Page 1

MANITOBA

30 min NE of Brandon Call Trent or Reg 204.763.4746 Toll Free 1.877.213.8225

Wrecking Newer and Older Heavy Trucks

Visit us online @ www.loewensalvage.ca for a listing of some of our inventory

Your Complete Farm Information Source

www.farmpressltd.com

MANITOBA EDITION

MONDAY, MARCH 12, 2012 - VOLUME 32, NO. 06 204-745-2054

Arborg, Manitoba

www.gveag.com

www.vikingmotors.ca

2011 TRAVERSE FWD remote start Bluetooth park assist msrp 41105

2010 JD 9630T

$29,900 1-888-204-2342

815 hrs

$321,800

Morden 1-866-325-7742 Altona 1-866-324-6456 Killarney 1-866-523-7571 Treherne 1-888-382-6866

Call for Spring Demo

located @ Greenland Equipment Hwy #3 South Carman, Mb

The Best Pre-Owned

W N Combines ON XIIO EX LE NL ON TIIO DIIT ED NE DN CD NC RN ER TE ST ES WE Available in Every Class Size NEW CH MT535B

’08 NH CR9060

NEW CH LB34B

130 hp, economy pto 24 spd Autopower VI

477 hrs Deluxe Chopper

Cutter, Flat Bale Chute GTA Console

$129,900 CASH

$206,900

$103,450 CASH

1 (877) 353-4343 ELIE • BRANDON • MORDEN

Visit www.toromontag.com Today!

NOW IS THE TIME TO PRE-BOOK YOUR

HIGH VOLUME WATER PUMP MANUFACTURING

FOR SPRING!

Magnum Coulter Disk

Available sizes: 21’ length x 6� diameter 21’ length x 8� diameter 21’ length x 12� diameter 21’ length x 16� diameter

UP TO 10,000 GPM!!!

UĂŠx{äÊ,*ĂŠ`Ă€ÂˆĂ›iÂ?ˆ˜i UĂŠՓL>VÂŽĂŠ`iĂƒÂˆ}˜ UĂŠ iÂ˜ĂŒĂ€>Â?ĂŠÂ?Ă•LĂ€ÂˆV>ĂŒÂˆÂ˜}ĂŠÂŤÂœÂˆÂ˜ĂŒ UĂŠ/Ă€>ˆÂ?iĂ€ĂŠÂ“ÂœĂ•Â˜ĂŒi`ĂŠĂƒĂžĂƒĂŒi“ UĂŠ"ÂŤiÂ˜ĂŠÂˆÂ“ÂŤiÂ?Â?iÀÊ`iĂƒÂˆ}Â˜ĂŠ>Â?Â?ÂœĂœĂƒĂŠĂ•ÂŤĂŠĂŒÂœĂŠĂŽÂťĂŠ`ˆ>“iĂŒiÀÊ ÂœLÂ?iVĂŒĂƒĂŠĂŒÂœĂŠÂŤ>ĂƒĂƒĂŠĂŒÂ…Ă€ÂœĂ•}Â…ĂŠĂœÂˆĂŒÂ…ÂœĂ•ĂŒĂŠĂƒĂŒÂœÂŤÂŤÂˆÂ˜}ʍՓ

USED EQUIPMENT SEEDING Flexi-coil 3850 TB Air cart Variable rate 2004 $45,000 Flexi-coil 1720 TB air Cart with dual casters ... $14,500 TILLAGE @ HARROWS Flexi-coil 820 chisel plow 41 ft 3 bar harrows 12� spacing .................................................................... $27,500 CIH 4700 48ft 6� spacing 3 bar harrows ............ $6,500 CIH 49ft 4700 6� spacing 3 bar harrows ......... $7,000 HAY & FORAGE NH BR 780 Auto wrap .................................... $16,950 Heston 560 RB new belts ............................... $5,800 NH 688 Round Baler .................................... $14,999 NH 688 Round Baler ..................................... $13,000 NH 499 Pivot Tonque mo co 2007 like new .... $22,000

Gehl 2275 14 ft Hydro swing 1995 good cond .. $6,950 CaseIH 8465A Round Baler 1999 excellent.... $15,900 SKID-STEER LOADERS & BUCKETS 2011 NH L185 Skidsteer 2011 650 hrs cab heat A/C like new ............................................................ $35,900 Bobcat 773 Skidsteer , 1988 4800 hrs ............. $9,500 FLAIL SHEDDERS & CONVEYORS 10� x 75 Batco Belt conveyor PTO drive ...... $6,900 Woods 20’ shredder new Knives gauge whls 3 pth $9,800 Woods 20ft shredder like new pull type .... $18,000 POTATO Harriston 200 clod Hopper .................................... call SNOWBLOWERS & MISC 84� Lucknow heavy duty snowblower 1998. $1,450

KROEKER MACHINERY SALES ST3TREET 7INKLERsWWWKMSMBCAs  

   

Gates Coulter Disk is a vertical tillage tool that gives you maximum versatilty by also performing as disk harrow. 0Ëš to 15Ëš Gang Angle

$74,900 Early order Special or lease for $7,200 SA TRACTORS 2007 CaseIH STX 480 Quad Track 3280 Hours, Gps, Diff locks, ....................................................................$205,000 9370 Case/IH 7800 hrs ‘98 PS24.5 rubber 50% rubber .......................................................................$69,500 NH Ford 9880 1995 20.8x42 5800 hours duals ... $76,500 NH T7040 2009, 150Hp, FWA, 3 remotes, 18.4x 42 tires with rear duals, 3pt weights, 680 hours .............. $109,500 Versatile 2425 4500 hours, power shift, 710/38, $119,500 Versatile 2425 3600 hours standard, 710 / 38 .. $112,500 Versatile 855, New rubber, nice shape, 9000 hrs $26,500 John Deere 9400 5300hrs 20.8x 42 tripples 12 spd$106,500 TILLAGE Gates Heavy Harrow 2009 104 ft.........................$29,500 Delmar Heavy Harrow 1996, 84ft ........................$16,800 Summers 2010 84ft heavy Harrow .......................$31,500 Phillips Rotary harrow 2010 45ft like new ..........$29,900 Flexi-Coil 800 Deep Tiller 50ft, new bushings .....$17,500 AIR DRILLS Seedhawk 1998 42’ 10� space, double shoot granular & NH3, loading auger, 105 bus tank on board. Liquid kit & on board 1250 gl tank. .......................................... $62,000 Case/IH 2009 3430 pro 600 monitor, TB, Mech drive ........................................................... $59,500

SPRAYERS 4730 JD 90 foot 2010, GPS, 900 hours, ........... $209,500 Apache 1010 2008 335 hrs, 100’, auto boom, 2 sets of rear rubber, EZ steer, 2 yrs Ltd powertrain warr . $139,500 Summers 1995 100’ PT hi clearance sprayer...... $22,500 MISC Buhler 16 x 104 Auger 2009 ............................... $26,000 Buhler 13x95 2004 auger, hydraulic swing, and lift$9,800 2008 Horsh Anderson 40-15 seeder with a 2006 Horsh tank 300 bushel, Dutch openers and liquid kit ... $135,000 2007 570R Cat Combine 700 thresher hours duals, pick up........................................................................ $165,000 Pattison CB 3200 2011, low acres, loaded w/options ............................................................. $39,500 New 3250 Gallon Caddy w/John Blue, 3� ......... $35,000 Bew 1600 Gallon Caddy w/John Blue drive & pump ................................................................. $19,500 Leon 1700 gallon Liquid Caddy, John Blue....... $12,500 WIDE VARIETY OF LIQUID STORAGE TANKS AVAILABLE, CALL FOR PRICING AND SIZE AVAILABLITY

South of Brandon, MB I 204-483-2774


PAGE 2 Manitoba FarmLIFE, Monday, March 12, 2012

Murray Rankin Auctions & Ross Taylor Auction Service

SPRING 2012 FARM EQUIPMENT AUCTIONS PATERSON GRAIN CROP INPUTS EQUIPMENT INVENTORY REDUCTION AUCTION SALE, TUESDAY, APRIL 10TH, 2012, 11 AM. LOCATED AT PRAIRIE FLEET YARD, KILLARNEY, MB. SELLING TRUCKS, FERTILIZER EQUIPMENT, GRAIN & FERTILIZER BINS & MISC. Fertilizer & Special Equip. include: 1995 IHC Floater 466 diesel engine, w/ Tyler dry fertilizer air system, w/ M250 fertilizer box, 40 ft., auto. trans., w/ hi-low range. 1990 IHC Loral Easy Rider Air Flo dry granular Floater w/ IHC 466 diesel engine, auto. trans., 2 spd., w/ hi-low range, 60 ft. booms, 1 seed compartment in addition to main fert. Compartment. 2 electric Fork Liftsroll–lift, electric stacker, 2500 lb. capacity, 24” load centre. 6 double NH3 tanks on HD trailers- both twin 1000 gal. & twin 250 gal. tanks. 2 other NH3 trailers. 3 FK 10” X 70’ augers w/ swing out hoppers. 2 Batco 10” X 70’ belt conveyors. 6 Meridian hopper bins w/ base, epoxy coated, 130 Tonne, like new. Trucks- all saftied. 2005 Chev Silverado 1500 HD 4 X 4, crew cab, V-8 auto. 1999 Ford 4 X 4 ¾ [three quarter] ton, regular cab, gas V-8 engine, auto., 244,000 kms. 2005 Chev Silverado ½ ton, good tires, regular cab, V-8 auto., 273,000 kms., Saftied. JD 3010 diesel tractor w/ 3 pt. w/ JD FE loader. JD 509- 3 pt. rotary mower. IHC #80 snow blower. More Equipment to be listed. DON RICHMOND CYPRESS RIVER, MB. FARM RETIREMENT AUCTION TUESDAY APRIL 17TH AT 11 AM. ½ MILE EAST OF CYPRESS RIVER, 1 MILE SOUTH. 1993 Ford Versatile 846 4 WD w/ 18.4 x 38 clamp on duals, 4 remotes and return line, 12 speed, 3875 original hours. 1991 Ford 8730 MFD, p/s, 20.8R x 38 radial factory duals, 16.9 x 28 front rubber, 3 PTH, 4 remotes, 540 & 1000 PTO, 2275 original hours. 1992 Case IH 1680 SP combine w/ 1015 p/u header, chopper, big spreaders, long auger, long sieves, cross flow fan, 30.5L32 rubber, 14.9 x 24 rear, 2710 original hours. Case IH 810 22.5’ straight header w/ big auger and batt reel. Case IH 810 22.5’ straight header w/ sm. auger, Sunflower attachment and batt reel. Prairie Star 25’ hydraulic fold PTO swather w/ Mac Don pickup reel and crop lifters. Bourgault 8810 33’ air seeder cultivator, 10” spacings, air package, mulchers and disc markers, sold w/ Bourgault 2155 air tank, hydraulic drive, single chute, loading auger. JD 634 32’ tandem disc w/ smooth blades and scrapers. White 20.5’ 271 tandem disc w/ smooth blades and harrows. 2007 Delmar 5500M medium duty 70’ hydraulic harrow outfit. Bourgault 60’ harrow packer bar w/ spray kit, 5 bar harrows and packers. IHC Cyclone 40 8-36 planter w/ transport and markers. IHC # 770 6 x 16 plow w/ auto reset. Westgo 4 row 36” 3 pth row cultivator. 2 – 16’ IHC 300 discers w/ Martin hitch. 1978 Chev C65 w/ 16’ Midland box, Nordic hoist, 5 & 2, 366 gas, roll tarp, 900 x 20 rear, 98,000 km’s. 1986 Chev Capri Classic Brougham loaded only 155,000 km’s. 14’ HaulAll w/ hydraulic augers. Westfield TR 10” x 51’ auger w/ hydraulic side swing hopper. Westfield 41 ft. X 7” auger w/ B & S 13 hp engine & Wheatheart bin sweep. Potato Growers consignment: Trucks all running: 1985 Ford F-900 auto., tandem, cab & chassis, diesel. 1974 GMC C-6500 good 427 engine, 5 X 2 trans., tag axle, 20 ft. X 8 ½ ft. box. 1966 Chev 292 engine, 5 X 2 trans., single axle, 14 ft. steel Cancade box. 1974 Ford F250 ¾ ton, 4 spd. trans. 1976 GMC C6000, 350 engine, 5 X 2 trans., 14 ft. X 8 ½ ft. box w/ hoist, 26,187 miles. IHC #45 Vibra-shank cultivator, 28 ft. MacDon 972-25 ft. pick-up reel w/ 9030 Bi-directional header adaptor. MacDon 25 ft. bat reel for 960 header. Plus other farm misc. equip. For information call Don 204-743-2180 Cell 204-526-5391

JACOB & LINDA ENNS, KILLARNEY, MANITOBA FARM RETIREMENT AUCTION SALE FRIDAY, APRIL 20TH, 2012 10:30 AM LOCATED 11 MILES SOUTH OF KILLARNEY, 2 MILE EAST. 1984 Case 4494 diesel 4WD, 12 spd. powershift, 8100 hrs. 1984 JD 2950 diesel, 3 pt., w/ JD 148 loader, 13,800 hrs., 1 owner. 1986 Case 448 lawn & garden tractor, 18 hp., 48” mower deck & 42” mulcher. 1992 Bourgault 330 air seeder w/ 32 ft. cultivator w/ Bourgault 2155 air tank & 4 row harrows. 1988 JD 1610- 31 ft. chisel plough, tandem axle w/ Degelman 3 row harrows. 1981 Herman hydraulic harrowbar. 1989 Eversman 6 yd. Scraper. 1985 JD 7720 Titan II diesel combine, JD pick-up, hydrostatic, 2 spd. cylinder, always shedded, 3300 hrs. 1984 Versatile 4400- 22 ft. SP swather, cab w/ air, hydrostatic. 2003 FK 41 ft. X 8” auger w/ Kohler 18 hp motor. 1983 Allied 41 ft. X 7” auger w/ B & S 16 hp engine. 1981 IHC Model 1100- 9 ft. mower. 1985 Vicon 6 wheel rake. 1983 NH 519 manure spreader. 2010 Walleinstein GX 920 Backhoe, 3 pt., mechanical thumb sells with hoe. New Idea 7 ft. snow blower. NH3 dual manifold attachment w/ electric shut-off. Good list Shop Equipment For information contact: Jake Enns- 204- 523-8659 . GEORGE & MAUREEN FREEMAN, HARTNEY, MB. FARM RETIREMENT AUCTION SATURDAY, APRIL 21ST, 2012, 11:00 AM. 1 MILE NORTH OF HARTNEY, 1 ¾ MILES WEST. 1981 John Deere 4240 diesel, factory 3 pt., quad-range trans., only 2700 hrs. since all engine work done in 2004tractor is premium. 1981 Case 1690 diesel tractor, w/ Dual 205 loader w/ grapple & 8 ft. bucket. 1961 JD 4010 diesel, 8 spd. Trans., 540 & 1000 PTO. IHC 560 diesel, w/ single hyd. Massey Harris #44 gas tractor, single hyd. JD 7720 turbo diesel combine, JD 6 belt pick-up, hydrostatic, very good. JD 6601 PT combine w/ Sund pick-up. JD 800- 21 ft. SP swather. Sakundiak 37 ft. X 6” auger w/ 15 hp Powerfist motor. Westfield 41 ft. X 8” PTO auger. Rem 552 grain vaccuvator. Hesston Model 5800 round baler. Hesston Model 1150- 12 ft. mower conditioner. Sitrex 10 wheel V hay rake3 pt. IHC 435 square baler. Trucks –All As Is. 1976 Chev C30 truck w/ 8 ft. X 12 ft. steel box, good running. 1967 Chev 1 ton truck, to restore. 1967 ¾ ton Chev w/ flat deck & hoist, to restore. 1979 Ford Lariet ½ ton. 1988 GMC S15 ½ ton, 4 spd., running. 1951 Mercury 1 ton truck w/ box & hoist. Collector Car: 1956 Dodge 4 dr. Sedan car. IHC 7200- 28 ft. hoe press drill, 2- 14 ft. sections w/ pan wheel press, factory transport. Wishek Model 714- 16 ft. heavy tandem disc. IHC #45- 27 ft. vibra-shank cultivator. IHC 16 ft.- 620 DD press drill. Flexi-coil WB45- 45 ft. harrow packer bar. New Holland 516 manure spreader, 205 bus. Farm King 8 ft. double auger snowblower, hyd. chute. Brandt end gate hydraulic drill fill. Sunbeam hammermill. 3- 300 gal. fuel tanks. Grain Bins- 21300 bus. Steel hopper bins. Springbok 15 ft. boat w/ Evenrude 20 hp motor, Eze-load trailer. For info please contact: George Freeman cell 204-483-0391 home 204-858-2549. P ALVIN SMITH, BRIAN DRUMMOND, METCALFE FAMILY FARMS, M. DRUMMOND, HOLLAND & TREHERNE AREA, MB. FARM RETIREMENT AUCTION SALE WEDNESDAY, APRIL 25TH, 2012 10:30 AM LOCATED 8 MILES NORTH OF HOLLAND ON PTH #34. ALVIN SMITH- 204- 526-2459:-- 1994 Ford-Versatile 9030 Bi-Directional diesel w/ Ford engine, 3spd. hydrostatic, 3 point both front & back ends, 1000 & 540 PTO front & back ends, w/ FE loader w/ 8 ft. bucket, 7000 hours on tractor, excellent. TD9 Industrial Cat Bulldozer w/ 10 ft. Smith angle dozer blade, tracks & pads are excellent. 1945 & 1948 John Deere styled “A” tractors. 2001 Vermeer Highline Rebel 5500 round baler, 5 X 5.5 ft. bale, done only 1400 bales, like new. Trail King 5thwheel 24 ft. X 8 ft. flat deck trailer, rebuilt deck, triple axle. Real Industries cattle squeeze & headgate. Brian Drummond 204-526-5166:-- 1976 White Field Boss 2- 105 diesel

MURRAY RANKIN AUCTIONS Murray 204-534-7401 Killarney;

tractor, 3 pt. hitch, 2000 hours on rebuilt engine, 7000 hrs. on tractor. 2002 New Idea 5212 discbine, 12 ft. 1997 New Idea 4865 soft core round baler, 5 ft. X 6 ft. 36 ft. bale trailer w/ iron frame deck. 1987 Norbert 7 ft. X 16 ft. gooseneck livestock trailer. Morand cattle handling system- cattle squeeze w/ headgate, palpation cage, 3 sections of alleys and crowding tub- complete system. Lewis cattle oiler. Metcalfe Family Farms- contact Neil Metcalfe- 204-526-7309 cell or 204-723-2175 office: -- 1991 Case-IH 1680 Axial flow Combine, 8.3 Cummins, AFX rotor, 3900 engine hours, with Case IH 1015 pickup header, always shedded, very well maintained and many updates. 1994 Case IH 1010 25’ s/cut header, pickup reel. 1991 Case IH 1010 25’ straight cut header, bat reel. 2003 Harvest Pro [MacDon] 8150 SP Windrower, turbo, 2 spd. Hydro, 1706 header hours, w/ 25’ 972 MacDon header, pickup reel, dual knife drive, hydraulic deck shift, & hydraulic header tilt. 1 owner, always shedded. 2006 Rem 2500 Grain Vac, HD flighting. Batco 13” X 85’ belt conveyor, swing hopper. IHC 800 row crop planter 8R36”, hydraulic markers. Alloway 8R36” multi-shank row crop cultivator, hydraulic wings. Lode King 14’ drill fill, 2 hoppers. 2 new Case IH/ Trimble EZ-Guide 500 GPS systems- never used. new Case IH/ Trimble RTK base station & tripod. Kyle Welding 2600 Imp. Gal. galvanized water tank. 1991 Ford LTA 9000 Aeromax Highway Tractor, Cummins N14E-370 HP, 9 spd. Trans., saftied & well maintained. 1984 Ford LN700 Grain Truck, 370 V-8, Midland 14’ grain box, 72,000 kms., saftied & well maintained. 1994 Ford F-150 regular cab 4 X 4, 300 6 cylinder, 5 spd., A/C, cruise, tilt, saftied. Morris Drummond 204-526-7672 : -- 1998 Macdon 9300 SP swather w/ 960- 25 ft. header w/ pick-up reel, cab w/ air, diesel engine. 1980 Versatile 4400 SP swather, 22 ft., cab w/ air, hydrostatic. Doepker 28 ft. drill carrier, hyd. 1999 White 9 hp yard bug rear engine rider mower. Collector tractors – 1947 IH-McCormick W4 gas tractor. 1948 JD ‘B’ w/ saw mandrel. 1942 Ford 8N tractor, 3 pt. 1953 IH-McCormick ‘M’. ANNEROSE SCHWARZ & ESTATE OF SIEGFRIED SCHWARZ, GLENBORO, MANITOBA FARM ESTATE AUCTION SALE MONDAY, APRIL 30TH, 2012 11:00 AM. 3 MILES SOUTH OF PTH #2 AT GLENBORO, 3 MILES EAST . 1981 Case 4690 diesel 4WD- 1000 PTO., 12 spd. P/ shift trans., trans & engine overhauled at 5400 hrs., 5938 hrs. 1982 Duetz DX160 diesel, MFWD, w/ cab, 24 spd. Trans. w/ Hi-low, 1000 & 540 PTO. Allis Chalmers 716 garden tractor, hydrostatic, w/ 46” mower deck, 48” tiller. IHC 7200-28 ft. hoe press drill, markers, pan wheel press, factory transport. Morris Magnum II MP912- 24 ft. deep tiller w/ Morris 3 row mulchers. IHC #45- 27 ft. V-shank cultivator w/ 2 row mulchers. Morris 50 ft. hyd. tine harrowbar. MF 880- 7 X 16 plough, 3 pt. IHC Model 620- 16 ft. DD press drill, 2- 8 ft. 2002 New Idea 6365 hard core round baler, 540 PTO. 2002 Macdon 5020- 14 ft. hydro swing mower-conditioner. New Idea 486 round baler, soft core. Niemeyer 3 pt. rotary rake, 3 metre. Gehl 1710 soft core round baler. 1992 Westward 3000 PT swather, 25 ft. MF 750 SP combine- Perkins diesel 6 cyl. engine, hydrostatic. MF 20 ft. S/cut header. JD 6601 PT combine. Westfield 7” X 51 ft. auger. Farm King 7” X 46 ft. auger. Westfield 41’ x 7” auger w/B&S 13hp motor and Wheatheart Bin Sweep; 1978 Norberts 16 ft. X 7 ft. – 5th wheel livestock trailer. Univerth-McCready 375 bus. gravity wagon on HD trailer, divided tank w/ roll-tarp. 1970 IHC 1310- 1 ton truck w/ Cancade steel 9 ft. box, hoist, dual wheels. New Idea 10 ton manure spreader, tandem wheels. Farmhand Feedmaster mix-mill. Farm King PTO roller mill. Hi-Hog cattle squeeze w/ headgate. Morand maternity pen w/ headgate & other livestock equip. 2 Lewis cattle oilers. 1000 gal. fuel tank w/ electric pump. Steel 1500 gal. water tank on skid. Scheifele 3 pt. commercial band saw, M500, PTO drive. Rodenator- propane & acetylene – used for gopher control. For equipment info please contact Jurgen Schwarz- 204-827-3949 or 204-827-2552 evenings.

Complete Listing & Pictures on websites ROSS TAYLOR AUCTION SERVICE Ross 204-522-5356, Brock 204-522-6396, Reston, Manitoba

www.mrankinauctions.com

www.rosstaylorauction.com


Manitoba FarmLIFE, Monday, March 12, 2012

2010 Case IH STX485Q, 1740 hrs, lux cab, HIDs, high cap draw bar........................ $299,000 S

2001 RoGator 1254 Sprayer, 4200hrs, 1200 gal stainless steel tank, 90’ boom ............. $120,000 S TRACTORS ’09 Steiger 535Q, 1637 hrs, lux cab, HIDs .................................$312,000 S ’10 Case IH STX485Q, 1740 hrs, Lux Cab, HIDs, cold pkg ........$299,000 S ’07 Case IH STX480Q, 1358 hrs, diff locks, pwrshft ...................$239,000 E ’09 Case IH Magnum 215, MFD, 602 hrs Dlx cab,4 remotes ......$129,000 S ‘06 Case IH MX215, 3924 hrs, 540/1000 pto, dlx cab, ldr............$109,000 P ’09 Case IH Puma 155, 3800 hrs, susp. Cab, 540/1000 .............. $90,000 S ’08 Case IH Puma 180, 3800 hrs, 3 hyd, 3pth, 540/1000 ..............$90,000 S ’02 Case IH MX200, MFD, 3575 hrs, 3pth, row crop fenders ........$82,900 P ‘08 Case IH Puma 165, 1810 hrs, radar, small 1000 pto ...............$82,000 P ’07 Case IH Maxxum 140 Pro, 3203 hrs, ldr, 3pth ........................$73,500 E ’97 Case IH 9370QT, 10798 hrs, 30” tracks, PwrShift ...................$69,500 E ’97 Case IH 8940, 7911 hrs, 30” row crop set up ...........................$64,000 P ’98 Case IH MX135, 7800hrs, L300 ldr, 540/1000 ........................$48,000 S ’10 Case IH Farmall 50 CVT, 325 hrs, 3pth, dlx cab ....................$37,900 S ’89 Case IH 7140, 9200 hrs, 175 pto, duals, creeper....................$34, 900 P ‘90 Case IH 7120, loader 540/1000 pto .........................................$34,500 E ’08 Case IH Farmall 55, 500 hrs, excellent ...................................$31,000 E ’08 Case IH JX1075c, 981 hrs, MFD, 3pt, rear wts ......................$27,900 P ’83 Case 2590, 5655 hrs, 1000 pto, duals, 3pth, cab.....................$34,900 P ’88 Case IH 7110, 11462hrs, duals, 3pth, dual PTO ......................$23,500 E ’84 Case 2394, 6400 hrs, 1000 pto, duals .....................................$22,000 S ’80 Case 2290, 2WD, 6300 hrs, 150 hp .........................................$15,900 S ‘81 Case 2390, 5450 hrs, 12 spd pwrshift, a/c ...............................$14,900 P ‘05 Case IH DX24E, 393 hrs, 60” CIH mower ...............................$10,500 E ’98 John Deere 8300, 5694 hrs, MFD, 3pth, weights ....................$77,500 P ’99 John Deere 6110, 5104 hrs, 540/1000, 3pth, ldr .....................$34,900 N ’75 John Deere 4630, 7070 hrs, excellent .....................................$19,900 S ’82 John Deere 1840, 3588 hrs, 3pth, JD 146 ldr..........................$10,900 S John Deere 2120, 540 pto, loader & bucket, draw bar ....................$7,499 P ‘08 New Holland TN75A, 380hrs, excellent condition ...................$38,900 S ’05 Fendt 412 Tractor, 105 hp, 6665 hrs, 3pth, 50km vario trans .$69,000 S ‘93 Caterpillar 75C, 7200 hrs, good cond .....................................$59,900 P ’98 Agco Allis 9745, 3200 hrs, 540/1000, 2 hyds..........................$49,995 N ’09 Kubota M135X, 1500 hrs, 540/1000 pto ..................................$69,900 N ’05 Kubota M125X, MFD, 5020 hrs, 125 hp ..................................$58,900 S ‘02 Kubota M120DTC1, 120HP 5360hrs, 3PT, M960 ldr...............$49,900 S ‘08 Kubota M5040DTHS, 50HP 130hrs, NEW demo,ldr,3pt .........$47,900 S ‘00 Kubota M9000DT, 90HP 4545hrs,540pto, 3-PT......................$26,900 S

PAGE 3

2010 Case IH SDX40 Air Drill, 64 openers, 7.5” spacing, SS ................................. $162,000 S

2004 Bourgault 5710 Air Drill, 54’, 3” openers, mid-row banders, 5350 air cart, SS ...................$129,900 N ’09 Kubota B2920HSD, 154 hrs, 54” mower, ldr assy, 50” bkt ......$17,700 P ’98 Kubota L3300HST, 780 hrs, 3pth, rear & mid pto ...................$13,900 S ‘04 Kubota B2410, 24 hp, 1208 hrs, mfd, 3 pth, snowblower ....... $11,900 S ’95 Kubota L2350BT, 3430 hrs, Allied 180 ldr...............................$10,499 N ’04 Kubota BX1500D, 573 hrs, 3 pth, grass catcher .......................$8,995 S ’04 Kubota BX2230, 358 hrs, 3pth, hydrotrans ...............................$8,299 N ‘01 Kubota B7500HSD, 1857 hrs, industrial tires ........................... $6,999 P ’95 Kubota B1700HSD, 17hp, 3 cyl, diesel .....................................$6,299 P ’88 Ford 8210, MFD, 8500 hrs, 540/1000, 3pth, 795 ldr, 7’ bkt......$29,000 S ’89 Ford 1520, 2147 hrs, 60” mower, 3pth, loader .........................$14,900 N ’08 Degelman 7900 Blade, 18’, mnt for STX335/385/TJ...............$32,500 E ’97 Deutz 7110, 2WD, 8500 hrs, good, 3pth, Leon 707 ldr ............$17,000 E ’07 Massey 1533, 525 hrs, ldr, pallet forks ....................................$18,900 P COMBINES ‘10 Case IH 9120, 601 hrs, 36” TRACKS, 2016 p/u.................... $349,000 E ‘10 Case IH 8120, 227 hrs, ST rotor, MagnaCut ..........................$315,000 S ‘10 Case IH 8120, 314 hrs, ST rotor, HID light .............................$299,000 S ’10 Case IH 9120, 373 hrs, Magna Cut Chopper, sm tube rtr ......$315,000 P ’10 Case IH 9120, 240 hrs, hyd hopper, dlx cab ..........................$303,000 S ‘09 Case IH 9120, 240 hrs RWD, Hopper EXT ............................$295,000 E ’09 Case IH 9120, 491 hrs, MagnaCut Chopper, ST rotor ...........$289,000 E ’08 Case IH 9120, 669 hrs, Magna Cut Chopper, lux cab, HIDs ..$275,000 P ‘08 Case IH 8010, 810 hrs, sm tube rotor, magna cut chopper....$245,000 P ’08 Case IH 2588, 590 hrs, hopper topper, Pro600......................$199,000 E ’05 Case IH 2388, 1077 hrs, Y&M, stone trap, 2015 p/u..............$159,000 S ’01 Case IH 2388, 2765hrs, chopper, stn trap, duals .................. $119,000 E ’98 Case IH 2388, 2300 hrs, AFX rotor, hopper topper ..................$89,000 E ‘98 Case IH 2388, 2563 hrs, header, chopper, excellent cond.......$89,000 E ‘98 Case IH 2388, 2819 hrs, header, chopper, excellent cond.......$89,000 E ‘97 Case IH 2188, 2129 hrs, good, 1015 p/u hdr ...........................$89,000 E ’96 Case IH 2188, 3487 hrs, spec rtr, hopper ext 1015 hdr ...........$61,000 P ’92 Case IH 1680, 3600 hrs, Swath Master p/u .............................$45,000 P ’91 Case IH 1680, 3658 hrs,chopper, spec. rotor...........................$45,000 E ’88 Case IH 1680, 3086 hrs, chopper, stone trap...........................$25,000 E ‘83 Case IH 1480, 3785 hrs, air foil sieve, p/u header ...................$19,900 S ’07 John Deere 9860 STS, 1339 hrs, 615P hdr .........................$224,000 P ’04 John Deere 9860 STS, 1897 hrs,Y&M, Hopper topper ........$195,000 S ’98 John Deere 9610, 2611 hrs, 914 p/u hdr ................................$91,500 S

’01 Caterpillar 470, 2506 hrs, 3D Sieves, good cond....................$89,900 S ‘95 New Holland TR97, 2575 hrs, rebuilt engine ’09, 14’ p/u ........$49,900 S ’93 New Holland TR96, 2300 hrs, 971 p/u, Redecop chopper ......$29,500 E ’94 New Holland TR97, 2507 hrs, 971 hdr, chopper .....................$27,500 P ‘98 New Holland TR96, 2600 hrs, 971 p/u, new rotors .................$24,500 E ’07 Gleaner A85,1016 hrs, MAV choppers, GPS .........................$159,000 P ‘07 Gleaner A85, 1009 hrs, GPS mapping ..................................$159,000 P ’79 Gleaner N6, 3983 hrs, good condition .......................................$9,500 E ’91 Massey Ferguson 8460, 2900 hrs ......................................... $26,000 E SEEDING ’12 Case IH 400 Air Drill, 45’, 7.2” spacing, 550lb trips, SS,2330 tank$169,000 P ’10 Case IH SDX40 Air Drill, 64 openers, 7.5” spacing, SS ........$162,000 S ’09 Case IH Flex Till 6000 Chisel Plow, 54’, 650 lb trips, 10” sweeps$61,000 S ’09 Amity 4010 Air Till Drill, SS, 650 lb trips, disc lvlrs........Call for Price S ’07 Bourgault 5710 Air Drill, 6550 ST air cart, dlx auger ...........$189,900 N ‘04 Bourgault 5710 Air Drill, mid-row banders, 5350 air cart, ss.$129,900 N ’01 Bourgault 8810-54’ Air Seeder, 3” rubber press, SS..............$95,900 N ’94 Morris 9000-6240, 9” spacing, knock on 4” shovels ...............$28,000 E ’99 Flexi-Coil 5000 Air Drill, 3450 tank, Atom Jet Boots...............$69,900 N ’00 Flexi-Coil 5000 Air Drill, 39’, SS, 2340 tank ...........................$59,900 S ‘95 Flexi-Coil 820 Air Seeder, c/w Flexi-Coil 1330 Air Tank ..........$39,900 N ‘95 Flexi-Coil 5000 Air Drill, 45”, 9” spacing, SS ..........................$23,000 E ’00 Concord 4010 Air Drill, single fold, new packer tires .............$42,500 E ‘84 Concord 4010 Air Till Drill, 40’ width, 10” spacing SS............$42,000 S ‘94 Concord 4710 Air Drill, 47’, 11’ LD sweeps(new ....................$31,500 E Haul All Drill Fill, 60/40 split, 20’ long, good cond .........................$4,200 E WINDROWERS ’07 Case IH WD1203, 433 hrs, 36’, DK, cross auger .....................$84,000 P ‘07 Case IH WDX1202, 586 hrs, 30’ hdr, SK, U2 reel ....................$74,900 P ’79 Case IH 8150, 25’ 972 hdr, 2 spd Turbo, excellent...................$58,000 P ’05 Hesston 9240, 710 hrs, 25’ draper, 18’ hay hdr ......................... $72,000 ’06 Prairie Star 4952I, 1392 hrs, 30’ 972 hdr, DK, hyd angle ........$65,000 P ‘04 Harvest Pro 8152I, 1334 hrs, 25’, 972 hdr hdr, hyd fore & aft .$65,500 E ’04 Harvest Pro 8140, 984 hrs, 25’ 972 hdr, DK ............................$50,000 E ’05 Agco SP85B, 600 hrs, 30’ draper, 6 batt p/u reel ................... $52,900 P ’97 Massey Ferguson, 1277 hrs, 25’ hdr, p/u reel.........................$36,000 P ’98 Massey Ferguson 220, 1347 hrs, 30’ hdr, p/u reel..................$30,800 E

‘03 MacDon 9352, 2000 hrs, 25’ 972 hdr, hyd deck, DK................$49,000 S ’03 MacDon 9352, 2200 hrs, 25’, 6 batt p/u reel ...........................$49,000 S ’00 MacDon Premier 2950, 1399 hrs, 25’ hdr, 2 spd turbo, p/u reel$52,500 N ’99 MacDon Premier 2930, 3333 hrs, 30’ 972 hdr ........................$45,900 P ‘94 MacDon Premier 2900, 2400 hrs, 25’ 972 hdr, SK ..................$33,900 S ’94 MacDon Premier 2900, 2200 hrs, 25’ 960 hdr, SK ..................$33,900 S ‘05 Caterpillar SP115, 549 hrs, 30’, p/u reel, dbl swath, hyd tilt ....$65,000 S ‘92 New Noble 722, 1449 hrs, 22’, dbl swath, a/c .........................$19,900 P ’88 Co-op Implements 742, 2700 hrs, 26.5’ hdr, 5 bat p/u reel.....$19,900 P ‘86 Co-op Implements 722, 26’ header, U2 p/u reel .....................$16,500 E HEADERS ‘05 Case IH 2062, 36’ flex header, sk, 5 batt reel, plastic tines ......$49,900 S ‘91 Case IH 1010, 25’ header, p/u reel, man. fore/aft.....................$10,500 E ‘95 Case IH 1010, 30’ header , bat reel..........................................$10,500 E ‘93 Case IH 1010, 30’, bat reel ........................................................$8,950 E ‘94 Case IH 1010, new bat reels, gearbox, knife & guards ..............$8,500 E ’02 HoneyBee SP42, 42’, upper cross auger ................................$45,000 S ’02 MacDon 974, 36’ Flex Draper, gauge wheels ..........................$44,500 P ’98 MacDon 960-30’, U2 p/u reel, SK Cat adapter ........................$22,000 E ’07 Lexion C512-30, corn hdr, 30” spacing, 12 row ...................... $42,000 E Agco 400,30’ combine hdr, U2 p/u reel, direct cut auger, excellent$15,000 P ’97 John Deere 930, SK, batt reel ...................................................$7,000 E SPRAYERS ’11 Case IH 4420, 519 hrs, Aim Command, 120’ boom ...............$295,000 S ’01 RoGator 1254, 4200 hrs, 1200 tank, 90’ boom .....................$120,000 S ’96 Melroe, 2790 hrs, 70’ boom, 400 gal........................................$39,900 S ‘05 Ag Shield 7700, 115’ boom, windshields, 1500 gal .................$32,500 E ’96 Spray Air 2200, 84’, raven monitor 1000 rpm ..........................$12,500 N ’98 Spray Air 2290, 90’, rotary screen, clear fill tank .......................$9,600 E ‘87 Brandt QF2000, 130’, dual boom ..............................................$8,999 P HAY & FORAGE ‘07 Case IH RBX563, Round, 1000 pto, wide p/u ..........................$17,500 E ‘03 Case IH RBX562, Round, wide p/u, auto tie ............................$14,900 S ‘04 New Holland BR780, Round, 540 pto, hyd p/u .......................$17,500 E ’02 New Holland 1475 Haybine, DK drive ...................................$14,900 P ‘00 John Deere 100, Square-large, packer cutter ........................$27,900 S


PAGE 4 Manitoba FarmLIFE, Monday, March 12, 2012

2012 SPRING TILLAGE AND SEEDING SALES EVENT Great Plains 40’ HD Disk Drill

CONVEYALL CST-32 COMMERCIAL SEED TENDER WIRELESS REMOTE CONTROL, 4 COMPARTMENT SELF CONTAINED HYDRAULIC PACK

c/w 7.5” Row spacing, 350 Bus Split Tank, DickeyJohn Intelliag Monitor c/w (10” Screen),

Balance of Factory Warranty

SALE PRICE $99500 Lemken Heliodor is your

J&M 375ST Seed Tender

“One Pass” seedbed preparation tool NEW for 2012 is the flexring packer option allowing maximum flex in a packer to virtually eliminate plugging

300 bushel, dual compartment, tarp Deluxe wired all function remote, 8” tube conveyor, 11’ telescoping downspout, Honda electric start engine Standard self load feature

Meridian Seed Express 375RT

300 bushel, dual compartment, Wireless all function remote, 8”tube w/12”cleated belt, variable speed control, tarp, electric start Honda engine

Coulters, Disks, Land Rollers, Mid & Heavy Harrows IN STOCK

March Madness 1 ONLY Trimble CFX750 display & EZ-Steer $5895 Your Summers Sales, Parts & Service expert since 1996

www.avonleagroup.com

Lincoln 12V and 18V Grease Gun Starting at $220

GREAT PLAINS & SUMMERS MARCH PARTS BLITZ Buy $500.00 in parts receive 10% discount Buy $1000.00 in parts receive 15% discount Buy $1500.00+ parts receive 20% discount Used Tillage 44’ Summers chisel plow, harrows/rear hitch....................... $45410 84’ Summers Superharrow plus ............................................ $36732 40’ Supercoulter, 8 wave blades and harrows....................... $49778 Demo 40’ Supercoulter 8 wave notched/harrows .................. CALL Ford 250 disk, 30’ .................................................................... $15235 Used Tractors Kioti CK20 Hydro 22 HP c/w loader, mid- mower............... $16100 Kioti DK45 SE hydro 45HP c/w deluxe cab.......................... $21995 AC5020 c/w loader, mid mower and tiller............................... $7495 Used Grain Carts J&M 875-18 c/w PTO, Tarp, RED......................................... $26805 Sunflower 8830 c/w PTO/hydraulic drive, tarp.................... $23920 Sunflower 8750 c/w PTO/hydraulic drive , tarp................... $21308 Unverferth 8200 c/w PTO and tarp ....................................... $24700

NEW & USED EQUIPMENT LISTINGS

Hesston Rodeo Rate 3.9% - 60 months...Plus Cash Discounts!

DRUMMOND’S FARM SERVICES LTD. 1-877-526-2740 | drumsales@mts.net | Holland, MB I SALES CELL 526-7671 204-526-2740 | 204-526-2067 | 204-526-2080 | www.agdealer.com/drummonds

TRACTORS Agco DT240A, ‘05, 1525 hrs, MFD, 18.4x42 duals CvT, 3pt .................................................................... REDUCED $109,000 MF 6180 MFD, 110 hp, loader, grapple, 5125 hrs, 3pt, ‘96 ... $39,000 Kubota M120 FWA, 98pto HP, ldr, ‘02, 3030 hrs ............... COMING Kubota M7040, cab, loader, FWA, ‘08, 875 hrs .................... $45,900 Kubota M6040DT, ‘11, Rops loader ......................................$37,900 Kubota BX2360 23hp, ‘11, diesel, 3pt, ldr ............................ $14,300 Kubota B7500, 21hp, ‘01 loader, 1906hrs .......................... COMING Kubota B2410 24hp, ‘01, 660 hrs, loader, 60” mid-mower ... $14,900 Kubota M7040 2WD, 545 hrs, ‘07, loader .............................$24,900 Kubota MX5100 2WD, 50hp, ‘11...........................................$17,900 MF 1648, 47hp, Hydrostatic, ‘11, 4WD, loader ......................$32,500 NH TC40D 40hp, ‘03, 2625 hrs, turf tires, loader ..................$14,500 Agco-White 6195,200 hp, p/ shift, duals, 4450 hrs,‘93 ......... $49,000 White 2-105, ‘79, 2WD, ldr, 3pt, 5710 hrs, new clutch, 540/1000 pto ..........................................................................$15,900 NH/Versatile 946, ‘90, cummins, 325 hp, 6300 hrs .............. $55,000 COMBINES Waiver of Interest till Jan/2014 Gleaner A85 Class 8 ‘07 300 hrs, 1 year/300 hr warranty w/12month Waiver of Interest ......................................................$239,000 Gleaner R76 ‘09, 200 hrs, loaded, warranty........................ $289,000 Gleaner R75, RWA 2004,1010 sep hrs, 1280 eng hrs, Fieldstar, Lateral tilt, 14” swivel auger, swathmaster p/u, shedded, CDF rotor, mint .......................................................................................$189,000 Gleaner C62 ‘02, 1100 sep hrs .............................................$99,000 Gleaner C62 ‘98, 1490 sep hrs .............................................$75,000 Gleaner 7000 30’ hdr, 2004, “R” series, pickup reel, low acres ................................................................................$18,000 Gleaner 24’ R-Series Sunflower Header............................... $8,500 NEW AUGERS IN STOCK! Brandt 13x90 HP, loaded ..........................................................CALL Brandt 13x70 HP, loaded ..........................................................CALL Farm King 13x85, loaded..........................................................CALL Farm King 10x70 Standard .......................................................CALL Brandt 10x35, 38HP mover................................................... $15,800 Brandt 8x40, 25HP .................................................................. $8,200 Brandt 8x35, 20HP, mover.................................................... $13,200 Brandt 8x35, 20HP .................................................................. $7,200

SWATHERS BEAT THE AUCTIONS! - Waiver of interest until Aug/12 MacDon M150, ‘11, 30’, D50 header, Demo unit ................ $119,000 MacDon 4952 ‘00 Turbo, 30’, 972 hdr, Double knife, 2050/1710 hrs, Canola Auger .........................................................................$59,500 MacDon 4930, ‘99, turbo, 1500 hrs, 25’ 972 hdr, double knife, canola auger, nice ..................................................................$51,500 MacDon 9250, ‘00, 80 hp, 2300 eng/1860 hdr hrs , 25’ 972 hdr, canola auger...........................................................................$42,900 MacDon 9300 ‘98 Turbo 25’ 972 header 2500 hrs................ $42,900 MacDon 9300 ‘98 Turbo 25’ 960 header 2975 hrs................ $32,900 MF 220XL ‘03, 1385 hrs, 25’, roto-shears ............................. $51,900 MF 220 II ‘00, 725 hrs, 30’ hdr, canola roto-shears ............... $53,900 CIH/Hesston 8825, ‘97, 1970 hrs, 30’ hdr, double knife ....... $30,900 Hesston 6450 ‘84, cab, air, w/21’ draper hdr, 16’ hay hdr, ... $13,900 MISCELLANEOUS Farm King/Conveyair 6640 Grain Vac, ‘11 ......................... $23,700 Brandt 7500 HP Grain Vac, ‘11 ............................................$28,950 Brandt 5200 EX Grain Vac, ‘11 ............................................$22,950 Brandt 3-Point Sprayer, 20’, 130 gallon, includes wind cones NEW ......................................................................$3,995 Free Form 51/2’ 3PT, Heavy Duty Cultivator NEW ................ $1,695 Kubota RTV500, 4x4, gas, Camo-Color, 14 hrs ..................... $9,700 Kubota RTV500 UTV, 52hrs, windshield, canopy ................. $10,500 Kubota RTV 900 UTV 4x4 diesel, ‘09, 310 hrs, windshield, roof, hyd, dump...............................................................................$13,900 Kubota RTV900 UTV 4x4 diesel, 2008, 455 hrs. ATV tires. ... $8,900 Unverferth Header Transports Fits most hdrs (Grain, corn, swather) 25-30’ .......................................................................................$4,900 Swath Roller 8’ .........................................................................$995 Farm King 1200 Susp 90’ PT sprayer(2011) row crop axle.. $36,900 Brandt 100’ SB 4000 suspended boom sprayer 14.9x46 w/duals, 2004, 1600 gallon ..................................................................$39,000 Brandt Bale Shredder (2002) new knives ..............................$7,900 Allied 96” 3pt snowblower (NEW) ...........................................$3,495 Farm King 60” 3pt Snowblower (NEW) ..................................$1,750 Morris 60’ Chisel Plow, Magnum CP660 harrows ............. $19,900 Morris 9000 Cultivator 9” spacing, 36’, 400Ibs trips, air pack. $14,900 Packers Wing-up 36’, Cypress Industries .............................. $5,500 HAYING Hesston 7433, 3x3 Sq Baler, knotter fan, ‘08, w/accumulator.$64,500 Hesston 7433, 3x3 Sq Baler, knotter fan, ‘08, w/accumulator.$62,500 MF/Hesston 1375, Disc Mower, 15’, ‘11, Demo, Drawbar hitch$38,500 MacDon R85 13’, Disc Mower Conditioner (2011) Demo .. $28,900 MacDon R85 16’ Disc Mower Conditioner 2011, Demo..... $34,900 MacDon 5000 mower conditioner, ‘95, 16’ ...........................$7,300 Hesston 4910 4x4 Square baler, 39000 bales, 2003 ..........$39,000 JD 566 Round Baler, ‘98, nice..............................................$12,900 Hesston 6566 16’ hay header, ‘85, will fit Hesston 8100 ........$7,900


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 5

SPRING SAVINGS SALE METEOR SNOWBLOWER

BLOWOUT Quality built tillers for varied conditions

Lazer: For 12-40 hp. 40”, 48” & 56” RP: For 30 to 60 hp. 60”, 72” & 80”

NOW Available in Newsprint AND on our Website!

RTX: For 72 to 140hp. 92”, 100” & 120”

RE: 50 to 80 hp. 80” & 88”

ALSO AVAILABLE: Howse, Wallenstein, & Bauma Equipment

& ROTARY CUTTERS STARTING AT $995

Cropmaster Rake Special

SUPER SAVINGS PROGRAM Another way to reach your target audience without any extra cost to you!

This is the best time to buy. Limited Inventory!

Call Curtis at (204) 782-7336 or see our products on line at

When you place an advertisement in our Manitoba FarmLIFE, Saskatchewan FarmLIFE, Ad-Viser and/or Ag-Viser newspapers, your advertisement is uploaded to our new site www.farmpressltd.com

www.sovema.com I www.howseimplement.com I www.embmfg.com I www.baumalight.com

# WEST SALES

1

For more information call Manitoba FarmLIFE at 1-888-756-7770

Leasing Available

www.farmpressltd.com

4845 Por tage Avenue Headingley, Manitoba PHONE: 204.927.9042 CELL: 204.782.7336

NEW & USED EQUIPMENT SEEDING & TILLAGE 2012 Free Form LC 2500 Liquid Cart..................................CALL NEW 2011 Bourgault 9800 42 ft, chisel plow w/3 bar harrows ...................................................................................CALL Used 2011 Bourgault 5810 62ft, air drill complete w/2006 6350 air tank................................................................................ 189,500 2004 Bourgault 8810 40ft, w/5250 air tank, mid row banders, packers, harrows ................................................................ $82,500 2000 Bourgault 8810 -40ft, w/5250 air tank, 8” spacing, 4 bar harrows ............................................................................... $55,000 1988 Bourgault FH 536-36ft, cult w/1994 3225 air cart ... $24,900 2009 John Deere 1890-42ft, w/‘06 1910 430 bu. air tank$144,000 2002 Bourgault 5710 40’, w/mid banders, rubber packers$49,900 1999 Bourgault 4300 air seeder tank ............................... $35,900 Felxi-Coil 400 Air seeder 50ft w/2320 air cart ................. $29,500 Great Plains 45ft hoe Drill, w/tank ................................... $12,900 1980 John Deere 335 24ft tandem disc .............................. $8,995 2002 Morris Air Seeder double shoot kit ............................ $4,500 2-MF 360 18ft Discers .......................................................... $1,495 HARROWS & PACKERS Good Selection of New Bourgault Mid & Heavy Harrows In Stock Flexi-Coil Multi-Hitch Packer ............................................. $2,995 Bourgualt 4 bar mounted harrows .....................................CALL Riteway 1900 Packer Draw Bar ....................................... $14,900 NEW & USED MISCELLANEOUS

SPECIAL 2011 MacDon M150 Complete w/New 2010 D60 35ft header Call Ron

MANDAKO LAND ROLLERS

Windrowing technology takes another leap forward How do you improve a machine that has set industry benchmarks for speed and productivity? The answer is you focus on pushing the boundaries even further; things like giving every model a horsepower boost, improving operator comfort with an all-new suspension system and boosting infield performance with an upgraded header drive. What you won’t find changed are the things operators loved, such as intuitive controls, easier maintenance and the exclusive Dual Direction® technology that permits faster travel to and from the field at road speeds up to 23 MPH (37 km/h).

Call for Price Farm King Finish Mowers, Rotary Cutters, Snowblowers & Tillers In-Stock 1972 Leon 8ft Dozer blade ................................................. $1,500 1996 John Deere 9600 Combine, clean, local trade........ $73,900 New Free Form 1750 Imp gallon water tank .................... $1,295 2009 Farm King 6640 Grain Vac w/6” clean up kit ................$19,900 2012 Ashland 13 Yard Scraper........................................ $44,500 2011 Leon 17 yd scraper ..................................................$48,500 2009 Leon 10yd Scraper ...................................................$27,900 1992 Conveyair 2970 grain vac w/clean up kit ....................$6,950 USED SPRAYERS Weststeel 88ft Field Sprayer ............................................. $1,800 GRAIN CART 1992 Haul All 750 Bushel w/hyd drive ............................. $14,900 Used 1992 A&L Grain Cart 680 bush w/24.5x32 tires ..... $14,900 SP & PT SWATHERS 2005 MacDon 973-36ft hdr ................................................ $42,500 2004 John Deere 635F 35’ flex hdr, w/Gaston hdr trailer . $34,500 2002 Premier 2952 w/30ft, 972 DK, roller ......................... $74,900 2001 Premier 2952 c/w 1999 972 SK 30ft hdr Good cond $66,900 1994 Premier 2900T w/30ft 960 hdr, good cond............... $42,900 2000 Prairie Star 4600 36ft, PTO swather .......................... $4,500

Phone: 204-746-8441

Toll Free:

1999 Prairie Star 4930 Turbo c/w 962 hdr, double draper drive, 1160 hrs, good cond .......................................................... $48,900 1995 Westward 9000 w/30ft 900 hdr, good cond ............. $36,900 1994 Westward 9000 w/30ft 2000-972 DK, cross auger................$47,500 1991 Case IH 730 30ft, PTO swather .................................. $4,500 1986 John Deere 2360 w/25ft hdr..................................... $16,900 1985 IHC 4000 gas, w/24 1/2 pt, pu reel ........................... $10,900 1984 Westward gas, 30ft, PU reel ...................................... $8,900 2009 MacDon CA 20 Adapter to fit 60-70 series JD Combine$18,900 2011 Elmers Header Transport Trailer ............................. $7,950 New custom built header trailers...................................... $4,295 Brackets to fit MacDon Swathers starting at $1,195 New MacDon 2000 30ft PU reels to fit 960 hdr ............................................ Blowout Price $3,995 New & Used 8 ft and 10 ft Swath Rollers ..........CALL AUGERS Good Selection of New Westfield TFX & MK Series Augers in Stock! 2012 Batco 1545 FL field loader w/wheel mover kit, hydraulic winch, 27hp kohler engine ................................................. $23,900 2012 Wheatheart SA 13-91c/w p/swing & hyd winch ....... $24,500 2009 Westfield MK130-81 flex w/hyd winch ..................... $22,900 2009 Farm King 13x70 c/w reverse & power swing ......... $12,900 New Farm King 10-41 w/SP kit........................................... $8,595 New Farm King 10-51 w/SP kit........................................... $9,095 Used Westfield MK 130x61G ............................................. $6,500 Used Westfield MK 130x71 ................................................ $7,500 Used Westfield MK130x61 GLP......................................... $8,950 2001 Westfield MK100x71 GLP ......................................... $4,995 Used Westfield MK10-61G ................................................. $4,995 1998 Westfield MK 100x71 G ............................................. $4,495 Used Westfield MK 10x51G ............................................... $3,295 Used Westfield J207x46 w/20hp, Kohler/SP kit ................. $4,495 1990 Westfield J208x36 w/honda....................................... $2,495 1992 Westfield J208x51 w/20hp Kohler ............................. $2,495 Used Westfield W70x36 w/5HP Baldor electric motor .......... $995 Used Westfield 707x26 w/9hp Honda ................................... $950 NEW & USED SNOWBLOWERS New Farm King 50” ............................................................ $1,825 New Farm King 60” ............................................................ $1,875 1995 Farm King 960 w/hyd cyl ........................................... $2,295 1980 Farm King 800 w/hyd cyl ........................................... $1,295 New Farm King 84” ............................................................. $2,995 New Farm King 96” D. Auger ............................................. $3,695 New Farm King 108” Double Auger.................................... $7,895 USED TRACTORS 1991 Case IH 695, 1550 hrs .............................................. $17,995 1981 Versatile 555 210hp, rear pto, 15sp trans................ $13,900 1979 John Deere 1830 w/loader & 3pt blade ................... $14,900

1-866-746-8441

Box 69, Rosenort, MB R0G 1W0

ÜÜÜ°>}`i>iÀ°Vœ“ÉÀœÃi˜œÀÌÊUÊÀœÃi˜œÀÌJ>}`i>iÀ°Vœ“

Û}ðÊ,œ˜ÊÀˆiÃi˜ÊÇ{ȇ{äxäÊUÊ>ÀŽÊ/…ˆiÃÃi˜ÊÇ{ȇääǙ Your Bourgault Shortline Farm Centre


PAGE 6 Manitoba FarmLIFE, Monday, March 12, 2012

INCREDIBLE SELECTION OF 4 WHEEL DRIVE TRACTORS!!

SOLD

2010 JD 9630

SOLD

2011 JD 9430

2700 Hrs, 78 Gal Pump, Triples.

$309,000

$219,000

1997 JD 9400

6925 Hrs.

$99,000

$79,000

2004 JD 9420 3529 Hrs, P/S, Duals.

$289,000

$189,000

1993 JD 8770

1993 CASE 9280

SOLD

1997 JD 9400

PTO, 683 Hrs, 78 gpm.

SOLD

1995 JD 8870

6376 Hrs, Triples.

2010 CASE STX535

SOLD

2005 JD 9620

868 Hrs Hrs, Triples Triples.

1990 JD 8760

4685 Hrs, Duals.

$109,000

1994 JD 8570

6245 Hrs.

9032 Hrs Hrs, Duals Duals.

9772 Hrs, Duals, PTO.

$87,500

$55,000

$49,000

1990 CASE 9150

1991 VERSATILE 976

1978 JD 8430

478 Hrs Hrs, Loaded Loaded.

8000 Hrs.

7511 Hrs.

6086 Hrs.

PTO. PTO

$299,000

$59,000

$55,000

$65,000

$25,000

GREAT SELECTION OF NEW SALFORD RTS

4WD TRACTORS

SPRAYERS JD 4710 (01) .................................................................................................$122,000 WILMAR 6400 (97) 3110 hrs. .........................................................................$51,000 AG CHEM 874SS (07) 1840 hrs. ..................................................................$149,000 BRANDT SB4000 90’ .....................................................................................$28,500 FLEXI-COIL S-67 XL 100’ ..............................................................................$15,000 FLEXI-COIL S-62 100’ .....................................................................................$5,900 AG SHIELD 80’ ...............................................................................................$10,000 MELROE 115 ...................................................................................................$4,500 ROGATOR 874 SS (07) 2070 hrs. ............................................................... $149,000 ROGATOR 1074 (05) 2950 hrs. ................................................................... $145,000

BEAT THE PRICE

INCREASE! Special low pricing on 30’ and 41’ models JD 9630 (11) Triples, 78 gpm hyd. ...............................................................$339,000 JD 9630 (10) 868 hrs., triples ............................................................SOLD $309,000 JD 9630 (09) 78 gal pump, 800/38, .............................................................$289,000 JD 9620 (06) 2403 hrs, 800/38 duals, p/s, 78 gal hyd pump.......................$229,000 JD 9620 (05) Triples, 78 gpm, 2700 hrs. ...........................................SOLD $219,000 JD 9530T (11) PTO .......................................................................................$339,000 JD 9430 (11) P/S, PTO, 800x38, 78 gpm, 683 hrs. ..........................SOLD $289,000 JD 9430 (11) Powershift. ............................................................................ $268,000 JD 9420 (06) 24 spd., 710 duals ................................................................. $189,000 JD 9420 (04) 3529 hrs, p/s, diff lock, 48 gal hyd pump, 710/42 duals ...............................................................................................$189,000 JD 9400 (97) 24 spd., 750x42 Trelbergs ..................................................... $135,000 JD 9400 (97) Duals, 4685 hrs. .................................................................... $109,000 JD 9400 (97) Triples, 6376 hrs. ..................................................................... $99,000 JD 9330 (10) Powershift, PTO .....................................................................$249,000 JD 8870 (95) 6925 hrs., duals, 24 spd. ......................................................... $79,000 JD 8770 (93) 6245 hrs .................................................................................... $87,500 JD 8760 (90) Duals. ....................................................................................... $55,000 JD 8570 (94) Duals, PTO .............................................................................. $49,000 JD 8430 (78) PTO .......................................................................................... $25,000 CASE STX 535 (10) Loaded, 478 hrs. .........................................................$299,000 CASE STX 425 532 hrs. ........................................................................ CONSIGNED CASE 9280 (93) 8000 hrs. ............................................................................. $59,000 CASE 9150 (90) 7511 hrs. ............................................................................. $55,000 VERS 976 (91) 6086 hrs. ................................................................................$65,000 VERS 1150 (82) 770 hrs, 208/42 triples, atom jet pump ...............................$69,000

MFWD & 2WD TRACTORS — MFWD —

JD 8300 c/w Degelman 5700 dozer ..............................................................$73,500 JD 8300 ..........................................................................................................$65,000 JD 7930 (11) IVT/746 loader ........................................................................$169,000 JD 7830 (11) IVT ...........................................................................................$155,000 JD 7320 (03) IVT 741 loader ..........................................................................$89,000 JD 7810 (00) c/w loader .................................................................................$69,500 JD 6420 (06) c/w 640 loader .............................................................. SOLD JUST IN JD 6320 (05) 1850 hrs .....................................................................................$56,500 JD 4955 ..........................................................................................................$59,000 JD 4955 c/w Leon 1020 dozer ......................................................................$67,500 BUHLER 2145 c/w loader .............................................................................$65,000 NH 8770 c/w loader .......................................................................................$65,000 NH TM 150 MFWD/loader .............................................................................$49,500 — 2WD — JD 7800 c/w 725 loader ................................................................. ARRIVING SOON JD 7600 (95) c/w 725 loader ..........................................................................$45,000 JD 4250 (84) 3 pt., loader, 8400 hrs. .............................................................$39,000 JD 4440 (79) mint condition ..........................................................................$25,000 JD 4040 3 pt. ................................................................................................. $15,000 JD 4020 c/w 158 loader. ............................................................................... JUST IN JD 2120 (70) c/w 707 Leon loader ................................................................$12,500 JD 2120 low hours ...........................................................................................$9,800

SEEDING EQUIPMENT

SALFORDS SALFORD RTS 50’ (Demo) ......................................................................... $112,000 SALFORD RTS (2) 50’ ................................................................................... $99,000 SALFORD RTS 41’ ......................................................................................... $79,000 SALFORD RTS 41’ (Demo) ........................................................................... $89,000

JOHN DEERE COMBINES JD 9870’S (11) 615 p/u, duals.

Starting from $332,500 ONLY 9 LEFT JD 9870’s (11) 190 hrs. ................................................................................. JUST IN JD 9870 (10) ................................................................................................. JUST IN JD 9870 (08) ................................................................................................. JUST IN JD 9770’S (11) 615 p/u, duals, 12 to choose from...................... Starting from $312,500 JD 9770 (09) ................................................................................................. JUST IN JD 9770 (08) ................................................................................................. JUST IN JD 9860/914P (05) 800/32’s, 1044 hrs. ...................................................... $175,000 JD 9860/1500 PRECISION (04) 800/32’s, 1803 hrs. .................................. $149,000 JD 9660 (07) 615 p/u, 800/38 .......................................................... JUST IN - CALL JD 9750/914 (03) 800/32’s, 1897 hrs. ......................................................... $149,000 JD 9750/914 (02) 18.4x42 duals, 2076 hrs. ................................................ $142,000 JD 9650 CTS 2045 hrs. ............................................................................... $147,500 JD 9650W/914 (01) 800/32’s, 3308 hrs. ....................................................... $88,000 JD 9610 (08) 3040 hrs .....................................................................................$79,000 JD 9600/914 (96) Chaff sprd., 2955 hrs. ...................................................... $62,500 JD 9600/212 (96) 3877 hrs. ........................................................................... $54,500 JD 9600 (96) 1896 hrs .................................................................................... $82,500 JD 9600 (95) 2168 hrs., duals ....................................................................... $79,000 JD 9600/914 (95) Chaff spread., F.C. Sonnybrook, 3233 hrs. ...................... $63,500 JD 9600/914 (94) Chaff spread., F.C. Sonnybrook ..........................JUST IN - CALL JD 9600/914 (93) Chaff spread., 3714 hrs. .................................................. $49,000 JD 9600/914 (91) Chaff spread., rice tires, 2916 hrs. .................................. $59,000 JD 9600/914 (90) Chaff spread.,2439 hrs. ................................................... $59,000 JD 9650 CTS 2045 hrs. ............................................................................... $147,500 JD CTS/914 (97) 2423 hrs., big top. ............................................................. $55,000 JD CTS/914 (97) 2700 hrs., new front tires .................................................. $59,000

OTHER COMBINES CASE 2188’S ............................................................................. $59,000 TO $83,500 CASE 1680 (87) 3700 hrs. ............................................................................. $25,000 CASE IH 1660 (87) 3187 eng. hrs., pu header. ............................................. $19,500 NEW HOLLAND CX8080 (10) 4WD ............................................................ $245,000 NEW HOLLAND CX880 (05) 1178 hrs. ........................................................ JUST IN NEW HOLLAND CX860 (05) 1490 hrs. ........................................................ JUST IN NEW HOLLAND TX66 (94) 971 pu, 2300 sep. hrs. ...................................... $42,500

BOURGAULT 3310 (10) 75’, c/w 6700 .............................................................. SOLD BOURGAULT 3310 (11) 65’, MRB c/w 6550 ....................................SOLD $355,000 BOURGAULT 3310 (09) 75’, MRB, c/w 6550L ............................................$325,000 BOURGAULT 3310 55’, MRB’s ....................................................................$199,000 BOURGAULT 3310 (08) 55’, NH3, MRB ......................................................$178,000 BOURGAULT 5710 (10) 75’, MRB ...............................................................$189,000 BOURGAULT 5810 (10) 62’, MRB ...............................................................$189,000 BOURGAULT 5710 64’, MRB, 12”, 5-1/2 packers c/w 6550 ......................$185,000 BOURGAULT 5710 64’, MRB, c/w 5440 .....................................................$115,000 BOURGAULT 5710 54’, MRB .............................................................. From $89,000 BOURGAULT 5710 (02) 52’, 12” space, MRB, dry sets w/ packers .. JUST IN/ CALL BOURGAULT 5710 (98) 40’, MRB .................................................................$48,000 BOURGAULT 8800 40’, c/w air pkg. (less tank) ................................SOLD $19,000 JD 1820’s 80’ ....................................................................................... From $39,000 FLEXI-COIL 5000 45’, c/w/ 2320 ........................................................SOLD $59,000

CULTIVATORS 61’ BOURGAULT 9400 (09) ............................................................................$94,500 57’ BOURGAULT 9400 (07) ............................................................................$82,500 63’ NEW HOLLAND ST 820 (09) ....................................................................$79,500 57’ NEW HOLLAND ST 820 (09) ....................................................................$59,000 48’ BOURGAULT 9400 ...................................................................................$39,000 52’ BOURGAULT 8800 ........................................................................SOLD $27,500 57’ FLEXI-COIL 820 .......................................................................................$27,500 41’ FLEXI-COIL 820 .......................................................................................$27,000 40’ JD 410 c/w yetters vertical till colters ....................................................$29,500

MISC. KELO OFFSET DISC 14’ ..................................................................................$8,500 NEW LEADER 3032 Dry box, fits JD 4930 ....................................................$45,000 BATEO 2110 CONVEYOR (07) 115’, c/w 50 HP electric engine .................. $39,000 FLEXI-COIL SXS 95 80’ harrow packer ........................................................$16,500 BRANDT 70’ heavy harrow, demo, carbide tines .........................................$45,000 BOURGAULT 6000 MID HARROWS 90’ ............................................. From $36,500 BOURGAULT 7200 HEAVY HARROW 72’ .....................................................$32,500 DEGELMAN (09) 82’ Strawmaster, carbide tips ............................................$45,000 DEGELMAN 14’ DOZER (4WD) .......................................................................$9,500 DEEGELMAN 10’ DOZER (2WD) .....................................................................$3,500 DEGELMAN 7900 DOZER 18’, demo ............................................................... CALL LEON 4000 DOZER 14’ Fits 8870 .................................................................... CALL JD 260 FRONT END LOADER ........................................................................ $7,500 JD 725 FRONT END LOADER ........................................................................ $6,500 LEON 800 FRONT END LOADER (Like new) ................................................. $6,500 LEON 707 FRONT END LOADER ................................................................... $3,500 DEGELMAN 1214 V MAX RAKE Demo .........................................................$15,900 DEGELMAN LL3050 HAND LEVELLER Demo ................................................$9,500 VALMAR 3255 (11) Fits Bourg. Hid harrow ...................................................$11,500 TWIN 1000 NH3 TANKS c/w trailer ...............................................................$13,500 12’ KELO OFFSET DISK ............................................................................... JUST IN FARM KING 16 x 104 .....................................................................................$29,500

NYKOLAISHEN FARM EQUIP. LTD.

KAMSACK, SK (306) 542-2814

www.nykolaishen.com

SWAN RIVER, MB (204) 734-3466

NEW

Toll Free 1-855-542-2814


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 7

BRAND NEW 2011 Chev Cheyenne 1/2Ton 4x4 Crew Cab Short Box stk#40182, blue granite, 4800, V8, positract, p/dl, p/w, air, tilt, cruise, on-star, cd, chrome package, r-boards, & more!

Plus $1,000 GM Minimum Connect & Win!

BLOWOUT $26,999

2009 GMC 1/2Ton 4x4 Crew short Box

1998 Chev Blazer 4x4

2005 Buick Rendezvous FWD CX model, 7 pass, p/seat, p/dl, p/w, V6, air, tilt, cruise, alum whls, ABS brakes, loaded $

4dr, only 110,000 kms, 1 owner, p/dl, p/w, air, auto, V6, tilt, cruise, & more $

8,995

2010 Dodge Grand Caravan SE p/dl, p/w, stow-n-go seating, tilt, cruise, 3.3 V6, auto, AM/ FM, cd player, alum whls, 54,000 kms

4800 V8, auto, air, tilt ,cruise, p/dl, p/w, trailer pkg, 99,000 kms, stealth grey met

6,995

$

Cheyenne, 55,000 kms, blue granite, air, tilt, cruise, p/dl, p/w, 4800 V8 & more

111,000 kms, auto, air, V6 & more!, white

14,899

$ $

17,999

2009 Chevrolet Chev 1/2T Ext Cab 2WD

2011 GMC Yukon XL SLT Loaded, 35,000 kms, silver metallic, heated leather, sunroof, remote start, loaded

41,999

$

2007 Ford F150 XLT 4x4 Supercab Loaded, 91,000 kms, grey-silver, 4.6 litre, V8, auto, air, tilt, cruise, cd, alum whls, p/dl, p/w, cd & more

18,999

$

Short box, 59,000 kms, dark cherry, stk#40233A, loaded, p/dl, p/w, air, tilt, cruise, cd, remote start, 4800, V8 alum whls, box rails, on-star, trailer pkg & more $

bucket seats, p/s, p/dl, p/w, air, tilt, cruise, 5300 V8, 6 spd, auto, trailer pkg, on-star, aut-trac & more $

$

2008 Montana 7 pass Van 91,000 kms, Maroon, loaded, V6, auto, air, p/dl, p/w, remote start, on-star & more $

11,999

14,995

2008 Torrent AWD Loaded, 5spd, auto, V6, air, p/dl, podium edition, remote start, p/w, 116,000 kms $

20,899

$

21,995

2010 GMC SLE 1/2T Ext Cab 4x4 Long Box 52,000 kms, black, stk#U2588, loaded,

1-owner, steel grey, 114,000 kms, V6, auto, alum whls, p/ dl, p/w, air, tilt, cruise, SLE model

22,995

2010 Chev 1/2 Ton 2WD Ext Short box

2009 GMC 1/2 Ton 2WD Reg Cab

2006 GMC Envoy 4x4 4dr

14,995

2009 Chev 1/2Ton 4x4 Ext Cab Short Box, blue granite, 58,000 kms, 1 owner, 4800 V8, p/ dl, p/w, air, tilt, cruise, trailer pkg, on-star, cheyenne eddition, running boards, positract & more, stk#40172A

23,899

$

2007 Chev 1/2T 4x4 crew cab Cheyenne

2008 Chevrolet Avalanche LTZ

4800 V8, p/dl, p/w, air, tilt, cruise, keyless entry, cd, 99,000 kms, gray, stk#U2560

Loaded, every option, 122,000 kms, sun-roof, navigation, DVD system, heated leather, gold mist, 20’ wheels

20,995

$

28,995

27,995

$

1-888-296-9666 SALES: 9 AM-9 PM Mon.-Thurs. 9 AM-6 PM Fri.-Sat. SERVICE: 8 AM-5 PM Tues.-Sat.

*Call Dealer for Details.

2010 F350 Super duty XLT 4x4 Diesel, loaded, heated leather, 31,000 kms, 5th wheel hitch, XTR package $

41,995


PAGE 8 Manitoba FarmLIFE, Monday, March 12, 2012

Pre-Owned Equipment TRACTORS NEW 2012 Versatile 435 HHT – synchro box, 710/70R42 duals ............................................................. $CALL KIOTI Tractors – in stock, try one today!! .................. $CALL ‘97 John Deere 8100 tractor – MFD, Outback GPS, 7400 hrs, new fronts/75% rear duals, totally mint ............................$67500 LIVESTOCK & FORAGE NEW HIGHLINE CFR650 BALE PROCESSORS .......... $CALL Penta Vertical Feed Mixers,Avail in all speciďŹ cations$INQUIRE NEW CLAAS JAGUAR FORAGERS ........CALL FOR PRICING NEW Bunning Spreaders – in stock .............................. $CALL USED Claas Forage Harvesters ALL Sizes/Specs Avail$CALL ’98 Claas Jaguar 880 – 4000 hrs, new engine...................$CALL New Holland Pickup Header – for FX forager ............... $CALL JF FCT1100 P/T Forage Harvester approx 1997 ........$17,500 Richardton 700 Hi-Dump Wagon, Excellent .................$8,500 ‘07 Lucknow 750 Mixer Wagon very good, otation tires$35000 Gehl 8285 mixer wagon – 285 cu. ft., good w.o. ............. $8500 ‘07 Highline 8000 bale processor – ot. tires, r/h dis. ...$9,500 ‘09 Bunning Lowlander 105 Manure Spreader – bolt on extensions, excellent, new wear parts, 930 bushels................ $38,500 ‘05 Bunning Lowlander 90 side extensions, 840 bushels$34500 ’05 Bunning Lowlander 90 – side ext., 840 bushels ..... $34500 ’08 Bunning Lowlander 75 – side ext., 680 bushel .......$30000 ‘05 Kuhn 2044 Manure Spreader – Vertical beater, upgraded tires, v. good, 600 bushels, .............................................$22,500 ’03 Leon 425 manure spreader - good ........................$13,500 ’05 Hagedorn 275 manure spreader – 2 to choose .....$17,500 IH 595 Manure Spreader – recent oor, good .................$7,500 TELEHANDLERS/FORK LIFTS NEW Manitou MLT735-120LSU – A/C, REAL AG MACH. $CALL NEW Manitou MLT/MT telehandlers – All sizes/specs.....$CALL ’05 Manitou MT1340SL Turbo 3500 hrs, 45ft, loaded ..$52,500 ’06 Manitou MT 1340SL Turbo – 1500hrs, 45ft, loaded$62,500 ’11 Manitou MLT 735-120 LSU PS – 125 hp, 150l/min hyd., Grammer air seat, Powershift, 460/70R24 Michelin, A/C, 1000 hrs, mint, local trade .........................................................$84995 ’05 Manitou MLT741-120LSU – 125hp, 150l/min hyd., Grammer air seat, hydraulic locking, new tires, A/C, Agri, 3000 hrs, mint, local trade .........................................................................$64995 TILLAGE & SEEDING SUMO subsoilers, superior build quality & ďŹ eld ďŹ nish$INQUIRE SALFORD RTS, VERTICAL TILLAGE TOOLS .............. $CALL NEW Ezee-On Drills and Carts – REBATES! ............... $CALL NEW Eagle rotary ditchers ........................................... $CALL Summer 70ft Harrowbar................................................... $2,000 CIH 7200 hoe press drill – 7â€?, 28ft, transport, mint..........$6000

HAY NEW CLAAS HAY RAKES – BEST PRICING ................. $HOT Kuhn GA7000 DL Rotary twinrake – very good ............$13995 ‘97 Claas Volto 1050T – 33 ft tedder .............................$10,995 ’09 Claas Variant 380 Round Baler – roto-cut, 4000 bales.. $32,995 ’07 Claas Variant 280 Round Baler – roto-cut, 6000 bales..$27,995 ‘99 Claas Variant 180 4x6, ...........................................$15,000 New Holland 688 Round Baler – good ............................$9500 ‘05 Case IH RBX 562 .....................................................$21,500 ‘02 Case IH RBX561 round baler – good .......................$12,500 ‘96 NH 1475/2218 Mower Conditioner, 18ft, nice shape $12,500 ’02 New Holland 1475 Haybine – 16ft, Coming ............ $CALL Kirschner Hay Fluffer .....................................................$3,500 John Deere 704 V-Rake – 10 wheel, very good ...............$6995 HARVEST NEW Macdon Westward swathers and headers all styles$CALL NEW Brandt Grain Vacs – 5200/7500 in stock ............ $CALL NEW Kane Silage/Grain Halfpipe Trailers – all sizes/specs to order, Tractor pickup hitches available! ........................... $CALL NEW BRANDT AUGERS - LARGE STOCK ................... $CALL ’07 New Holland HW325 Swather 30ft, 800 hrs, ............ $72,500 ‘98 Premier 2930 – 30ft 972 – 2400 hrs, turbo/2 spd .....$42500 ’95 Prairie Star 4900 30ft 960, 2500hrs, turbo/2spd,COMING$39,500 CIH 8220 P/T Swather – 25ft, U2 P/U Reel, mint .............$7500 Honeybee SP36 – JD Adapter, good .............................$21,995 ’06 Brandt 1070XL swing auger – very little use............. $8500 ’03 Brandt 1060XL Grain Auger – very good ..................$5000 WestďŹ eld 10 x 70 Swing Auger, newer ights and tube $6,000 MISC NEW and USED Farm King/Allied Snowblowers ....... $CALL NEW Farm King Suspended Boom Sprayers IN STOCK .$CALL NEW Woods 3 point/trailed Equipment........................ $CALL EAGLE ROTARY DITCHERS 2 units to choose, mint cond., new blades ...................................................................... $CALL ‘09 Wolverine Rotary Ditcher – mint .............................$39000 Flexi-Coil System 65 Sprayer 1000 gallon, 120 ft, nice .$7,995 Inland Terminator 1 Sprayer 70’, 800 gal.......................$5,500 NEW HLA Skidsteer and Euro Pallet Forks ................. $CALL ‘06 Brandt 5000EX Grain Vac – nice shape .................. $15,995 Agromec big square bale hook grab – Manitou Q/A, as new ...... $6,995 Skidsteer/Euro/Etc. Weld on Quick Attach Plates ....... $CALL

(204) 727-1050

VERMEER BALERS: INQUIRE TODAY! hepson.ca

After Hours (204) 573-5734

“Working With You� Brandon, MB

Sid Patterson

Neal Patterson

Jim Robinson

Mobile: (204) 573-5734

Mobile: (204) 573-0819

Mobile: (204) 573-0360

Looking for more GrainBins? Manitoba FarmLIFE has advertisements for all your farming needs.

1.888.756.7770 0( s&!8  sFARMLIFE MTSNET

EXG 300 AKRON FROM

THE

GREAT CAPACITY, 300 TON/HOUR 1 BUSHEL CLEAN UP AT THE END OF THE BAG. FULLY WINDS UP GRAIN BAG CHABOT IMPLEMENTS Neepawa, MB 204-476-3333 Steinbach, MB 204-326-6417 F.V. PIERLOT & SONS Nipawin, SK 306-862-4732 GREENFIELD AGRO SERVICE Rosetown, SK 306-882-2600 KROEKER MACHINERY Winkler, MB 204-325-4311 MARKUSSON NEW HOLLAND Emerald Park, SK 1-800-819-2583 MARTODAM MOTORS Spiritwood, SK 306-883-2045 MOODY’S EQUIPMENT LTD. Saskatoon, SK 306-934-4686 Perdue, SK 306-237-4272 Unity SK 306-228-2686 Lloydminster, SK 306-825-6141 Kindersley, SK 306-463-2335 Olds, AB 403-556-3939 High River, AB 403-652-1410 Balzac, AB 403-295-7824 NYKOLAISHEN FARM EQUIPMENT Kamsack, SK 306-542-2814 Swan River, MB 204-734-3466

PARKLAND FARM EQUIPMENT North Battleford, SK 306-445-2427 REDVERS AGR. & SUPPLY LTD. 306-452-3444 ROBERTSON IMPLEMENTS (1988) LTD. Shaunavon, SK, 306-297-4131 Swift Current, SK 306-773-4948 SCHROEDER BROS. Chamberlain, SK 306-638-6305 TWEED FARM EQUIPMENT Devil’s Lake, ND 701-662-7522 Medora, MB 204-665-2260 WHITE AG SALES & SERVICE Whitewood, SK 306-735-2300 AR-MAN EQUIPMENT Vulcan, AB 403-485-6968, 1-866-485-6968 BILL’S FARM SUPPLIES INC. Stettler, AB 403-742-8327 CAOUETTE & SONS IMPLEMENTS St. Paul, AB 780-645-4422 FOSTER’S AGRI-WORLD Beaverlodge, AB 780-354-3622, 1-888-354-3620

Email: craigyeager@grainbagscanada.com or aaronyeager@grainbagscanada.com

HAT AGRI-SERVICE Medicine Hat, AB 403-526-3701, 1-888-526-3702 Dunmore, AB,403-526-3701, 1-888-526-3702 HI LINE FARM EQUIPMENT LTD. Wetaskiwin, AB 780-352-9244, 1-888-644-5463 HAMMER NEW HOLLAND Westlock, AB 780-349-2588 1-877-456-3276 HOULDER AUTOMOTIVE LTD. Falher, AB, 780-837-4691, 1-866-837-4691 Grimshaw, AB 780-332-4691, 1-800-746-4691 KASH FARM SUPPLIES LTD. Eckville, AB 403-746-2211, 1-800-567-4394 TROCHU MOTORS LTD. Trochu, AB 403-442-3866, 1-888-336-3866 E. BOURASSA & SONS: Assinniboia 1-877-474-2456 Estevan 1-877-474-2495 Pangman 1-877-474-2471 Radville 1-877-474-2450 Weyburn 1-877-474-2491

Call Your Local Dealer

or Grain Bags Canada at 306-682-5888

www.grainbagscanada.com


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 9

SEEDING

JH:9:FJ>EB:CI

‘08 Bourgault 5710 64ft, 9.8” spacing, 3 1.2 steel packers, atom jet openers .... $92,500 ‘99 Bourgault 5710 64ft, 9.8” spacing, 3” rubber packers, mid row banders ...... $65,000 ‘03 Bourgault 5710 54ft, 9.8” spacing, 3” rubber packers, mid row banders ...... $75,000 ‘07 Bourgault 5710 54ft, 9.8” spacing, 3 1/2 steel packers, w/Bourgault 6350 aircart ......................................................................................................... $142,500 ‘01 Bourgualt 8810 55ft, 10” spacing, double shoot air kit, mid row banders ..... $75,000 ‘01 Bourgault 8810 55ft, 10” spacing, 450 Ib trip 4 bar harrows, granular kit ..... $56,500 ‘01 Bourgault 8810 40 ft, 10” spacing, double shoot air kit, independent poly packers .................................................................................................................. $45,000 Flexi-Coil 5000 Air Drill 45ft, 9” spacing, 3” rubber packers, w/2320 air cart ..... $49,500 Bourgault FH 536-40 40ft, 8” spacing, w/2155 air cart........................................ $19,500 ‘95 Bourgault 3225 Air Cart 225 bushel .............................................................. $16,900 ‘92 Bourgault 3165 Air Cart 165 bushel ................................................................ $9,500 *Good Selection of Used Poly Packers*

TRACTORS

‘05 Kubota M125X powershift trans w/Kubota M960 front end loader, 1925 hrs $59,500 ‘07 Kubota M108 swing shift, trans, open station, w/Kubota M45 FEL, 3200 hrs $43,500

Maximize Performance when it counts - the 5710 Air Hoe Drill. It’s easy to see why the 5710 AHD is the most popular drill over the last decade. UÊ-Õ«iÀˆœÀÊ`iÈ}˜Ê>˜`ÊVœ˜ÃÌÀÕV̈œ˜Ê“i>˜ÃʏiÃÃÊLÀi>Ž`œÜ˜Ê`ÕÀˆ˜}ÊÃii`ˆ˜}] UÊ ÝVii˜ÌÊVœ˜ÌœÕÀˆ˜}ÊV…>À>VÌiÀˆÃ̈VÃÊ܈Ê«ÀœÛˆ`iÊ«ÀiVˆÃiÊÃii`Ê«>Vi“i˜Ì] UÊ-ˆ˜}i‡«œˆ˜ÌÊ`i«Ì…ÊVœ˜ÌÀœÊvœÀʵՈVŽÊ>˜`Ê>VVÕÀ>ÌiÊÃii`ˆ˜}Ê>`ÕÃ̓i˜ÌÃ] UÊÊ܈`iÊÀ>˜}iʜvʜ«i˜iÀÊ>˜`Ê«>VŽiÀʜ«Ìˆœ˜ÃÊ̜ÊÃՈÌÊiÛiÀÞÊv>À“ˆ˜}ʜ«iÀ>̈œ˜° UÊÛ>ˆ>LiÊÕ«Ê̜ÊÇx½Êœ˜Ê™°n»Ê>˜`Ê£Ó°È»Êë>Vˆ˜}°

s-AC$ONs+UBOTAs(IGHLINEs6ERMEERs+UHN+NIGHTs

MISC

‘10 Salford RTS 570 50ft.................................................................................... $104,500 ‘06 Leaon 585 Manure Spreader ........................................................................ $14,400 ‘07 Schulte XH1000 rotary cutter 10ft, w/Schulte FLX10 flex arm .................... $16,900 Riteway 1600 packer bar, 40ft, w/P30 packers..................................................... $4,500 Turbo K990 super deluxe grain vac, minty clean ................................................ $7,250

BjggVnÉh;VgbHjeea^Zh ÆEgdjYH]dgia^cZ9ZVaZg[dg',NZVghÇ

WINDROWERS

‘09 MacDon M150 320 hrs, w/D60 35ft header ................................................. $114,500 ‘09 MacDon M100 329 hrs, w/D50 30ft header ................................................. $101,000 ‘07 NH HW325 820 hrs, w/Honeybee 30ft header ............................................... $82,500 ‘02 MacDon 9352C 1708 hrs, Turbo 2 spd, w/30ft 972 header ........................... $72,900

GJHH:AA

H=D6AA6@:

(204) 773-2644

(204) 759-2626

!FTER(OURS #ORRIE+AEDING204-773-6382

!FTER(OURS $UANE+ENT   *ASON$IGBY  


PAGE 10 Manitoba FarmLIFE, Monday, March 12, 2012

The equipment listed is only a small portion of what Miller Equipment has to offer! Visit us online!

06 Apache AS1010 795 Hrs,90’,1000 Gal,Autoboom,Front & Rear Fenders, Hydro Trans STK# 042548......$117,500 M

04 Apache AS850 1600 Hrs,90’,850 Gal SS Tank,Rinse Tank,Foam Mrkr,Drop Boxes STK# 042842 ........ $95,000 M

10 Apache AS715 258 Hrs,90’,750 Gal,Autoboom,Foam Mrkr,3 Way Nozz, Raven Ctrlr STK# 041819 .....$134,500 B

01 Apache 890 2495 Hrs,100’ Boom, 2 Ex. 520/85R42 Tires - 60%, 4 Crop Dividers STK# 043995 ................. $81,500 M

09 Apache AS715 228 Hrs,90’ Autoboom,750 Gal Tank, No Foam Marker STK# 036534 .............................. $129,500 M

03 Apache 859 1620 Hrs, 90’ Boom, Heavy Duty Front End, 460 Raven Controller STK#048631..................... $94,500 M

SEEDING O38970 O53634 O54412 O50929 O42526 O53422 O37556 O54347 O52296 O41481 O53077 O54381 O50709 O50715 O45398 O51105 O54663 O50913 OO4374M O52293 O53439 O54322 O53720 O54973 O53803 O54753 O52291 O53148

98 Bourgault 8800 36’, 8” Spac, 230# Trip, 155 BU Tank, Sngl Sht, Float Hitch, 2 Tnk Mtr............................. $27,500 B 97 Bourgault 8800 40’, 3 Bar Harrows, BG Quick Release Sweeps, Seed Boots, 225 BU Tank, Auger ...... $30,000 BV 93 Bourgault 8800 36’ 8” Spacing, Flexicoil 1100 Tank, 230 Trips, 3/4” Openers w/Side Wedge..................... $25,500 Y 07 Bourgault 5710 64’, 9.8” Spac, MRB, 3” Openers, 6550 TBH Tank, Dlx Auger, Dual Sht ............... $207,000 Y 02 Bourgault 5710 47’, 9.8” Spacing, 3.5” Steel Packers, Dual Shoot ................................................... $57,500 M 11 Bourgault 3310 74’, 12” Spacing, Mid Row Shanks, Double Shoot, Full Dual Walking Castors ..... $335,000 M 10 Bourgault 3310 74’, 12” Spacing, 330Trip, 4.5” V-Style Packers, Mid Row Shanks ...................... $315,000 M 09 Bourgault 3310 65’, 12” Spacing, Dual Shoot, Dry to MRB’s, Dual Caster Whls Ft, No Openers .. $159,500 M 97 Bourgault 3225 225 BU Tow Behind, Single Shoot, Single Fan, Auger, Rear Hitch ..................................... $15,000 P 94 Bourgault 3225 225 BU, 2 Comp Tank, Fill Auger, Single Fan, New Hyd Fan Motor .................................. $13,500 D 95 Bourgault 3195 195 BU, Load/Unload Auger, Single Shoot, Std Monitor, Mint Condition ........................... $15,000 M 96 Bourgault 2155 155 Bushel Tank, Load/Unload Auger, Std. Monitor, Hyd Fan, Single Shoot ....................... $9,500 B 09 Seed Hawk 72-12 600 TBT Tank (2011),Rear Clevis Htch,Prim Blkg,Hyd Meter,Duals ............................. $310,000 Y 09 Seed Hawk 72-12 600 TBT Tank (2011),Rear Clevis Htch,Prim Blkg,Hyd Meter,Duals ............................. $310,000 Y 09 Seed Hawk 65-10 30.5x32 Duals Cart, Dual Fans, Dual Shoot Dry, 400 BU Tank, TBT Tank.................. $229,500 M 09 Seed Hawk 65-10 3430 Tow Between, Dbl Shoot Air Pkg, NH3 Tanks, 8 Run Dbl Shoot.......................... $228,000 P 05 Seed Hawk 60-12 60’ 12” Spacing, 4.5 Pneumatic Pack, Quick Pin Depth Set, Duall Castors ................. $115,000 B 08 Seed Hawk 400 400 BU Tow Behind, Dual Shoot, 10” Fill Auger,Dual Hyd Fan ........................................... $73,000 Y 85 John Deere 7300 8 Row Planter, 3PT,Markers, Granular Fert......................................................................... $8,950 W 97 John Deere 787 230 BU Tow Behind, 6 Run Single Shoot, Rear Hitch, Fill Auger ....................................... $13,500 P 96 John Deere 787 230 BU, Tow Between, Auger, Two Tank Metering, 23L26 AWT-60% .............................. $14,800 P 87 John Deere 737 40’ 7.5” Spacing, Rubber Packers, Single Shoot, 230 BU Tank, Fill Auger........................ $36,000 P 93 Flexi-Coil 5000 57’ Air Drill, Tow Between, 3” Steel Packers, Single Shoot, 230 BU, 2320 Air Tank.......... $27,500 D 03 Flexi-Coil 3450 51’ Air Drill, 12” Spacing, Stealth Openers, 500 Tank, Dual Shoot, Load/Unload............... $79,500 M 98 Flexi-Coil 3450 Air Tank, 350 Bushels, Tow Behind, Var. Rate Meter Drive, Dual Shoot 6 Run Config...... $29,500 Y 00 Flexi-Coil 2340 Air Tank/Cart, 230 BU, Tow Behind, Mech. Drive, 8 Run Shoot, Dual Fans........................ $23,500 P 97 Flexi-Coil 2320 Tow Behind, Three Rollers, Dual Fan, Auger, 320 Third Tank.............................................. $23,000 Y 93 Flexi-Coil 2320 230 BU, Tow Behind, Four Rollers, Auger, 4 Run Double Shoot.......................................... $12,700 Y

O48863 O48864 O43713 O47941 O47936 O43162 O49467 O49497 O52967

11 CaseIH 4420 510 Hrs, 120’ Boom, 650/65R38x4, 320/90R46x4, Aim Com, 1200 Gal ..................... $310,000 S 11 CaseIH 4420 510 Hrs, 120’ Boom, 650/65R38x4, 320/90R46x4, Aim Com, 1200 Gal ..................... $310,000 S 10 CaseIH 4420 616 Hrs, 120’ Boom, 1200 Gal Tank, Hydro Trans, Lux Cab, Auto Pilot ..................... $279,500 K 10 CaseIH 4420 1160 Hrs, 120’ Boom, Viper & Can Cont. Sys, Act. Hyd. Susp, AIM Com. ................. $279,500 Y 10 CaseIH 4420 1202 Hrs, 100’ Boom, HID Ctr Lt, Lux. Cab, 100’ Boom, Foam Marker, Viper Pro.... $259,500 Y 09 CaseIH 4420 1565 Hrs, 120’ Boom, Act Susp,HID Lt, Raven Auto Steer, Foam Mrkr,Aim .............. $245,000 P 11 CaseIH 3330 132 Hrs, 100’ Boom, Nav II 262 Receiver, Pro 600, Ex. Set Tires ............................. $269,500 M 11 CaseIH 3330 500 Hrs, 100’ Boom, Pro 600 Nav II 262 Receiver, Del. Cab ..................................... $259,500 M 11 CaseIH 3330 300 Hrs, 100’ Boom, HID Lights, Autoboom Ht/Wheels, Foam Marker ...................... $250,000 M

SPRAYERS

Brandon, MB

Dauphin, MB

Moosomin, SK

O54888 O36122 O51122 O35541 O54943 O36479 O36165 O35765 O54785 O48041 O48668 O44369 O53206 O54460 O42842 O53328 O51240 O53719 O52432 O54246 O48576 O43995 O48631 O35547 O52714 CONSIGN CONSIGN O52705 O53076 JBU01720 O48867 O52975 O53969 O31806 JBU01719 O40685 O54149 O47939 O54942

10 CaseIH 3330 454 Hrs, 120’ Boom, Aim, Deluxe Cab, Autoboom, Accuboom, Pro 600, Auto Steer $260,000 BV 10 CaseIH 3330 353 Hrs,120’ Boom,1000 Gal,600 Mon,Ctr HID,Lthr Pkg,Full Accugde, Aim Command $259,500 M 10 CaseIH 3330 575 Hrs,120’ Boom, Quick Fill, HID Lts, Addtl Boom Sensors, 2 Sets Tires, Aim Command $265,000 BV 10 CaseIH 3330 293 Hrs,120’ Boom,1000 Gal, 20” Spac,Act Susp,Fndrs,Extra Tires .......................... $256,000 D 10 CaseIH 3330 650 Hrs, 100’ Boom, 1000 Gallon Tank, Act. Susp, Lux. Cab, Auto Height ................ $232,000 K 10 CaseIH 3330 828 Hrs,100’ Boom, 1000 Gal, Pro 600, Autoboom, Foam Mrkrs, Extra Tires .......... $219,500 M 10 CaseIH 3330 421 Hrs, 100’ Boom, 1000 Gal, 320/46 Front, 650/38 Rear, Deluxe Cab ................... $249,000 K 08 CaseIH 3320 866 Hrs, 100’, Raven Smart Trax, Aim Comm, Fenders, Act. Susp. .......................... $235,000 W 08 CaseIH 3320 1067 Hrs, 100’ Boom, 1000 Gal. Tank, Act. Susp, 5 Way Nozzle, Hal. Lights......... $208,000 KD 00 CaseIH 3200B 2501 Hrs, 90’ Boom, 750 Gal Poly Tank, Foam Marker, 3 Way Noz. ......................... $99,500 D 08 CaseIH PS160 134’ Boom, E. Pro Controller, Ultraglide, Accuboom, Fenders, Ace 206 .................... $59,500 Y 05 CaseIH 4510 2200 Hrs, Floater, 70’ Boom, Single Prod. Tank, 54x31x26 Tires - 70% ................... $139,500 M 11 Apache AS1020 200 Hrs, 100’ Boom, 1000 Gallon Poly Tank, 42” Clearance, 4 Crop Dividers ..... $169,500 S 10 Apache AS1010 395 Hrs, 100’ Boom, 1000 Gal Tank, Auto Boom, Foam Marker, EZ Guide ........ $145,000 M 04 Apache AS850 1600 Hrs,90’ Boom, 850 Gal SS Tank, Rinse Tank, Foam Mrkr, Drop Boxes ......... $95,000 M 11 Apache AS720 92 Hrs, 100’ Boom, 750 Gal. Tank, Foam Marker, SCS 5000, Radar Gun, Auto Boom $140,000 M 09 Apache AS715 300 Hrs, 90’ Boom, 750 Gal Tank, Foam Mrkr, Autoboom, Ultraglide .................... $129,000 M 09 Apache AS715 758 Hrs, 90’ Boom, 750 Gal. Poly Tank, Raven SCS 5000, HD Front End, Radar Gun $115,000 BV 08 Apache AS710 177 Hrs, 380/38 Tires, 155 Engine HP, 4 Spd Auto.............................................. $112,500 BV 06 Apache AS710 841 Hrs, 90’ Booms, 750 Gal. Tank, 4 Spd PS, Foam Marker, HD Front End ....... $104,500 M 06 Apache AS710 1290 Hrs, 90’ Boom, 750 Gal Tank, Auto Boom Ht. Control. .................................. $101,500 P 01 Apache 890 2495 Hrs, 100’ Boom, 2 Ex. 520/85R42 Tires - 60%, 4 Crop Dividers ......................... $81,500.00 03 Apache 859 1620 Hrs, 90’ Boom, Heavy Duty Front End, 460 Raven Controller .............................. $94,500 M 01 Apache 790 1750 Hrs, 90’ Boom, 750 Gallon Tank, Foam Marker,As Is........................................... $69,500 M 01 Apache 560 60’ Boom, 500 Gallon Tank, High Clearance, Norac Autoboom, 4400 Raven .............. $40,000 M 03 Flexi-Coil 67XL 90’ Boom, 830 Gallon Tank, Pull Type Sprayer, Hyd Pump,2 Way Noz Bod .......... $25,000 M 02 Flexi-Coil S67 80’ Boom, 830 Gallon Tank, 1000 PTO Pump, SP655 Ctrl, Windscrns, Rinse Tank $26,500 M 02 Flexi-Coil S67 90’ Boom, Single Wheel, Mix & Fill Rinse Tank Touch Down, Wheel Marker.......... $22,000 BV 02 Flexi-Coil S67 90’ Boom, 14.9/38 Tires, Triple Nozzle Bodies, Hyd Pump, Rate Controller .............. $18,000 K 00 Flexi-Coil XLT67 2 Booms, 2 Tanks, Auto Rate............................................................................... $27,000 KD 00 Flexi-Coil XLT67 2 Tanks, Wind Screens, Auto Rate, New Tires .................................................... $18,000 KD 98 Flexi-Coil 67XL 130’ Boom, 1200 Gallon Tank, Wind Screens, Auto Rate......................................... $12,000 K 94 Flexi-Coil S65 80’ Boom, 800 Gallon Tank, Disc Marker, Hyd Drive Hypro Product Pump ................. $5,300 Y 85 Flexi-Coil S50 70’ Boom, Pull Type, Double Body Nozzles, PTO Drive, 42 Nozzles .......................... $5,450 W 97 Flexi-Coil 65 90’ Boom, 800 Gallon Tank, Auto Rate, Disc Markers, Hyd Pump............................. $15,000 KD 10 Melroe 4660 100 Hrs, 80’ Boom, 400 Gal, Auto Trans, 2 Sets Tires, Charcoal Filter, Tow Hitch.. $110,000 BV Brandt QF2000S 130’ Boom, 1500 Gallon Tank, 16.5x16.1 x 4 Tires, Walking Axles, Auto Rate ......... $13,000 K 10 John Deere 4930 720 Hrs, Boom Trac Pro-5 Level, Wheel Shields, 5 Way Nozzle......................... $289,500 Y 03 John Deere 1810 50’ Boom, 10” Spacing, 350 BU, 150/200 BU Split, Single Chute, Atom Jet Openers $38,500 S

Shoal Lake, MB

Yorkton, SK

Langenburg, SK (306) 743-2312

Kindersley, SK (306)463-4651

(204) 725-2273

(204) 638-5558

(306) 435-3866

(204) 759-2424

(306) 783-8508

Boissevain, MB

Killarney, MB

Neepawa, MB

Winkler, MB

Preeceville, SK

(204) 534-2463

(204) 523-4644

(204) 476-3344

(204) 325-4122

www.millerfarmequipment.com

(306) 547-3300


Manitoba FarmLIFE, Monday, March 12, 2012

10 CaseIHST435 567 Hrs, 24 Spd Trans,Diff Loks,55 Gal Hyd Pump,Perf Monitor stk# O37173 ............... $207,500 S

08 CaseIHST485Q 1920 Hrs,30” Tracks, 55 GPM High Output, Diff Locks Ft/Rear stk# O51717............ $241,000 Y

SPRAYERS CONTINUED O47143 O54979 JBU01726 O43159 O52890

05 John Deere 850 1597 Hrs, Rear Duals, 175 Eng. HP. Zynx Monitor, Sect Cont, 850 Gal ................. $87,500 B 03 Bourgault 1460 82’ Boom, 1250 Gal. Tank, Disc Markers, Wind Screens, Fresh Water Rinse Tank . $9,900 M 08 Westward Sprayer Pull Behind Estate Sprayer, Like New ................................................................ $2,750 KD 97 Patriot 150 2714 Hrs, 90’ Boom, 3Way Nozzle, Deutz Eng, 3 Set Tips, DJ Control........................... $55,000 Y 94 Ag Shield Sprayer 100’ Wheel Boom, 1000 Gal. Tank w/Mix&Fill Tank, Wind Screens, 4 Sect. Boom .. $6,800 Y

TRACTORS

CASE IH QUAD TRACTORS O52487 O48862 O51231 O49767 O49302

11 CaseIH ST600Q 170 Hrs, 36” GY Tracks, Lux. Cab, PTO, Diff Locks, 57 GPM Hyd. Pump ............ $405,000 Y 11 CaseIH ST535Q 875 Hrs, 30” GY Tracks, 16F/2R PS, Lux. Cab, 4 Remotes .................................. $326,000 S 10 CaseIH ST535Q 795 Hrs, 30” Tracks,Dlx Cab,Dlx. Cloth Htd Seat, Adj Wide Mrkr Lts ................. $310,000 BV 11 CaseIH ST485Q 650 Hrs, 30” Tacks, Lux. Cab, HID Lights, Cold Start, 55 Gal Hyd Pump ............ $310,000 M 10 CaseIH ST435Q 1100 Hrs, 30” Tracks, PS Trans, Lux. Cab, 55 GPM Pump .................................. $255,000 M

TRACTORS: CASE IH 4WD O54256 O48276 O48083 O48880 O48881 O48885 O52900 O49874 O54929 O36199 O52472 O50434 O49495 O48082 O49316 O48307 O48255 O49305 O48099 O51250 O52491 O52699

12 CaseIH ST600 No Hours, New On Lot, Lux. Cab, Rear Remotes, Hi CapBar w/Diff Lock ............... $369,500 S 11 CaseIH ST535 550 Hrs, Prs, Triples, Lux. Interior, Nav II Controller, Diff Locks ............................... $294,500 B 11 CaseIH ST535 980 Hrs, Duals, PS Trans, Lux. Cab, Hi Cap, Pump, 4 Remotes ............................. $286,500 B 11 CaseIH ST535 504 Hrs, Full PS 16F/2R, 520/85R46 Triples, Lux. Cab, Cold Start.......................... $297,000 S 11 CaseIH ST535 622 Hrs, Full PS 16F/2R, 520/85R46 Triples, Lux. Cab, Cold Start.......................... $297,000 S 11 CaseIH ST535 727 Hrs, Full PS 16F/2R, 520/85R46 Triples, Lux. Cab, Cold Start.......................... $297,000 S 11 CaseIH ST535 506 Hrs, 520/85R46 Triples, PS Trans, Lux. Cab, Diff Locks, 55 GPM Pump ......... $297,000 D 10 CaseIH ST535 1634 Hrs, PS, Lux Cab, Diff Locks, 4 Hyd Rem, Perf Mon, Triples ....................... $267,500 BV 10 CaseIH ST535 720 Hrs, HP 610 (Pro Model), Duals, Diff Locks, Ex. Hydr. Pump, 4 Remotes ........ $259,000 S 09 CaseIH ST535 1724 Hrs, PS, 520 Triples, Lux Cab, PTO, Pro 600, 58GPM Pump ..................... $244,500 BV 09 CaseIH ST535 1400 Hrs, PS Trans, Duals, 4 Hyd Remotes, Air Seeder Drain, Frt/Rear Diff Locks $240,000 B 11 CaseIH ST485 200 Hrs, Duals, 55 Hyd Pump, Lux. Cab, 4 Hyd Remotes,PS Trans ...................... $263,500 M 11 CaseIH ST485 700 Hrs, Del. Cab, Duals, 55 Gal Hyd Pump, 4 Hyd Remotes, Nav II..................... $255,000 M 11 CaseIH ST435 750 Hrs, Duals, PS Trans, Lux. Cab, Hi Cap, Pump, 4 Remotes ............................. $242,000 B 11 CaseIH ST435 275 Hrs, Duals, 24 Spd. PS. Diff Locks, 55 Gal. Pump............................................ $222,500 M 11 CaseIH ST385 286 Hrs, Duals, PS Trans, Std Cab, Diff Locks, No Nav II Cont. .............................. $216,000 B 11 CaseIH ST385 400 Hrs, Duals, PS Trans, 4 Hyd Remotes, Perf. Monitor, Radar ............................ $216,000 D 11 CaseIH ST385 200 Hrs, Duals, PS Trans, 4 Hyd Remotes, Diff Locks, 55 Gal. Hyd Pump ............ $216,000 M 11 CaseIH ST385 400 Hrs, Duals, PS Trans, Del. Cab, Hi Cap Pump, 4 Remotes............................... $216,000 B 10 CaseIH ST385 366 Hrs, PS, Hi Cap Pump, Diff Locks, Std Drawbar, No PTO, Cold St................... $204,500 S 09 CaseIH ST385 500 Hrs, Duals, 16 Spd PS, Dlxe Cab PS, Wheel Axle w/o Diff, Std Drawbar w/o 3PT $195,000 M 96 CaseIH 9370 7529 Hrs, Duals, PTO, 12 Spd PS, 4 Remotes, Air Seat, Radio ................................... $69,000 P

TRACTORS : OTHER 4WDS O51515 CONSIGN O54847 O54857 O54404 O54820 O54946

06 New Holland TJ530 2389 Hrs, 800/70R38 Duals, Mega Flow Hyds, Perf. Monitor ............................... $202,000 Y 98 New Holland TV140 10535 Hrs, 16.9X38 Tires, NH 7614 Loader/Buck, 22 Frt Weights ........................ $34,500 K 95 New Holland 9280 4907 Hrs, 18.4R38 Tires, Duals, 4 Hyd. Remotes, Low Pressure Return, 250 HP .. $45,000 P 97 John Deere 9300 5841 Hrs, 12 Spd Std Trans, 4 Hyd. Remotes, Duals, 2-680kg Rear Wheel Weights $85,000 L 96 John Deere 8570 6135 Hrs, 18.4R38 Duals, 4 Remotes, Diff Locks, 250 Engine HP, 12 Spd Trans .... $57,000 Y 02 Buhler 2180 2400 Hrs, MFD, Duals, 1000 PTO, 3 PT Hitch, 4 Remotes, PS 18/9, Trans ...................... $73,000 B 76 Versatile 800 8400 Hrs, Duals, AC/Heater, 12 Spd. Standard, 235 Engine, 4 Remotes ......................... $12,500 B

CASE IH TRACTORS : MFD / 2WD O48075 O50197 O41600 O38436 O49485 O48879 O48877 O51863 O51248 O41135 O40951 OO3979M

11 CaseIH Puma180 700 Hrs, Duals, 112” Axle, CVT Trans, 4 Remotes, Del. Cab. ............................ $121,500 B 10 CaseIH Puma140 300 Hrs, Loaded Joystick, Fenders, Bucket, 3 Pt. Hitch, 3 Hyd Remotes ......... $119,500 M 09 CaseIH Puma140 1566 Hrs, PS, 4 Hyd Rem, 3 PTH, L760,Joystick ............................................... $97,500 KD 09 CaseIH Puma140 1031 Hrs, PS, 112”Bar Axle, 3 Hyd Rem, Fndrs, LX760, Whl Wts ........................ $92,750 L 11 CaseIH Puma 125 150 Hrs, L760 Ldr, 102” Buck/Grapple, 540/1000 PTO, 98” Bar Axle ............... $104,500 M 11 CaseIH Puma125 581 Hrs, 540/1000, 3 Remotes, Cold Weather Pkg, 8 Weights ............................. $84,500 S 11 CaseIH Puma125 875 Hrs, 540/1000, 3 Remotes, Cold Weather Pkg, 8 Weights ............................. $84,500 S 10 CaseIH Puma125 480 Hrs, L760 Ldr, 95” Buck/Grapple, 19 Spd Trans, 23 degree radial............... $105,000 S 10 CaseIH Puma125 218 Hrs, PS, 3 Hyd Rem, Grid Heater, Elec Mirrors, PTO, Cold Start Pkg ........... $99,500 S 09 CaseIH Puma125 2015 Hrs, 18 Spd, L760 Loader, 3 Func Joystick, Fenders .................................. $96,500 W 09 CaseIH Puma125 2489 Hrs, PS, L760 w/Bkt/Grpl/Sil Sc, 3 Hyd Rem, 3 Func Joystk, No Duals....... $89,500 D 09 CaseIH Puma125 1069 Hr, MFD, 3Pt, Loader Rdy,18.4R42, Frt.Fndrs,16.9x28 ................................ $87,500 B

BRANDON Larry Mountain Wade Heinrichs Craig Frondall Marv Nicholls

BOISSEVAIN

DAUPHIN

KILLARNEY

Wayne Stansall George Panko Jeff Cuvelier Henry Voth Todd Nichol Kelly Johnston Ryan Heinrichs Jeff Abraham Bruce Charles Henry Voth (204) 534-7578

O48354 OO2654M O34589 O45613 O46433 O54188 O38833 O48061 O48154 O48153 O48106 O48059 O48107 O38403 O54567 O38293 O48072 O51966 O48060 O53629 O41515 O48537 O41739 O54830 O54361 JBU01825 O54819 O39949 O54261 O37844 O33136 O52535 O53235

PAGE 11

11 CaseIH ST435 591 Hrs, Duals, Dlx. Cab, Diff Locks, PS Trans, Low Pressure Return stk# O49736 ....... $242,000 M

08 CaseIH Puma125 1751 Hrs, L760 Loader, 3 Pth, Joystick, Del. Cab, Rear Wgts ........................... $91,500 BV 08 CaseIH Puma125 984 Hrs, MFD, 3Pt, 20.8x38, L760 FEL, 92” Bkt, 2 Hyds, 540/1000 .................... $85,000 M 08 CaseIH Puma125 1744 Hrs, PS, 3 Hyd Rem, 3PTH, Bar Axle, Frt Wts, Dual PTO .......................... $83,000 M 06 CaseIH MXM190 5369 Hrs, PS, 190 Engine HP, 175 PTO HP, 3 PT Hitch........................................ $71,500 S 04 CaseIH MXM175 4530 Hrs, PS, MFS, 3Pt Hitch & PTO, LX175 MSL Load w/Grap. & Joystick ........ $70,000 Y 06 CaseIH MXM120 4300 Hrs, LX162 Ldr, 4 Hyd. Remotes, 3 PT Hitch, Bucket/Grapple, 540/1000 PTO $54,500 D 03 CaseIH MXM120 4144 Hrs, LX 160 Ldr, Semi PS, No Duals, 3 PTH,4 Hyd Remotes ...................... $47,500 M 11 CaseIH MX275 700 Hrs, Duals, 19 Spd PS, Del. Cab, Sgle Beacon, Frt Fenders ........................... $159,500 B 10 CaseIH MX275 1250 Hrs, Duals, 23 Spd PS/Creeper, Del. Cab. 10 Weights................................... $149,500 B 10 CaseIH MX275 1250 Hrs, Duals, 23 Spd PS/Creeper, Del. Cab. 10 Weights................................... $149,500 B 11 CaseIH MX245 700 Hrs, Duals, 19 Spd PS, Del. Cab, Sgle Beacon, Frt Fenders ........................... $158,000 B 11 CaseIH MX245 545 Hrs, Duals, 245 Engine HP, 19 Spd PS, Del. Cab, Single Beacon, 4 Remotes $146,500 B 11 CaseIH MX245 700 Hrs, Duals, 19 Spd PS, Del. Cab, Sgle Beacon, Frt Fenders ........................... $158,000 B 09 CaseIH MX215 1160 Hrs, PS, 4 Hyd Rem, Beacon, Htd Cloth Seat, No 3PTH, PTO ................... $135,000 BV 06 CaseIH MX215 3100 Hrs, PS, 4 Rear Remotes, 3PT Hitch, Diff Locks, PTO, Heavy Duty Draw Bar $115,000 KD 99 CaseIH MX180 7757 Hrs, Duals, PS, MFD, 3 Rem, 3PTH, Beacon, Buddy Seat, PTO .................... $52,000 W 11 CaseIH MX125 600 Hrs, L750 Loader/Grapple, 98” Bar Axle, Semi PS, 3 Remotes .......................... $99,500 B 10 CaseIH Max125 291 Hrs, L750 Ldr, 95” Buck/Grapple, 16x16 Semi PS, 540/1000 PTO .................. $94,000 M 10 CaseIH Max125 377 Hrs, Max 125 Value, 3x4 Synchro, 125 Eng. HP, 3 Remotes ........................... $64,500 B 09 CaseIH Max110 300 Hrs, L740 MSL Frt Ldr, Open Station, Folable Rops, 16X16 Semi PS Trans ... $50,500 B 97 CaseIH 8920 6428 Hrs, PS, 2895 Buhler Ldr/Jystk, 3 PTH,3 Hyd Rem, Cab/Air/Heater .................... $62,500 N 99 CaseIH 7110 10259 Hrs, Std. Cab, AC/Heater, No 3 PTH, 3x Rear Hyd. Remotes ........................... $22,500 B 89 CaseIH 7110 9249 Hrs, 18 Spd PS Tr, 3 Rem, 540/1000 PTO, Duals............................................... $25,000 M 82 CaseIH 5288 Standard Transmission, 160 Engine HP, 14L-15.1 Front, 20.8/38 Rear, Duals ............ $13,500 D 84 CaseIH 3688 7200 Hrs, Duals, Std. Trans, 140 Engine HP, 3 Hyd. Remotes, A/C, Heater................ $12,500 B 83 CaseIH 2590 9092 Hrs, Case FEL .................................................................................................... $11,500 KD 82 CaseIH 2390 6126 Hrs, 12 Spd. PS, Duals, 2 Hyd. Remotes, 1000 PTO, Cab, Air, Heat. ................. $16,500 D 81 CaseIH 2390 6665 Hrs, PS, 2 Hyd Remotes, 1000 PTO, Duals ........................................................ $14,500 M 86 CaseIH 2096 9042 Hrs, PS Transmission, 11.00-16 Front, 18.4-38 Rear, L795 Ldr & Bucket ........... $17,500 N 78 CaseIH 2090 8153 Hrs, PS, Bolt on Duals, 2 Remotes, 540/1000 PTO ............................................. $12,500 N 84 CaseIH 1896 7663 Hrs, PS, 540/1000 PTO, 3 Hyd Rem, Rear Whl Wts ........................................... $15,000 M 76 CaseIH 674 2615 Hrs, 2WD, Loader, 60” Land Pride 25-60 3 PTH Mower, 540 PTO, 8x4 Transmission $7,000 B 66 CaseIH 580 Industrial Tractor, 3 PTH, Gas Eng, 2WD, Const. Front End Ldr, Road Box Scrap 84” . $9,500 Y

OTHER TRACTOR MAKES O46553 O47167 O54467 O54558 O49883 O54818 O51230 O53968

04 New Holland TM175 4628 Hrs, LB72 Loader, 95” Buck. w/Grapple, No Duals, 3 Function ............. $62,500 M` 94 New Holland 8870 9564 Hrs, MFD, Lg 1000 PTO, Duals, Shedded, PS Transmission ..................... $38,000 B 96 New Holland 8670 6090 Hrs, MFD, PS Transmission, 140 Engine HP, Allied FEL ......................... $55,000 M` 00 John Deere 7510 13058 Hrs, 740SL Fel & Grapple, 3 Remotes, Air, 3 Point, Joystick, 155 PTO HP $44,500 N 75 John Deere 4230 5848 Hrs, Quad Shift Trans, 10-16 Front Tires, 18.4x38 Rear Tires ..................... $13,500 D 84 John Deere 2950 5885 Hrs, 260 SL Loader, Bucket/Grapple, Quick Detach, Joystick, 3 PT Hitch ... $28,500 D 92 Massey Ferg 390 2020 Hrs, 12 Spd Tr, Diff Lock, #80 Ezee Loader............................................... $12,000 BV 08 Kubota M135XD 2435 Hrs, Loader/ Bucket Grapple, Fast Turn, 4 Hyd, Dual PTO, Fluid In Tires . $65,000 BV

O54344 O51251 O48326 O48282 O49493 O48090 O48891 O48892 O48894 O48895 O49713 O48287 O48281

12 CaseIH WD1203 4 Hrs, 16’ HDX 162 Hay Hdr, Dbl Knife Drive,Rubber on Rubber, PU Reel ......... $108,500 B 11 CaseIH WD1203 43 Hrs, DH362 Draper, Dbl Knife, Spit Reel, Hyd F&A, Susp Cab......................... $126,000 S 11 CaseIH WD1203 125 Hrs, DH362, UII 6 Bat 1 PC Reel, Dbl Knife Drive, Hyd F&A ......................... $126,000 B 11 CaseIH WD1203 86 Hrs, DH302, 30’ UII PU Reel, Hyd F&A, Dbl Knife Drive, Del. Cab.................. $126,000 B 11 CaseIH WD1203 100 Hrs, DH302 30’ Draper, Dbl Knife Dr, Cab Upgraded, UII PU ....................... $126,000 M 11 CaseIH WD1203 200 Hrs, DH362, 1 PCUII PU Reel, Upgraded Cab, Dbl Knife Dr. ........................ $126,000 B 11 CaseIH WD1203 205 Hrs, DH362, 21Lx28 Tires, Cab Susp. Only, Split Reel, Hyd F&A .................. $126,000 S 11 CaseIH WD1203 207 Hrs, DH362, 21Lx28 Tires. Cab Susp. Only, Split Reel, Hyd F&A .................. $126,000 S 11 CaseIH WD1203 261 Hrs, DH362, 21Lx28 Tires, Cab Susp. Only, Split Reel, Hyd F&A .................. $126,000 S 11 CaseIH WD1203 223 Hrs, DH362, 21Lx28 Tires, Cab Susp. Only, Split Reel, Hyd F&A .................. $126,000 S 11 CaseIH WD1203 191 Hrs, DH302, 30’ UII PU Reel, 21Lx28 Tires, Susp. Cab, Hyd F&A ................. $119,000 S 11 CaseIH WD1203 86 Hrs, DH302, 30’ UII PU Reel, Hyd F&A, Sgle Knife Dr. Del. Cab .................... $119,000 B 11 CaseIH WD1203 86 Hrs, DH302, 30’ UII PU Reel, Hyd F&A, Sgle Knife Dr. Del. Cab .................... $119,000 B

SWATHERS AND HEADERS

MOOSOMIN

NEEPAWA

SHOAL LAKE

WINKLER

YORKTON

PREECEVILLE

Torrie Carter Barry Doole Jason Miller

Doss Mayor Buzz Bradley Wally Van Niekerk

Mark Swereda Willie Voth Gerry McTavish

Kevin Bergen Lee Maclean Travis Thiessen

Barry Maurer Jerry Borchowitz Ken Chepil Warren Kotzer

Jason Reine Russel Larnder

www.millerfarmequipment.com

LANGENBURG Cory Andres Dave Eberts


PAGE 12 Manitoba FarmLIFE, Monday, March 12, 2012

The equipment listed is only a small portion of what Miller Equipment has to offer! Visit us online!

07 CaseIH 2042 36’ Draper,2388 Adptr, No Trans, Gauge Whls, Empire Whls, Stk# 033645 ........................$32,500 M

O49302 10 CaseIH ST435Q 1100 Hrs, 30” Tracks, PS Trans, Lux. Cab, 55 GPM Pump ........................................... $55,000 M

08 CaseIH ST535 1925 Hrs,PS,Lux Cab,4 Hyd Rem,Pro 600,262 Rec,Nav II,Triples stk# O38363 ........... $235,000 D

09 CaseIHWD1203 202 Hrs, DHX362 Hdr, Dbl Knife Dr, Hyd F/A, Susp Cab, Wiper, Cold Start stk# O37901 .. $114,000 L

05 CaseIH WD1202 910 Hrs,36’ PU DH362 Sngl Knife Dr,Sch. Cut Sys,Slow Spd Tr STK#033264 ......... $86,900 B

10 CaseIH WD1203 197 Hrs, 36’ DH362, PU Reel, Upgrade Cab, Cold Start, srk# O35234 .......................... $119,500 B

SWATHERS AND HEADERS CONTINUED O48223 O49325 O49303 O48098 O49745 O49204 O49207 O48415 O52460 O36307 O36309 O35817 O37726 O38164 O36215 O36216 O52972 O36093 O38295 O38908 O49732 O37849 O38163 O48416 O48413 O48157 O35018 O38360 O38361 O50062 O50061 O40566 O46162 O49783 O47165 OO3290 O46343 O31940 OO5006M

11 CaseIH WD1203 75 Hrs, DH302, 21Lx28 Tires, 30’ PU, 2 Spd Hydro,Hdr Transport ...................... $119,000 S 11 CaseIH WD1203 50 Hrs, DH302, 21Lx28 Tires, 30’ UII PU, Hydro Trans, Susp. Cab ..................... $119,000 M 11 CaseIH WD1203 2 Hrs, DH302, 21Lx28 R4 Lug, 30’ UII PU Reel, 5 Bat Plastic .............................. $122,500 M 11 CaseIH WD1203 200 Hrs, DH302, 21Lx28 Tires, Del. Cab, Cab Susp. Frt Wiper ............................ $119,000 B 11 CaseIH WD1203 155 Hrs, 36’ PU Reel, 362 Header, 21Lx28 Tires .................................................. $126,000 K 11 CaseIH WD1203 150 Hrs, DH302, 18.4R26 Tires, Dble Knife Drive, UII 5 Batt Reell ...................... $119,000 D 11 CaseIH WD1203 150 Hrs, DH302, 18.4R26 Tires, Dble Knife Drive, UII 5 Batt Reell ...................... $119,000 D 11 CaseIH WD1203 120 Hrs, 30’ DH302, UII 5 Batt PU Reel, Hyd Fore/Aft. Del. Cab.......................... $115,000 D 11 CaseIH WD1203 105 Hrs, 30’ DH302, UII PU Reel, Hyd Fore/Aft, Chaff Wiper Kit, Plastic Teeth ... $115,000 S 10 CaseIH WD1203 285 Hrs, 36’ DH362, UII Split Reel, Hyd Fore/Aft, Dual Knife Dr........................... $119,500 S 10 CaseIH WD1203 256 Hrs, 36’ DH362, UII Split Reel, Hyd Fore/Aft, Dual Knife Dr........................... $119,500 S 10 CaseIH WD1203 72 Hrs, 30’ DH302, UII 6 Batt Reel, Upgrade Cab, Aux Hyd Pump Reel Dr ......... $119,500 B 10 CaseIH WD1203 217 Hrs, 36’UII PU,Dbl Knife Dr,Hyd Fore/Aft,Front Wiper,Dlx Cab ...................... $105,000 M 10 CaseIH WD1203 209 Hrs, 36’ UII PU,Fore/Aft,Dlx Cab,Front Wiper,Cold Start Pkg,Mirrors ............ $119,500 S 10 CaseIH WD1203 209 Hrs, 36’ DH362 6 Batt UII PU, Hyd Fore/Aft, Dual Knife Dr.......................... $119,500 BV 10 CaseIH WD1203 246 Hrs, 36’ DH362 6 Batt UII PU, Hyd Fore/Aft, Dual Knife Dr............................ $119,500 B 10 CaseIH WD1203 180 Hrs, 36’ DH362, Del. Cab, Hyd Fore/Aft, Cab Suspension, Frt Wiper/Washer ... $117,500 M 10 CaseIH WD1203 80 Hrs, 30’ UII PU ,Hyd Fore/Aft, Hyd Tilt, Single Knife Dr, Dlx Cab .................... $115,500 S 10 CaseIH WD1203 167 Hrs, 30’, UII PU Reel w/Plastic Teeth, Fore/Aft,Dlx Cab................................ $115,000 W 10 CaseIH WD1203 312 Hrs, 36’ PU, Dble Knife Dr, Std Cab w/Susp, Rear Axle Susp, Cold St ....... $114,800 BV 10 CaseIH WD1203 523 Hrs, 36’ DH362 Header, UII Split Reel, F&A, Dble Knife Drive ...................... $114,500 M 10 CaseIH WD1203 247 Hrs, 36’ DH362, 6 Batt UII PU,Hyd Fore/Aft,Dual Knife Dr ........................... $114,500 BV 10 CaseIH WD1203 151 Hrs, 30’ UII w/Plastic Teeth, Fore/Aft, Dlx Cab, Front Wiper, Grid Htr ........... $112,500 S 10 CaseIH WD1203 275 Hrs, 30’ DH302 UII 5 Batt PU, Del.Cab, Cold Start, Cold Start Kit ................. $110,000 D 10 CaseIH WD1203 220 Hrs, 30’ DH302 UII 5 Batt PU, Del. Cab, Hyd Fore/Aft, Cold Start ................. $110,000 D 10 CaseIH WD1203 250 Hrs, DH302, 21Lx28 Tires, Del. Cab, Cab Susp, Frt Wiper ............................ $109,500 B 09 CaseIH WD1203 316 Hrs, 36’ UII PU Reel, Dbl Knife Dr, Hyd F/A, Sngl Span Reel ........................ $112,000 D 09 CaseIH WD1203 396 Hrs, 36’ UII PU Reel, Dbl Knife Dr, Hyd F/A, Cold Start Pkg.......................... $109,500 S 09 CaseIH WD1203 337 Hrs, 36’ UII PU Reel, Dbl Knife Dr, Hyd F/A, Cold Start Pkg.......................... $109,500 S 09 CaseIH WD1203 300 hrs, 36’ UII PU Reel, Split Reel, Double Knife Drive, Del. Cab....................... $107,500 M 09 CaseIH WD1203 300 Hrs, 36’ UII PU Reel, Split Reel, Double Knife Drive, Del. Cab ...................... $107,500 M 08 CaseIH WD1203 419 Hrs, 36’ UII 6 Batt 1 Pc Reel, Dbl Knife Dr, Trans,Dlx Cab,Wiper .................... $89,500 B 08 CaseIH WD1203 433 Hrs, 30’ DH302 Double Knife Drive, Completed Updates ................................. $88,500 K 08 CaseIH WD1203 785 Hrs, 30’ DH302 Dbl Knife Dr, UII Pickup Reel, Hyd F/A, Dlx Cab .................... $87,500 D 07 CaseIH WDX1202 831 Hrs, 36’ Header, UII Split Reel, Dbl. Knife Drive, F&A ................................... $87,500 N 07 CaseIH WDX1202 732 Hrs, 30’ PU Reel, Transport, Guage Wheels, Dlx Cab ................................... $82,500 D 06 CaseIH WDX1202 883 Hrs, Split Reel, Gauge Wheels, Endwise Transport ....................................... $83,000 Y 06 CaseIH WDX1202 395 Hrs, 25’, Hdr Tilt, Steel PU Teeth, Fore/Aft, Hi Spd Transport ...................... $79,500 W 06 CaseIH WDX1202 1586 Hrs, 36’ PU Reel, Guage Wheels, Transport,SKD .................................... $72,500 KD

O36732 O45578 O51273 O51276 O45786 O49704 O50063 CONSIGN O49917 O46386 O47170 O54204 O46429 O46360 O46624 O45530 O42428 O54015 O54205 O54078 O33419 OO3221M O46628 O49995 O52882 O49499 CONSIGN O53330 O52085 O48665 O47763 O48666 O45537 O54532 O46629 O54921 O54922 O46273 O46574 O52575

06 CaseIH WD1202 470 Hrs, 36’, Split Reel, Hyd Fore/Aft, Transport, Guage Whls ............................... $76,500 M 05 CaseIH WD1202 837 Hrs, 30’ Sinlge Knife Drive, UII PU Reel ........................................................... $89,000 K 05 CaseIH WD1202 813 Hrs, DH362 Hdr, Hyd Fore & Aft, Double Knife Drive, PU Reel ....................... $79,500 D 05 CaseIH WD1202 1062 Hrs, DH362, Single Knife Drive, Pickup Reel.................................................. $77,500 D 05 CaseIH WD1202 1025 Hrs, 30’ Header, 18.4x26, 14Lx16.1 Tires, UII PU Reel, Del. Cab ................. $77,500 D 05 CaseIH WD1202 870 Hrs, 30’ Draper Header, UII PU Reel, New Guards, Hydro Trans ................... $76,000 K 09 CaseIH HDX162 16’ HDX162 Hay Header .......................................................................................... $22,500 M 08 CaseIH HDX162 16’ Hay Head Fits WD1202/WD1203 ....................................................................... $21,500 M 99 CaseIH 8825 1700 Hrs, 25’ Hdr w/UII PU Reel, Diesel Engine, Shedded........................................... $28,500 N 98 CaseIH 8825 1985 Hrs, 14.9x24, 11Lx15, Hydro Trans, Dbl. Swath, Dbl. Knife Drive........................ $34,000 N 97 CaseIH 8825 1850 Hrs, 25’, UII PU Reel, DKD, DS, Hydro Trans, 98 Engine HP ............................. $32,000 K 96 CaseIH 8820 2031 Hrs, 25’ Center Delivery Header, UII PU Reel, 21.5x16.1 Front, 7.5x15 Rear ..... $22,500 B 95 CaseIH 8820 1910 Hrs, 21’ Header, UII PU Reel, 14.9-24 Tires ......................................................... $26,500 D 95 CaseIH 8820 2305 Hrs, 25’ UII PU Reel, 14.9-24 Tires, Canvas Good Condition .............................. $25,500 S 94 CaseIH 8820 2195 Hrs, 30’ UII PU Reel, 16.5x16.1, 9.5x14 Tires, Plastic Teeth ............................... $27,500 S 94 CaseIH 8820 2460 Hrs, 30’ Header, Double Knife, UII PU Reel, Plastic Teeth .................................. $23,500 D 94 CaseIH 8820 2715 Hrs, 25’ PU Reel, Dble Knife Drive, Gauge Wheels, Diesel Engine ..................... $22,900 B 94 CaseIH 8820 4732 Hrs, 25’ UII PU Reel, 14.9-24 Tires, Double Swath .............................................. $14,500 D 96 CaseIH 8820 16’ Hay Header, Steel on Steel Conditioner, Single Knife Drive...................................... $5,500 B 93 CaseIH 8820 14’ Hay Header, Double Knife Drive, Steel on Steel Rollers, PU Reel ............................ $5,500 D 85 CaseIH 6000 3800 Hrs, 30’ PU Reel, Rear Weights ............................................................................ $11,500 M CaseIH 730 30’ PT Windrower,Bat Reel,Rubber Canvass ........................................................................ $2,650 W 96 CaseIH 205 16’ Hay Header to fit Massey Windrowers 200 and 220 .................................................... $4,500 S 06 MacDon 9250 660 Hrs, 36’ 963 Draper Header, Pickup Reel, Gauge Wheels ................................... $72,000 M 00 MacDon 9250 978 Hrs, 30’ 962 Header(2001) PU Reel, Deluxe Cab, 21.5x16.1 Ft/ 14Lx16 Rear.... $59,500 M 02 MacDon 2940 1145 Hrs, 962 30’ Header w/PU Reel, 2 Spd Trans .................................................... $67,500 M 96 MacDon 960 25’, Fits Vers/NH 9030 Bi Directional, mounted swath roller, knife ................................ $11,500 N 09 MacDon M150 525 Hrs, 35’ D60 Draper Header, Mech Centre Link, Hyd F&A, Single Knife Drive . $125,000 M 09 MacDon 100 255 Hrs, 30’ D50 Hdr, 600 Dr. Tires, 16.5x16.1 Forked Rear, Hyd F&A ..................... $110,000 L 10 Massey 9435 36’, Single Swath, One Piece UII Reel, w F&A, End Guage Wheels............................ $99,500 Y 09 Massey 9430 130 Hrs, 36’ Draper Head w/PU, Sgl Knife Drive, Rear Weights ................................ $109,500 M 08 Massey 9430 36’ Single Swath, 6 Rear Weights, Accutrac Steering, Hyd Tilt, F&A ........................... $91,500 Y 06 Massey 9220 805 Hrs, 25’ 5200 Hdr Model, Formed Casters, 5 Batt Reel........................................ $61,000 W 97 Massey 220 2211 Hrs, 26’ PU Reel, Double Swath, Schumacher Knife Drive, Hydro Trans ............. $29,500 M 03 Massey 200 1420 Hrs, 26’, UII PU with Plastic, Cavasses & Knife very good cond. .......................... $29,500 S 09 John Deere 4895 283 Hrs, 36’ Honey Bee Header, PU Reel, Deluxe Cab, Gauge Wheels, Hydro Trans. $109,500 M 09 John Deere 4895 270 Hrs, 36’ Honey Bee Header, PU Reel, Deluxe Cab, Gauge Wheels, Hydro Trans.$109,500 M 99 Prairie Star 4920 1876 Hrs, 25’ 960 Hrd, PU Reel, Shedded, Field Ready....................................... $39,500 D 00 Prairie Star 4600 2000 Hrs, 30’ Pull Type Swather, Batt Reel .............................................................. $4,500 D 03 Westward 9250 920 Hrs, 30’ 972 Header, Double Knife Drive, Double Swath, Hyd F& A, Split Reel $62,000 K

Brandon, MB

Dauphin, MB

Moosomin, SK

Shoal Lake, MB

Yorkton, SK

Langenburg, SK

(204) 725-2273

(204) 638-5558

(306) 435-3866

(204) 759-2424

(306) 783-8508

(306) 743-2312

Boissevain, MB

Killarney, MB

Neepawa, MB

Winkler, MB

Preeceville, SK

(204) 534-2463

(204) 523-4644

(204) 476-3344

(204) 325-4122

Kindersley, SK (306)463-4651

(306) 547-3300

* All prices expire 28 days after publication, subject to change without notice.

www.millerfarmequipment.com


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 13

10 CaseIH Puma140 648 Hrs, PS, 540/1000 PTO, L760 Ldr (No Grapple), 2 Func Jystk stk# O37260 .. $105,000. K

92 Flexi-Coil 5000 57’, 235 BU Tank, 350# Trip, 2” Steel Pkrs, C-Shanks, 3/4” Carbide Opnrs stk# O40780 $48,500 N

97 Bourgault 5710 2’ Air Drill, 7” Spacing, 3” Steel Packers, 330lbs Trips stl# O47678 .................................... $39,500 M

09 Bourgault 3310 65’ Width, 12” Spacing, Double Shoot, Mid Row Shanks, 4.5” Packers stk# O49979 ....$147,500 M

07 Bourgault 5710 64’,9.8” Spac,MRB,3” Openers,6550 TBH Tank,Dlx Auger,Dual Sht stk# O42197 .......$207,000 Y

10 Bourgault 8810 60’ Drill, MRB, HD Packers, Single Shoot, NH3 Kit, stk# O52915 ........................... $135,000 M

SWATHERS AND HEADERS CONTINUED O51800 O46093 O33418 O53209

04 Westward 2952 740 Hrs, 972 Hdr, 30’ Split Reel, PU Reel, Plastic Teeth, Two Spd ......................... $74,500 S 90 Hesston 8100 1647 Hrs, 25’ Header, Gas, New Whl Seal on RH Side, Field Ready ......................... $18,500 M 89 Hesston 8100 3642 Hrs, 30’ Pickup Reel ............................................................................................ $19,500 M 06 NewHolland HW325 680 Hrs, 30’ PU Reel, Double Knife Drive, Hyd F&A ........................................ $69,500 S

COMBINES

CASE IH COMBINES O48838 O48840 O48841 O48842 O48843 O48844 O48845 O49503 O48050 O49170 O49766 O37087 O40806 O53066 O52003 O52894 O52892 O36268 OO4352M O33952 O54701 O51055 O45500 O51183 O49993 O34058 O50045 O39587 O49802 O38404 O36285

11 CaseIH 9120 251 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad Lights ....................... $314,000 S 11 CaseIH 9120 256 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 S 11 CaseIH 9120 235 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 S 11 CaseIH 9120 254 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 K 11 CaseIH 9120 313 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 K 11 CaseIH 9120 247 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 S 11 CaseIH 9120 256 Hrs, Duals, 2016 PU Header, Std. Cut Chopper, HID Stad. Lights ...................... $314,000 S 11 CaseIH 9120 100 Hrs, Duals, 2016 16’ PU Hdr, Lux Cab, Magna Cut Chop, Lg Auger ................... $314,000 K 11 CaseIH 9120 325 Hrs, Duals, 2016 PU Header, Y&M, Lateral Header Tilt, Pro 600 ........................ $308,000 B 11 CaseIH 9120 186 Hrs, Duals, 2016 14’ PU Hdr, Fully Hyd Steer, 24’ Auger, Lat. Tilt ...................... $308,000 D 11 CaseIH 9120 255 Hrs, 3016 PU Hdr, Fine Cut Chopper, LT Rotor, Ext Wear ................................. $304,000 W 10 CaseIH 9120 251 Hrs, 14’ 2016 PU,Sm Tube Rotor,Magnacut Chpr,HID......................................... $314,000 B 10 CaseIH 9120 387 Hrs, 14’ 2016 Hdr,Pro 600,HID Lts,Sm Tube Rotor,Diff Locks,Y&M .................... $305,000 D 10 CaseIH 9120 351 Hrs, Duals, Magna Cut Chopper, Ext. Wear Sm Tb Rotor, 600 Monitor .............. $305,000 S 10 CaseIH 9120 354 Hrs, 16’ Hdr, Duals, Magna Cut Chopper, Ext. Wear Sm Tb Rotor ...................... $305,000 S 10 CaseIH 9120 198 Hrs, 16’ 2016 PU Hdr, Duals, Fine Cut Chopper, Sm Tb Rotor, Lat. Tilt, Lux. Cab .. $299,500 D 10 CaseIH 9120 231 Hrs, 16’ 2016 PU Hdr, Duals, Magna Cut Chopper, Small Tube Rotor, Lux. Cab $299,500 D 10 CaseIH 9120 370 Hrs, 16’ 2016 PU, Sm Tube Rotor, Pro 600, HID Lts,Dlx Cab ............................ $299,500 S 09 CaseIH 9120 611 Hrs, 2016 PU,Lat Tilt,Std Rotor,Magna Cut Chpr,HID Lts,24” Auger .................. $291,000 M 09 CaseIH 9120 396 Hrs, 7.3 M Unload Auger, Cloth Seat, Sm Tube Rotor, HID Std LTs ................... $299,500 S 09 CaseIH 9120 300 Hrs, 16’ 2016 PU, Sm Tube Rotor, Fine Cut Chopper, Y&M, Pro 600 ................ $280,000 M 09 CaseIH 9120 655 Hrs, 14’ 2016 PU,Lux Cab,Magna Cut Chppr,Y&M,HID Lts,Duals ....................... $275,000 D 10 CaseIH 8120 394 Hrs, 2016 16’ PU Header, Duals, Hydro Trans, 450 Engine HP .......................... $299,000 B 10 CaseIH 8120 291 Hrs, 2016 PU Hdr,AFX Ext Wear Rotor,Magna Cut,Rock Trap ............................ $296,000 Y 10 CaseIH 8120 480 Hrs, 2016 PU Hdr, AFS Pro 600,Y&M, Fine Cut Chopper .................................... $292,500 N 10 CaseIH 8120 294 Hrs, 2016 Hdr, Magna Cut Chpr, 24’ Auger, HID Stad Lts ................................ $290,000 BV 10 CaseIH 8120 692 Hrs, 16’ 2016 PU Header, Duals, Fine Cut Chopper, Y&M ................................. $285,000 N 10 CaseIH 8120 404 Hrs, Hal Stadium Lts, Yield&Moisture Perf. Trough ............................................. $285,000 W 10 CaseIH 8120 280 Hrs, 14’ 2016 PU Hdr, AHHC, Lat. Tilt, Fine Cut Chop, Y&M.............................. $280,500 M 09 CaseIH 8120 619 Hrs, Pro 600,Magna Cut Chpr,Lateral Tilt,Elec Mirrors,Duals .............................. $279,500 S 09 CaseIH 8120 830 Hrs, 14’ 2016 PU Header, Pro 600, 24’ Unload Auger ......................................... $272,500 N

BRANDON Larry Mountain Wade Heinrichs Craig Frondall Marv Nicholls

BOISSEVAIN

DAUPHIN

KILLARNEY

Wayne Stansall George Panko Jeff Cuvelier Henry Voth Todd Nichol Kelly Johnston Ryan Heinrichs Jeff Abraham Bruce Charles Henry Voth (204) 534-7578

O53639 WA20338A WA03183A O35183 O48229 O48241 O35049 O47087 O46664 O40489 O40491 O48586 O51245 O51246 O38286 O50018 O50017 O31996 O48250 O48511 O50166 O52693 O52692 OO5570M O54056 WA105222 O34420 O35869 O36565 O49547 O49285 O49309 O49457 O49466 O49983 O49984 O48052 O48051 O36457

09 CaseIH 8120 480 Hrs, 16’ 2016 Swathmaster PU, Pro 600, 24’ Unload Auger, Rock Trap ............. $265,500 B 08 CaseIH 8010 547 Hrs, 16’ 2016 Hdr, Sml Tube Rotor, F/cut Chper, Y&M, Elec. Sieve .................... $265,000 Y 08 CaseIH 8010 572 Hrs, 14’ Hdr., Pro600, F/cut Chpr, 24’ Unload Auger, Dlx Cab............................. $260,000 Y 08 CaseIH 8010 660 Hrs, 14’ 2016 PU Hdr,Fine Cut Chpr,Y&M,Pro 600,Long Aug.............................. $244,900 D 08 CaseIH 8010 509 Hrs, 14’ 2016 PU Hdr, Duals, Del.Cab, Long Auger, Lat. Tilt ............................... $243,000 D 08 CaseIH 8010 509 Hrs, 14’ 2016 PU Hdr, Duals, Del.Cab, Long Auger, Lat. Tilt ............................... $243,000 D 08 CaseIH 8010 685 Hrs, 14’ 2016 PU Hdr, Fine Cut Chpr, Y&M, Pro 600,Long Auger ......................... $242,50 D 08 CaseIH 8010 923 Hrs, 16’ PU, Pro 600, Y&M, 10” Platform Ext, 24’ Unload Auger ......................... $242,500 N 08 CaseIH 8010 978 Hrs, 14’ PU Hdr, Sieve Elec Adj, Rock Trap, Y&M, Pro 600 ................................ $229,000 Y 08 CaseIH 8010 838 Hrs, 14’ PU Hdr, Sieve Elec Adj, Rock Trap, Y&M, Pro 600 ................................ $221,000 L 08 CaseIH 8010 833 Hrs, 14’ PU Hdr, Sieve Elec Adj, Rock Trap, Y&M, Pro 600 ................................ $221,000 L 08 CaseIH 8010 850 Hrs, 14’ 2016 PU Hdr, Pro 600 Screen, 10” Platform Ext. ................................. $219,500 BV 07 CaseIH 8010 605 Hrs, 14’ 2016 PU Hdr, Std Cut Chppr,Y&M, 24’ Auger, Pro 600 .......................... $245,000 D 07 CaseIH 8010 556 Hrs, 14’ 2016 PU Hdr, Std Cut Chppr, Y&M, 24’ Auger, Pro 600 ......................... $245,000 D 07 CaseIH 8010 1200 Hrs, HID Lights, Long Auger, Chopper, Electric Mirrors,Duals .......................... $199,500 M 07 CaseIH 8010 1188 Hrs, 14’ PU, Pro 600 Monitor, Duals, Fine cut chopper, Hop Top ...................... $198,000 S 07 CaseIH 8010 1189 Hrs, 14’ PU, Pro 600 Monitor, Duals, Fine cut chopper, Hop Top ...................... $198,000 S 06 CaseIH 8010 907 Hrs, 14’ 2016 PU Hdr, 425 HP Eng, 20.8x42 Duals, Pro 600 Mon ..................... $189,500 M 06 CaseIH 8010 1736 Hrs, 14’ 2016 PU Hdr, Duals, 6.4M Unload Auger, Del. Cab ............................ $215,000 M 06 CaseIH 8010 1131 Hrs, 14’ 2016 PU Hdr, Chopper, Y&M, Ext. Wear Rotor..................................... $200,000 K 06 CaseIH 8010 1206 Hrs, 14’ 2016 PU Hdr, HID Lights, Y&M, GPS Ready, 21’ Auger.................... $195,000 KD 06 CaseIH 8010 1283 Hrs, 14’ 2016 PU Hdr, 20.8R42 Duals, Elect Sieve Adjust, Rock Trap, Fine Cut Chop $185,000 P 06 CaseIH 8010 1242 Hrs, 14’ 2016 PU Hdr, 20.8R42 Duals, Elect Sieve Adjust, Rock Trap, Fine Cut Chop $185,000 P 05 CaseIH 8010 1529 Hrs, 2016 PU w/Hyd Windguard,Extender in Auger .......................................... $159,500 M 04 CaseIH 8010 1684 Hrs, 16’ 2016 PU Swathmaster, 21’ Unload Auger, Del. Cab, Sieve Elec. Adjust .. $198,500 Y 04 CaseIH 8010 1296 Hrs, 14’ 2016 Hdr, Rock Trap, Elec.Sieve, Chper, Revs Fan ............................. $192,000 Y 04 CaseIH 8010 1215 Hrs, 14’ 2016 PU, AFX Rotor, Dlx Cab,Std Fdr, No Diff Locks........................... $190,000 N 04 CaseIH 8010 1324 Hrs, 14’ 2016 PU, Y&M, Pro 600, Dlx Cab, 24’ Auger w/Ext .............................. $175,500 D 04 CaseIH 8010 1182 Hrs, 14’ 2016 PU Hdr, Fine Cut Chpr, Rock Trap, Beacons, Long Auger .......... $163,550 P 04 CaseIH 8010 2425 Hrs, 14’ 2016 PU, 900/60R32, 540/65R32, Black/White Mon............................. $160,000 D 11 CaseIH 7120 8 Hrs, 14’ 2016 PU Hdr, 1 1/8” Adj. Up/Sieve, Fine Cut Chopper .............................. $282,000 M 11 CaseIH 7120 25 Hrs, 2016 PU Header, Y&M, HID Lights, Car. Header Drove ................................ $282,000 M 11 CaseIH 7120 100 Hrs, 14’ 2016 PU Hdr, Y&M, Magna Fine Cut Chop, HID Lights ......................... $282,000 M 11 CaseIH 7120 <100 Hrs, 14’ 2016 PU Hdr, Y&M, Magna Fine Cut Chop, HID Lights....................... $282,000 M 11 CaseIH 7120 146 Hrs, 2016 PU Hdr, 1 1/8” Sieves, Fine Cut Chop, Std Wear Cone ...................... $282,000 S 11 CaseIH 7120 148 Hrs, 2016 PU Hdr, 1 1/8” Sieves, Fine Cut Chop, Std Wear Cone ...................... $282,000 S 11 CaseIH 7120 300 Hrs, 2016 PU Hdr, Magna Cut Chop, Y&M Monitor, Pro 600 ............................... $282,000 B 11 CaseIH 7120 152 Hrs, 2016 PU Hdr, Magna Cut Chop, Y&M Monitor, Pro 600 ............................... $282,000 B 10 CaseIH 7120 329 Hrs, 14’ 2016 Hdr w/ Swthmastr PU, Std Rotor, Pro 600, HID Lts #3 .................. $283,000 B

MOOSOMIN

NEEPAWA

SHOAL LAKE

WINKLER

YORKTON

PREECEVILLE

Torrie Carter Barry Doole Jason Miller

Doss Mayor Buzz Bradley Wally Van Niekerk

Mark Swereda Willie Voth Gerry McTavish

Kevin Bergen Lee Maclean Travis Thiessen

Barry Maurer Jerry Borchowitz Ken Chepil Warren Kotzer

Jason Reine Russel Larnder

www.millerfarmequipment.com

LANGENBURG Cory Andres Dave Eberts


PAGE 14 Manitoba FarmLIFE, Monday, March 12, 2012

The equipment listed is only a small portion of what Miller Equipment has to offer! Visit us online!

08 CaseIH 8010 823 Hrs,Y&M,Fine Cut Chpr, Lat. Tilt,Pro 600,Var Hdr Dr,Stone Trap STK#041054 ......... $245,000 M

09 CaseIH 2152 35’ Draper, Transport, Guage Wheels, Hyd.F/A, Skid Shoes, Stk# 002786M .................. $69,500 B

CASE IH COMBINES CONTINUED O36092 O36471 O36882 O36478 O35024 O34998 O45307 O41166 O50182 O47023 OO2939M O53080 OO3483M O37981 O37982 OO2643M O47809 OO3222M OO3372M O49977 O45580 O50070 O38291 O41132 OO3387M JBU01849 O48449 O37426 O37428 O48149 O36175 O48151 O45579 O52881 O52880 O48477 WA04495A O54437 WA95708A O53430 O45701 O48496 O48485 O39679 WA276228 WA75250B O51317 O36523 O54016 O49539 OO1861M O32112 O41146 O45703 O49540 O47753 O40299 O48582 O39396

10 CaseIH 7120 182 Hrs, 16’ 2016 PU, AFX Rotor, Fine Cut Chpr, Pro 600,Y&M ................................ $277,500 S 10 CaseIH 7120 272 Hrs, Yield & Moisture, Pro 600 Monitor, HID Lights, Std Chopper ...................... $262,500 M 10 CaseIH 7120 255 Hrs, 14’ 2016 PU, Std Chpr, HID Lts #2 Cold Start Pkg, Y&M, Pro 600 ............. $257,500 M 10 CaseIH 7120 251 Hrs, 14’ 2016 PU, Std. Chopper, HID Lts #2, Y&M, Cold Start ............................ $269,500 S 10 CaseIH 7120 207 Hrs, 14’ 2016 PU Hdr, Y & M, Pro 600, HID Lights, Magna Cut Chpr.................. $269,500 B 10 CaseIH 7120 263 Hrs, 2016 Hdr w/ Swathmstr PU, 600 Mon, Aug & Hopp Ext, ........................... $264,500 BV 09 CaseIH 7120 537 Hrs, 14’ 2016 PU Hdr, Rock Trap, Hydro Trans, No Duals .................................. $260,000 B 09 CaseIH 7120 195 Hrs, 16’ 2016 Swthmstr, Hyd Fore/Aft, Y&M, Pro 600, Unload Auger .................. $260,000 B 09 CaseIH 7120 349 Hrs, 14’ 2016 Strawmaster, 7.3M Unload Auger, Straw Chopper ....................... $257,500 M 09 CaseIH 7120 440 Hrs, 16’ 2016 PU, Chopper, Rock Trap, Pro 600, 900x32, 600x28 ................... $250,000 BV 09 CaseIH 7120 479 Hrs, 14’ 2016 PU Hdr, Pro600, Y&M,900/60R32, HID, 24’Auger ........................ $239,500 M 10 CaseIH 7088 1050 Hrs, 24’ Unload Auger, Y&M, Ext. Wear Rotor, Grain Tank Cover, Sieve Adjust ... $197,000 Y 09 CaseIH 7088 464 Hrs, 2016 PU Hdr, Pro 600, 800/65R32, Hopper Tpr, Y&M, HID ......................... $239,500 B 09 CaseIH 7088 415 Hrs, 2016 PU Hdr, AFS,Y&M, GPS,14ft 2016, Fore/Aft, AFX Rotor, Chopper,900x32 $225,500 L 09 CaseIH 7088 586 Hrs, 2016 Swthmstr PU, Lat Tilt, AFS, AFX Rotor, HID, Y&M, Blk Htr.............. $225,500 KD 09 CaseIH 7088 226 Hrs, 14’ 2016 PU Hdr, H.D. Cone, Peterson Sieve, Y & M, HID Lights................ $209,500 N 08 CaseIH 7010 322 Hrs, 14’ PU, Duals, Del Cab, Pro 600, 24’ Auger, Fine Cut Chop ..................... $269,000 KD 08 CaseIH 7010 331 Hrs, 16’ 2016 PU Hdr,Pro 600,900/60R32Sngls,Fine Cut Chpr .......................... $259,500 W 08 CaseIH 7010 500 Hrs, 14’ 2016 PU Hdr, Pro600, 900/60R32, 28Lx16, HID Lites ........................... $225,000 M 08 CaseIH 7010 550 Hrs, 2016 PU Hdr, Duals, Pro 600, Y&M, Hal. Lights, Lg Auger ....................... $250,000 KD 08 CaseIH 7010 502 Hrs, 14’ 2016 PU Hdr, Deluxe Cab, Fine Cut Chopper, HID Lights...................... $239,500 P 08 CaseIH 7010 649 Hrs, 14’ 2015 PU Hdr, Pro 600, Duals, Y&M, Halogen Lights ........................... $235,000 KD 08 CaseIH 7010 815 Hrs, 14’ 2016 PU Hdr, AFS Y&M w/GPS, Fine Cut Chpr, Duals .......................... $228,000 Y 08 CaseIH 7010 512 Hrs, 14’ 2016 Swthmstr, Long Auger, Y&M, Dlx Cab, Pro 600 w/Card ................ $221,000 K 07 CaseIH 7010 746 Hrs, 16’ 2016 PU Hdr, 20.8R42 Duals, Y&M, Pro 600, Std.Cut Chopper............. $249,500 B 07 CaseIH 7010 1043 Hrs,14’ 2016 PU Hdr, AFS, Y&M, GPS, Fore/Aft,AFX Rotor,Chop,900x32 .... $197,500 KD 10 CaseIH 6088 144 Hrs, 14’ 2016 PU Hdr, Chopper, Chaff Spreader, Long Auger ............................ $240,000 S 10 CaseIH 6088 187 Hrs, 16’ Swthmstr PU Hdr, Std Fdr Dr, Cold Start Pkg, AHHC, Std Cab ............. $235,000 S 10 CaseIH 6088 262 Hrs, 16’ Swthmstr PU Hdr, Std Fdr Dr, Cold Start Pkg, AHHC, Std Cab .......... $235,000 KD 10 CaseIH 6088 289 Hrs, 2016 PU Hdr, Del. Cab, Y&M, Pro 600, Fine Cut Chopper........................... $234,500 B 09 CaseIH 6088 189 Hrs, 2016 PU Hdr, Chpr,Chaff Sprdr, Pro 600, Y&M, Rock Trap ......................... $229,500 S 09 CaseIH 6088 504 Hrs, 2016 PU Hdr, Del. Cab, Y&M, Pro 600, Std. Cut Chopper ........................... $212,500 B 09 CaseIH 6088 816 Hrs, 14’ PU Hdr, Pro 600 Chopper, Hid Lighting, Long Auger........................... $201,500 KD 08 CaseIH 2588 475 Hrs, 14’ 2015 Swathmaster, Y&M, 6.4M Unload Auger, Straw Chopper ............. $199,900 M 08 CaseIH 2588 475 Hrs, 14’ 2015 Swathmaster, Y&M, 6.4M Unload Auger, Straw Chopper ............. $199,900 M 08 CaseIH 2588 686 Hrs, 14’ 2015 PU Hdr, AFX Rotor, Chaff Spreader, Ext Wear Cone ................... $197,500 M 08 CaseIH 2588 1027 Hrs, 12’ 2015 PU Hdr, Y&M, Rock Trap, Hdr Float, Peterson Sieve .................. $180,000 Y 07 CaseIH 2588 1884 HRs, 2015 PU Hdr, Y&M w/600 Display, AFX Rotor, Auger Ext, Straw Chopper... $165,000 Y 06 CaseIH 2388 865 Hrs, 14’ 2015 PU Hdr, Y&M, Ext.Wear Trans Cone, Chper,Sprdr ........................ $166,500 L 06 CaseIH 2388 1169 Hrs, 16’ 2015 Swathmaster, Big Top Hopper Topper, Y&M, Fine Cut Chop ..... $145,000 W 05 CaseIH 2388 1132 Hrs, 14’ 2015 PU Hdr, 5.5M Unload Auger, Straw Chopper, Y & M.................. $159,500 M 05 CaseIH 2388 1117 Hrs, 14’ 2015 PU Hdr, AFX Rotor, Chaff Spread, Hopper Top.......................... $155,500 M 05 CaseIH 2388 1450 Hrs, 14’ 2015 PU Hdr, AFX Rotor, Chaff Spreader, Hopper Top ...................... $155,500 M 05 CaseIH 2388 1470 Hrs, Swathmaster PU, Y&M, Hopper Topper, Auger Ext ................................... $127,500 M 05 CaseIH 2388 1103 Hrs, 2015 PU Hdr, AFX Rotor, Topper,Y & M, Silencer, Auger Ext.................... $139,500 L 04 CaseIH 2388 1122 Hrs, 2015 PU Hdr, Rock Trap, Field Tracker, AFX Rotor, Sprder ...................... $160,000 Y 04 CaseIH 2388 1088 Hrs, 14’ 2015 PU Hdr, Y&M, AFX Rotor, Crary Hppr Tppr, Chppr ..................... $147,500 Y 04 CaseIH 2388 1285 Hrs, 14’ Swathmaster PU Hdr, Spec Rotor, Chpr, Hpr Tpr, Long Auger ........... $125,000 M 04 CaseIH 2388 1996 Hrs, 2015 PU Hdr, Y&M, Pro 600, Hyd. Reverser, Crary Hop. Top, Straw Chop ... $133,000 Y 03 CaseIH 2388 1590 Hrs, 2015 PU Hdr, AFX Rotor, Chopper, Long Auger, Hop Top ........................ $122,500 D 02 CaseIH 2388 1643 Hrs, 1015 PU Hdr,Spec.Rotor, Chopper, Long Auger, 30.5x32, 14.9x24.......... $107,500 M 02 CaseIH 2388 1873 Hrs, 2015 Swthmaster PU Hdr, Spec Rotor, Chpr, Chaff Spreader .................... $98,500 M 02 CaseIH 2388 2841 Hrs, 2015 Swthmstr PU Hdr, Hyd F/A, AFX Rotor, Rock Trap, Straw Chpr ......... $95,500 B 00 CaseIH 2388 2045 Hrs, 2016 Swthmstr PU, F&A,Hppr Tppr, Y&M,Rock Trap, Chpr ....................... $106,000 Y 99 CaseIH 2388 1836 Hrs, 2015 PU Hdr, Spec Rotor, Chopper, Long Auger ......................................... $99,500 D 99 CaseIH 2388 1857 Hrs, 1015 Swthmstr PU Hdr, AFX Rotor, Rock Trap, Chopper ............................ $95,500 Y 99 CaseIH 2388 2367 Hrs, Hopper Topper, IH PU Hdr, Chopper Chaff Sprdr, AHH, Fore/Aft ................ $93,500 S 99 CaseIH 2388 2555 Hrs, 1015 PU Hdr, Crary Hopper Ext, Yield & Moisture, Crary Hopper Ext. .... $79,500 BV 99 CaseIH 2388 2616 Hrs, 1015 PU Hdr, Spec Rotor, Chopper, 30.5x32 Tires ..................................... $74,500 M

O51062 O42282 O34853 O47637 O47445 O38283 O33769 O38374 O46295 O47632 O45442 O47636 O41614 O41150 O37801 O46821 O46438 O53228 O43772 O46948 O50450 O53832 O41541 O53229 O46551 O45790 O31808 O47625 O52701 O46693 O47395 O49544

07 CaseIH 2042 36’Draper,Split PU Reel,8010 Adptr, Guage Wheels, Trans, Stk# 002954....................$49,500 M

99 CaseIH 2388 3053 Hrs, 1015 Hdr, New PU Belts, AFX Rotor, Y&M, New Chppr Blades................... $75,000 B 99 CaseIH 2388 3870 Hrs, 1015 PU Hdr, AFX Rotor ,Rock Trap, Long Auger, Chopper........................ $62,500 L 98 CaseIH 2388 1760 Hrs, 1015 PU Hdr, Spec Rotor, Y&M,Rock Trap,Long Auger,Hpr Tpr ................ $89,500 W 98 CaseIH 2388 2044 Hrs, 1015 PU Hdr, Spec Rotor, Long Auger, Chopper, Chaff Spread .................. $86,000 K 98 CaseIH 2388 1961 Hrs, 1015 PU Header w/Victory PU, Spec. Rotor, Straw Chop ............................ $85,000 Y 98 CaseIH 2388 2638 Hrs, Spec Rotor, Hpr Tpr, Rock Trap, Redekop Chpr .......................................... $79,500 N 98 CaseIH 2388 2388 Hrs, 2015 PU Hdr, Chaff Spreader,Chopper,Hopper Topper ............................ $77,500 BV 98 CaseIH 2388 2580 Hrs, Accelerator Kit, Hopper Topper, Krby Spreader,Shedded ............................ $75,000 K 98 CaseIH 2388 2195 Hrs, 1015 PU Hdr, Rock Trap, Specialty Rotor, Hyd Reverser............................. $71,500 P 06 CaseIH 2377 845 Hrs, 2015 PU Header, 250 Chipped Engine, Chopper SM ................................ $185,000 KD 98 CaseIH 2366 1615 Hrs, 23.5-32,14.9-24 Tires, Rock Trap, Spec. Rotor............................................. $86,500 L 97 CaseIH 2188 2841 Hrs, Yield Monitor, Chopper/Chaff Sprdr, Long Auger, Excell Rotor .................... $71,000 K 97 CaseIH 2188 3256 Hrs, 1015 PU Hdr, Spec Rotor, Chpr/Sprdr, Fore/Aft, Y&M, Long Auger............. $60,000 D 96 CaseIH 2188 2818 Hrs, 1015 PU, Std Cab, AFX Rotor, Rock Trap, Hyd F/A, Straw Chpr................. $62,500 B 95 CaseIH 2188 3177 Hrs, 1015 PU, AFX Rotor, Straw Chopper,Unload Auger .................................... $49,500 M 95 CaseIH 2188 2788 Hrs, Rock Trap, Specialty Rotor, Maurer Hopper Topper, Hyd F & A .................. $53,000 Y 95 CaseIH 2188 2974 Hrs, Hopper Topper, Specialty Rotor, Chopper .................................................... $48,500 S 94 CaseIH 1688 3100 Hrs, 1015 PU Hdr, Spec. Rotor, Chopper, Long Auger, Outside Bottom Sieve Adjust. $40,000 S 94 CaseIH 1688 4377 Hrs, 1015 PU Hdr, Rock Trap, Spec. Rotor, Reddekop Chopper ......................... $39,000 L 94 CaseIH 1688 4159 Hrs, Chopper, CIH Pick Up, Specialty Rotor ...................................................... $37,500 BV 94 CaseIH 1688 4100 Hrs, 1015 PU Hdr w/IH PU, No Chopper, Rock Trap, Long Auger....................... $32,000 L 90 CaseIH 1688 3900 Hrs, 1015 PU Hdr, Spec Rotor, Chopper, Long Auger, Rock Trap, Shedded ...... $27,500 D 92 CaseIH 1680 3718 Hrs, PU Hdr, Chpr/Sprdr, Hpr Ext, Straw Sprdr, Rock Trap .............................. $26,500 BV 92 CaseIH 1680 3575 Hrs, 12’ 1015 PU Hdr, F&A, Third Lift Cylinder, Cross Flow Fan, Auto Hdr........ $24,000 S 91 CaseIH 1680 4607 Hrs, 1015 PU Hdr, Concaves, Chopper, Air Foil Sieve......................................... $26,500 Y 89 CaseIH 1680 4199 Hrs, 7 Belt PU, Rear Wheel Dr. Hopper Topper, Header Height ......................... $26,000 W 88 CaseIH 1680 3180 Hrs, 1015 PU Hdr, Chppr, Hdr Hght Ctrl, Long Auger,Spec. Rotor ..................... $27,900 W 87 CaseIH 1680 3360 Hrs, 1015 PU Hdr, Hopper Topper, Grain Loss Monitor ...................................... $24,500 W 86 CaseIH 1680 4040 Hrs, 1015 PU Hdr, Rock Trap, Std Rotor, Chopper, 235 Engine HP, Hydro Trans $24,000 P 87 CaseIH 1660 3379 Hrs, 1015 PU Hdr, Std Rotor, No Chopper, Rock Trap, GLM .............................. $22,250 Y 86 CaseIH 1660 4705 Hrs, 1015 PU Hdr, Std. Rotor, Chopper, Kirby Chaff Spreader ............................ $17,400 P 81 CaseIH 1480 4450 Hrs, 810-13’ w/12’ Hdr, Rodono Straw Chop, Rock Trap ..................................... $12,500 N

OTHER MAKE COMBINES O51227 O48653 O48651 O50403 O54948 O44471 O46488 O49101 O49099 WA706090 OO4623M O48509 WA720401 O48529 O46345 O48143 O40328 O41036 O48265 OO5562M O47529 O52833 O51420 O37550 O35237 O46718

10 Massey Ferg 9895 499 Hrs, 4200 PU w/Swthmstr,Mav Chppr,Lthr Seat,Raven .............................. $279,000 Y 10 Massey Ferg 9895 494 Hrs, Duals, Fdr Hse Lat, Hdr Tilt Sys, Mav. Chop, Leather Seat ................ $255,000 Y 07 Massey Ferg 9895 1269 Hrs, Duals, MF 4000 Hdr, Sieve& Chaffer, Elec. Adj. Mav. Chop............... $164,50 L 09 Massey Ferg 9795 604 Hrs, Duals, 4200-14’ Hdr, Y&M, Touch Screen Monitor........................... $225,000 KD 06 Massey Ferg 9690 936 Hrs, 4200 PU Header, Fieldstar Ready, On Track GPS, Mav Chopper, 300 BU $125,000 KD 04 Massey Ferg 9690 1549 Hrs, 14’ Swathmaster PU, 480X42 Duals, 16.9X28 Rear Tires ............. $109,000 KD 94 Massey Ferg 8570 2328 Hrs, Hydro Trans, Chopper, Dual Chaff Spreaders .................................... $41,500 M 09 John Deere 9870STS 691 Hrs, Duals, 916 PU Hdr, Long Auger, AutoGuidance Ready .............. $270,000 KD 08 John Deere 9870STS 451 Hrs, Duals, 916 PU Header, AutoGuidance Ready, Yield & Moisture $281,000 KD 04 John Deere 9860STS 811 Hrs 14’ PU Hdr, F/cut Chpr, Hpr Tarp, Harvest Trac Monitor................. $178,500 Y 04 John Deere 9860 2179 Hrs, No PU Hdr,20.8x42 Dls, Mav Chpr, Long Auger, Yield & Moisture ......$144,500 B 08 John Deere 9770STS 800 Hrs, No PU, Duals, 20.8R42 .................................................................. $230,000 W 07 John Deere 9760STS 1111 Hrs, 16’ Swathmaster PU Hdr,28L-26 Rear,Greenstar Autotrac & Display, $220,000 Y 05 John Deere 9760 1054 Hrs, 914 PU Header, Yield & Moisture, Fine Cut Chopper, Shedded ........ $165,000 K 91 John Deere 9600 1843 Hrs, 30.5-32 Ft Tires, 14.9-24 Rear Tires, 914 PU Header........................... $62,500 D 08 New Holland CX8080 1059 Hrs, 14’ 76C Swathmaster PU Hdr, 900/60R32 Tires, Full Y&M Map $215,000 M 06 New Holland CR970 1297 Hrs, 16’ 76C PU Hdr, Long Unld Auger, Y&M, Fin Cut Chpr ................ $175,000 M 03 New Holland CR970 954 Hrs, 14’ Strawmaster PU Hdr, Beacon Lts, Chaff Sprdr, Chppr,Unload Auger.. $153,000 P 03 New Holland CR960 2181 Hrs, 14’ 76C PU Header, Del. Cab, Del. Straw Chopper ...................... $133,000 Y 02 New Holland CX840 3255 Hrs, Swathmaster PU Hdr, Rear Whl Assist, Chpr w/Blwr, Beacons ..... $120,000 B 02 New Holland TR-99 2141 Hrs, 14’ Swathmaster PU Hdr, Hopper Topper, Red Cop Chopper .......... $92,500 B 01 New Holland TR-99 1648 Hrs, Swathmaster PU Hdr,971 Header, Duals, Stone Trap, Chopper, Tarp Cover $85,000 P 97 New Holland TR98 3100 Hrs, 14’ Swathmaster PU Hdr, 30.5-32 Front, 14.9-24 Rear, Chaff ........... $34,000 K 93 New Holland TR96 2765 Hrs, NH 971 Hdr w/Swathmaster PU, 30.5-32 Tires, Chaff Sprdr .............. $28,000 L 90 New Holland TR96 3744 Hrs, Vict PU Hdr, Var Spd Feeder, Elec Stone Tr, Straw Chopper ............ $21,300 B 95 New Holland TX66 2513 Hrs, Chaff Spreader, Straw Chopper, Grain Loss Monitor, Rock Trap ....... $41,500 Y

Brandon, MB

Dauphin, MB

Moosomin, SK

Shoal Lake, MB

Yorkton, SK

Langenburg, SK

(204) 725-2273

(204) 638-5558

(306) 435-3866

(204) 759-2424

(306) 783-8508

(306) 743-2312

Boissevain, MB

Killarney, MB

Neepawa, MB

Winkler, MB

Preeceville, SK

(204) 534-2463

(204) 523-4644

(204) 476-3344

(204) 325-4122

Kindersley, SK (306)463-4651

www.millerfarmequipment.com

(306) 547-3300


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 15

10 CaseIH 9120 252 Hrs, 16' 2016 Hdr, Full Auto Guide, Diff Lock, Lat Tilt, STK#036450 ........................ $324,000 W

10 CaseIH 9120 527 Hrs, 16’ Swthmastr PU, Sm Tube Rotor, Pro 600, HID Lts STK#036241 .....................$299,500 Y

10 CaseIH 8120 425 Hrs,2016 PU Hdr HID, Guidance Rdy,Hpr Tpr,Fine Cut Chpr,Duals STK#038911 ................$295,500 BV

09 CaseIH 9120 396 Hrs, 7.3 M Unload Auger, Cloth Seat, Sm Tube Rotor, HID Std LTs stk# O33952 ........ $299,500 S

10 CaseIH 9120 290 Hrs, 14’ 2016 Hdr, Pro 600, HID Lts, Sm Tube Rotor stk#O36278 ............................. $315,000 N

09 CaseIH 7120 283 Hrs,14’ 2016 PU Hdr, Y&M,Rock Trap,Small Tube Rotor STK#033599 .................$286,000 Y

OTHER MAKE COMBINES CONTINUED OO3128

05 Caterpillar 580R 815 Hrs, 14’ Swathmaster PU Hdr, 900/60R32, 500/85R24, Chaff Spreader ...... $229,500 W

O54848 O54850 O54851 O44307 O48852 O48855 O48856 O48857 O48858 O48859 O48860 O39470 O39474 O50046 O48288 O39278 O52883 O33284 OO3003M O50002 O48587 O35604 O35431 O53412 OO2652M O52433 OO1657M O36171 O45090 O47591 OO4223M O41189 OO2755M O36784 O51072

11 CaseIH 3020 30’ PU Header, 6 Bat, Plastic Tines, End Dividers, Cutterbar 3”, Man. Cutterbar Susp. . $34,000 L 11 CaseIH 3020 30’ PU Header, 6 Bat, Plastic Tines, End Dividers, Cutterbar 3”, Man. Cutterbar Susp. . $34,000 L 11 CaseIH 3020 30’ PU Header, 6 Bat, Plastic Tines, End Dividers, Cutterbar 3”, Man. Cutterbar Susp. . $34,000 L 08 CaseIH 2152 40’ PU Reel, 11X15 Tires, Factory Transport, Float Sensor .......................................... $56,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 11 CaseIH 2142 35’ Single Knife Dr, 5 Bat, Transport Pkg, Auto Header Height..................................... $59,500 S 10 CaseIH 2142 35’ Draper PU Single Reel,Hyd Fore/Aft,Gauge Whls,10/20 Adpt................................. $59,500 S 10 CaseIH 2142 35’ Draper PU Single Reel,Hyd Fore/Aft,Gauge Whls,10/20 Adpt................................. $59,500 Y 10 CaseIH 2142 35’ Drpaer PU, Hyd Tilt, Slow Speed Transport, Lodged Crop Fing.............................. $59,500 N 10 CaseIH 2142 35’ Std. Cut Hdr, Single Knife Dr. PU Reel, Hyd. Fore/Aft. Transport ........................... $56,500 B 06 CaseIH 2062 36’,Cross Auger Pkg,Gauge Whl,Slow Spd Trans,Hyd F/A,Adptr ................................. $57,000 Y 06 CaseIH 2062 36’ Cross Auger Pkg, Gauge Whl, Slow Spd Trans, Hyd F/A, Shedded ....................... $54,000 Y 06 CaseIH 2052 36’ Rigid Split Reel, 4 Whl Trans, Fore/Aft, 10/20 AFX Adptr ........................................ $51,000 Y 07 CaseIH 2042 30’ Rigid, Hart Carter Reel, 2388 Adptr, Fore/Aft, No Trans.......................................... $39,500 S 10 CaseIH 2020 35’ Flex Header, Dble Knife Drive, Auto Hdr Height Control, 7088 Adapt .................. $45,000 KD 08 CaseIH 2016 14’ Pickup Header ....................................................................................................... $16,500 BV 08 CaseIH 2015 14’ Pickup Header ........................................................................................................ $16,900 M 09 CaseIH 2010 30’ Rigid,6 Batt, PU Reel, Auto Hdr Height Ctrl, Lateral Tilt .......................................... $28,000 D 07 CaseIH 2010 30’ Rigid Header, PU Reel, Plastic Fingers, Hyd F&A, Always Shedded ...................... $22,500 D 01 CaseIH 1042 36’ Draper, PU Reel, Transport, Guage Wheels ......................................................... $34,500 BV 03 CaseIH 1042 36’ Pickup Reel, Transport ............................................................................................ $32,000 M 99 CaseIH 1042 30’ Draper, PU Reel, F/A,Guage Wheels, Transport ..................................................... $29,500 S 04 CaseIH 1020 30’ Flex PU Hdr, Fore/Aft ............................................................................................... $19,000 D 96 CaseIH 1020 30’, PU, Header Transport, Hydr. Fore and Afte. ......................................................... $17,300 W 95 CaseIH 1020 25’ Flex Header, Plastic Fingers, Always Shedded....................................................... $13,000 W 94 CaseIH 1020 30’ Flex, Hart Carter PU Reel, Fore/Aft, Dble Dr, Open Wbl Box .................................. $12,500 S 96 CaseIH 1020 25’, 5 Batt. PU Reel, Plastic Fingers, Crop Dividers, Hyd. Fore & Aft. ........................... $7,650 W 93 CaseIH 1015 14’ Pickup Header,Super 8 Pickup .................................................................................. $4,750 M 87 CaseIH 1015 13’ IH Pickup Header........................................................................................................ $1,995 S 04 CaseIH 1010 30’ Rigid Header, Pickup Reel....................................................................................... $13,500 M

CASE IH HEADERS

BRANDON Larry Mountain Wade Heinrichs Craig Frondall Marv Nicholls

BOISSEVAIN

DAUPHIN

KILLARNEY

Wayne Stansall George Panko Jeff Cuvelier Henry Voth Todd Nichol Kelly Johnston Ryan Heinrichs Jeff Abraham Bruce Charles Henry Voth (204) 534-7578

O53311 O49885 O53839 O46440

99 CaseIH 1010 30’ Rigid Header, PU Reel, Near New Knife Sections/Guards, Bushings on Reel....... $12,750 M 94 CaseIH 1010 30’ Rigid Header, Fits 80/88 Series Combines ............................................................... $8,800 M 93 CaseIH 1010 30’ Rigid Header, PU Reel, Shedded ............................................................................... $9,500 D 93 CaseIH 1010 30’ Straight Cut Header .................................................................................................... $8,800 S

O35048 O54438 O37187 O49498 O35075 O42488 OO3159M

92 CaseIH 1010 25’ Rigid Header, Batt Reel,Cranks,Four Wheel Trailer.................................................. $7,500 M 92 CaseIH 1010 25’ Header, with PU Reel ................................................................................................ $7,000 M 91 CaseIH 1010 30’ Rigid Header, Pickup, 5 Batt w/Steel Fingers .......................................................... $11,500 D 90 CaseIH 1010 30’ Header, with PU Reel ................................................................................................ $9,900 M 90 CaseIH 1010 30’ Rigid Batt Reel, Summers Header Transport ............................................................. $8,900 K 87 CaseIH 1010 30’ Hyd Fore/Aft, Pickup Reel ,Slow Speed Header Trailer ........................................... $11,500 B 82 CaseIH 810 30’ Bat Reel, Large Auger .................................................................................................. $2,500 N

OTHER MAKE HEADERS O47174 O38822 OO4303M O52978 O38608 JBU01813 JBU01735 O46283 O49324 O46375 O44601 O52831 OO5066M JBU01781 O48549 O33116 O49862 O514737 JBU01797 O48309 O33277 O40114 O40115 O40116 O37859 O50043

09 Honey Bee SP42 42’, Centre Mount, Case Adapter, 5 Bat PU Reel, Hdr Height Cont .................... $65,000 BV 06 Honey Bee SP42 42’ Draper,Dual Knife Dr,Fact Trans,Cutter Bar,Hyd Ang Tilt,8010 Adpt ....................$48,000 Y 09 Honey Bee SP40 40’,Draper Hdr,UII PU Reel,Hyd.F/A,Dbl Knife Drive,........................................... $71,500 BV 10 Honey Bee SP36 36’ Header, Never Used, PU Reel, Single Knife Drive, 20 Series Adapter .....................$55,000 B 06 Honey Bee SP36 36’ Draper,PU,Cross Auger,Transport Kit,8010 Adapter ........................................ $43,500 M 00 Honey Bee SP36 36ft, PU Reel, Pea Auger, 2588 Adaptor ..............................................................$26,500 KD 98 Honey Bee SP36 36ft, PU Reel, Pea Auger, Transport, 2588 Adaptor............................................. $32,500 KD 94 Honey Bee SP36 36’ Draper Header, Split PU Reel, Cross Auger, 2388 Adapter ...........................$12,500 KD 09 Honey Bee SP30 30’ Draper Hdr, UII PU Reel, Trans. Hyd Fore/Aft, New Never Used .................... $54,500 M 04 Honey Bee SP30 30’, PU Reel, Hyd Fore/Aft, Upper Cross Auger, Transport, Adapt 2388 ...................$38,000 M 97 Honey Bee SP30 30’ Draper Header, Endwise Transport, 2388 Adapt. Castor Gauge ......................$30,000 L 00 Honey Bee SP25 25’ Header, UII Pickup Reel, Hyd Fore & Aft, Gauge Wheels ................................$19,000 P 03 Honey Bee 436 36’ Draper,PU Reel,JD Adptr,Cross Auger,Transport ............................................. $42,500 BV 09 New Holland 94C 40’ PU Reel, Pea Auger,Transport,7120 Adaptor, End Wheels........................... $69,000 KD 07 New Holland 94C 36’ Draper Header, Pick Up Reel, Cross Auger, Crop Lifters, Shedded .....................$45,500 KD 06 New Holland 994 36’ Draper,PU,Hyd Fore/Aft,Cross Auger,2388 Adapter ........................................ $47,500 M 00 New Holland 994 36’ Draper Hdr,New Canvas,New Fingers,Pea Auger, JD Adptr.......................... $30,000 KD 99 New Holland 994 30’ Draper Header, Trailer Adapt. U2 Reel, Slow Speed Trans ..............................$22,500 K 98 New Holland 971 To go on TR99, NO Pickup .....................................................................................$5,000 KD 89 New Holland 971 30’ Header, Crop Lifters, No Fore/Aft. .................................................................. $10,000 BV 89 New Holland 971 30’ Rigid, UII Pickup Reel, Std Batt Reel,2008 Hdr Trans.........................................$9,000 B 07 MacDon D60-D 40’, Fac Trans, Hyd fore/Aft, Dual Guage Whls, Sngl Knife Dr, Ux Auger ...................... $59,500 BV 07 MacDon D60-D 40’, Fac Trans, Hyd fore/Aft, Dual Guage Whls, Sngl Knife Dr, Ux Auger............................$62,500 BV 07 MacDon D60-D 40’, Fac Trans, Hyd fore/Aft, Dual Guage Whls, Sngl Knife Dr, Ux Auger ...................... $59,500 BV 04 MacDon 2052 36’ Draper,PU,Split Reel, Single Knife Dr,Fore/Aft,7120 Adptr,Transport.................... $50,000 M 08 MacDon 974 36’ Draper Hdr, Single Knife Drive, Slow Speed Transport, Split Reel ........................$40,000 KD

MOOSOMIN

NEEPAWA

SHOAL LAKE

WINKLER

YORKTON

PREECEVILLE

Torrie Carter Barry Doole Jason Miller

Doss Mayor Buzz Bradley Wally Van Niekerk

Mark Swereda Willie Voth Gerry McTavish

Kevin Bergen Lee Maclean Travis Thiessen

Barry Maurer Jerry Borchowitz Ken Chepil Warren Kotzer

Jason Reine Russel Larnder

www.millerfarmequipment.com

LANGENBURG Cory Andres Dave Eberts


PAGE 16 Manitoba FarmLIFE, Monday, March 12, 2012

VERSATILE 190

FWA, loader, grapple, loaded.

VERSATILE SX275 SP SPRAYER

275 HP, 1200 gal tank, 100 ft. boom, boom height control, full GPS, loaded cab.

CALL FOR MORE DETAILS & PRICING

Milliken Farm

Supplies (1977) Ltd.

Taber, AB

403-223-4437

Toll Free 1-888-313-9988 Email us at sales@millikenfarm.com


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 17

Classified Section

Published Every Other Monday Office Hours: 7:30 a.m. to 4:00 p.m. Monday to Friday

(600) Farm Machinery USED GRAIN CARTS: 400-1050 bushel; large selection. Gravity wagons; used 200-750 bushel, new 400 bushel - $6,700. Richardton Hi Dump Wagons. Used fertilizer spreaders. Phone: 1-866-938-8537, www.zettlerfarmequipment.com. (600) MB 14-20 SK 15-21

LIQUIDATION & EQUIP. INVENTORY REDUCTION. Museum Project abandoned. Many collectables/ duplicates. Dozer Blades 5'-16' wide - $375-$2,200. Wetmore hammermill w/hay mixer, on trans., very little used - $750. Small bale elevators. Extra HD 9' motor driven snow blower $7,800. 8' RT/sweeper, quick attach mount, S/S - $1,400. 1988 Dodge Ram 50 half, 4x4, 318 engine - $1,850. 1999 Dodge 1500 4x4, good condition, 3/4" box liner since new - removable, will show original near new box interior, clean truck replaced by larger capacity is reason for sale - $3,475. Vintage combines: (2) MF Model 72’s (1 - PTO, 1 - motor driven), exc. restoration project. MF 88 diesel tractor, no scrapes or dents, clean tractor $3,400. Inquiries welcome - If you need it, I might have it. Phone: 403-7324979. (600) AG 18-19 MB 19-20 AD 11-12 SK 20-21

USED EQUIPMENT- 1995 John Deere tractor 8300 MFWD, 3PT, P/S, 5800 hours $77,500, New 2011 Parker 739 grain cart w/tarp SALE PRICE $24,900, 2004 John Deere 630F SALE PRICE $20,500, 2004 John Deere 635F SALE PRICE $23,900, Horsch Anderson Joker short disc 8RT, 5 in stock from $60,000 to $68,000 Please visit website at www.genag.com or call Shelton Kehler 701-330-7401 or Tom Wiebe 204-312-0604

341 - 10th Street, Brandon, MB

Phone Orders Toll Free 1-877-328-0048 Ext. 228

(600) Farm Machinery

(609) Miscellaneous

(609) Miscellaneous

WANTED NEW! Wrapped & Boxed! • John Deere 2520, 3020, 4020, 4620, (’69-’72), diesel powershift • Steiger 470 or 525 tractor

Phone: 306-423-5983 or 306-960-3000 (604) Seeding & Tillage VW MANUFACTURING - Carbide Drill Points. See our new products for spring 2012. Our full carbide - triple shoot - paired row openers have fertilizer between seed rows & slightly below. We also have 1/4” stainless steel liquid fertilizer lines delivering fertilizer to seed rows. Available for all Paralink, C Shank & Edge-on. Please visit our website for updates, www.vwmfg.com - thanks for visiting. VW Mfg, Dunmore, AB (Medicine Hat) 403-528-3350.

UÊ …ˆÀœ«i`ˆVÊ+Õii˜Ê*ˆœÜ̜«Ê i`Ê-iÌ........ $395 ­ œÕLiÊ-iÌÊfÎÇx®

UÊi>̅iÀÊ-œv>]ÊœÛiÊÃi>ÌÊEÊ >ÌV…ˆ˜}Ê …>ˆÀÊ­ `˜Ê >`i®Ê­ ÀœÜ˜ÊœÀÊ >VŽ®........................f£]Ιx UÊ-œˆ`Ê">ŽÊ™È»Ê/>Li]ÊÈÊ«>``i`ʅˆ}…ÊL>VŽÊ V…>ˆÀÃ]Ê œÊ6i˜iiÀÊ­ ÕvvÉÕÌV…ÊÛ>ˆ°®Ê/>LiÊ-iÌÊ ÜœÀ̅ÊfÎ]{xä ............................. - Êf£]Èxä UÊÈÊ«V°Ê i`Àœœ“Ê-ՈÌiÊ­ˆ˜VÕ`ˆ˜}Ê+Õii˜Ê*É/Ê Li`ÊÃiÌ]ÊÎÊ œœÀî................................. $900 UÊ-œˆ`Ê7œœ`Ê-ˆ˜}iʜÛiÀÊ œÕLiÊ Õ˜ŽÊ-iÌÊ­-É-Ê -iÌÊfx™x®Ê-«>À>LiÊEÊ œÌi`.................... fÈxä

MUST SELL!

YOUR AD COULD BE HERE

VISIT OUR CLASSIFIED PAGES ONLINE www.farmpressltd.com

(610) Machinery Parts

CLASSIFIED INDEX

MURPHY SALVAGE: new, used, rebuilt parts, for tractors, combines, swathers, balers, tillage & miscellaneous machinery. Buying used machinery. Toll Free: 1-877858-2728 or 204-858-2727, Deleau, MB.

Announcements ......................................90 Antiques ................................................200 Coins .....................................................201 Auctions.................................................300 Construction Equipment ........................400 Dairy & Supplies....................................500 Farm Machinery ....................................600 Haying Equipment .................................601 Combines & Headers ............................602 Fertilizer Equipment ..............................603 Seeding & Tillage ..................................604 Spraying Equipment ..............................605 Swathers & Mower/Conditioners ...........606 Tractors..................................................608 Miscellaneous .......................................609 Machinery Parts ....................................610 Farm Buildings ......................................700 Granaries & Bins ...................................701 Grain, Feed & Hay.................................800 Irrigation ................................................900 Hogs & Supplies ..................................1000 Horses & Supplies ...............................1100 Livestock & Supplies ...........................1200 Poultry & Supplies ...............................1300 Sheep & Supplies................................1400 Specialty Livestock ..............................1500 Pets & Supplies ...................................1600 Seed ....................................................1700 Specialty Seeds...................................1701 General Miscellaneous ........................1750

(610) MB 14 TFN SK 15 TFN

(700) Farm Buildings STEEL BUILDING SALE - Inventory Discount Sale: 30x40, 42x80, 100x100. Erection Available. Must Sell, Will Deal. 40 yr paint. 1-800964-8335 Source: 1MC (700) AG 18-19 MB 19-20 AD 11-12 SK 20-21

(800) Grain, Feed & Hay HEATED PEAS/FLAX…Buying damaged pulses & oilseeds. “On Farm Pickup” Westcan Feed & Grain: 1-877-250-5252. (800) AG 13-19 MB 14-20 AD 6-12 SK 15-21

CAN DELIVER! (204) 571-1971 BRD.

HEATED CANOLA

BUYING HEATED OR GREEN CANOLA

(604) AG 12-21 MB 13-22 AD 5-14 SK 14-23

AG-VISER CLASSIFIEDS WORK!

“ON FARM PICK UP”

1-877-250-5252

(609) Miscellaneous

WIRADA RANCH ENTERPRISES

WE BUY DAMAGED GRAIN

You Deserve the Best! Why Settle for Less!

WIRELESS DRIVEWAY ALARMS LETS YOU KNOW ANYTIME SOMEONE WALKS OR DRIVES INTO YOUR PLACE!

Green &/or Heated Canola / Flax Wheat, Barley, Oats, Peas, Etc.

(600) SK 19-20 MB 19-20

1985 MF 3545 Tractor, Duals, 3pth, 2 hyd, front weights, heat, air, 150 hp, $14,000 Degalman Stone picker 3 500 gal, fuel, tanks on metal stand, 25’ MF deep tiller, colo flow, hydrous. Phone 204-834-2750 or 204-476-0367

R7A 4E9

E-Mail: adsales@farmpressltd.com Visa or Mastercard

P.O. Box 882, Coalhurst, AB T0L 0V0

1-877-641-2798

Ph/Fax: (403) 381-4817

Bow Valley Trading Ltd

Email: wirada@telusplanet.net

“WE DELIVER TO

EVERY

FOR SALE

FOR RENT Acreages .............................................1800 Commercial Property...........................1900 Equipment ...........................................2000 Farms & Ranches................................2100 Houses ................................................2200 Land ....................................................2300 Storage................................................2400

REAL ESTATE Acreages .............................................2600 Auctions...............................................2700 Commercial Property...........................2800 Farms & Ranches................................2900 Houses ................................................3000 Industrial..............................................3100 Manufactured Homes ..........................3200 Realtor Listings....................................3300

TRANSPORTATION Automobiles.........................................3400 Automotive Parts & Service.................3500 Boats & R.V.’s ......................................3600 Heavy Trucks .......................................3700 Light Trucks .........................................3800 Motorcycles & Quads ..........................3900 Snowmobiles .......................................4000 Trailers .................................................4100 Vans ....................................................4200

SERVICES Accounting & Bookkeeping .................4300 Computers & Accessories ...................4400 Custom Work.......................................4500 Feedlot Cleaning .................................4600 Land Mapping .....................................4700 Parts & Repairs ...................................4800 Rentals ................................................4900 Travel ...................................................4950

EMPLOYMENT Employment Opportunities..................5000 Employment Wanted............................5100 Business Opportunities .......................5200 Training................................................5300

WANTED Equipment ...........................................5400 Personal ..............................................5600

FARM & RANCH!”

A Division of:

“Where Farmers and Ranchers Look First to Buy.”

NATION WIDE CLASSIFIED HOTLINE 1-877-328-0048 EXT. 228


PAGE 18 Manitoba FarmLIFE, Monday, March 12, 2012

Where Farmers and Ranchers Look First To Buy

Classified Section (1100) Horses & Supplies

(1100) Horses & Supplies

Added Attraction 10 a.m. to 2 p.m.

Trade Show

(1700) Seed

(3700) Heavy Trucks

CERTIFIED #1 Unity/Waskada, midge tolerant VB, vigar & germination tested 97%, winter & volume pricing. Naicam, SK: 306874-7590.

2 - 1999 IHC 9200 day cab w/12.7L Detroit 430/470, 13 spd, 3 way lockers, 12x40 axles, aluminum buds all around, very clean, saftied - $28,000; 1998 IH 9200, 410 HP, N14, 10 spd., saftied - $12,000; 2002 IH 9100, ISX Cummins, 450 hp, 13 spd., saftied - $18,000; 2001 Western Star w/ 72” Sleeper, Cat C15 6NZ engine, 475 HP, 13 spd, 3.70RR, 24.5” rubber 90%, 1.5K km, 3-way lockers, saftied Asking $25,000.Eastern Equipment Ltd. 204-436-2317.

(1700) AG 16-21 MB 17-22 AD 9-14 SK 18-23

(1750) General Misc. Silver Sage Community Corral Brooks, AB

(1750) AD 6 TFN SK 15 TFN AG 14 TFN MB 15 TFN

Select Horse Sale

(3700) MB 14 TFN SK 15 TFN

Saturday, March 24th, 2012 All classes of Riding Horses: Ranch, Performance, Pleasure, Youth Preview of Horses 10 a.m. Sale starts 1:30 p.m. www.badlandsspringselecthorsesale.com online catalog www.northernhorse.com For further information contact Darren Hubka 403.363.2723 • Gordon Musgrove 403.363.1729 Darren Rebalkin 403.633.9997 • email: badlandshorsesale@hotmail.com Sale Managed by: Sale conducted by:

gwacountry@gmail.com www.gwacountry.com

BUGGIES, DEMOCRATS, Cutters, Large Sleigh, Wagon, totally restored & upholstered. Harness, Saddles & Tack. Call: 204-8574932, Portage la Prairie, MB. (1100) MB 19 AD 11 SK 20

1-877-328-0048

DISCOUNT PLYWOOD Douglas Fur 4x8, 4x9, 4x10 standard or with smooth overlay 3/8 to 1 1/2 inch thick. 1 1/2 and 1 3/4 pine plywood up to 60 ft. 306-278-3138

TRIM BOSS: Power Hoof Trimmer - take the work out of hoof trimming. Trim wall, sole & flare on Saddle Horses, Drafts & Mini’s. Phone, Rominick Livestock Services: 780-898-3752, www.rlscanada.ca. (1100) AG 17-20 MB 18-21 AD 10-13 SK 19-22

FIND WHAT YOU NEED IN THE FARMLIFE

(4500) Custom Work WIRELESS DRIVEWAY ALARMS, calving/foaling barn cameras, video surveillance, rear view cameras for RV’s, trucks, combines, seeders, sprayers and augers. Mounted on magnet. Free Shipping. 403616-6610, www.FAAsecurity.com, Calgary, AB. (4500) AD 6 TFN SK 15 TFN AG 14 TFN MB 15 TFN

CLASSIFIEDS

www.farmpressltd.com

(3300) Realtor Listings

(3300) Realtor Listings

LAKE McGREGOR AREA • 8,240 cultivated acres in one block. • 1,120 acres lease land. Call for more details and price. For viewing call Harold or Lyle Magnuson at Magnuson Realty Ltd. Harold: 403-485-0368 Lyle: 403-485-6901

(5000) Employment Opportunities A full time position on a mid-sized, East Central Alberta Beef and Grain Farm available April 2012. Looking for a physically fit, self-motivated, & energetic individual. Duties will include all aspects of farm related work including: operation and maintenance of farm related machinery, feeding and handling of livestock in cow/calf production and feedlot operation. A clean driving record and police check may be required. Wage range depending on experience from $16-$22/hour. Bonuses available upon evaluation. Please fax or email resume to Peter (with subject: Farm Labourer Resume) Email: pjs.cls@xplornet.com Fax: 403-882-2053 Home Phone Number: 403-882-2053

Help Wanted Operators needed for a modern custom manure applicator company. Experience with equipment and maintenance is an asset. Willing to train. Must be responsible, motivated and a team worker. Year round work available for the right candidate. Company is based in Southwest Manitoba. Please call 204-534-7382 for more information!

3 EASY WAYS TO PLACE YOUR AD IN THE CLASSIFIEDS

123 CALL TOLL FREE: 1-877-328-0048

BY FAX: (403) 328-5443

BY E-MAIL:

adsales@farmpressltd.com

Real Value

Real Effectiveness Call today to place your Classified Ad


PAGE 19 Manitoba FarmLIFE, Monday, March 12, 2012 PAGE 22 Manitoba FarmLIFE, Monday, March 12, 2012

Lucknow 425 Twin screw, Vertical Mixer, Floatation Tires, Hydraulic Chute.

Lucknow 2290

HARTNEY

$ 172,900

70’, 10” Spac., SS, 7 Run

’10 NH P2070 Air Drill

BRANDON

$ 209,900

1180 hrs, 710/70R42D, PS, 4 Remotes

’09 NH T9040

NEEPAWA

$ 287,900

710E/630T hrs, Long Auger w/ext., Chaff Sprdr, Y&M

’10 NH CR9080

BLOWOUT

4 Horizontal Augers, Flotation Tires, Hydraulic Chute.

ARBORG

Blowout Pricing

’02 NH TR99

ARBORG

’98 NH 9882

Blowout Pricing

’02 BO 5710 Air Drill 81,900

’04 Degelman 7900 $

’11 CIH Magnum 190 108,900

2019E/1579S, 30.5x32, Chpr, Chaff Sprdr

$

, 4600 hrs, 20.8 Triples, Std. Transmission

59,900

$

54’, MRB, 4” Rubber Pckrs, SS, Heavy Trip

22,500

’07 Toro 2110 Workman

PORTAGE

’11 NH ST830 738 hrs, 1250LB Capacity, Elec. Dump Kit

MOOSOMIN

’06 NH TV145 42’, 4 Bar Harrows

SWAN RIVER

’09 NH BR 7090 105HP, 856 hrs, 16.9x38, 2 Hyd. Remotes

ROBLIN

$ 47,500

SHOAL LAKE

$

Blade w/Sileage ext., 16’, Hyd tilt & Angle

146,900

$

710R38-600/65x28 Front, 3 PTH, 3 Hyd, w/L780 SL Ldr

STE. ROSE

1000 RPM, Gathering Wheels, LB, BC $ 91,300

Roblin 937-2134 Shoal Lake 759-2126 Winnipeg 253-2900

Swan River 734-9361 Ste. Rose 447-2739 Moosomin (306) 435-3610

Check out our complete inventory at mazergroup.ca

02 AGCHM 1254 110’, 620/75R 30-380/90R46, 1200 Gal Stainless Tank, ...................... $159,900 A 07 APAHE 1010 103’, Drop Boxes, 1000 Gallon Tank, 500 Ez Steer, Sharp Shooter Boom.$138,900 SW 08 APAHE 1010 103’, 380/80R38-380/90R46, 20.8X42, 1000 Gallon Plastic Tank, ......$138,900 SW 08 APAHE 1010 100’, 380 Narrow Tires, 520 Used Rear, 1000 Gal. Tank, Tripple Nozzle$155,900 B 11 NH SP.240F 100’, 275 HP, 6.7L Turbo, 320/90R50, 1000 Gal. SS Tank, 31 GPM Pump$277,900 H 90 SCOUP 230 11.4x24, Extra Tires 9.4x24, Single Nozzle Bodies, Tee Jet, Light Bar .... $12,000 SL 95 SCOUP 3430 73’, Mid Tech Controller, 5 Spd Trans, 5 Section Boom, 400 Gal. Poly Tank$35,900 A

SELP PROPELLED SPRAYERS

86 AH 6555 16’ Hay Head, 4200 hrs, Cab, Air, 21.5L x 16.1 Turf Tires.............................$13,900 ST 06 CIH WDX1202 30’, 286E hrs, 18.4 x 26, DHX 302 Hdr, Dbl Knife, UII PU Reel ............. $81,900 P 06 S WDX1202 934E hrs, PU Reel, 2 Roto Shears, New Canvases in 2011, .................$82,900 SW 06 CIH WDX1202 18.4 x 26, New Canvas in 2011, Trnspt & Gauge Whls, Roto Shears .$83,050 SW 08 CIH WD1203 30’, 777 hrs, 126 HP, 18.4x26 tires, UII PU, Dbl Knife Hdr, 6’ Hay Hdr ... $119,900 H 10 CIH WD1203 120 HP, 400 Hrs, 18.4R26 Drive & 14L-16.1 Rear, Double Knife, ....... $109,600 CC 86 CIH 4000 UII PU Reel, Gauge Whls Rear Axle Ext. 2’ Rear Wts, End Hitch..................... $8,500 A 96 CIH 8820 30’, 1563 Hrs, 21.5x16 Drive, 7.60x15 Rear, Hdr, U2 Reel Single Span .......$30,375 K 98 CIH 8825 21’, 2000 hrs, 21.5Lx16.1, Table, DKD, UII PU Reel, Shiftable Draper.........$27,900 ST 98 CIH 8825 2185 hrs, 21.5 x 16.1-9.5 x 16 Rear, 30’ Hdr, Gauge Whls, U2 PU Reel .....$16,875 SW 90 JD 2360 75’, 4563 hrs, 21.5 x 16 Front & 8.5 x 14 Forked Rear, 21’ Draper Hdr.........$14,900 SW 81 JD 2420 25’, PU Reels, Diesel, Air, Underneath Swather Roller, Gauge Wheels. ......$10,688 SW 04 JD 4895 30’, 967 hrs, 6 Batt PU Reel, Gauge Wheels, Transport, 2 Roto Shears. .....$73,900 SW 01 MB 2940 25’, 2105 hrs, 21.5 x 16.1, 9.5L Single Fork, MD 972 Hdr, 6’ Bat PU, Dbl Swather .$54,900 N 01 MB 9250 1532E hrs, 2003 Macdon 922 18’ Auger Hdr ................................................... $48,900 P 00 MF 220 II 1131 E hrs, 25’, 21.5Lx16.5 Drive & 9.5L Forked Caster Tires, PU Reel ..... $43,875 CC 99 MF 220 II 25’ PU Reel, Honey bee Cutting System 21.5L-16.1SL Cleat Tread Drive Wheels$37,900 A 03 NH HW300 1820 hrs, Pwr Reverser Kit, Rotary Screen Cleaner, 16.9 x 24 Cleat Tires .$45,900 N 07 NH HW305 720 hrs, 18.4 x 26, Bought New in 2009, NH HS16 Head ........................... $78,900 A 20 NH HW305 5 hrs, 98HP ..................................................................................................$61,900 M 01 NH HW320 2328E hrs, 16.9 x 24, 994 25’ Head , UII PU Reel, DKD, Trnsprt Kit .......... $56,900 N 03 NH HW320 2276 hrs, UII 5 Bat PU Reel, Plastic Teeth, 2 Spd, 25’ 94C .........................$55,900 N 07 NH HW325 1474 hrs, Cab & Rear Axle Susp, HCC PU Reel, Cross Auger Kit, HB30 Hdr$77,900 ST 07 NH HW325 30’, 535 hrs, HB30, 5 Bat PU Reel, SKD, Std. Dyck 18.4x26 Cleat Tires . $88,000 CC 07 NH HW325 25’, 780 hrs, Cab Susp, 21Lx238, UII PU, 5 Bat, Plastic Teeth.................$81,900. ST 06 NH HW325 30’, 1129 hrs, 18.4R26 R1, w/NH HB30, UII Steel Fingers, Poly Skid .........$82,900 B 07 NH HW325 30’, 740 hrs, SKD, HCC PU Reel, 2 Roto Shears, Dlx Cab, Cab Susp ....$88,000 SW 05 NH HW325 30’, 1300 hrs, w/NH 994, SKD, UII Plastic 5 Batt Reel, Gauge Wheels.......$70,900 B 07 NH HW325 HB30 Header................................................................................................ CALL SW 03 NH HW340 1037E hrs, 18.4x26 10 ply, 25’ Hdr, UII PU Reel, Gauge Whls, 15’ Discbine$85,250 SL 08 NH H8040 30’ HB30 Head, 650 hrs, Cab Susp, PU Reel w/Plastic Fingers .................$107,900 B 08 NH H8040 25’, 825 hrs, 18.4 x 26-14L x 16.1 Rear, Manual For/Aft, UII Pick Up Reel $92,900 ST 08 NH H8040 438E hrs, 18.4-26, Cab & Axle Susp., Dlx Cab, HB30 Header......................$98,900 R 08 NH H8040 30’, 422 hrs, Dlx Cab, w/NH HB30 Head, Hyd Fore Aft, SKD, Center Delivery $106,900 B 08 NH H8040 16’, 1665 hrs, w/NH HS16 Head, Rubber Conditioning Rolls. .......................$82,900 M 09 NH H8040 30’, 222 hrs, 18.4R26 R1, w/NH HB30 Head, SKD, UII PU Reel, Plastic Fingers$110,900 B 08 NH H8040 36’ Hdr, 605 hrs, 18.4R26, DKD, UII Reel, Gauge Wheel, Transport Kit ... $102,300 SL 08 NH H8040 30’, 480 hrs, w/NH HB30 Head, DKD, Hyd Fore/Aft, Cab Suspension. .....$103,900 M 08 NH H8080 802 hrs, Cab & Axle Susp., 18.4 x R26, Dlx Cab, 18’ 770 HDN Hdr ......... $104,900 ST 99 PREMR 2920 30’, 1532 hrs, w/MB 972, Gauge Wheels, PU Reel..................................$54,900 H 96 PREMR 2920 25’. 2460 hrs, 21.5x16.1, 960 Header, UII PU Reel, 600 Hours On New Engine$43,900 N 01 PREMR 2940 80HP, 1751 Hrs, 21.5x16 & 9.5Lx14, 972 MD, 5-Batt PU Reel ............. $62,700 CC 99 PSTAR 4920 25’,1836 hrs, 21.5x15 Drive & 9.5Lx14, 972 Harvest Hdr, PU Reel ....... $56,100 CC 03 PSTAR 4940 25’, 1530E hrs, 21.5 x 16- 9.5L X 14 Caster Wheels, MD 972 Harvest Hdr$63,800 K 01 PSTAR 4950 30’, 1151 hrs, 21.5 L -16.1 Front -9.5 L -15” Rear, 972 30’ Header , SKD$70,900 SW 86 VA 4700 25’, 2485 hrs, PU Reel ...................................................................................$10,200 SW 90 VA 4750 22’., 2800 hrs, UII PU Reel ...............................................................................$13,900 B 09 WS M150 30’, 299E hrs, 900 Front-16.1 X 16.5 Rear, D60 Hdr, SKD, PU Reel .......$114,900 SW 09 WS M150 900 Front and 16.1 X 16.5 Rear, 5256 Total Acres Swathed, PU Reel, D60 Hdr $114,900 SW 97 WS 9200 25’, 1602 hrs, MacDon 960 Harvest Hdr, Hyd Deck Shift, PU Reel ............. $50,050 CC 01 WS 9250 25’, 1631 hrs, w/972 Head, Double Swath, SKD, PU Reel..............................$57,900 M 08 WS 9250 25’, 528 hrs, Rear Wgt Pkg, 21.5L-16 Drive & 9.5L-14, 972 MD Harvest Hdr$80,300 CC

SWATHERS

WINNIPEG

5,512

KILLARNEY

$

$ 29,250

Crystal City 873-2480 Hartney 858-2000

91 BOURGAULT 2115 TBH Bourgault 2115 Tank, 2 Compartment ...................................... $4,900 P 09 CIH 3430 430BU., 30.5-32, 8 Run, DS, Variable Rate ....................................................$64,900 R 87 EZ 2175 5 Run, 175 BU, 60/40 Split, SS.........................................................................$7,900 ST 10 NH P1060 430BU., TBH, VariRate, Dual Fan, 18.4x38R1 Duals w/Spacers, 10”Auger $82,500 K

TANKS

01 BO 7200 72’, 21.5 X 16.1, 5/8” Tine .............................................................................$33,750 SW 01 BO 7200 70’., Heavy Harrow, Hyd. Tine Adjust ...............................................................$28,900 M 02 FC S82 60’, Warning Lamps, 12 Section........................................................................... $6,750 P

HARROW

90 BO 8800 40’, 8” Spacing, w/4 Bar Harrows & Knives, w/ BO 3225 Tank, 7” Auger,...... $27,900 SL 99 BO 9400 60’, 500 Lb Trip, NH3 Kit, 4 Bar Harrows, Spd Lock Adapters .....................$59,900 SW ELMER RC20SS830 8 Row Crop Cultivator, 30” Spacing ................................................... $12,319 P MONGRAIN PAKER BAR 36’, Farm Built Packer Bar, 1.5” Coils, Wing Type.....................$3,900 ST 98 MR 9000 49’, 5 Section, Floating Hitch, 4 Bar Harrows .................................................. $24,750 P 11 NH ST830 42’, 12” Spac, 650LB Trips, Transport Lighting & Marking.............................$45,000 R

TILLAGE

96 BO 5710 40’, 12.5” Spacing, 3.5” Steel Pkrs, Atom Jet Boot, 5 Run Air Pk, Liquid Kit ... $30,900 H 98 BO 5710 50’, 12” Spacing, MRS w/NH3 Tubes, SS, Steel Packers, New Openers........$53,900 M 02 BO 5710 63’, 12” Spacing, Steel Pkrs, MRB, 18” Coulters, w/BO 5350 Tank, ............$100,900 M 00 BO 5710 40’, 450LB Trip, 9.8” Spacing, SS, 4” Rubber Packers, Harrow, Closers .....$42,188 SW 10 BO 5710 w/6550 Tank, Dual Whls, 450 lb Trip, SS.Square Seed Boots, Dbl Caster Whls$224,900 SW 02 BO 5710 54’, MRB, SS Air Kit, Dual Casters ...............................................................$59,900 SW 97 CC 4010 40’, Case 2300 Tank, 300 Bu., (4) 18.4-26 Tires On Tank, 2 Compartments ... $39,400 K 98 CC 4010-4R 40’, SS, Packer Tires, Dual Casters, w/FC TBT 2320 Tank........................ $45,900 A 95 CC 4012 40’, 3” Paired Row Dutch Openers, Pneumatic Pkrs, DS, FC Air Kit ............... $20,800 R 92 FC 5000 57’, 2320 Air Tank, Single Spike Carbides, 7.2” Spacing, 3” Steel Press .........$43,875 K 98 FC 5000 45’, 3” Steel Packers, 550 lb. Trip, 10” Spacing, Openers In Box.................$30,900 SW 97 FC 5000 57’, w/1996 2320 Tank TBT,Steel Packers, 500 lb Trip, 7.2” Spacing, .......... $32,500 SL 99 FC 5000 45’ , SS, 550 lb. Trips, 9” Spacing, 4” Rubber Pkrs, FC 2320 TBH Cart........... $60,500 P 93 FC 5000 39’, 3” Rubber, Liquid Kit, 5 Run, SS, 450LB Trip, w/FC 2320 Tank..............$30,900 SW 94 FC 5000 39’, 3.5” Steel Packers, 7.2” Spacing, 350 Trips, 6 Manifold TBH, .................$22,900 N 02 FC 7500 60’, 3 1/2” Split Boots, 5” Rubber Pkrs, 10” Spacing, DS, 3450 Air Cart, TBT, 350 BU $64,900 CC 97 MR MAXIM 49’, New Atom Jet Openers (1500 Acres), Rubber Packers, Dual Shoot ....$31,900 M 01 MR MAXIUM 34’, 10 In. Spac, Steel Whls, Patison Liquid Kit, w/MO 7240 TBH, ........... $44,900 H 10 NH P2070 70’, 10” Spac, SS, 7 Run, NH3 Tubes, NH Knife, ........................................$172,900 H 08 NH SD550 70’ Hoe Drill, 430BU. TBH Tank, SS, Stealth Carbide Tips, 10” Spac, .......$162,225 K

DRILLS

83 CA 4490 213HP, 5693 hrs, 18.4R34 Duals .....................................................................$14,900 M 99 JD 9300 360 HP, 4805 hrs, 620/70R X 42 Duals, Wts & Ballast, 12 Spd., 4 Hyd. Remotes$96,750 K 04 NH TJ325 325 HP, 2929 hrs, New 520R42R1W Michelin, Powershift .........................$137,900 B 07 NH TJ530 530HP, 1701 hrs, 800/70R38, 55 GPM, 4 Remotes, Std Weight Pkg, Dlx Cab$203,900 B 11 NH T9.450 400 HP, 300 hrs, Dlx Cab, HID Lights Front & Back, 16 Spd PS ...............$242,900 H 11 NH T9.450 400HP, 1939 hrs, 4 Remotes, Dlx Cab, Guidance Ready ...........................$219,900 B 11 NH T9.450 400HP, 1409 hrs, 55 Gal. Pump, 4 Remotes, Deluxe Cab..........................$224,900 B 10 NH T9030 385 HP, 1961 hrs, PS, HD Drawbar, 55 GPM Hyd Pump, 4 Remotes .........$183,500 B 11 NH T9040 435HP, 420E hrs, Full Intellisteer, High Flow Hyd, 1000 RPM PTO ............. $252,000 R 09 NH T9040 435HP, 1180 hrs, 710/70R42 Duals, 4 Remotes, PS, Auto Guidance Ready$209,900 B 11 NH T9050 485HP, 400 hrs, 800 R 38 Duals, Full Intellisteer, 55 Gallon Pump, HID Lights$252,000 SW 11 NH T9060 535HP, 290E hrs, 800/70R38, Full Intellisteer Autoguidance, High Flow .....$300,300 R 09 NH T9060 535HP, 2187 hrs, 800/70R38 Duals, High Capacity Pump, Deluxe Cab .....$229,900 B 10 NH T9060 535HP, 985E hrs, 800/70R38D, Luxury Cab, High Flow Hyd, 6 Remotes ...$266,700 R 98 NH 9882 425HP, 4600 hrs, 20.8 Triples, Standard Transmission .................................$108,900 M 97 NH 9482 310HP, 6112 hrs, 20.8 R42 Drum Duals, 4 Remotes, PS ....................................CALL P 88 NH 876 280HP, 11,226 hrs, 18.4R42 Duals,Standard Transmission...............................$28,125 R

TRACTORS 4WD

10 NH T8020 200 PTO HP, 1275 hrs, 480/80R46D, 420/90R30 Fronts, 3 PT, 540/1000 PTO $152,200 B 94 NH 8770 160HP, 9150 hrs, 20.8R42 Duals, 16.9R30 Front, FWA, 4 Hyd Remotes ...... $49,900 H 00 NH 8870 180 PTO HP, 3406 hrs, 20.8R42 Duals, 16.9R30 Front Duals, 1000 PTO, FWA $71,500 H

PRE-OWNED EQUIPMENT

CRYSTAL CITY

COMPACT TRACTOR 40HP 98 JD STX38 w/38” Mower Deck, Hydro, 13HP.....................................................................CALL SL 89 JD 332 1000 hrs,16HP Diesel Eng., 2WD, Hyd. Trans, 48” Mower Dk, Rear Mnt. Tiller $4,500 W 96 NH CM224 582 hrs, 22HP, 60” Deck, 2 Speed Hyd, 4WD, Diff Locks, ............................. $6,900 P 07 NH G4010 19HP, Zero Turn, 42” Deck, 2 Blades ..............................................................$2,190 M 04 NH MZ18 18HP, 44” Deck ...............................................................................................$2,900 ST 99 NH TC18 1800 hrs, 15 PTO HP, FWA, Hyd, 3PTH, w/NH 914 60” Mower .......................$7,900 H 00 NH TC21 1832 hrs, 20HP, MFWD, 3 PT Turf Tires, Hydrostatic, ROPS ......................... $7,900 ST 08 NH T1010 230 hrs, 20HP, Turf Tires, 10LA Loader, 54 CMS Mower, GC Bagger .......... $16,875 W 07 TO GT2200 100 hrs, 25HP, Riding Mower, Rear Bag, 50” Mid Mnt ................................. $6,750 W

COMPACT TRACTOR 40-59HP 10 NH BOOMER 40 40HP, 213 hrs, Turf tires, 4WD, Hydro Trans, 250TL Ldr 3PT ........... $27,000 W 04 NH TC45DA 45HP, 2663 hrs, w/17LA Ldr, Hydro Trans, SS, R4 Tires, 4WD, 3PTH ..... $21,280 W 10 NH WRKMST 55 392 hrs, w/615TL Ldr, w/ Skid Steer Quick Attach, 4WD, 8x8 Trans, 3PTH $29,680 W 94 UN 530DTC 52HP, 2026 hrs, 3PTH, w/Allied 594HSL Ldr, Bale/Manure Fork ...............$12,900 N

COMPACT TRACTOR 60-99HP 79 AC 7000 106 PTO HP, 5300 hrs, 18.4R38 Rear, 10X16 Front, 2WD, 540/1000 PTO ......$6,900 H 85 CASE IH 685 61HP, 3216 hrs, 16.9 X 30, 80%, Std Trans, 3PH, CIH 2250 Ldr/Bkt. ...$11,812 SW 68 IHC 656 65HP, 8500 hrs, 18.4 x 26 Rear Duals, 7.5 x 15 Front, 540 PTO, 3 Hyd. Remotes$5,740 K 07 KU M9540 84HP, 3420E hrs, 12.4-24, 18.4-30, FWA, Dif Lock, 2 Remotes, M30 Ldr w/Bckt$27,900 N 06 NH TN70 70HP, 535 hrs, MFWD, Canopy, 16 Spd PS, 3 PTH ...................................... $30,900 W 07 NH TT60A 60 HP, 813 hrs, FWA, 620TL Ldr, 16.9-28@80%, 9.5-24@80% ..................$24,900 B 09 NH TT75 65 PTO HP, 400 hrs, 16.9-30, 7.50-16, 2WD, 8X2 Trans, 3 PTH ....................$22,900 H

COMPACT TRACTOR 100-139HP 82 CA 2290 132 HP, 10,000 hrs, 18.4R38 Singles.................................................................$9,900 M 98 JD 6400 105 HP, 5036 hrs, 18.4R x 38 Rear, 13.6R x 28 Frt., 16 Spd., 540&1000 PTO $49,500 K 03 NH TM130 130HP, 7050 hrs, 20.8R38 Cast, 16.9R30 Fronts, w/NH 72LB Ldr, 96” Bkt . $47,900 B 01 NH TM135 100 PTO HP, 6519 hrs, 4 Hyd Remotes, w/ALO 980 Ldr, 95” Bkt ................$47,900 H 07 NH T6030 95HP, 1269E hrs, 540-1000 PTO, 3 Hyd, 840TL Ldr Bkt 84” & Grapple ..... $72,600 SL 09 NH T6030 95 PTO HP, 1500 hrs, w/NH 840TL Ldr, 83” Bkt, 16x16, 3 Hyd, 3 PTH....... $71,900 SL 08 NH T6050 105HP, 420 hrs, 20.8 X 38 16.9 X 28, 3 Hyd, C/W Bkt & Grapple, 3 PTH .$96,800 SW 08 NH T7030 135HP, 3575 hrs, 850 NH Loader w/Grapple/Joystick ................................$87,900 SW 94 NH 8340 106 HP, 5266 hrs, 3 PTH, w/795 Allied Ldr w/96” Bkt ..................................... $20,900 A

TRACTORS BI-DIRECTIONAL 03 NH TV140 105HP, 4824 hrs, 420/85/r28, Rear Wts, 3 Spd, 7614 Ldr, Bucket & Grapple$51,700 P 06 NH TV145 105HP, 856 hrs, 16.9 x 38 GY, Mega-Flow Ready, EE Wts, 2 Hyd. Remotes$91,300 K 06 NH TV145 105HP, 8500 hrs, 480/85R34, Grapple, 3 PTH, 2 Remotes EE .................... $57,900 A 06 NH TV145 105HP, 3545E hrs, Cab End 3 PTH, 3rd Pedal, 540/1000 PTO, Long Loader$75,900 A 04 NH TV145 105HP, 2346 hrs, 16.9R38, Aux. Hyds, Bucket, Grapple, Manure Tines .......$74,900 M 08 NH TV145 145HP, 1350E hrs, 84LB Ldr w/Grapple, Cab End 3PH, Cab End PTO........$89,650 R 09 NH TV6070 145HP, 1661 hrs, 16.9R38, PTO EE, Remotes EE, 540/1000 PTO .......... $111,900 B 09 NH TV6070 145HP, 2824 hrs, 18.4 Non Directional, New Long Loader and Grapple. .$104,900 M 09 NH TV6070 145HP, 1242 hrs, 16.9R38, 3rd Pedal, Grapple, 540/1000 PTO ...............$108,900 B 09 NH TV6070 145HP, 980E hrs, 480/85R34 Non-Directional, 82LB loader .....................$107,500 R 09 NH TV6070 145HP, 1280E hrs, 480/85R34 Non-directional, 84LN Ldr, ......................$104,400 R

TRACTOR 140+ HP 79 CA 2390 160HP, 11,000 hrs, 20.8R38D, 1000 PTO, Dual Hyd ....................................... $11,900 N 11 CIH MAGNUM190 165HP, 768 hrs, 3 PTH, 3 Hyd, L780SL Ldr, 8’ Bucket ...............$146,900 ST 06 CIH MX255 255HP, 2200 hrs, 4 Hyd, 540-1000 PTO, Ezee Steer .............................. $116,900 ST 87 FIAT 180-90 180HP, 7050 hrs, MFWD, 3 PTH, Front Weights, Triple Hyd ...................$26,900 ST 86 JD 4650 165HP, 9013 hrs, FWA, 16.9X28 Front, 20.8X38 Rear, 15 Spd PS, 3 Remotes. $30,900 M 07 NH TG215 215HP, 2605 hrs, 710/70R38, 600/65R28, 3 PT, w/NH 870TL Ldr, 540/1000 PTO$128,900 B 04 NH TG285 285HP, 3414 hrs, 420/80R46D, 380/85R30, SS, 540/1000 PTO, 3 PT, 1000 PTO$108,900 B 11 NH T8.275 235HP, 1165 hrs, 480/80R50D, New 380/80R38, Triple PTO, 3 PTH ....... $160,900 B 11 NH T8.275 235HP, 650 hrs, PS, FWA, 480/80R50D, 380/80R38, Triple PTO, 3PTH ...$162,900 B 11 NH T8.275 195 PTO HP, 1140 hrs, NEW 480/80R50D, New 380/80R38 Front, 6 Remotes$160,900 H 09 NH T8010 175 PTO HP, 1755 hrs, 520/85R42 Duals, 16.9R30 GY, 540/1000 PTO, 3 PTH$134,900 H 10 NH T8010 175HP, 1816 hrs, 520/85R42D,16.9R30 Front,3 PT, 540/1000 PTO, 1000 PTO $137,900 B 10 NH T8020 200HP, 1440 hrs, 380/80R38 Frt, 480/80R50 Rear Duals, 4 Remotes, 3 PTH $148,900 P

Brandon 728-2244 Arborg 376-5600

Killarney 523-4414 Neepawa 476-2364 Portage 857-8711

w w w. m a z e r g r o u p . c a


Crystal City 873-2480 Hartney 858-2000

Killarney 523-4414 Neepawa 476-2364 Portage 857-8711

Roblin 937-2134 Shoal Lake 759-2126 Winnipeg 253-2900

Swan River 734-9361 Ste. Rose 447-2739 Moosomin (306) 435-3610

Manitoba FarmLIFE, Monday, March 12, 2012

w w w. m a z e r g r o u p . c a

Brandon 728-2244 Arborg 376-5600

COMBINE HEADERS 94 CIH 1010 25’ PU Reel, Manual Fore & Aft, New Oil Bath Wobble Box ............................. $8,900 N 94 CIH 1010 25’ UII PU Reel, Lights, Manual Fore/Aft...........................................................$8,900 N 98 CIH 1020 30’, Flex-Header, PU Reel, Fore & Aft, Transporter, Polyskids. ...................$14,900 SW 01 CIH 1042 36’ PU Reel, Hyd Fore & Aft, Shedded, Case 2588 Adapter ......................... $38,900 ST 00 CIH 1042 36’ PU Reel, Hyd Fore/Aft, 2588 Adapter ......................................................$32,900 ST 98 HY SP30 30’, JD Adapter, Gauge Wheel transport, UII PU reel, Polyskid. .................... $27,200 H 95 HY SP30S 30’ UII PU Reel, Steel Teeth, Gauge Wheel Transport, TX Adapter. .............$22,900 B 05 HY SP36 36’, CAT Adapter, Gauge Wheel transport, UII Split Pickup Rell, Single Knf. ..$41,900 H 99 HY SP39 39’, U2 PU Reel, Plastic Fingers, Split Reel, Gauge Whls, Trpt, Single Knf....$37,600 M 00 HY SP42 42’, Gauge Wheel Transport, Split UII PU Reel w/PlasticFingers, Double Knife$31,900 B 98 HY ST30 30’, Canvas 2 Years Old, c/w Bearings & Knife, Fore & Aft, PU Reel ..........$30,937 SW 06 JD 630R 30’, 5 Bat PU Reel, Plastic Teeth, Hyd Fore & Aft ........................................... $23,900 N 89 JD 930 30’, PU Reel, Transport.......................................................................................$10,900 H 98 JD 930 30’, PU Reel, Transport.........................................................................................$9,900 H 11 MB FD70 35’ Flex Draper, Single Knf, Split 5 Batt PU Reel, Plastic Teeth...................... $90,900 H 95 MB 960 25’, MacDon 2000 Reel, Double Shift Table, TR Adapter ............................... $11,800 SL 94 MB 960 30’, JD Adapter, SKD, MacDon PU Reel, Plastic Fingers, Gauge Wheels .......$12,900 B 93 MB 960 25’, HCC PU Reel, Offset TR Adapter, Hyd Fore/Aft ........................................$14,900 N 99 MB 962 30’, 5 Bat Pick PU Reel, Plastic Teeth, SKD, Factory Transport...................... $28,900 ST 03 MB 962 30’, 871 Adapter, Gauge Wheels, Transport ................................................... $31,500 CC 98 MB 962 30’ PU Reel, New Factory Transport Kit, TX Adapter, Shedded ........................ $20,900 N 99 MB 972 30’, TR adapter, 30’ PU Reel ............................................................................$31,220 R 02 MB 972 30’, JD Adapter, SKD, Split Reel w/Plastic Fingers, Gauge Wheels ..................$27,900 B 87 MF 9224 24’, Auger Head. ................................................................................................$8,390 B 02 NH 71C 25’, HCC PU Reel, Plastic Teeth, Hyd Fore and Aft .......................................... $16,900 N 02 NH 71C 25’, Hart Carter PU Reel .................................................................................... $15,750 P 03 NH 76C 14’, PU Head, Swathmaster PU ........................................................................$10,900 M 09 NH 94C 40’, U2 PU Reel, Plastic Teeth, DKD, Hyd. Fore And Aft, Auto Hdr Height .... $71,500 CC 04 NH 94C 39’, CR/CX Adpater, SKD, Schumacher Cutterbar, Hyd Fore/Aft, Transport ..... $46,900 H 04 NH 94C 36’, JD Adapter, SKD, UII PU Reel, Plastic Teeth, Hyd Fore/Aft, Poly Skid. ..... $46,900 H 02 NH 94C 30’, Pea Auger, UII PU Reel, Auto Header Hgt, Trsprt Pkg, SKD, Center Delivery.$35,900 B 04 NH 94C 36’, CX Adapter, SKD, UII PU Reel, Hyd Fore/Aft, Transport. ........................... $48,900 H 04 NH 94C 39’, CR/CX Adapter, Gauge Wheel Transport, UII Steel Fingers....................... $47,900 B 03 NH 94C 30’, w/Transport, Gauge Wheels, PU Reel, Fore and Aft ..............................$41,062 SW 11 NH 94C 36’ Draper Header, DKD, HCC 6 Batt PU Reel, hHyd Fore & Aft, Auto Height Control $72,600 R 09 NH 94C 40’, CR/CX Adapter, 5 Bat PU Reel, Plastic Teeth, DKD, Hyd F/A .................. $63,900 ST 04 NH 94C 42’, UII PU Reel, DKD, CR/CX Adapter, Hyd F/A, Transport, Top Cross Auger $43,875 P 03 NH 94C 36’, UII PU Reel, CR/CX Adapter, Hyd F/A, Poly Skid, Transport ..................... $46,900 H NH 970 24’ PU Reel ............................................................................................................ $3,375 CC 87 NH 971 24’, Rebuilt Wobble Box, Bat Reel .......................................................................$4,900 N 94 NH 971 30’ PU Reel ........................................................................................................ $12,375 P 92 NH 971 30’ Straight Cut Header, Batt Reel, DKD ............................................................ $7,650 SL 95 NH 971 30’, Batt Reel, Crop Lifters, Elmers Transport. .....................................................$6,900 H 91 NH 971 30’, PU Reel, Crop Lifters, Mattson Transport......................................................$8,900 H 98 NH 971 30’, Bat Reel, DKD, Stainless Steel Floor ............................................................$7,900 N NH 971 30, ‘ PU Reel .............................................................................................................$7,800 H 95 NH 971 30’ Straight Cut Head, w/PU Reel ......................................................................$10,900 R 95 NH 971 25’, Batt Reel ........................................................................................................ $7,290 P 97 NH 971 30’ Straight Cut Header w/Elmers Transport ...................................................... $7,300 SL 98 NH 971 30’ Straight Cut Header, PU Reel, w/ 4 Wheel Trailer ...................................... $11,130 SL 99 NH 971 13’, 14B Swathmaster, Straight Auger, Hyd Lift, Wind Guard ........................... $4,900 ST 98 NH 971 30’, PU Reel, DKD, New Gear Boxes. ...............................................................$11,900 M 99 NH 994 36’, Hyd F/A, Cross Auger, Split Reel, SKD, Plastic Finger, Trans Kit ............. $33,900 SL

ROTARY COMBINE 98 CIH 2388 2637E/2098T, 30.5x32, Y&M, Area Counter Info Centre, 1015 PU Hdr, Chopper$87,900 N 97 CIH 2188 2315E hrs, Y&M, Stone Trap, 1010 PU With 3 Year Old Belts..................... $78,900 ST 05 JD 9760STS 1050E/736T, Harvest Monitor, Deluxe Header Control w/HHS .............. $194,900 ST 86 MF 8560 2816E hrs, 30.5-32, Vittetoe Chaff Spreader, Feeder Reverser Kit, Melroe PU$27,900 B 07 NH CR9060 993E/747T, Dlx Cab, Y&M, w/NH 76C Head, 14 Ft, Swathmaster ........... $208,900 H 07 NH CR9070 922E/667T, 900/60R32, Y&M, w/NH 76C PU Head,14 Ft., Rake Up PU .$219,900 M 08 NH CR9070 710E/503S, 900/60R32, 600/65R28, w/NH 76C, 14 Ft., Swathmaster.....$240,900 R 10 NH CR9070 288E/230T Hrs, Y&M, Data Logging, 76C16 Hdr..................................... $294,000 K 07 NH CR9070 1175E/921T, 900/65R32, 540/65R30, w/NH 76C Head, 14 Ft, Swathmaster.$208,900 H 10 NH CR9070 260E/219T, 900/60R32 Drive, 600/65R28 Steer, Y&M, 76C Header ........ $292,900 A 09 NH CR9070 614E/477T, 24’ Unload Auger, Y&M, 76C 16Ft PU ................................ $262,500 CC 09 NH CR9070 666E/530T, 24’ Unload Auger, Y&M, 76C 16Ft PU ................................ $262,500 CC 07 NH CR9070 1380T/1050E, &M, Variable Feeder, 76C PU Hdr.....................................$197,400 R 07 NH CR9070 1080T/1430E, 520/85R42D, 600/65R28Rear, Y&M, 76C PU Hdr ............ $195,300 R 07 NH CR9070 943E/702T,Dlx Chopper, Y&M, 76C 14’ w/ Rake Up PU........................... $225,900 N 09 NH CR9070 459E/590T, 900 Front and 600 Rear Tires, Y&M, Big Screens ..............$266,900 SW 09 NH CR9070 325E/495T, 900 Front and 600 Rear Tires, Y&M, Big Screens, RWA....$272,900 SW 09 NH CR9080 556E/417T, Dlx Cab,w/NH 76C Head, 16 Ft, Swathmaster ...................... $315,000 H 10 NH CR9080 415T, 76C 14’ PU Hdr, Y&M, 21’Auger, Variable Hdr ................................ $314,900 P 09 NH CR9080 597E/485T Hrs, Y&M, Dlx Chopper, 76C16 PU Hdr .............................. $275,310 CC 09 NH CR9080 619E/494T Hrs, Y&M, Dlx Chopper, 76C16 PU Hdr .................................$288,750 K 10 NH CR9080 308E / 228T, Long Auger, Dlx Chopper, w/76C 16’ PU Hdr ...................... $314,500 R 09 NH CR9080 480E hrs,Small Grain, Hdr Drive ...............................................................$275,100 R 10 NH CR9080 750E/630T, Long Auger, STD Chopper, Y&M, Chaff Spreader, 16’ PU ...$287,900 N 10 NH CR9080 746E/647T, 2sp Gear Box, STD Chopper, Y&M, Chaff Sprdr,16’ PU........ $287,900 N 10 NH CR9080 721E/629T, Chopper, Y&M, Chaff Spreader, Dual Rasp Bars, 16’ PU..... $287,900 N 11 NH CR9080 55E/188T, 520/85R42D, 281/26, Y&M, Dlx Chopper, 790CP 15’ PU Hdr . $345,500 R 11 NH CR9080 155E/188T, 520/85R42D, 281/26, Y&M, Long Auger, Dlx Chpr, 15’ PU Hdr$345,500 R 11 NH CR9080 275E/220T, 900/600, Y&M, Deluxe Chopper, Awning Plates, 790CP Hdr$325,500 SW 09 NH CR9080 275E/220T, 900/600, Y&M, Deluxe Chopper, Awning Plates, 790CP Hdr PU CALL H 03 NH CR960 1638E/1355T, 900/60R32, 600/65R28, Chaff Spreaders, w/NH 75C Head$137,900 M 03 NH CR960 2045E/1618T, 900/60R32, 600/65R28, Dlx Chpr, 76C Head, Swathmaster PU $127,900 M 03 NH CR960 2197E/1618T, 900/60R32, 600/65R28, Dlx Chpr, 76C Head, Swathmaster PU $122,900 M 04 NH CR960 2170E/1550T, 20.8R42D, Dlx Cab, Y&M, Long Auger, w/NH 76C Head .... $142,900 H 05 NH CR970 1125E/835T, 900/60 R32 Tires, Y&M, Long Auger, Swathmaster PU ......$183,900 ST 04 NH CR970 1466E/1080T, Dlx Cab, Y&M, 18.4x38 D & 600/65R28, 76C 16’ Hdr ......... $167,900 P 05 NH CR970 1188E/964S, 900/60R32 Drive, 600/65R28 Steer, 21 Ft Auger, Y&M, 76C14 Hdr$177,450 K 03 NH CR970 2308E/2178S, Y&M, Chaff Spdr, Dlx Cab, w/NH 76C Head, 14 Ft., Rake Up PU.$139,900 M 06 NH CR970 1232E/944S, 520D, Y&M, w/2009 NH 76C Head, Swathmaster PU ..........$198,900 M 05 NH CR97 1980E/1640S, 20.8x42D, Dlx Cab, Chaff Spreader, Y&M, w/NH 76C ..........$161,900 M 06 NH CR970 1214E hrs, 900/60R32, Dlx Chopper, Y&M, w/NH 76C Swathmaster PU .. $182,900 P 80 NH TR95............................................................................................................................$5,060 R 84 NH TR95 2653E, Chopper, w/NH 970 Hdr, 388 Melroe 7 Belt PU, Plasic Teeth............. $14,100 P 91 NH TR96 2505E, 14.9-24 Rear, Chopper, w/NH 971, 388 Melroe 8 Belt PU .................. $27,600 P 93 NH TR96 2922E/2901T, Swathmaster PU, Redi Kopp Chopper, Long Auger, Shedded$23,900 ST 93 NH TR96 3700E/2800T, 30.5x32, Chopper, w/NH 971 Head,14 Ft. Swathmaster PU ... $22,900 B 93 NH TR96 3189E/2369T, Auto Hdr Hght, Chopper, 971 Hdr, Swathmaster PU, Shedded$22,900 N 90 NH TR9 2255T, 30.5x32 Drive Tires, Straw Chopper & Spreader, 971 NH PU Hdr, 388 PU$24,200 CC 94 NH TR97 3137E, Chopper & Chaff Sprdr, Westward 388 PU, Ultra Control UC-2 ......... $24,900 P 95 NH TR97 2910E/2161T, 30.5x32 Drive, Chopper, w/NH 971 Head, 14 Ft. Swathmaster$43,900 B 97 NH TR98 2662E/2028T, 30.5x32, 14.9x24, Chaff Sprdr, 3 Ft, Victory Super 8 PU ......... $44,900 H 96 NH TR98 3078E/2454T, Chopper, Chaff Sprdr, 971 Swathmaster PU Hdr ..................... $41,800 R 97 NH TR98 2389E/1872T, Swathmaster PU, Long Auger, Chaff Spreader ........................ $52,900 N 98 NH TR98 2840E/2233T, Swathmaster PU, Hopper Topper, Chaff Spreader, Chopper ... $43,300 R 97 NH TR98 2241E, Chopper, Chaff Spreader, 971 Hdr, w/Swathmaster ......................... $51,900 SL 97 NH TR98 2501E/1998T, Chaff Spreader, Swathmaster PU ...........................................$51,900 M 02 NH TR99 2019E hrs, Chpr, 2 Spd, Chaff Spdr, w/NH 75C 14t. Swathmaster PU .......... $81,900 P 01 NH TR99 2870E/2124T, 18.4x42D, Hopper Ext., w/ NH 971 Head, Swathmaster PU.... $70,900 B 00 NH TR99 2279E hrs, Redekopp Chopper, Swathmaster 14B PU ................................... $70,900 P 02 NH TR99 2238E/1806T, 20.8x42D, 14.9x24 Rear, Y&M, w/NH 971 Head, Rake Up PU$95,900 M

CONVENTIONAL COMBINE 88 JD 8820 3219E hrs, 255HP, 30.5x32, Titan II, w/JD 912 Head ...........................................$13,900 80 JD 8820 1832E hrs, 255HP, B107- 30.5x32, Single Speed Cylinder. ............................ $11,800 B 93 JD 9600 4080E/3026T, 260HP, Chaff Spreader, Grain Hopper Extensions, Shedded $48,900 SW 93 JD 9600 3841E/3018S hrs, 260HP, 30.5 x 32, Rem Chaff Spreader, 914 PU hdr, Shedded$49,900 P 93 JD 9600 3505E/2865T, 260HP, Fine Cut Chopper, Chaff Sprdr, New PU Belts,. ............. $54,900SW 98 JD 9610 2992E/2121T, 30.5x32, 2 Spd, Mauer Topper, Chaff Spinners, w/JD 914 Head$82,500 B 09 NH CX8070 862E /639T, Auto Steer, Y&M, w/NH 76C Head,14 FT. Swathmaster. ...... $214,900 H 09 NH CX8070 314E/217T, Y&M, Chaff Sprdr, w/NH 76C Head,14 Ft., Swathmaster PU $240,900 B 09 NH CX8070 307E/221T, Y&M, Chaff Sprdr, w/NH 76C Head, 14 Ft. Swathermaster PU$240,900 B 08 NH CX8070 1319E/944T w/NH 76C Head, Swathmaster PU, Y&M ............................. $172,900 A 08 NH CX8070 1224E hrs, 322HP, SW/600/65R28, Y&M, 76C 14’ Swathmaster PU ..... $176,900 SL 10 NH CX8070 459E /375T, Y&M, Chaff Spinners, Long Auger, w/14’ Swathmaster PU .. $245,900 B 11 NH CX8070 3E/0T, 900 Tires, Y&M, Chaff Spinners, w/NH 790CP Head, 15 Ft.......... $287,900 B 11 NH CX8070 53E/39T, Y&M, Leather Seat, Long Auger, w/NH 790CP Head, 15 Ft. .....$287,900 B 09 NH CX8080 760E/554T, 520 Duals, Y&M, Chaff Spreaders, w/NH 76C Head ............. $235,900 B 08 NH CX8080 988E/762T, 900 Front/600 Rear, Y&M, Chaff Spreaders, w/NH 76C Head$203,900 B 08 NH CX8080 650E/480T, 900 Front Tires, 600 Rear Tires, Yield & Moisture Monitor .$219,900 SW 07 NH CX8080 1205E/924T, Calmar, Chaff Blowers, New Stationary Knives, 76C........$196,875 SW 08 NH CX8080 958E/786T, 900 Front and 600 Rear Tires, Chaff Blowers .....................$207,375 SW 08 NH CX8080 65E/814T, 900 Front and 600 Rear Tires, 76C.......................................$204,750 SW 08 NH CX8080 8E/806T, 900 Front & 600 Rear Tires, 76C ............................................$204,750 SW 08 NH CX8080 1043E/802T, 900 Front/600 Rear, Y&M, Chaff Spreaders, w/NH 76C Head$230,900 B 09 NH CX8090 592E/474T, 900 Tires, Yield & Mapping, Chaff Spinners, 76C Head ........$251,900 B 04 NH CX840 1819E-1293T, Y&M, Chaff Blowers, w/NH 76C Head, Swathmaster PU .... $133,900 B 06 NH CX840 1229E/996T, 520x42D-600 Rear, w/NH 76C Head, Swathmaster PU, 14’ . $167,900 B 04 NH CX840 1712E/1313T, 900 Tires, Chaff Blowers, Y&M, w/NH 76C, Swathmaster PU $133,900 B 06 NH CX840 1242E/1033T, 900/600, Long Auger, Y&M, w/NH 76C, Swathmaster PU ... $161,900 B 04 NH CX840 1884E/1624T, 900/600, Long Auger, Y&M, w/NH 76C Head,Swathmaster PU$128,900 B 05 NH CX840 647E/520T, 900 Tires, Long Auger, Y&M , W/NH 76C Head.......................$172,900 M 02 NH CX840 1897E/1378T, PU Hdr 14’ Swathmaster, 900/600, Chaff Blower, Y&M ...... $113,090 K 02 NH CX840 1900E/1700T, 900 Tires, Y&M, Chaff Blowers, W/NH 76C Head,Rake Up PU$113,900 B 04 NH CX840 1120E hrs, 900/65R32, 600/65R28, Y&M, Dlx Chopper, Chaff blower ....... $150,390 R 03 NH CX840 2145E/1684T, 900/60R32, 540/65R30, w/NH 76C,14 Ft, Swathmaster. .... $112,900 H 03 NH CX840 1715E/1352T, 900 Tires, Dlx Cab, Long Auger, Chaff Blowers, w/NH 76C.$127,900 B 02 NH CX840 1804E/1453T hrs, Chaff Blowers, 76C 14ft Swathmaster PU ..................... $116,100 P 05 NH CX840 1428E/1185T, 20.8R42D, Dlx Cab, w/NH 76C Head, 14 Ft, Swathmaster .$158,900 H 03 NH CX860 2506E/1910T, Chaff Blowers, w/NH 76C Head,14 ft., Swathmaster PU .....$108,900 M 05 NH CX860 1825E/1492T, Chaff Blowers, Y&M, w/NH 76C Head, 14 Ft., Swathmaster PU $142,900 M 04 NH CX860 1414E/1094T, Chaff Blower, w/NH 76C Head, Rake Up PU .......................$149,900 M 03 NH CX860 1784E /1352T hrs, Y&M, Small Screen Monitor, Screen Brush, 18’ Auger .$139,200 R 06 NH CX860 1010E/845T, 900 Singles, Y&M, w/NH 76C Head, Swathmaster PU. .......$179,900 M 06 NH CX860 1325E/1115T, 900/600, Straw Blowers, Long Auger, Y&M, 76C Head.....$157,500 SW 05 NH CX880 1834E/1381T, 20.8R42D, 600/65R28, Y&M, Chaff Blowers, w/NH 76C Head$161,900 H 99 NH TX66 2177E/1867T, 800/65R32 Drive, 16.0R70 Steer, Chaff Sprdr, 971 PU Hdr.. $60,500 CC 98 NH TX66 2657E / 1947S hrs, 800R65/32, w/971 PU Hdr ...............................................$55,880 R 98 NH TX66 2744E/2144T, 30.5-32, Chaff Spreader, Swathmaster PU .............................. $53,900 B 98 NH TX66 2500E /2000T, 800 Tires, Single Speed Cylinder, Double Vittetoe .................. $60,500 B 99 NH TX66 3004E/2447T, 2 Spd Cyl, Chaff Sprdr, w/NH 971, Swathmaster ..................... $33,900 H 98 NH TX66 2356E/1906T, 8SS Cyl., Chopper & Chaff Spreader ....................................... $49,500 K 98 NH TX66 2900E/2240T, 800/60R32, w/NH 971 Head, Chopper, Single Speed..............$53,900 M 98 NH TX68 3287E/2626T, 14.9 X 24 Steer, 971 NH Hdr, Swathmaster PU .................... $55,000 CC

PRE-OWNED EQUIPMENT

PAGE 20 Manitoba FarmLIFE, Monday, March 12, 2012 PAGE 21


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 23

FarmLIFE Auction Calendar Mon, March 12, 2012 Killarney Auction Mart Regular Weekly Cattle Tues, April 3 2012 9am PARKS AUCTION-- WHITEWOOD Sale. Killarney, MB. Fraser Auction Service 1-800-483-5856 LIVESTOCK REGULAR WEEKLY CATTLE SALE. WHITEWOOD, SASK. VISIT www.whitewood livestock.com. Tues, March 13, 2012 Prairie Partners Meat and Muscle Bull Sale, RHETT PARKS 306-735-2822 OR 306-735-7813. GENE Killarney Auction Mart. Fraser Auction Service 1-800-483-5856. PARKS 204-727-2828 OR 204- 729-7118. Tues, March 13, 2012 9am PARKS AUCTION-- WHITEWOOD LIVESTOCK REGULAR WEEKLY CATTLE SALE. WHITEWOOD, SASK. VISIT www.whitewood livestock.com. RHETT PARKS 306-735-2822 OR 306-735-7813. GENE PARKS 204-727-2828 OR 204- 729-7118

Wed, April 4, 2012 Unreserved Retirement Farm Auction for Tom and Jean Ryall, Rivers, MB. Fraser Auction Service 1-800-4835856

Tues, March 20, 2012 9am PARKS AUCTION-- WHITEWOOD LIVESTOCK REGULAR WEEKLY CATTLE SALE. WHITEWOOD, SASK. VISIT www.whitewood livestock.com. RHETT PARKS 306-735-2822 OR 306-735-7813. GENE PARKS 204-727-2828 OR 204- 729-7118

Wed, April 11, 2012 Livestock Equpment Dispersal for Bolduc Farms Plus Local Consignors. Deloraine, MB. Fraser Auction Service 1-800-483-5856.

Tue., April 10, 2012 Prairie Grain Crop Inputs Equipment Reduction Auction at Prairie Fleet Yard, Killarney, MB. 11:00 Mon, March 19, 2012 Killarney Auction Mart Regular Weekly Cattle am. Murray Rankin Auctions 204-534-7401 Ross Taylor Auction Service 204-877-3834 Sale. Killarney, MB. Fraser Auction Service 1-800-483-5856

Sat, April 14, 2012 Retirement Farm Auction for Jack and Mervin Stefanishyn. Russell, MB Fraser Auction Service 1-800-483-5856

Frid, March 23, 2012 1pm – DIAMOND T LIMOUSIN 7th ANNUAL Sat, April 14, 2012 Bob Hawmans Lifetime Antique Collections, BULL and FEMALE SALE KENTON DISTRICT, MB. PARKS Arcola, Prairie Place Complex, SK. Murray Rankin Auctions 204AUCTION SERVICE GENE PARKS 204-727-2828 OR 204534-7401, Ross Taylor Auction Service 204-877-3834 729-7118. RHETT PARKS 306-735-2822 OR 306-735-7813. Visit www.globalauctionguide.com Sat, April 14, 2012 1pm PRAIRIE LANE 34th ANNUALL BULL Mon, March 26, 2012 Killarney Auction Mart Regular Weekly Cattle and FEMALE SALE – SOURIS DISTRICTPARKS AUCTION SERVICE GENE PARKS 204-727-2828 OR 204- 729-7118. Sale. Killarney, MB. Fraser Auction Service 1-800-483-5856 RHETT PARKS 306-735-2822 OR 306-735-7813. Visit www. prairielaneangus.com Tues, March 27, 2012 Pure Country Bull Sale Taylor Auctions,Melita,MB Ross Taylor Auctions 204-877-3834 Mon, April 16, 2012 Killarney Auction Mart Regular Weekly Cattle Sale. Killarney, MB. Fraser Auction Service 1-800-483-5856 Tues, March 27, 2012 9am PARKS AUCTION-- WHITEWOOD LIVESTOCK REGULAR WEEKLY CATTLE SALE. Mon, April 16, 2012 Retirement Farm Auction for Andy and Ann WHITEWOOD, SASK. VISIT www.whitewood livestock.com. Dubois. Carroll, MB. Fraser Auction Service 1-800-483-5856 RHETT PARKS 306-735-2822 OR 306-735-7813. GENE PARKS 204-727-2828 OR 204- 729-7118 Mon, April 16, 2012 Estate of Calvin Sawyer Farm Auction, Langbank,SK Ross Taylor Auctions 204-877-3834 Mon, April 2, 2012 Killarney Auction Mart Regular Weekly Cattle Sale. Killarney, MB. Fraser Auction Service 1-800-483-5856 Tues, April 17, 2012 Unreserved Retirement Farm Auction for Bernard and Louise Trinder Langenburg, MB. Fraser Auction Tues, April 3, 2012 “Buy The Beef Bull Sale” JAS Red Service 1-800-483-5856 Angus and Sunset Ridge Red Angus consignors. Neepawa Ag Complex, Neepawa Manitoba. . PARKS AUCTION SERVICE Tues, April 17, 2012 Don Richmond, Farm Retirement Auction, GENE PARKS 204-727-2828 OR 204- 729-7118. RHETT PARKS 306-735-2822 OR 306-735-7813. Visit www.globalauc- Cypress River, MB. Murray Rankin Auctions, 204-534-7401, Ross Taylor Auction Service 204-877-3834 tionguide.com

MAGUIRE INSURANCE AGENCY

To Place your Auction in the next issue of Manitoba FarmLIFE, call 1-888-756-7770 or Fax at (204) 729-8965

Term Life Insurance - $250,000 AGE 35 40 45 50 55 60

MALE $ 135 $ 175 $ 25250 $ 35750 $ 585 $ 94750

Rates have

FEMALE $ 11250 $ 145 $ 180 $ 260 $ 405 $ 652

10 year term for an individual Tobacco free with preferred underwriting

637 10th St. Brandon (204) 727-4700 1-800-465-5433 Get an instant online quote at: www.maguire.mb.ca

BRANDON TRAILER SALES 2 miles west on Victoria Avenue

“A better Deal!”

Phone (204) 724-4529 brandontrailers@yahoo.ca

Dominion City, Manitoba

Dealer Permit #4383

Call About Rental Rates

Phone: 204-427-2777 Evenings: 204-347-7483 Website: www.tractorpeople.com

4WD & TRACK TRACTORS 2010 Versatile 435, 450 hrs, 800R38 dls, P.shift.................................................$219,000 2003 Buhler 2425, 2750 hrs, 800R38 dls, 12 spd, weights .................................$135,000 1996, Cat 65D, 4950 hrs, PTO, 3pth, P.Shift, 4 hyds.............................................$59,900 1995 Cat 45, 4000 hrs, 18” tracks, p.shift, 3pth, weights .......................................$55,000 2007 Challenger MT865B, 5200 hrs, 36” tracks, P.shift weights, 6 hyd .............$165,000 2004 CIH STX450Q, 3850 hrs, 30” tracks, 5 hyds, OB autosteer, ag tractor.......$165,000 1998 CIH 9370Q, 5300 hrs, P.Shift, 4 hyds, 30” tracks........................................$109,000 1995 CIH 9270, 5380 hrs, 20.8R38dls, 12 spd, std ................................................$65,000 1992 CIH 9280, 7500 hrs, 20.8R38 triples, P.shift trans, 4 hyds............................$55,000 1988 CIH 9170, 6700 hrs, 24.5R32 dls, P.shift, 4 hyds..........................................$57,500 1988 CIH 9130, 7900 hrs, 18.4-38dls, P.shift, 3 hyds ............................................$37,500 2000 JD 9400T, 5500 hrs, 30” tracks, 24 spd trans, 5 hyds ................................$105,000 2001 JD 9300T, 6050 hrs, 30” tracks, 24 spd trans, 5 hyds ..................................$95,000 1998 JD 8400T, 7800 hrs, 3pth, 24” tracks, p/shift.................................................$72,500 2002 JD 9520, 3400 hrs, 800R38dls, p.shift, 4 hyds, 8000Ibs weights................$165,000 1998 JD 9400, 3250 hrs, 710R38 dls, 24spd trans ..............................................$119,000 1997 JD 9400, 4000 hrs, 710R38 dls, weights, 12 spd std, local trade ...............$112,500 1997 JD 9400, 6750 hrs, 710R38 dls, 24spd trans, weights ..................................$95,000 1998 JD 9400, 12000 hrs, 700R38 Trelleberg Duals, 24spd trans, PTO ...............$72,500 2009 NH T9060HD, 984 hrs, 800R38 dls, p.shift, outback S2 autosteer .............$229,000 2002 NH TJ325, 4400 hrs, 20.8R42dls, P.shift, 4 hyds........................................$112,500 2000 NH 9884, 4024 hrs, 710R38dls, 12 spd std, weights ..................................$109,000 2000 NH 9684, 5300 hrs, 710R38 dls, 12 spd std, weights ...................................$89,900 1994 NH 9880, 6300 hrs, 20.8R42 triples, 12spd std .............................................$72,500 1995 NH 9880, 9100 hrs, like new, 20.8Triples, 12 spd std, nice ..........................$67,500 1985 Versatile 936, 9200 hrs, 20.8R42dls, 12 spd std ..........................................$35,000 1985 Versatile 976, 24.5dls, 13200hrs, 4 hyds, std trans, local trade ...................$32,500 1981 Steiger ST280, 20.8-38 dls, local one owner trade .......................................$21,500 1979 White 4-175, 23.1-34 singles, PTO, 3 hyds ..................................................$13,500 COMBINES 2009 JD 9870STS, 433/584 hrs, 5 spd fdr hsr, topper, touch set. 650R38 dls, hi cap unload, JD 615P ....................................................................................................$265,000 2005 JD 9760STS 1200/1840 hrs, duals, fine cut chpr, Hi cap unload, HD V.S. feeder house, CM, yield & moisture, ATR, touch set, w/JD 914P .................................... $152,500 2005 JD 9760STS, 3038/4500 hrs, contour, Y&M, High cap unload, 800/R38 dls, touch set, topper JD 914PU ............................................................................................$129,000 1999 JD 9610 1991/2880 hrs, F. cut chpr, 800R32s, l. auger, topper, contour master, JD 914............................................................................................................................ $79,900 1986 JD 8820 Titan II, 2200 hrs, 30.5R32s, chopper, JD 214PU........................... $25,000 1993 CIH 1688, 3800 hrs, Spec rtr, accel kit, 30.5R32s, CIH 1015 PU .................. $47,500 1998 Cat 460, 2623/3550 hrs, 800R32s, 3D sleve, chopper, PU head .................. $52,500 1998 Cat 460, 2600/3600 hrs, 800R32s, 3D sieve, chopper, PU head .................. $52,500 MFD & COMPACT TRACTORS 2008 Puma 165 1700 hrs, CIH 770 loader, grapple, 3pth....................................$109,000 1997 CIH 5240, 10500 hrs, 18.4R38s, CIH 540ldr w/grapple, LHT=R ...................$37,500

2002 JD 4410, 650 hrs, 3pth, MFD, hydro trans, Mid MT PTO ..............................$19,000 2003 JD 4310, 450 hrs, hydro, 3pth, ldr, MFD .......................................................$18,500 1995 JD 8100, 6100 hrs, 18.4R46 dls, triple PTO, 3PTH, 3 hyds..........................$77,000 1996 JD 8400, 10950hrs, 18.4R42dls, P. Shift, 3pth, 4hyd ..................................$62,500 2WD TRACTORS Case 2590, 7800 hrs, 20.8R38dls, 3pth, P.shift .....................................................$12,500 1977 IHC 1586, dual, pto, 3pth, 18.4R38 singles ...................................................$16,500 COMBINE HEADS 2008 JD 635F, Single PT Hook Ups, PU reel.........................................................$32,500 2010 JD 630F, Single PT Hook Ups, PU reel.........................................................$36,000 2005 JD 630F, Single PT, FF auger, PU reel AWS air system ..............................$35,000 2000 JD 930R, P.U. Reel, 50S Drives ...................................................................$17,500 2001 JD 930R, PU reel, 50 series drives, FF auger ...............................................$17,500 2000 JD 930F, FF Auger, PU reel, 50S Drives ......................................................$17,500 1999 JD 930F, PU reel, 50 series drives ................................................................$13,500 1999 JD 930F, PU reel, 50 series drives ................................................................$13,500 JD 843, 8 row, oil bath drives, 30” cenfig ...............................................................$12,500 2008 CIH 2020, 35ft, single Pt hookup ...................................................................$22,500 1998 Cat F30, Flex, PU reel .....................................................................................$9,000 1998 Cat G30, Rigid, PU reel .................................................................................$12,500 SEEDING, TILLAGE & LOADERS 2003 JD 650 Disk, 30ft, 25” blades, hyd leveling, 3 bar harrow ............................$32,500 2006 Bourgault 7200 Heavy Harrow, 84ft, 25” tines, D. Pressure .......................$37,500 Degelman Strawmaster 7000, 70ft, 24” tines .......................................................$29,900 NH ST830, 42ft, New Bushings, New Harrows, 8” sweeps ....................................$42,500 NEW LEON 705 Loaders, Bucket, MTS & Hoses Extra .........................................$7,500 NEW LEON 805 Loaders, Bucket, MTS & Hoses Extra ..........................................$8500 GRAIN CARTS 2004 Kinze 1050, tracks, scale tarp .......................................................................$79,000 Unverferth GC 7000, tarp, 30.5s, corner unload ...................................................$18,500 1996 Brent 774, 17” auger, 30.5s, local trade........................................................$19,500 1996 Brent 674, 17” auger, 30.5s, nice ..................................................................$18,500 1997 Brent 874, 850 bu, corner unload..................................................................$25,000 Brent 472, 24.5s, tarp, corner unload.....................................................................$13,500 2008 Brent 1194, Tarp, Scale, 900R32’s, NICE! ...................................................$52,500 SPRAYERS & FLOATERS 2005 AgChem 1064 RG, 1850 hrs, 1000G SS tank, 10 bolt drvs, hyd tread, 2 sets of tires, NICE .............................................................................................................. $112,500 2006 AgChem 874, 2050 hrs, 90ft booms, 2 sets of tires, hyd tread adj ............. $119,000 1996 Loral Air Max 5, 6000 hrs, Ford engine, 60ft booms, canola box ................. $42,500 SWATHERS 2005 MacDon 9352C, 1800/1400 hrs, MacDon 972 25ft head, turbo, 2 spd ........$65,000 2002 MF 220XL, 1400 hrs, 26ft head .....................................................................$45,000 1999 MF 220, 1500 hrs, 30ft, PU reel.....................................................................$39,900 1994 Westward 9000, 1900hrs, MacDon 960, 25ft, PU Reel ...............................$42,500 INDUSTRIAL EQUIPMENT & MiSCELLANEOUS 2008 JD 317, bucket, Aux Hyd., Solid Tires, 300hrs .............................................$25,000 NEW Allied 960 Snowblower, Double Auger .........................................................$6,750


PAGE 24 Manitoba FarmLIFE, Monday, March 12, 2012

NOW Available in Newsprint AND on our Website!

&

Another way to reach your target audience without any extra cost to you! When you place an advertisement in our Manitoba FarmLIFE, Saskatchewan FarmLIFE, Ad-Viser and/or Ag-Viser newspapers, your advertisement is uploaded to our new site www.farmpressltd.com For more information call Manitoba FarmLIFE at 1-888-756-7770

www.farmpressltd.com


Manitoba FarmLIFE, Monday, March 12, 2012 30 min of of Brandon 30 minNENE Brandon Call Trentoror 204.763.4746 Call Trent RegReg 204.763.4764 Toll Free1.877.213.8225 1.877.213.8225 Toll Free

Arborg, Manitoba

NEW 2011 IMPALA pwr seat alloy wheels flip and fold rear seat

RETRO FIT YOUR EXISTING BIN WITH A PRP HOPPER BOTTOM We do installs,ext.kits,skid or concrete slab. New PRP/Behlen Hopper Combo From 3000-9700bus. Visit our Website at prpenterprises.ca

Wrecking and Wrecking Older Older and Older Newer Trucks

www.vikingmotors.ca

Newer Heavy Trucks

$19,900 1-888-204-2342

PAGE 25

Visit usVisit online @ www.loewensalvage.ca a listing of some of our inventory us online @ www.loewensalvage.ca forfor a lisƟng of some of our inventory

ND

2 SECTION 2080 Currie Blvd. (South of the Shoppers Mall Brandon)

www.formanhonda.ca

17,995

$

‘10 Mazda3 GX

9,800 kms, stk#U10097, fully equipped, heated seats, cd, p/dl, p/w

21,000 km, auto, p/w, p/dl, cd, stk#31176A

32,995

‘08 Honda CR-V LX

75,025kms, stk#U10131, fully loaded, cd, sunroof, leather

8104,000 kms, p/w, p/dl, 4x4, auto, cruise, cd, stk#U10120

‘08 Honda Pilot SE

Auto, 6 cyl, air, cruise, p/w, p/dl, cd, turbo, 88,700 kms

90,100 kms, 4x4, cd, p/w, p/dl, cruise, atk#U10130

10,995

$

‘07 Chrysler Sebring

83,600 kms, p/w, p/dl, air, tilt, cd, stk#M11005

97,400 kms, 4 spd, auto, cd, p/w, p/dl, cruise, stk#D12060A

9,995

$

Bi-Weekly $

238

‘07 Honda Ridgeline EX-L 4x4, auto, cd, fully equipped, p/dl, p/w, sunroof, leather, stk#U10116

10,995

$

10,995

$

Bi-Weekly $

156

Bi-Weekly $

125

‘07 Mazda B-Series SE

14,995

22,495

$

Bi-Weekly $

163

$

227

‘08 Mazda CX-7 GS AWD

Bi-Weekly $

202

Bi-Weekly $

202

15,995

Bi-Weekly $

24,995

$

19,995 Bi-Weekly $

$

19,995

$

Dealer Permit #0254

$

202

‘08 Acura MDX Tech Pkg

725-1530

89,970 kms, auto, tilt, cruise, cd, p/w, p/dl, skt#R12115A

Bi-Weekly $

316

110,560 kms, 5spd, auto, p/w, p/dl, cruise, cd, stk#V11240A

‘08 Hyundai Sonata GL

auto, 4 cyl, air, cruise, p/w, p/dl, keyless, alloys, 105,400 kms

$

Bi-Weekly $

‘07 Toyota Camry LE

‘09 Volkswagon Jetta TDI Sedan

19,995

$

84,450 kms, stk#32093A, p/w, cruise, cd, air

202

147

‘11 Ford Focus SES

15,995

$

Bi-Weekly $

Bi-Weekly $

177

‘07 Ford F-150 XLT 4x4

19,995

$

16,995

$

Bi-Weekly $

128

‘02 Ford Super Duty F-250 XLT

‘07 Nissan Versa 1.85

stk#C11238B, p/dl, p/w, cd, cruise

69,050 kms, stk#U10053, p/w, p/dl, cd

Albert Loewen

James Burkart

Don Ramsey

Doug Wiebe

Bobby Binions

Ricardo Medina

Steve Mooney

‘00 Nissan Frontier 4WD SE 21,000 kms, stk#32058B, sunroof, cd, cruise, 5 spd, manual, 4x4

728-4848 Dealer Permit #4407


PAGE 26 Manitoba FarmLIFE, Monday, March 12, 2012

Bill Klassen Auctions Ltd. LARGE FARM EQUIPMENT AUCTION FOR VERENA LOBSIGER AND THE LATE DANIEL LOBSIGER TUESDAY APRIL 10 . 11 AM 2012. WE MAY RUN 2ND RING FOR HOUSEHOLD, AT 11.30 PLEASE NOTE MRS VERENA LOBSIGER IS MOVING TO SWITZERLAND SO EVERYTHING WILL SELL TO THE HIGHEST BIDDER DIRECTIONS: from Dominion City 7 miles south on 200, and east on 218, or from Ridgeville follow 218, 2 miles south and one west on 218 s#ASE)(3TEIGER SPEEDSTANDARD PTO REMOTES 2@DUALS HOURSSHOWING SERIAL*%%/// s#ASE)(-ODELWHEELDRIVE POWERSHIFT REMOTES PTOWITH,EON FRONTENDLOADER )(#MODEL PTH DUALPTO4! DUAL HYD X s3TEIGER34WHEELDRIVE #AT ENGINEPLUSHORSEPOWER  SPEED REMOTESX3UPERIOR$UAL WHEELSYSTEM DUALSCENTREHINGESDONEAND PLUMBEDFOR'03 3OLIDTRACTORCONSIGNED BY"RYRON(EINRICHS VEHICLES s#HEVROLET%QUINOX,4 !7$ $OOR CYLINDERSTICKAUTOMATIC BROWNINCOLOUR LOADED ONLYONEOWNERKM SERIAL #.&,'%#" s$ODGE2AM3,4 CYLINDER DIESELPICKUP XAUTOMATICQUADCAB SHORT BOX LOADED ONEOWNERKMATLISTING SERIAL$,8#' s#HEVROLET #HEYENNEDAYCAB LONGBOX VSPEEDSTANDARD NICECLEAN FARMTRUCK KMSHOWING HARVESTING s*OHN$EERE#OMBINE WITH BELTPICKUPONHEAD DUALSPEED CYLINDER CHAFFSPREADER HOPPEREXTENSION

X2ICETIRES ONLYENGINE SEPERATORHOURS SERIAL s*OHN$EERECORNHEAD( 8  ROWXINCH POLYDIVIDERS REALNICE UNIT s*OHN$EERE&LEXWITHPICKUPREELFORE AFTSERIAL&WITH"ERGEN HEADERTRANSPORT s#ASE)(PTOAUTOFOLDSWATHER WITH PICKUPREEL TILLAGE AND SEEDING s*OHN$EEREPULLBETWEENAIRCART X WITHMODELSEEDINGTOOL FTINSPACE WITHSPLITTERBOOT mOATING HITCH $EGELMANMULCHERS s*OHN$EEREMAXIMERGEVACUM PLANTER WITHINSECTICIDEATTACHMENT TRAILING TYPEHITCH FOLDINGMARKERS s#ASE)(MODELDEEPTILLERFTWITH .(KIT s2AVENRATECONTROLLER MULCHERS s4ORMASTERFTDIAMONDHARROWSAUTOFOLD s*OHN$EEREXKICKBACKPLOW CANNOT lNDMODEL GRAIN HANDLING s2EMGRAINVAC MODELWITHLOTS OFPIPENOZZLEETCONLYTOTALHOURS s&ARM&AN!"!GRAINDRYERSINGLE PHASE HOURS SELLSWITHLOADINGAUGER s,ABTRONICSCELLGRAINMOISTUREMETER COMPLETE s7ESTlELDAUGERS-+8,IKENEW -+8 8 W"RIGGS8W HPELECTRICANDNEW*WHP(ONDA ELECTRICSTART s7OODS&4-ODEL#$STOCKSHEDDER PTODRIVETRAILERHITCHSERIAL s3PRAYER.EW(OLLAND&LEXICOIL MODEL 3& WITHWINDSCREENS XTIRES LITERTANK TOTALHYDRAULICFOLDAND HEIGHT INDUCTIONETC SERIAL0., s4WOMARTINCAPITALWHEELTRAILERSSERIAL  2XTIRESWITHAPPROX BUGRAVITYBOXES s4RUCK&RAMETANDEMAXLETRAILERX TIRESWITHFARMTRACTORHITCHXBOXAND

R.R.1, Box 81, Winkler, MB, Canada R6W 4A1 Ph: 204-325-4433 â&#x20AC;¢ Cell: 204-325-6230 www.billklassen.com Email: bill@billklassen.com

HOISTWITHCOMBINATIONGRAINANDSILAGEEND GATE JACKLIGHTSETC REALHEAVYDUTYSETUP s,ANDLEVELERFTDUALHYDRAULICBUILDBY 6ITA7ELDING

s0LANTERSROWINCHSPACING *OHN DEERE s!LLOWAYROW2OWCROPCULT

s4WO*OHN$EEREROWALLCROPHEADERS s4ILLAGE#I-ODELDEEPTILLERFTWITH MISC 'AUGEWHEELSAND-ULCHERS s7INPOWERPTO GENERATORON s"OURGAULT#ULTIVATORFTWITH+NOC WHEELTRAILER ON3HOVELSANDMULCHERS s$IESELFUELTANKSTWOGAL ONE s0OWERMATICFT$IAMOND(ARROWAUTOWITHVOLTPUMPSANDBOWSER FOLD sFTPTHROTARYMOWER s(UTCHMASTERFT4ANDEMDISC s-4$YARDTRACTORHPHYDROWITH s$UETZ!LLISAPROZFT2UBBERMOUNTED MOWER SHANKlELDCULTIVATOR s0USHTYPE9ARDMANLAWNMOWER s04((EAVYDUTYPTODRIVEROTARY$ITCHER sXFT#ORRALPANELSONEWALKINWGATE s4URNCOGRAVITYWAGONONWHEELTRAILER sXCLAMPONDUALSWITHGOODTIRES RUNNINGGEAR OTHERDUALHARDWARE s&ARM+INGINPHDUALAUGERSNOW s,ARGESTACKCOVERTARP "LOWER s)NBACKYARD *OHN$EEREAIRSEEDERAIR s&ARM+INGX@'RAINAUGERDUAL CARTONLYWITH4"(HITCH CONDITIONASIS AUGERINLOWPROlLEHOPPER sXBEAVERTAIL CHECKERPLATETOP s&ARM+INGX!UGERWITHSWINGHOPPER XLBAXLESBRAKESONvTIRESXBOLT s3AKUNDIAKXFTGRAINAUGERWITHHONDA RIMS vFRAME ENGINE s7ESTlELDXAUGERLESSENGINE HOUSEHOLD sPTH"LADE sALL&URNITUREINHOUSE$ININGSUITEBEDROOM s"RANDTPTSPOTORESTATESPRAYERAPROX SUITE ,IVINGROOM&URNITUREETCPLEASESEE FTFOLDINGBOOMSETC 0HOTOSONWEBSITE s4WOGAL.(TANKSON2UNNINGGEARS s'ALFUELTANKWITHVOLTPUMP FOLLOWING Farm Equipment from s GALLOWPROlLE&IBERGLASSWATER Neighbour Jamie Toffelmire will sell at TANK Lobsiger auction s3HOPPRESSCRANECAM&RAMEONLYWITH s4RACTORS)(#MODEL(YDRO2OWCROP ADJUSTABLE"ED DUALPTO$UALHYD OPENSTATION2OLL"AR s@#OLDWELLHPAERATIONFAN WITHCANGOOD XTIRES VASTRANSITION s)(#%AGLEHIGHWAYTRACTOR CAT s4WO@#OLDWELLHPAERATION&ANS ENGINESPEED $AYCAB WET+IT  X s#!3%)(MOUNTEDAXLEDUALSXON TIRESAIRRIDESUSPENSIONNOSAFETY RIMSCWWITHAXLE#LAMPS s3EEDTENDERUNITFTDUALCOMPARTMENT s-AGIQUISTPRESSUREWASHERREALNICE TWINREARAUGERDISCHARGEMOUNTEDONFT s3OMESHOPTOOLSETC,+3!MPSTICK TANDEMAXLESEMITRAILERXTIRES WELDER sFTSEMITRAILER&IELDSPRAYERTENDER SINGLEAXLE'REAT$ANEVAN"ODYWITHTWO GAL0OLYWATERTANKS #HEMICALINDUCTION4ANK HPPUMPANDlLLERHOSEREEL

s/LDER4RIPLEAXLEFT4RAILERWITHSELF CONTAINED2AMPIDEALFORHAULING3KIDSTEER


Manitoba FarmLIFE, Monday, March 12, 2012

Bill Klassen Auctions Ltd. GIESBRECHT RICK AND LIZ FARM AUCTION SATURDAY APRIL 7 10 AM 2012 DIRECTIONS: Location at the Farm from Lowe Farm 2 miles west on Hwy. 23, then 3.5 miles south on Road 8 west. Yard # 20071 Will have signs up auction day. will be selling aprox 2 hours of smalls with internet powered by Bidspotter begining at 12 noon will have line up on website closer to auction day, TRACTORS s6ERSATILE3ERIES))HOURS"OTTOMEND DONEATHOURS/UTBACKGUIDANCEANDAUTOSTEER XTIRES s6ERSATILE3ERIES)))HRS"OTTOMENDDONE ATHOURS2 s2ADIALTIRES !TOMJETKIT PLUMBEDFORAIRSEEDER4RIMBLE GUIDANCEANDAUTOSTEER s*OHN$EERE0REMIUM-&7$ HOURS 22EARAND2 s&RONTTIRESSPEED!UTO1UADPLUSTRANSMISSION AIRSEAT FRONTFENDERS/UTBACKGUIDANCEANDAUTOSTEER s)(#$HOURSPTH ALLIED&%, DUAL HYDRAULICS HARVESTING EQUIPMENT s*OHN$EERE343COMBINESEPARATOR HOURS'REENLIGHTEVERYYEAR LPICKUPHEAD *OHN$EERE !UTOTRACGUIDANCEANDMAPPING!UTOHEADER  3PADE'RIPTIRES s&LEXHEAD PICKUPREELANDPOLYSKIDS s2IGIDHEADBATREEL s %LMERSHEADERTRANSPORT s %LMERSHEADERTRANSPORT

s#ASE)(3WATHERHOURS5PICKUP REEL DOUBLESWATH%: 3TEER s'UIDANCEANDAUTOSTEERANDMOUNTEDROLLER s5NVERFERTHGRAINCART TIRES ROLLTARP s&ARMFAN!"!GRAINDRYER TRUCKS s)(#%AGLEWITH ,OADLINEBOX HOIST ELEC TRICROLLTARP 2EMOTEHOISTANDCHUTE (0$ETROITWITH INFRAMEDONERECENTLYSPEED WILLBESAFTIED s'-##WENGINETRANSMISSION  #ANCADEBOX HOIST MILES 3AFTIED s#HEVY3ILVERADOXMILES USEDFOR SERVICETRUCK s,OAD+INGGRAINHOPPERTRAILER sTH7HEEL&LATDECKTRAILER ALMOSTNEWAXLES WHEEL ANDBRAKES B s 9AMAHAX+ODIAK1UADKMS TILLAGE s#ASE)(CHISELPLOWWITHMOUNTEDHARROWS ANDAUTOWINGLOCK s#OOPDEEPTILLERWITH2AVEN!UTORATE CONTROLLERANDRADAR WALKING s!XLES REARHITCHANDHYDRAULICWINCHANDMOUNTED HARROWS s -&DISKERS-ARTINHITCH HYDRAULIC CYLINDERSANDHARROWS s4OR-ASTERDIAMONDHARROW s4OR-ASTERHEAVYHARROW"IGTIRESvHARROW TEETH s#RUSTBUSTERTANDEMDISK CYLINDERSANDHOSES s*OHN$EEREPTHDEEPTILLER s#ULTIVATORSHOVELSETS s/LDERBOTTOMPLOW

LARGE FARM AUCTION FOR LAWRENCE AND TAMMY DYCK, ROLAND MANITOBA. THURSDAY APRIL 12, 10 AM DIRECTIONS:From Roland jct 23 and 428, 1 mile east on 23 and 3/4 south on road 20W Note: Roland is 11 miles north of Winkler Manitoba OR 10 miles south of Carman Manitoba. TRACTORS s#ASE)(3TEIGERBUILT X TRIPLES HYD TRIMBLE%:AUTOSTEER SPEED STANDARDTRANS HOURS SERIAL*++ s#ASE)(-8-&7$ HYD PTH  SPEEDPOWERSHIFT 28DUALS PLUMBED FOROUTBACKAUTOSTEERHOURS SERIAL **! s#ASE HYD PTH XDUALS HOURS SERIAL s#ASE)(-ODELPTOCOMBINE NEW PICKUP NEWBUSHINGSONSIEVES SERIAL s#ASE)(FTSWATHER 5))PICKUP REELPLOYTEETH HOURS s#ASE)(MODELPTOSWATHER s#ASE)(MODELSTRAIGHTCUTHEADER FTBATTREEL  s#ASE)(CORNHEADROWWIDE

SERIAL s#ASE)(-ODELCORNHEADROWX SERIAL9!3 s+INZEBUSHELGRAINCARTPTOX $IAMONDTHREADTIRES s7OODSFTSHREDDERSERIAL s&4TAPEREDSWATHROLLER s2OTORFROM#ASE)(COMBINERAN HRSSTRAIGHTROTOR s$-#GRAINSCREENERWELECTRICMOTOR TRUCKS AND TRAILERS s&REIGHTLINERHIGHWAYTRACTOR &,$#AT WSPEED NEWXTIRES!IR2IDE SUSPENSION +MSSERIAL&59%$"0!SAFTIED '-##6 TANDEM FT BOXHOIST ROLLTARP s#HEV# 6 TAGAXLE FT CANCADEBOXANDHOIST ROLLTARP s,ODE+INGFTLEADTANDEMHOPPERBOTTOMGRAINTRAILER2EBUILTIN s,ODE+INGFT0UP!4RAINHOPPERGRAIN TRAILER2EBUILTIN s#HEVTRUCK $URAMAXDIESEL AUTOMATIC WD WSERVICEDECK CABINETS TOOLBOXESETC/NLYKMSSERIAL'"+%-"SAFTIED s&ORD& EXTENDEDCAB DIESEL

R.R.1, Box 81, Winkler, MB, Canada R6W 4A1 Ph: 204-325-4433 â&#x20AC;¢ Cell: 204-325-6230 www.billklassen.com Email: bill@billklassen.com

s3HOPBUILTPTH6DITCHER s GAL.(TANKSONTRAILERSPRESSURETESTED SPRAYER & ACCESSORIES s(ARDI#OMMANDER0LUSHIGHCLEARANCE SPRAYER4RIPLETNOZZLES s$IAPHRAGMPUMP AUTORATECONTROLLER s#HEMHANDLERANDHP(ONDAWATERPUMPONFRAME s 53GAL%NDURA0LASWATERTANKWITHVALVESGOOD FORFERTILIZER s 53GAL%NDURA0LASNURSETANKWITHVALVE s GALGALVANIZEDWATERTANK s3PRAYERPUMPSANDNOZZLES GRAIN HANDLING s&ARM+ING LOWPROlLEHOPPERHYDHOPPER MOVERANDWINCH s7ESTlELD-+ AUGER s7ESTlELD4& AUGER(HYDAUGERMOVER BIN SWEEPPLUMBING s7ESTlELD7 AUGERWITHLHP(ONDAMOTOR s7ESTlELD7 AUGER s7ESTlELD PTOAUGER s (YDRAULICDRILLlLLAUGER s 7ESTlELDUTILITYAUGER s UTILITYAUGER s7ESTlELDREARMOUNTvDRILLlLL s$"$RILLlLLTANKLAND4 ROLLTARP ELECTRICOVER HYDRAULICCONTROLS s7ALINGA'RAIN6ACWITHHOSES s "ALDORHPELECTRICMOTOR s "ROOKHPELECTRICMOTOR s-ISCELECTRICMOTORS s 7HEATHEART(YDRAULIC"IN3WEEP

Bill Klassen Auctions Ltd.

PAGE 27

GRAIN BINS & ACCESSORIES s -ERIDIAN&RIESENBIN s -ERIDIAN'RAIN-AXBINS ONEONSKID2OCKET AERATION /PICABLES SIGHTGLASS s %DWARDS#ENTRIlCALFANS s HPvFAN s #ALDWELLHPvFANS s +EHOv#ENTRIlCALFANS s #ROSSDUCT+EHOAIRATION s 0ORTABLEBINAIREATIONNEEDSFAN s EXTENSIONCORDS  L      s/PI /NEPROBEANDMONITOR s'RAINANDTEMPPROBE s,ABTRONICSvGRAINMOISTURETESTER MISC. EQUIPMENT s4WOFUELBOWSERS sGALFUELSTORAGETANKWITHELECTRICPUMPANDMETER s4RUCKSERVICETANKWITH6PUMP s$ELTAALUMINUMTRUCKSTORAGEBOX s(ONDAPOWEREDPRESSUREWASHERPSIGAL MIN s 7AYRADIOSANDANTENNAS s (ANDHELDWAYRADIOS s,AND0RIDEPTHBLADEWHYDANGLEANDTILT s"UHLERSNOWBLOWERWITHHYDCHUTECONTROLS s*OHN$EERELAWNSWEEPER s!LUMINUMEXTENSIONLADDERS s3TEPLADDERS sSWINGSHOCKHITCHES s3OMESUITCASEANDWHEELWEIGHTS sLARGEAMOUNTOFGOODSHOPTOOLSAND&ARMHARDWAREAND GOODAMOUNTOF(OUSEHOLDMERCHANDISE see www .billklassen.com for more complete list and some photoâ&#x20AC;&#x2122;s Lunch available. Owners 204 746 8365

R.R.1, Box 81, Winkler, MB, Canada R6W 4A1 Ph: 204-325-4433 â&#x20AC;¢ Cell: 204-325-6230 www.billklassen.com Email: bill@billklassen.com

AUTOMATIC WD SAFTIED KMS SERIAL &4.8&%"

s$ODGE$W6SPEED WITH SERVICEBODYDUALWHEELS AUGERS s&ARM+INGX@4--AUGER WITH HYDRAULICHOPPERMOVERSERIAL s"ATCOBELTCONVEYOR PTODRIVE s"ATCOUNDERCARBELTCONVEYORW ELECTRICMOTOR s7ESTlELD78PTO 78WITHGAS MOTOR 78WITHGASMOTOR TILLAGE AND SEEDING s#ASE)(DEEPTILLERFTSECTION BAR MULCHERSW2AVEN.(+IT s*OHN$EERETANDEMDISCFT s&LEXICOILFTP PACKERBARWITHHYDFOLDING HITCH s4ORMASTERFTDIAMONDAUTOFOLDHARROWS s3UMMERSFTBARTINEHARROWS s4ORMASTERFTTINEHARROWPACKERBAR s*OHN$EEREROWCROPPTH XCULTIVATOR s!LLOWAYXROWCROPCULTIVATOR s(EATHROWNARROWBEANCUTTER s#ASEXPTHSEMIMOUNTPLOW s&LEXICOILFTAIRSEEDER CULTSEEDING TOOLWSPACING WDOUBLECHUTE3EED

TREATER!UTODEPTHCONTROL2AVEN.(KIT (AUKUSMARKERS WITH0"(SEEDCART WREAR HITCHANDWINCH s*OHN$EEREROWXPLANTERWDRY FERTILIZER )(#$ISKALSEEDERX@WITH7ESTlELDHARROWCART s#ONVEYAL"43BEANTENDERSERIAL $ 6ALMARAPPLICATOR SPRAYER EQUIPMENT s!PACHEMODELHIGHCLEARANCE SPRAYER FTBOOM PLUMBEDFOR/UTBACK AUTOSTEER AUTOMATICBOOMSHUTOFF HRS 4RIDENKONCROPDIVIDERSXREARTIRES XFRONT sPTHROWCROPBANDSPRAYER ROWXWITH NOZZLESPERROW sGALCADDYWAGONW3.$METERING HYD CLUTCH s4RAILERWGALTANKWITHMIXINGTANKANDPUMP s,ABTRONICSGRAINMOISTUREMETERWSCALE ETC s/UTBACK'03LIGHTBARGUIDANCESYSTEM sSOMESMALLSELLINGAPROXHOURWILLBEON "ISPOTTERINTERNETATAM /WNERS


PAGE 28 Manitoba FarmLIFE, Monday, March 12, 2012

Bill Klassen Auctions Ltd. KEN AND SHARON REIMER AND SHAKEN FARMS INC, FARM AUCTION APRIL 14 10 AM Location at the farm from west edge of Lowe Farm on Hwy 23, 2 miles south and ½ east on road 22. Coming from south Rosenfeld 9 miles north on 332 and 1.5 west on road 22. Internet bidding powered by Bidspotter begins at 11 am, TRACTORS s6ERSATILE DELUXECAB 2DUALS SPEEDSTANDARD WEIGHTPACKAGEWITH/UTBACK 3 AUTOSTEER ONEOWNERHOURS SERIAL  s3TEIGER#OUGARPTO HP SPEED POWERSHIFT XDUALS WITH3 /UTBACK AUTOSTEER ANDMAPPING APPROXHRS SERIAL  s#ASE-&7$#AB SPEEDSHUTTLE SHIFT PTH TRIPLEHYD DUAL04/ WITHALLIED LOADER BUCKETANDBALEFORK HARVEST EQUIPMENT s*OHN$EERECOMBINE 2 TIRES PICKUPHEAD CONTOURMASTER AUTOSTEER READY SEPARATOR ENGINEHOURS FULLY LOADEDCOMBINE SERIAL4ERMSAVAILABLE

 DOWNAUCTIONDAY BALANCECERTIlED FUNDSUPONPOSSESSIONONORBEFORE!UG  s*OHN$EERE&&LEXHEAD PICKUPREEL CONTOURMASTER STUBBLELIGHTS EXCELLENTCONDITION s%LMERSHEADERTRANSPORT3ELLSAFTER& s"RENTMODELGRAINCARTBUSHEL PTODRIVE X$IAMONDTIRES ROLLTARP s&4PULLTYPESWATHROLLER s3HOPBUILT3WATHERTRANSPORTSIDEDRIVEON TRUCKS & TRAILERS s&ORDHIGHWAYTRACTOR MODEL!4 WITH ##ATHP SP GOOD2TIRES CURRENTSAFETY s#ASTLETON&4GRAINHOPPERTRAILER TANDEM AIRRIDE -ICHEALSROLLTARPCURRENT3AFETY s#HEVROLET# GRAINTRUCK6  X-IDLANDBOXHOIST4AGAXLEWLIFTANDBRAKES GOODXTIRES CURRENTSAFETY s0OLARISTWINX!46 FRONTWINCH  MILES sDRAINAGEWHEELSFOR!46SELLSEPARATE s*TRAILERFTmATDECKTWO LBAXLES lFTH WHEELORBALLHITCH WITHRAMPS s0*UTILITYTRAILERSINGLEAXLEWITHFOLDDOWN4AILGATE RAMPSMODEL YARD EQUIPMENT s-ASSEY&ERGUSONYARDTRACTORMODEL'#  WITHMOWERANDLOADER JOYSTICK PTH AND REARREMOTE HYD

s$OUGLASFTPTH ROTARYTILLER s!LLIEDFTLIGHTBLADE s3HOPBUILTFTLANDLEVELERCWHYDRAULICLIFT s3HOPBUILTUTILITYTRAILERCWHYDRAULICDUMP s*$4LAWNSWEEP s9ARDSPREADER s3TIHLCHAINSAW s-OTTPTHFTFAILMOWER;NEEDSGEARBOX] TILLAGE AND FARM EQUIPMENT s&ARM+INGINDUALAUGERSNOWBLOWERLIKE NEW s&ARM+INGPTHFTSNOWBLOWERLIKENEW

#ASE)(MODELDEEPTILLERFTWITHMULCHERS s4ORMASTERFTDIAMONDAUTOFOLDHARROWS 2AVEN3UPER#OOLER.(APPLICATIONSYSTEM[ OUTLETMANIFOLDS= s3PRAYER&LEXICOILSYSTEM FT s2AVEN3#3RATECONTROLLERCONSOL USED WITHSPRAYERAND.(APPLICATOR SELLSAFTER SPRAYER s3PRAYER&LEXICOILSYSTEM FT s,EONPTH MODELBLADEHYD TILT ANGLEAND OFFSET s7HITEMODEL4ANDEMDISCFT sFTTAPEREDSWATHROLLER s'RAHAMFTPTHSHOPBUILTBORDERCULTIVATOR s7ESTlELDXWITHWHEATHEART30KITLIKENEW s7ESTlELDX-+AUGER s7ESTlELDXPTOAUGER

Bill Klassen Auctions Ltd. FARM EQUIPMENT AUCTION FOR DOROTHY KLOEPPEL AND THE LATE DIETER KLOEPPEL BRUNKILD MANITOBA, MONDAY APRIL 2 10 AM 2012. DIRECTIONS: From Brunkild 5.5 miles west on 305 or 11.5 miles east from Highway 2 and 13 [ Elm Creek ] Aprox 4 mile south on 13 then 11 mile east on PR 305 WIil have signs auction day, Due to the passing of the Late Dieter Kloeppel, Mrs Dorothy will sell this mostly one owner machinery line to the highest bidder. Inspection of equipment will be March 29 and 30, from 9 a.m. to 5 p.m. 2012 or by apointment with Auction co, 204 325 4433 , or cell 325 6230 EQUIPMENT s*OHN$EERE44RACKS %:3TEER FULLY EQUIPPED ONEOWNERHOURS SERIAL s#ASE)(-8-&7$ PTH  DUALS REMOTE 04/ %:STEER ONEOWNERHOURS SERIAL *AZ s6ERSATILEPURCHASEDINSPRINGOF REMOTESANDRETURNLINE LIKENEW4RELLEBORG SINGLES ONEOWNERHOURS SERIAL$ s4ORO:-ASTER :ERO4URNMOWERONLYUSED HOURS TRUCKS AND TRAILERS s+ENWORTH4" HIGHWAYTRACTOR. CUM MINS SPEED FULLER WETKIT RUBBERKMS SHOWING6). s&ORD4ANDEM'RAINTRUCK #UMMINS  SPEED WITH,OADLINEXX'RAINBOXKMS

SHOWING SERIAL&$95,&-! s)(#4ANDEM#UMMINS SPEEDFULLER SERIAL (3&"'2,# SHOWINGKMS7ITH ,OADLINEXX'RAINBOX s-ACK%CONODYNE SPEED lFTHWHEEL WETKIT SHOWINGHOURS SERIAL-.9%#// s,OADLINEXX%ND$UMP'RAINTRAILER 2TANDEMRUBBER#URRENT-ANITOBASAFETY3ERIAL 5%9 s,OADLINEXX@'RAINEND$UMP SWING OUTDOORSTAILGATE 2RUBBER3ERIAL&$95,& -! s#HEVROLETPICKUPDOORXLONGBOXV AUTOMATIC3ERIAL'4(+26&/KMS SHOWING LARGEFUELTANKANDVOLTPUMP/NTRUCKSELLS AFTER s3PRAYERTENDER@TANDEM(IGHBOYTRAILER TIRES WITHTWINGALPLOYTANKS CHEMICALTANKAND(ONDA PUMP3ELLSASUNIT s(IGHBOY3PRAYERTRUCKWITH-ARmEXFTBOOMGAL lBERGLASSTANK3PRAYERPOWEREDBYHP(ONDA ALL MOUNTEDON)(#3 84RUCK6%NGINE SPEED TRACTORTIRESALLAROUNDWITHCABCONTROLS /UTBACKGUIDANCESYSTEM s'-4RACKERXWITHALLAROUNDX4RACTORTIRESTHIS UNITISMODIlEDTOFASTTRACKRUNOFFWATERINlELDDRAINS !PPARENTLYNEVERBEENSTUCK s4#AR(AULERTRAILERTANDEMAXLEWITHBUILTON2AMPS

HARVESTING EQUIPMENT s7ESTWARD3WATHERPOWERUNIT SERIAL WITHFT-ACDONHEADERTWINPICKUPREEL ENGINE HOURSONCUTTERBAR HEADER s7ESTWARD3WATHERPOWERUNITSERIAL

R.R.1, Box 81, Winkler, MB, Canada R6W 4A1 Ph: 204-325-4433 • Cell: 204-325-6230 www.billklassen.com Email: bill@billklassen.com s7ESTlELDXWITHELECTRICHP s#ONVEYAIRPTODRIVEGRAINVACWITHHOSES ETC s,ABTRONICS@CELLGRAINMOISTUREMETER s,OADSOFGOODCORDSVARIOUSLENGHTS

s+EHOAERATIONFANS,OWTEMPJETTAIRHEATER IN INLINE'RAIN'UARDHEATER sGALPROPANETANK MISC sHPGENERATORSETWATT s,+3AMP!#$#STICKWELDER s,INCOLNSP4WIREWELDER s3ANBORNGALUPRIGHTAIRCOMPRESSOR s&LOORMODELšDRILLPRESS s#OLDPRESSUREWASHER s#UTTINGTORCHLESSTANKS s3OMEGOODREPAIRSTEEL3TOREDINSIDE s7ELDINGTABLEWITHVISEETC sWORKBENCHMETALTOP7OODDRAWERSETC

s$OUBLEENDGRINDER s+INGBANDSAW sTONHYDRAULICPRESS s!IROPERATEDOILDISPENSER s0ALLETSOFHARROWTEETH CULTSHOVELS XTRUCK TIRESETC s4RAILERLOADOFSMALLGOODFARMHARDWARE /WNERS

R.R.1, Box 81, Winkler, MB, Canada R6W 4A1 Ph: 204-325-4433 • Cell: 204-325-6230 www.billklassen.com Email: bill@billklassen.com

7ITHFT-ACDONHEADERTWINPICKUPREEL:EROHOURS ONNEWDROPINEXCHANGE#UMMINSENGINE HRSON CUTTERBAR (EAD s#AT,EXION2#OMBINE3WATH-ASTERPICKUPON FTHEAD2ICETIRESLOADEDMACHINEAUTOSTEERETC ENGINEHOURS SEPARATORHOURS3ERIAL 4ERMSIFDESIRED NONREFUNDABLEDOWNAUCTIONDAY BALANCEUPONPOSSESSIONONORBEFORE!UG  s#ASE)(#OMBINE #HOPPERPICKUPHEAD WITHBELTPICKUP HOPPERTOPPER 2ICEXTIRES  ENGINEHOURS SERIAL**#/*4ERMSIFDESIREDAS ABOVE s*-'RAINCART-ODEL  PTODRIVE X TIRES SERIAL SEEDING AND TILLAGE s3UMMERSFT$EEPTILLER ROWMULCHERS SERIAL" s!IR3EEDER#ONCORDCARTHYDFAN MODEL!3  SERIAL!3WITH4RELLEBORGTIRES FT #ONCORDSEEDINGTOOLSHANKSSPACESINGLECHUTE SHEDDED s"OURGAULTFTMIDHARROW s&LEXICOILFTSYSTEMSUPERHARROW (AULALLFT$UALTANKDRILLlLLSYSTEMDUAL REARAUGER DISCHARGE s!G3HIELD HIGHLIFTPULLTYPEFTSPRAYER HYD PUMP FOLDINGBOOM XTIRES IMPGALPOLYTANK s(UTCHMASTERTANDEMDISCFTSPACEBLADES AUGERS AND GRAIN s7ALINGACHROMEPUMP 'RAINVACSERIAL 4 s&ARM+INGAUGERWITHSINGLEAUGERHOPPER s3UKUNDIAKXCMORFTTOPLOADERAUGERWITH HOPPERANDREVERSER

s3UKUNDIAKXAUGERPTODRIVE s3AKUNDIAKXWITH'8(ONDAENGINE s3AKUNDIAKXCMORFTWITHHP(ONDAAND WHEATHEART30ANDSWEEPKITS s7ESTlELD*XWITHHP(ONDAWITHWHEATHEART 30ANDSWEEPKIT s2OLLERVIKING'RAINCLEANERSETUPWITHTWOSMALLERHOP PERSSELLSASAUNIT

MISC s#AT(YDRAULICSCRAPER s4OWABLETRIPODTOHOLDLAZARLEVEL s4OPPSLAZARLEVELUNITSELLSAFTERSCRAPER sFT,OPEL9ARDLEVELERBOXSCRAPER s2OTARYPTODRIVE$ITCHERMODEL2$,IKE.EW s3OVEMAPTHFT2OTARY4ILLER sUNITS-AXONANDSTANDARDTWOWAYRADIOSALLONSAME CHANNEL#OMPLETEWITHBASEUNIT MISC TIRES sXCONSTRUCTIONTIRE sXTRACTORTIRESONCASEDUALRIM s,8IMPLEMENTTIRESONRIMSANDXONRIMS SOMEWITHOUT s4RUCKTIRESONRIMS22ANDFEWX ONOLDSTYLERIMS sXFRONTTRACTORONMFWDRIMS s#ATQUICKHITCH s7OODSTOVE s)(#64RUCKENGINE s4WO#AT 1UICK(ITCHES Please note 10 a.m. Auction. We will be selling machinery by 10:30 a.m. Internet powered by Bidspotter begins at 10 30 am


Manitoba FarmLIFE, Monday, March 12, 2012

Bill Klassen Auctions Ltd. LARGE FARM EQUIPMENT AUCTION FOR YUILL FARMS AND ESTATE OF THE LATE KEN YUILL WEDNESDAY APRIL 18, 10 AM 2012. DIRECTIONS: Location at the seed plant, HWY 1A Exit east side of Portage La Prairie. 1 mile north of Allis Chalmers Museum on road 34 west will have signs up auction Day s#ASE)(-ODELWHEELDRIVE SPEED STANDARD 2AVENAUTOSTEER REMOTES WITHX TRIPLES HOURS SERIAL s#ASE)(-8-&7$ PTH PTO REMOTES  REARTIRES WITHFRONTENDLOADER QUICKBUCKETETC HOURS s)NTERNATIONAL-ODEL(YDRO PTH CAB WITH HIGHLIFTLOADER XTIRES s*OHN$EEREMODEL -&7$ PTH DUALPTO  REMOTES2AXLEDUALS SERIAL CHECK WEBSITEFORHOURS s*OHN$EEREUTILITYDIESELWITHFRONTEND LOADER PTH PTOROLLBARHILOSHIFT s*OHN$EEREUTILITYDIESELWITH,EONLOADER PTH PTO ROLLBARANDHILOSHIFT s*OHN$EEREDIESEL##RAWLERWITHLOADER AND REMOTEHYD SERIAL s9ANMARDIESELYARDTRACTORPTH PTO HORSE POWER ONLYHOURS

com p lete fa r m

a u ction

HARVESTING s#ASE)(COMBINE3PECIALROTOR NEWFRONTBARS ANDFEEDERCHAIN PICKUPANDHOPPERTOPPER s#ASE)(FTmEXHEADER s*OHN$EERECORNHEADWITH)(ADAPTORTO ETC FTPTOSWATHER s.EW(OLLANDSWATHERPOWERUNIT WITHFT (ONEYBEESWATHHEAD 5))PICKUPREEL PLUMBEDTORUN +EARSHEERS s4WOSWATHROLLERS s"ELTCONVEYORSUSEDTOUNLOADCOMBINEHOPPERS TRUCKS AND TRAILERS s&ORDHIGHWAYTRACTOR DAYCAB #UMMINS SPEED WETKIT XTIRES SAFTIED -ACKHIGHWAYTRACTOR MACKSPEED SLEEPER AIRRIDE s-ACK(IGHWAYTRACTOR MACKENGINE  SPEED AIR2IDE XTIRES

s-IDLANDTANDEMXTIRESENDDUMPGRAINTRAILER XXSIDES2OLLTARPSERIAL-'3#/. 2/ s,ODE+INGTANDEMSETOFSUPER"3 CURRENT SAFTIED  TIRES&! s&ORDGAS6 FTBOXHOISTROLLTARPNO SAFETY

R.R.1, Box 81, Winkler, MB, Canada R6W 4A1 Ph: 204-325-4433 â&#x20AC;˘ Cell: 204-325-6230 www.billklassen.com Email: bill@billklassen.com

PLANTING s*OHN$EERE-AXIMERGE0LATE ROWIN s*OHN$EEREROWXINWPLANTERUNITSW MAXIMERGECLOSERS s6ERTICALE0ARRALLEL&OLD s%LMERSROWBANDSPAYERSETUPFORBEANS s&LEXICOILSYSTEM FTSPRAYER INDUCTIONTANK WIND SCREENSSHEDDED s&LEXICOILSYSTEMSPRAYERWITHWINDSCREENSFTNO WINDSCREENS TILLAGE AND OTHER FARM EQUIPMENT s3UN&LOWERFTTANDEMDISCNICESHAPE s#ASE)(FT6IBRATILLERWITH.(KITANDHITCH s#ASE)(FT6IBRATILLER s#CILFTCULTIVATOR s7ESTERNFTHARROWPACKER"ARvCOILSHYDRAULIC TILTLIFTANDFOLD s-ELROE BOTTOM-OULDBOARDPLOW s2AU KOMBIFTPTHSEEDBEDDERMACHINE sFTTINEHARROWS sFTDIAMONDHARROWS s!UGERSALL3AKUNDIAK svXWITH(ONDAPOWER svXPTO vXPTO svXWITHSWING svXWITHSWING

M eier BrothersF a rm s-Ga rry M eier & Glen M eier W ed n esd a y,Ap ril4 th -10:3 0 a m -Rid ged a le,S K

(Tisd a le a rea ) S eller Con ta cts:Ba rry or Glen 3 06 -277-4 900

H i-L itesIn clu d e: TRACTORS -2008 New Holla n d T9050 4w d tra ctorw /485 en g hp, fu ll16 spd pow ershifttra n s,1000 pto,1792 hrs show in g;2008 JD 9530 4w d tra ctorw /475 en g hp,18 spd pow ershifttra n s,1405 hrs show in g; 2004 JD 9320 4w d tra ctor w / 375 en g hp, 18 spd pow ershifttra n s,1000 pto,2905 hrsshow in g;2008 JD 7730 M FW D tra ctor w / 190 en g/152 pto hp,Pow erQ u a d tra n s,du a lpto,2205 hrs show in g;Degelm a n 12â&#x20AC;&#x2122;dozer bla de w / 4-w a y hyd a n gle/lift; M in n ea polis-M olin e ZTS a n tiqu e tra ctor; COM BIN E S & ACCE S S ORIE S -2011 JD 9770 STS sp com bin e & JD 615P hea der,271 thr/383 en g hrs show in g,(25% dow n sa le da y); 2009 John Deere 9770 STS sp com bin e & JD 615P,524 hr/769 en g hrs show in g (25% dow n sa le da y);2008 JD 9770 STS sp com bin e & M a cDon PW 7 hea der,822 thr/1224 en g hrs show in g (25% dow n sa le da y);2009 M a cDon FD70 35â&#x20AC;&#x2122;flex dra per hea der (25% dow n sa le da y);2006 M a cDon 974 36â&#x20AC;&#x2122;flex dra perhea der(25% dow n sa le da y);2006 M a cDon 974 36â&#x20AC;&#x2122;flex dra per hea der (25% dow n sa le da y); S W ATH E RS - 2009 M a cDon M D 150 sp sw a ther & 2009 M a cDon D60-D 35â&#x20AC;&#x2122;hea der,486 hdr/640 en g hrs show in g (25% dow n sa le da y);2009 M a cDon M D 150 sp sw a ther& 2009 M a cDon D60-D 35â&#x20AC;&#x2122; hea der,397 hdr/548 en g hrs show in g (25% dow n sa le da y);1995 Tra il-tech side loa d sw a thertra n sport;Pa lm ier10â&#x20AC;&#x2122;sw a th flu ffer; S E E D IN G & TIL L AGE - 2009 Bou rga u lt 3310-65 PHD 65â&#x20AC;&#x2122;Pa ra Lin k Hoe Drill; 2009 Bou rga u lt 6550ST TBH a ir ta n k ; 2008 Bou rga u lt 3310-65 PHD 65â&#x20AC;&#x2122;Pa ra Lin k Hoe Drill;2008 Bou rga u lt6550ST TBH a ir ta n k ;1996 Bou rga u lt 5710 54â&#x20AC;&#x2122;seedin g tool;1996 Bou rga u lt 4300 TBH a ir ta n k ;2002 Bou rga u lt 8810 51â&#x20AC;&#x2122;cu ltiva tor & Va lm a r 3255 gra n u la r k it; 2002 D w a in Tw in 1450 NH3 ca rt w / 2-1450 ga l W esteel ta n k s; 2001 D w a in Tw in 1250 NH3 ca rt w / 2-1200 ga l W esteelta n k s;1990 Bou rga u lt FH48-52 50â&#x20AC;&#x2122;cu ltiva tor;2002 RiteW a y 4245H 45â&#x20AC;&#x2122;la n d roller;2002 Rite-W a y 8100 77â&#x20AC;&#x2122;hea vy ha rrow ba r; Pheon ix 53â&#x20AC;&#x2122; rota ry ha rrow ; Flexi-coil System 95 50â&#x20AC;&#x2122; ha rrow pa ck er ba r & Va lm a r 240 A irFlo; Flexi-coil System 82 70â&#x20AC;&#x2122; tin e ha rrow ba r;JD 230 21â&#x20AC;&#x2122;ta n dem disc; GRAIN S TORAGE â&#x20AC;&#x201C; Grea tselection ofhopperbin s& a era tion fa n s; GRAIN H AN D L IN G - 2010 Un verferth 1315 Extrem e gra in ca rt; 1984 Pa rk er 4000 hopper w a gon ;2005 W a lin ga 6614 gra in va c; 2000 Highlin e A ccelera tor 8510 10â&#x20AC;?x85â&#x20AC;&#x2122;belt con veyor;2 - Bu hler Fa rm K in g 1370 13â&#x20AC;?x70â&#x20AC;&#x2122;sw in g a u gers;2009 Sa k u n dia k TL10-1200 10â&#x20AC;?x35â&#x20AC;&#x2122;gra in a u ger,Ha w es m over& lift;1998 Sa k u n dia k HD8-1000 8â&#x20AC;?x32â&#x20AC;&#x2122;gra in a u ger;1997 Sa k u n dia k HD8-1200 8â&#x20AC;?x38â&#x20AC;&#x2122;gra in a u ger;

svXMOUNTEDONSELFPROPELLEDCOMBINE CHASSIS 5NITED&ARM4OOLSGRAINCART XTIRESHYD DRIVE s+LONSKILDEGRAINVAC MISC FARM s'RADERCONVERTEDTOREGULARTRACTORHITCH s&RONTMOUNTEDBLADE s3NOWBLOWERIN)NLAND NICE s3NOWBLOWERvINLAND GOOD s5TILITYTRAILERS s,ILYPTHFTDISCBINE sPTHPOSTPOUNDER sPTHWAYBLADE sPTHvTILLER sPTHIN&ARM+INGlNISHMOWER sPTHWOODSFTROTARYMOWER Very little small selling please be on time. information on items call Kevin Yuill 204 857 8708 Please Note some of the machinery listed here will be updated on our website www.billklassen.com 204 325 4433 cell 6230 internet bidding with Bidspotter begins at 11.30 am see website for details,

D irection s:F rom Rid ged a le go 1/2 m ile W esta n d 1/2 m ile N orth. Au ction Coord in a tor(s):Bren d a n K ra m er, K im K ra m er or M icha elH iggs3 06 -4 4 5 -5 000

S PRAY IN G - 2007 JD 4720 sp spra yer w / 90â&#x20AC;&#x2122; boom s, a u to su spen sion (25% dow n sa le da y); 1997 Bra n dt Q F2000S 90â&#x20AC;&#x2122; pt spra yerw /dou ble boom s; H AY IN G & L IVE S TOCK - 2009 JD CX -15 flex-w in g rota ry cu tter; 1983 A vco New Idea 486 rou n d ba ler;Gophin a toron tra ilerw / 60 ga lNH3 ta n k ; IN D US TRIAL -Eu clid S-18 Hydra u lic ptscra per;K irchn erV-ditcher; In gersollRa n d 185 CFM m obile a ircom pressor; H E AVY TRUCK S - 1997 Freightlin er highw a y tra ctor w / 430/470 Series 60 Detroit en gin e,18 spd;1995 In tern a tion a l 9370 Ea gle highw a y tra ctorw /430/470 Series 60 Detroiten gin e,18 spd;1991 M a ck CH613 highw a y tra ctor w / 400 M a ck , Ea ton Fu ller Roa d Ra n ger15 spd tra n s; L IGH T TRUCK S & CARS -1975 Ford F350 Cu stom on e ton service tru ck ;1996 GM C 2500 Sierra 3/4 ton 4x4 tru ck w /6.5L Tu rbo diesel; 2004 Chevrolet 2500HD LS 3/4 ton 4x4 crew ca b short box w / Du ra m a x diesel; TRAIL E RS - 2007 Doepk er Su per B gra in tra ilers w / a lu m in u m slopes;2007 Doepk er Su per B gra in tra ilers w / a lu m in u m slopes; 2005 Dou ble â&#x20AC;&#x153;A â&#x20AC;? 30â&#x20AC;&#x2122;goosen eck fla t deck tra iler;1975 Lin den low bed equ ipm en t tra iler,set-u p w ith 1800 US ga lbla ck poly ta n k , 1550 US ga lbla ck poly ta n k ,4 hp Hon da ,Sotera Chem -tra veller, Chem Ha n dler III;26â&#x20AC;&#x2122;hi-boy fla t deck tra iler,set-u p w / 1750 ga l poly ta n k ,1500 ga lpoly ta n k ,Hon da 3.5 hp,Chem Ha n dlerIII; L AW N & GARD E N - Hu squ a va rn a 850-12 ridin g m ow er; In tern a tion a l80 3 pth sn ow blow er; ATVâ&#x20AC;&#x2122;S ,RVâ&#x20AC;&#x2122;S & BOATS - Pola ris Sportsm a n 500 4w d fou r w heeler A TV;Pola risL/T 440cc sn ow m obile; OTH E R M IS C E QUIPM E N T;a n d m ore. CON S IGN M E N T F rom K evin W hen ha m (3 06 ) 277-4 3 22 TRACTORS -1982 Ca se 2390 2w d tra ctor,p/s tra n s,1000 pto,5434 hrsshow in g; S W ATH E RS -1990 Ca se 725 25â&#x20AC;&#x2122;p/tsw a ther; GRAIN H AN D L IN G & S TO RAGE - 5 - Gra in Va u lt 1805 4800 bu hopper bin s;4 -W esteelRosco 1850 bu hopper bin s;6 - Behlen 2911 2600 bu gra in bin s, steel floor; n u m erou s other bin s & a era tion fa n s; Sa k u n dia k HD 7-33 gra in a u ger; Bra n dt 8â&#x20AC;? x 52â&#x20AC;&#x2122; Su percha rged PTO gra in a u ger;W estfield M K 100-61 sw in g a u ger; H E AVY TRUCK S - 1973 Ford F600 s/a gra in tru ck , 361-V8, 5+2 tra n s,steelbox,a n d m ore. ThisL istin g IsO n ly A Gu id e An d In N o W a y A Gu a ra n tee O fS ize,D escrip tion O r Y ea r .

1.800.5 29.995 8 â&#x20AC;˘S K PL #914 6 18 â&#x20AC;˘ AB PL #3 206 95 9 â&#x20AC;˘S K L D #116 4 00 â&#x20AC;˘ â&#x20AC;˘ A UTH O RIZE D AB L IVE S TO CK D E AL E R â&#x20AC;˘

PAGE 29

S E E M O RE @

In tern et B id d in g & Equ ipm en t S ells @ 11:00 a m


PAGE 30 Manitoba FarmLIFE, Monday, March 12, 2012

- Honey Bee 36’ w/split p/u reel, hyd fore/aft, factory transport, 20’ pea auger, IHC adapter s/n 436000611. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $24,500 - 222 JD w/PU reel, s/n 324956. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,950 - 224 JD w/batt reel, decent cond, s/n 483771 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,250 - 320 Gleaner Flex hdr w/p/u reel to fit N & R series, s/n 19350 . . . . . . . . . . . . . . . . . . . . . $4,000 - 327 Gleaner -Batt reel with hyd kit -fits N-R series combines. . . . . . . . . . . . . . . . . . . . . . $5,500 - 810 IH, 22.5’ p/u reel, skid plates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 - 1010 IH 22.5’ w/pu reel, w/hyd fore/aft, s/nJJC0076143 . . . . . . . . . . . . . . . . . . . . . . . . . . $6,950 - 1010 IH 30’ w/batt reel, very nice header, s/n JJC0078368 . . . . . . . . . . . . . . . . . . . . . . . . $7,450 - 1010 IH 30’ w/batt reel, very nice header, s/n JJC0126766 . . . . . . . . . . . . . . . . . . . . . . . . $7,950 - 1020 IH 25’ w/pu reel, s/n JJC0093747 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,950

SEVERAL MACDON HEADER ADAPTERS TO FIT MANY MAKES & MODELS - 1859 MF 20’ w/p/u reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,750 - 9024 MF 22’ w/p/u reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,950 - 9024 MF, Batt reel, Floor & Auger mint . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 - 9230 MF 30’ w/batt reel, very low acres, fits 8600-9720, 8560, 8570, 8780, 8590, s/n H000033 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $9,500 - 9230 MF, Batt reel,fits 8600-9720,8560,8570,8780,8590 . . . . . . . . . . . . . . . . . . . . . . . . . $7,500 - 9550 Claas, 20’ flex hdr w/p/u reel, crop lifters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 - 6022 Claas 22’ stripper . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 - 971 NH, 24’, batt reel, s/n 518631 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,950 - 971 NH 25’ w/pu reel, s/n 576126 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,950 - 971 NH, 30’, Rigid w/p/u reel with hyd fore/aft . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,500 - AC LM, 24’ w/batt reel, will fit L,M series combine, S/N LM2461862 . . . . . . . . . . . . . . . . . $4,000 - AC LM, 20’, w/batt reel, will fit L,M series combines. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,750 - AC LM, 18’, w/batt reel (excellent), fits M, L3SOLD Gleaner . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,500

DIESEL ENGINE OVERHAUL KITS IN STOCK!!! Most John Deere, B & C Cummins, & Perkins Ag Applications available! Visit www.gcparts.com for kit pricing and details!

Grouser 11’ industrial paralift blade, fits many steigers (off CM325) . . . . . . . . . . . $10,500 Leon 13’, 4 way, excellent condition, very little use, 39” frame mount, off PT250 . $12,500 Leon 12' 2 way, mnts to fit 700-950 Vers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Leon 11’ 2 way, has snow & ice cutting edge, mnts to fit 118-145 Vers, easily adapted to others. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$4,500 Leon 10’ 4 way, to fit 9030 Ford NH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,500 Homemade 9’ 4 way blade, very easily adaptable for most 2wd & smaller MFWD (WA11). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $1,500 Leon Rock Ripper (pins to existing frame) or we have partial frame to modify . . . . $1,250

JD 148 6’ w/o grapple, needs some repairs, call for details, mounts to fit 4010-4455 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,250 JD 148 6’ w/grapple, quite nice condition, mounts to fit 4010-4455. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,950 JD 280 loader w/grapple, some wear, decent usable mounts to fit 4430-4850. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $9,000 JD 746 8’ w/grapple, some fire, but quite nice, call for details, off 7920 FWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $8,000 JD 840 8’ w/grapple, some fire (8100-8420 mnts) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,500 K160 White 6’ bucket, decent cond., mnts to fit 700 White MFWD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,500 Boss 8’ w/grapple, very decent, to fit 2-135/2-155 White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,000 MF 1080 8’ w/ 2cyl grapple, quite nice cond., s/n 000058, mnts to fit 6280-6290 MF. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,500 Ezee-on 2100 7’ w/grapple, decent cond., mounts to fit 6170-6180 MF . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Ezee-on 115E, 7’ w/grapple, very decent cond, mnts to fit 3630, 3650 -3660 MF . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Leon 790 7' bucket w/grapple, very nice, fits 7630 Agco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Leon 747 8' bucket w/teeth, excellent shape, fits 706-1256, easily modified to fit 966-1486 . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 Leon 707 w/o bucket, some fire buy very decent, mnts to fit 90-94 series Case . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,500 Leon 707 7’ bucket w/grapple, fair amount of welding, no mounts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,500 CIH L300 7’ w/grapple, very decent cond., has mnts to fit MX 110-120-135 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,500 CIH L510 7’ bucket/grapple, mnts to fit 5130-5250 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,950 Ezee-on 120 7’ w/grapple, needs some work, mnts to fit 90-94 series Case . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $2,500 Ezee-on 2105 7’ w/grapple, decent cond., mnts to fit 5130-5250 CIH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $3,250 Ezee-on 20805/905 6’ w/grapple, very decent cond, s/n 40563, mnts to fit C80,4210,4230 CIH. . . . . . . . . . . . . . . . . . . . . . . . $4,000 Versatile 2360 priced from $2,500 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Call For Details 7414 Ford.Vers. 8’ w/grapple to fit 256-9030 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,950

SOLD

Ezee on #4515 to fit 970-1175 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $750 Ezee on #3541 to fit 3690 MF. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $1,150 Ezee on #3501 to fit 1100-1130 MF. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $750 Ezee on #9519 to fit 8010-8070 AC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $595

SOLD

WHY BUY NEW? 12 Bolt 18.4 x 38 Vers 12 Bolt 24.5 x 32 Vers 12 Bolt 18.4SOLD x 38 Vers (4) inners 16 Bolt 20.8 x 38 Vers (yellow) 16 Bolt 20.8 x 38 Vers (white) 10 Bolt 18.4 x 38 Steiger 10 Bolt 20.8 x 38 Steiger

USED STARTERS Starting at $95.00! USED ALTERNATORS Starting at $50.00!

Bench Tested and 30 Day Replacement Warranty! SAVE YOUR MONEY!


Manitoba FarmLIFE, Monday, March 12, 2012

Prepare better seedbeds

for superior crop production For the many soils, crops and horticultural techniques where intensive seedbed preparation is a challenge, Kuhn offers a broad range of EL Power Tillers and HRB and HR Power Harrows. Tough, resilient construction, heavy-duty drive trains, and loads of features and options make these Kuhn soil-working implements the machines of choice for agronomists all over the world.

HR 1004 Series

s7ERE7ESTERN#ANADAS LEADINGFARMBUYERS GUIDES WITHOVER  COMBINEDDISTIBUTIONIN !LBERTA 3ASKATCHEWAN AND-ANITOBA

PAGE 31

31 models of EL Power Tillers 1.0m to 4.6m, 38" to 15' working widths

15 models of HR Power Harrows 1.2m to 6.1m, 4' to 20' working widths

Invest in Quality!

Videos at

www.KuhnNorthAmerica.com

Visit V isit y your our local local Kuhn Kuhn dealer dealer today! today! H & L Motors Glenboro

T. I. C. Parts & Service Neepawa

We offer extended coverage to all three Prairie Provinces

WWWFARMPRESSGROUPCOM

1-888-756-7770

BORDERLINE FABRICATION 24â&#x20AC;&#x2122; AND 31â&#x20AC;&#x2122; FREE STANDING PANELS 24â&#x20AC;&#x2122; pipe & rod panels ................................. starting $290 ea 24â&#x20AC;&#x2122; combo panels .... starting $425 ea 31â&#x20AC;&#x2122; all pipe panels ................. $425 ea

Clean, strong and durable. Customer satisfaction guaranteed! Delivery available

PH: Mike (204) 822-5293 www.borderlinefab.com

Van L Equipment Reston

H & L Motors Steinbach

Saskatchewan FarmLIFE 58,500, Manitoba FarmLIFE 26,500, & Alberta AgViser/AdViser 78,000

TOTAL: 163,000


PAGE 32 Manitoba FarmLIFE, Monday, March 12, 2012

Fernie Alpine Resort Mountain Stats 838cm snowfall to date 140 runs plus glades 1,082m vertical 1,013 hectares 5 alpine bowls & 10 lifts 30% 40% 30% Ski-in ski-out lodging

BEST DEALS OF THE SEASON

On Now!

Mid-Week Specials. Includes 30% off Lift Tickets! - Ski & Stay for $96! $42 per night per person. Choose from ski-in ski-out, on-mountain or in-town. Hotel, condo or townhome! - Luxury Ski-in Ski-out! 3rd Night Free at Snow Creek Lodge. - Hostel it! $29 per night per person. - Book by March 30th

Coming over for a weekend? Ski & Stay from $107!

Coming over for a week? Buy 7 nights Pay Only 5!

EXPLORE MORE OF FERNIE & BOOK TODAY 1 - 8 7 7 - 9 3 3 - 7 6 4 3 | TO U R I S M F E R N I E . C O M | FAC E B O O K . C O M / F E R N I E . CA N A DA


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 33

The 17th annual Assiniboia Spring Fever Lotto is underway!

Over 80 PRIZES worth over $250,000.00 to give away! ONLY 5,400 TICKETS WILL BE SOLD! OUR TOLL-FREE LOTTO LINE IS 1-888-BUY-FARM (1-888-289-3276) GRAND PRIZE DRAW - MAY 12, 2012 Prize Winner will have a choice of receiving: Plane Pack

OR JD Ranch Pack

2005 Maule MX-7-180C, 4 place airplane, 180 hp, Lycoming engine, GPS, autopilot.

2012 JD 7230 ComfortGard Premium Cab tractor, 2012 JD 568 round baler, 2012 JD 741 loader with grapple and bucket.

Supplied by: Maule Air of Canada, Carman, Manitoba.

Supplied by: South Country Equipment Ltd. Assiniboia, Saskatchewan

Retail Value$165,000.00

Retail Value

OR Case IH Farm Pack

$206,911.08

OR NH Ranch Pack

2012 Case IH Magnum 180 CVT tractor.

2011 T6050 PLUS Cab tractor, and 2011 New Holland L230 Skid Steer Loader.

Supplied by: Youngâ&#x20AC;&#x2122;s Equipment Inc. Assiniboia, Saskatchewan

Supplied by: E. Bourassa & Sons Ltd. Assiniboia, Saskatchewan

Retail Value

Retail Value

$194,893.65

$183,744.37

OR Fantasy Pack 2012 45th Anniversary Edition Chevrolet Camaro Convertible Supplied by: Nelson GM, Assiniboia, Saskatchewan

s7ERE7ESTERN#ANADAS LEADINGFARMBUYERS GUIDES WITHOVER  COMBINEDDISTIBUTIONIN !LBERTA 3ASKATCHEWAN AND-ANITOBA

2012 Arctic Cat Wildcat 1000 ROV Supplied by: E.Bourassa & Sons, Ltd,

3 Month World Cruise for 2 with Cunard Cruise Lines Supplied by: Assiniboia Travel,

Assiniboia, Saskatchewan

Total Value

$155,411.40!!

Assiniboia, Saskatchewan

OR $150,000.00 CASH!! 2ND PRIZE $7,000.00 Cash, OR John Deere TS 2011 Gator Utility Vehicle, Supplied by South Country Equipment, Assiniboia 3RD PRIZE $4,000.00 Cash, OR New 3D Panasonic 60â&#x20AC;? TV w/ BluRay, supplied by Harveyâ&#x20AC;&#x2122;s Home Centre, Assiniboia 4TH PRIZE $3,000.00 Cash, OR a Swisher Zero Turn Mower, supplied by Southland Co-op, Assiniboia 5TH PRIZE $2,000.00 Cash, OR a fantasy golf vacation, worth $3,400.00, supplied by Northstar Mountain Village, Kimberley, BC 6TH PRIZE $900.00 OR a BE Electric start Generator, supplied by Southland Co-op, Assiniboia 7TH PRIZE $800.00 OR a New Bosch Dishwasher, supplied by Harveyâ&#x20AC;&#x2122;s Home Center, Assiniboia 8TH PRIZE $500.00 OR EdenPURE 1000 Gen3 portable Heater, supplied by Harveyâ&#x20AC;&#x2122;s Home Centre, Assiniboia 9TH PRIZE $500.00 OR a Chelsea Anywhere Fireplace, supplied by Classique Home Improvements, Assiniboia 10TH & 11TH PRIZE $300.00 Cash OR an iRobot Roomba 440 Vacuum, supplied by Harveyâ&#x20AC;&#x2122;s Home Center, Assiniboia

40 OTHER GREAT PRIZES 7 Garmin Nuvi GPS, supplied by The Source, Assiniboia; 7 sets of Bernie Brown Dinnerware, supplied by Classique Home Improvements, Assiniboia; 3 Windscribe Wind Meters, supplied by Davis Instruments Corp.; 5 Sirius Starmate 6 Satelite Radios, supplied by The Source, Assiniboia; 2 Samsung ES65 Digital Cameras, supplied by The Source, Assiniboia; 10 King Canada Cordless Drills, supplied by Southland Co-op, Assiniboia; 2 FujiFilm Finepix Z70 Digital Cameras, supplied by The Source, Assiniboia; 3 Panasonic Cordless Phone Answering Systems, supplied by The Source, Assiniboia; 1 Sony W180 Cybershot Digital Camera, supplied by The Source, Assiniboia. Intended for SK residents.

This year we have added a 50/50 Draw to the Spring Fever Lotto. Buy 1 ticket for $10.00, 3 for $25.00 or 10 for $50.00! 1/2 Proceeds go to the Winner! ONLY 56,000 TICKETS SOLD

PREVIOUS BUYERS DRAW FEBRUARY 25, 2012

Lottery Lic No. LR11-0066

& EARLY BIRD DRAW APRIL 7, 2012

Choose $5,000.00 Cash, OR a 7 day Alaskan Cruise for 2 valued at $5,600.00 and Supplied by Assiniboia Travel

Proceeds for Olympia Theatre, playgrounds and skating arena, Assiniboia, Sask. THANK YOU SO MUCH Lottery Lic No. LR11-0065

Assiniboia Civic Improvement Association â&#x20AC;˘ email: buy@springfeverlotto.com

Visit our website for more details: www.springfeverlotto.com

or http://lotto.sasktelwebhosting.com/springfever/index.php

WWWFARMPRESSGROUPCOM

1-888-756-7770

Draws Held At Mountain & Mountain Law Office

Make cheques payable to: Spring Fever Lotto, Box 1351 Assiniboia, SK, S0H 0B0 Name: __________________________________________ Phone #: ______________ Address: ________________________________________ Postal Code: ___________ Visa/MC/AM Express # _____________________________ Expiry Date: ___________ Email:_____________________________ No of tickets: 1 for $100 ___ 3 for $250 50/50 Tickets: 1 for $10.00__ 3 for $25.00__ 10 for $50.00__ Total $ =_______Send Brochure Next year YES Tickets $100ea. or 3 for $250


PAGE 34 Manitoba FarmLIFE, Monday, March 12, 2012

Check out fall programming on Morris Equipment!

How To Make Your Equipment Disappear...

AIR DRILLS - AIR SEEDERS Morris 9000 (25’) w/valley packers & 7130 Tank.$21,900 ‘02 Morris Max II Air Drill (49’) 12” DS w/7240...$84,000 Morris Maxim (40’) 7.5 spacing...........................$23,500 ‘97 Morris Max (34’) 10” D.S. ..............................$22,500 John Deere 610 29ft w/harrows, 777 tank ...........$28,900 AIR TANKS ‘94 Morris 6240 Air Seeder, excellent ................$20,000 ‘93 Morris 6180 Engine Drive ................................$8,900 SWATHERS & HEADERS ‘05 Westward 9352i w/30’ 963 PUR....................$83,500 ‘05 Westward 9352i w/30’ 963, 600 hrs ..............$79,500 ‘02 Westward 9250 1750 hrs, w/’04 972 (30’) ..... $58,900 ‘03 Premier 2940 w/30’ 962 hrs 1150 hrs ............ $57,500 ‘08 Case 1203 w/36’ Honeybee & 18’ auger hdr $109,000 ‘97 MF 220 (30’) PUR 1500 hrs............................$28,500 ‘97 Massey 220 w/30’ 1600 hrs ...........................$24,500 Westward 3000 25’, pull type, PU reel ..................$6,900 BALE PROCESSORS Bale King 2020 w/grain tank..................................$8,900 TRACTORS Kubota M8950DT loader, cab, 7000 hrs..............$25,900 ‘06 Kubota M125XDTC w/loader grapple 3800 hrs...............................................................$62,500 ‘08 Kubota B2320HST w/loader 65 hours ...........$13,900 Kubota BX2350 w/mower/tiller ............................$10,900

1985 IHC 5488 w/duals .................................. Consigned MOWER CONDITIONERS Hesston 1150 (12’) ................................................$3,900 Hesston 1170 (16’) ................................................$6,900 New Holland 116 (16’) ...........................................$3,900 MISCELLANEOUS ‘02 Rem 2100 grain vac ........................................ $9,350 Morris Wrangler III wing up packer bar................. $4,900 ‘08 Rem Grain Bagger, done 15 bags ................ $16,500 ‘06 Kawaski 3010 Mule trans 950 hrs ...................$6,300 Schulte Rotary Cutter.........................................$16,900 Schulte SD 110” Front Blower............................. $7,900 Rockamatic Stone Picker.....................................$2,900 Ezee-on loader with bucket .................................$3,900 Schulte RS320 Conveyor Picker .......................$11,900 Schulte XH1500 w/hitch ......................................$24,500 New 4” Rubber Packers for Maxim Air Drill ........ CALL ‘09 REM 2700 Vac ...............................................$18,900 Verns Swath Roller ..................................................$900 AUGERS ‘08 Farm King 16x104 Auger .............................$29,500 ‘08 Farm King 13x70 Swing Auger ......................$9,900 Sakundiak 7x1200 w/engine .................................$2,750 Brandt 8x47 w/mover/engine.................................$5,900 (All Current Listings are Cash Prices)

(204) 748-2408 UÊ6, ]Ê /"  “Quality Products, Quality People...Here For Your Farm Equipment Needs!”

After Hour Sales Call: Trevis Hunter 204-748-7437 David Draper 204-748-5528

Simply advertise in Manitoba FarmLIFE and get results quickly!

CALL

Farmlife helps you cut through the clutter and find the perfect equipment for your farm.

1.888.756.7770 or 204.727.5459 or email farmlife@mts.net

1.888.756.7770 Ph: 204.727.5459 | Fx: 204.726.5999 farmlife@mts.net


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 35

Best Western Plus Pembina Inn & Suites

NOW Available in Newsprint AND on our Website!

& s.ONSMOKING s0ET&RIENDLY s0OOL HOTTUBAND7ATERSLIDE s&REEHOTBREAKFAST s&REEINTERNET s&REEPARKING

Another way to reach your target audience without any extra cost to you! When you place an advertisement in our Manitoba FarmLIFE, Saskatchewan FarmLIFE, Ad-Viser and/or Ag-Viser newspapers, your advertisement is uploaded to our new site www.farmpressltd.com For more information call Manitoba FarmLIFE at 1-888-756-7770

Best Western Plus Pembina Inn & Suites

www.farmpressltd.com

0EMBINA(WY 7INNIPEG -B #ALL  OR4OLL&REE   

HORSCH ANDERSON Farming with passion

the JOKER Corn, wheat, bean or cover crop, the Horsch Anderson Joker is versatile enough to handle any type of crop residue in wet, dry, rocky or extremely saturated soils. No other tillage system gives you the speed, durability, moisture conservation and finishing capabilities of the Horsch Anderson Joker. With the Joker, you donâ&#x20AC;&#x2122;t have to sacrifice speed to finely chop and incorporate residue back into your field. It is specifically designed to perform at higher speeds in order to give you the most efficient, time-saving tillage experience. From the frame to the tires, the discs to the finishing system, the team at Horsch Anderson analyzed every aspect of the design to find ways to improve performance and increase your productivity. The result is the fastest, most efficient minimum tillage system on the market. The Joker can till fields in half the time or faster. Just a few miles per hour faster increases the productivity per acre. In our field tests, the Joker was able to perform at speeds up to 12 mph. Thatâ&#x20AC;&#x2122;s more than twice as fast as traditional tiller systems. Think about how much more you could accomplish with the fast, efficient and flexible Joker. The Joker compact disc may not look like every other tiller system, but then again, no other minimum tillage system handles quite like the Joker. Whether itâ&#x20AC;&#x2122;s the MT, RT or PT series, the Joker has the versatility to become an integral part or your farming operations.

Milliken Farm

Supplies (1977) Ltd.

YOUR

HORSCH ANDERSON DEALER FOR ALBERTA

Taber, AB

403-223-4437

Toll Free 1-888-313-9988 Email us at sales@millikenfarm.com


PAGE 36 Manitoba FarmLIFE, Monday, March 12, 2012

Expect yields twice this on normal year!

67

65

60

WHEAT CITY SEEDS

BRANDON

727 3337

NOTHING RUNS, WORKS, OR OUTPERFORMS LIKE A ROGATOR. NOTHING. In some ways it’s not even fair. RoGator’s been dominating the professional-grade sprayer category for years. And then we go and build the 2012s. Just look at them. A redesigned cab for enhanced comfort, greater visibility and reduced noise levels of up to 10 decibels. And underneath that sleek exterior, our proven drive package has been joined by an AGCO Power 8.4-liter diesel engine with more horsepower than ever. Add it all up and you’ve got the best RoGator to ever roll off the line. And that’s saying something. No matter what color you’re running now, do yourself a favor and test drive a new RoGator at a dealer near you.

Used Combines

WE NEED COMBINE TRADES!!!

2009 MF 9895 $269,000 Chopper, chaff spreader, lateral tilt, autolube, swathmaster 2008 Challenger 680B CALL Chopper, chaff spreader, lateral tilt, swathmaster, warranty 2006 Case IH 8010 $199,000 Duals, chopper, lateral tilt, 2014 swathmaster 2004 MF 9790 $149,000 Chopper, chaff spreader, swathmaster, 1638 hrs 2003 MF 9790 $149,000 Chopper, chaff spreader, Swathmaster, 1262 hrs $77,500 1999 Case IH 2388

2005 MF 8000 30’ pur, stainless feather sheets, poly, mint 1991 MacDon 960 25’, pur 1995 Case IH 1020 30’, flex, pur 2010 MacDon FD70 35”, flex draper, pur, CIH adapter, loaded

Used Tractors

WE NEED TRACTOR TRADES!!!

Chopper, spreaders, swathmaster

2006 Case IH MXM130 Pro

0% financing available

2006 Case IH MXM140 Pro

Used Combine Heads 2008 Challenger FHB35 Call 35’ flex header, pur, stainless feather sheets, poly, warranty 2005 MF 8000 $25,900 30’ pur, stainless feather sheets, poly

FWA AND

$10,000 $11,900 $63,900

Whitewood, SK

2012 Rogator RG1300 370 hp, 1300 gal, 120’ boom, loaded 2012 Rogator RG1100 337 hp, 1100 gal, 100’ boom, loaded 2012 Rogator RG900 305 hp, 900 gal, 100’ boom 2012 Spray-Coupe 7660 90’ boom, 2wd & fwa

2 COMING

$51,000

0% for 3 years

SOLD!

Used Seeding & Tillage

$28,000

2003 Morris Maxim II $69,000 55’, 10” spacing, 3 1/2” packers atom jet openers, liquid and alpine kits, 7300 TBH, loading auger nice 2012 Seed Hawk CALL Various sizes available

fwa, blade fwa, loader/ grapple

COMING

2006 Challenger SP115C $79,900 115 hp,2 speed, deluxe cab, 36’ pu reel, gauge wheels

fwa, 3495 hrs

1998 MF 4255

2 COMING

SOLD!

fwa, loader/grapple, 3062 hrs

1990 Case IH 7110

Used Hay Tools 2 COMING

Used Swathers

4WD!!!

We hear you.

WSW

Sprayers

$27,900

!

FOLLOW US

ON FACEBOOK & TWITTER! www.whitesag.com

@WHITES_AG

1999 Hesston 565A 5x6, auto tie 2006 Hesston 956A 5X6, autocycle, 9000 bales 2004 MacDon 5020 16’, s/s, 1000 rpm

$14,900 $17,900 $14,900

Used Miscellaneous 2007 Brandt 1390 HP SOLD! 13”x90’ hydraulic hopper & swing, reverser full bin sensor, like new 2006 Spray Air 4370 $13,500 13” x 70’ swing auger, winch Farm King 1050 $4,800 10” x 50’ swing auger 2011 Farm King 1385 Blow Out!!! 13”x85’ swing auger, various config’s Degelman $8,000 12’ dozer blade, 4 way, mounts to fit JD 2011 EZ Trail 860 UNDER 30K!!! 860 BU grain cart, 14’ auger, tarp Valley Packing Systems $19,900 2700 gal, tow between liquid caddy 2003 Freightliner Columbia Class $25,000 460 Hp, full autoshift, day cab, fresh safety Fontaine $15,000 45’ step deck, fresh safety

After Hours Call

DON JOHNSON (306) 736-7295 DENNIS EDWARDS (306) 696-7773 BLAIR ADAMS (306) 735-7232 CURTIS LANGFORD (306)-735-7662

306-735-2300


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 37

Mazergroup, a major retailer of New Holland Agricultural and Construction products, is currently accepting applications at our Arborg location for a

TRUCK DRIVER >V…ˆ˜iÊ-̜À>}iÊUʘÃՏ>Ìi`Ê-…œ«ÃÊ UÊ"ˆwi`Ê Õˆ`ˆ˜}ÃÊUÊ œ““iÀVˆ>Ê Ո`ˆ˜}ÃÊ Uʘ`ÕÃÌÀˆ>Ê Ո`ˆ˜}ÃÊUÊ7>Ã…Ê >ÞÃÊ UÊ-̜À>}iÊ Õˆ`ˆ˜}ÃÊUÊ7i`ˆ˜}Ê-…œ«ÃÊUÊ7>Ài…œÕÃiÃÊ UÊ,ˆ`ˆ˜}ÊÀi˜>ÃÊUÊVÀi>}iÊ Õˆ`ˆ˜}ÃÊ UÊ µÕˆ«“i˜ÌÊ i>iÀň«ÃÊUÊ>ÞÊ-…iÌiÀÃÊ UÊ >Ì̏iÊ-…iÌiÀÃÉ >Ûˆ˜}Ê >À˜ÃÊ UʈÀ«>˜iÊ>˜}>ÀÃÊUÊ"vwViÉ,iÌ>ˆÊ Ո`ˆ˜}Ã

The successful candidate must be a team player, self-motivated and organized. A current Class 1 driver’s license with Air endorsement along with a clean driver’s abstract is required. Reporting to the Service Manager, the Truck Driver is tasked with the delivery of major Agricultural Equipment and assisting in the delivery of superior customer service as part of a very diverse, fast-paced dealership environment. Mazergroup offers competitive salaries and a very comprehensive benefits package, including health, dental and vision coverage, as well as an excellent Group RRSP contribution plan.

Commercial Buildings

If you are interested in joining our Team; we invite you to forward your resume to: Contact: Jennifer Berry Fax: (204) 376-2455 Email: jennifer.berry@mazergroup.ca

Industrial Buildings

Mazergroup is an equal-opportunity employer. We thank all who apply, however only successful candidates will be contacted for an interview. Dedicated to improving customer productivity with innovative solutions, Mazergroup has 13 locations in Manitoba and S/E Saskatchewan.

www.goodon.com

1.800.665.0470

Oilfield Buildings

. . . and much more

Manitoba Sales: Ed Dyck

We stock Michel’s Tarps, Electric or Manual, Remote Tail Gate Openers & Hoist Controls. We install 90,000 lb air pintel hitches ‘06 International 9200

19’ box, 400hp, ISX cummins, 10spd, auto shift w/clutch $

59,500

‘95 Mack

‘06 IH 9200I

‘06 International 9200

20’ box, 400hp, ISX cummins, 10spd, auto shift w/clutch $

Sold

20’ box, pop hitch, 400hp, ISX cummins, 10spd, auto shift w/clutch $

60,500

‘04 Century Freightliner

‘06 IH 9200

61,500

‘01 Freightliner 80

10spd, auto shift, elect tarp hoist & tail gate opener, pop hitch, chrome wheel, discs, new recaps, 20’ box, 400 hp cummins, new ual exhaust Reg. $71,000

65,500

$

Just Arrived!

350 Mack, 10 spd

$

515 hp, detroit, 12 spd, ultra shift

$

42,000

‘04 Freightliner Classic

59,500

‘01 Freightliner FL80

3126 Cat engine, 240-270hp, 9spd, a/c, 14000 frts c/w new 20/21’ box & hoist Only 2 Available

$

‘97 Volvo

48,000

‘01 Mack

60 series detroit 370 hp, 10 spd, new 20’ box, power hoist

$ 435 Mercedes w/10 spd, autoshift, will have 20’ box

$

55,000

300 hp, Cummins, 9 spd trans, 16,000 fronts

39,000

13 spd, CX613, 350 Mack, c/w 20’ box

For more trucks visit

49,000

$

$

52,000

www.lbgraintrucks.com

L & B Friesen RR4 Brandon, MB | Leonard Friesen (204) 824-2172 | Larry Duchek Cell (204) 720-0876


PAGE 38 Manitoba FarmLIFE, Monday, March 12, 2012

USED COMBINES/HEADERS 2 - 2008 NH CR9060 750 hrs., deluxe chopper . . . . . . . . . . . . . . $199,000 2008 Case IH 8010 650T hrs., chopper, pickup table, y/m. . . . . . . $239,000 2 - 2010 Case IH 8120 350 hrs, Luxury cab, fine cut chopper, rock trap, Pro 600 w/ auto steer, long auger . . . . . . . . . . . . . . . . . . $315,000 2 - 2007 NH CX8080 1050 hrs.. . . . . . . . . . . . . . . . . . . . . . ea. $225,000 MacDon 873 adapter for JD 9600 to MacDon 972, 973, 962 . . . . . . . $9,500 2007 NH CR9070 1100 hrs . . . . . . . . . . . . . . . . . . . . . . . . . . . . $199,000 2 - 1997 30’ Honeybee headers for 2388 combines, bat reels . . . . . . $15,500 30’ MacDon D60 c/w CNH Adapter. . . . . . . . . . . . . . . . . . . . . . . Coming In 35’ MacDon D60 c/w CNH Adapter. . . . . . . . . . . . . . . . . . . . . . . Coming In

USED FORAGE/HAYING

2006 NH FX60 harvester, 850 CH hrs., field ready . . . . . . . . . . . . . $165,000 2003 NH FX60 sp harvester, 2836 ch hrs . . . . . . . . . . . . . . . . . . . . $84,500 RS510T Vicon tedder. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $4,000 3800 Vicon disc mower conditioner, 13' cut, 2 pt . . . . . . . . . . . . . . . $9,500 NH 688 round baler, twine bale command . . . . . . . . . . . . . . . . . . . . . $9,900 NH 688 round baler, twine bale command. . . . . . . . . . . . . . . . . . . . $12,000 2007 NH BR780A net wrap . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $24,500 2007 NH 1431 discbine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $22,500 NH HW300 12’ header. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $35,000 NH 660 round baler . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $5,500 NH 1069 bale wagon, gas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $34,500

SOLD

USED SEED & TILLAGE Flexi-coil 39’ 5000 Air Drill 9” spacing, 2340 tow behind air cart. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $69,000 Flexi-coil 2320 Air Cart tow behind . . . . . . . . . . . . . . . . . . . . . . . $18,500

SOLD

USED SWATHERS

1999 MacDon 802 TV140 header adapter . . . . . . . . . . . . . . . . . . . $4,000 2005 MacDon 9352i c/w 30’ 972 header, 1200 hrs . . . . . . . . . . $69,000 MacDon M200 c/w 16’ disk head & 30’ D60, Outback auto steer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $155,000 MacDon M150 c/w 25’ D60 D/K D/S . . . . . . . . . . . . . . . . . . . . Coming In 2004 MacDon 9352i c/w 25’ header. . . . . . . . . . . . . . . . . . . . . Coming In

USED TRACTORS

2006 NH TG210 4500 hrs.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $89,500 2003 NH TM155 4795 hrs, suspension, 72LB loader/gpl, 3 pt . . . . $65,000

USED SPRAYERS

SOLD

Flexi-Coil SF115 susp. boom, 90' . . . . . . . . . . . . . . . . . . . . . . . . . . $27,500 Brandt QF1000 120' . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $7,800

FM 750 EZ-STEER

$6,200

Reg. $6,892 - Now While Supplies Last

(Mounting bracket not included)

JOHN BEYER

• Cell: (403) 380-0488 • Res.: (403) 345-3275

Miller Condor G75 Sprayer 1200 gal. poly tank, 120’ boom, CLEARANCE PRICE. . . . . . . . . . . . . . . . . NEW . . . . . . Call for Details

MISCELLANEOUS Bale King Vortex 3000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $9,000 20' Gooseneck Trailer 7000 lb. tandem axles . . . . . . . . . . . . . . . . . $4,000 Hi Line 6800 Bale Processor. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6,500 NH MC28 Commercial Mower . . . . . . . . . . . . . . . . . . . . . . . . . . . . $16,900 Snapper Turf Cruiser Side By Side ATV . . . . . . . . . . . . . . . . . . . . . . $6,900

GENO KORNELSON

• Cell (403) 382-5028 • Res.: (403) 320-7309


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE 39

IN YARD

LD O SCIH 485STX 2010, 650 hrs.

$225,000

LD

SFCO System 95

40 ft. Harrow Packer Bar.

$7,500

NH CR940 1500 hrs, dlx chopper, 76C pickup header.

$125,000

2 - CR9065 COMBINES Wishek 842 Disc

$42,000

LD

NH T8020 2010, 3 pt, 1400 hrs, 870 FEL.

$139,000

2010 MODELS WITH ONLY 250 HOURS

SO

CIH STX375 Quad

S JD 2950

3000 hrs, 3 pt hitch, 260 FEL

Call For Price

$32,000

$139,000

3800 hours.

40 ft.

$44,000

BLOWOUT PRICE

$79,000

Harsch Anderson Joker

FC System 65XL

2011, 25 ft.

130 ft.

$59,000

$14,900

$15,000

NH H8080 w/18 ft. disc header, 500 hrs.

57', 2002, 12", 4 1/2 steel, c/w 2003 3450 variable rate cart

$92,000

50 ft.

2003, 3900 hrs., with Degelman blade.

Great Plains Turbo Till

Flexi-Coil 5000

Landroller

5 Shank

CIH 1680

Allied Grapple, Joystick, 6,900 hrs.

$23,900

NH ST650

D L O

JD 4240

$7,500

CIH 8820 2500 hrs, 25 ft.

$29,000

USED EQUIPMENT

Manitou telehandler - 1400 hrs, c/w bucket, big square bale fork, pallet fork. 50â&#x20AC;&#x2122; Land Roller Due to a major increase in sales, we are looking for the following qualified personnel: 1 - SALESMAN; 1 - PARTSMAN 1 - MECHANIC Please phone for further information and to book an interview.


PAGE 40 Manitoba FarmLIFE, Monday, March 12, 2012

2011 GMC Canyon *2 to choose from (11035)

Starting at: MSRP $29,295 Finance $18,648

2011 Chev Camaro 2SS

2011 Chevrolet Colorado LT Crew

*2 to choose from Stk 11100

Stk 11164

2011 Chevrolet 2500HD Ext 4X4 Duramax *4 to choose from Stk 11243

Starting at: MSRP $50,000 $40,368 Finance $41,368

MSRP $33,460 $22,158 Finance $22,158

Starting at: MSRP $62,785 $46,689 Finance $46,689

2011 Chevrolet Cruze

2011 Chevrolet Tahoe LT 4X4

2011 Chevrolet Traverse LT

*2 to choose from Stk 11350

loaded Stk 11545

AWD 7 passenger Stk 11558

MSRP $68,760 $49,989 Finance $50,089

MSRP $49,370 $37,658 Finance $37,658

2011 GMC 3500HD SLT Crew Dually Duramax

2011 GMC 2500HD SLE Ext 4X4 Duramax

Stk 11654

stk 11559

MSRP $71,535 $ 58,588 Finance $55,688

MSRP $68,110 $52,878 Finance $52,878

Starting at: MSRP $17,995 $14,809 Finance $14,809

2011 Buick Regal CXL *5 to choose from Stk #11010

Starting at: MSRP $34,935 $24,953 Finance $24,953

2011 Chevrolet Malibu LT *2 to choose from Stk 11433

Starting at: MSRP $29,020 Finance $20,854

2011 Buick Lacrosse to choosefrom from Stk 3 to*4choose stk11075 11549

Starting at: MSRP $37,555 $27,585 Finance $26,453

2011 Chevrolet Impala *8 from Stkfrom 11060 5 totochoose choose

Starting at: MSRP $29,915 $21,766 Finance $21,766

Recycle your 2005 model year or older vehicle and receive up to $3,000 † in additional cash incentives. Model Dependant

Mainline Motors EXCHANGE POLICY

INSPECTION

Industry leading 30 days

150+ points coverage

MANUFACTURER’S WARRANTY 3 months/5000km

Hwy #1, Virden, MB VIRDEN: (204) 748-3811 or 1-866-770-3811 BIRTLE: (204) 842-3301

www.VirdenMainline.com ROADSIDE ASSISTANCE 24-hour around the clock


Manitoba FarmLIFE, Monday, March 12, 2012

FRASER AUCTION LTD. 2012 Spring Auction Guide

PAGE B1


PAGE B2 Manitoba FarmLIFE, Monday, March 12, 2012

UNRESERVED AUCTION FOR TOM & JEAN RYALL of RIVERS, MB

WEDNESDAY APRIL 4th 12:00 noon

DIRECTIONS: FROM RIVERS, MB. Jct of hwys #25 & #250 West on hwy #250 to Jct of #259 (At old air force base) Take hwy #259 west 10kms (to St. Mathews Cemetery) Turn south 1km to sale site on east side of road. FROM KENTON, MB. Jct of hwys #21 & #259 Take hwy #259 east 14.5kms (to St. Mathews Cemetery) Turn south 1km to sale site on east side of road. ORDER OF SALE:Ê This sale has little to no small items to sell, so please don’t be late Sale starts at 12 noon sharp.

TRACTORS: UÊ£™™ÇÊ ʙÎääÊ{7 ÊÎÈ䅫ÊÌÀ>V̜ÀÊ ÜÉÓä°n,{ÓÊ Õ>Ã]ʈɜÜÊ+Õ>`Ê/À>˜Ã°]Ê{Ê ,i“œÌiÊÞ`°]Ê,iÌÕÀ˜Êˆ˜i]ÊÎxn£…ÀÃÊŜ܈˜}]Ê Ãɘää£Î™™ UÊÓäääÊÕLœÌ>ʇ£ÓäÊ7 Ê£Ó䅫ÊÌÀ>V̜ÀÊ ÜÉәÈäÊ+ՈVŽˆiÊ-Êœ>`iÀ]Ê ÕVŽiÌ]ÊÀ>««i]Ê Î«Ì]Ê Õ>Ê*/"]Ê*ˆVŽÊ1«ÊˆÌV…]ÊÓÊ,i“œÌiÊÞ`]Ê £ÈÊ-«`Ê*œÜiÀÊ-…ˆvÌÊÜÉ-…ÕÌ̏i]Ê£n°{‡ÎnÊ-ˆ˜}iÃ]Ê ÓÇää…ÀÃÊŜ܈˜}]ÊÃɘxäx™£ COMBINES: UÊÓääÈÊ ʙÇÈäÊ-/-ÊëÊVœ“Lˆ˜iÊÎ{䅫ÊÜÉ ÕiÌÊ,œÌœÀ]ÊŜ܈˜}ÊǙxÊ̅Àiň˜}ʅÀÃ]Ê£äÈxÊ i˜}ʅÀÃ]ÊÈ£x*Ê«ˆVŽ‡Õ«Ê…i>`]ÊÃÌ`ʓœ˜ˆÌœÀÊ«>VŽ‡ >}i]ÊÃɘä™ÇÈä-Ç£ÈÓx{ UÊÓä£äÊÎä½Ê ÊÈÎä ÊÞ`À>ʏœ>ÌÊÃÌÀ>ˆ}…ÌÊVÕÌÊ …i>`iÀÊÜÉ«ˆVŽ‡Õ«ÊÀii] ÊÃɘ£ääÈÎä äÇÎxÈÈx Uʏi݇vˆ˜}iÀʈvÌiÀÃÊvœÀÊÎä½Êi>`iÀ UÊ£™™ÇÊ iÜÊœ>˜`Ê/8ÈÈÊÜÉ ˜}ˆ˜iÊœÕÀÃÊ Ón™È]Ê/…À>ň˜}ÊœÕÀÃÊÓ{äÈ]Ê£{vÌÊ-Ü>Ì…Ê >ÃÌiÀÊ*ˆVŽÕ«Êi>`iÀʘiÜÊ*ˆVŽÊÕ«Ê iÌÃ]Ê …>vvÊ -«Ài>`iÀ]ʏÊÕ«`>ÌiÃ]ÊÃɘnÓÓxäÇ£ SEED & TILLAGE EQUIPMENT: UÊ{x½Ê-ii`Ê>ÃÌiÀÊ>ˆÀÊ`ÀˆÊÜÉÊ-ii`Ê>ÃÌiÀÊ ÓnäÊ ÕÃÊ}À>ˆ˜ÊÌ>˜Ž]ÊÓnäÊ ÕÃÊviÀÌÊÌ>˜Ž]Ê£ä»Ê ë>Vˆ˜}]ÊÎÊÀœÜÊÅ>˜ŽÃ]Ê`LÊŜœÌ]Ê>`ÕÃÌ>LiÊ …Þ`ÊÌÀˆ«Ã]Ê`ˆÃŽÊ“>ÀŽiÀÃ]ÊÎÊÃiÌÃʜvʓiÌiÀˆ˜}Ê ÀœÃ]ÊÃɘ-xäÇÓ UÊÇä½Ê i}i“>˜ÊÇäääÊ-ÌÀ>ÜÊ>ÃÌiÀʅi>ÛÞÊ …>ÀÀœÜÃÊÜÉxÉn»Ê̈˜iÃ]ÊÃɘ{£ÇÇ AUGERS: UÊÓää™ÊÈä½ÊÝÊ£ä»Ê À>˜`ÌÊ*/"ÊÃ܈˜}ʅœ««iÀÊ >Õ}iÀÊÜÉÀiÛiÀÃiÀ]ÊÃɘ™ääә UÊÓää£ÊÈä½ÊÝÊ£ä»Ê À>˜`ÌÊ*/"ÊÃ܈˜}ʅœ««iÀÊ >Õ}iÀÊÜÉÀiÛiÀÃiÀ]ÊÃɘȣ{ÇÇ UÊx£½Ýn»Ê7iÃÌvˆi`Ê*/"Ê>Õ}iÀ

UÊÎx½ÊÝÊn»Ê->ŽÕ˜`ˆ>ŽÊÕ}iÀÊÜÉ-ivÊ*Àœ«iÊˆÌ]Ê Óä*ʈ˜>“>ÀÊi˜}ˆ˜i UÊ ˆ˜ÊՏÊ-i˜ÃœÀÊvœÀÊÕ}iÀ

UÊ£ää}>ÊΈ`ÊÌ>˜Ž UÊӻʜ˜`>ÊÜ>ÌiÀʫՓ« UÊλÊ}>ÃÊÜ>ÌiÀʫՓ«

SPRAYER: UÊ£™™™Ê Ê{Çääʈ}…Ê i>À>˜ViÊ-«À>ÞiÀÊ £n䅫ÊÜəä½Lœœ“Ã]ÊÌÀˆ«iʘœââiʅœ`iÀÃ]Ê Ã…œÜˆ˜}Ê£™än…ÀÃ]ÊÈÓäÉÇx,ÓÈÊ̈ÀiÃÊEÊÀˆ“ÃÊ «ÕÃÊ£Ó°{‡ÎnÊ̈ÀiÃÊEÊÀˆ“Ã]Ê Ê}Ո`>˜ViÊÃÞÃÌi“]Ê œÀ>VÊLœœ“Ê…iˆ}…ÌÊVœ˜ÌÀœÃ]ÊÀˆ˜ÃiÊÌ>˜Ž]ÊV…i“ˆ‡ V>Êˆ˜`ÕV̜À]ʅ>˜`ÊÜ>ÅÊÌ>˜Ž]Ê{ÊÃiÌÃʜvʘœââi]Ê Ãɘä{ÇääÈää{äÓÓ

ATV & YARD EQUIPMENT: UÊÓää{Ê>Ü>Ã>ŽˆÊ >ޜÕÊÓxäʵÕ>` UÊ 7Ê£ÓÊ6œÌÊ iVÌÀˆVÊ7ˆ˜V…ÊvœÀÊ/6 UÊÕLœÌ>Ê/£{Èäʏ>ܘÊÌÀ>V̜À UÊ>ܘÊÃÜii«

TRUCK: UÊ£™™{Ê6œÛœÊ/ÉÊ}À>ˆ˜ÊÌÀÕVŽÊÜÉÓä½Ê ³]ÊÀœÊ Ì>À«]Ê6œÛœÊÎÇä«Êi˜}ˆ˜i]Ê£äÊë`ÊÌÀ>˜Ã]Ê Ãɘ{6£ x,,nÎäÇÓx]Ê->v̈i`]Ê iÜÊLÀ>Žià TRAILERS: UʣȽÊÝÊn½Ê`Õ>Ê܅iiÊ-ÉÊ}À>ˆ˜ÊÜ>}œ˜Ê ÜɅœˆÃÌ UÊI ÊÌÀ>ˆiÀÊ>ݏiÊÜÉ`Õ>Ê܅iiÃ UÊ{½ÊÝÊn½Ê1̈ˆÌÞÊÜ>}œ˜ 3 PT EQUIPMENT: UÊ£ää»ÊœÜ>À`Ê-£ääÊΫÌÊÀœÌœÊ̈iÀ]Ê ÃɘÇÈäΣÎ{ UÊ >ÀÊ7œvÊΫÌÊ«œÌ>̜Ê`ˆ}}iÀ UÊ£ä½ÊΫÌÊÇ̈˜iÊVՏ̰ UÊ£ä½ÊΫÌÊÞ>À`ÊÃVÀ>«iÀ UÊÓää™ÊǽÊ7œœ`ÃÊ n{ä8ÊΫÌÊÀœÌ>ÀÞʓœÜiÀ]Ê Ãɘ££ÓÈääÇ OTHER FARM EQUIPMENT: UÊ ˆiÃiÊ*ÀœÊ«œÜiÀÊV…ˆ«Ê­V>“iʜÕÌʜvÊ ʙÈxäÊ Vœ“Lˆ˜i® UÊÊ >“ÊÃÞÃÌi“ÊÜɣʓœ˜ˆÌœÀ]Ê{ÊV>“iÀ>à UÊ/Àˆ“LiÊÕ̜Ê-ÌiiÀÊ1˜ˆÌ UÊ£Ó½Ê i}i“>˜Ê£Ó ÊvÀœ˜ÌʓœÕ˜ÌÊL>`iÊ ÜɓiV…>˜ˆV>Ê>˜}i]ÊÃɘ£ÇÈÎx UÊ-iÌʜvÊVÀœ«Ê`ˆÛˆ`iÀÃÊvœÀÊëÀ>ÞiÀ UÊ >iÊvœÀŽ

SHOP EQUIPMENT: Uʘ}iÀ܏‡,>˜`Ê`ÏÊ>ˆÀÊVœ“«ÀiÃÜÀ UÊiÌÊÓäääÊ«ÀiÃÃÕÀiÊÜ>ÅiÀÊÜÉx*Êœ˜`> UÊ/>˜>Ž>Ê- ÊÓÓ£Ê}i˜iÀ>̜À MISC: UÊ1Ãi`Ê̈Àià UÊ*/"ÊÅ>vÌà UʈÀÊÃii`iÀʅœÃi UÊ-iiV̈œ˜ÊœvÊv>À“ÊV…i“ˆV>Ã UÊ*œÕÌÀÞÊÜ>ÌiÀÃÊEÊvii`iÀà UÊÓx®Êi“«ÌÞÊ«>Ã̈VÊV…i“ˆV>Ê`ÀՓà UÊ1Ãi`Ê`ˆ“i˜Ãˆœ˜>ÊÕ“LiÀ UÊ1Ãi`Ê}À>`iÀÊL>`ià UÊ-ÌiiÊVÕ̇œvvà UÊ,>ˆÊ̈ià UÊ1Ãi`ÊÌÀi>Ìi`Êvi˜ViÊ«œÃÌÃÊ>««ÀœÝÊÓää UÊ««ÀœÝÊÈääÊi˜ViÊ*œÃÌÃ]ÊL՘`iÃʜvÊxä½Ã UÊ««ÀœÝÊ{äÊ,>ˆÜ>ÞÊ/ˆià UÊÈ»ÊÝÊÓ»Ê>˜`Ên»ÊÝÊÓ»Ê,œÕ}…Ê->Ü˜Ê œ>À`à UÊ1Ãi`Ê-Ìii UÊ1Ãi`Ê,œœvÊ-…iï˜}]Ê6>ÀˆœÕÃÊi˜}̅à UÊ1Ãi`Ê i`>ÀÊ-ˆ`ˆ˜} UÊ 7Ê£ÓÊ6œÌÊÕiÊ*Փ« UÊÎääÊ>ÊÕiÊ/>˜Ž

FOR MORE INFO CONTACT OWNER

/"ʜÀÊ  Ê,9Ê Óä{‡ÎÓn‡Çx{Èʅœ“i Óä{‡ÇÓ{‡{ÈΙÊVi

AUCTIONEERS NOTES:Ê/…iÊ,Þ>½ÃÊ܈ÅÊ̜ʜvviÀÊÌiÀ“Ãʜ˜Ê̅iÊ ÊVœ“Lˆ˜iÊEʅi>`iÀ°Êʘœ˜ÊÀiv՘`>LiÊ `i«œÃˆÌʜvÊÓx¯Ê`œÜ˜ÊÃ>iÊ`>ÞÊ܈̅ÊL>>˜ViÊ`Õiʜ˜ÊœÀÊLivœÀiÊÕ}ÕÃÌÊ£]ÊÓä£Ó°Ê1˜ˆÌÃÊÃÌ>Þʈ˜Ê«œÃÃiÃȜ˜ÊœvÊ,Þ>Ê>À“Ê Ì`°Ê՘̈Ê«>ޓi˜ÌʈÃʓ>`iʈ˜ÊvՏÊۈ>ÊL>˜ŽÊ`À>vÌʜÀÊViÀ̈vˆi`ÊV…iµÕiÊ̜Ê,Þ>Ê>À“ÊÌ`°ÊvÊvՏÊ«>ޓi˜ÌʘœÌÊÀiViˆÛi`ÊLÞÊ Õ}ÕÃÌÊ£ÃÌ]ÊÓä£ÓÊLÕÞiÀÊvœÀviˆÌÃÊ`œÜ˜Ê«>ޓi˜ÌÃ]Ê>˜`Ê,Þ>Ê>À“ÊÌ`ÊÀiÌ>ˆ˜ÃʜܘiÀň«°Ê/…ˆÃʈÃÊ>ÊÛiÀÞÊ}œœ`Êi>ÀÞÊëÀˆ˜}Ê Ã>iʜvÊÜiÊŽi«Ìʏ>Ìiʓœ`iÊv>À“ÊiµÕˆ«“i˜Ì°ÊœÃÌʜvÊ̅iÊiµÕˆ«“i˜ÌʈÃÊÅi``i`Ê>˜`ʈÃÊ>Êˆ˜ÊÛiÀÞÊ}œœ`ÊVœ˜`ˆÌˆœ˜°Ê>ÀŽÊ ̅ˆÃÊ`>ÌiÊ>˜`Ê«>˜Ê̜Ê>ÌÌi˜`Ê̅ˆÃÊÃ>i° Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE B3

LIVESTOCK EQUIPMENT DISPERSAL FOR BOLDUC FARMS DELORAINE, MB.

PLUS AREA CONSIGNORS WEDNESDAY APRIL 11th 11:00AM

DIRECTIONS: DIRECTIONS: (From Deloraine, MB. Jct #3 & #21 hwys) 2 miles west on #21hwy (to Correction Line Road) #21 curves south correction line continues west Turn right on Correction Line Road continue ½ mile west to sale site south side

LIVESTOCK HANDLING EQUIPMENT: UÊ,i>½ÃÊÜi`ˆ˜}ÊVÀœÜ`ˆ˜}ÊÌÕLÊÜÉÓÊÃiV̈œ˜Ê>`ÕÃÌ>LiÊ VÕÀÛi`Ê>iÞ Uʈ}…Êœ}ʓ>ÌiÀ˜ˆÌÞÊ«i˜ UÊ*i>ÀܘÊõÕiiâiÊV…ÕÌiÊÜɅi>`Ê}>ÌiÊEÊ«>«>̈œ˜Ê}>Ìi UÊ >vÊõÕiiâiÊV…ÕÌiÊEÊ̈«ÊÌ>Li UÊ­Ó®ÊÓ{½ÊvÀiiÊÃÌ>˜`ˆ˜}Ê>iÞ½ÃÊÜÉψ`iÊ`ˆÛˆ`iÊ}>Ìià UÊ£n½Ê«>˜iÊ܈̅ÊÓʅi>ÛÞʙ½Ê}>ÌiÃÊ UÊ­Ó®ÊÎä½ÊxÊL>ÀÊ«ˆ«i]ÊvÀiiÊÃÌ>˜`ˆ˜}Ê«>˜iÃÊ­£ÊÜÉÊ£Ó½ÊqÊ ÎÈäÊÃ܈˜}Ê}>Ìi® UÊ­£x®ÊÓ{½ÊvÀiiÊÃÌ>˜`ˆ˜}Ê«>˜iÃ]ÊÓÝÓÊÌÕLˆ˜} UÊ­£ä®Ê£Ó½ÊvÀiiÊÃÌ>˜`ˆ˜}Ê«>˜iÃ]ÊÓÝÓÊÌÕLˆ˜} UÊ­{ä®Ê£ä½]Ê£»ÊVœÀÀ>Ê«>˜iÃ UÊ­£Ó®Ê£Ó½]Ê£»ÊVœÀÀ>Ê«>˜iÃ UÊ­n®ÊÓ{½Ê܈˜`ÊLÀi>ŽÊÉÈÊL>ÀÊ«>˜iÃ LIVESTOCK FEEDING EQUIPMENT: UÊ,>˜V…iÀÃÊ7i`ˆ˜}ÊÎÊL>iÊvii`iÀ UÊ­{®Ê£»ÊÌÕLˆ˜}ÊÀœÕ˜`ÊL>iÊvii`iÀà UÊ+Õ>˜ÌˆÌÞʜvÊÌÀ>V̜ÀÊ̈ÀiÊvii`ÊÌÀœÕ}…à UÊ£ÓäLÕÃÊ«œÀÌ>LiÊVÀii«Êvii`iÀÊ UÊ£ä»ÊiiVÌÀˆVÊÀœiÀʓˆÊÜÉÊx…«Ê“œÌœÀÊ­>Ü>ÞÃÊÃ̜Ài`Ê ˆ˜Ãˆ`i® UÊÓxLÕÃÊvii`ÊLœÝÊÜÉiiVÊ՘œ>`Ê>Õ}iÀ UʣȽÝ{»Ê«i˜VˆÊ>Õ}iÀÊÜÉiiVÌÀˆVʓœÌœÀ FENCING EQUIPMENT & SUPPLIES: UÊ-…>ÛiÀÊΫÌÊ«œÃ̇«œÕ˜`iÀÊÜɓ>˜Õ>Ê̈ÌÊ UÊ+Õ>˜ÌˆÌÞʜvÊÀ>ˆÜ>ÞÊ̈ià UÊ+Õ>˜ÌˆÌÞʜvÊvi˜ViÊ«œÃÌÃ

OTHER EQUIPMENT: UÊÎä½Ê ÊÎÎxÊÌ>˜`i“Ê`ˆÃVÊÜÉӜœÌ…ÊL>`ià UÊ{ä½Ê i}i“>˜ÊVՏ̈Û>̜ÀÊÜÉÎÊÀœÜʅ>ÀÀœÜÃ]ʘiÜÊλʘœVŽÊ œ˜Ê뜜˜Ã UÊŏ>˜`ÊnÊÞ`°ÊÞ`°Ê-VÀ>«iÀ UÊ ÊÈä™ÊÌÀ>ˆÊÌÞ«iÊÀœÌ>ÀÞʓœÜiÀ UÊ ÊxäÎÊΫÌÊÀœÌ>ÀÞʓœÜiÀ UʣȽÊÌÉ>ÊV>Àʅ>ՏiÀÊÜÉLi>ÛiÀÊÌ>ˆ UÊiÌ>ÊVÕÌ̈˜}ÊL>˜`ÊÃ>Ü UÊ-…œ«Ê`ÀˆÊ«ÀiÃà MORE EQUIPMENT IS BEING CONSIGNED DAILY. PLEASE CHECK WEBSITE FOR UPDATED LISTING. CALL NOW TO ADD YOUR ITEMS TO THIS SALE. CONSIGNED EQUIPMENT: UÊ£™™nÊ œÀLiÀ̽ÃÊÌÀˆ«iÊ>ÝiÊÎÓ½ÝǤ½Êx̅Ê܅iiÊˆÛiÃ̜VŽÊ ÌÀ>ˆiÀÊÜÉnäääLÃÊ>ݏiÃ]ÊÎÊ`ˆÛˆ`iÊ}>ÌiÃ]ÊiÝÌÀ>ʅˆ}…]Êψ`iÊ Ãˆ`iÊÛi˜Ìˆ˜} UÊ£™™ÇÊ œÀLiÀ̽ÃÊÌÉ>ʣȽÝǽÊx̅Ê܅iiÊˆÛiÃ̜VŽÊÌÀ>ˆiÀ]Ê Ãˆ`ˆ˜}Ê`ˆÛˆ`iÊ}>Ìi]ÊÇäääLÃÊ>ݏiÃ]ÊÀÕLLiÀʓ>Ìà UÊÓääÓÊœ>`ˆ˜iÊ-Õ«iÀÊ Ê}À>ˆ˜ÊÌÀ>ˆiÀÃÊÜÉÀiVi˜ÌÊ«ˆ˜ÃÊEÊ LÕň˜}Ã]Ê-/

UÊ >ÃiÊnnÓäÊëÊ`ÏÊÃÜ>̅iÀÊÜÉÎä½Ê…i>`iÀ]Ê«ˆVŽ‡Õ«ÊÀii UÊ£È½Ê >ÃiÊVÀˆ“«iÀʅi>`iÀÊ­œvvÊnnÓä® UÊ,i>½ÃÊ7i`ˆ˜}ÊõÕiiâiÊV…ÕÌiÊÜɅi>`Ê}>Ìi UÊÓxäÊLÕÃÊVÀii«Êvii`iÀ UÊ>ÃÜÀÌi`Ê«>˜iÃ Uʏi˜}̅ÃʜvÊ`ÀˆÊÃÌi“Ê«ˆ«i

FOR MORE INFO ON THIS SALE OR TO ADD YOUR EQUIPMENT TO THIS LISTING PLEASE CONTACT LISTING AUCTIONEERS: BRENT CROWE 204-522-6224 OR PETER DOWNEY 204-522-5883 AUCTIONEERS NOTES:Ê/…iÊ œ`ÕV½Ãʅ>ÛiÊ`ˆÃ«iÀÃi`ʜvÊ̅iˆÀÊV>Ì̏iʅiÀ`Ê>˜`Ê>ÀiʜvviÀˆ˜}Ê̅iˆÀʏˆÛiÃ̜VŽÊ iµÕˆ«“i˜ÌÊvœÀÊÃ>i°Ê/…ˆÃʈÃÊÛiÀÞÊÜiÊŽi«ÌÊiµÕˆ«“i˜Ì°Ê/…iÀiÊ܈ÊLiÊܓiÊ}œœ`ʏˆÛiÃ̜VŽÊ>˜`Êv>À“Ê“>V…ˆ˜iÀÞÊVœ˜Ãˆ}˜‡ “i˜ÌÃÊ>``i`Ê̜Ê̅ˆÃÊÃ>iÊÜʫi>ÃiÊÜ>ÌV…ÊvœÀʘiÜÊ>``ˆÌˆœ˜Ã° Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


PAGE B4 Manitoba FarmLIFE, Monday, March 12, 2012

RETIREMENT FARM AUCTION FOR JACK & MERVIN STEFANISHYN RUSSELL, MB

SATURDAY, APRIL 14th 11:00 AM

DIRECTIONS: From Silverton, MB. (Silverton, MB is located 8.5kms east of Russell, MB or 9.5kms west of Angusville, MB at the jct of hwy #45 & #478) At town of Silverton, MB Jct #45 & #478 turn north on #478 and travel 4kms to Rd122W. At Rd122W turn east and travel 2.8kms to sale site on north side of road. ORDER OF SALE:Ê 11am – 1pm (shop items, misc, tanks, aeration equipment, grain bins) 1pm (major equipment will sell) TRACTORS: UÊ£™nnÊ6iÀÃ>̈iÊnÇÈÊ iÈ}˜>̈œ˜ÊÈ]Ê{ÊÜ`ÊÓn䅫ÊÜÉÊÓä°nÊ,ÎnÊ

Õ>Ã]Ê{Ê,i“œÌiÊÞ`]ÊÀiÌÕÀ˜Êˆ˜i]ÊÎ{ÓÈʅÀÃÊŜ܈˜}]Ê£ÓÊë`Ê ÌÀ>˜ÃÊ­£Ê"ܘiÀÊ1˜ˆÌ®ÊÃɘÎÎäÎÓ£ UÊ£™ÇxÊ ÊÈäÎäÊÓÊÜ`ÊÌÀ>V̜ÀÊ£Çx…«ÊÜÉ>ÕÝÊvÕiÊÌ>˜Ž]ÊÓä°n‡ ÎnÊ Õ>Ã]Ê£äääÊ*/"]Ê`Õ>Ê…Þ`°]Ê-ޘVÀœÊÌÀ>˜Ã]Ê`ˆvvʏœVŽ]ÊÈÓÈÓÊ …ÀÃ]ÊV>L]ÊÃɘäÎxnÓÓ,Ê­ i>Àˆ˜}ÊÀi`œ˜iʈ˜Ê,i>ÀÊ ˜`®Ê­/ÕÀLœÊ ,i`œ˜i® UÊ£™ÈxÊ Ê{äÓäÊ ÃÊÓÊÜ`ÊÌÀ>V̜ÀÊÇ䅫ÊÜÉÊÓÊÀi“œÌiʅÞ`]Ê`Õ>Ê */"]Ê«œÜiÀÊňvÌ]ʜ«i˜ÊÃÌ>̈œ˜]ʙ£Ç£…ÀÃÊŜ܈˜}]Ê iÜÊ£n°{‡Î{Ê ÀÕLLiÀ]ÊÃɘ/ÓÓÎ*ä™n£x™, UÊ£™Ç™Ê7…ˆÌiÊӇ£xxÊ7 ÊÜÉiœ˜Ê£äääʏœ>`iÀ]ÊLÕVŽiÌ]Ê }À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊÇäxn…ÀÃÊŜ܈˜}]Ê 7ÊÀi>ÀÊ`Õ>Ã]Ê ÃɘÓnxnә‡{Ó£ UÊiœ˜ÊÇ{ÇÊœ>`iÀÊÜÉÊ ÕVŽiÌÊEÊ >iÊœÀŽÊ­œÕ˜ÌÃÊvœÀÊ Ê ÓäÊ-iÀˆiî WHEEL LOADER: UʈV…ˆ}>˜Ê£ÇxÊ7…iiÊœ>`iÀÊÜÉÊ««ÀœÝÊxÊ9`Ê ÕVŽiÌ]Ê iÌÀœˆÌÊ Î£nÊ ˜}ˆ˜i HARVEST EQUIPMENT: UÊÓää{Ê*Ài“ˆiÀÊә{äÊëÊÃÜ>̅iÀÊÜÉÊÓääxÊÓx½Ê>V œ˜Ê™ÇÓÊ …i>`iÀ]Ê«ˆVŽÕ«ÊÀii]ÊÓȣʅi>`iÀʅÀÃ]ÊÎ{{Êi˜}ʅÀðʭ£Ê"ܘiÀÊ 1˜ˆÌ®ÊÃɘ£x™ÓÓÓ UÊ£™nÎÊÊnÈäÊëÊVœ“Lˆ˜iÊÜÉ*>ÌÌiÀܘÊ-ˆiÛi]ÊÀi‡Ì…À>ň˜}Ê >Õ}iÀ]ÊÓ£ÇxʅÀÃ]Ê7iÃÌÜ>À`ÊΙÇÊ*ˆVŽ‡Õ«]ÊÃɘ£Ç{ȇ£Ç™n{ UÊ£™nÈÊ ÊÇÇÓ£Ê/ˆÌ>˜ÊÊ«ÌÊVœ“Lˆ˜iÊÜÉÊÀiÛiÀÃiÀ]Ê>Õ̜ʅi>`iÀÊ …iˆ}…Ì]ʏœ˜}Ê>Õ}iÀ]ÊÃɘȣx{Ç{ UÊ£n½ÊʛÇxÊ«ÌÊÃÜ>̅iÀÊÜÉL>ÌÊÀii UÊ>LÌÀœ˜ˆVÃʙ£™Ê`ˆ}ˆÌ>Ê“œˆÃÌÕÀiÊÌiÃÌiÀ SEED & TILLAGE EQUIPMENT: UÊxÓ½Ê œÕÀ}>ՏÌÊÓÎäÊ-iÀˆiÃÊx{ȇxÓÊÜÉÊn»Êë>Vˆ˜}Ê­Ü>ÞÃÊ -…i``i`®Ê{ÊL>ÀÊ œÕÀ}>ՏÌʅ>ÀÀœÜÃʭӘ`ʜܘiÀÃʜvÊ̅ˆÃÊ՘ˆÌ® UÊ{Ó½Ê œÕÀ}>ՏÌÊxÎ{‡{ÓÊÜÉÊÎÊL>ÀÊ œÕÀ}>ՏÌʅ>ÀÀœÜÃ]Ê>ˆÀʎˆÌÊ >˜`Ê}À>˜Õ>ÀʎˆÌ]Ê œÕÀ}>ՏÌÊ£ÎnÊ>ˆÀÊÌ>˜ŽÊÜɅÞ`Êv>˜]ʎ˜œVŽ‡œ˜Ê ŜÛiÃ]Ê>Ü>ÞÃÊÅi``i`]ÊÃɘ£ÓÎÓÊ­£Ê"ܘiÀÊ1˜ˆÌ® UÊә½Ê-՘vœÜiÀÊÌ>˜`i“Ê`ˆÃŽÊÜÉÊӜœÌ…ÊvÀœ˜ÌÊEÊL>VŽ UÊ£ää½Ê6iÀÃ>̈iÊÎäääʈi`ÊëÀ>ÞiÀÊÜÉÊ£äääÊ>Ê*œÞÊ/>˜Ž]Ê 7ˆ˜`Ê-VÀii˜Ã]Ê …i“ʈÝÊ/>˜Ž]Êœ>“Ê>ÀŽiÀÃ]ÊÞ`Ê*Փ«Ê Ãɘ䣣xäÎ UÊxä½Êi݈‡ œˆÊ-ÞÃÌi“Ê™xÊ>ÀÀœÜ]Ê*>VŽiÀÊ >À UÊxä½Ê >“>ÀÊ>À“Ê>ÃÌiÀÊÞ`Ê>ÀÀœÜà UÊ{ǽÊÀˆ}ÃÌ>`Ê/ˆ>}iÊÜÉœÀÀˆÃÊÎÊL>ÀÊ>ÀÀœÜà UÊÈä½ÊiÀ“>˜Ê>ÀÀœÜà UʣǽÊ>Տ‡Ê-ii`ÊEÊiÀÌÊ/i˜`iÀÊÜÉÊÞ`ÊÕ}iÀà UÊ i}i“>˜Ê,œÌ>ÀÞÊ-̜˜iÊ*ˆVŽiÀÊÜÉÊÞ`Ê ÀˆÛi UÊ­È®Ê{½Ê-iV̈œ˜ÃʜvÊœÀÀˆÃʜ՘Ìi`Ê>ÀÀœÜà UÊ œÕÀ}>ՏÌʘœVŽ‡"˜Ê-«œœ˜Ã UÊ"`ÊÈʤ½Ê`ˆÃV AUGERS & GRAIN VAC: UÊ7>ˆ˜}>Êx£äÊÃÌ`ÊÀ>ˆ˜Ê6>V]Ê£äääÊ*/"]ÊÃɘ™£äÈ{Çää]ÊÕÃi`Ê ÛiÀÞʏˆÌ̏iÊ­£Ê"ܘiÀÊ1˜ˆÌ® UʣλÊÝÊÈ£½Ê7iÃÌvˆi`Ê-܈˜}Êœ««iÀÊÕ}iÀÊÜɏœÜÊ«ÀœÊ…œ««iÀ]Ê Ãɘ££È£äÇ UÊÇ»ÊÝÊÎǽÊ->ŽÕ˜`ˆ>ŽÊÕ}iÀÊÜÉ££Ê*Êœ˜`>]ÊÃɘÓÓ£™ä UÊn»ÊÝÊ{£½Ê->ŽÕ˜`ˆ>ŽÊÜÉÓÎÊ*Êœ…iÀÊ ˜}ˆ˜i UÊ7…i>̅i>ÀÌÊ£ä»ÊÞ`Ê/À>˜ÃviÀÊÕ}iÀ UÊi>ÀÊ œÝÊvœÀʣλÊ7iÃÌvˆi`ÊÕ}iÀ UÊ*œÞÊÕ}iÀÊ œœÌÃ

GRAIN BINS: UÊ­x®ÊÓäääÊ ÕÃÊ7iÃÌiiÊ>ÌÊ œÌ̜“Ê ˆ˜Ê­ i“i˜Ì® UÊ­Ó®ÊÓ£xäÊ ÕÃÊLˆ˜ÊÜÉÊLœœÌÃ]Ê>iÀ>̈œ˜ UÊ­£®Ê£ÎxäÊ ÕÃÊi«œÝÞÊVœ>Ìi`ʅœ««iÀÊLœÌ̜“ÊLˆ˜ UÊ­{®Ê£ÈxäÊ ÕÃÊ7iÃÌiiÊLˆ˜Ã UʭӮʣÈxäÊ ÕÃÊ7iÃÌiiÊ>ÌÊ œÌ̜“Ê­ i“i˜Ì® UÊ­{®ÊÓÇääÊ ÕÃÊ7iÃÌiiÊ>ÌÊ œÌ̜“Ê­ i“i˜Ì® UÊ£ÈxäÊ ÕÃÊ7iÃÌiiÊœ««iÀÊ œÌ̜“ UÊ£ÎxäÊ ÕÃÊ7iÃÌiiÊœ««iÀÊ œÌ̜“ UÊ««ÀœÝÊÎxääÊ ÕÃÊiÌ>Ê>ÌÊ œÌ̜“Ê ˆ˜Ê­ œ˜ÛiÀÌi`Ê ˆÌÀœ}i˜Ê />˜Ž® UÊ£ÎxäÊ ÕÃÊÀˆiÃi˜Ê «œÝÞÊ œ>Ìi`Êœ««iÀÊ œÌ̜“ UÊÓäääÊ ÕÃÊ7iÃÌiiÊ ˆ˜Ê*>ÀÌÃÊ­,œœv]Ê œœÀÃ]ÊiÌV® UʭȮʫ«ÀœÝÊÓä½Ê Ê ˆ˜Ê>``iÀà UʭӮʫ>ˆÃʜvÊLˆ˜ÊLœÌÃÊ­vœÀÊÓäääÊ ÕÃÊLˆ˜Ã® TRUCKS: UÊ£™™ÎÊÊ >}iʙÎääʈ}…Ü>ÞÊ/À>V̜ÀÊÜÉÊ£äÊ-«ii`Ê-«ˆViÀÊ /À>˜Ã°]ÊΣÇÈÊ >ÌÊ ˜}ˆ˜i]Ê>ŽiÊLÀ>Ži]Ê*ÀœÊi>ÌÊ7>L>ÃVœÊ ˜}ˆ˜iÊ i>ÌiÀ]Ê Õ˜Ž]ʈ}…Ê*ÀœvˆiÊx̅Ê7…iiÊ*>Ìi]Ê£]xn{]™nxŽ“ÃÊ -…œÜˆ˜}]ÊÓ{°xÊ,ÕLLiÀ]ÊÃɘÓ- È,™* äÈÇÓÎÓ]Ê->v̈i`Ê ­i˜}ˆ˜iÊÀiLՈÌÊ£Èä]ää䎓ÃÊ>}œ® UÊ£™ÇnÊÊÓxÇx]Ê/ÉÊÀ>ˆ˜Ê/ÀÕVŽÊÜÉÊ£™½Ê E]ÊÈÈ»ÊÈ`iÃ]Ê,œÊ />À«]ÊÓÓ°xÊ,ÕLLiÀ]Ê£ÎÊ-«`Ê/À>˜Ã°]ÊәäÊ Õ““ˆ˜}ÃÊ­-iiÛiÃÊ>˜`Ê *ˆÃ̜˜Ãʏˆ˜iÃÊ`œ˜iÊÎä]äääʎ“ÃÊ>}œ®]Ê>ŽiÊLÀ>Ži]ÊÎxä]xäÎÊ“ÃÊ -…œÜˆ˜}]Ê,i>ÀÊœˆÃÌÊ œ˜ÌÀœÃ]Êi˜`iÀܘÊÃÕëi˜Ãˆœ˜]Ê->vïi`]Ê Ãɘ Ó-ÇÓ{äÓ{ UÊœœ`Ê>˜`ÊV>LÊvœÀÊ>ÊÊ£™ääÊÌÀÕVŽ TRAILERS: UÊÓää£Ê{ä½Ê/ˆ“«ÌiÊ/ÉÊ LÊœ««iÀÊÀ>ˆ˜Ê/À>ˆiÀÊÜÉʈÀÊ,ˆ`i]Ê Ç{»ÊÈ`iÃ]Ê iÜÊ,œÊ/>À«]ÊÓÓ°xÊ,ÕLLiÀ]Ê -É £/ {ääÓ8 䙙ÈÓ£]Ê->vïi`Ê­>VŽÊ…>Ãʜܘi`Ê̅ˆÃÊ՘ˆÌÊ Ãˆ˜ViÊÓää{°ÊÌʅ>Ãʅ>`ÊÛiÀÞʏˆÌ̏iʓˆiÃʜ˜ÊˆÌÊȘVi°® UÊÓn½ÊÀÕi…>ÕvÊ-Éʈ}…LœÞʏ>Ì`iVŽÊ/À>ˆiÀÊÜÉi>`>V…iÊ ,>VŽ]ÊÓ{°xÊÀÕLLiÀ]Ê->vïi`]ÊÃɘ-{ääÈxÈÈÓÓ UÊ{n½ÊÀÕi…>ÕvÊ/Éʏ>ÌÊ iVŽÊ>ÞÊ/À>ˆiÀ]Ê->vïi` UÊ-ÉÊ œ˜ÛiÀÌiÀÊ œÞ UÊ-ÉÊÃÜ>̅iÀÊÌÀ>˜Ã«œÀÌ OTHER EQUIPMENT: Uʈi`“>ÃÌiÀÊÞ`Ê-VÀ>«iÀ]Ê««ÀœÝÊÎÊÞ`Ê >« UÊ Þ˜>‡>LÊ6‡ ˆÌV…iÀ]ÊÃɘxnÈ£äΣ UÊ{½Êiœ˜ÊÃ̜˜iÊ`ˆ}}iÀ UÊ{Ê܅iiÊÎÊ*/Ê>ÞÊ,>Ži UÊÓÊʛ£ÈÊÈ`iÊ`iˆÛiÀÞÊÀ>ŽiÃÊÜÉÌ>˜`i“Ê…ˆÌV… UÊ{{»Ê,>˜V…ʈ˜}Ê*ՏÊ i…ˆ˜`ʈ˜ˆÃ…ˆ˜}ÊœÜiÀÊÜÉÊ£ä°xÊ«]Ê ÊEÊ-Ê ˜}ˆ˜i UÊλÊœ˜`>Ê7>ÌiÀÊ*Փ« AERATION EQUIPMENT: UÊi…œÊ*Àœ«>˜iÊÀ>ˆ˜Ê ÀÞiÀ UÊ­Ó®Êi…œÊxÊ*ÊiÀ>̈œ˜Ê>˜Ã UʭӮʜ`i˜ÊÀ>ˆ˜ÊÓ{»ÊiÀ>̈œ˜Ê>˜Ã UÊiÀ>̈œ˜Ê/ÕLˆ˜}

UÊ­Ó®ÊxääÊ>ÊÕiÊ/>˜ŽÃÊÜÉÊ-Ì>˜`à UÊ£ääÊ}>Ê-Žˆ`Ê/>˜Ž SHOP ITEMS & TOOLS: Uʈ˜Vœ˜Ê-‡ÓääÊ>ÃÊ*œÜiÀi`Ê œ˜Ìˆ˜i˜Ì>Ê7i`iÀʜ˜ÊÓÊ7…iiÊ 7>}œ˜ UÊ Ê£xä Ê -Êi>ÌiÀÊUÊ/ Ê£ÈÊë`Ê`ÀˆÊ«ÀiÃà UÊ >`iÀÊ£ÉÓÊ*Ê i˜V…ÊÀˆ˜`iÀÊUÊÓ½ÊÝÊλÊiÌ>Ê7i`ˆ˜}Ê/>Li UʘۈÊUÊÎȻʫˆ«iÊÜÀi˜V…ÊUÊ Ê"ÛiÀÊi>`Ê ˜}ˆ˜iÊœˆÃÌ UÊ œœÃÌiÀÊ >LiÃÊUÊ,ÕLLiÀʈÀÊœÃi UÊxÊ/œ˜ÊœœÀÊ>VŽÊUÊ/ÀÕVŽÊEÊ“«i“i˜ÌÊ/ˆÀià UÊÎÉ{Ê ÀˆÛiÊ“«>VÌÊ7Ài˜V…ÊUÊ>ÎiÌÊ>ÌiÀˆ>Ê­>À}iÊ,œ® UÊ i>`Ê Ài>ŽiÀʈ}ÊUÊ/>«ÊEÊ ˆiÊ-iÌÃÊUÊ/À>ˆiÀʈ}…Ìà UÊ*ՏiÀÊ-iÌÊUÊ*ˆ«iÊ̅Ài>`iÀÊUÊ*ˆ«iʈÌ̈˜}à UÊ œÌ̏iÊ>VŽÊUÊ Ý…>ÕÃÌʘ>ÞâiÊUÊÞ`ʈÌ̈˜}à UʈÀÊ/œœÃÊ­,>ÌV…iÌ]Ê …ˆÃi]ÊiÌV°®ÊUÊ iVÌÀˆVÊ£Éӻʓ«>VÌ UÊ œŽiÊ œœiÀʓ>`iʈ˜ÌœÊ*>ÀÌÃÊ7>ÅiÀ UÊ >ÀÃ]Ê-˜ˆ«iÃ]Ê-…œÛiÃ]ÊiÌV°ÊUʣʣÉÓÊ/œ˜Ê …>ˆ˜Ê œ“i‡>œ˜} UÊ£Ê/œ˜Ê …>ˆ˜ÊœˆÃÌÊUÊœ}}ˆ˜}Ê …>ˆ˜ÃÊUÊ iۈÃià UÊ >“«Ãʜ˜Ê-ÌÀ>«Ê7ˆ˜V…iÃÊUÊ ÝÌi˜Ãˆœ˜Ê œÀ`ÃÊ UÊÃÜÀ̓i˜ÌʜvÊ ÕÌÃÊEÊ œÌÃÊUÊÓÊë`Ê Ê-…œ«Ê*ÀiÃà UÊ >ÀÀiÊ*Փ«ÃÊUÊÞ`Ê Õ“«iÀÊ>VŽ UÊ*ˆ«iÊ7Ài˜V…iÃÊUÊÀi>ÃiÊ՘à MISCELANIOUS ITEMS: UÊiiVÌÀˆV>Ê«>˜iÊLœÝÊÜÉLÀi>ŽiÀÃÊ­Ü>ÃʓœÕ˜Ìi`ÊLÞÊLˆ˜Ã® UÊ£ÓÊ6œÌÊÕiÊ*Փ«ÊUÊ ÊÊ,>`ˆœÃÊ­ ÀÞÃÌ>Ê-Ìޏi® UÊÊnÈäʓ>˜Õ>ÊUÊÎÊ7>ÞÊÞ`Ê-«œœÊ6>Ûià UÊ/À>«ÃÊUÊÃÌiiÊV>LiÊUÊÞ`ÊœÃiÃÊUÊ>ÀÀœÜÊ/ˆÀià UÊiiÀÊ-…i>ÀÊUÊλʳÊ{»Ê >iÊ-ÌÀ>«ÃÊUÊ Àœ«ÊˆvÌiÀà UÊ7iÊ*Փ«Ê>VŽÊUÊÞ`Ê-«À>ÞiÀÊ*Փ« UÊÃÜÀ̓i˜ÌʜvÊ6Ê iÌÃÊUÊ/À>V̜Àʈ}…Ìà UÊiÌ>ÊxÊ>Ê*>ˆÃÊvœÀÊii`ˆ˜} UÊÃÜÀ̓i˜ÌʜvÊ>À“Ê,i>Ìi`Ê/œœÃÊ>˜`Ê-“>Ã UÊ-ÕL“iÀÈLiÊ*Փ«Ê œ˜ÌÀœÃÊEÊ7ˆÀˆ˜} UÊ£{ʣȰ£Ê{Ê,ˆLÊ“«i“i˜ÌÊ/ˆÀiÃÊÜÉnÊ œÌÊ,ˆ“ UÊ ÝÌÊ>``iÀÊUÊ/>À«ÃÊUÊÃÜÀÌi`ÊiÌ>Ê-…iï˜} UÊÃÜÀÌi`Ê`ˆ“i˜Ãˆœ˜>ÊՓLiÀÊEÊ*Þܜœ` UÊÃÜÀÌi`Ê Ý«>˜`i`ÊiÅÊՏÊ-…iiÌÃÊ­6>ÀˆœÕÃÊ-ˆâiî UÊxäÊ>ÊiÌ>Ê ÀՓÃÊUÊ“«i“i˜ÌÊ/ˆÀiÃÊÜÉÊ,ˆ“à UÊ Ê£n»Ê³ÊÓ{»Ê/ÕÀ˜Ê ÕVŽiÃÊUÊ£n°{ʇÊÎ»Ê Õ>Ã UÊ,ˆ˜}iÀÊ7>ÅiÀÊUÊ Ài>“Ê-i«>À>̜ÀÃÊUÊ i`>ÀÊ-…ˆ˜}ià Uʈ˜ˆÊ ՏŽÊ >}ÃÊUÊœ>“Ê>ÀŽiÀʈÌÊ­ 7® UÊÞ`ÀœÊ*œiÃ]Êi˜ViÊ*œÃÌÃ]Ê,>ˆÊ/ˆiÃÊUÊiÀÀÞÊ >˜Ã UʭӮʣӻݣ{½ÊVՏÛiÀÌÃÊUÊ­£®Ê£È»Ý{½ÊVՏÛiÀÌ Uʘ̈µÕiÊÃÌiiÊ܅iiÃ UÊ"`ʓiÌ>ÊÌÀ>V̜ÀÊÃi>ÌÃÊ­£ÊˆÃÊV>ÃÌÊLÕÌʈÌʈÃÊVÀ>VŽi`® HOUSEHOLD EFFECTS: UÊiiVÌÀˆVÊÃ̜ÛiÊUÊVœÕV…ÊEÊV…>ˆÀÊUÊÃ܈ÛiÊÀœVŽiÀ UÊV>Lˆ˜iÌÊÃÌޏiÊ/6ÊUÊ7…ˆÌiÊiiVÌÀˆVÊÃi܈˜}ʓ>V…ˆ˜iÊÜɜ>ŽÊ`iÃŽÊ UÊLi`Àœœ“ÊÃՈÌiÊ­Li`ÊvÀ>“i]Ê`ÀiÃÃiÀ]ÊV…iÃÌʜvÊ`À>ÜiÀî UÊiÝÌiÀˆœÀÊ`œœÀÃÊÎÈ»ÊUÊܜœ`ÊÃ̜ÛiÊUÊVœvviiÊÌ>Li UÊ>ÃÜÀ̓i˜ÌʜvÊ`ˆÃ…iÃÊUÊLœœŽÃÊUÊÃiVÀiÌ>ÀÞÊ`iÎ

TANKS: UÊ£äääÊ}>ÊÕiÊ/>˜ŽÊÜÉ££äÊ6œÌÊ*Փ«ÊEÊiÌiÀ UÊ£äääÊ>Ê*Àœ«>˜iÊ/>˜Ž UÊ­Ó®£ÓxäÊ>Ê*œÞÊ/>˜ŽÃ UʭӮʣxäÊ>Ê*œÞÊ/>˜ŽÃ

FOR MORE INFO CONTACT OWNER

 Ê-/  -9 Ê Óä{‡ÇÇ·Îä™n

AUCTIONEERS NOTES:Ê/…ˆÃÊÛiÀÞÊÜiÊŽi«Ìʏˆ˜iʜvÊiµÕˆ«“i˜Ìʅ>ÃÊ>Ü>ÞÃÊLii˜ÊÅi``i`°Ê Ûi˜Ê̅iÊ̈>}iʈÃÊ Ži«ÌÊÅi``i`Ê܅i˜Ê˜œÌʈ˜ÊÕÃi°Ê9œÕʓÕÃÌÊÃiiÊ̅ˆÃÊÃ>iʈ˜Ê«iÀܘÊ̜Ê>««ÀiVˆ>ÌiÊ̅iÊVœ˜`ˆÌˆœ˜°Ê*>˜Ê̜Ê>ÌÌi˜`Ê̅ˆÃÊ}Ài>ÌÊ Ã>i° Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE B5

RETIREMENT FARM AUCTION FOR ANDY & ANN DUBOIS OF CARROLL, MB.

MONDAY APRIL 16th 10:00AM

DIRECTIONS: (Carroll, MB. Is located on #2 hwy west of #10 and east of Souris, MB.) From Carroll, MB. (Jct #2 hwy & Road 114) 6 miles south on road 114 then turn ½ mile west to sale site. Watch for signs sale day.

TRACTORS: UÊ£™™nÊ Ê/-££äÊ7 Ê£än…«ÊÌÀ>V̜ÀÊ Üɏˆi`Ê-Êx™xʏœ>`iÀ]ÊLÕVŽiÌ]Ê*iœµÕˆ˜Ê }À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊÎÓÊë`ÊÌÀ>˜Ã]Ê Ã…ÕÌ̏iÊňvÌ]Ê`ˆvvʏœVŽ]ÊΫÌ]Ê`Õ>Ê«Ìœ]Ê {ÊÀi“œÌiʅÞ`]Ê£n°{‡ÎnÊÀi>ÀÊȘ}iÃ]Ê £{°™,ÓnÊvÀœ˜Ì]ÊÇÎÇn…ÀÃÊŜ܈˜}]Ê ÃɘȣnÎÎx UÊ£™™ÎœÀ`Ê6iÀÃ>̈iʙäÎäÊ ˆ‡ ˆÀiV̈œ˜>ÊÌÀ>V̜ÀÊÜÉʏœ>`iÀ]Ê }À>««i]ÊΫÌ]ÊÌÀˆ«iʅÞ`À>ՏˆVÃ]Ê x{äÉ£äää«Ìœ]ʅˆ‡vœÜʏˆ˜iÃÊV>LÊi˜`]Ê ÀiVi˜ÌÊV>LÊi˜`Ê̈ÀiÃ]ʣȰ™ÝÓn»]ÊÇäxÓÊ …ÀÃ]ÊÃɘ ™ÎÓ{xÇ UÊ£™Ç™ÊÊÓÇäxÊÓÜ`Ê£ÓӅ«ÊÜÉV>LÊEÊ >ˆÀ]ÊnÊë`]ÊΫÌ]Ê`Õ>Ê…Þ`]Êx{äÉ£äääÊ */"]Ê£n°{ÝÎnÊ̈ÀiÃÊÜÉÊv>V̜ÀÞÊ`Õ>Ã]Ê Ãɘ™,ää{ÈÎÈ UÊ£™näÊ iÕÌâÊ£Èä]ÊÓÜ`ÊÜÉV>LÊEÊ>ˆÀ]Ê £äääÊ*/"]Ê`Õ>Ê…Þ`]ÊÃÌ>˜`>À`ÊÌÀ>˜Ã]Ê Óä°nÝÎnÊÀi>ÀÊ̈ÀiÃ]ʘiÜÊVÕÌV…]ÊÀiVi˜ÌÞÊ Ì…ÀœÕ}…Ê̅iÊŜ«]ÊǙ™ä…ÀÃÊŜ܈˜}]Ê ÃɘÇÈÓ{‡äx{Ç

HAYING & LIVESTOCK EQUIPMENT: UÊÓääxÊ Ê ,ÊÇnäÊÀœÕ˜`ÊL>iÀÊÜÉ܈`iÊ «ÉÕ]ÊÃɘÈÎ{{È UÊÓäääÊ£{½Ê Ê£{Çxʅ>ÞLˆ˜iÊÜÉÓÎääÊ ÃiÀˆiÃʅi>`iÀÊÃɘÈ{Èäxn UÊ>ÕÀˆiÀʇӣÓxÊȘ}iÊÀœÜÊL>iÊ«ˆVŽiÀ UÊ/œ˜ÕÌ̈Ê6£{ÊqÊ£{Ê܅iiÊº6»ÊÀ>Ži UÊ>}i`œÀ˜ÊÓÇxÊÌ>˜`i“Ê>ݏiʓ>˜ÕÀiÊ Ã«Ài>`iÀÊÜɅÞ`°Ê«ÕÅʜvv]ÊÌ>ˆ}>Ìi]Ê`Õ>Ê Li>ÌiÀÃ]Ê{ÓxÊÈx,ÝÓÓ°xÊ̈Àià UʈvvÞʙääÊL>iÊ«ÀœViÃÜÀÊÜÉ£äääÊ*/"]Ê ivÌʅ>˜`Ê`ˆÃV…>À}iÊÃɘ- äääÓ£È£Ó UÊ ÊÇääʓˆÝʓˆÊÜÉ«œÜiÀÊL>iÊ vii`iÀ]Ê£äääÊ*/"

OTHER LIVESTOCK RELATED EQUIPMENT: UÊ,i>Ê˜`ÕÃÌÀˆiÃÊV>Ì̏iÊõÕiiâiÊÜɅi>`Ê }>Ìi]ʘiVŽÊiÝÌi˜`iÀ]Ê«>«>̈œ˜ÊV>}iÊEÊ £näÊ`i}ÀiiÊVÀœÜ`ˆ˜}ÊÌÕL UÊ >Ì̏iÊ œÕ˜ÌÀÞÊõÕiiâiÊÜɅi>`Ê}>ÌiÊ EÊ«>«>̈œ˜ÊV>}i UʭǮʣӽʓiÌ>ÊL՘ŽÊˆ˜iÊvii`iÀà UÊ­£Ó®Ê£ä½Êˆ>“ˆÊÜi`ˆ˜}Êvii`ÊÌÀœÕ}…à SEEDING & TILLAGE: UʭӮʣ{½Ê“iÌ>Êvii`ÊÌÀœÕ}…à UÊÓ{½ÊÊÈÓääÊ`ˆÃVÊ`ÀˆÃÊÜÉÊv>V̜ÀÞÊ UÊ7œœ`i˜ÊVÀii«Êvii`iÀÊÜÉʓiÌ>Ê«>˜iÃ ÌÀ>˜Ã«œÀÌ UÊÊxxääÊ6ˆLÀ>ÊÅ>˜ŽÊVՏ̈Û>̜À]ʎ˜œVŽÊ UÊ+Õ>˜ÌˆÌÞÊÀœÕ˜`ÊL>iÊvii`iÀà œ˜ÊŜÛiÃÊÜÉÊ œÕÀ}>ՏÌÊÎÊÀœÜʓœÕ˜Ìi`Ê UÊ+Õ>˜ÌˆÌÞʜvÊ£»ÊVœÀÀ>Ê«>˜iÃÊEÊ}>Ìià UÊ,ˆÌV…ˆiÊ£ääʅi>`ÊÃ̜VŽÊÜ>ÌiÀiÀ …>ÀÀœÜà UÊ+Õ>˜ÌˆÌÞʜvÊ>>}…iÀÊvi˜ViÀÃÊEÊ UÊÓä½Ê-՘vœÜiÀʜvvÃiÌÊ`ˆÃV vi˜Vˆ˜}ÊiµÕˆ«“i˜Ì UÊ£{½ÊʛxÓÊ`ˆÃVÊÜÉʘœÌV…i`ÊvÀœ˜ÌÊ UÊÊ-̜VŽÊ œV̜À L>`ià UÊȻʫi˜VˆÊ>Õ}iÀʜ˜Ê܅iiÃÊÜÉÊ£…«Ê UÊ£{½Ê œ‡œ«Ê`ii«Ê̈iÀÊÜÉÊÓÊÀœÜÊ “œÌœÀ …>ÀÀœÜà UʭήʓiÌ>ÊLœÌ̜“]Ê«Þܜœ`Ê̜«Ê…œ}Ê UÊÈä½Ê>À“ÊŽˆ˜}ÊëÀˆ˜}ʅ>ÀÀœÜà vii`iÀÃÊ£Ó½Ýn½{» UÊ>À“ʈ˜}Ên»Ý{ȽÊ*/"Ê>Õ}iÀ

FOR MORE INFO CONTACT LISTING AUCTIONEERS

*iÌiÀÊ œÜ˜iÞÊÓä{‡xÓӇxnnÎʜÀÊ Ài˜ÌÊ ÀœÜiÊÓä{‡xÓӇÈÓÓ{

VEHICLES, TRAILERS, & BOAT: UÊÓä£äÊœ>`Ê>ÝÊÎÓ½Êx̅Ê܅iiÊ v>ÌÊ`iVŽÊÌÀ>ˆiÀÊÜÉÊÓÊqÊ£ääääLÊ `Õ>Ê܅iii`Ê>ݏiÃ]ÊiiVÌÀˆVÊLÀ>ŽiÃ]Ê ÓÎxÉnä,£ÈÊ̈ÀiÃ]ÊLi>ÛiÀÊÌ>ˆÃ]Ê̜œÊLœÝ]Ê ÃÉ˜ä£™Ç™È UÊ£™™ÇÊÓn½Ê ÕiʈÃÊÌÉ>ÊÃ̜VŽÊÌÀ>ˆiÀÊ ÜÉÓÊ«>À̈̈œ˜Ê}>ÌiÃ]Êi˜VœÃi`ʘœÃiÊÜˆÌ…Ê }>Ìi]Êܜœ`ÊvœœÀ]ÊvÀœ˜ÌÊiÃV>«iÊ`œœÀ]Ê ÃÉ˜Ó ™xÓ6ÎÓ86£äxÎ䣣 UÊ"`iÀÊ/œÞœÌ>ÊÌÀÕVŽ UÊ6ˆ˜Ì>}iÊ À>˜`œ˜Ê/À>˜ÃˆÌÊVˆÌÞÊLÕà UÊ£{½ÊÕ“ˆ˜Õ“ÊvˆÃ…ˆ˜}ÊLœ>ÌÊÜÉÊÓä…«Ê œ…˜Ãœ˜Ê“œÌœÀÊEÊÌÀ>ˆiÀ UÊ-“>ÊȘ}iÊ>ݏiÊṎˆÌÞÊÌÀ>ˆiÀ SHOP ITEMS & MISC: UÊ >“«LiÊ>ÕÃvi`Êx…«ÊÓÈÊ}>Ê>ˆÀÊ Vœ“«ÀiÃÜÀ UÊiÌ>ÊÜi`ˆ˜}ÊEÊŜ«ÊLi˜V…ià UÊi>ÌÊ}Àˆ˜`iÀÊEʓi>ÌÊL>˜`ÊÃ>Ü UÊ/>LiÊÃ>Ü UÊ-iiV̈œ˜ÊœvÊVœ““œ˜ÊŜ«Ê̜œÃÊEÊ iµÕˆ«“i˜Ì BUILDING SUPPLIES: UÊÎä½ÊÅiiÌʓiÌ>]ÊÓäÊ«ˆiViÃÊ̜Õ}…ÊÀˆL UÊ>À}iʵÕ>˜ÌˆÌÞʜvʜ̅iÀÊÅiiÌʓiÌ> UÊ+Õ>˜ÌˆÌÞʜvʘ`ÕÃÌÀˆ>ÊÅiiÌʓiÌ>Ê ­Ó»ÊÀˆL® UÊ+Õ>˜ÌˆÌÞʜvÊv}`ÊvœœÀÊÌÀÕÃÃià UʭӮʣn»ÝÓÓ»ÝÎä½Êܜœ`ÊLi>“à UÊ­£Ó®Ê{½Ý£Ó½Ê`ÀÞÜ>ÊÅiiÌà UÊ««ÀœÝ°ÊÎxÊÅiiÌÃʜvÊ i…i˜ÊVÕÀÛi`Ê “iÌ> UÊ+Õ>˜ÌˆÌÞʜvÊÃVÀ>«ÊˆÀœ˜

AUCTIONEERS NOTES:ʘ`ÞÊEʘ˜Ê…>ÛiÊ܏`Ê̅iˆÀÊv>À“Ê>˜`Ê>ÀiÊÀïÀˆ˜}ÊÌœÊ À>˜`œ˜°ÊœÌÃʜvÊÕÃivՏÊiµÕˆ«‡ “i˜ÌÊvœÀÊ̅iʏˆÛiÃ̜VŽÊ“>˜ÊEÊÓ>Êv>À“iÀtÊ՘V…Ê-iÀÛi`°ÊœÀÊiµÕˆ«“i˜Ìʈ˜vœÊ«i>ÃiÊVœ˜Ì>VÌÊ̅iʏˆÃ̈˜}Ê>ÕV̈œ˜iiÀÃÊ *iÌiÀÊ œÜ˜iÞÊÓä{‡xÓӇxnnÎʜÀÊ Ài˜ÌÊ ÀœÜiÊÓä{‡xÓӇÈÓÓ{ Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


PAGE B6 Manitoba FarmLIFE, Monday, March 12, 2012

UNRESERVED RETIREMENT FARM AUCTION

FOR BERNARD & LOUISE TRINDER of LANGENBURG, SK.

TUESDAY APRIL 17th 11:00AM (Sask Time)

DIRECTIONS: From: Binscarth, MB. (Jct of #16 & #478 hwy) Go west 15.5kms on hwy #478 to jct of #579 – Turn north 5kms on #579 to road 114N Turn west 2.5kms on road 114N - Turn south into yard (Watch for signs sale day) From: Russell, MB. (#16 Yellowhead Highway) Go west on #16 hwy to road 173W (notice road 173W is just east of the MB/SK border) Turn south 10kms on road 173W to road 114N - Turn west 2.5kms on road 114N Turn south into yard (Watch for signs sale day) From: Langenburg, SK. (#16 Yellowhead Highway) Go east on #16 hwy to road 173W (notice road 173W is just east of the MB/SK border) Turn south 10kms on road 173W to road 114N - Turn west 2.5kms on road 114N Turn south into yard (Watch for signs sale day) ORDER OF SALE:Ê11:00am – 1:00pm (misc, tools, shop equipment, livestock related items, tanks, pumps) 1:00pm (major equipment)

TRACTORS: UÊ£™™nÊ >ÃiÊ8££äÊ7 ʙx…«ÊÜÉ >ÃiÊÎääÊ -ʏœ>`iÀ]ÊLÕVŽiÌ]Ê}À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊΫÌ]ÊÎÊ Ài“œÌiʅÞ`]Ê`Õ>Ê*/"]Ê«ÜÀʵÕ>`ÊÌÀ>˜Ã]Ê£n°{,ÎnÊÀi>ÀÊ Ãˆ˜}iÃ]Ê£{°™,ÓnÊvÀœ˜Ì]ÊÇΙx…ÀÃÊŜ܈˜}]Ê ÃɘäänÎxÎn UÊ£™™ÓÊ >ÃiÊÇ£ÎäÊ7 Ê£ÇӅ«ÊÜÉ£në`Ê«ÜÀÊ Ã…ˆvÌ]ÊÎÊÀi“œÌiʅÞ`]Ê£äääÊ*/"]ÊvÀœ˜ÌÊÜiˆ}…ÌʎˆÌ]Ê Óä°n,ÎnÊ`Õ>ÃÊÀi>À]Ê£n°{,ÓnÊȘ}iÃÊvÀœ˜Ì]ÊxxÇ{…ÀÃÊ Ã…œÜˆ˜}]ÊÃɘääΙÈÈ{]Ê­fn]äää°ääÊëi˜ÌÊëÀˆ˜}ʜvÊ Óä£ä°Ê1˜ˆÌÊÜi˜ÌÊ̅ÀœÕ}…ÊÀi`ʏˆ}…ÌÊ`i>iÀʈ˜Ã«iV̈œ˜°® UÊÊÈÓ{Ê`ÏÊÜÉÓÊÀi“œÌiʅÞ`]Êx{äÊ*/"]ÊvœÀÜ>À`É ÀiÛiÀÃiÊÅÕÌ̏i]ʘiÜiÀʣȰ™‡ÎäÊÀÕLLiÀ UÊÊ{{{Ê`ÏÊÜɏœ>`iÀ]ÊΫÌ]Êx{äÊ*/"]ÊȘ}iʅÞ` HARVEST EQUIPMENT: UÊ£™nÈÊ ÊÇÇÓ£Ê/ˆÌ>˜ÊÊ«ÌÊVœ“Lˆ˜iÊÜÉȘ}iÊë`ÊVޏ]Ê ˆÀvœˆÊÈiÛi]ʘiÜiÀÊÓࣇÓÈÊÀÕLLiÀ]ÊÃɘȣx{n{ UÊ£™™™Ê >ÃiÊÓx½ÊnÓÓäÊ«ÌÊÃÜ>̅iÀÊÜÉ«ˆVŽ‡Õ«ÊÀii]Ê Ãɘ ä£ÈÈäǙ UÊÓ{½Ê6iÀÃ>̈iʛ£äÊ«ÌÊÃÜ>̅iÀ UÊǽʫœÞÊÃÜ>̅ÊÀœiÀ UÊ ˆVŽˆiÊœ…˜Êˆ˜ˆÊ  Ê}À>ˆ˜Ê“œˆÃÌÕÀiÊÌiÃÌiÀ HAYING EQUIPMENT: UÊ£™™nÊiÃÃ̜˜Êx£{ÊÀ`ÊL>iÀÊÃɘääÇÎÓ UÊ£™™£Ê >ÃiÊnÎÇäÊ£{½Ê“œÜiÀÊVœ˜`ˆÌˆœ˜iÀÊ Ãɘ ääänn™{ UÊ>ÞʓœˆÃÌÕÀiÊÌiÃÌÊ«ÀœLi FEED PROCESSING EQUIPMENT: UÊÓäääʈ}…ˆ˜iÊ >iÊ*ÀœÊÇäääÊ*ÕÃÊL>iÊ«ÀœViÃÜÀÊ ÜÉ£äääÊ*/"]ÊÃɘ *ÇäÓä{™Î£ UÊ ÊÎxnʅ>““iÀʓˆÊÜÉ«ÜÀÊL>iÊvii` TRUCKS & TRAILERS: UÊ£™nÎÊ …iÛÊ ÇäÊÃÉ>Ê}À>ˆ˜ÊÌÀÕVŽÊÜÉ£È½Ê ³]ÊÀœÊ Ì>À«]ÊÎÈÈÊ}>Ã]Êx³ÓÊÌÀ>˜Ã]Ê£ÎǙ{Ȏ“ÃÊŜ܈˜}]Ê Ãɘ£ Ç £ È 6£Óx™™™ UÊ£™ÇÎÊ …iÛÊ xäÊÃÉ>Ê}À>ˆ˜ÊÌÀÕVŽÊÜÉ£{½Ê ³]ÊәÓÊ }>Ã]Ê{Êë`ÊÌÀ>˜ÃÊ­˜œÌʏˆVi˜Ãi`ÊÞ>À`ÊÌÀÕVŽÊœ˜Þ® UÊÓääÓÊ£È½Ê Õ˜V>˜ÊÌÉ>ÊÃ̜VŽÊÌÀ>ˆiÀÊÜÉÇäääLÃÊ>ݏiÃ]Ê ÃÉ˜Ó ™{n™Ó,äÈ䙣ä UÊÓn½Ê-…œ«Ê ՈÌÊÌÀˆ«iÊ>ÝiÊÜ>}œ˜Ê­“œLˆiʅœ“iÊ >ÝiÃ® UÊ-…œ«Ê ՈÌÊÃÉ>ʓi`ˆÕ“Ê`ÕÌÞÊVœ˜ÛiÀÌiÀÊ`œÞ

3PT MOWERS & YARD SPRAYER: UÊx½ÊÊΫÌÊÀœÕ}…ÊVÕÌÊÀœÌ>ÀÞʓœÜiÀ UÊǽÊ/iV“>ÊÓÎäÊΫÌÊvˆ˜ˆÃ…ˆ˜}ʓœÜiÀÊÜÉÀi>ÀÊ `ˆÃV…>À}i Uʈ“VœÊÌÀ>ˆiÀÊÃÌޏiÊÞ>À`ÊëÀ>ÞiÀÊÜÉ£ÓۜÌʫՓ« AUGERS & AREATION FANS: UÊ£ä»8x£½Ê7iÃÌvˆi`Ê*/"ÊÃ܈˜}ʅœ««iÀÊ>Õ}iÀ UÊÇ»8Îx½Ê À>˜`ÌÊ>Õ}iÀÊÜÉ 7Ê£n…«Êœ…iÀÊiiVÌÀˆVÊ ÃÌ>ÀÌÊi˜}ˆ˜i UÊ7…i>ÌÊi>ÀÌÊLˆ˜ÊÃÜii« UÊÈ»Ê>Õ}iÀÊÜÉ΅«Ê£«…ÊiiVÌÀˆVʓœÌœÀÊ­ÕÃi`ÊvœÀÊ viÀ̈ˆâiÀ® UÊÈ»Ê>Õ}iÀÊÜɅÞ`ʓœÌœÀʜ˜ÊÀ՘˜ˆ˜}Ê}i>ÀÊ­ÕÃi`ÊÌœÊ vii`ʓˆ® UÊ«œÞÊ>Õ}iÀʅœ««iÀà UÊ­Ó®Ê>À“Ê>˜ÃÊ>iÀ>̈œ˜Êv>˜Ã Uʏi˜}̅ʜvÊÓÓäÊۜÌÊiÝÌi˜Ãˆœ˜ÊVœÀ` SEED & TILLAGE EQUIPMENT: UÊÎ{½Ê œÕÀ}>ՏÌÊ œ““>˜`iÀÊÎ{‡ÎnÊ̈>}iÊÜÉ>ˆÀÊ Ãii`iÀʎˆÌ]Ên»Êë>Vˆ˜}]ʓœÕ˜Ìi`ʅ>ÀÀœÜÃ]ÊœÀÀˆÃÊ i˜iÈÃÊÊ£ääÊ-iÀˆiÃÊ̜ÜÊLiÌÜii˜Ê>ˆÀÊÌ>˜Ž]Ê*/"Êv>˜ UÊә½ÊœÀÀˆÃÊ>}˜Õ“Ê *ÇÓxÊV…ˆÃiÊ«œÜÊÜÉ ÎʎˆÌ]Ê ÎÊL>ÀʓœÕ˜Ìi`ʅ>ÀÀœÜà UÊÈä½Êi݈‡ œˆÊ-ÞÃÌi“Ê™xʅ>ÀÀœÜÊ«>VŽiÀÊL>À UÊ ÀœÜ˜ÊÈÊÞ`ʅÞ`ÊÃVÀ>«iÀ UÊÓä½ÊiœÕ}…ÊÓ£äÊ-iÀˆiÃÊÌ>˜`i“Ê`ˆÃŽÊÜɘœÌV…i`Ê`ˆÃŽÃ UÊxä½ÊiÀ“>˜Ê…Þ`ʅ>ÀÀœÜà UÊÈn½Ê6iÀÃ>̈iÊÎäääÊ«ÌÊëÀ>ÞiÀÊÜÉnää}>Ê«œÞÊÌ>˜Ž]Ê */"ʫՓ«]ÊV…i“Ê“ˆÝÊÌ>˜Ž UÊ£{½Ê`ii«Ê̈>}i UÊ i}i“>˜ÊÀœÌ>ÀÞÊÃ̜˜iÊ«ˆVŽiÀ LIVESTOCK ITEMS: UÊ,>˜V…iÀÃÊ7i`ˆ˜}ÊÎÊL>iÊvii`iÀÊÜÉÀi“œÛ>LiÊi˜`Ê «>˜iÊœ˜ÊΈ`à UÊ-…œ«Ê ՈÌʓ>ÌiÀ˜ˆÌÞÊ«i˜ÊÜɅi>`Ê}>Ìi UÊ-iiV̈œ˜ÊœvÊ£»ÊÌÕLˆ˜}Ê«>˜iÃÊ­n»‡£ä½‡£Ó½® UÊÀœÕ˜`ÊL>iÊvii`iÀà UÊÌÀi>Ìi`Êvi˜ViÊ«œÃÌà UÊvi˜ViÊÃÌ>Þà UʭӮʫœÞʓˆ˜iÀ>Êvii`iÀÃÊÜÉÀÕLLiÀÊ̜«Ã UÊ-̜VŽÊ œV̜À UÊÃÜÀ̓i˜ÌʜvÊÛiÌÊÃÕ««ˆiÃÊ­ÃÞÀˆ˜}iÃ]ÊÌ>}}iÀÃ]Ê ÕÀ`iââœÃ]ÊiVÌ°® UÊV>vʫՏiÀ UÊ«œÞÊV>vÊÏiˆ}… UÊvi˜Vˆ˜}Ê̜œÃ

TANKS: UÊ£Óää}>Ê«œÞÊÜ>ÌiÀÊÌ>˜ŽÊ­L>VŽ® UÊxää}>ÊvÕiÊÌ>˜ŽÊÜÉÃÌ>˜` UÊxä}>ÊΈ`ÊÌ>˜ŽÊÜɅ>˜`ʫՓ« PUMPS & HOSE: UÊÓ»ÊÜ>ÌiÀʫՓ«ÊÜÉx…«Ê ³-Êi˜}ˆ˜i UÊÓ»Ê`ˆÃV…>À}iʅœÃi UÊ ÎʅœÃi UÊ>ˆÀÊÃii`iÀʅœÃi SHOP EQUIPMENT & TOOLS: UÊÕõÛ>À˜>ÊÎ{xÊV…>ˆ˜ÊÃ>Ü UÊ-Ê É

Ê>ÀVÊÜi`iÀ UʜÝÞÉ>ViÌÊ̜ÀV…ÊÜÉv>À“iÀʜܘiÀʓˆ˜ˆÊLœÌ̏ià UÊ£ÈÊë`Ê`ÀˆÊ«ÀiÃà UʓiÌ>ÊVÕÌ̈˜}ÊV…œ«ÊÃ>Ü UʭӮʫœÀÌ>LiÊ>ˆÀÊVœ“«ÀiÃÜÀà UʭӮʫœÀÌ>LiÊ>ˆÀÊÌ>˜ŽÃ UÊ­Ó®ÊL>ÌÌiÀÞÊLœœÃÌiÀÊV…>À}iÀà UÊ>˜Ûˆ UÊۈÃiʜ˜ÊÃÌ>˜` UÊ ÊÌÀÕVŽÊÀ>“«Ã UÊL>ÀÀiÊ«Õ“«Ã UÊ̜«Ê>˜`ÊLœÌ̜“Ê̜œÊV…iÃÌ UÊ>ÃÜÀÌi`ʅ>˜`Ê̜œÃʭÜVŽiÌÃ]ÊÜÀi˜V…iÃ]ÊiVÌ°® UÊÎÉ{»ÊÜVŽiÌÊÃiÌà UÊvœœÀʍ>VŽÃ UÊ}Ài>ÃiÊ}՘à UÊ-…œ«Ê6>V UÊVœ˜ÃÌÀÕV̈œ˜Ê…i>ÌiÀ UÊ>VŽ‡Ê>VŽÃ UÊÞ>À`Ê̜œÃʭŜÛiÃ]ÊvœÀŽÃ]ÊiVÌ°® MISC: UÊ£n…«Ê ³-Ê>Õ}iÀʓœÌœÀ UʅÞ`ÊVޏ UÊiiVÌÀˆVʓœÌœÀà UÊ*/"Ê>`>«ÌiÀà UÊVÀÞÃÌ>ÊÃÌޏiÊÊÀ>`ˆœÃÊ­{‡xÊ՘ˆÌî

FOR MORE INFO CONTACT OWNER

iÀ˜>À`ÊEʜՈÃiÊ/Àˆ˜`iÀ œ“iÊÎäȇÇ{·ÓnÈnÊ œÀÊ iÊÓä{‡Ç™È‡£ÓnÓ

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE B7

UNRESERVED FARM DISPERSAL FOR CRAIG & CONNIE MYERS of BELMONT, MB.

THURSDAY APRIL 19th 12:00 noon

DIRECTIONS: Sale will be held along the highway on the east edge of the town of Belmont, MB. Belmont is located on #23 highway. Watch for signs sale day. ORDER OF SALE:Ê 12:00pm – 1:00pm – misc farm related smalls, farm tools, tanks 1:00pm – augers, seed & tillage, trucks, harvest equipment, tractors, guidance system

TRACTORS: UÊ£™™äÊœÀ`Ê6iÀÃ>̈iʙ{ÈÊ iÈ}˜>̈œ˜Ê ÈÊÎÓx…«ÊÜÉÓä°n,{ÓÊ`Õ>Ã]Ê{ÊÀi“œÌiÊ …Þ`]ÊÀiÌÕÀ˜Êˆ˜i]Ê£ÓÊë`ÊÃÌ`ÊÌÀ>˜Ã]Ê ÈӣDžÀÃÊŜ܈˜}]ÊÃɘ {x䣣ÈÊ­>««ÀœÝÊ Óxä…ÀÃʜ˜ÊVÕÌV…® UÊ£™nÎÊÊ{n{äÊÜÉÓä°n‡ÎnÊ`Õ>Ã]Ê{Ê Ài“œÌiʅÞ`]ÊÀiÌÕÀ˜Êˆ˜i]ÊÎÊë`Ê«ÜÀÊňvÌ]Ê

Փ“ˆ˜ÃʙäÎÊi˜}]ÊÈnxx…ÀÃÊŜ܈˜}]Ê Ãɘ™ ää{£ÓÈ UÊ£™È£Ê ÊÎä£äÊÜÉ£n°{‡ÎäÊȘ}iÃ]Ê ÓÊÀi“œÌiʅÞ`]ÊÃޘVÀœÊ/À>˜Ã]Êx{äÊ*/"]Ê ÈǙä…ÀÃÊŜ܈˜}]ÊÃɘ£Ó/Çn™Ç UʭήÊ/ÕÀLœÊÊ«Ài‡Vi>˜iÀà GUIDANCE SYSTEM: UÊ/Àˆ“LiÊÓxäÊ >ÃÞÊՈ`iʏˆ}…ÌÊL>ÀÊ ÃÞÃÌi“ÊÜÉ£xÊ>˜Ìi˜˜>

ÀœÊÌ>À«]ÊÈäÊÃiÀˆiÃÊ iÌÀœˆÌÊxä䅫Êi˜}]Ê £nÊë`ÊÌÀ>˜Ã]Êi˜}ˆ˜iÊLÀ>ŽiÃ]Ê{‡Ü>ÞÊ `ˆvvʏœVŽÊÕ«]ʅœˆÃÌÊVœ˜ÌÀœÃÊ>ÌÊÌ>ˆÊ}>Ìi]Ê ££,Ó{°xÊÀÕLLiÀ]Ê£{ÇÓx{Ύ“ÃÊŜ܈˜}]Ê Ãɘ£1* x< n9*£Èx™{Ê­ iÜÊÀ>`ˆ>‡ ̜À]ÊVÕÌV…Ê`œ˜iÊ>««ÀœÝÊ£Î]ää䎓Ã]Ê ÌÀ>˜ÃÊÀiLՈÌÊ>««ÀœÝÊ£ää]ää䎓Ã]Ê`Àœ«Ê ˆ˜Êi˜}ˆ˜iÊ{ää]ää䎓ÃÊ>}œ® UÊ£™Ç{Ê ÊÈxääÊÌ>}Ê>ݏiÊ}À>ˆ˜ÊÌÀÕVŽÊ ÜÉÓä½Ê ³]ÊÀœÊÌ>À«]ÊÎÈÈÊ}>ÃÊi˜}]Êx³ÓÊ /À>˜ÃÊ­ÓÊë`ʘœÌÊܜÀŽˆ˜}®]ÊxÎ]ΙxŽ“ÃÊ Ã…œÜˆ˜}]ÊÃɘ/ ÈÇ{6xÇÓä£Î UÊ£™È{ÊœÀ`ÊÈääÊÃÉ>Ê}À>ˆ˜ÊÌÀÕVŽÊÜÉ£{½Ê ³]ÊΙ£Êi˜}]Ê{³ÓÊ/À>˜Ã]ʙ°ää‡ÓäÊÀÕL‡ LiÀ]Ê{™ÓÓÎʓˆiÃÊŜ܈˜}] ÊÃɘ£n£ÈäÇ{‡£x{ÇäÓ

SEED & TILLAGE EQUIPMENT: UÊ£™™ÎÊ{ä½Ê œÕÀ}>ՏÌÊnnääÊ>ˆÀÊÃii`iÀÊ HARVEST ÜÉ œÕÀ}>ՏÌÊÓ£xxÊ>ˆÀÊÌ>˜Ž]ʅÞ`Êv>˜]Ê EQUIPMENT: UÊÓx½ÊÓää£Ê*Ài“ˆiÀÊәxäÊëÊÃÜ>̅iÀÊ }À>˜Õ>ÀʎˆÌ]ʵՈVŽÊ>ÌÌ>V…Ê«>VŽiÀÃÊ>˜`Ê ÜÉÓääÓÊ>V œ˜Ê™ÇÓʅi>`iÀÊ܈̅ÊV>˜œ‡ …>ÀÀœÜÃ]Ên»Êë>Vˆ˜}]ÊÎÇxLÃÊÌÀˆ«Ã]Ê iÜÊ …œÃiÃ]ÊÓääÊ>VÀiÃʜ˜Êϻʎ˜ˆÛiÃ]ÊVՏÌÊ >Ê>Õ}iÀʜ«Ìˆœ˜]Ê«ˆVŽ‡Õ«ÊÀii]Ê££ä…«Ê ÃɘnÓ£Ó{™]ÊÌ>˜ŽÊÃɘ{xäÈ i˜}]ÊÓÊë`ÊÌÀ>˜Ã]ÊÇ{ä…ÀÃÊŜ܈˜}]Ê UÊÓää£Ê{ä½Ê œÕÀ}>ՏÌʙ{ääÊ̈>}iÊ Ãɘ£{Ón{x ÜÉ ÎʎˆÌ]Ê{ÊL>Àʅ>ÀÀœÜÃ]ʏˆ}…ÌʎˆÌ]Ê£Ó»Ê UÊn½Ê«œÞÊÃÜ>̅ÊÀœiÀ ë>Vˆ˜}]ÊÈxäLÃÊÌÀˆ«Ã]ÊÃɘÎx™ÇÓ *ä™ UÊ£™nÎÊÊnÈäʅÞ`ÀœÊëÊVœ“Lˆ˜iÊ ÜÉÀi>ÀÊ܅iiÊ>ÃÈÃÌ]ʅÞ`ÊV…>vvÊëÀi>`iÀ]Ê UÊÈǽÊ>ÕÀˆiÀʅ>ÀÀœÜÊÉ«>VŽiÀÊL>À UÊnÓ½Ê œÕÀ}>ՏÌÊ i˜ÌÕÀˆœ˜ÊÊ«ÌÊvˆi`Ê ÇÊLiÌÊiÀœiÊ«ˆVŽ‡Õ«]Ê{™Çn…ÀÃÊŜ܇ ëÀ>ÞiÀÊÜÉ£äääÊ«œÞÊÌ>˜Ž]ʅÞ`ʫՓ«]Ê ˆ˜}]ÊÃɘ£Ç{ȇ£nÓ£È `ˆÃŽÊ“>ÀŽiÀÃ]Ê܈˜`ÊÃVÀii˜Ã]ÊÀˆ˜ÃiÊÜ>ÌiÀÊ UÊ£™nÎÊÊnÈäʅÞ`ÀœÊëÊVœ“Lˆ˜iÊ Ì>˜Ž]ÊÃɘ-‡£näx ÜɅÞ`ÊV…>vvÊëÀi>`iÀ]ÊÇÊLiÌÊiÀœiÊ UÊ i}i“>˜Ê,-xÇäÊ}ÀœÕ˜`Ê`ÀˆÛiÊÀœÌ>ÀÞÊ «ˆVŽ‡Õ«]ÊΙÈä…ÀÃÊŜ܈˜}] Ã̜˜iÊ«ˆVŽiÀÊÜÉÀœVŽÊ>«Àœ˜Ê­ iÜÊ«ˆ˜Ãʈ˜Ê ÊÃɘ£Ç{ȇ£ÇÈÇÈ L>ÎiÌÊ«ˆÛœÌÃ]ʘiÜÊLi>Àˆ˜}ÃÊ>˜`Ê«ˆœÜÊ UÊ>LÌÀœ˜ˆVÃʙ£™Ê“œˆÃÌÕÀiÊÌiÃÌiÀ LœVŽÃʈ˜ÊÀii]Ê iÜÊ̈ÀiÃ]Ê iÜÊ܅iiÊ Li>Àˆ˜}î TRUCKS: UÊiœ˜ÊvœÀŽÊÌÞ«iÊÃ̜˜iÊ«ˆVŽiÀ UÊÓäääÊÀiˆ}…̏ˆ˜iÀÊ >ÃÈVÊÌÉ>Ê}À>ˆ˜Ê UÊ{äÊ̜“ʍiÌÊV>ÀLˆ`iÊ̈«Ê Îʎ˜ˆÛià ÌÀÕVŽÊ-/ ÊÜÉÓä½Ê iÕÃÌ>ÀÊ ³]Ê

UÊœ`iÊ£ä£ÊVÕÌV…ÊÃ܈ÌV…ÊEʓœ˜ˆÌœÀÊvœÀÊ œÕÀ}>ՏÌÊÓ£xxÊ>ˆÀÊÌ>˜Ž UÊ­xä®Ê ʏœÜÊ`ÀˆvÌʘœââiÃÊ£ä}>ÊqÊ x“«…Ê­œ˜ÞÊÕÃi`ÊxääÊ>VÀiî UÊÞ«ÀœÊ…Þ`À>ՏˆVÊëÀ>ÞiÀʫՓ«Ê ­ÀiLՈÌ® AUGERS: UÊÎǽÝÇ»Ê->ŽÕ˜`ˆ>ŽÊ>Õ}iÀÊÜɣ΅«Ê i˜}ˆ˜i]ÊÃɘx™nÇ£ UÊx£½Ýn»Ê7iÃÌvˆi`Ê*/"Ê>Õ}iÀ UÊ{£½Ýn»Ê7iÃÌvˆi`Ê*/"Ê>Õ}iÀ UÊΣ½ÝÇ»Ê7iÃÌvˆi`Ê>Õ}iÀÊÜɣȅ«Ê ³-Ê i˜}ˆ˜i]Ê7…i>̅i>ÀÌÊLˆ˜ÊÃÜii« TANKS: UÊ£ÓääÊ}>Ê«œÞÊÜ>ÌiÀÊÌ>˜Ž UÊ££xÊ}>ÊΈ`ÊÌ>˜ŽÊÜÉ£ÓÊۜÌʫՓ« OTHER EQUIPMENT & MISC: UÊ{Ê܅iiÊv>À“ÊÀ>VŽ UÊÊnÈäÊ«>ÀÌà UÊÊ{n{äÊ«>ÀÌà UÊ>ˆÀÊÃii`iÀʅœÃi Uʅ>ÀÀœÜÊ̈˜ià UÊÕÃi`ÊVՏÌÊŜÛiÃ UÊ}À>ˆ˜ÊŜÛiÃ UÊ«œÞÊ>Õ}iÀʅœ««iÀà UʏœœÀʓœ`iÊ`ÀˆÊ«ÀiÃà UÊÀVÊÜi`iÀ UÊ >ÌÌiÀÞÊV…>À}iÀ UÊ«œÀÌ>LiÊ>ˆÀÊVœ“«ÀiÃÜÀ

FOR MORE INFO CONTACT OWNER

,Ê9 ,-Ê Óä{‡nÓLJÓ{nÓʅœ“iÊ œÀÊÓä{‡ÇÓ䇙{{ÇÊVi

AUCTIONEERS NOTES:Ê/…iÊÞiÀÃÊv>“ˆÞʅ>ÃÊLii˜Ê>ÊÛiÀÞÊÜiÊŽ˜œÜ˜Êv>À“Êv>“ˆÞʈ˜Ê̅iÊVœ““Õ˜ˆÌÞÊvœÀÊ }i˜iÀ>̈œ˜Ã°Ê/…iÊiµÕˆ«“i˜ÌʈÃÊÛiÀÞÊÜiÊ“>ˆ˜Ì>ˆ˜i`Ê>˜`Ê܈ÊLiÊvˆi`ÊÀi>`Þ°Ê"ˆÃÊ>˜`ÊvˆÌiÀÃÊ܈ÊLiÊV…>˜}i`Ê>˜`Ê À>ˆ}Ê ÜˆÊ…>ÛiÊ}œ˜iÊ̅ÀœÕ}…Ê̅iÊiµÕˆ«“i˜ÌÊ>ÃʈvʅiÊÜ>ÃÊ}œˆ˜}Ê̜Ê̅iÊvˆi`Ê̅ˆÃÊëÀˆ˜}ʅˆ“Ãiv°Ê>ÀŽÊ̅ˆÃÊÃ>iÊ`>Ìiʜ˜ÊޜÕÀÊ V>i˜`>ÀÊ>˜`Ê«i>ÃiÊ«>˜Ê̜Ê>ÌÌi˜`° Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell 2012


PAGE B8 Manitoba FarmLIFE, Monday, March 12, 2012

ANNUAL SPRING CONSIGNMENT SALE at FRASER AUCTION BARN

4th ANNUAL KILLARNEY & DISTRICT EQUIPMENT CONSIGNMENT AUCTION

BRANDON, MB.

KILLARNEY, MB. SATURDAY APRIL 21st 9:00am

DIRECTIONS: Sale will be held at the farm of Del & Gert Smith, ½ mile west of the jct of #3 & #18 hwys. (Just off #3 hwy across from water tower) ORDER OF SALE:Ê 10:00am – 12:00pm (misc, tools, palleted lots) 12:00pm – (livestock related items followed by major equipment) THIS IS AN EARLY LIST WITH MORE CONSIGNMENT BEING ADDED DAILY. CALL NOW TO HAVE YOUR ITEMS ADDED TO THIS COMMUNITY SALE. TRACTORS: UÊxännÊÌÀ>V̜ÀÊÜÉÎn»Ê`Õ>Ã]ÊÃɘ1ää{xÓn U Ê{äÓäÊÌÀ>V̜ÀÊÜÉ`Õ>Ê…Þ`]Ê`Õ>Ê«Ìœ]ÊÀiVi˜ÌÊVÕÌV…]ʘiÜÊi݅>ÕÃÌ]Ê ˜iÜÊL>ÌÌiÀˆiÃ]ʘiÜÊÃi>Ì]ʘiÜÊVˆÀVՏ>̈˜}ʅi>ÌiÀ]ÊÈxää…ÀÃÊŜ܈˜} U Ê{ä£äÊÜÉ Ê£{nʏœ>`iÀ]Ê`Õ>Ê…Þ`]ÊÃi«>À>ÌiÊÛ>ÛiÃÊvœÀʏœ>`iÀ]Ê £ÓÊۜÌÊÃÞÃÌi“]ʏˆ}…Ìà U£™ÈÓÊ ÊÎä£äÊÜÉ Ê{Èʏœ>`iÀ]Ê£ÓÊۜÌÊÃÞÃÌi“]Ê`Õ>Ê…Þ`]ÊÃi«>À>ÌiʅÞ`ÊÛ>ÛiÊvœÀʏœ>`iÀ]Ê}œœ`ÊÀÕLLiÀ U ÊÊÀœÜÊVÀœ«ÊÌÀ>V̜À U-Õ«iÀÊʅˆ}…ʏˆvÌʏœ>`iÀ U}À>««iÊvœÀŽÊœvvÊʏœ>`iÀ HARVEST EQUIPMENT: U

ʙÈääÊ«ÌÊVœ“Lˆ˜i UÓä½Ê6iÀÃ>̈iÊ{ääÊëÊÃÜ>̅iÀÊÜÉL>ÌÊÀii U n™äÊ«ÌÊvœÀ>}iʅ>ÀÛiÃÌiÀÊÜÉ nnä7Ê«ˆVŽ‡Õ«Ê…i>` UÊ nnä7ÊÎȻʅ>ÀÛiÃÌiÀʅi>`iÀ UÊ ÊÓÊÀœÜÊ>`ÕÃÌ>LiÊVœÀ˜Ê…i>`iÀ HAYING EQUIPMENT: UÊ­Î®Ê Ê ,ÇnäÊÀ`ÊL>iÀà UÊ£Ó½Ê Ê{™™Ê…Þ`ÀœÊÃ܈˜}ʓœ‡Vœ UÊ£Ó½Ê Ê{™xʅ>ÞLˆ˜iÊÃɘÈäx£nn UÊ£È½Ê >ÃiÊnÎnäʅÞ`ÀœÊÃ܈˜}ʓœ‡Vœ UÊ}Ê-…ˆi`Ê,iVœ˜ÊÊÀiVÀˆ“«iÀÊÜɅÞ`Ê`iviV̜ÀÊňi`Ã]Êx{äʫ̜ UÊ-ˆÌÀiÝÊÈÊ܅iiÊÀ>ŽiÊÃɘnÓÎäÇ UÊÓÊ܅iiÊÀ>ŽiÊÃɘ£äÇÈ UÊL>iÊÌÀ>ˆiÀÊUÊL>iÊiiÛ>̜À LIVESTOCK RELATED ITEMS: UÊ ÊÎxnʅ>““iÀʓˆÊÜÉ«ÜÀÊL>iÊvii`]Ê£äääʫ̜]ÊÓÊÃVÀii˜Ã]Ê Vœ“«iÌiʅÞ`ʏœ˜}Ê՘œ>`Ê>Õ}iÀÊ­ˆvÌ]ÊÃ܈˜}]Ê`ÀˆÛi®]ÊÃɘn£xÇÓä UÊÊ£ÓxäʓˆÝʓˆÊÜÉÃÕ««i“i˜Ìʅœ««iÀ]Ê£äääʫ̜ UÊ>À“ʈ˜}ʓœ`iÊÈäÊiiVÌÀˆVʅ>““iÀʓˆÊÜÉx…«Ê£«…ÊÓÓäۜÌʓœÌœÀ UÊ*>À̘iÀň«Ê7i`ˆ˜}Ê, ‡xäÊL>iÊ«ÀœViÃÜÀÊÜÉÎÊLi>ÌiÀÃ]ÊÃivʏœ>`ˆ˜}]Êx{äʫ̜]Ê­}Àˆ˜`ÃÊLœÌ…ÊÀœÕ˜`Ê>˜`ÊõÕ>ÀiÊL>iî UÊ,i>Ê˜`ÕÃÌÀˆiÃÊ«œÀÌ>Liʅ>˜`ˆ˜}ÊÃÞÃÌi“ÊÜÉ>Õ̜ÊV>ÌV…Ê…i>`Ê}>Ìi]Ê £È½Ê/ÕL]ʣȽÊ>`ÕÃÌ>LiÊ>iÞÊ܈̅Ê̅ÀiiÊ>VViÃÃÊ«>˜iÃÊ>Ìʅi>`Ê}>Ìi]Ê L>VŽÊÕ«ÊÃ̜««iÀÃ]Ê«>«>̈œ˜ÊV>}iʈ˜Ê>iÞ]ʅˆÌV…Ê>˜`Ê܅iiÊŽˆÌ

UÊ£ä½Ýn½Êœ>`iÀʓœÕ˜Ìʓ>ÌiÀ˜ˆÌÞÊ«i˜ÊÜÉ œÀ̅Ê-Ì>ÀÊ>Õ̜ÊV>ÌV…Ê…i>`Ê }>Ìi]ʓœÕ˜ÌÃÊ̜Ê ʵՈVŽÊ>ÌÌ>V… UÊÀÊ-µÕiiâiÊV…ÕÌiÊÜÉ>Õ̜ÊV>ÌV…Ê…i>`Ê}>ÌiÊUʅi>`Ê}>Ìi UÊȘ}iÊ>˜ˆ“>Ê`ˆ}ˆÌ>ÊÃ̜VŽÊÃV>i UÊ ÊǙäÊÌÉ>ʓ>˜ÕÀiÊëÀi>`iÀÊÜÉȘ}iÊLi>ÌiÀ]Ê£äääʫ̜ UÊÊÓäxÊÃÉ>ʓ>˜ÕÀiÊëÀi>`iÀ]ÊÃɘÓäx£Èä UÊ>««ÀœÝÊÓxäÊvi˜ViÊ«œÃÌà UʭǮʈ>“ˆÊ7i`ˆ˜}ÊL՘ŽÊvii`iÀà Uʭήʣä½Ê“iÌ>Êvii`ÊÌÀœÕ}…à UÊ­{®ÊÓn½Ê,>˜V…iÀÃÊ7i`ˆ˜}ÊL՘ŽÊˆ˜iÊvii`iÀà UÊ­Ó®Ê,ˆÌV…ˆiÊ£xäʅi>`ÊÃ̜VŽÊÜ>ÌiÀiÀà SEED & TILLAGE EQUIPMENT: UÊ£Ó½ÊÕÌV…Ê>ÃÌiÀʜvvÊÃiÌÊ`ˆÃVÊÜɘœÌV…i`ÊvÀœ˜ÌÊ>˜`ÊӜœÌ…ÊÀi>ÀÊL>`ià UÊÓn½Ê >ÃiÊÇÓääʅœiÊ«ÀiÃÃÊ`ÀˆÊÜÉ̜“ÊiÌʜ«i˜iÀÃ]ÊÀÕLLiÀÊ «ÀiÃÃÊ܅iiÃ]ʓ>ÀŽiÀÃ]Êv>V̜ÀÞÊÌÀ>˜Ã«œÀÌ UÊÓ{½Ê

Êvˆi`ÊVÕÌ UÊә½Ê ÕÅÊœ}Êvˆi`ÊVÕÌ UÊÓx½Ê

ÊÓ£xÊ`ii«Ê̈>}i UÊ i}i“>˜ÊÈÊÞ`ʅÞ`ÊÃVÀ>«iÀ UÊ i}i“>˜ÊvœÀŽÊÌÞ«iÊÃ̜˜iÊ«ˆVŽiÀ UÊ­Ó®Ê ÀœÜ˜ÊvœÀŽÊÌÞ«iÊÃ̜˜iÊ«ˆVŽiÀà Uʓ>ÀŽiÀÃÊvœÀʏi݈‡ œˆÊ>ˆÀÃii`iÀ UÊ£™½ÊiÝÌÀ>ʅˆ}…Ê>ՏʏÊÃii`ÊEÊviÀÌÊÌi˜`iÀÊÜÉÀi>ÀÊ`ˆÃV…>À}iÊ>Õ}iÀà UÊ{ÊÀœÜÊ Ê{™{ÊVœÀ˜Ê«>˜ÌiÀʜ˜ÊÎÈ»ÊÀœÜÃÊÜÉviÀ̈ˆâiÀÊ>ÌÌ>V…“i˜Ì TRAILERS: UÊ,>ˆ˜LœÜÊ`œÕLiÊ܈`iÊ؜ܓœLˆiÊÌÀ>ˆiÀ INDUSTRIAL EQUIPMENT: UÊ 7ÊŜ«ÊLՈÌÊ ÊLœÝÊL>`iÊÃVÀ>«iÀ SHOP EQUIPMENT & TOOLS: UÊ >}iÊV>ÃÌʈÀœ˜Ê>ˆÀÊVœ“«ÀiÃÜÀÊÜə…«Êœ˜`>Êi˜}ˆ˜i œ`ˆ>ŽÊ- {äää8-ÊiiVÌÀˆVÊÃÌ>ÀÌÊ}i˜iÀ>̜ÀÊÜÉx…«Êœ˜`>Êi˜}ˆ˜i RECREATIONAL & LAWN and GARDEN ITEMS: UÊnÝnÊÀ}œÊ>“«…ˆLˆœÕÃÊ/6 UÊ ÊÓ£{ʏ>ܘÊÌÀ>V̜ÀÊÜÉ{n»Ê“œÜiÀÊ`iVŽ]Ê؜ÜLœÜiÀ UÊ«>iÌÃʜvÊ«>̈œÊLœVŽÃÊ>˜`ÊÜ>ŽÊÜ>ÞÊÃ̜˜iÃ

SATURDAY APRIL 28th 9:00am

DIRECTIONS: : Sale will be held at Fraser Auction Service Ltd. sales yard ¼ mile north of the junction of highways #1 & #10 on Wheatbelt Road. Brandon, MB THIS SALE WILL FEATUREÊ : *Farm Equipment *Industrial Equipment *Trucks & Trailers *Livestock Handling Equipment *Vehicles *Lawn & Leisure *Shop Equipment & Tools *3pt hitch & Acreage Equipment *Government Surplus *Plus misc. Pallet Lots & more

>ÊœÕÀʜvvˆViʘœÜÊ̜ÊVœ˜Ãˆ}˜Ê̜Ê̅ˆÃÊÛiÀÞÊÜiÊ>ÌÌi˜`i`Êi>ÀÞÊëÀˆ˜}Ê Vœ˜Ãˆ}˜“i˜ÌÊ>ÕV̈œ˜°Ê£‡nää‡{n·xnxÈʜÀÊ ‡>ˆÊœvvˆViJvÀ>ÃiÀ>ÕV̈œ˜°Vœ“ MORE EQUIPMENT IS BEING ADDED TO THIS SALE DAILY! FOR A WEEKLEY UPDATED LIST WITH FULL DETAILS AND PICTURES GO TO: www.fraserauction.co“ EARLY EXAMPLES OF OUR SALE LIST ARE: TRACTORS UÊÓÓx*Ê-Ìiˆ}iÀÊ i>ÀÊ >ÌÊ*/ UÊ£™nnÊ >ÃiÊÊx£ÎäÊ7Ê/À>V̜À]ÊnÈÊ*]ÊÜÉÊÎÊ«Ì]Ê««ÀœÝÊ{™ääʅÀÃÊŜ܈˜} UÊ Ê{ÓÎäÊ/À>V̜À]Ê£ääÊ*]Ê>««ÀœÝÊ£xäääʅÀà UÊÓÇ{xÊ>ÃÃiÞ]Ê£{ÎÊ* UÊ Ê{äÓäÊÜÉœ>`iÀ]ʙxÊ* UÊ£™xnÊ Ê/À>V̜À SEED & TILLAGE: UÊÓ{½ÊÊÈÓääÊ

Ê*ÀiÃÃÊ Àˆ]ÊÀÕLLiÀÊ«ÀiÃÃÊ܅iiÃ UÊÓӽʜÀÀˆÃÊ££ÊœiÊ Àˆ UʣȽÊÊÈÓääÊ

Ê*ÀiÃÃÊ Àˆ]ʏÜ>ÞÃÊ-…i``i`]ÊÊÀÕLLiÀÊ«ÀiÃÃÊ7…iiÃ UÊÇÓ½ÊiÀ“>˜Ê>ÀÀœÜà UÊœÀÀˆÃÊx£™Ê /ÊÜÉÊ>ÀÀœÜà UÊ{n½Ê‡>ÀÌʘ`i«i˜`i˜ÌÊ*>VŽiÀÃ]Ên»Ê-«>Vˆ˜}]ÊλÊ,ÕLLiÀÊ«>VŽiÀ UÊiÀ̈ˆâiÀÊ>««ˆV>̜Àà UʈµÕˆ`ÊviÀ̈ˆâiÀÊV>``ˆià UÊ ÎÊÜ>}œ˜Ã GPS SYSTEMS: UÊ,>Ûi˜Ê‡*+ÊEʜ՘ÌÊEÊՈ`iÊ >ÀÊ SEMI TRUCKS: UÊ£™™{ÊœÀ`ÊiÀœ“>Ý]ʙäää]Ê >ÌÊ ˜}]Ê£ÎÊ-«ii`Ê/À>˜Ã]Ê7iÌʈÌ]Ê UÊ£™n£Ê/œ«ÊˆVŽÊÀ>ÛiÊ/ÀÕVŽ]Ê/>˜`i“]Ê£{½Ê œÝ UÊ/ÀÕVŽÊEÊ/À>ˆiÀ VEHICLES: UÊÓä£äÊœÀ`Ê ÃV>«iÊ8/Ê-«œÀÌÊ1̈ˆÌÞ]Ê{Ê œœÀ]Ê{Ê Þ]Ê££ÈÈÈ°Çʎ“ÃÊŜ܈˜} UÊÓääxÊ …iÛÊ œL>ÌÊ-]Ê{Ê œœÀ]Ê{ÊVޏ]ÊÀ>Þ]Ê-É Ê££{ä™äʎ“à UÊ£™™ÇÊœÀ`Ê£xäÊ-Ê8/Ê-Õ«iÀÊV>LÊ/ÀÕVŽ]ÊnÊ Þ]Ê ÀœÜ˜]ÊÎÓ{ÎÓxʎ“à UÊ£™™ÇÊ …iÛÀœiÌÊÉ6Ê£äÉ£xääÊ{³Ê >L]Ê ÝÌi˜`i`Ê >LÊ/ÀÕVŽ]ÊÊnÊ Þ]Ê 7…ˆÌi]Ê{Èä{{Çʎ“ÃÊ-…œÜˆ˜}]Ê6 \Ó £™,Î6£ÓÎÈÎ{ä UÊ£™n™Ê 7ÊÎÓx£Ê >LÀˆœiÌÊ œ˜ÛiÀ̈LiÊ >À]ÊÈÊ Þ]Ê7…ˆÌi]Ê£ÎänÎÓÊ

Ž“ÃÊ-…œÜˆ˜}]Ê6 \Ê7  ÓÎä8nnÈ{x{n UÊ£™nnÊ/œÞœÌ>Ê£É{Ê/œ˜Ê/ÀÕVŽ]Ê{ÊÝÊ{]Ê6ÈÊ ˜}]Ê-Ì`Ê/À>˜Ã]ÊΣÊÝÊ£ä°xä,Ê£xÊ /ʜ˜ÊÕ“ˆ˜Õ“Ê,ˆ“Ã]ÊÎ{£xÓÓÊʈiÃÊ-…œÜˆ˜}Ê "/Ê,1  ]Ê "Ê 9TRAILERS: UÊ£™nxʈ`>˜`Ê iÞÊ Õ“«Ê/À>ˆiÀ UÊÓää™Ê˜ÌiÀÃÌ>ÌiÊv}ʘV°Ê Փ«iÀʈÌV…Ê >À}œÊ/À>ˆiÀ]Ê£nÊ£ÉÓ½ÊÝÊǽÜÊ ÝÊǽ…]ÊΣÇxʎ}Ê­ÇäääʏL®Ê67,]Ê6 \Ê£1xääÓ8n£äÈ{ÇÎn UÊÓääÈÊÊÊEÊÊ Õ“«Ê1̈ˆÌÞ]Ê£Ó½ÊÝÊǽʭ Փ«iÀʈÌV…®]Ê iVÌÀˆVÊ"ÛiÀÊ Þ`Ê Õ“«]Ê,œÊ/>À«]Ê-ˆ`iÊ ÝÌi˜Ãˆœ˜Ã]ÊÓÊÜ>ÞÊ/>ˆ}>Ìi UÊÓääÓÊ՘V̈œ˜Ê,6ʘV]Ê Õ“«iÀʈÌV…Ê >À}œÊ/À>ˆiÀ]Ê£™½ÊÝÊǽÜÊÝÊÈÊ £ÉÓ½…]ÊΣÇȎ}Ê­ÇäääʏL®Ê67,]Ê6 \ÊÓ™ -ÈÓÈ{Ó7ä{Ǚ££ UÊÓ{½Êx̅Ê7…iiÊ>ÌÊ iVŽÊ/À>ˆiÀ UÊx½ÊÝÊ£ä½Ê>ՏÊ>ÀŽÊ/À>ˆiÀÊ >À}œ UÊ-Ìi…Ê/œÜÊ œÞ]Ê67,ʇÊә™™ÊLÃ]Ê,>“«ÃÊEÊ7…iiÊ-ÌÀ>«Ã RECREATIONAL VEHICLES & MOTORCYCLES: UÊÓääÎÊœÕÀÊ7ˆ˜`ÃʘÌiÀ˜>̈œ˜>ÊœÌœÀÊ œ>V…]Ê >ÃÃÊnÊ Þ]Ê ÀœÜ“]Ι{ÎÇ°Îʎ“ÃÊŜ܈˜}]Ê6 \£ä£Ó{ÇÓ UÊÓääÇÊ>ÀiÞÊ >ۈ`ܘÊ-œvÌ>ˆ]Ê ÕÃ̜“Ê«iÊ>˜}iÀÊ>˜`iL>ÀÃ]Ê ÕÃ̜“Ê ݅>ÕÃÌ]Ê ÕÃ̜“ÊÀˆ«ÃÊEÊ*i}Ã]ʙÈÊ ÕÊi˜}ˆ˜i]Ê{ÎxÎʎ“ÃÊŜ܈˜}] UÊÓää™Ê"̅iÀÊœÀÀiÃÌÊ,ˆÛiÀÊ Ê/i˜ÌÊ/À>ˆiÀ]Êœ`iÊ*Ó£ääʇÊ*œ˜Þ UÊ£™nxÊœ˜`>ÊÎÊ܅iiiÀÊÓää-]Ê œÌÊ,՘˜ˆ˜}]ÊÈΣʈiÃÊŜ܈˜}]Ê 6 ʇÊÎ/ äxΙ{ÎÎÎä™]ʘœÊŽiÞÊÀiµÕˆÀi` UÊÎÊ܅iiÊṎˆÌÞÊV>ÀÌ HAYING: UÊ iÜÊ`i>Ê{nÈxÊ >iÀ]Ê£™™{ UÊ-ˆ>}iÊ7>}œ˜ INDUSTRIAL: Uʈ`Êxä½ÃÊÊ/ ™Ê À>܏iÀÊÜÉʙ½Ê >`i]ÊÀiLՈÌÊvˆ˜>Ê`ÀˆÛiʜ˜Êœ˜iÊÈ`i BUILDING MATERIALS: UÊ>À}iÊ+Õ>˜ÌˆÌÞʜvÊ-ÌiiÊ >``ˆ˜} SHOP ITEMS & TOOLS: UÊ-…œ«ÊÌi“Ã]Ê/œœÃ]Ê >ÀLÕÀi̜Àà UÊ-i“ˆÊœ>`ʜvÊ*>iÌi`Ê*>ÀÌÃÊEÊ/œœÃ MISCELLANIOUS ITEMS: UÊ­È®Ê>}˜Õ“Êœ`Ê-Ìi>“Ê i>˜iÀÃÊ­ iÜ® UÊ­Ó®Ê>}˜Õ“Ê-Ìi>“Ê i>˜iÀÃÊ­ iÜ® UʭήÊ*>ÌiÊ œ“«>V̜ÀÃÊ­ iÜ®

FOR MORE INFO CONTACT OWNER

FRASER AUCTION SERVICE LTD.

iÊ-“ˆÌ…ÊÓä{‡xÎ{‡ÇÇnÎ À>ÃiÀÊÕV̈œ˜Ê-iÀۈViÊ Óä{‡ÇÓLJÓää£

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

Brandon, Manitoba

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL:office@fraserauction.com Auctioneer: Scott Campbell

REMEMBER IT’S JUST A SHORT HAUL TO THE KILLARNEY AUCTION MART WHERE WE HAVE EXCELLENT BUYER SUPPORT AND CUSTOMER SERVICE IS NUMBER ONE! Killarney Auction Mart Ltd. is a family owned and operated livestock auction service. It is owned and operated by Scott & Lori Campbell who also own and operate Fraser Auction Service Ltd. out of Brandon MB. Since buying The Killarney Auction Mart in November 2007 we have done extensive upgrading and renovations to both the back end and the front end of our yards. We run fully computerized sales, and are covered by all the major buyer orders and have very strong support from local farm buyers as well. We work hard to give you the best possible market for your cattle. Lori & Scott Campbell owners of The Killarney Auction Mart are pleased to have Mr Allan Munroe as the manager of the auction mart. Allan Munroe has been involved in the cattle business his entire life. After growing up on a cow calf operation in Eastern Ontario, he completed an Animal Science degree at the Univer-

Scott Campbell C: (204) 724-2131

sity of Guelph. While a student he worked at cattle operations at Williams Lake, BC, and across Australia. After graduation from university he moved to High River, AB. where he was herdsman for a large purebred Horned Hereford/Angus operation. Allan brings a wealth of marketing knowledge and he can be reached anytime at Killarney Auction Mart 204-523-8477. Al likes nothing better than talking about the cattle industry and would be happy to give you his marketing advise. Regular sales every Monday at 9:00am with special sales held throughout the year as advertised. Cattle are sold in the order they are delivered in to our yard. Sunday delivery hours 8am - 8pm. Scott Campbell Livestock Dealer Licence #1361. For marketing information or an on farm look at your cattle or to discuss booking your cattle into one of our future sales, be sure to call one of our representatives below:

Allan Munroe C: (204) 523-6161

Warren Wright C: (204) 534-7997

FOR MORE INFO OR TO CONSIGN CALL 204-727-2001


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE B9

UNRESERVED FARM EQUIPMENT and TACK AUCTION FOR THE ESTATE of ANDRE GAGNON BALDUR, MB.

WEDNESDAY APRIL 25TH 10:00am

DIRECTIONS: From Baldur, MB. East 6.5kms to Glenora Road Turn North 1.6kms Turn West 1.6kms to sale site. (Lane angles off main road to North/West.) Watch for auction signs sale day. ORDER OF SALE:Ê 10:00am - misc. smalls, tools, and shop equipment, tanks, 3pt equipment, tack Approx 1:00pm – major equipment

CRAWLER LOADER: UÊ ÊÎxä‡ Ê«œÜiÀÊňvÌÊVÀ>܏iÀʏœ>`iÀÊÜÉ̜œÌ…ÊLÕVŽiÌ]Ê …Þ`ÊÀiÛiÀÃi]ÊŜ܈˜}ÊÎäÎ{…ÀÃ]ÊÃɘ£xÈÇÈ{/Ê­À>ˆÃÊEÊ Ã«ÀœVŽiÌÃÊÀi«>Vi`®Ê­£‡œÜ˜iÀÊ՘ˆÌ®

FEEDERS & TROUGHS: UʭήʓiÌ>Êvii`ÊÌÀœÕ}…à UÊ­x®ÊÀœÕ˜`ÊL>iÊvii`iÀà UÊ­Ó®Ê/œ“LÃ̜˜iÊvii`iÀÃ

TRACTORS: U Ê/£ÎäÊ7 ÊÜÉ Õ…iÀʏˆi`ÊǙxʏœ>`iÀ]Ê {£ÎӅÀÃÊŜ܈˜}]Ê£në`Ê܈̅ÊÅÕÌ̏iÊňvÌ]ÊΫÌ]Ê{Ê Ài“œÌiʅÞ`]Ê >LÊ-Õëi˜Ãˆœ˜]Ê£n°{,ÎnÊȘ}iÊÀi>À]Ê ÎnäÉnx,ÓnÊvÀœ˜Ì]ÊÃɘ ÓÓÇxÈÓ U£™nÓÊ7…ˆÌiÊӇ£ÎxÊÓ7 ÊÌÀ>V̜ÀÊÜÉV>L]Ê£n°{‡ÎnÊ `Õ>Ã]ÊΫÌ]ÊŜ܈˜}Êș™ä…ÀÃ]ÊÃɘәnÓxȇ{£x UI œVŽÃ…ÕÌÌÊ£ÎxäÊ}>ÃÊÓ7 ʜ«i˜ÊÃÌ>̈œ˜ÊÌÀ>V̜À]ʣȰ™‡ ÓnÉ£{‡ÓnÊȘ}iÃ]ÊŜ܈˜}Ê£xäȅÀÃ]ÊÃɘÓnÎä{xÈxÊ U œVŽÃ…ÕÌÌÊ£Èxäʜ«i˜ÊÃÌ>̈œ˜ÊÓ7 ÊÌÀ>V̜À]Ê£n°{‡Î{Ê Ãˆ˜}iÃ]ÊŜ܈˜}ÊÈäÇDžÀÃ]ÊÃɘÓxn‡{ÓÓx

MANURE SPREADERS: UÊ Õ>ÊÈääʓ>˜ÕÀiÊëÀi>`iÀ UÊÊȘ}iÊLi>ÌiÀʓ>˜ÕÀiÊëÀi>`iÀ UÊ >ÃiÊ£ÎäÊȘ}iÊLi>ÌiÀʓ>˜ÕÀiÊëÀi>`iÀ

HAYING & HARVEST EQUIPMENT: UÓääÎʣȽÊ>V`œ˜ÊxäÓäʓœÜiÀÊVœ˜`ˆÌˆœ˜iÀÊ Ãɘ£xÓÇx™Ê­œ˜ÞÊ`œ˜iÊxä‡ÈäÊ>VÀiÃÉÞÀʇÊiÝVii˜Ì® UÓääÓÊ ÊxÈÇÊÀ`ÊL>iÀÊÜÉi}>Ê7ˆ`iÊ«ˆVŽÕ«]Ê>««ÀœÝÊ ££]äääÊL>iÃ]ÊÃɘ£™äÓ™Ó U™‡Ü…iiÊ6ˆVœ˜Ê£äxäÊÀ>Ži U£™nxÊ7…ˆÌiÊn™ÓäÊ`ÏʅÞ`ÀœÊVœ“Lˆ˜iÊÜÉV…œ««iÀ]Ê ÀiÛiÀÃiÀ]ÊÃ̜˜iÊÌÀ>«]ÊiÀœiÊÎnnÊ«ˆVŽÕ«]ÊÓn‡ÓÈÊÀÕL‡ LiÀÊÃɘx‡Ó£äÓ]ÊŜ܈˜}Ê£xÇÇʜÀˆ}ˆ˜>Ê…Àà U£n½Ê6iÀÃ>̈iÊ{ääÊëÊÃÜ>̅iÀÊÜÉL>ÌÊÀii]ÊVÀœ«ÊˆvÌiÀà UÓx½ÊÊÇÓxÊ«ÌÊÃÜ>̅iÀÊÜÉÀÕLLiÀÊÏ>ÌÊV>˜Û>à UÃÜ>̅iÀÊÌÀ>˜Ã«œÀÌÊvœÀÊ6iÀÃ>̈iÊ{ää Un½Êœi˜`iÀÃÊ«œÞÊÃÜ>̅ÊÀœiÀ SEED & TILLAGE EQUIPMENT: U{ä½Ê

ÊÓǙÊvˆi`ÊVՏÌÊÜÉ·L>Àʅ>ÀÀœÜà UÎνÊœÀÀˆÃÊ*‡™£ÓÊ`ii«Ê̈iÀÊÜə»Êë>Vˆ˜}]Ê ÎʎˆÌ]Ê Ì>˜ŽÊ…ˆÌV…]ʓœÕ˜Ìi`ʅ>ÀÀœÜà UÓ£½Ê7…ˆÌiÊÓxÈÊÌ>˜`i“Ê`ˆÃŽÊÜɘœÌV…i`ÊvÀœ˜ÌÊEÊ Ã“œœÌ…ÊL>VŽÊL>`ià U­Ó®ÊÊÇÇäÊx‡LœÌ̜“Ê«œÜÊÜÉÌ>˜`i“Ê…ˆÌV… UÊÓä½ÊÊÈÓäÊ­ÓÝ£ä½Ã®Ê É Ê«ÀiÃÃÊ`ÀˆÃÊÜÉÃÌiiÊ «>VŽiÀÃ]ʓ>ÀŽiÀà UÊÇä½Ê-Փ“iÀÃʅ>ÀÀœÜÃÊÜÉxääÊ}>Ê«œÞÊÌ>˜Ž UÊÈä½Ê6ˆVœ˜ÊnääÊ}>Ê«ÌÊëÀ>ÞiÀÊÜɫ̜ʫՓ«]ÊV…i“°Ê “ˆÝ]ÊÀˆ˜ÃiÊÌ>˜Ž UÊÎȽÊœÀÀˆÃÊÀœ`ÊÜii`iÀÊÜɅ>ÀÀœÜà UÊ`ÀˆÊV>ÀÀˆiÀ TRAILERS: UÊÓn½Ê1˜ˆÛˆÃˆœ˜Ê̈Ìˆ˜}ÊL>iÊÜ>}œ˜ÊÜÉ܈˜V…ÊEÊnÊ̈ÀiÃÊ ­>ÃœÊ…>Տi`ʅˆÃÊ ÊÎxä‡ ÊVÀ>܏iÀ® UÊ£™nÓÊ£x½Ê7އiiÊx̅Ê܅iiÊÓʅœÀÃiÊÌÀ>ˆiÀÊÜÉÌ>VŽÊ Vœ“«>À̓i˜Ì]ÊL>iÊÀ>VŽ]ÊiÝÌiÀˆœÀÊ̈iʜÕÌÃ]ÊÃɘ nÓä£Î UÊ£™nÎÊ£x½Ê>ÛiÀˆVŽÊx̅Ê܅iiÊÃ̜VŽÊÌÀ>ˆiÀÊÜÉÓÊVœ“‡ «>À̓i˜ÌÃ]ÊÃɘ£7<£ÓÎÓ™nΣÓäxän

AUGERS: UÊn»ÊÝ{ä½Ê>À“ʈ˜}Ê*/"Ê>Õ}iÀ UÊÇ»ÝÊÎȽÊ7iÃÌvˆi`Ê>Õ}iÀÊÜɣȅ«Êœ…iÀÊ}>à UʭӮʜ`iÀÊ>Õ}iÀà OTHER EQUIPMENT: UÊΫÌÊ7ˆŽœ“ˆÊÇä£Ê«œÃ̇…œiÊ>Õ}iÀÊÜÉÓÊLˆÌÃÊ­£ä»ÊEÊÈ»® UÊn½Ê>À“ʈ˜}ÊΫÌÊL>`i UÊψ«ÊÌ>˜ŽÊÜÉ££ä6ʈ‡,ˆÌiʫՓ« Uʏˆi`Ê{ä½ÊL>iÊiiÛ>̜À UÊÀˆi˜ÃʣDž«Ê>ܘÊÌÀ>V̜ÀÊÜÉ{n»Ê“œÜiÀÊ`iVŽ]Ê{x»Ê ̈iÀ]ÊÃɘääǙnÇ UÊܓiÊ>˜ÌˆµÕiʈ“«i“i˜ÌÃÊ­`Փ«ÊÀ>Ži]Ê«œÜÃ]ÊiÌV® UÊ­Ó®Ê7iÃÌv>ˆ>ÊiiVÌÀˆVÊVÀi>“ÊÃi«>À>̜ÀÃÊÜÉLœÜÃ]ÊiÌV TANKS: UÊÎääÊ}>Ê`ÏÊÌ>˜ŽÊEÊÃÌ>˜` UÊxääÊ}>Ê`ÏÊÌ>˜ŽÊEÊÃÌ>˜` UÊ ÊÃÌiiÊÜ>ÌiÀÊÌ>˜Ž HORSE DRAWN ITEMS: UÊ{Ê܅iiÊ,œ>`ÃÌiÀÊLÕ}}ÞÊ­vœÀÊ>VŽ˜iÞÊ«œ˜Þ®ÊȘ}iÊ …œÀÃi]ÊÀÕLLiÀÊ܅ii UÊ{Ê܅iiÊ«>À>`iÊLÕ}}Þ]ÊÓÊÃi>ÌiÀ]Ê`œÕLiʅœÀÃi]ÊÀÕL‡ LiÀÊ܅ii UÊ{Ê܅iiÊ}À>ˆ˜ÊÜ>}œ˜]ÊÓʅœÀÃi]ÊÀÕLLiÀÊ܅ii UÊÓÊ܅iiÊ-ՏŽˆiÊÜÉܜœ`i˜Ê܅iiÃ]ÊȘ}iʅœÀÃi UÊÓÊ܅iiÊ-ՏŽˆiÊÜÉÀÕLLiÀÊ܅iiÃ]ÊȘ}iʅœÀÃi UÊȘ}iʅœÀÃiÊVÕÌÌiÀÊÜÉȘ}iÊÃi>Ì UÊȘ}iʅœÀÃiÊVÕÌÌiÀÊÜÉLÕ``ÞÊÃi>Ì UÊǽÊVՏ̈Û>̜ÀÊÜÉÃÌiiÊ܅ii]ÊvÀœ˜ÌÊV>ÃÌiÀà UÊÓÊvÕÀÀœÜÊ«œÜ UÊ`Փ«ÊÀ>Ži UÊ܅iiÊVœÛiÀÃÊvœÀÊLÕ}}Þ UÊÃiÌʜvÊܜœ`i˜Ê œLÏiˆ}…ÃÊ­}œœ`ÊÅ>«i® SADDLES & TACK: UÊ >}iÊ"Àˆ}ˆ˜>ÊŜÜÊÃ>``iÊÜÉLÀˆ`i]ÊLÀi>ÃÌÊVœ>À UʈiÃÊ ˆÌÞÊ->``iÀÞÊ œ°Ê­"Àˆ}ˆ˜>Ê œ}}Å>Ê->``i®Ê ˜ÌˆµÕi UÊ œ˜˜œÞÊ ÀœÃ°Ê->``iÀÞÊ œ°Ê->``iÊÜÉ ˆ>“œ˜`Ê™Ê À>˜`ʜ˜ÊÃ>``iÊ­˜ÌˆµÕi®ÊVœ“iÃÊ܈̅ʅˆÃ̜ÀÞÊ`œVՓi˜‡ Ì>̈œ˜°Êi>ÃÕÀiÃÊÓλÊ>VÀœÃÃÊvÀœ˜ÌÊ­VœÌÊLÀi>Žˆ˜}ÊÃ>``i®°Ê /œÊÀi>`ʅˆÃ̜ÀÞʏiÌÌiÀÊ«i>ÃiÊVˆVŽÊ̅iÊ* ÊLÕÌ̜˜Ê>ÌÊ̜«Ê œvÊ«>}iÊ̜Ê`œÜ˜œ>`ʏiÌÌiÀʏivÌÊLÞÊÀ°Ê>}˜œ˜° UÊÜiÃÌiÀ˜ÊÃ>``iÊUÊ7…ˆÌ“>˜Ê ˜}ˆÃ…ÊÃ>``i UÊ“iÀˆV>˜Ê->``iÀÞÊ ˆÀViÊÊÈ{ä°xÊÜiÃÌiÀ˜ÊÃ>``i

UÊÕÃÌÀ>ˆ>˜Ê-̜VŽÊÃ>``i UÊ >VŽÊEÊ-ˆÛiÀÊÜiÃÌiÀ˜Ê«>À>`iÊÃ>``i UÊ"Àˆ}ˆ˜>Ê >“œÀʓœ`iÊÓxÊÀœ«ˆ˜}ÊÃ>``i UÊÜiÃÌiÀ˜ÊÃ>``iÊUÊ ˜}ˆÃ…ÊÃ>``i UÊÃiiV̈œ˜Êœvʅ>ÌiÀÃÊUÊÃiiV̈œ˜ÊœvÊLÀˆ`ià UÊÃiiV̈œ˜ÊœvÊÌ܈ÌV…iÃÊUÊ>Àˆ>Ìà UÊȘ}iÊ`ÀˆÛˆ˜}ʅ>À˜iÃà UÊ>ÃÜÀ̓i˜Ìʜvʅ>À˜iÃÃÊëÀi>`iÀà UÊLiÞÊL>˜`ÊvœÀÊȘ}iʅ>À˜iÃà UÊŜÜʅ>ÌiÀÃÊUʅœÀÃiÊL>˜ŽiÌà UÊÓʅœÀÃiÊ«œ˜Þʅ>À˜iÃÃÊUʏˆ}…ÌÊ`ÕÌÞÊÓʅœÀÃiʅ>À˜iÃà UÊΈ`ÊLœœÌÃÊUÊ«>ˆÀʜvʓÕââiÃÊUÊ>ÃÜÀ̓i˜ÌʜvÊÃ̈ÀÀÕ«Ã UÊ>ÃÜÀ̓i˜ÌʜvÊ œÕLiÊ/ÀiiÃ]Ê œ>ÀÃ]Ê-VœÌV…Ê/œ«Ã]Ê

…>Ûiâ UÊ iÌ>ÊÌi>“Ê`ÀˆÛˆ˜}ʏˆ˜iÃÊUÊ­Ó®ÊÓʅœÀÃiÊܜÀŽÊ…>À˜iÃà UÊȘ}iʅœÀÃiÊܜÀŽÊ…>À˜iÃÃÊUÊÌ>ˆÊiÝÌi˜Ãˆœ˜Ã UʓˆÃVʅ>À˜iÃà OTHER HORSE & LEATHER RELATED ITEMS: UÊ>˜`ˆÃʏi>̅iÀÊVÕÌÌiÀÊÜÉ£Ó»Ê̅Àœ>Ì UÊÀœÃʜvʏi>̅iÀÊUÊ iVÌÀœ‡Àœœ“ÊÃ̜VŽÊÛ>VÕՓ UÊ-՘Li>“Ê ˆ«Ê>ÃÌiÀÊÃ̜VŽÊVˆ««iÀà UÊÌ>VŽÊLœÝiÃÊUÊ̅ÀœÜˆ˜}ÊÀœ«iÃÊUÊiÀÀˆiÀ½ÃÊ>«Àœ˜ UÊiÀÀˆiÀ½ÃÊ̜œÃÊ>˜`ÊÃÕ««ˆià UÊÃiiV̈œ˜ÊœvʅœÀÃiÊŜiÃ]Ê«>`Ã]ʘ>ˆÃ]ÊiVÌÊ­˜iÜÊEÊ ÕÃi`® UʅœœvÊÌÀˆ““iÀÃÊUÊ­£{®Ê{½ÝȽÊÀÕLLiÀÊvœœÀʓ>Ìà ANTIQUES: UÊ­£Ç®ÊǽÊÃiV̈œ˜ÊœvÊ>˜ÌˆµÕiʓiÌ>Êvi˜ViÊ«>˜iÃ UʈViÊÃ>ÜÊEÊ̅œ˜}ÃÊUÊ-VÞ̅iÊUÊ7>ÌiÀœœÊÃV>i UÊ«œÃÌÊ`ÀˆÊUÊLœÜÊÃ>ÜÃÊUʅ>ÞÊÃ>Ü UÊ̜ÀV…ÊUÊVÀi>“ÊV>˜ SHOP ITEMS, PARTS & MISC: UÊVŽ>˜`ÃÊ ‡Óxä*Ê É

ÊÜi`iÀ UÊ-“ˆÌ…Ê,œiÃÊÊxÉnÊqÊ£ÈÊë`Ê`ÀˆÊ«ÀiÃÃ]Ê ÎÉ{»ÊV>«ÊÜÉۈÃi UÊ{Ê£ÉÓ»ÊL>˜`Ã>ÜÊ{»ÝȻʅœÀˆâœ˜Ì>Ê“iÌ>ÊVÕÌ̈˜} UÊ->˜LœÀ˜iÊÈäÊ}>ÊÕ«Àˆ}…ÌÊVœ“«ÀiÃÜÀ]£{äÊ«ÃˆÊ UÊ ʺ6ՏV>˜»Ê ʓœ`iÊ6Ê̈ÀiÊV…>˜}iÀ UÊ-̈…ÊV…>ˆ˜ÊÃ>ÜÊUÊ£ä»Ê£…«Ê}Àˆ˜`iÀÊUÊ̜ÀV… UÊ}ÊEÊ>Õ̜ʫ>ÀÌÃ]ÊiÌVÊUÊÌ>À«Ã]ʍ>VŽÃ UÊÓÊ>˜ÛˆÃÊ­£ääLÃÊ«ÕîÊUÊÓʅÕLÃʜ˜ÊvÀ>“ià UÊ`ˆÃŽÊV…>˜}iÀÊUÊ ÊۈÃiÊUÊLˆ}ʅ>ÞÊÌ>À« Uʜ`Ê`ÀˆÊUÊVœ˜ÃÌÀÕV̈œ˜Ê…i>ÌiÀ UÊ ÊiiVÌÊVœÀ`Ã

FOR MORE INFO CONTACT OWNER

 , Ê " Ê Óä{‡xÎx‡Ó£Ó{Ê œÀÊÓä{‡™™n‡Îx{Ó

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


PAGE B10 Manitoba FarmLIFE, Monday, March 12, 2012

FARM EQUIPMENT DISPERSAL FOR DAVID & JUANITA McNISH of WAWANESA, MB

MONDAY APRIL 30th 10:00AM

DIRECTIONS: From #23 hwy at Dunrea, MB. ½ mile west of Dunrea turn off on #23 hwy Turn north 10kms (road jogs a couple times just stay on main road heading north) Turn east 1km into yard. (Signs will be posted sale day) From jct of #2 hwy & PR 340 at Wawanesa, MB. ¼ mile west of Wawanesa on #2 hwy to Tenterfield Road Turn south 5kms to dead end. West 6kms then south to Noble Lake Road. (Road goes ½ mile west then south) Stay on main road going south. Turn west 3kms Turn south 2.5kms Turn east 1km into yard. (Signs will be posted sale day) SIGNS WILL BE POSTED MORNING OF SALE. WATCH FOR SIGNS AND FOLLOW TO SALE! ORDER OF SALE:Ê 10:00AM – 12:00PM (tools, misc, recreation, lawn & garden, smaller livestock items) 12:00PM (riding horses, tack, major equipment) TRACTORS: UÊ£™™xÊ >ÃiÊxÓxäÊ7 Ê££Ó…«ÊÜÉ+ՈVŽiÊÈÈäʏœ>`iÀ]Ê LÕVŽiÌ]Ê}À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊΫÌ]Ê£ÈÊë`ÊÅÕÌ̏iÊňvÌÊ ÌÀ>˜Ã]Ê`Õ>Ê…Þ`]Ê`Õ>Ê«Ìœ]Ê`ˆvvʏœVŽ]ÊÇÓää…ÀÃÊŜ܈˜}] ÊÃɘ£ä{Ó£™Î UÊ£™™£Ê >ÃiÊx£ÓäÊ7 ÊÜÉ >ÃiÊx£äʏœ>`iÀ]ÊLÕVŽiÌ]Ê }À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœÃ]ÊΫÌ]ÊÅÕÌ̏iÊňvÌ]ÊÓÊÀi“œÌiʅÞ`]Ê `Õ>Ê«Ìœ]ÊÃɘ£ä£xÈÈÈ UÊ£™näÊ Ê{{{äÊÌÀ>V̜ÀÊÜɵÕ>`ÊÀ>˜}iÊÌÀ>˜Ã]Ê`Õ>Ê«Ìœ]Ê `Õ>Ê…Þ`]ÊÓä°n‡ÎnÊ`Õ>Ã]Ê£äÎää…ÀÃÊŜ܈˜}Ê­i˜}ˆ˜iÊ ÀiLՈÌÊ>Ìʙxää…Àî]ÊÃɘäÎäÈÓä UÊ Ê{äÓäÊÌÀ>V̜ÀÊÜÉÃޘVÀœÊÌÀ>˜Ã]Ê`Õ>Ê«Ìœ]ÊÎÊÀi“œÌiÊ …Þ`]Êxx{£…ÀÃÊŜ܈˜}]ÊÃɘÓ/n™n™äÊ­˜ii`ÃÊvˆ˜}iÀÃʜ˜Ê «ÌœÊVÕÌV…® UÊ£™ÈÈÊ Ê{äÓäÊÌÀ>V̜ÀÊÜÉÃޘVÀœÊÌÀ>˜Ã]ÊȘ}iÊÀi“œÌiÊ …Þ`]Ê`Õ>Ê«Ìœ]ʙ™ÎȅÀÃÊŜ܈˜}]ÊÃɘ££™£™Ó UÊ£™È{Ê Ê{äÓäÊÌÀ>V̜ÀÊÜÉÊÃޘVÀœÊÌÀ>˜Ã]Ê`Õ>Ê…Þ`]Ê`Õ>Ê «Ìœ]ÊÓxÇDžÀÃÊŜ܈˜}]ÊÃɘÈșxx UÊiœ˜Êœ>`iÀÊÜɓœÕ˜ÌÃÊ̜Ê Ê{äÓä UÊn½Êiœ˜ÊL>`iÊ­Ü>Ãʜ˜Ê Ê{äÓä® HAYING EQUIPMENT: UÊÓää{Ê Ê ,ÊÇnäÊÀ`Ê >iÀÊÜÉ£äää«Ìœ]ÊÃɘȣ™£ä]Ê -…i``i` UÊ£™™ÓÊn{ÈxÊ >ÃiÊÊÀ`Ê >iÀÊÜɈ˜œVՏ>̜ÀÃ]ÊÃÉ ˜ääÇ{Ónn]Ê-…i``i`Ê­ˆ˜œVՏ>̜ÀÃÊÃiÃÊÃi«>À>Ìi® UÊ£™ÇnÊ6iÀ“iiÀÊÈäxÊÀ`Ê >iÀÊÜɅÞ`Ê̈i]ÊÃɘ£nÎÓ UÊÈäxÊ6iÀ“iiÀÊÀ`Ê >iÀÊÃɘ£n™È UÊÈäxÊ6iÀ“iiÀÊÀ`Ê >iÀÊÃɘÎÎn£ UʣνÊՅ˜Ê Ê{äääÊ,Ê`ˆÃVLˆ˜iÊÃɘ£änÓÇ£ä‡ ä£xÎ UÊ£Ó½ÊiÃÃ̜˜Ê££xäÊ>ÞLˆ˜i]ÊÃɘӣä™ä UÊ-œÛi“>Ê£ÓÊ7…iiÊ6‡,>ŽiÊÃɘ™xÓxÓ UÊ>ÕÀˆiÀ£Ó£xÊ`LÊ>À“Ê£ÓÊ >i]Ê >iÊ«ˆVŽiÀ]ÊÃɘ,7Ǚ™Ç LIVESTOCK RELATED EQUIPMENT: UÊ >iʈ˜}Ê6œÀÌiÝÊÓäääÊ >iÊ*ÀœViÃÜÀÊÃɘ £™x™ UÊ ÊÎxnʈÝʈÊÜÉ«ÜÀÊ >iÊii`iÀ]ʓiV…>˜ˆV>Ê`ÀˆÛi]Ê ÓÊÌÕÀ˜ÃʏivÌʜ˜Ê…>““iÀÃ]ÊÓÊÃVÀii˜Ã]ÊÃɘÇnÎÈÓÓÊ>Ü>ÞÃÊ Ã…i``i` UÊ ÊǙ£ÊÌÉ>ʓ>˜ÕÀiÊëÀi>`iÀÊÜÉÃÌiiÊvœœÀ]ÊȘ}iÊ Li>ÌiÀ]ÊȘ}iÊV…>ˆ˜ UÊ ÊǙäÊÌÉ>Ê>˜ÕÀiÊ-«Ài>`iÀÊÜÉ̜«ÊLi>ÌiÀ]Êܜœ`ÊvœœÀ]Ê Ãˆ˜}iÊV…>ˆ˜ UÊ ÊǙäÊëÀi>`iÀÊvœÀÊ«>ÀÌà UÊÊxÇäÊÌÉ>Ê>˜ÕÀiÊ-«Ài>`iÀÊÜÉȘ}iÊLi>ÌiÀ]Êܜœ`Ê vœœÀ]Ê`œÕLiÊV…>ˆ˜]ÊÃɘää£ÎΙʭ˜iÜÊV…>ˆ˜ÃÊÎÊÞi>ÀÃÊ>}œ® Uʈ˜`i˜ÊÌÀ>ˆiÀÊÌÞ«iÊ*œÃÌÊ*œÕ˜`iÀÊÃɘäÎx™ UÊÎäääLÃÊV>«Ê*œÀÌ>LiʈÛiÃ̜VŽÊ-V>iÊÜɅˆÌV…Ê>˜`Ê܅iiÃ UÊ iÜÊ“iÀˆV>˜Ê>À“>˜`Ê-µÕiiâiÊ …ÕÌiÊ­ÕÃi`ÊÛiÀÞʏˆÌ̏i® Uʈ}…Ê+Õ>Ê-µÕiiâiÊ …ÕÌiÊÜÉ«>«>̈œ˜ÊV>}iÊ­˜ii`ÃÊvœœÀ® UʭήÊÓÓ½Ýn°x½ÊL>iÊvii`iÀà UÊ­Ó®ÊÓ{½Ýn½Ê“iÌ>ÊV>vÊÅiÌiÀÃʜ˜ÊΈ`à UÊ«>˜iÊ…>Տˆ˜}ÊÜ>}œ˜ÊUÊ >vÊ/ˆÌÊ/>Li UÊΫÌÊL>iÊvœÀŽÃÊUÊ+Õ>˜ÌˆÌÞʜvÊ/܈˜i UÊ+Õ>˜ÌˆÌÞʜvÊ>ÌiÃÊEÊ«>˜iÃÊ UÊ+Õ>˜ÌˆÌÞʜvÊ >iÊii`iÀà UÊ >vÊ Àii«Êii`iÀʜ˜Ê7…iiÃ UÊ,i>Ê˜`ÊVÀii«Êvii`iÀÊUÊ >vÊ-…i`Ã

UÊ{ää}>Ê«œÞʓœ>ÃÃiÃÊÌ>˜Ž UÊi˜ViÀÃÊUÊ-̜VŽÊ*Àœ`ÃÊUÊ/Ài>Ìi`Êi˜ViÊ*œÃÌà UÊ,>ˆÀœ>`Ê/ˆiÃÊUÊ >ÀLi`Ê7ˆÀi]Ê iVÊ7ˆÀi UÊi˜Vˆ˜}Ê-Õ««ˆiÃÊUÊ"̅iÀʈÛiÃ̜VŽÊ-Õ««ˆià RIDING HORSES & TACK: UÊ/…ÀiiÊ ÀœŽiÊ,ˆ`ˆ˜}ÊœÀÃià UÊ œÕLiÊ ÀˆÛˆ˜}Ê>À˜iÃÃÊÜÉÊ œ>Àà UÊœÀÃiÊ ÀˆÛˆ˜}Ê >ÀÌÊUÊœÀÃiÊ Ài>Žˆ˜}Ê >ÀÌ Uʜ˜iʅœÀÃiÊÏiˆ}… UÊ"̅iÀʈÃVÊœÀÃiÊ/>VŽÊEÊ µÕˆ«“i˜Ì TRUCKS: UÊ£™™xÊœÀ`Ê,>˜}iÀÊ8ÊÜÉ{ÊVޏ]ÊxÊëii`]ÊÓÎÓ]xä䎓ÃÊ Ã…œÜˆ˜} UÊ£™™{Ê …iÛÊ …iÞi˜˜iÊ£xääÊ£ÉÓÊ̜˜]Ê ÝÌÊ >LÊÜÉV>««iÀÊ Ìœ«]Ê{ÓÓ]Èx䎓ÃÊŜ܈˜}]Êx°ÇʏˆÌiÀÊi˜}]Ê>Õ̜ÊÌÀ>˜Ã]Ê>ˆÀ]Ê ÌˆÌ]ÊVÀՈÃi]ÊÃɘÓ £™Ó,££ÎÓÈÈn UÊ£™nnÊ Ê- Ê-ˆiÀÀ>ÊÓxää]ÊiÝÌÊV>L]ʏœ˜}ÊLœÝÊ ÜÉΙÎäÓ䎓ÃÊŜ܈˜}]Ê6nÊ}>Ã]ÊÎÊë`ÊÌÀ>˜Ã]ÊÃɘÓ/‡ ә{£xx™£££ UÊ£™näÊœÀ`Ê£xäÊ ÕÃ̜“Ê{Ý{ÊÜÉ{ääÊ}>ÃÊi˜}]Ê>Õ̜ÊÌÀ>˜Ã]Ê Ãɘ£{  ä{£™ UÊ£™Ç™ÊœÀ`Ê£xäÊ£ÉÓÊ/œ˜ÊÜÉ6nÊ}>Ã]Ê>Õ̜ÊÌÀ>˜Ã] ÊÃɘ£ä Èxn{]Ê­ œÌÊ,՘˜ˆ˜}® UÊ£™ÇÈÊ ÊÈxääÊ >LÊ"ÛiÀÊÜɣȽÝn°x½Ê-ÌiiÊ œÝÊEÊ œˆÃÌ]ÊÎÈÈÊi˜}]ÊÕ̜“>̈VÊ/À>˜Ã]Ê£{£ÈxÎʓˆiÃÊŜ܈˜}]Ê Ãɘ// ÈÈÈ6xÇ{nÓÇ UÊ£™ÇÓÊÊœ>`ÃÌ>ÀÊÜÉ£{½Ê-ÌiiÊ œÝÊ>˜`ÊœˆÃÌ]Ê6nÊ}>Ã]Ê >Õ̜ÊÌÀ>˜Ã]Ê œÌÊ,՘˜ˆ˜}]ÊÃɘ 7‡{nÎÇȇ n UÊ£™Ç£ÊÊœ>`ÃÌ>ÀÊÌ>}Ê>ݏiÊÜÉ£n½ÊÃÌiiÊLœÝÊ>˜`ʅœˆÃÌ]Ê Îäää}>ÊÜ>ÌiÀÊÌ>˜ŽÊ>˜`ÊÌÀœÕ}…]Êx³ÓÊÌÀ>˜Ã]ÊÀœÊÌ>À«]ʘœÌÊ À՘˜ˆ˜}]ÊÃɘ{£ÈäÈä äÈ{È£È UÊ£™È£Ê £Ç{Ê ÊÎÊ̜˜ÊÜɣȽÊ-ÌiiÊ œÝÊ>˜`ÊœˆÃÌ]Ê6nÊ }>Ã]Ê{³ÓÊÌÀ>˜Ã]Ê«Õ“Li`ÊvœÀÊ`ÀˆÊvˆ]ÊÃɘ ™£äUÊÎÊ/œ˜ÊÌÀ>ˆiÀÊÜÉÃÌiiÊLœÝÊ>˜`ʅœˆÃÌ UÊ£Ê/œ˜ÊÃÌiiÊLœÝÊ>˜`ʅœˆÃÌÊÌÀ>ˆiÀ]ʘii`ÃÊܜÀŽ TRAILERS & WAGONS: UʣǽÊÌÉ>ÊŜ«ÊLՈÌÊ-̜VŽÊ/À>ˆiÀÊÜÉÊÇäääLÃÊ>ݏiÃ] Ê«>À̈̈œ˜Ê}>Ìi Uʙ½ÊÓʅœÀÃiÊÌÉ>Ê ÊÌÀ>ˆiÀÊÜÉ«>``i`ÊÈ`iÃ]ÊÌ>VŽÊVœ“«>À̇ “i˜Ì]Êvii`ÊÃÌ>̈œ˜]Ê>˜`Ê>VViÃÃÊ`œœÀÃʜ˜ÊLœÌ…ÊÈ`iÃÊ­Li˜ÌÊ >ݏi® UÊÌÀ>ˆiÀÊÜɅœˆÃÌÊ>˜`Ê£{½ÊLœÝ SEED & TILLAGE EQUIPMENT: UÊÓÓ½ÊÊV…ˆÃiÊ«œÜÊÜÉ ÎʈÌ]ÊÎÊL>Àʅ>ÀÀœÜà UÊ£x½Ê>˜`Ê,œiÀ UÊxνÊiÀ“>˜Ê>ÀÀœÜà UʣȽÊ/>ޏœÀÊ7>ÞÊ/>˜`i“Ê ˆÃVÊ Uʙ½ÊÊ ii«Ê/ˆiÀ UÊÓn½ÊÊÇÓääÊœiÊ ÀˆÃÊÜÉÃÌiiÊ«ÀiÃÃÊ܅iiÃ]Ê ii`ÃÊܜÀŽ UÊ̜“ÊiÌʜ«i˜iÀÃÊvœÀÊÊ`Àˆ UÊÎä½Ê ÀˆÊœÛiÀ UÊ,œVŽ‡œ‡>̈VÊ,iiÊ/Þ«iÊ-̜˜iÊ*ˆVŽiÀ UÊiœ˜Ê*Àœ˜}Ê/Þ«iÊ-̜˜iÊ*ˆVŽiÀ UÊ ÛiÀÓ>˜ÊÓ- Ê-VÀ>«iÀ]ÊÃɘÓÓ{Î UʣνÊÊV…ˆÃiÊ«œÜ

AUGERS & AREATION: UÊ£ä»Ýxä½Ê iÀ}i˜Ê«ÌœÊÕ}iÀ]ÊÞ`ʏˆvÌ UÊÇ»ÝÎÈ½Ê À>˜`ÌÊÕ}iÀ]Ê£ÎÊ*Êœ˜`>ÊÜÉ`À>}Ê>Õ}iÀ UÊÇ»Ý{£½Ê>À“ʈ˜}ÊÕ}iÀ]Ê£ÈÊ*Êœ…iÀ UÊ­Ó®Ê iVÌÀˆVÊÕ}iÀÃʜ˜Ê7…iiÃ UÊ-“>ÊÕ}iÀʜ˜Ê7…iiÃ UÊ­Ó®Ê`ÀˆÊvˆÊÕ}iÀÃ]ʅÞ`ʓœÌœÀÃÊÜÉ`œÜ˜ÊëœÕÌà UÊ­Ó®Ê À>}ÊÕ}iÀà UÊ*œÞÊÕ}iÀÊœ««iÀà UÊ΅«Ê-ÕŽÕ«Ê ÎÇx£Ê>iÀ>̈œ˜Êv>˜ LAWN & GAREN & RECREATION: UÊÓääÇÊœ˜`>Ê/,8Ê{ÓäÊ/ÊÓ7 Ê+Õ>`ÊÃÉ ˜£/ Î{äÇÇ{ä£{Ó{ä UÊÓääxÊœ˜`>ÊÓxäÊÓ7 Ê+Õ>`ÊÜÉiiVÊňvÌÊ Ãɘ£/ Ó£{8È{ÈäÓäÎx UÊÓää£Êœ˜`>ÊÎxäÊÓ7 Ê+Õ>`ÊÜɓ>˜Õ>ÊňvÌ]ÊvÀœ˜ÌÊ>˜`Ê L>VŽÊÀ>VŽÃ UÊœ˜`>ÊÎxäÊÓ7 Ê+Õ>`]ÊÀiLՈÌʓœÌœÀÊÓÊÞi>ÀÃÊ>}œ UÊÓäääÊœ˜`>ÊÓxäÊÓ7 Ê+Õ>`]ʘii`ÃÊܜÀŽ UÊ7œœ`i˜Ê >˜œi UÊ£™™xÊ*œ>ÀˆÃÊ{{äÊv>˜Ê-«œÀÌÊ-˜œÜ“œLˆiÊÜɘiÜÊÌÀ>VŽ]Ê x{™äʓˆiÃÊŜ܈˜}]ÊÃɘÓ8- { -x8 äÓÎ{ÇÇ UÊ£™™{Ê*œ>ÀˆÃÊ{{äÊ-Õ«iÀÊ-«œÀÌÊ-˜œÜ“œLˆi UÊ ÕLÊ >`iÌÊ£äÈʏ>ܘÊÌÀ>V̜ÀÊÜɣ䅫Êi˜}ˆ˜i]Ê{{»Ê`iVŽ UÊ ÕLÊ >`iÌÊ/£ä{xʏ>ܘÊÌÀ>V̜ÀÊÜÉÓ䅫Êœ…iÀ]Ê{È»Ê `iVŽ]ÊÃÌ`ÊÌÀ>˜Ã UÊœ}Ê-«ˆÌÌiÀà UÊ-«À>ÞiÀÊvœÀÊ+Õ>`Ê>˜`Ê œœ“à UÊ*ՏÊLi…ˆ˜`Ê>ܘÊ-Üii« UÊ­Ó®Ê>Ü˜Ê œÞʓœÜiÀà UÊÊÀœÌœÊ̈iÀÊÜÉ ³-Êi˜}ˆ˜i OTHER EQUIPMENT: UÊǽÊ>À“ʈ˜}ÊΫÌÊȘ}iÊ>Õ}iÀÊ-˜œÜÊ œÜiÀ UÊiœ˜ÊÇäÇÊœ>`iÀÊUÊÎÊ«ÌÊ >iÊœÀŽÃ UÊiÀ>̈œ˜Ê>˜ÊUÊ{ääÊ>œ˜Ê7>ÌiÀÊ/>˜Ž UÊ£ÓxäÊ>œ˜Ê7>ÌiÀÊ/>˜ŽÊœ˜Ê ÊÜ>}œ˜ TOOLS & MISC: UʈÀÊ œ“«ÀiÃÜÀÊUÊ …>ˆ˜Ê->Üà Uʈ˜Vœ˜Ê ‡ÓÓx‡-Ê7i`iÀ UÊ­Ó®Ê-ˆ«Ê/>˜ŽÊ܈̅Ê*Փ«ÊUÊ1Ãi`ÊiÌ>Ê-ˆ`ˆ˜} UÊ+Õ>˜ÌˆÌÞʜvÊŜ«ÊÃÕ««ˆiÃÊ UÊ-“>Ê“œÕ˜ÌʜvÊ/œœÃ Uʏœ>`i`ÊLœÌÊLˆ˜ÃÊ UÊ+Õ>˜ÌˆÌÞʜvÊ-VÀ>«ÊÀœ˜ UÊ1Ãi`Ê*1Ê-Ì>ÃÊUÊ1Ãi`Ê/ˆÀià UÊ­Ó®Ê-ˆ«Ê/>˜ŽÃ]Ê œÊ*Փ«Ã

FOR MORE INFO CONTACT OWNER

6 ÊV -Ê Óä{‡ÇÓ{‡{™™£

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE B11

UNRESERVED FARM DISPERSAL

BABCOCK FARMS LTD of BIRNIE, MB

TUESDAY MAY 1st 11:00 AM

DIRECTIONS: FROM NEEPAWA, MB. 16 miles north of Neepawa, MB on #5 hwy to jct. of #5 & #352. East 4 miles on #352 to 5 Corner jct. Sale site located on north side of road. (Watch for signs sale day.) FROM RIDING MOUNTAIN, MB. 5 miles south of riding Mountain, MB on #5 hwy to jct of # 5 & #352. East 4 Miles on #352 to 5 Corner jct. Sale site located on north side of road. (Watch for signs sale day.) ORDER OF SALE:Ê 11:00am – 1:00pm – misc, shop equip, fuel tanks, vet supplies, livestock handling equip, grain bins, fans 1:00pm – livestock equip, augers, dryers, seed & tillage, spraying, haying equip, trucks, trailers, harvest equip, tractors, GPS systems TRACTORS: UÊÓääxÊ Ê/£ÎäÊ7 Ê£Î䅫Ê/À>V̜ÀÊÜÉ+ՈVŽiÊ-ʏœ>`iÀ]Ê LÕVŽiÌÊ}À>««i]ʍœÞÃ̈VŽÊVœ˜ÌÀœ]Ê*œÜiÀÊ-…ˆvÌÊ/À>˜ÃÊÜÉÊÅÕÌ̏i]Ê ÎÊ*/]ÊÎÊ,i“œÌiÊÞ`°]Ê£äääÊ*/"]ÊÓä°n,ÎnÊ,ÕLLiÀ]ÊxäääʅÀÃÊ Ã…œÜˆ˜}]Ê­ iÜÊvÀœ˜ÌÊÀÕLLiÀʣȰ™,Ón®Ê ÊÀœ˜ÌÊ ˜` UÊ£™n£Ê6iÀÃ>̈iÊxxxÊ{7 Ê£nӅ«Ê/À>V̜ÀÊÜÉ{Ê,i“œÌiÊÞ`°]Ê ÕÝÊÀiÌÕÀ˜Êˆ˜iÊ*/"Ê ÀˆÛi]Ê£äääÊ*/"]Ê£n°{‡ÎnÊ Õ>Ã]ÊÈÇääÊ …ÀÃÊÃɘ£Î££™ÇÓ]Ê­/À>˜ÃÊLi>Àˆ˜}ʅ>ÛiÊLii˜Ê`œ˜i]ÊÕ«`>Ìi`ÊÌœÊ ˜`ÕÃÌÀˆ>ÊÞ`]ÊxääʅÀÃʜ˜Ê ˜}ˆ˜iÊ i>Àˆ˜}î UÊ£™Ç™Ê6iÀÃ>̈iÊxääÊ{7 Ê£È䅫Ê/À>V̜ÀÊÜÉÊÎÊÀi“œÌiʅÞ`°]Ê£äääÊ */"]Ê£n°{‡Î{Ê Õ>Ã]Ê««ÀœÝÊ£Ó]äääʅÀÃ]Ê/À>V̜Àʅ>ÃÊLii˜ÊÕ«}À>`iÊ ÜˆÌ…ÊxxxÊi˜}ˆ˜i]Ê iÜÊ >ÌÌiÀˆiÃ]Ê ÝÌiÀ˜>Ê«>˜iÌ>ÀÞÊ`ˆvvð UÊ

Ê£Îä‡äÈÊ/À>V̜ÀÊÜÉÓÊ,i“œÌiÊÞ`°]Ê£äääÊ*/"]Ê£n°{ʇÎnÊ

Õ>Ã]Ê*œÜiÀÊ>`ÕÃÌ>LiÊÀi>ÀÊÀˆ“Ã]Ê««ÀœÝÊÈxääʅÀà UÊœÀ`ܘÊ>œÀÊ ˆiÃiÊÓÊ7 Ê/À>V̜ÀÊÜÉÊÎÊ«Ì]Ê-ˆ˜}iÊÞ`]Êx{äÊ */"]Ê*œÜiÀÊ-ÌiiÀˆ˜} UÊ­Ó®Ê >iÊœÀŽÃʓœÕ˜ÌÃÊ̜Ê+ՈVŽiÊœ>`iÀ UÊÎÊ*/Ê >iÊœÀŽ GPS SYSTEMS: UÊ"ÕÌL>VŽÊ-ÊՈ`>˜ViÊ-ÞÃÌi“ÊÜÉÊ"ÕÌL>VŽÊÎÈäÊ>««ˆ˜}Ê6iÀȜ˜ÊÓ UÊ"ÕÌL>VŽÊ-ÓÊՈ`>˜ViÊ-ÞÃÌi“ÊÜɈ}…ÌÊ >À HARVEST EQUIPMENT: UÊ£™™ÓÊ Ê/8ÎÈÊ-*Ê œ“Lˆ˜iÊÜÉÊ ʙǣÊ*ˆVŽÊիʅi>`iÀÊÜÉÊ-Ü>Ì…Ê >ÃÌiÀÊ«ˆVŽÕ«]ÊÓnÇäÊi˜}ÊÀÃ]ÊÓÓ£ÓÊ-i«ÊÀÃ]ÊÃɘnÈäÇäÇ£ÊÜÉi>`iÀÊ ,iÛiÀÃiÀ]Ê iÜiÀÊ œ˜V>ÛiÃÊEÊ,ÕLÊL>ÀÃ]Ê iÜÊ i>˜ÊÀ>ˆ˜Ê …>ˆ˜Ê}œiÃÊ ÜˆÌ…ÊˆÌ°ÊˆÀvœˆÊ-ˆiÛiʈ˜Ê՘ˆÌÊ­œÀˆ}ˆ˜>Ê-ˆiÛiÊ܈ÊLiʈ˜VÕ`i`® UÊn½ÊœÜÃiÀÊiÌ>Ê-Ü>̅Ê,œiÀ UÊ-Ü>̅iÀÊ/À>˜Ã«œÀÌ UÊ>LÌÀœ˜ˆVÃʙ£™ÊœˆÃÌÕÀiÊ/iÃÌiÀÊÜÉÊ ˆ}ˆÌ>Ê-V>i° SEED & TILLAGE EQUIPMENT: UÊÎνʏi݈‡ œˆÊxäääʈÀÊ`ÀˆÊÜÉʏi݈‡ œˆÊ£ÇÓäʈÀÊ/>˜ŽÊ ­Ü>ÞÃÊ-…i``i`®]ʙ»Ê-«>Vˆ˜}]ÊÎÎäʏLÃÊ/Àˆ«Ã]Ê-Ìi>Ì…Ê"«i˜iÀÃÊ ÜÉÊλÊ-«ˆÌÌiÀÃ]Ê{»Ê,ÕLLiÀÊ*>VŽiÀÃ]ÊÀii˜Ê Àœ«ÊˆµÕˆ`ÊiÀÌʈÌ]Ê ˆ˜iÊEÊ œÕÀÃiÊiÌiÀˆ˜}Ê,œÃ UÊÎӽʏi݈‡ œˆÊÎääʈÀÊ-ii`iÀÊÜÉʏi݈‡ œˆÊ£££äʈÀÊ/>˜Ž]Ê Þ`Ê>˜]Ê£Ó»Ê-«>Vˆ˜}]ÊxääʏLÃÊ/Àˆ«Ã]ÊÎÊ >ÀÊ>ÀÀœÜÃ]ʈ˜iÊEÊ VœÕÀÃiÊiÌiÀˆ˜}Ê,œÃÊÃɘäÎnxä™ UÊxä½Ê-Փ“iÀÃÊi>ÛÞÊ>ÀÀœÜÃÊ­ iÜʘÕVŽiÃʈ˜Êœˆ˜Ìî UÊxä½Ê >˜V…>À`ÊÞ`À>‡ˆvÌÊ>ÀÀœÜÊ*>VŽiÀÊ >ÀÊÜÉÊÓÊ£ÉÓ»Ê *>VŽiÀÃ]Ê iÜiÀÊ/ˆ˜iÃ]Ê iÜÊ/ˆÀià UÊÈä½Ê˜>˜`ÊÞ`Ê>ÀÀœÜÃ]Ê iÜÊ/ˆ˜ià UÊÎӽʏiÝˆÊ œˆÊ-ÞÃÌi“ÊÇäÊ œˆÊ*>VŽiÀà UÊ£™½ÊˆÃÊÓÈääÊ/>˜`i“Ê ˆÃŽÊÜÉ-“œœÌ…Ê >`ià UÊiÀœiʙäÎ]ÊnÊ œÌ̜“Ê*œÜÊÜÉÊ iÜʣȻÊ-…i>Àà UÊÀii˜Ê Àœ«Ê£äääʈµÕˆ`ÊiÀÌÊ >``ÞÊÜÉÊÇx½Ê œœ“Ã]Êœ…˜Ê ÕiÊ*Փ«]Ê­ œ“«iÌiÊÀiLՈÌ®]Ê iÜÊÞ`ʈÊ*Փ« UÊ,>“LœVÊœLˆˆÌÞʙääÊ*/"Ê ÀˆÛiÊiÀ̈ˆâiÀÊëÀi>`iÀÊ ­ œ“«iÌiÞÊ,iLՈÌ® UÊ7ˆ“>ÀÊnääÊ*/"ÊiÀ̈ˆâiÀÊ-«Ài>`iÀÊ­œÀÊ*>ÀÌî UÊ,œVŽ‡"‡>̈VÊ*/"Ê ÀˆÛiÊ,œÌ>ÀÞÊ-̜˜iÊ*ˆVŽiÀÊ­ÎÊ7…iiÊ-Ìޏi® UÊÊÈÊ,œÜÊ œÀ˜Ê*>˜ÌiÀÊÜÉiÀÌÊ œÝià UÊÈÊ,œÜÊÎÊ«ÌÊ œÀ˜Ê Տ̰ UÊÎä»ÊœÀiÛiÀÊÀ>ˆ˜Ê i>˜iÀ UÊ£n½Êœ>`ʈ˜}Ê-ii`ÊEÊiÀÌÊ/i˜`iÀÊÜÉʅÞ`Ê>Õ}iÀà UÊ>܎ˆ˜ÃÊ ÀˆÊ>ÀŽiÀà UÊÎä½Ê œˆÊ*>VŽiÀÃÊ­L>Ê…ˆÌV…ÊÃÌޏi®Ê­È®Ê‡Êx½Ê-iV̈œ˜Ã SPRAYING EQUIPMENT: Uʙä½Ê œÕÀ}>ՏÌÊnxäÊ i˜ÌÕÀˆœ˜Êʈi`Ê-«À>ÞiÀ]Ê£äääÊ}>Ê«œÞÊ Ì>˜Ž]ʘiÜÊ̈ÀiÃ]ʅÞ`°Ê«Õ“«]ÊV…i“Ê“ˆÝÊÌ>˜Ž]ÊiÞiÊÜ>ÅÊÌ>˜Ž UÊ-…œ«Ê ՈÌÊi˜Viʈ˜iÀÊ-«À>ÞiÀÊÜÉ*/"Ê*Փ« UÊÓ»Ê …i“Ê>˜`iÀÊÊ …i“ʈÝÊ1˜ˆÌ UÊ£ÓääÊ>Ê*œÞÊ7>ÌiÀÊ/>˜ŽÊ­ >VŽ® UÊÓ»Ê >˜œÊ*Փ«ÊÜÉÊxÊ£É{Ê*ʜ̜À HAYING EQUIPMENT:

UÊ£™™nÊ£{½Ê>V œ˜ÊxäääÊ>ÞLˆ˜iÊÜÉ£äääÊ*/"]Ê-ÌiiÊ

Àˆ“«ˆ˜}ÊÀœiÀÃ]Ê iÜʘˆvi]Ê­>Êv>V̜ÀÞÊvÀ>“iÊÕ«`>ÌiÃÊ`œ˜i® UÊÓääÇÊ Ê ,ÇnäÊ,œÕ˜`Ê >iÀÊÜÉÊ >iʈVŽiÀ]Ê£äääÊ*/"]Ê Þ`Ê*ˆVŽÕ«]ÊÕ̜Ê̈i]ÊÃɘ9È ä£ÇӣΠUÊ Ê/£x{Ê£{Ê7…iiÊ6‡,>ŽiÊÜÉÊ܈˜`Ê`iviV̜À]ÊÃɘ£ÓÎÇÓn UÊ>˜`ˆÊ >iʘœVՏ>̜Àà GRAIN BINS & AERATION FANS: UʭӮʣ™xäÊ 1-Ê7iÃÌiiÊ ˆ˜Ãʜ˜Ê >ÀŽ“>˜Êœ««iÀÊÜÉiÀ>̈œ˜]ʜ˜Ê-Žˆ` UÊÓ£ääÊ 1-Ê7iÃÌiiÊ ˆ˜Êœ˜Ê >ÀŽ“>˜Êœ««iÀÊÜÉiÀ>̈œ˜]ʜ˜Ê-Žˆ` UÊ««ÀœÝÊÓääLÕÃÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Êii`Ê ˆ˜ UÊ£n»Ê7iÃÌiiÊ£Ê£ÉÓÊ*ÊiÀ>̈œ˜Ê>˜ UÊ­{®Êˆ``iÊ-Ì>ÌiÊiÀ>̈œ˜Ê>˜ÊÎÊ* AUGERS & GRAIN DRYERS: UÊ£ä»ÊÝÊÇ£½Ê7iÃÌvˆi`Ê*/"Ê-܈˜}Êœ««iÀÊÕ}iÀÊÃɘ{xÓÓ{ UÊÇ»Ê6iÀÃ>̈iÊÕ}iÀÊÜÉ£Ó*Êœ˜`>Ê ˜}ˆ˜i UÊÈ»ÊÝÊ£x½ÊÕ}iÀÊÜÉxÊ£ÉÓʅ«Êœ˜`>Ê ˜}ˆ˜i UʭӮʈÃVÊÈ»ÊÝÊÇ»ÊÕ}iÀÃÊUÊ*i˜VˆÊÕ}iÀà UÊÞ`Ê ÀˆÊˆÊÕ}iÀà UÊ/ÊÎnäÊ*Àœ«>˜iÊÀ>ˆ˜Ê ÀÞiÀÊÜÉ*/"Ê>˜]ÊÃɘÎnäÓäx UÊœÀˆ`}iÊ*Àœ«>˜iÊ*/"ÊÀ>ˆ˜Ê ÀÞiÀ TRUCKS: UÊ£™™ÎÊ Ê/œ«ÊˆVŽÊ-ÉÊ/ÀÕVŽÊÜÉÊÎÈÈÊ*Àœ«>˜iÊ ˜}ˆ˜i]Ê xÊ-«`Ê/À>˜Ã]ÊÓÈÈ]Îxäʎ“ÃÊŜ܈˜}]Êx̅Ê܅iiÊ«>Ìi]ÊÃÉ ˜£ È£*£{™x{]Ê->v̈i`Ê­œÜ˜iÀÊ >LVœVŽÊ>À“ÃÊÌ`® UÊ£™ÇxÊœÀ`ÊÇääÊ/>}ÊݏiÊ/ÀÕVŽÊÜÉ£n½ÊiÌ>Ê˜`°Ê œÝÊEÊ œˆÃÌ]Ê,œÊ/>À«Ê­>ÃÊÀ>ˆ˜ÊEÊ-ˆ>}iÊ ˜`Ê>Ìiî]ÊÎÈ£Ê>Ã]ÊxÊ³Ê ÓÊ/>˜Ã]ÊÇ£]äÓäʈiÃÊŜ܈˜}ÊÃɘÇä 16xÓäΣ UÊ£™™™ÊœÀ`ÊÓxäÊ{ÊÝÊ{Ê Ã]Ê,i}Ê >L]Ê{Ê-«ii`]Ê" Ê/À>˜Ã]Ê -…œÜˆ˜}ÊÎÓä]™ääʎ“Ã]Ê->v̈i`Ê­"ܘiÀÊ >LVœVŽÊ>À“îÊÃÉ ˜£/ Ó£ä8 Ç{££x]Ê­ ÕÌV…Ê,iLՈÌʈ˜VÕ`ˆ˜}Ê>ÃÌiÀÊ Þ® UÊ£™™nÊ …iÛÊ£xääÊ{ÊÝÊ{Ê,i}Ê >L]ÊÎxäÊ>Ã]Ê>Õ̜Ê/À>˜Ã]Ê ÓÎä]äääÊ“Ã]Ê->vïi`Ê­"ܘiÀÊ >LVœVŽÊ>À“î TRAILERS & WAGONS: UÊ£™nnÊ£n½Ê 7-Êx̅Ê7…ii]Ê/ÉÊ-̜VŽÊ/À>ˆiÀÊÜɘiÜÊܜœ`Ê vœœÀ]ÊÛiÀÞʏˆÌ̏iÊÀÕÃÌ]ÊÃÉ˜Ó ™6£nÇäΣää{ UÊ£™nnÊÓä½Ê-…œ«Ê ՈÌÊ/ÉÊx̅Ê7…iiÊ>ÌÊ iVŽÊ/À>ˆiÀÊÜÉ

…iVŽiÀÊ*>ÌiÊ iVŽ]ÊÇäääʏLÃÊݏiÃ]Ê­˜iÜÊÅ>VŽiî UÊ£È½Ê œ˜>…ÕiÊ/ÉÊÀ>ˆ˜Ê/À>ˆiÀÊÜÉœˆÃÌ]ÊiiVÌÀˆVÊ À>ŽiÃ]Ê ,i“œÛ>LiÊ-ˆ`iÃ]ÊÃɘ-Îää£È  UÊ£{½Ê-ÉÊÀ>ˆ˜Ê œÝÊÜÉœˆÃÌ]Êȏ>}iÊi˜`Ê}>Ìi]ÊÃÌiiÊvœœÀ]Ê ÌÀ>V̜ÀʅˆÌV…ÊÃÌޏi UÊ­Ó®Ê{x½Ê/Éʅ>ÞÊÜ>}œ˜ÃÊ­ˆ}…Ê œÞÊ/À>ˆiÀÊ œ˜ÛiÀȜ˜® UÊ­Ó®Ê-ÉÊx̅Ê7…iiÊ œˆiÃÊUÊ Ê/ÉÊ/ÀÕVŽÊÀ>“i UÊ£n½Ê Ê-ÉÊ µÕˆ«“i˜Ìʏœ>ÌÊÕÃi`ÊvœÀÊ >iÊ7>}œ˜ UÊÓȽÊ Ê7œœ`i˜Ê iVŽÊ>ÞÊ,>VŽ UÊÎÓ½Ê >iÊ7>}œ˜Ê­««ÀœÝÊ£ÇÊ >iÊ >«® UÊ>À̈˜Ê>À“Ê7>}œ˜]Ê{ääÊ 1-ÊÀ>ۈÌÞÊ7>}œ˜ÊÜɏˆ}…ÌʎˆÌ]Ê …ˆ}…ÊÈ`iʎˆÌ]ÊÃɘÊää™x™ UÊ{Ê܅iiÊv>À“ÊÜ>}œ˜ÊÜÉ«>˜iÊÜi`ˆ˜}ʍˆ}ʓœÕ˜Ìi`ʜ˜ÊˆÌ LIVESTOCK EQUIPMENT: UÊ>ÞLÕÃÌiÀÊÓÈxäÊ >iÊ*ÀœViÃÜÀ]ÊÜÉÞ`Ê iviV̜À UÊ-…ՏÌâÊ Õ˜ŽÊii`iÀÊœ`iÊ£näÊ*/"Ê Õ˜ŽÊˆ˜iÀÊii`Ê7>}œ˜Ê ÜÉÀ>ˆ˜Ê/>˜Ž UÊ>À“ʈ`Ê{{äÊ-ÉʈÝiÀÊii`Ê7>}œ˜ÊÜÉÊ-Ì>ÀÊ-V>iÊi>` UÊ ÊÎxÇÊ>““iÀʈÊÜÉÊ*ÜÀÊ >iÊii`iÀ]ÊiV…>˜ˆV>Ê 1˜œ>`]ÊÓʘiÜÊÈ`iÃʜ˜Ê…>““iÀÃ]Ê>ÃÜÀÌi`ÊÃVÀii˜Ã UÊ ÊÎxÇÊÜÉ*iiÀiÃÃÊÓä»Ê,œiÀʈÊÞ`Ê1˜œ>`Ê>Õ}iÀ UÊʈÊ œ˜ÛiÀÌi`Ê̜Ê>ÊÞ`Ê*iiÌÊÀ>ˆ˜Êii`iÀ UÊ ÊÈǙÊ/ÉÊ>˜ÕÀiÊ-«Ài>`iÀÊÜÉ`LÊLi>ÌiÀÃ]Ê iÜÊ-ÌiiÊ œœÀÊx{äÊ*/" UÊ ÕVŽiÌʜ՘ÌÊÞ`Ê«œÃÌʅœiÊ>Õ}iÀÊÜÉÊÈ»ÊEÊ£Ó»ÊLˆÌà LIVESTOCK HANDLING EQUIPMENT: Uʈ‡+Õ>Ê-µÕiiâiÊ …ÕÌiÊÜÉÊ-V>i]Ê*>«>̈œ˜Ê >}i

Uʈ‡+Õ>ÊÎÊ-iV̈œ˜Ê>`ÕÃÌ>LiÊ-ʏiÞÊÜÉ >VŽÊ1«Ê-̜«ÊÀ“à Uʈ‡+Õ>ÊÎÊ-iV̈œ˜Ê ÀœÜ`ˆ˜}Ê/ÕLÊ-ÞÃÌi“ UÊ,i>Ê˜`°Ê-µÕiiâiÊ …ÕÌiÊÜÉÊ*>«>̈œ˜Ê >}i]ÊÕÌœÊ >ÌV…Êi>`Ê >ÌiÊ­ iÜʏœœÀ® UÊ ˆ>ÃÊ-ˆ˜}iʘˆ“>Ê7iˆ}…ÌÊ-V>iÊÜÉV…ÕÌiÊÎ]äääʏLÃÊ >« UÊ*œÀÌ>LiÊ >Ì̏iÊœ>`ˆ˜}Ê …ÕÌiÊ­`ÕÃÌ>LiÊiˆ}…Ì® UÊ>ÌiÀ˜ˆÌÞÊ >Ûˆ˜}Êi>`Ê>Ìi UÊÇÊ >vÊ …ÕÌiÊÜÉÊ-V>i UÊ£Ó½ÊÝÊÎä½Ê >ÌV…Ê*i˜Ê­ ÀˆÊ-Ìi“ÊEÊ-ÕVŽiÀÊ,œ`®ÊÜÉʜÛiÀ…i>`Ê LÀ>Vˆ˜}Ê­7iÊ ՈÌ® UÊ Þ«ÀiÃÃʘ`°Ê>««ÀœÝÊÓxäÊLÕÃÊ Àii«Êii`iÀʜ˜Ê7…iiÃÊÜÉ *>˜iÃ]Ê"ˆiÀÃÊEʈ˜iÀ>Ê œÝ UÊ>««ÀœÝÊ£xäÊLÕÃÊ >ÃÞÜ>ÞÊ Àii«Êii`iÀʜ˜Ê7…iiÃÊÜÉ*>˜iÃ UÊ>««ÀœÝÊ{ääÊLÕÃÊ Þ«ÀiÃÃʘ`°Ê Àii«Êii`iÀʜ˜Ê-Žˆ`à UÊ­È®ÊÎä½ÊÀiiÊ-Ì>˜`ˆ˜}Ê7ˆ˜`LÀi>ŽÊ*>˜iÃ UÊ­£Ó®ÊÎä½Ê ÀˆÊ-Ìi“Êii`Ê Õ˜ŽÊ*>˜iÃ UÊ­£Ç®Ê£Ó½Ê->˜ÌÊ >ÀÊii`Ê*>˜iÃ UÊ­£x®ÊÓx½Ê-ÕVŽiÀÊ,œ`Ê œÀ>Ê*>˜iÃ UÊ­£ää®Ê£»Ê-µÊ/ÕLiÊ*>˜iÃʇʣä½Ê‡Ê£Ó½Ê‡Ê£{½Ê‡Ê£È½ UÊ­Óx®Ê/À>V̜ÀÊ/ˆÀiÊii`iÀÃÊUʭǮʣx½ÊiÌ>Ê ՘ŽÊii`iÀà UÊ-iiV̈œ˜ÊœvÊ*>˜iÃÊ܈̅Ê7>ŽÊ̅ÀœÕ}…Ê}>Ìià UÊ­Ó®Êi܈ÃÊ >Ì̏iÊ"ˆiÀÃÊÜÉʈ˜iÀ>Ê/ÕLÃʇʣÊ-ˆ˜}iÊÀ“ÊEÊ£Ê LÊÀ“ UÊ­Ó®ÊȽÊ-…œ«Ê ՈÌÊ >Ì̏iÊ"ˆiÀÃÊ­>«Àœ˜Ê-Ìޏi® UÊ >Ì̏iÊL>VŽÊÃVÀ>ÌV…Ê"ˆiÀÊÜÉʈ˜iÀ>Ê/ÕL UÊ£xäÊ>Ê/>˜ŽÊÕÃi`ÊvœÀÊ ÕŽÊ >˜œ>Ê"ˆÊvœÀÊii`Ê«ÕÀ«œÃi UÊ­n®Ê,œÕ˜`Ê >iÊii`iÀÃÊUÊ-ÉÊ >vÊ7>}œ˜ UÊ œ“«iÌiÊÃiÌʜvÊ iVÌÀˆVÊ Õ“iÀˆVÊ À>˜`ˆ˜}ÊÀœ˜Ã SELECTION OF VET SUPPLIES: UÊ­Ó®Êi`ˆÊ >ÀÌÊ ÀœÃÃÊ œÜÃÊUÊ*ˆÃ̜ÊÀˆ«Ê-ÞÀˆ˜}ià UÊ i…œÀ˜iÀÃÊUÊ ÕÀ`iââœÃ UÊ«ÕÃÊÃiiV̈œ˜ÊœvÊÛ>ÀˆœÕÃÊÛiÌÊÃÕ««ˆià FUEL TANKS & PUMPS: UÊ£äääÊ>Ê7iÃÌiiÊÕiÊ/>˜ŽÊÜɈ‡,ˆÌiÊ££xÊ6œÌÊ*Փ«ÊEÊ iÌiÀ UÊ£äääÊ>ÊÕiÊ/>˜ŽÊœ˜Ê7œœ`i˜Ê-Ì>˜`Ê UʭήÊÎääÊ>ÊÕiÊ/>˜ŽÊUÊxäÊ>Ê-Žˆ`Ê/>˜ŽÊÜÉ£ÓÊ6œÌÊ*Փ« SHOP EQUIPMENT: UÊÈ°xÊ*Ê>ÃÊ*œÜiÀi`ʈÀÊ œ“«ÀiÃÜÀÊ­ iÜÊ ˜}ˆ˜iÊEÊ iÜÊ

œ“«ÀiÃÜÀÊi>`®Ê­ iÜÊœÀˆâœ˜Ì>Ê/>˜Ž® UÊxÊ*Êœ˜`>Ê*œÜiÀi`Ê*ÀiÃÃÕÀiÊ7>ÅiÀ UÊ£ä*Ê œi“>˜ÊxäääÊi˜iÀ>̜À MISC. ITEMS: UÊ6Ê,>`ˆœÃÊ­ ÀÞÃÌ>ÊEÊ*Àœ}À>““>Li® UÊÞ`°Ê …>vvÊ-«Ài>`iÀÊUÊ­xä®Ê,>ˆÊ/ˆià UÊÓä°n‡ÎnÊ Õ>Ãʜ˜ÊÀˆ“ÃÊvœÀÊ£ää‡äÈÊ iÕÌâÊÜÉÊ-«>ViÀà UÊ Êœ>`ˆ˜}Ê,>“«ÃÊUÊ-iiV̈œ˜ÊœvÊ>À“ÊV…i“ˆV>Ã UÊÃÜÀ̓i˜ÌʜvÊ>À“Ê,i>Ìi`Ê-“>ÃÊEʈÃV°

FOR MORE INFO CONTACT OWNER

7>ÀÀi˜Ê >LVœVŽÊ Óä{‡{ÇȇÈxÇ{ Ê ‡>ˆÊÜÀL“iJ…œÌ“>ˆ°Vœ“

œÀʏœÞ`Ê >LVœVŽÊ Óä{‡{ÇȇÈ{ÓÇÊÊ ‡>ˆÊL>LVœVŽJˆ˜i̅œ“i°V>

AUCTIONEERS NOTES:Ê\Ê/…iÊ >LVœVŽ½ÃÊ>ÀiÊÛiÀÞÊ}œœ`ÊV>ÀiÊÌ>ŽiÀÃÊ>˜`Ê̅iÞÊ>ÀiÊÛiÀÞʓiV…>˜ˆV>°ÊÊ̅iÊ iµÕˆ«“i˜ÌʈÃÊÛiÀÞÊÜiÊœœŽi`Ê>vÌiÀÊ>˜`ÊÛiÀÞÊVi>˜°ÊÊܜÀŽÊ˜ii`i`ʜ˜ÊiµÕˆ«“i˜ÌÊÜ>ÃÊ>Ü>ÞÃÊ`œ˜iÊ>˜`ÊޜÕÊ܈ÊLiÊ …>À`Ê«ÀiÃÃi`Ê̜Êvˆ˜`ÊiµÕˆ«“i˜ÌʜvÊ̅ˆÃÊÈâiÊ>˜`Ê>}iʈ˜Ê̅ˆÃʎˆ˜`ʜvÊVœ˜`ˆÌˆœ˜°Ê*i>ÃiÊ«>˜Ê̜ÊVœ“iÊ>˜`Êëi˜`Ê̅iÊ`>ÞÊ ÜˆÌ…ÊÕð Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

2012


PAGE B12 Manitoba FarmLIFE, Monday, March 12, 2012

UNRESERVED FARM AUCTION FOR HIGHWAY 68 FEEDERS JASON & THERESA ZUK and DAVID & VALERIE ZUK of ARBORG, MB

FRIDAY MAY 25TH @ 12:00 noon DIRECTIONS: From Arborg, MB. 10 miles west of Arborg on highway 68 (through the S-curves to 1st yard on south side.)

TRACTOR: UÊÓääÈÊi˜`ÌÊn£nÊ7ÊÌÀ>V̜ÀÊ ÜÉi˜`ÌÊÇxxʏœ>`iÀÊ܈̅ÊÎÀ`Êv՘V̈œ˜]ÊÎÎʓˆiÊ«iÀʅœÕÀÊÌÀ>˜Ã]ÊvÀœ˜ÌÊ ÃÕëi˜Ãˆœ˜]Ê/-]Ê{ÊÀi“œÌiʅÞ`]Ê Î«Ì]Êx{äÉx{äÊiVœ˜Ê>˜`Ê£äääʫ̜]Ê Ón™ä…ÀÃÊŜ܈˜}]ÊÃɘǣnÉÓÓÉÇä{Î CAT & WHEEL LOADER: UÊ£™nÎÊ >ÌÊ È ÊVÀ>܏iÀÊÜÉ£Î½Ê “>˜Õ>Ê>˜}iÊL>`i]Ê«ÜÀÊňvÌÊÌÀ>˜Ã]Ê Ài>ÀÊ܈˜V…]Êә»Ê«>`Ã]Ê£{ÈÓx…ÀÃÊ Ã…œÜˆ˜}]ÊÃɘÓä8äÎxÇnÊ­ÛiÀÞÊviÜÊ …œÕÀÃʜ˜Ê˜iÜÊvˆ˜>Ê`ÀˆÛiÃÊ>˜`ÊÀi>ÀÊ >ݏiÃ]Ê>˜`Ê̜ÀµÕiÊVœ˜ÛiÀÌiÀÊܜÀŽ® UÊ£™ÇÎʏˆÃÊ …>“iÀÃÊn{äÊ܅iiÊ œ>`iÀÊÜÉn½ÊLÕVŽiÌ]Ên½Ê“>˜ÕÀiÊvœÀŽ]Ê ÃɘÎäxx FORAGE HARVESTING EQUIPMENT: UÊÓäääÊ >>ÃÊ>}Õ>ÀÊnÈäÊȏ>}iÊ …>ÀÛiÃÌiÀÊÓÜ`]ÊÜÉ{Óää…ÀÃÊŜ܈˜}]Ê ÀœVŽÊÃ̜««iÀ]Ê>Õ̜ʎ˜ˆviÊÅ>À«i˜iÀ]Ê >Õ̜ʏÕLi]ÊÃɘ{™£äÓ{ÇÓÊ­œ˜ÞÊ {xä…ÀÃʜ˜Ê˜iÜÊVÕÌ̈˜}ÊVޏˆ˜`iÀ]Ê Vޏˆ˜`iÀʎ˜ˆÛiÃ]ÊÅi>ÀÊL>À]ÊLœÜiÀÊ «>``iÃ]ʎiÀ˜iÊ«ÀœViÃÜÀÊÀœÃ]Ê>˜`Ê Üi>ÀÊ«>Ìiî UÊ£™™äÊiÃÃ̜˜ÊÇÇÓxÊȏ>}iʅ>ÀÛiÃÌiÀÊÎÓx…«]ÊÃɘÓxä‡ä䙇äÎx UÊ£Ó½Ê >>ÃÊÎnäÊ ʅ>Þʅi>`iÀÊ Ãɘ{әä£nx{ UÊi“«iÀʓœ`iÊ{xääÊÈÊÀœÜÊVœÀ˜Ê …i>`ÊÃɘ{{™£™

UÊ}i>ÀLœÝÊ`ÀˆÛiÊ>˜}iÊ>`>«ÌiÀÊÌœÊ “œÕ˜ÌÊi“«iÀʅi>`ÊÌœÊ ʜÀÊ

UÊiÃÃ̜˜ÊxÊÀœÜÊVœÀ˜Ê…i>` UÊǽÊiÃÃ̜˜Ê…>Þʅi>`iÀ UÊ,ˆV…>À`ܘÊˆÊ Փ«Êȏ>}iÊÜ>}œ˜ UÊ,ˆV…>À`ܘÊˆÊ Փ«Êȏ>}iÊÜ>}œ˜ LIVESTOCK FEEDING EQUIPMENT: UÊ£™™™Ê >iʈ˜}Ê6œÀÌiÝÊÓäääÊL>iÊ «ÀœViÃÜÀÊÃɘÓäänä UÊ£™™™ÊÕVŽÊ œÜÊÎääÊȏ>}iÊÜ>}œ˜Ê ÜÉ{Ê>Õ}iÀʓˆÝiÀ]ʅÞ`ÊV…ÕÌiʅiˆ}…Ì]Ê

ˆ}ˆÃÌ>ÀÊÃV>i]Ê£äää«Ìœ]ÊÃɘ™™‡Ç£Ç UÊ£™nÓÊœÀ`ÊnäääÊÌ>˜`i“ÊÌÀÕVŽÊÜÉÊ ÕVŽÊ œÜÊ{ÓxʓˆÝiÀÊvii`ÊÜ>}œ˜ ]Ê{Ê>Õ}iÀʓˆÝiÀ]Ê ˆ}ˆÃÌ>ÀÊÃV>i]ʅÞ`Ê V…ÕÌiʅiˆ}…Ì]ÊÎÓänÊ >ÌÊi˜}ˆ˜i]Ê>ÕÌœÊ ÌÀ>˜Ã]ÊvÀœ˜ÌʓœÕ˜ÌʅÞ`ʫՓ«Ê`ÀˆÛi]Ê Ãɘ£ 91nä1 6£ÈÓÈÈ TRUCK & TRAILER: UÊ£™nÎÊœÀ`ʙäääʅˆ}…Ü>ÞÊÌÀ>V̜ÀÊ->v̈i`ÊÜÉÎxäÊ Õ““ˆ˜Ã]ʙÊë`Ê ÌÀ>˜Ã]ÊÜiÌʎˆÌ]ÊÎÇșÓӎ“ÃÊŜ܈˜}]Ê Ãɘ£ 91™ä7È 6{xÈÇ UÊ£™™ÇÊqÊ{n½ÊiÀÀˆÌÌÊV>Ì̏iÊ«œÌÊ ->v̈i`ÊÜÉ>ˆÀÊÀˆ`i]ʘœÃiÊ`iVŽˆ˜}]Ê ˜iÜÊLÀ>ŽiÃ]ʘiÜÊ`ÀՓÃ]ʘiÜÊ̈ÀiÃ]Ê Ãɘ£/Ó {nә6ä£ä™Ç£

UÊ/ÀÕiÊ/iÃÌÊ8,ÊÎäääÊÃV>iʓœ˜ˆÌœÀÊ ÜÉÜ>˜`ÊÀi>`iÀ UÊÎä½ÊvÀiiÊÃÌ>˜`ˆ˜}Ê«>˜iÃʭܓiÊ ÜˆÌ…Ê܈˜`ÊLÀi>ŽÊLœ>À`î OTHER EQUIPMENT: UÊ£™™{Ê >ÃiÊÊnnÓäÊëÊÃÜ>̅iÀÊ ÜÉÓx½Ê}À>ˆ˜Ê…i>`iÀ]ÊÓÓää…ÀÃÊŜ܈˜}]ÊÃɘää{™Èx UÊ£È½Ê >ÃiÊVÀˆ“«iÀʅ>Þʅi>`iÀ UÊ,œ“iÊÌ>˜`i“Êœvv‡ÃiÌÊ`ˆÃŽÊÜÉn½Ê ܜÀŽˆ˜}Ê܈`̅]Ê>`ÕÃÌ>LiÊ>˜}i]ÊÎä»Ê ˜œÌV…i`Ê`ˆÃVà UÊ£™™ÇÊ-V…ՏÌiʈ>˜ÌÊÓxääÊÀœÌ>ÀÞÊ Ã̜˜iÊ«ˆVŽiÀÊÜɅÞ`Ê`ÀˆÛi UÊ/ÕLi‡"‡>̜ÀÊ}À>ˆ˜ÊL>}}iÀÊÜÉÎÈ»Ê ,i˜˜ÊÀœiÀʓˆÊ­V>˜ÊLiÊ돈̮ UÊ£{½Ê>˜`ÊÀœiÀ UÊ-…œ«Ê ՈÌÊÀœÌ>ÀÞÊ`ˆÌV…iÀ MISC. ITEMS & PARTS: UÊÎä½ÊÃÕVŽiÀÊÀœ`à UÊ iÜÊL>}ÃÊvœÀÊ}À>ˆ˜ÊL>}}iÀ UÊvœ>“ʏi>vÊVÕÌÌiÀÊLiiʘiÃÌà UÊ«>Ã̈VÊ`œ“iʏi>vÊVÕÌÌiÀÊLii ÊÅiÌiÀÃ

OTHER LIVESTOCK EQUIPMENT: UÊ-…œ«Ê ՈÌʅÞ`ÊõÕiiâiÊV…ÕÌi UʈÊ+Õ>ÊVÀœÜ`ˆ˜}ÊÌÕL UÊ>>}…iÀÊ, ÊÌ>}Ê«>˜iÊÀi>`iÀ

FOR MORE INFO CONTACT OWNER

>ܘÊ<ÕŽÊ Óä{‡ÈÈ{‡x{ääÊ œÀÊ

>ۈ`Ê<ÕŽÊ Óä{‡ÈÈ{‡xÓÇ{

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C.

PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell 2012


Manitoba FarmLIFE, Monday, March 12, 2012

PAGE B13

UNRESERVED RETIREMENT FARM AUCTION FOR MAMCHUK FARMS LTD. of FISHER BRANCH, MB

SATURDAY, MAY 26TH 10:00 AM

DIRECTIONS: : From Fisher Branch, MB (Jct # 17 & 233) on # 17 North 4.8 kms (Dept of Highways Yard) turn West 3.8 kms to sale site on South side of road. ORDER OF SALE:Ê10:00 – 12:00 (Tools, Shop Equipment and Misc) 12:00 – 1:00 (Tanks, Bins, Aeration Fans, Grain Dryers, Augers) 1:00 PM (Trucks & Major Equipment) TRACTORS: UÊ£™n™Ê >Ãiʙ£xäÊÊ{Ü`ÊÜÉÎÊÀi“œÌiʅÞ`]Ê£ÓÊë`Ê*ÜÀÊňvÌ]Ê UÊ£™n™Ê >Ãiʙ£xäÊÊ{Ü`ÊÜÉÎÊÀi“œÌiʅÞ`]Ê£ÓÊë`Ê*ÜÀÊňvÌ]Ê

Փ“ˆ˜ÃÊ£äÊi˜}ˆ˜iÊÓnäʅ«]ÊxÓäÉnx,ÎnÊ`Õ>Ã]ÊxÎә…ÀÃÊŜ܈˜}

Փ“ˆ˜ÃÊ£äÊi˜}ˆ˜iÊÓnäʅ«]ÊxÓäÉnx,ÎnÊ`Õ>Ã]ÊxÎә…ÀÃÊ UÊ >ÃiÊÓәäÊÓÜ`ÊÜÉ£n°{‡ÎnÊ`Õ>Ã]ÊΫÌ]ÊÓÊÀi“œÌiʅÞ`]Ê Ã…œÜˆ˜}]ÊÃɘäääÓnÇÎ ÈÓxx…ÀÃÊŜ܈˜}]ÊÃɘnn{ȣΣÊÜÉʈ`ÌiV…Ê-Ü>̅Ê8ʈ}…ÌÊ >ÀÊ UÊ >ÃiÊÓәäÊÓÜ`ÊÜÉ£n°{‡ÎnÊ`Õ>Ã]ÊΫÌ]ÊÓÊÀi“œÌiʅÞ`]Ê Ո`>˜ViÊ-ÞÃÌi“ ÈÓxx…ÀÃÊŜ܈˜}]ÊÃɘnn{ȣΣÊÜÉʈ`ÌiV…Ê-Ü>̅Ê8ʈ}…ÌÊ >ÀÊ UÊ1˜ˆÛiÀÃ>Ê1/ Ê1‡{{xÊ /Ê7 ÊÜÉΫÌ]ÊȘ}iÊÀi“œÌiʅÞ`] Ո`>˜ViÊ-ÞÃÌi“ UʏˆÃÊ …>“iÀÃÊ ÊÜÉÊ iÞʜ՘ÌÊ-ˆVŽiÊœÜiÀÊ­ œÌÊÀ՘˜ˆ˜}® UÊ1˜ˆÛiÀÃ>Ê1/ Ê1‡{{xÊ /Ê7 ÊÜÉΫÌ]ÊȘ}iÊÀi“œÌiʅÞ` UʏˆÃÊ …>“iÀÃÊ ÊÜÉÊ iÞʜ՘ÌÊ-ˆVŽiÊœÜiÀÊ­ œÌÊÀ՘˜ˆ˜}® INDUSTRIAL EQUIPMENT: UʏˆÃÊ …>“iÀÃÊ {ÊÜÉÊœ>`iÀÊ­œ˜iÊÞ`ÊLÕVŽiÌ®Ê >`iÊEÊ INDUSTRIAL EQUIPMENT: -̜˜iÊœÀŽ]Ê-…ÕÌ̏iÊ ÕÌV…]Ê-ÌÀiiÌÊ*>`à UʏˆÃÊ …>“iÀÃÊ {ÊÜÉÊœ>`iÀÊ­œ˜iÊÞ`ÊLÕVŽiÌ®Ê >`iÊEÊ UÊœ“>˜Ê -Ê£ÇxÊ ÊˆÀÊ œ“«ÀiÃÜÀʜ˜Ê-ÉÊ/À>ˆiÀÊÜÉÓÊ -̜˜iÊœÀŽ]Ê-…ÕÌ̏iÊ ÕÌV…]Ê-ÌÀiiÌÊ*>`à -ˆâiÃʜvʅœÃià UÊœ“>˜Ê -Ê£ÇxÊ ÊˆÀÊ œ“«ÀiÃÜÀʜ˜Ê-ÉÊ/À>ˆiÀÊÜÉÓÊ -ˆâiÃʜvʅœÃià COMBINES: UÊ£™™ÇÊ ʙÈääÊÃ«Ê œ“Lˆ˜iÊÜÉ ʙ£{Ê«ˆVŽÕ«]Êvˆ˜iÊVÕÌÊV…œ«‡ COMBINES: iÜÊÎä°x‡ÎÓÊÀˆViÊ̈ÀiÃ]Ê «iÀ]Ê-ÊV…>vvÊëÀi>`iÀ]ʈÀÊœˆÊÈiÛiÃ]Ê UÊ£™™ÇÊ ʙÈääÊÃ«Ê œ“Lˆ˜iÊÜÉ ʙ£{Ê«ˆVŽÕ«]Êvˆ˜iÊVÕÌÊV…œ«‡ œ˜}Ê>Õ}iÀ]ʅœ««iÀÊÌ>À«]Ê£nÇxÊi˜}ʅÀÃÊŜ܈˜}]Ê£{È£ÊÃi«Ê…ÀÃÊ «iÀ]Ê-ÊV…>vvÊëÀi>`iÀ]ʈÀÊœˆÊÈiÛiÃ]Ê iÜÊÎä°x‡ÎÓÊÀˆViÊ̈ÀiÃ]Ê Ã…œÜˆ˜}]Ê>ÀÛiÃÌÀ>VÊœ˜ˆÌœÀÃ]ÊÃɘÈÇäÈnÇ œ˜}Ê>Õ}iÀ]ʅœ««iÀÊÌ>À«]Ê£nÇxÊi˜}ʅÀÃÊŜ܈˜}]Ê£{È£ÊÃi«Ê…ÀÃÊ UÊ£™™ÇÊ ʙÈääÊÃ«Ê œ“Lˆ˜iÊÜÉ ʙ£{Ê«ˆVŽÕ«]Ê-ÊV…>vvÊ Ã…œÜˆ˜}]Ê>ÀÛiÃÌÀ>VÊœ˜ˆÌœÀÃ]ÊÃɘÈÇäÈnÇ Ã«Ài>`iÀ]Ê ÊÃiˆÛiÃ]ÊÎä°x‡ÎÓÊÀˆViÊ̈ÀiÃ]ʏœ˜}Ê>Õ}iÀ]ʅœ««iÀÊ UÊ£™™ÇÊ ʙÈääÊÃ«Ê œ“Lˆ˜iÊÜÉ ʙ£{Ê«ˆVŽÕ«]Ê-ÊV…>vvÊ Ì>À«]Ê>««ÀœÝÊ£ÇääÊi˜}ʅÀÃÊŜ܈˜}]Ê>««ÀœÝÊ£{xäÊÃi«Ê…ÀÃÊ Ã«Ài>`iÀ]Ê ÊÃiˆÛiÃ]ÊÎä°x‡ÎÓÊÀˆViÊ̈ÀiÃ]ʏœ˜}Ê>Õ}iÀ]ʅœ««iÀÊ Ã…œÜˆ˜}]Ê>ÀÛiÃÌÀ>VÊœ˜ˆÌœÀÃ]ÊÃɘÈÇäÎäx Ì>À«]Ê>««ÀœÝÊ£ÇääÊi˜}ʅÀÃÊŜ܈˜}]Ê>««ÀœÝÊ£{xäÊÃi«Ê…ÀÃÊ Ã…œÜˆ˜}]Ê>ÀÛiÃÌÀ>VÊœ˜ˆÌœÀÃ]ÊÃɘÈÇäÎäx HEADERS: UÊÓx½Ê ʙÓxʏiÝÊi>`iÀÊÜÉ«ˆVŽÕ«ÊÀii]ÊÃɘÈx£{ÎÓ HEADERS: UÊÓx½Ê ʙÓxʏiÝÊi>`iÀÊÜÉ«ˆVŽÕ«ÊÀii]ÊÃɘÈx£{ÎÓ MOISTURE TESTERS: UÊ>LÌÀœ˜ˆVÃʙ£™Ê/ÊœˆÃÌÕÀiÊ/iÃÌiÀ MOISTURE TESTERS: UÊ*œÀÌ>LiÊœˆÃÌÕÀiÊ/iÃÌiÀ UÊ>LÌÀœ˜ˆVÃʙ£™Ê/ÊœˆÃÌÕÀiÊ/iÃÌiÀ UÊ*œÀÌ>LiÊœˆÃÌÕÀiÊ/iÃÌiÀ SWATHER: UÊÓää{Ê>V œ˜Ê>ÀÛiÃÌÊ*ÀœÊn£xӈÊ`ÏÊëÊÃÜ>̅iÀÊÜÉÓx½Ê SWATHER: >V œ˜Ê™ÇÓÊi>`iÀ]Ê«ˆVŽÕ«ÊÀii]Ê`LÊÃÜ>̅]ÊȘ}iʎ˜ˆviÊ`ÀˆÛi]Ê UÊÓää{Ê>V œ˜Ê>ÀÛiÃÌÊ*ÀœÊn£xӈÊ`ÏÊëÊÃÜ>̅iÀÊÜÉÓx½Ê x£äÊVÕÌ̈˜}ʅÀÃÊŜ܈˜}]ÊÈxÈÊi˜}ʅÀÃÊŜ܈˜}]Ê­£änʅ«ÊÃÕâÕÊ >V œ˜Ê™ÇÓÊi>`iÀ]Ê«ˆVŽÕ«ÊÀii]Ê`LÊÃÜ>̅]ÊȘ}iʎ˜ˆviÊ`ÀˆÛi]Ê /ÕÀLœÊi˜}ˆ˜i®ÊÃɘ£x™ä£Î x£äÊVÕÌ̈˜}ʅÀÃÊŜ܈˜}]ÊÈxÈÊi˜}ʅÀÃÊŜ܈˜}]Ê­£änʅ«ÊÃÕâÕÊ UÊn½Ê*œÞÊ-Ü>̅Ê,œiÀ /ÕÀLœÊi˜}ˆ˜i®ÊÃɘ£x™ä£Î UÊn½Ê*œÞÊ-Ü>̅Ê,œiÀ SPRAYERS: UÊÓääxÊ >ÃiÊ- 8ÊÎΣäÊ-*Ê-«À>ÞiÀÊÜəä½Ê œœ“Ã]ÊxÊLœ`ÞÊ SPRAYERS: ˜œââiÃ]ʈÀÊ ÕLLiÊiÌʘœââiÃ]Ê£äääÊ}>Ê-É-ÊÌ>˜Ž]ÊV…i“ˆV>Ê UÊÓääxÊ >ÃiÊ- 8ÊÎΣäÊ-*Ê-«À>ÞiÀÊÜəä½Ê œœ“Ã]ÊxÊLœ`ÞÊ ˆ˜`ÕV̜À]ÊλÊvˆÊÛ>ÛiÃ]ÊÓääÊ«Êi˜}ˆ˜iÊ­ Փ“ˆ˜Ã®]Ê/Àˆ“LiÊ ˜œââiÃ]ʈÀÊ ÕLLiÊiÌʘœââiÃ]Ê£äääÊ}>Ê-É-ÊÌ>˜Ž]ÊV…i“ˆV>Ê >Õ̜ÊÃÌiiÀÊÃÞÃÌi“]Êvœ>“Ê“>ÀŽiÀÃ]ÊëÀ>ÞÊÌiÃÌÊÃÞÃÌi“]ʙ™ÈÊ ˆ˜`ÕV̜À]ÊλÊvˆÊÛ>ÛiÃ]ÊÓääÊ«Êi˜}ˆ˜iÊ­ Փ“ˆ˜Ã®]Ê/Àˆ“LiÊ …ÀÃÊŜ܈˜}]Ê- -Ê{ÈääÊœ˜ˆÌœÀÊ*Ž}]ÊÃiÃÊ܈̅ÊÓÊÃiÌÃʜvÊ̈ÀiÃÊ >Õ̜ÊÃÌiiÀÊÃÞÃÌi“]Êvœ>“Ê“>ÀŽiÀÃ]ÊëÀ>ÞÊÌiÃÌÊÃÞÃÌi“]ʙ™ÈÊ EÊÀˆ“Ã]Ê­ÈxäÉÈx,ÎnÊ̈ÀiÃÊEÊÀˆ“ÃÊ­œœ`Ê9i>ÀÊ /Ên£n®ÊEÊ …ÀÃÊŜ܈˜}]Ê- -Ê{ÈääÊœ˜ˆÌœÀÊ*Ž}]ÊÃiÃÊ܈̅ÊÓÊÃiÌÃʜvÊ̈ÀiÃÊ ­ÎÓäəä,{ÈÊ̈ÀiÃÊEÊÀˆ“ÃÊ­œœ`Ê9i>ÀÊ /nää®]ÊÃɘäääÇxÎä EÊÀˆ“Ã]Ê­ÈxäÉÈx,ÎnÊ̈ÀiÃÊEÊÀˆ“ÃÊ­œœ`Ê9i>ÀÊ /Ên£n®ÊEÊ UÊxä½ÊiÀœiÊ££xÊ-«À>ÞÊ œÕ«iÊÜÉ£xäÊ}>Ê«œÞÊÌ>˜Ž]ÊxÇäʅÀÃÊ ­ÎÓäəä,{ÈÊ̈ÀiÃÊEÊÀˆ“ÃÊ­œœ`Ê9i>ÀÊ /nää®]ÊÃɘäääÇxÎä Ŝ܈˜}]ÊÃɘ££x££nx‡Ç™ UÊxä½ÊiÀœiÊ££xÊ-«À>ÞÊ œÕ«iÊÜÉ£xäÊ}>Ê«œÞÊÌ>˜Ž]ÊxÇäʅÀÃÊ UÊÈn½Ê6iÀÃ>̈iÊ{näÊ«ÌÊ-«À>ÞiÀÊÜÉxääÊ}>Ê*œÞÊ/>˜Ž]Ê*/"Ê*Փ« Ŝ܈˜}]ÊÃɘ££x££nx‡Ç™ UÊÈn½Ê6iÀÃ>̈iÊ{näÊ«ÌÊ-«À>ÞiÀÊÜÉxääÊ}>Ê*œÞÊ/>˜Ž]Ê*/"Ê*Փ« SEED & TILLAGE EQUIPMENT: UÊ£{½Ê Ê£È{äÊ/>˜`i“Ê ˆÃŽ SEED & TILLAGE EQUIPMENT: UʣǽÊ>Տ‡Ê-ii`ÊEÊiÀÌÊ/i˜`iÀ UÊ£{½Ê Ê£È{äÊ/>˜`i“Ê ˆÃŽ UÊÓä½Ê ʙÎxäÊ É Ê*ÀiÃÃÊ ÀˆÊÜÉ,ÕLLiÀÊ*>VŽiÀÃ]Ê/>À«ÃÊ UʣǽÊ>Տ‡Ê-ii`ÊEÊiÀÌÊ/i˜`iÀ ­Ü>ÞÃÊ-…i``i`® UÊÓä½Ê ʙÎxäÊ É Ê*ÀiÃÃÊ ÀˆÊÜÉ,ÕLLiÀÊ*>VŽiÀÃ]Ê/>À«ÃÊ UÊǽÊÎÊ*/Ê ÕÌ ­Ü>ÞÃÊ-…i``i`® UÊ ÀœÜ˜Ê,œÌ>ÀÞÊ-̜˜iÊ«ˆVŽiÀÊÜÉÞ`Ê ÀˆÛi]ÊÎÊ >ÌÊ,ii UÊǽÊÎÊ*/Ê ÕÌ UÊÓä½ÊÎÊL>ÀÊ>ÀÀœÜÃÊ­7iÃÌvˆi`Ê>Àœ‡ˆ˜}® UÊ ÀœÜ˜Ê,œÌ>ÀÞÊ-̜˜iÊ«ˆVŽiÀÊÜÉÞ`Ê ÀˆÛi]ÊÎÊ >ÌÊ,ii UÊÓääxÊÇä½Ê œÕÀ}>ՏÌÊÈäääʈ`‡>ÀÀœÜÊÜÉÇɣȻÊÝÊÓä»Ê/ˆ˜ià UÊÓä½ÊÎÊL>ÀÊ>ÀÀœÜÃÊ­7iÃÌvˆi`Ê>Àœ‡ˆ˜}® UÊ{ä½Ê Ê£äääʈi`Ê ÕÌÊÜÉÎÊL>ÀÊ>ÀÀœÜÃ]ÊÃɘää{xn{ UÊÓääxÊÇä½Ê œÕÀ}>ՏÌÊÈäääʈ`‡>ÀÀœÜÊÜÉÇɣȻÊÝÊÓä»Ê/ˆ˜ià UÊ{ä½ÊÊÈ{xÊ/ˆ>}iÊÜÉÎÊL>ÀÊ>ÀÀœÜà UÊ{ä½Ê Ê£äääʈi`Ê ÕÌÊÜÉÎÊL>ÀÊ>ÀÀœÜÃ]ÊÃɘää{xn{

UÊΣ½Ê

Óä{Ê ii«Ê/ˆ>}iÊÜÉÎÊL>ÀÊ>ÀÀœÜà UÊ{ä½ÊÊÈ{xÊ/ˆ>}iÊÜÉÎÊL>ÀÊ>ÀÀœÜà UÊÈÊ œÌ̜“ÊnnäÊÎÊ«ÌÊ*œÜÊÜÉÊÞ`ÊÀiÃiÌÃ]ÊÃɘ£È™{ääÓx™{ UÊΣ½Ê

Óä{Ê ii«Ê/ˆ>}iÊÜÉÎÊL>ÀÊ>ÀÀœÜà UÊnÊ œÌ̜“ÊÊnnäÊ*œÜÊÜÉÊÞ`Ê,iÃiÌÃ]ÊÃɘ£È™{xäÎäÎ{ UÊÈÊ œÌ̜“ÊnnäÊÎÊ«ÌÊ*œÜÊÜÉÊÞ`ÊÀiÃiÌÃ]ÊÃɘ£È™{ääÓx™{ UÊnÊ œÌ̜“ÊÊnnäÊ*œÜÊÜÉÊÞ`Ê,iÃiÌÃ]ÊÃɘ£È™{xäÎäÎ{ GRAIN DRYER, AUGERS & GRAIN HANDLING EQUIP: GRAIN DRYER, AUGERS & GRAIN UÊ Ê£Ó£äÊ œ˜Ìˆ˜ÕœÕÃʏœÜÊxÊ-iV̈œ˜Ê*Àœ«>˜iʜÀÊ >ÌÕÀ>Ê HANDLING EQUIP: >ÃÊÀ>ˆ˜Ê ÀÞiÀ]Ê£Ê*]Ê{ʈˆœ˜Ê /1Ê>Ý]Êä°xʈˆœ˜Ê /1Ê UÊ Ê£Ó£äÊ œ˜Ìˆ˜ÕœÕÃʏœÜÊxÊ-iV̈œ˜Ê*Àœ«>˜iʜÀÊ >ÌÕÀ>Ê ˆ˜ˆ“Õ“]Ê-iÃÊÜÉÊ£ä½ÊÝÊ£Ó½Ê ÀÞiÀÊ-…>VŽÊ̅>ÌʅœÕÃiÃÊ>Ê >ÃÊÀ>ˆ˜Ê ÀÞiÀ]Ê£Ê*]Ê{ʈˆœ˜Ê /1Ê>Ý]Êä°xʈˆœ˜Ê /1Ê iiVÌÀˆV>ÊEÊ œ˜ÌÀœÊ«>˜iÃ ˆ˜ˆ“Õ“]Ê-iÃÊÜÉÊ£ä½ÊÝÊ£Ó½Ê ÀÞiÀÊ-…>VŽÊ̅>ÌʅœÕÃiÃÊ>Ê UÊ£ä»ÊÝÊÈä½Ê>À“ʈ˜}Ê*/"Ê-܈˜}Êœ««iÀÊÕ}iÀÊÜÉ iÜÊ}i>ÀÊ iiVÌÀˆV>ÊEÊ œ˜ÌÀœÊ«>˜iÃ LœÝiÃ]Ê iÛiÀÊ눏ÊëœÕÌÊÃɘ™£äÎÓä{ UÊ£ä»ÊÝÊÈä½Ê>À“ʈ˜}Ê*/"Ê-܈˜}Êœ««iÀÊÕ}iÀÊÜÉ iÜÊ}i>ÀÊ UÊÓääÈÊn»ÊÝÊ{È½Ê Õ…iÀÉ>À“ʈ˜}ÊÕ}iÀÊÜÉ-ivÊ*Àœ«iÊˆÌ]Ê LœÝiÃ]Ê iÛiÀÊ눏ÊëœÕÌÊÃɘ™£äÎÓä{ Ó{Ê*Êœ˜`>Ê ˜} UÊÓääÈÊn»ÊÝÊ{È½Ê Õ…iÀÉ>À“ʈ˜}ÊÕ}iÀÊÜÉ-ivÊ*Àœ«iÊˆÌ]Ê UʭήÊÈ»Ê7iÃÌvˆi`ÊÕ}iÀÃÊÜÉÊΰxÊqÊx…«Ê iVÌÀˆVʜ̜ÀÃ]Ê Ó{Ê*Êœ˜`>Ê ˜} 6>ÀˆœÕÃÊi˜}̅à UʭήÊÈ»Ê7iÃÌvˆi`ÊÕ}iÀÃÊÜÉÊΰxÊqÊx…«Ê iVÌÀˆVʜ̜ÀÃ]Ê UÊÈ»ÊÕ}iÀÊÜÉ££…«Ê E-Ê ˜}ˆ˜i 6>ÀˆœÕÃÊi˜}̅à UÊ««ÀœÝÊ£ää½Ê1‡/ÀœÕ}…ÊÀ>ˆ˜Ê>˜`ˆ˜}Ê-ÞÃÌi“ÊÜÉÊÇÊ`Àœ«ÃÊ UÊÈ»ÊÕ}iÀÊÜÉ££…«Ê E-Ê ˜}ˆ˜i ÜÉÊxÊ*]Ê£Ê«Ê iVÌÀˆVʜ̜À UÊ««ÀœÝÊ£ää½Ê1‡/ÀœÕ}…ÊÀ>ˆ˜Ê>˜`ˆ˜}Ê-ÞÃÌi“ÊÜÉÊÇÊ`Àœ«ÃÊ UʭȮʣȽÊ-iV̈œ˜ÃʜvÊ >ÌÊ7>Žˆ˜} ÜÉÊxÊ*]Ê£Ê«Ê iVÌÀˆVʜ̜À UʭȮʣȽÊ-iV̈œ˜ÃʜvÊ >ÌÊ7>Žˆ˜} TRUCKS: UÊ£™näÊœÀ`ÊnääÊ/ÉÊÀ>ˆ˜Ê/ÀÕVŽÊÜÉ£n½Ê ³]ÊÀœÊÌ>À«]ÊxÊ TRUCKS: ³Ê{Ê/À>˜ÃÊ­Ê,iLՈ`Ê-iVœ˜`>ÀÞÊ/À>˜ÃÊÓÊ9i>ÀÃÊ}œ®]Ê{әÊ>ÃÊ UÊ£™näÊœÀ`ÊnääÊ/ÉÊÀ>ˆ˜Ê/ÀÕVŽÊÜÉ£n½Ê ³]ÊÀœÊÌ>À«]ÊxÊ³Ê ˜}]ÊÎÈ]ÓÎΎ“ÃÊŜ܈˜}]Ê£ä°ää‡ÓäÊ,ÕLLiÀ]Ê- / ]ÊÃÉ {Ê/À>˜ÃÊ­Ê,iLՈ`Ê-iVœ˜`>ÀÞÊ/À>˜ÃÊÓÊ9i>ÀÃÊ}œ®]Ê{әÊ>ÃÊ ˜}]Ê ˜xn£6nää™ ÎÈ]ÓÎΎ“ÃÊŜ܈˜}]Ê£ä°ää‡ÓäÊ,ÕLLiÀ]Ê- /

UÊ£™Ç™Ê>VŽÊ,-ÇääÊ/ÉÊÀ>ˆ˜Ê/ÀÕVŽÊÜÉÓä½Ê ³]Ê,œÊ/>À«]Ê™Ê -«`ÊՏiÀÊ/À>˜Ã]ÊΣxÊ*Ê>VŽÊ ˜}]Ê£Ç{]ÇxäʈiÃÊŜ܈˜}]Ê ÓÓ°xÊ,ÕLLiÀ]ÊÃɘ,xÇ£Ó-/ÎÇ{ș]Ê-/

UÊ£™nÈÊ …iÛÊ7À>˜}iÀÊ£ÉÓÊ̜˜ÊÓÜ`ÊÜəÓ]{ÎnʜÀ}Ê“ÃÊ -…œÜˆ˜}]Ê-/ ]ÊÃɘÓ/ £{Σx䙙nÎ UÊ£™näÊ …iÛÊÇäÊ-ÉÊÜÉÓxääÊ}>Ê«œÞÊÜ>ÌiÀÊÌ>˜Ž]ʣȽʏ>ÌÊ

iVŽ]ÊÓ»Ê …i“Ê>˜`iÀÊÊV…i“ˆV>Ê“ˆÝÊÃÞÃÌi“]ÊÎÈÈÊ}>ÃÊi˜}]Ê x³ÓÊ/À>˜Ã]Ê iÜÊÓ»Ê7>ÌiÀÊ*Փ«]ÊÈ£ä{£Ž“ÃÊŜ܈˜} iÜÊÓ»Ê7>ÌiÀÊ*Փ«]ÊÈ£ä{£Ž“ÃÊŜ܈˜}]Ê UÊ£™ÈÎÊ …iÛÊÈäÊ-ÉÊÜÉ£{½Ê ³]ÊÀœÊÌ>À«]ÊәÓÊ>ÃÊ ˜}]Êx³ÓÊ /À>˜Ã]ÊÎxn£ÈʈiÃÊ-…œÜˆ˜}]ÊÃɘΠÈÎäÎÈäÇÇÇÓ UÊ£™™{Ê Ê- ÊÎÉ{Ê/œ˜Ê{ÊÝÊ{Ê ÝÌÊ >LÊÜÉÈ°xʏˆÌiÀÊ`Ï]ÊÕÌœÊ /À>˜Ã]Ê œÝÊ >«]ÊÓÓÓ]ÎÓ£Ž“ÃÊ-…œÜˆ˜}]Ê-/

UÊ£™nxÊ Ê6>˜`ÕÀ>ÊÎxääÊ6>˜ÊÜÉ1  Ê,iviÀÊ œ`Þ]Ê ÎÓn]È{Ȏ“ÃÊ-…œÜˆ˜}]Ê,iLՈÌÊÎxäÊi˜}]ÊÕ̜Ê/À>˜Ã]ÊÃɘÓ ‡ ÎÓn]È{Ȏ“ÃÊ-…œÜˆ˜}]Ê,iLՈÌÊÎxäÊi˜}]ÊÕ̜Ê/À>˜Ã Σ™{xäÈ{{™ TRAILERS: TRAILERS: UÊ£{½Ê Ê/ÉÊ*ˆ˜ÌiʈÌV…Ê/ˆÌˆ˜}Ê/À>ˆiÀÊ­>Տi`Ê {Ê À>܏iÀ® UÊ£{½Ê Ê/ÉÊ*ˆ˜ÌiʈÌV…Ê/ˆÌˆ˜}Ê/À>ˆiÀÊ­>Տi`Ê {Ê À>܏iÀ® UÊÓä½Ê/ÉÊ>âÕÀÊ7i`ˆ˜}ʏ>ÌÊ iVŽÊ/À>ˆiÀÊÜÉÎxääʏLÃÊݏià UÊÓä½Ê/ÉÊ>âÕÀÊ7i`ˆ˜}ʏ>ÌÊ iVŽÊ/À>ˆiÀÊÜÉÎxääʏLÃÊݏià UÊxνÊ/ÉÊ-̜À>}iÊ/À>ˆiÀÊ­ "Ê/" ® UÊxνÊ/ÉÊ-̜À>}iÊ/À>ˆiÀÊ­ UÊ{n½Ê/ÉÊ-̜À>}iÊ/À>ˆiÀÊ­ "Ê/" ® UÊ{n½Ê/ÉÊ-̜À>}iÊ/À>ˆiÀÊ­ "Ê/" ® 3PT EQUIPMENT: 3PT EQUIPMENT: UÊn½Êˆi`ÊΫÌÊ LÊÕ}iÀÊ-˜œÜÊ œÜiÀÊÃɘ™Èän™™Ç UÊn½Êˆi`ÊΫÌÊ LÊÕ}iÀÊ-˜œÜÊ œÜiÀÊÃɘ™Èän™™Ç UÊx½Ê ՅiÀÉ>À“ʈ˜}Êx£äÊ,œÌ>ÀÞÊœÜiÀÊÃɘÓÇ£ääx{£ UÊx½Ê ՅiÀÉ>À“ʈ˜}Êx£äÊ,œÌ>ÀÞÊœÜiÀÊÃɘÓÇ£ääx{£ UÊΫÌÊ >iÊœÀŽÊUÊΫÌÊ i“i˜ÌʈÝiÀÊUÊΫÌÊ/À>VŽÊ À>ÃiÀà UÊΫÌÊ >iÊœÀŽÊUÊΫÌÊ i“i˜ÌʈÝiÀÊUÊΫÌÊ/À>VŽÊ À>ÃiÀà GRAIN BINS:Ê­ œ˜iʜvÊ̅iÊLˆ˜Ãʅ>ÛiÊiÛiÀÊLii˜ÊÕÃi`Ê GRAIN vœÀÊviÀ̈ˆâiÀ°®BINS:Ê­ œ˜iʜvÊ̅iÊLˆ˜Ãʅ>ÛiÊiÛiÀÊLii˜ÊÕÃi`Ê vœÀÊviÀ̈ˆâiÀ°® UÊ­Ó®Ê{äääÊ 1-ÊÀ>ˆ˜Ê>ÝÊœ««iÀÊ œÌ̜“Ê ˆ˜ÃÊÜÉȽÊiÀ>̈œ˜Ê UÊ­Ó®Ê{äääÊ 1-ÊÀ>ˆ˜Ê>ÝÊœ««iÀÊ œÌ̜“Ê ˆ˜ÃÊÜÉȽÊiÀ>̈œ˜Ê ,œVŽiÌ]Ê «œÝÞÊ œ>Ìi`]Ê/i“«Ê-i˜ÃœÀÊ >Lià ,œVŽiÌ]Ê «œÝÞÊ œ>Ìi`]Ê/i“«Ê-i˜ÃœÀÊ >Lià UÊ­{®ÊÓÓnäÊ 1-ÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Ê ˆ˜ÊÜÉ{ʤ½ÊiÀ>̈œ˜Ê UÊ­{®ÊÓÓnäÊ 1-ÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Ê ˆ˜ÊÜÉ{ʤ½ÊiÀ>̈œ˜Ê ,œVŽiÌ]Ê «œÝÞÊ œ>Ìi`]Ê/i“«Ê-i˜ÃœÀÊ >Lià ,œVŽiÌ]Ê «œÝÞÊ œ>Ìi`]Ê/i“«Ê-i˜ÃœÀÊ >Lià UʭӮʣnääÊ 1-ÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Ê ˆ˜Ã]Ê «œÝÞÊ œ>Ìi` UʭӮʣnääÊ 1-ÊÀˆiÃi˜Êœ««iÀÊ œÌ̜“Ê ˆ˜Ã]Ê «œÝÞÊ œ>Ìi` UÊ­x®Ê7iÃÌiiÊ£ÈxäÊ ˆ˜Ãʜ˜Ê ,7ÊÓxäÊ ÕÃÊœ««iÀà UÊ­x®Ê7iÃÌiiÊ£ÈxäÊ ˆ˜Ãʜ˜Ê ,7ÊÓxäÊ ÕÃÊœ««iÀà UÊÎxääÊ 1-Ê6ˆ`ˆÀÊœ««iÀÊ ˆ˜Ã]Ê «œÝÞÊ œ>Ìi` UÊÎxääÊ 1-Ê6ˆ`ˆÀÊœ««iÀÊ ˆ˜Ã]Ê «œÝÞÊ œ>Ìi`

TANKS & PUMPS: UÊ£äääÊ>Ê œÀ̅iÀ˜Ê-ÌiiÊÕiÊ/>˜ŽÊÜÉÊ££äÊ6œÌÊ*Փ«ÊEÊiÌiÀ TANKS & PUMPS: UÊ£äääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜` UÊ£äääÊ>Ê œÀ̅iÀ˜Ê-ÌiiÊÕiÊ/>˜ŽÊÜÉÊ££äÊ6œÌÊ*Փ«ÊEÊiÌiÀ UÊ­Ó®ÊÎääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜`à UÊ£äääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜` UÊxääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜` UÊ­Ó®ÊÎääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜`à UÊ£ÓxäÊ>Ê*œÞÊ7>ÌiÀÊ/>˜Ž UÊxääÊ>ÊÕiÊ/>˜ŽÊÜÉiÌ>Ê-Ì>˜` UÊ£äääÊ>ÊiÌ>Ê7>ÌiÀÊ/>˜Ž UÊ£ÓxäÊ>Ê*œÞÊ7>ÌiÀÊ/>˜Ž UÊÕÝÊvÕiÊ-Žˆ`Ê/>˜ŽÊÜÉÊ£ÓÊۜÌʫՓ«ÊEÊÃ̜À>}iÊVœ“«>À̓i˜Ìà UÊ£äääÊ>ÊiÌ>Ê7>ÌiÀÊ/>˜Ž UÊ iÜÊ££äÊۜÌÊÕiÊ*Փ«ÊUÊȻʏœ>̈˜}Ê-œÕ}…Ê*Փ« UÊÕÝÊvÕiÊ-Žˆ`Ê/>˜ŽÊÜÉÊ£ÓÊۜÌʫՓ«ÊEÊÃ̜À>}iÊVœ“«>À̓i˜Ìà UÊÓ»ÊxÊ*Êœ˜`>Ê7>ÌiÀÊ*Փ«ÊUÊ ÕV>ÀÊÓ»Ê7>ÌiÀÊ*Փ« UÊ iÜÊ££äÊۜÌÊÕiÊ*Փ«ÊUÊȻʏœ>̈˜}Ê-œÕ}…Ê*Փ« UÊ ÊEÊ-ÊÓ»Ê7>ÌiÀÊ*Փ«ÊÜÉÊx…«Êi˜} UÊÓ»ÊxÊ*Êœ˜`>Ê7>ÌiÀÊ*Փ«ÊUÊ ÕV>ÀÊÓ»Ê7>ÌiÀÊ*Փ« UÊ ÊEÊ-ÊÓ»Ê7>ÌiÀÊ*Փ«ÊÜÉÊx…«Êi˜} OTHER FARM EQUIPMENT: UÊ Ê{xÈÊǽÊ-ˆVŽiÊ >ÀÊœÜiÀ]ÊÃɘәxx™x OTHER FARM EQUIPMENT: UÊ{Ê7…iiÊ>À“Ê7>}œ˜ÊUÊ­x®Ê ˆ˜ÊiÛiÊ˜`ˆV>̜Àà UÊ Ê{xÈÊǽÊ-ˆVŽiÊ >ÀÊœÜiÀ]ÊÃɘәxx™x UÊ-Ü>̅iÀÊ >ÀÀˆiÀÊÜÉÊ7>Žˆ˜}Ê i>“Êݏià UÊ{Ê7…iiÊ>À“Ê7>}œ˜ UÊÓ{½Ê ÀˆÊ >ÀÀˆiÀÊ­ iÜiÀÊ-Ìޏi® UÊ­x®Ê ˆ˜ÊiÛiÊ˜`ˆV>̜Àà Uʘ̅iÃÊÀ>ۈÌÞÊ œÝʜ˜Ê{Ê7…iiÊ7>}œ˜ UÊ-Ü>̅iÀÊ >ÀÀˆiÀÊÜÉÊ7>Žˆ˜}Ê i>“Êݏià UÊ­n®ÊÊ,>`ˆœÃÊ­*Àœ}À>““>LiÊ-Ìޏi®Ê£Ê >ÃiÊ-Ì>̈œ˜ UÊÓ{½Ê ÀˆÊ >ÀÀˆiÀÊ­ iÜiÀÊ-Ìޏi® Uʘ̅iÃÊÀ>ۈÌÞÊ œÝʜ˜Ê{Ê7…iiÊ7>}œ˜ RECREATIONAL & YARD UÊ­n®ÊÊ,>`ˆœÃÊ­*Àœ}À>““>LiÊ-Ìޏi®Ê£Ê >ÃiÊ-Ì>̈œ˜ EQUIPMENT: UÊÃÜÀÌi`Ê9>À`Ê/œœÃÊ­-…œÛiÃ]ÊœÀŽÃ]Ê,>ŽiÃ]ÊiÌV°® RECREATIONAL & YARD UÊ+Õ>`Ê,>“«ÃÊvœÀÊ/ÀÕVŽ EQUIPMENT: UÊ7œœ`Ê-«ˆÌÌiÀʇÊ/À>ˆiÀÊ/Þ«i UÊÃÜÀÌi`Ê9>À`Ê/œœÃÊ­-…œÛiÃ]ÊœÀŽÃ]Ê,>ŽiÃ]ÊiÌV°® UÊ{n»Ê-Üii«‡Ê Ó{{nÊ*œÜiÀÊ>ܘÊ-Üii«iÀÊÜÉx°xÊ*Ê>ÃÊ UÊ+Õ>`Ê,>“«ÃÊvœÀÊ/ÀÕVŽ ˜}ˆ˜i UÊ7œœ`Ê-«ˆÌÌiÀʇÊ/À>ˆiÀÊ/Þ«i UÊ{½Ê Ê£xÊ/6Ê >ÀÌÊÜÉ>˜Õ>Ê Փ« UÊ{n»Ê-Üii«‡Ê Ó{{nÊ*œÜiÀÊ>ܘÊ-Üii«iÀÊÜÉx°xÊ*Ê>ÃÊ ˜}ˆ˜i UÊ*œ>ÀˆÃÊ/8Î{äÊ-˜œÜ“œLˆi]Ê£™Çn UÊ{½Ê Ê£xÊ/6Ê >ÀÌÊÜÉ>˜Õ>Ê Փ« UÊ œi“>˜ÊxxääÊi˜iÀ>̜À UÊ*œ>ÀˆÃÊ/8Î{äÊ-˜œÜ“œLˆi]Ê£™Çn UÊ œi“>˜ÊxxääÊi˜iÀ>̜À SHOP EQUIPMENT, TOOLS & MISC: EQUIPMENT, TOOLS & SHOP UÊx°xÊ*Êœ˜`>Ê*ÀiÃÃÕÀiÊ7>ÅiÀÊUÊÕ>À`ˆ>˜Ê£ÈÊ-«`Ê ÀˆÊ*ÀiÃà MISC: Uʈ˜Vœ˜Ê ÊÓÓxÊÀVÊ7i`iÀÊUÊÊiÌ>Ê ÕÌ̈˜}Ê >˜`ÊÃ>Ü UÊx°xÊ*Êœ˜`>Ê*ÀiÃÃÕÀiÊ7>ÅiÀÊUÊÕ>À`ˆ>˜Ê£ÈÊ-«`Ê ÀˆÊ*ÀiÃà UÊ-œ>ÀÊÈÇäÊ >ÌÌiÀÞÊ …>À}iÀÉ œœÃÌiÀ Uʈ˜Vœ˜Ê ÊÓÓxÊÀVÊ7i`iÀÊÊUÊ1Ãi`Ê/ˆÀiÃÊ­/ÀÕVŽÊEÊ“«® UÊ >ÀŽiÊ£ä£ ÊÀVÊ7i`iÀÊUʈ˜Vœ˜ÊˆÀÊÀi>ÃiÀ UÊ-œ>ÀÊÈÇäÊ >ÌÌiÀÞÊ …>À}iÀÉ œœÃÌiÀÊ UÊ œÀ`iÃÃÊ/œœÃÊUÊÓ{½Ê ÝÌi˜Ãˆœ˜Ê>``iÀ UÊÊiÌ>Ê ÕÌ̈˜}Ê >˜`ÊÃ>ÜÊUÊ >ÀŽiÊ£ä£ ÊÀVÊ7i`iÀ UÊn½Ê-Ìi«Ê>``iÀÊUÊ/œÜÊ >LiÃÊEÊ …>ˆ˜Ã Uʈ˜Vœ˜ÊˆÀÊÀi>ÃiÀÊUÊ œÀ`iÃÃÊ/œœÃ UÊ >ÀÀiÊ*Փ«ÃÊUÊ-“>Ê˜ÛˆÊUÊ1Ãi`Ê/ˆÀiÃÊ­/ÀÕVŽÊEÊ“«® UÊÓ{½Ê ÝÌi˜Ãˆœ˜Ê>``iÀÊUÊn½Ê-Ìi«Ê>``iÀ UÊ Ê7i`ˆ˜}Ê i˜V…ÊÜÉ6ˆÃiÊUʏ>ÌÊÜÀi˜V…iÃÊÕ«Ê̜ÊÓ» UÊ/œÜÊ >LiÃÊEÊ …>ˆ˜ÃÊUÊ >ÀÀiÊ*Փ«Ã UÊ>““iÀÃÊUÊ*ˆ«iÊ7Ài˜V…iÃÊ UÊ-“>Ê˜ÛˆÊUÊ Ê7i`ˆ˜}Ê i˜V…ÊÜÉ6ˆÃi UÊÃÜÀ̓i˜ÌʜvÊv>À“ÊÀi>Ìi`Ê̜œÃÊUÊ*œÀÌ>LiʈÀÊ œ“«ÀiÃÜÀ Uʏ>ÌÊÜÀi˜V…iÃÊÕ«Ê̜ÊÓ»ÊUÊ>““iÀÃÊUÊ*ˆ«iÊ7Ài˜V…ià UʈÀʅœÃiÊÀiiÊÜÉÊÀÕLLiÀʅœÃiÊUÊ"ÝÞÉVVÌÊ/œÀV…ÊˆÌ UÊÃÜÀ̓i˜ÌʜvÊv>À“ÊÀi>Ìi`Ê̜œÃÊUÊ*œÀÌ>LiʈÀÊ œ“«ÀiÃÜÀ UÊÀˆ˜`iÀÃ]Ê ÀˆÃ]Ê->ÜÃ]Ê ÌV°ÊUÊ*ՏiÀÃÊUÊi>ÃÕÀˆ˜}Ê7…iiÃ UʈÀʅœÃiÊÀiiÊÜÉÊÀÕLLiÀʅœÃiÊUÊ"ÝÞÉVVÌÊ/œÀV…ÊˆÌ UÊÓäÊ/œ˜ÊˆÀÉÞ`Ê œÌ̏iÊ>VŽÊUÊÈÉ£äÉÓäÊ/œ˜Ê œÌ̏iÊ>VŽÃ UÊÀˆ˜`iÀÃ]Ê ÀˆÃ]Ê->ÜÃ]Ê ÌV°ÊUÊ*ՏiÀÃÊUÊi>ÃÕÀˆ˜}Ê7…iiÃ UÊ Ê œ“iÌÊ i˜V…ÊÀˆ˜`iÀÊUÊ1Ãi`Ê܈˜`œÜà UÊÓäÊ/œ˜ÊˆÀÉÞ`Ê œÌ̏iÊ>VŽÊUÊÈÉ£äÉÓäÊ/œ˜Ê œÌ̏iÊ>VŽÃ UÊ Ê œ“iÌÊ i˜V…ÊÀˆ˜`iÀÊUÊ1Ãi`Ê܈˜`œÜà MISC. LEAF CUTTER BEE EQUIPMENT: MISC. LEAF CUTTER BEE UÊ*i>ÃiÊV>Ê ˆÊvœÀʈ˜vœÀ“>̈œ˜]Ê>Û>ˆ>LˆˆÌÞÊ>˜`Ê`iÌ>ˆÃÊ>LœÕÌÊ EQUIPMENT: i>vÊVÕÌÌiÀÊLiiÊiµÕˆ«“i˜Ì° UÊ*i>ÃiÊV>Ê ˆÊvœÀʈ˜vœÀ“>̈œ˜]Ê>Û>ˆ>LˆˆÌÞÊ>˜`Ê`iÌ>ˆÃÊ>LœÕÌÊ i>vÊVÕÌÌiÀÊLiiÊiµÕˆ«“i˜Ì

FOR MORE INFO CONTACT OWNER

Ê ˆÊ>“V…ÕŽÊ Óä{‡ÇΙ‡ÈΣx

CONDITIONSÊ\Ê ÕÞiÀÃʅ>Ûiʣʓœ˜Ì…Ê̜ÊÀi“œÛiÊʈÌi“ÃÊvÀœ“ÊÃ>iÊÈÌi°Ê­ ˆ˜Ãʈ˜VÕ`i`® Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit.

FRASER AUCTION SERVICE LTD. Brandon, Manitoba

Licensed Licensed and and bonded. bonded. P.L. P.L. License License #918093. #918093. Member Member of of M.A.A., M.A.A., S.A.A., S.A.A., A.A.A., A.A.A., A.A.C. A.A.C.

PHONE: PHONE: (204) (204) 727-2001 727-2001 FAX: FAX: (204) (204) 729-9912 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com www.fraserauction.com EMAIL: fauction@mts.net Auctioneer: Scott Campbell Auctioneer: Scott Campbell - Warren Wright

2012


PAGE B14 Manitoba FarmLIFE, Monday, March 12, 2012

RETIREMENT FARM AUCTION for KEN & JOYCE BARLOW of BRANDON, MB.

TUESDAY JUNE 12th11:00AM

DIRECTIONS: From Jct #10 & #353 hwys (Brookdale Road) East 3.2kms on hwy #353 to road #106 (Humeville Rd.) North 2.5kms on road #106 to sale site on east side of road. (Watch for signs) TRACTORS: UÊÓääÇÊ ÊÈ{ÎäÊ7 ʙx…«ÊÜÉ ÈÇÎÊ-ʏœ>`iÀ]ÊLÕVŽiÌ]Ê }À>««i]ʍœÞÃ̈VŽ]ÊLÕVŽiÌÊÌii̅]ʏœ>`iÀÊÃÕëi˜Ãˆœ˜]ÊÓ{Êë`Ê «ÜÀʵÕ>`ʈÊë`ÊÌÀ>˜Ã]ÊÊÅÕÌ̏i]ÊΫÌ]ÊÃ՘Àœœv]ʏœ>`iÀʏˆ}…ÌÊ «Ž}]ÊÓÊÀi“œÌiʅÞ`]Ê`Õ>Ê*/"]Ê£n°{,ÎnÊÀi>À]ʣȰ™,ÓÈÊvÀœ˜Ì]Ê ÓǙä…ÀÃÊŜ܈˜}]ÊÃɘx£ÎΣÈÊ­/À>V̜ÀʈÃʏˆŽiʘiÜÊ>˜`ÊvՏÞÊ œ>`i`Ê܈̅Ê>Ê>Û>ˆ>Liʜ«Ìˆœ˜ÃʜvviÀi`°® UÊ iÕÌâʙ£xäÊÓÜ`Ê£x䅫ÊÜÉΫÌ]Ê`Õ>Ê*/"]Ê«ÜÀÊňvÌ]ÊÎÊ Ài“œÌiʅÞ`]ÊÓä°n‡ÎnÊ`Õ>Ã]Êx£x΅ÀÃÊŜ܈˜}]ÊÃɘ£{ÈÎÊ ­ÌÀ>V̜ÀÊLœÕ}…ÌʘiÜʈ˜Ê£™™Ó® UÊ£™xÎÊ>À“>Ê-Õ«iÀÊ7 ÈÊÃɘÈÎÈÇ UÊ£™xäÊ>À“>Ê ÊÃɘ£n£x UÊ£™{ÇÊ>À“>Ê ÊÃɘ£xn™Ç HARVEST EQUIPMENT: UÊ£™™ÇÊÓx½Ê >ÃiÊnÓÓäÊ«ÌÊÃÜ>̅iÀÊÜÉL>ÌÌÊÀii UÊ£™nÇÊ ÊÇÇÓ£Ê/ˆÌ>˜ÊÊ«ÌÊVœ“Lˆ˜iÊÜÉ`Õ>ÊÀ>˜}iÊVޏ]ʈÀÊ œˆÊÈiÛiÃ]Ê£äääÊ*/"]Ê«>ÌiÃÊvœÀÊ`Àœ««ˆ˜}ÊÃÌÀ>Ü]ÊÃɘÈÓäÈ£Ó UÊǽʫœÞÊÃÜ>̅ÊÀœiÀ UÊ>LÌÀœ˜ˆVÃʙ£™Ê“œˆÃÌÕÀiÊÌiÃÌiÀÊÜÉÃV>i UÊ­£Ç®ÊVÀœ«ÊˆvÌiÀà HAYING EQUIPMENT & FORAGE SEED: UÊÓääÈÊ£È½Ê Ê£{ÇxʓœÜiÀÊVœ˜`ˆÌˆœ˜iÀÊÜÉ-£Èʅi>`iÀ]Ê £äääʫՓ«]ÊÃɘ££{Óäș UÊÓääÓÊ ÊxÈÇÊÀ`ÊL>iÀÊÜÉi}>Ê܈`iʅÞ`ʏˆvÌÊ«ˆVŽ‡Õ«]Ê«ÜÀÊ

vii`]Ê£äääÊ*/"]Ê£äx{ÇÊL>iÃ]ÊÃɘ£nnÎÓ{ UÊ­£®ÊL>}ʜvʏv>v>ÊÃii` UÊ­£®ÊL>}ʜvÊ}À>ÃÃÊÃii`Ê­{ä¯Ê-“œœÌ…Ê Àœ“iÊqÊ{ä¯ÊiiÌÊ i>`œÜÊ Àœ“iÊqÊ£ä¯Ê/>ÊiÃVÕiÊqÊ£ä¯Ê˜ÌiÀ“i`ˆ>ÌiÊ 7…i>ÌÊÀ>Ãî TRUCK, TRAILER, & WAGONS: UÊ£™ÇxÊ œ`}iÊÈääÊÃÉ>Ê}À>ˆ˜ÊÌÀÕVŽÊÜÉ£{½ÊÃÌiiÊ ³]ÊÎÈ£Ê i˜}]Êx³ÓÊÌÀ>˜Ã]Ê>««ÀœÝÊ££ä]äääʓˆiÃÊÃɘ È£xä£ÈÇÇ£ UÊÓääÈÊ ÕiʈÃÊ£n½ÝÈʤ½ÊÌÉ>ÊÃ̜VŽÊÌÀ>ˆiÀÊÜÉ«>À̈̈œ˜Ê }>Ìi]ÊvÀœ˜ÌÊiÃV>«iÊ`œœÀ]ÊÃÉ˜Ó ™xÓ6ÓÓ{È£äxÎäÓÇ UÊÕÎiiÊÎÎxÊ}À>ۈÌÞÊ}À>ˆ˜ÊÜ>}œ˜ÊÜÉ>««ÀœÝÊÎÎxLÕÃÊV>«]Ê Ãɘnä{ÓÇÎ UÊÓä½ÊL>iÊ`iVŽÊœ˜ÊxÊ̜˜Ê˜>˜`ÊÜ>}œ˜ÊÃɘ£ÓÎx AUGERS & GRAIN DRYER: UÊ{ȽÝÇ»Ê À>˜`ÌÊ>Õ}iÀÊÜÉ£n…«Ê ³-Ê -Êi˜}ˆ˜i UÊ{ä½ÝÇ»Ê À>˜`ÌÊ>Õ}iÀÊÜɣȅ«Êœ…iÀÊ -Êi˜}ˆ˜i]Ê7…i>ÌÊ i>ÀÌÊLˆ˜ÊÃÜii« UÊ/œÝ‡"‡7ˆŽÊÎÇäÊ«Àœ«>˜iÊ}À>ˆ˜Ê`ÀÞiÀÊÜÉ*/"Êv>˜]ÊÃɘÎäÈ£n UÊ«œÞÊ>Õ}iÀʅœ««iÀà UÊ£ä½Ý{»Ê`ÀˆÊwÊ>Õ}iÀÊÜÉëœÕÌ UÊ££½Ýx»Ê À>˜`ÌÊ>Õ}iÀÊÜɅÞ`Ê`ÀˆÛi]ÊëœÕÌ UÊ À>˜`ÌÊÌ>ˆ}>ÌiÊ`ÀˆÊw AREATION FANS: UÊx…«Êi…œÊ>iÀ>̈œ˜Êv>˜ UÊ΅«Ê …ˆV>}œÊ>iÀ>̈œ˜Êv>˜

TANKS & PUMPS: UÊ£Óxä}>Ê«œÞÊÜ>ÌiÀÊÌ>˜ŽÊUÊnxä}>Ê«œÞÊÜ>ÌiÀÊÌ>˜Ž UÊÎää}>ÊvÕiÊÌ>˜ŽÊEÊÃÌ>˜`ÊUÊλÊœ˜`>ÊÈ°x…«ÊÜ>ÌiÀʫՓ« UÊÓ»ÊÞëiVÊx°x…«ÊÜ>ÌiÀʫՓ«Ê­ÎÞÀÃʜ`® UÊ««ÀœÝÊ££ää½ÊÜ>ÌiÀʅœÃi TOOLS & MISC: UÊ>ÀV…iÀÊ«ÀiÃÃÕÀiÊÜ>ÅiÀÊUÊÅ>˜ŽÊÃÌÀ>ˆ}…Ìi˜iÀ UÊÃÜÀ̓i˜ÌʜvÊv>À“ÊÀi>Ìi`ʅ>˜`Ê̜œÃ UʭӮʙ…«Ê ³-Êi˜}ˆ˜iÃÊUÊV…>ˆ˜Ê…œˆÃÌÊUÊV>ÀÊÀ>“«Ã UÊۈÃiÊUʏœ}}ˆ˜}ÊV…>ˆ˜ÃÊUÊ̜ÜÊV>LiÃÊUÊ}i>ÀʜˆÊ«Õ“« UÊL>ÀÀiÊ«Õ“«ÊUʅÞ`ÊVޏÊUÊ­Ó®ÊiiVÌÀˆVʓœÌœÀà UÊ­Ó®ÊÓä°n,ÎnÊÕÃi`ÊÀ>`ˆ>ÊÌÀ>V̜ÀÊ̈Àià Uʙ°ää‡ÓäÊÌÀÕVŽÊ̈ÀiÊEÊÀˆ“ÊUʈ“«i“i˜ÌÊ̈ÀiÊEÊÀˆ“ UÊ 7Êܜœ`ÊÃ̜ÛiÊUÊÀœiÀÊV…>ˆ˜Ê>˜`ÊVœ˜˜iV̜ÀÃʛ{äʇʛxäʇʛÈä UÊÀœÊ«ˆ˜ÊŽˆÌÊUÊVœÌÌiÀʎiÞʎˆÌÊUÊL>ÌÌiÀˆiÃÊUÊLœÌÊLˆ˜Êœ>`i` UÊLi>“ÊÃV>iÊUÊŜ«ÊVÀii«iÀÊUÊÌÀ>«ÃÊ UÊ­Ó®ÊÜ>Ê“œÕ˜ÌÊ}՘ÊÀ>VŽÃÊUÊÀ>ˆÊˆÀœ˜ CULVERTS: UÊ­£®Ê{ӻݣ{½ÊUÊ­Ó®Ê{ӻݣӽÊUÊ­£®ÊÓ{»Ý£Ó½ÊUʭӮʣn»Ý£ä½ GOLF CART: UÊ œÕ“Lˆ>Ê{Ê܅iiÊ}>ÃÊ}œvÊV>ÀÌ

UÊÎÊVÀœÃÃÊÃiV̈œ˜ÊÃÞÃÌi“ÊœvÊ>iÀ>̈œ˜ÊÌÕLˆ˜} SEED & TILLAGE EQUIPMENT: UÊÓǽÊœÀÀˆÃÊ>}˜Õ“ÊÊÜÉÎÊL>Àʅ>ÀÀœÜÃ]ÊÃɘ™ÓxäääÓxä£ UÊÓn½ÊÊÇÓääʅœiÊ«ÀiÃÃÊ`ÀˆÃÊÜÉv>V̜ÀÞÊÌÀ>˜Ã«œÀÌ]ʓ>ÀŽiÀÃ]Ê ÀÕLLiÀÊ«ÀiÃÃÊ܅iiÃ]ÊÃɘä䣙Çä‡Ç£ UÊ£È½Ê âii‡"˜Ê{ääÊÌ>˜`i“Ê`ˆÃVÊÜÉӜœÌ…ÊÓ{»ÊL>`ià UÊÈä½Ê À>˜`ÌÊ{ÓäÊ«ÌÊwi`ÊëÀ>ÞiÀÊÜÉ£äääʫՓ«]ÊÃɘ£™xxÇ UÊÇä½Ê>ÕÀˆiÀʅÞ`ʅ>ÀÀœÜÃÊÜÉxää}>ÊÌ>˜Ž]ʫՓ«]ÊLœœ“Ã]ÊxÊ L>Àʅ>ÀÀœÜÃ]Ê}œœ`Ê̈˜ià UÊÓxʤ½Ê

Ê̈>}iÊÜÉÎÊL>Àʅ>ÀÀœÜÃÊÃɘääääÇÎ UÊvœÀŽÊÌÞ«iÊÃ̜˜iÊ«ˆVŽiÀ UʙÊÃiV̈œ˜Ê`ˆ>“œ˜`ʅ>ÀÀœÜà UÊÎx½ÊœiʈÊiÛiiÀÊ­œÀÀˆÃÊ …ˆÃiÊ«œÜÊ܈̅Ê}À>`iÀÊ blades on back) LIVESTOCK RELATED EQUIPMENT: UÊÓääÓÊ>}i`œÀ˜ÊÓÇxÊÞ`À>‡-«Ài>`ÊÌÉ>ʓ>˜ÕÀiÊëÀi>`iÀÊ ÜÉ£äääÊ*/"]ʅÞ`Ê«ÕÅʜvv]Ê`LÊLi>ÌiÀÃ]ÊÃɘÓn™x Uʈ˜`i˜ÊÌÀ>ˆiÀÊÌÞ«iÊ«œÃÌÊ«œÕ˜`iÀ UÊÃivÊvii`iÀÊvœÀÊV>Ûià UʭӮʣӽʈ˜Êvi˜ViÊV>Ì̏iÊvii`iÀÃÊUʓˆ˜iÀ>Êvii`iÀà UʭήÊÃ̜VŽÊÜ>ÌiÀÊÌÀœÕ}…ÃÊUÊyœ>̈˜}ÊÜ>ÌiÀʅi>ÌiÀà UÊV>vÊÏiˆ}…ÊUÊV>vʫՏiÀÊUÊV>vÊÃV>iÊÜɅi>`Ê}>Ìi UʘiÜÊvi˜ViÊ«œÃÌÃÊUÊÀ>ˆÊ̈ià UÊÃÜÀ̓i˜ÌʜvʏˆÛiÃ̜VŽÊ>˜`ÊÛiÌÊÃÕ««ˆià UÊÓä½ÊL>iÊiiÛ>̜ÀÊÜÉ܅iiÃ]ÊiiVÌÀˆVʓœÌœÀ

TRANSPORT BUSINESS & SHOP CLOSE-OUT GWB TRANSPORT of

PLUMAS, MB. WEDNESDAY JUNE 20th 10:00am COMPLETE LIST WITH FULL DETAILS WILL BE POSTED AT www.fraserauction.com CLOSER TO SALE DATE.

FOR MORE INFO CONTACT OWNERS KEN & JOYCE BARLOW 204-728-7176

EARLY EXAMPLES INCLUDE: TRUCKS: (Detailed maintenance history available on trucks) UÊÓää£Êi˜ÜœÀ̅Ê/Óäääʅˆ}…Ü>ÞÊÌÀ>V̜ÀÊ-/

UÊÓäääÊÊ >}iʙ™ääˆÊ…ˆ}…Ü>ÞÊÌÀ>V̜ÀÊ-/

UÊ£™™™ÊÊ >}iʙÎääˆÊ…ˆ}…Ü>ÞÊÌÀ>V̜ÀÊ-/

UÊÊÌÉ>Ê}À>ÛiÊÌÀÕVŽ UʭήÊÏÊ̜˜Ê«ˆVŽ‡Õ«ÊÌÀÕVŽÃÊ-/

TRAILERS: (Detailed maintenance history avail‡ able on trailers) UÊÓä£ÓÊ œi«ŽiÀÊ-Õ«iÀÊ Ê}À>ˆ˜ÊÌÀ>ˆiÀÃÊ-/

UÊÓääÇÊœ>`ʈ˜}Ê-Õ«iÀÊ Ê}À>ˆ˜ÊÌÀ>ˆiÀÃÊ-/

UÊ£™nÇÊÎȽÊ/À>ˆÊœLˆiÊi˜`Ê`Փ«Ê}À>ÛiÊÌÀ>ˆiÀÊ-/

UÊÓää™ÊÎÓ½Ê œÀLiÀ̽ÃÊy>ÌÊ`iVŽÊÜÉLi>ÛiÀÊÌ>ˆÃ]ÊÀ>“«Ã]Ê Üˆ˜V…Ê-/

UÊÓääÓÊ£n½Ê̈ÌÊ`iVŽÊy>ÌÊ`iVŽÊÌÀ>ˆiÀÊÜÉ܈˜V…Ê-/

UÊÓä£äÊ,>ˆ˜LœÜÊ}œvÊV>ÀÌÊÌÀ>ˆiÀ ATV’S, LAWN & GARDEN EQUIPMENT: UÊÓä£äÊ<iÀœÊÌÕÀ˜Ê“œÜiÀ UÊÓääÇÊ<iÀœÊÌÕÀ˜Ê“œÜiÀ UÊ£™n™ÊÀV̈VÊ >ÌÊxääÊ{Ý{ʵÕ>` INDUSTRIAL EQUIPMENT: UÊÓääÎÊ ÓxäÊΈ`ÊÃÌiiÀʏœ>`iÀ UÊ£™ÇxʏˆÃÊx{x Ê܅iiÊœ>`iÀ

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit. Sale conducted by FRASER AUCTION SERVICE 1-800-483-5856 www.fraserauction.com

SHOP EQUIPMENT & PARTS: UÊ>À}iÊÃiiV̈œ˜ÊœvÊÌÀÕVŽÊ̈ÀiÃÊ>˜`Ê«>ÀÌà UÊÕ}iÊÃiiV̈œ˜ÊœvÊ}œœ`ʵÕ>ˆÌÞÊŜ«ÊiµÕˆ«“i˜ÌÊEÊ̜œÃ FOR MORE INFO CONTACT GREG BUHR 204386-2501 office or 204-841-0902 cell

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit. Sale conducted by FRASER AUCTION SERVICE 1-800-483-5856 www.fraserauction.com

• Farm Machinery • Heavy Equipment Trucks & Trailers • Buildings • Driveways • Certified Kitchen Exhaust Cleaning • Sewer & Water Line Thawing & More!

(204) 761-2353 • (204) 725-4681

Murray Polenski

631 - 25th Street, Brandon, Manitoba R7B 2L9 polenski@westman.wave.ca


Manitoba FarmLIFE, Monday, March 12, 2012

                                                        !      "      #   !      #         $%&&'$&((()         * 

PAGE B15


Thank you for supporting your locally-owned business

PAGE B16 Manitoba FarmLIFE, Monday, March 12, 2012

Light Medium & Heavy Towing Local & Long Distance Hauling

MB0312  

The leading farm buyers' guide in Manitoba