HP, 1280E hrs, 480/85R34 Non-directional, 84LN Ldr, ...................... $104,400 R

TRACTORS BI-DIRECTIONAL

82 CA 2290 132 HP, 10,000 hrs, 18.4R38 Singles.................................................................$9,900 M 98 JD 6400 105 HP, 5036 hrs, 18.4R x 38 Rear, 13.6R x 28 Frt., 16 Spd., 540&1000 PTO $49,500 K 03 NH TM130 130HP, 7050 hrs, 20.8R38 Cast, 16.9R30 Fronts, w/NH 72LB Ldr, 96” Bkt . $47,900 B 01 NH TM135 100 PTO HP, 6519 hrs, 4 Hyd Remotes, w/ALO 980 Ldr, 95” Bkt ................ $47,900 H 07 NH T6030 95HP, 1269E hrs, 540-1000 PTO, 3 Hyd, 840TL Ldr Bkt 84” & Grapple ..... $72,600 SL 09 NH T6030 95 PTO HP, 1500 hrs, w/NH 840TL Ldr, 83” Bkt, 16x16, 3 Hyd, 3 PTH....... $71,900 SL 08 NH T6050 105HP, 420 hrs, 20.8 X 38 16.9 X 28, 3 Hyd, C/W Bkt & Grapple, 3 PTH .$96,800 SW 08 NH T7030 135HP, 3575 hrs, 850 NH Loader w/Grapple/Joystick ................................$87,900 SW 94 NH 8340 106 HP, 5266 hrs, 3 PTH, w/795 Allied Ldr w/96” Bkt ..................................... $20,900 A

COMPACT TRACTOR 100-139HP

79 AC 7000 106 PTO HP, 5300 hrs, 18.4R38 Rear, 10X16 Front, 2WD, 540/1000 PTO ...... $6,900 H 85 CASE IH 685 61HP, 3216 hrs, 16.9 X 30, 80%, Std Trans, 3PH, CIH 2250 Ldr/Bkt. ...$11,812 SW 68 IHC 656 65HP, 8500 hrs, 18.4 x 26 Rear Duals, 7.5 x 15 Front, 540 PTO, 3 Hyd. Remotes$5,740 K 07 KU M9540 84HP, 3420E hrs, 12.4-24, 18.4-30, FWA, Dif Lock, 2 Remotes, M30 Ldr w/Bckt$27,900 N 06 NH TN70 70HP, 535 hrs, MFWD, Canopy, 16 Spd PS, 3 PTH ...................................... $30,900 W 07 NH TT60A 60 HP, 813 hrs, FWA, 620TL Ldr, 16.9-28@80%, 9.5-24@80% .................. $24,900 B 09 NH TT75 65 PTO HP, 400 hrs, 16.9-30, 7.50-16, 2WD, 8X2 Trans, 3 PTH .................... $22,900 H

COMPACT TRACTOR 60-99HP

10 NH BOOMER 40 40HP, 213 hrs, Turf tires, 4WD, Hydro Trans, 250TL Ldr 3PT ........... $27,000 W 04 NH TC45DA 45HP, 2663 hrs, w/17LA Ldr, Hydro Trans, SS, R4 Tires, 4WD, 3PTH ..... $21,280 W 10 NH WRKMST 55 392 hrs, w/615TL Ldr, w/ Skid Steer Quick Attach, 4WD, 8x8 Trans, 3PTH $29,680 W 94 UN 530DTC 52HP, 2026 hrs, 3PTH, w/Allied 594HSL Ldr, Bale/Manure Fork ............... $12,900 N

COMPACT TRACTOR 40-59HP

98 JD STX38 w/38” Mower Deck, Hydro, 13HP.....................................................................CALL SL 89 JD 332 1000 hrs,16HP Diesel Eng., 2WD, Hyd. Trans, 48” Mower Dk, Rear Mnt. Tiller $4,500 W 96 NH CM224 582 hrs, 22HP, 60” Deck, 2 Speed Hyd, 4WD, Diff Locks, ............................. $6,900 P 07 NH G4010 19HP, Zero Turn, 42” Deck, 2 Blades ..............................................................$2,190 M 04 NH MZ18 18HP, 44” Deck ...............................................................................................$2,900 ST 99 NH TC18 1800 hrs, 15 PTO HP, FWA, Hyd, 3PTH, w/NH 914 60” Mower ....................... $7,900 H 00 NH TC21 1832 hrs, 20HP, MFWD, 3 PT Turf Tires, Hydrostatic, ROPS ......................... $7,900 ST 08 NH T1010 230 hrs, 20HP, Turf Tires, 10LA Loader, 54 CMS Mower, GC Bagger .......... $16,875 W 07 TO GT2200 100 hrs, 25HP, Riding Mower, Rear Bag, 50” Mid Mnt ................................. $6,750 W

COMPACT TRACTOR 40HP

PRE-OWNED EQUIPMENT

Saskatchewan FarmLIFE, Monday, March 19, 2012 PAGE 11


PAGE 12

Saskatchewan FarmLIFE, Monday, March 19, 2012

Bill Klassen Auctions Ltd. GIESBRECHT RICK AND LIZ FARM AUCTION SATURDAY APRIL 7 10 AM 2012 DIRECTIONS: Location at the Farm from Lowe Farm 2 miles west on Hwy. 23, then 3.5 miles south on Road 8 west. Yard # 20071 Will have signs up auction day. will be selling aprox 2 hours of smalls with internet powered by Bidspotter begining at 12 noon will have line up on website closer to auction day, TRACTORS s6ERSATILE3ERIES))HOURS"OTTOMEND DONEATHOURS/UTBACKGUIDANCEANDAUTOSTEER XTIRES s6ERSATILE3ERIES)))HRS"OTTOMENDDONE ATHOURS2 s2ADIALTIRES !TOMJETKIT PLUMBEDFORAIRSEEDER4RIMBLE GUIDANCEANDAUTOSTEER s*OHN$EERE0REMIUM-&7$ HOURS 22EARAND2 s&RONTTIRESSPEED!UTO1UADPLUSTRANSMISSION AIRSEAT FRONTFENDERS/UTBACKGUIDANCEANDAUTOSTEER s)(#$HOURSPTH ALLIED&%, DUAL HYDRAULICS HARVESTING EQUIPMENT s*OHN$EERE343COMBINESEPARATOR HOURS'REENLIGHTEVERYYEAR LPICKUPHEAD *OHN$EERE !UTOTRACGUIDANCEANDMAPPING!UTOHEADER  3PADE'RIPTIRES s&LEXHEAD PICKUPREELANDPOLYSKIDS s2IGIDHEADBATREEL s %LMERSHEADERTRANSPORT s %LMERSHEADERTRANSPORT

s#ASE)(3WATHERHOURS5PICKUP REEL DOUBLESWATH%: 3TEER s'UIDANCEANDAUTOSTEERANDMOUNTEDROLLER s5NVERFERTHGRAINCART TIRES ROLLTARP s&ARMFAN!"!GRAINDRYER TRUCKS s)(#%AGLEWITH ,OADLINEBOX HOIST ELEC TRICROLLTARP 2EMOTEHOISTANDCHUTE (0$ETROITWITH INFRAMEDONERECENTLYSPEED WILLBESAFTIED s'-##WENGINETRANSMISSION  #ANCADEBOX HOIST MILES 3AFTIED s#HEVY3ILVERADOXMILES USEDFOR SERVICETRUCK s,OAD+INGGRAINHOPPERTRAILER sTH7HEEL&LATDECKTRAILER ALMOSTNEWAXLES WHEEL ANDBRAKES B s 9AMAHAX+ODIAK1UADKMS TILLAGE s#ASE)(CHISELPLOWWITHMOUNTEDHARROWS ANDAUTOWINGLOCK s#OOPDEEPTILLERWITH2AVEN!UTORATE CONTROLLERANDRADAR WALKING s!XLES REARHITCHANDHYDRAULICWINCHANDMOUNTED HARROWS s -&DISKERS-ARTINHITCH HYDRAULIC CYLINDERSANDHARROWS s4OR-ASTERDIAMONDHARROW s4OR-ASTERHEAVYHARROW"IGTIRESvHARROW TEETH s#RUSTBUSTERTANDEMDISK CYLINDERSANDHOSES s*OHN$EEREPTHDEEPTILLER s#ULTIVATORSHOVELSETS s/LDERBOTTOMPLOW

s3HOPBUILTPTH6DITCHER s GAL.(TANKSONTRAILERSPRESSURETESTED SPRAYER & ACCESSORIES s(ARDI#OMMANDER0LUSHIGHCLEARANCE SPRAYER4RIPLETNOZZLES s$IAPHRAGMPUMP AUTORATECONTROLLER s#HEMHANDLERANDHP(ONDAWATERPUMPONFRAME s 53GAL%NDURA0LASWATERTANKWITHVALVESGOOD FORFERTILIZER s 53GAL%NDURA0LASNURSETANKWITHVALVE s GALGALVANIZEDWATERTANK s3PRAYERPUMPSANDNOZZLES GRAIN HANDLING s&ARM+ING LOWPROlLEHOPPERHYDHOPPER MOVERANDWINCH s7ESTlELD-+ AUGER s7ESTlELD4& AUGER(HYDAUGERMOVER BIN SWEEPPLUMBING s7ESTlELD7 AUGERWITHLHP(ONDAMOTOR s7ESTlELD7 AUGER s7ESTlELD PTOAUGER s (YDRAULICDRILLlLLAUGER s 7ESTlELDUTILITYAUGER s UTILITYAUGER s7ESTlELDREARMOUNTvDRILLlLL s$"$RILLlLLTANKLAND4 ROLLTARP ELECTRICOVER HYDRAULICCONTROLS s7ALINGA'RAIN6ACWITHHOSES s "ALDORHPELECTRICMOTOR s "ROOKHPELECTRICMOTOR s-ISCELECTRICMOTORS s 7HEATHEART(YDRAULIC"IN3WEEP

Bill Klassen Auctions Ltd. LARGE FARM EQUIPMENT AUCTION FOR YUILL FARMS AND ESTATE OF THE LATE KEN YUILL WEDNESDAY APRIL 18, 10 AM 2012. DIRECTIONS: Location at the seed plant, HWY 1A Exit east side of Portage La Prairie. 1 mile north of Allis Chalmers Museum on road 34 west will have signs up auction Day s#ASE)(-ODELWHEELDRIVE SPEED STANDARD 2AVENAUTOSTEER REMOTES WITHX TRIPLES HOURS SERIAL s#ASE)(-8-&7$ PTH PTO REMOTES  REARTIRES WITHFRONTENDLOADER QUICKBUCKETETC HOURS s)NTERNATIONAL-ODEL(YDRO PTH CAB WITH HIGHLIFTLOADER XTIRES s*OHN$EEREMODEL -&7$ PTH DUALPTO  REMOTES2AXLEDUALS SERIAL CHECK WEBSITEFORHOURS s*OHN$EEREUTILITYDIESELWITHFRONTEND LOADER PTH PTOROLLBARHILOSHIFT s*OHN$EEREUTILITYDIESELWITH,EONLOADER PTH PTO ROLLBARANDHILOSHIFT s*OHN$EEREDIESEL##RAWLERWITHLOADER AND REMOTEHYD SERIAL s9ANMARDIESELYARDTRACTORPTH PTO HORSE POWER ONLYHOURS

HARVESTING s#ASE)(COMBINE3PECIALROTOR NEWFRONTBARS ANDFEEDERCHAIN PICKUPANDHOPPERTOPPER s#ASE)(FTmEXHEADER s*OHN$EERECORNHEADWITH)(ADAPTORTO ETC FTPTOSWATHER s.EW(OLLANDSWATHERPOWERUNIT WITHFT (ONEYBEESWATHHEAD 5))PICKUPREEL PLUMBEDTORUN +EARSHEERS s4WOSWATHROLLERS s"ELTCONVEYORSUSEDTOUNLOADCOMBINEHOPPERS TRUCKS AND TRAILERS s&ORDHIGHWAYTRACTOR DAYCAB #UMMINS SPEED WETKIT XTIRES SAFTIED -ACKHIGHWAYTRACTOR MACKSPEED SLEEPER AIRRIDE s-ACK(IGHWAYTRACTOR MACKENGINE  SPEED AIR2IDE XTIRES

s-IDLANDTANDEMXTIRESENDDUMPGRAINTRAILER XXSIDES2OLLTARPSERIAL-'3#/. 2/ s,ODE+INGTANDEMSETOFSUPER"3 CURRENT SAFTIED  TIRES&! s&ORDGAS6 FTBOXHOISTROLLTARPNO SAFETY

R.R.1, Box 81, Winkler, MB, Canada R6W 4A1 Ph: 204-325-4433 â&#x20AC;¢ Cell: 204-325-6230 www.billklassen.com Email: bill@billklassen.com GRAIN BINS & ACCESSORIES s -ERIDIAN&RIESENBIN s -ERIDIAN'RAIN-AXBINS ONEONSKID2OCKET AERATION /PICABLES SIGHTGLASS s %DWARDS#ENTRIlCALFANS s HPvFAN s #ALDWELLHPvFANS s +EHOv#ENTRIlCALFANS s #ROSSDUCT+EHOAIRATION s 0ORTABLEBINAIREATIONNEEDSFAN s EXTENSIONCORDS  L      s/PI /NEPROBEANDMONITOR s'RAINANDTEMPPROBE s,ABTRONICSvGRAINMOISTURETESTER MISC. EQUIPMENT s4WOFUELBOWSERS sGALFUELSTORAGETANKWITHELECTRICPUMPANDMETER s4RUCKSERVICETANKWITH6PUMP s$ELTAALUMINUMTRUCKSTORAGEBOX s(ONDAPOWEREDPRESSUREWASHERPSIGAL MIN s 7AYRADIOSANDANTENNAS s (ANDHELDWAYRADIOS s,AND0RIDEPTHBLADEWHYDANGLEANDTILT s"UHLERSNOWBLOWERWITHHYDCHUTECONTROLS s*OHN$EERELAWNSWEEPER s!LUMINUMEXTENSIONLADDERS s3TEPLADDERS sSWINGSHOCKHITCHES s3OMESUITCASEANDWHEELWEIGHTS sLARGEAMOUNTOFGOODSHOPTOOLSAND&ARMHARDWAREAND GOODAMOUNTOF(OUSEHOLDMERCHANDISE see www .billklassen.com for more complete list and some photoâ&#x20AC;&#x2122;s Lunch available. Owners 204 746 8365

R.R.1, Box 81, Winkler, MB, Canada R6W 4A1 Ph: 204-325-4433 â&#x20AC;¢ Cell: 204-325-6230 www.billklassen.com Email: bill@billklassen.com

PLANTING s*OHN$EERE-AXIMERGE0LATE ROWIN s*OHN$EEREROWXINWPLANTERUNITSW MAXIMERGECLOSERS s6ERTICALE0ARRALLEL&OLD s%LMERSROWBANDSPAYERSETUPFORBEANS s&LEXICOILSYSTEM FTSPRAYER INDUCTIONTANK WIND SCREENSSHEDDED s&LEXICOILSYSTEMSPRAYERWITHWINDSCREENSFTNO WINDSCREENS TILLAGE AND OTHER FARM EQUIPMENT s3UN&LOWERFTTANDEMDISCNICESHAPE s#ASE)(FT6IBRATILLERWITH.(KITANDHITCH s#ASE)(FT6IBRATILLER s#CILFTCULTIVATOR s7ESTERNFTHARROWPACKER"ARvCOILSHYDRAULIC TILTLIFTANDFOLD s-ELROE BOTTOM-OULDBOARDPLOW s2AU KOMBIFTPTHSEEDBEDDERMACHINE sFTTINEHARROWS sFTDIAMONDHARROWS s!UGERSALL3AKUNDIAK svXWITH(ONDAPOWER svXPTO vXPTO svXWITHSWING svXWITHSWING

svXMOUNTEDONSELFPROPELLEDCOMBINE CHASSIS 5NITED&ARM4OOLSGRAINCART XTIRESHYD DRIVE s+LONSKILDEGRAINVAC MISC FARM s'RADERCONVERTEDTOREGULARTRACTORHITCH s&RONTMOUNTEDBLADE s3NOWBLOWERIN)NLAND NICE s3NOWBLOWERvINLAND GOOD s5TILITYTRAILERS s,ILYPTHFTDISCBINE sPTHPOSTPOUNDER sPTHWAYBLADE sPTHvTILLER sPTHIN&ARM+INGlNISHMOWER sPTHWOODSFTROTARYMOWER Very little small selling please be on time. information on items call Kevin Yuill 204 857 8708 Please Note some of the machinery listed here will be updated on our website www.billklassen.com 204 325 4433 cell 6230 internet bidding with Bidspotter begins at 11.30 am see website for details,


Saskatchewan FarmLIFE, Monday, March 19, 2012

Bill Klassen Auctions Ltd. LARGE FARM EQUIPMENT AUCTION FOR VERENA LOBSIGER AND THE LATE DANIEL LOBSIGER TUESDAY APRIL 10 . 11 AM 2012. WE MAY RUN 2ND RING FOR HOUSEHOLD, AT 11.30 PLEASE NOTE MRS VERENA LOBSIGER IS MOVING TO SWITZERLAND SO EVERYTHING WILL SELL TO THE HIGHEST BIDDER DIRECTIONS: from Dominion City 7 miles south on 200, and east on 218, or from Ridgeville follow 218, 2 miles south and one west on 218 s#ASE)(3TEIGER SPEEDSTANDARD PTO REMOTES 2@DUALS HOURSSHOWING SERIAL*%%/// s#ASE)(-ODELWHEELDRIVE POWERSHIFT REMOTES PTOWITH,EON FRONTENDLOADER )(#MODEL PTH DUALPTO4! DUAL HYD X s3TEIGER34WHEELDRIVE #AT ENGINEPLUSHORSEPOWER  SPEED REMOTESX3UPERIOR$UAL WHEELSYSTEM DUALSCENTREHINGESDONEAND PLUMBEDFOR'03 3OLIDTRACTORCONSIGNED BY"RYRON(EINRICHS VEHICLES s#HEVROLET%QUINOX,4 !7$ $OOR CYLINDERSTICKAUTOMATIC BROWNINCOLOUR LOADED ONLYONEOWNERKM SERIAL #.&,'%#" s$ODGE2AM3,4 CYLINDER DIESELPICKUP XAUTOMATICQUADCAB SHORT BOX LOADED ONEOWNERKMATLISTING SERIAL$,8#' s#HEVROLET #HEYENNEDAYCAB LONGBOX VSPEEDSTANDARD NICECLEAN FARMTRUCK KMSHOWING HARVESTING s*OHN$EERE#OMBINE WITH BELTPICKUPONHEAD DUALSPEED CYLINDER CHAFFSPREADER HOPPEREXTENSION

X2ICETIRES ONLYENGINE SEPERATORHOURS SERIAL s*OHN$EERECORNHEAD( 8  ROWXINCH POLYDIVIDERS REALNICE UNIT s*OHN$EERE&LEXWITHPICKUPREELFORE AFTSERIAL&WITH"ERGEN HEADERTRANSPORT s#ASE)(PTOAUTOFOLDSWATHER WITH PICKUPREEL TILLAGE AND SEEDING s*OHN$EEREPULLBETWEENAIRCART X WITHMODELSEEDINGTOOL FTINSPACE WITHSPLITTERBOOT mOATING HITCH $EGELMANMULCHERS s*OHN$EEREMAXIMERGEVACUM PLANTER WITHINSECTICIDEATTACHMENT TRAILING TYPEHITCH FOLDINGMARKERS s#ASE)(MODELDEEPTILLERFTWITH .(KIT s2AVENRATECONTROLLER MULCHERS s4ORMASTERFTDIAMONDHARROWSAUTOFOLD s*OHN$EEREXKICKBACKPLOW CANNOT lNDMODEL GRAIN HANDLING s2EMGRAINVAC MODELWITHLOTS OFPIPENOZZLEETCONLYTOTALHOURS s&ARM&AN!"!GRAINDRYERSINGLE PHASE HOURS SELLSWITHLOADINGAUGER s,ABTRONICSCELLGRAINMOISTUREMETER COMPLETE s7ESTlELDAUGERS-+8,IKENEW -+8 8 W"RIGGS8W HPELECTRICANDNEW*WHP(ONDA ELECTRICSTART s7OODS&4-ODEL#$STOCKSHEDDER PTODRIVETRAILERHITCHSERIAL s3PRAYER.EW(OLLAND&LEXICOIL MODEL 3& WITHWINDSCREENS XTIRES LITERTANK TOTALHYDRAULICFOLDAND HEIGHT INDUCTIONETC SERIAL0., s4WOMARTINCAPITALWHEELTRAILERSSERIAL  2XTIRESWITHAPPROX BUGRAVITYBOXES s4RUCK&RAMETANDEMAXLETRAILERX TIRESWITHFARMTRACTORHITCHXBOXAND

PAGE 13

R.R.1, Box 81, Winkler, MB, Canada R6W 4A1 Ph: 204-325-4433 â&#x20AC;¢ Cell: 204-325-6230 www.billklassen.com Email: bill@billklassen.com

HOISTWITHCOMBINATIONGRAINANDSILAGEEND GATE JACKLIGHTSETC REALHEAVYDUTYSETUP s,ANDLEVELERFTDUALHYDRAULICBUILDBY 6ITA7ELDING

s0LANTERSROWINCHSPACING *OHN DEERE s!LLOWAYROW2OWCROPCULT

s4WO*OHN$EEREROWALLCROPHEADERS s4ILLAGE#I-ODELDEEPTILLERFTWITH MISC 'AUGEWHEELSAND-ULCHERS s7INPOWERPTO GENERATORON s"OURGAULT#ULTIVATORFTWITH+NOC WHEELTRAILER ON3HOVELSANDMULCHERS s$IESELFUELTANKSTWOGAL ONE s0OWERMATICFT$IAMOND(ARROWAUTOWITHVOLTPUMPSANDBOWSER FOLD sFTPTHROTARYMOWER s(UTCHMASTERFT4ANDEMDISC s-4$YARDTRACTORHPHYDROWITH s$UETZ!LLISAPROZFT2UBBERMOUNTED MOWER SHANKlELDCULTIVATOR s0USHTYPE9ARDMANLAWNMOWER s04((EAVYDUTYPTODRIVEROTARY$ITCHER sXFT#ORRALPANELSONEWALKINWGATE s4URNCOGRAVITYWAGONONWHEELTRAILER sXCLAMPONDUALSWITHGOODTIRES RUNNINGGEAR OTHERDUALHARDWARE s&ARM+INGINPHDUALAUGERSNOW s,ARGESTACKCOVERTARP "LOWER s)NBACKYARD *OHN$EEREAIRSEEDERAIR s&ARM+INGX@'RAINAUGERDUAL CARTONLYWITH4"(HITCH CONDITIONASIS AUGERINLOWPROlLEHOPPER sXBEAVERTAIL CHECKERPLATETOP s&ARM+INGX!UGERWITHSWINGHOPPER XLBAXLESBRAKESONvTIRESXBOLT s3AKUNDIAKXFTGRAINAUGERWITHHONDA RIMS vFRAME ENGINE s7ESTlELDXAUGERLESSENGINE HOUSEHOLD sPTH"LADE sALL&URNITUREINHOUSE$ININGSUITEBEDROOM s"RANDTPTSPOTORESTATESPRAYERAPROX SUITE ,IVINGROOM&URNITUREETCPLEASESEE FTFOLDINGBOOMSETC 0HOTOSONWEBSITE s4WOGAL.(TANKSON2UNNINGGEARS s'ALFUELTANKWITHVOLTPUMP FOLLOWING Farm Equipment from s GALLOWPROlLE&IBERGLASSWATER Neighbour Jamie Toffelmire will sell at TANK Lobsiger auction s3HOPPRESSCRANECAM&RAMEONLYWITH s4RACTORS)(#MODEL(YDRO2OWCROP ADJUSTABLE"ED DUALPTO$UALHYD OPENSTATION2OLL"AR s@#OLDWELLHPAERATIONFAN WITHCANGOOD XTIRES VASTRANSITION s)(#%AGLEHIGHWAYTRACTOR CAT s4WO@#OLDWELLHPAERATION&ANS ENGINESPEED $AYCAB WET+IT  X s#!3%)(MOUNTEDAXLEDUALSXON TIRESAIRRIDESUSPENSIONNOSAFETY RIMSCWWITHAXLE#LAMPS s3EEDTENDERUNITFTDUALCOMPARTMENT s-AGIQUISTPRESSUREWASHERREALNICE TWINREARAUGERDISCHARGEMOUNTEDONFT s3OMESHOPTOOLSETC,+3!MPSTICK TANDEMAXLESEMITRAILERXTIRES WELDER sFTSEMITRAILER&IELDSPRAYERTENDER SINGLEAXLE'REAT$ANEVAN"ODYWITHTWO GAL0OLYWATERTANKS #HEMICALINDUCTION4ANK HPPUMPANDlLLERHOSEREEL

s/LDER4RIPLEAXLEFT4RAILERWITHSELF CONTAINED2AMPIDEALFORHAULING3KIDSTEER


PAGE 14

Saskatchewan FarmLIFE, Monday, March 19, 2012

USED COMBINES/HEADERS 2003 JD 9750STS 1444T hrs., Green Star . . . . . . . . . . . . . . . . . . . Coming In 2003 JD 9750STS 1691T hrs . . . . . . . . . . . . . . . . . . . . . . . . . . . . Coming In 2008 Case IH 8010 650T hrs., chopper, pickup table, y/m. . . . . . . $239,000

2 - CASE IH 8120 350 hrs, Luxury cab, fine cut chopper, rock trap, Pro 600 w/ auto steer, long auger Cash No Trade Price till end of March

$275,000 ea. 4.49% Financing OAC 2 - 2007 NH CX8080 1050 hrs.. . . . . . . . . . . . . . . . . . . . . . ea. $225,000 MacDon 873 adapter for JD 9600 to MacDon 972, 973, 962 . . . . . . . $9,500 2007 NH CR9070 1200 hrs . . . . . . . . . . . . . . . . . . . . . . . . . . . . $199,000 2 - 1997 30’ Honeybee headers for 2388 combines, bat reels . . . . . . $15,500 30’ MacDon D60 c/w CNH Adapter. . . . . . . . . . . . . . . . . . . . . . . Coming In 35’ MacDon D60 c/w CNH Adapter. . . . . . . . . . . . . . . . . . . . . . . Coming In 36’ MacDon 960 c/w JD Adapter . . . . . . . . . . . . . . . . . . . . . . . . . . $12,900

USED FORAGE/HAYING

Step into the productivity of a new Guardian™ front boom sprayer from New Holland and you won’t turn back. With the boom in front, you have a complete unobstructed view of every nozzle. This outstanding visibility means you can run the boom closer to the ground to control drift. Spray is delivered into the crop before the first tires go over it, eliminating the potential for dust to neutralize the spray. Start achieving a new level of spraying freedom and productivity. THE HIGHEST HORSEPOWER AVAILABLE – UP TO 365 HP THE LARGEST TANK SIZES – UP TO 1,600 GALLONS THE HIGHEST CROP CLEARANCE – SIX FEET THE TIGHTEST TURNING – 15-FOOT TURNING RADIUS THE SMOOTHEST SUSPENSION – 20 INCHES OF TRAVEL

SP240FXP IN STOCK

JOHN BEYER

• Cell: (403) 380-0488 • Res.: (403) 345-3275

2006 NH FX60 harvester, 850 CH hrs., field ready . . . . . . . . . . . . . $165,000 RS510T Vicon tedder. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,000 3800 Vicon disc mower conditioner, 13' cut, 2 pt . . . . . . . . . . . . . . . $9,500 NH 688 round baler, twine bale command . . . . . . . . . . . . . . . . . . . . . $9,900 NH 688 round baler, twine bale command. . . . . . . . . . . . . . . . . . . . $12,000 2007 NH BR780A net wrap . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $24,500 2007 NH 1431 discbine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $22,500 NH HW300 12’ header. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $35,000 NH 575 baler . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $16,000 NH 660 round baler . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,500 NH 1069 bale wagon, gas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $34,500 NH RI450 corn head . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $35,000

USED SEED & TILLAGE Flexi-coil 2320 Air Cart tow behind . . . . . . . . . . . . . . . . . . . . . . . $18,500

USED SWATHERS 1999 MacDon 802 TV140 header adapter . . . . . . . . . . . . . . . . . . . $4,000 2005 MacDon 9352i c/w 30’ 972 header, 1200 hrs . . . . . . . . . . $69,000 MacDon M200 c/w 16’ disk head & 30’ D60, Outback auto steer . $155,000 MacDon M150 c/w 25’ D60 D/K D/S . . . . . . . . . . . . . . . . . . . . Coming In 2004 MacDon 9352i c/w 25’ header. . . . . . . . . . . . . . . . . . . . . Coming In

USED TRACTORS NH Versatile 9880 c/w 14' Degelman dozer. . . . . . . . . . . . . . . . . . $69,000 2006 NH TG210 4500 hrs.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $89,500 2003 NH TM155 4795 hrs, suspension, 72LB loader/gpl, 3 pt . . . . $65,000

USED SPRAYERS Hardy 60' susp. boon sprayer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $8,500 Brandt QF1000 120' . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,800 Miller Condor G75 Sprayer 1200 gal. poly tank, . . . . . . Call for Details 120’ boom, CLEARANCE PRICE. . . . . . . . . . . . . . . . . NEW

GENO KORNELSON

• Cell (403) 382-5028 • Res.: (403) 320-7309


Saskatchewan FarmLIFE, Monday, March 19, 2012

PAGE 15

Check out fall programming on Morris Equipment!

MANUFACTURING

Magnum Coulter Disk AIR DRILLS - AIR SEEDERS Morris 9000 (25’) w/valley packers & 7130 Tank.$21,900 ‘02 Morris Max II Air Drill (49’) 12” DS w/7240...$84,000 Morris Maxim (40’) 7.5 spacing...........................$23,500 ‘97 Morris Max (34’) 10” D.S. ..............................$22,500 John Deere 610 29ft w/harrows, 777 tank ...........$28,900 AIR TANKS ‘94 Morris 6240 Air Seeder, excellent ................$20,000 ‘93 Morris 6180 Engine Drive ................................$8,900 SWATHERS & HEADERS ‘05 Westward 9352i w/30’ 963 PUR....................$83,500 ‘05 Westward 9352i w/30’ 963, 600 hrs ..............$79,500 ‘02 Westward 9250 1750 hrs, w/’04 972 (30’) ..... $58,900 ‘03 Premier 2940 w/30’ 962 hrs 1150 hrs ............ $57,500 ‘08 Case 1203 w/36’ Honeybee & 18’ auger hdr $109,000 ‘97 MF 220 (30’) PUR 1500 hrs............................$28,500 ‘97 Massey 220 w/30’ 1600 hrs ...........................$24,500 Westward 3000 25’, pull type, PU reel ..................$6,900 BALE PROCESSORS Bale King 2020 w/grain tank..................................$8,900 TRACTORS Kubota M8950DT loader, cab, 7000 hrs..............$25,900 ‘06 Kubota M125XDTC w/loader grapple 3800 hrs...............................................................$62,500 ‘08 Kubota B2320HST w/loader 65 hours ...........$13,900 Kubota BX2350 w/mower/tiller ............................$10,900

1985 IHC 5488 w/duals .................................. Consigned MOWER CONDITIONERS Hesston 1150 (12’) ................................................$3,900 Hesston 1170 (16’) ................................................$6,900 New Holland 116 (16’) ...........................................$3,900 MISCELLANEOUS ‘02 Rem 2100 grain vac ........................................ $9,350 Morris Wrangler III wing up packer bar................. $4,900 ‘08 Rem Grain Bagger, done 15 bags ................ $16,500 ‘06 Kawaski 3010 Mule trans 950 hrs ...................$6,300 Schulte Rotary Cutter.........................................$16,900 Schulte SD 110” Front Blower............................. $7,900 Rockamatic Stone Picker.....................................$2,900 Ezee-on loader with bucket .................................$3,900 Schulte RS320 Conveyor Picker .......................$11,900 Schulte XH1500 w/hitch ......................................$24,500 New 4” Rubber Packers for Maxim Air Drill ........ CALL ‘09 REM 2700 Vac ...............................................$18,900 Verns Swath Roller ..................................................$900 AUGERS ‘08 Farm King 16x104 Auger .............................$29,500 ‘08 Farm King 13x70 Swing Auger ......................$9,900 Sakundiak 7x1200 w/engine .................................$2,750 Brandt 8x47 w/mover/engine.................................$5,900 (All Current Listings are Cash Prices)

(204) 748-2408 UÊ6, ]Ê /"  “Quality Products, Quality People...Here For Your Farm Equipment Needs!”

After Hour Sales Call: Trevis Hunter 204-748-7437 David Draper 204-748-5528

Gates Coulter Disk is a vertical tillage tool that gives you maximum versatilty by also performing as disk harrow. 0˚ to 15˚ Gang Angle

$74,900 Early order Special or lease for $7,200 SA TRACTORS 2007 CaseIH STX 480 Quad Track 3280 Hours, Gps, Diff locks, ....................................................................$205,000 9370 Case/IH 7800 hrs ‘98 PS24.5 rubber 50% rubber .......................................................................$69,500 NH Ford 9880 1995 20.8x42 5800 hours duals ... $76,500 NH T7040 2009, 150Hp, FWA, 3 remotes, 18.4x 42 tires with rear duals, 3pt weights, 680 hours .............. $109,500 Versatile 2425 4500 hours, power shift, 710/38, $119,500 Versatile 2425 3600 hours standard, 710 / 38 .. $112,500 Versatile 855, New rubber, nice shape, 9000 hrs $26,500 John Deere 9400 5300hrs 20.8x 42 tripples 12 spd$106,500 TILLAGE Gates Heavy Harrow 2009 104 ft.........................$29,500 Delmar Heavy Harrow 1996, 84ft ........................$16,800 Summers 2010 84ft heavy Harrow .......................$31,500 Phillips Rotary harrow 2010 45ft like new ..........$29,900 Flexi-Coil 800 Deep Tiller 50ft, new bushings .....$17,500 AIR DRILLS Seedhawk 1998 42’ 10” space, double shoot granular & NH3, loading auger, 105 bus tank on board. Liquid kit & on board 1250 gl tank. .......................................... $62,000 Case/IH 2009 3430 pro 600 monitor, TB, Mech drive ........................................................... $59,500

SPRAYERS 4730 JD 90 foot 2010, GPS, 900 hours, ........... $209,500 Apache 1010 2008 335 hrs, 100’, auto boom, 2 sets of rear rubber, EZ steer, 2 yrs Ltd powertrain warr . $139,500 Summers 1995 100’ PT hi clearance sprayer...... $22,500 MISC Buhler 16 x 104 Auger 2009 ............................... $26,000 Buhler 13x95 2004 auger, hydraulic swing, and lift$9,800 2008 Horsh Anderson 40-15 seeder with a 2006 Horsh tank 300 bushel, Dutch openers and liquid kit ... $135,000 2007 570R Cat Combine 700 thresher hours duals, pick up........................................................................ $165,000 Pattison CB 3200 2011, low acres, loaded w/options ............................................................. $39,500 New 3250 Gallon Caddy w/John Blue, 3” ......... $35,000 Bew 1600 Gallon Caddy w/John Blue drive & pump ................................................................. $19,500 Leon 1700 gallon Liquid Caddy, John Blue....... $12,500 WIDE VARIETY OF LIQUID STORAGE TANKS AVAILABLE, CALL FOR PRICING AND SIZE AVAILABLITY

South of Brandon, MB I 204-483-2774


PAGE 16

Saskatchewan FarmLIFE, Monday, y March 19, 2012

Fernie Alpine Resort Mountain Stats 838cm snowfall to date 140 runs plus glades 1,082m vertical 1,013 hectares 5 alpine bowls & 10 lifts 30% 40% 30% Ski-in ski-out lodging

BEST DEALS OF THE SEASON

On Now!

Mid-Week Specials. Includes 30% off Lift Tickets! - Ski & Stay for $96! $42 per night per person. Choose from ski-in ski-out, on-mountain or in-town. Hotel, condo or townhome! - Luxury Ski-in Ski-out! 3rd Night Free at Snow Creek Lodge. - Hostel it! $29 per night per person. - Book by March 30th

Coming over for a weekend? Ski & Stay from $107!

Coming over for a week? Buy 7 nights Pay Only 5!

EXPLORE MORE OF FERNIE & BOOK TODAY 1-877-933-7643 | TOURISMFERNIE.COM | FACEBOOK.COM/FERNIE.CANADA

SK0319  

The leading farm buyers' guide in Saskatchewan

Read more
Read more
Similar to
Popular now
Just for you